2C4FU

Crystal structure of factor vii.stf complexed with pd0297121
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
116
structure length
116
Chain Sequence
EPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords COAGULATION FACTOR VII PRECURSOR
publication title The Discovery of Fluoropyridine-Based Inhibitors of the Factor Viia/Tf Complex--Part 2
pubmed doi rcsb
total genus 21
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c4fU00
4L29A 1GYAA 3L3KA 4Y2DC 3BD3A 3P73B 3QXAB 4WFED 4KK8D 4WHCA 3W9DA 2APTA 2QV2A 4YDLB 2E8YA 1RK1B 3MA7A 3O3EA 1N3NA 3SO3B 4M5ZL 3FZUD 3LPGA 2ESVB 4MAUH 4LQFL 4ZODA 2FX9H 5DJ6A 4DN4H 3B83A 3HC3H 1BZ7A 2XY2A 5L6YH 5EORL 3G6DL 2X40A 5CJXC 5I15L 1C7TA 4XT1C 1FE8H 1SVZA 5EN2B 4ONGL 3QHZH 4MNGE 3HN3A 1DTUA 3BKYL 3QUZB 3EYFA 1M1SA 4PJCB 4U1IB 1QRKA 4HT1L 4ZAKB 3T0BA 4OAWA 1R6VA 4UIKL 5E2TH 1PD6A 4ZFFB 5BRZB 1QFWL 4UV4H 4MD0A 4FXKB 4MNHB 3V6OE 1Z0MA 2W1NA 3FT3A 2CQVA 3U4BL 2JELL 3QWQB 1B0GB 4UOJA 4O2EB 1PYWB 2J8UB 2FGZA 4FZEH 1C08B 1JNLH 5IB3B 5C0NC 5L2JB 1D6VH 2GK0A 4GAYB 1M7IA 2R56L 2Y25A 1X5XA 1BMGA 4X7SL 1Q38A 1AGFB 3GSXB 1CQYA 1YYML 5JOFA 5AEAA 4JG0H 3N1GC 4HC1A 1YN6A 2XKSA 4JY5H 3K0WA 1P9MC 4Z7WB 3UTTA 1UZ8B 4M7JH 1RUKL 2NXZD 5AAMA 1VGEH 4RMRA 4C56B 3WDIA 2I25N 2VDMH 5SWQA 3L9RB 2P47B 4BZ2H 1OTSD 1DBJL 4LRNH 3H0TB 3L5JA 3NABH 3RVWD 4Y19E 1JF1B 2DKSA 4Y2DB 3SE4A 4AEEA 3QDGA 5IFAL 1OGTB 1EZVX 4R2GD 3VXRB 1R3KB 3F5WA 4DKFH 4EQ3A 4N0YL 2YK1L 3RAJL 5SX4I 5EO9B 5CJ5A 2P45B 4X6DE 4X5XA 4QTIH 4XP5H 4O58L 4NC0B 4JFEB 2CR3A 4P5TA 3CDFA 1XCQA 2Y6SC 2GAZB 4FS0A 3ZDXF 5C0FA 4RA0C 4L8BB 5CAYB 3RA7H 4S2SB 3SE4C 5SWSA 1HQ4A 5GJSL 2DOCA 1S7VB 1AO7E 2AJZA 4TPRL 3P4NA 5D7LE 1I3GL 4MD4A 4YXKH 3L1OH 1A6WL 2VL5A 4ODWA 4D9QE 4P5TC 2EZ0C 4M1GH 2G75B 4ELMF 1HXMA 1SYVA 5TF1H 1R3IL 3DSFH 4PJGE 2F53A 3VXME 4R0LA 3HI5L 1S5IH 5D1ZD 3TA3A 4G6JL 4I2XE 4P3CH 2H1PH 4M7ZC 3VH8G 4F7EB 4JKPL 1NSNL 2EDTA 4QNPE 3KXFD 1FRGH 3ARSA 3BJ91 4NQCB 4DEPB 5BS0B 1YEGH 2OR9H 4NYLA 4WI5A 2XA8H 4XNXL 2IH3B 4ZPVA 1DBKH 5GRUL 2XYCA 4BZ1L 2UV3A 5MHSD 35C8L 3D25A 3GBLA 3UBXI 4JFDA 1X44A 2VDQH 4R0LC 4FQJH 3OSKA 5F7UA 2XTJC 4MZ2A 1BIHA 4Z77A 1FNEB 1JYVA 1AIFB 3HB3C 3HG1E 3OB8A 3GSWB 4ONOA 4ZUVB 1MCRA 3S35L 2GITA 1M7XA 3MRPB 3PF2A 4KDTA 4WGWB 3CK0L 4JANB 4OQTH 4UUJB 2CDFA 1FORL 3V0AC 1OF2A 4DVBA 2VZSA 5EUOB 4F33B 2ZUVA 4EDWH 4F9PC 1P5UA 1FV1A 4Y2OA 3KAAA 3OXRB 4GKNA 2BVOB 2VJXA 3MUGB 1CR9L 2A1WH 5F8RC 5A1AA 3H42H 4WI2A 3X14B 5T1LA 1IGML 1IGCL 2Z8SA 4PJDE 2YBRA 3RZCD 3VH8B 1U8LB 1DQDL 3VFNA 5DFTA 1MRCL 1XIWC 5DD5H 5DMKA 1I7UA 1OAXH 4Y16A 5BVJA 2HKHL 3KYOB 1RZJH 3K46A 4P0DA 3TO2A 4X7CC 2FZ3A 4C4KO 5H37H 5J06A 4GRLA 4ZTOH 1DL7L 2NX5E 4FQHB 4YK4C 1MHEB 2FX8L 4LAJH 4N90D 4Y5VA 3DI3B 4M7ZB 2MJWA 3OKMB 4HGWA 3BSZL 2CUHA 4H20H 5KANG 4OQ1A 4J7RA 3L3OB 5FHAH 4JFFD 1ZMYA 3PGCA 4XVJL 4CUCA 5GRXG 4L9LC 4CGTA 4GRLC 2P43B 3VW3L 4K7PH 4FFZH 1GL4B 4LLYB 4Y5VC 4JDTL 4MXWH 4Z0BL 1CWVA 3RL1A 2BC4B 1MJJA 4S1QL 5KSVB 2FECL 3TWCL 2F58H 1R3LB 3MRLB 1CICD 1KTLB 1KIRA 3NA4A 1KLFA 5KOVC 2PTVA 1JNNL 5E1AB 2BOBA 3ZKMD 2YXMA 1FZKA 4XP1L 5IOPB 4NZRL 1VFAA 5KSBA 1DQML 3BO8B 2PCPB 4LASL 5I17B 5F88A 3W11D 2C1OA 2ZJSL 4OZHE 3O2DA 5DMYA 4RISH 4HKXB 1E0OB 1WC7B 4NQSB 5F7DA 4F37F 4DUWA 5TQ2L 1DUZB 5IJVA 1I9JL 3ARDB 4GRWB 2VXTL 4HXBH 4J3OC 1TZGH 4KHXH 4KK5D 1WISA 3D69A 4FG6D 5HHOE 5JORA 5K93A 5CMAB 4WI3A 2DDQH 3W9EA 2VLKD 2O5YL 3O6FC 4C55A 1XIWB 1ZVYA 1WK0A 5F1IB 3BP6A 4NBZB 4P59L 4DUXA 3P40A 4BQ8A 3O6LL 3H7BA 5TDOB 1ZA3A 3I50H 3B9VA 3U6RA 4XC1L 4P46C 4Y1AE 2UY7A 1MAKA 1VADA 5DRNA 4CW1B 3DSNA 1X5IA 1QKZL 2AGJL 2BOCB 1VENA 3QDHA 5ITBL 4YHNA 1I4FB 3PHSA 3T65A 3PP4L 3T4AB 1PY9A 3VCLB 1V3KA 3QFJD 3TNNA 5FUZH 5ID0B 3V52H 3TZVD 1ZSDA 4K3JH 4L9LB 3GSQB 3OZ9L 1H0DA 3OJDB 4F3FA 2CIIB 1ZGLM 2C9AA 5D7SL 5EZOH 5JQ6L 5TE4H 5E9DE 1A21A 4EIZC 2BVQA 1RJYA 1ZGLB 1J11A 2QSCL 1EEYB 4ONFL 1D5BA 1YEDB 2KKQA 2DI7A 5D93B 4YR6A 2Z9TA 4PJHA 4TRPL 5HGAA 4BSWB 4RIRA 4XMKL 3CU1A 3ARZA 2HTKD 4RZCA 3H3PL 4WO4C 3WKNA 4QHUA 1NGQH 5IBLC 3HR5A 5FCSH 1QPPA 5CIPH 1CD1B 4F7PB 1HHGA 3QDAA 1NCUA 1RUPL 3HNVL 3ZYOA 5B38G 5JXED 3Q6FB 3MRNA 4MX7B 1K6QL 1YC8A 2WMPA 2XWJA 1GIGH 3JTSB 5TH2B 1FH5L 3UJIH 2CDGB 2BHYA 4NNXB 5CS7A 3TNMA 2R0WH 1MFBH 4HUWA 2X4OB 2GW5A 3O6FB 4X9HA 3DO7A 1GJIA 1M7DA 3BP5B 4I3RL 2E7MA 3PQYE 4XRCB 5FKAA 4ODVL 4OV6F 1J1OL 1N5YL 4MA1B 1QLEL 3L5WB 4P46B 4ZS6D 4JCLA 4LSVH 1F3JA 2HFTA 2H2PC 3N9GL 4YXLL 1NCWH 4MB3A 2D4DA 3UYOD 3OAYH 1Q1JL 4H0HB 1BFVL 2YZ1A 3B2UC 3GSOA 2CKBB 2X4QB 3L5IA 1RMFH 4LEXH 1JHKH 4M9OA 3H7LA 2ERJC 1TVBA 4JFHE 1A7NL 1D6EA 5JHLH 3TBSB 1S3KH 4KJPD 3S88L 4IOIB 1C1EH 4XVSL 3EYQD 2UUDH 2HFFB 5ERWA 5C09B 1ZKAA 4WFGD 2IAMA 3VXOA 5B38B 5DQ9A 4NJAH 2WIIB 3N50A 3VD3A 4LRIA 1NGWA 1T4KA 5DLML 4RFNB 1A64A 4JO2L 4WO4B 2XPGA 1KACB 5DD3L 3C2AL 5EU5A 4QRUB 2NR6D 4YPGA 4FOMA 5MI0B 4FQLL 1NMCC 4OLWH 3GSVA 2IAMC 4R4FH 5C2UB 4NO2A 4XH2A 4LRIC 3W39B 1HSAB 4JN2B 5BV7C 3HI6H 4LGPB 5F8QC 1CU4L 4Z7VF 5AD0A 4HG4K 1PGRB 5C0AE 4DKEL 2R0LL 2A9MH 4M6OH 3CXDH 5E6IA 1EUTA 3OKOA 2DLIA 3ZE1E 2EDJA 3M07A 4U2ZA 3S36X 1GHFL 2DLFL 1MH5A 3QEQD 4HC1L 4I3SL 5D7KD 1LO0L 3G5YA 3MGAA 1U92A 4DKDC 1JNHA 4XMLH 3RIFF 4Y8AA 3SY0A 3U79A 1I1AB 4N0UB 3GMMA 3C5ZC 4LLQB 4PJFA 1UCTA 1I9IL 2OL3B 4J3XA 4S1DD 5MERB 5CSBA 43CAA 4I3GA 4PJDF 2BK8A 4QHKI 2P8MA 2BY2A 2C7UB 2VSCA 3K1DA 5AZEL 4ELMB 4X9IA 1UXSB 4XC3L 1QNZL 1P7KB 5AWNH 4FQCL 1P5VA 1G6RA 5ISZA 4XPAH 5ICZB 4LIQE 4NKQB 3PWVA 3UTPE 2VR9A 3PGDA 2J4WL 9CGTA 4MQXD 3I84A 5C1MB 1PG7L 2DIBA 2AEPH 2PO6A 1MHHB 1TJIH 2YA0A 2RR3A 2X10A 5F97E 5ID1A 4PRIB 5FEBA 3EJZD 2XWBB 1CIUA 4Z78B 1OLLA 5EWIL 1RY7B 1Z9MA 1X6LA 1DFBH 1JRHL 5ANME 5T5NG 4HZAA 3PHOA 4XCYA 3LIZL 4XNMA 5BV7B 5HI5D 4S0SD 3BMVA 1MQKL 1DBMH 1EHXA 5A2IH 1E6OH 2PO6C 4LMQE 2UYLB 5J6HB 3L3DA 5CZKA 3PWNA 4FFWC 4APQD 3SKMB 3KPLB 1CT8B 3G08B 1B4JH 2OMNA 3DX7B 5J9PA 1BX2B 1EK3A 2YPLE 3NIGF 1RIVL 3LS5H 1ADQH 2HKFH 3QHFL 5KS9E 4NQDE 2DQUH 1BHGA 4EZMA 4NHUB 5I75C 3ZLQC 1R5WA 4HJGA 4YDVB 4GKSB 5TDPB 4FQ1L 3C5ZB 4P3DB 5FYLE 5C0BB 4MNGA 4GO6B 4QGYA 5BJTB 1EFQA 5HVGB 1P2CA 2AJYH 4LU5H 4NN5C 1JPSL 1JI2A 1QR1A 3V6ZB 5DK2B 4GG8A 3DRTA 5J11C 4WUUE 2MCG1 5I71B 3V6OA 3C2SA 1HH6B 1HE7A 2FNBA 1HK6A 3PXJA 12E8L 4M6ML 4M03A 3PDGA 4TUKH 3MLXH 1DP0A 3E3QC 3RVUD 2AEQL 3GIVB 4UT7L 1IRAY 1YMMD 5TE6H 2VZ3A 4JREB 2A6KA 1OP9A 1SVCP 1UADC 3THMH 4TTGA 5I8KL 4E41D 5EU6D 4NNYA 5E8OA 3SCMA 4HDIA 1E27B 3V6OC 3BT2L 5D7IF 3L7EA 1T0PB 5IROC 4N1EA 3DYOA 3RNKB 1NANH 5IMLB 2HJKB 2X4NA 4JM2B 1CVSC 5HYJD 3DARA 1N64H 3K8MA 4HG4J 2WINA 4K94H 3SKJH 4PR5B 3MNWA 2MNUA 2J5LC 5KN5B 3P9WB 2B0SL 4WDIB 3SCMC 4CNIB 1XZ0A 4Y19A 4GMSH 2FO4A 5D70L 2XZCH 1FP5A 1MJ7H 5ESVB 5I1JH 2F54E 5FF6B 3RKPA 1XH3B 5IVNA 5HGDA 4LHUB 1YQVL 3KYKL 4ZOCA 1I75A 3V4PL 4X6DA 1FZOB 5I75B 1CFVL 3SE8L 4P2OC 4TNWF 5D7JD 1J05A 3C60D 3IJYB 3EJYD 2A77H 3HMXH 3TV3L 1A1NB 3GSUB 4NN5B 1HOCB 1UA6H 2FIRT 4KV5F 5DJ0A 1ACZA 2XZAL 1Q9KA 1AO7A 2BCKA 1EFXB 3ARGA 5J11B 4OCNC 4XBGA 1QFOA 1HINL 5D7LA 4HUVB 3TFKD 4WVRA 3X12B 2RIKA 2PN5A 5MEPB 5DRWA 1YNLL 1D9KB 3BE1L 1HKLL 4QHNA 4XPGL 4YLQT 1A7QH 1GGUA 4PJGA 2JJVA 3VXMA 4NUJA 3KPNB 3O2DL 5I8EB 4ZFZB 4I2XA 3ARGC 2BX5A 4B41A 1A6VH 5DR5L 5JW3L 3KLAA 5LXGL 3IXTA 4EKXA 2DQTL 4ZNEE 3AFLA 1IC7L 1N6VA 4QGTA 3P0GB 4UV7L 1EBPA 1F58H 2XOTA 3O9WB 5I2IA 4P2QD 1UCBH 3QT2A 1U0QA 3D6GA 2NYYD 4MLIA 5T3ZL 3RNQA 2VXVH 4LLWB 1VGKB 1FYTD 4LPXA 3VXSE 3AAZA 4PIRF 4NFBA 3NCYP 3PGFH 2BY1A 4HULB 2XNAB 2APVA 1KCVH 4ZO8A 4R8WL 3HG1A 3UAJD 4A2LA 2VLLB 1X7QA 1WWWX 4XCCH 4M8VA 1JCKA 4AEFA 2ZNXA 1FG2A 1GZQA 3Q1SL 1FVCA 5ESAA 4M00A 1J0YA 1AI1L 4N68A 4HPYL 3REWA 4P2OB 5A2FA 4LVHC 3VFSB 2QKIB 2R2HA 3CIQA 3IS1X 5CZXD 1F4XH 3EDJA 1JJUA 2FATL 3QQ9D 3CSYB 5D2NC 4G6KH 4JRYD 4MA8H 3MV11 1QFWI 5FYKU 4PJDA 5BXFB 3EO0A 3U0PB 5EB9A 2D0FA 4ZAKD 2AEIT 4L4TE 3MFFB 3R8QA 5I8CA 3H3KA 1BIIB 5T1MA 3MLTB 1NMAL 4Q6IC 2OJZH 4KRPD 4EN3A 4NZUL 5DJ8A 3MLPA 3UC0L 4OCWH 3ARFA 1AGBB 2LABA 4RGNE 2NX5A 4G5ZL 5INCA 3OX8A 3T0EE 5ETUB 4BH8B 1AY1H 5BO1L 4LNRA 1XF3A 1FL5A 4FQPA 5ABDE 4EN3C 1V7NH 5EZJB 4NO0A 2WQ8A 3ARFC 4FXLA 2ARJQ 3OAYK 4YHPA 2EIEA 1G9ML 4OGXL 1WFOA 1XF4B 3OKEA 5GRZA 3GUTB 1UT9A 4K2UH 1PW3A 3CZJA 3T0AA 5KVEH 1BFSA 3IDXH 3QA3A 4RRPG 1BWMA 2R1XA 4JM4H 4BJLA 1M71B 1MCNA 1WFNA 2X44D 2HMID 2Y36H 4HXAH 1EHLH 1S9WA 1KJ2A 5LCVH 3CFIC 1HHJA 2HT3D 2WAHA 1CDUA 4LEOA 3B6SA 2ICWB 2UUDK 4GKOA 2XWTA 5DJYB 4JKLA 5TE7L 1QFWM 5BVPH 2DQDH 4PJBE 4OZFG 1F5WA 5I18H 2DQHL 1YEIH 2OI9B 5AYQA 4Z7VB 4OZHA 5HHQA 5J1AA 2IPKB 4OCMC 5I74C 4LSQL 4UT9H 4YGVA 3BGMA 4R4BA 4IHOB 5D2NB 1A4JA 4WJ5B 4W6WB 5FYJU 2HVKB 4PRDB 5HHOA 3GRWA 1G9NC 4I13B 5JW4R 5F9OL 2H2SC 3L3JA 1XGTA 6CGTA 1R5IA 3TIEA 4Q6IB 2LAAA 5DO2C 5C07A 3CX5K 1CGSH 2A2QT 2JJTA 1JYNA 2E7BA 3V5KA 4Y1AA 5CEZL 3LZFL 3GSNL 1D5MA 1U36A 1PJ9A 2IQAA 3VGDA 1Z0NA 5DS8B 3QDMB 5C0ND 1WFUA 3FT4A 2EDRA 2KH2B 4YIQB 1MNUL 3WJJC 2JJTC 3Q5TA 3VFUA 1FNGB 1TETL 3MNZA 3OXSA 4PJEF 3S5LB 2YD9A 3GIZH 1MPAH 3AMKA 3MC0A 3RU8L 1G7JA 4OZFB 5E9DA 2W65B 4M1DH 3BPOB 3CCHB 4P2RB 4X0KA 4P49A 3K2UH 3PDOB 5K59E 4NNPL 1KELL 1MCWM 4UDTB 4YFLI 4HGKC 4MA3A 4XCNB 2DI8A 3W0WE 5IEKB 3MLRL 3TYFA 1S5HB 1EEZB 2V17H 4Y4HA 3EOAA 2YKLL 2X7LA 4YXHL 5JNYA 2I60L 2V2XA 1JNJA 3T0VA 3VRJB 2B7DT 2V2WA 3CDGB 3JZ7A 1YMHA 4LLAA 3UX9B 1EXUB 4GG6E 1JF5A 1YECH 2XQYG 4XXCA 4QT5A 2Y6SD 3VE0A 1LP9E 3MCKA 1TTGA 3QDGD 4JN1L 4TUOA 1JVKA 1G7LB 1R24A 2Z8RA 3WLBB 1KCKA 1FL3B 5BW7A 3PQYA 4Y4KA 5K9OA 1OTTC 3ZDYF 3SBWA 1MF2L 1P4LA 2N7AA 1W0WB 4XP6L 4DFHA 3D3VE 2WBJB 5DA0B 4IMLA 5IW1B 4ALAL 2DWDB 4XB7A 4XXCC 4P5TD 2EZ0D 3QG6A 4LARL 2FYYA 3VXPA 4AIXA 5JPMB 2AXFA 2ZG2A 3HRZB 1I8KA 4NO5B 4QRSB 2YRPA 5IBTL 3RPIA 3K1KC 1HEZB 3IDIB 5I6XC 3SBWC 2V6HA 3E6FA 4Y4FC 5I1DA 3QNZB 1S9VA 1CCZA 1ND0B 4PJ9C 4K9EC 2RFXB 1T89A 3RL2B 2A6DA 1PAMA 2F53D 1MI5B 2G60H 1NAMH 2X89A 2EO9A 2FECI 4ORGA 1CQKA 3TA3D 5D7IB 1CFNB 2BVYA 2XTJD 4JFZL 1ZEAL 5DQJB 1AP2A 2Y23A 3T2NL 3HB3D 3MRIB 2E9IA 5IV2A 4U0RC 1HNGA 2WUCL 3IRZA 1T89C 1KC5L 1A5FL 4JFDD 5TFSL 4PLOB 3RHWF 4LAQH 2V2TA 1Q72H 2E9JA 3CC5B 1INEL 3WKML 2HH0H 5C9JA 4PRBA 5C0AA 4B50A 3FMGH 2GYSA 4JDZB 4Y5YA 1REIA 3KGRA 4P23C 1GZPA 4UTAL 3X13A 4TSCL 4DZBB 2DM3A 4UU9B 1DEDA 4FQQA 1YEFL 3B4NA 3WL9B 2AI0L 3SJVB 1P7QB 1RFDL 1XIWD 3FONA 2CUIA 1ZHKA 5EOQL 3V7MA 1OSPL 4GS7C 3QWOA 4HIEB 4MQSB 3FTGB 4ZQKB 5KVGL 2C4XA 4OTXL 5LGKA 4Y5YC 2OTPA 5HYQB 5IR1B 1OAZH 1J1XL 5T1LD 3QQ3B 3HFML 5KTEL 3HZKA 2NY2C 1RIUL 5F7EL 4JPKL 1A4KA 4PGCB 4Y4FB 4NSKA 2I9LA 4U6HA 2APXA 4YUEH 1PZ5B 5B39A 4PJ9B 5A16A 4KTDL 2D3VA 3NZ8B 3QNXB 4GRLD 3ULUF 2VC2L 3MGOB 4HK3N 1X4ZA 3RWDB 2LE9A 3TIDB 4NWTL 5EU3A 2HA1A 4J3UA 2D03H 1T20A 4PGBA 4EUPA 2VQ1A 5MEQB 3QRGL 3EOTH 4OSUL 3P0VH 3K4DA 4FFVC 4PLKC 3DYMA 4LSDA 5ANMA 3UEZA 2JIXB 1UEMA 3PXHA 2YHGA 5C86A 1NDMB 2EDBA 2CLVA 3MYJB 1MHPH 2EYRA 3SDXB 3LKSB 4EXPX 2DIAA 1CXIA 3BGAA 4P23B 3QRFM 4YHLH 4GQ9L 4WV1B 3MCLH 1UFUA 2CK0H 3KPSE 2YPLA 3FN3A 4NC2B 5KS9A 3O6FD 3AS1A 4NQDA 2JJUA 4WWID 3VFOA 3C6SB 4M61B 2G5BA 2O5XH 2NCMA 3ARXA 1BFOB 4GXUN 1AQKL 4P46D 4OFKA 3RAJH 2AQ2A 3KYMB 5EZIL 3T3PF 3MRMA 3X3FL 2MPAL 3G04A 1IGTB 1S7XA 3PP3H 3CFKA 4YHZH 1ZWIB 3DXAB 4WUUA 4IS6A 1I7RB 5CEXB 3N06B 2Z31A 3D2UA 4KC3B 1EMTL 1N59A 4KVCL 2AJXH 4RGOL 2N7BA 2AJ3B 3HZMA 4UQ3B 4YDKL 4M62L 4TPRH 5FO7B 1BVLB 4OLXL 5BOZG 5C09D 1I3GH 4AMKH 4U1NA 4QRPB 4KHTH 4MCZA 4OFYD 8CGTA 3SDDC 1A6WH 1L6ZA 3A6OA 1KG0B 3MXWL 3V4VH 2CRIA 1B0RA 4IRJC 4LSTL 2VLRE 5IBLD 2VMFA 1DDHA 1I8IB 2Y06H 1HSBB 1XCTB 1C5CH 5MP6L 4HIJB 1FAIL 3R06B 2R8SL 1T7YA 5HYSA 3QPQD 4JKPH 5DJ2A 1MRFL 4O2CB 5I0ZA 4FZ8H 1XR8A 2IADB 1JGUH 2H26B 8FABA 3KJ4B 3EYOA 3ZDZF 1KB9K 4FTVE 2P7TB 3IDNA 2NXYB 4Z7QE 5JUEH 3IJHB 3P30L 4F7CA 2VLME 3SKOB 1LO3L 3B9DA 3U4EB 5IGXL 4OM1L 2F54A 3C6LB 4DCQB 5L2KB 5DHYA 5JW5A 3CVHB 4KPHL 3U83A 5ITFA 1LEKA 1IEBB 4Z95L 2A9NH 1MWAA 4MA7L 4CN6A 4PGJA 4YHML 2QR0A 1P4BL 4JFYA 3BUYA 4WTZA 2NNAB 2ITCA 4YHIA 1NDGA 3OKNA 5GRWA 1TJGH 1AHWA 4O5LL 5F7FA 5I1AA 3Q6GL 2FD6L 4G8IA 4U0QB 1FORH 4AEHH 2H2PD 3O41A 5INDA 3DGCR 2UZIL 4I8DA 2CIKB 3B2UD 3OAZH 5IWLA 1CF8H 3FO2B 3ECBB 1C12B 5GGRA 4HX1B 1CR9H 3D0LA 2UY6A 1MREL 1I9RL 1ZHLB 1G9NL 1BD2B 1FNLA 1OM3L 3U9UA 1Q9OA 1AHWC 5EU4B 2R0KL 2SEBB 1W8OA 4ZUSA 4PS4H 2UZXB 1IGCH 3ARQA 5E8NB 4ODHL 3S36H 2GTWA 1J7VR 5K9JH 1DQDH 1A3RL 2R2BB 3PL6A 4G9DB 3GMLB 4NGHL 1MRCH 2GFBB 1MIML 3RGVC 4KQ4H 3SDDB 2HKHH 5IWLC 1RJLA 5SWZB 4UB0L 5E24E 3GJFB 1OWWA 4PJEB 4IRJB 5LGHH 4ZNEA 2EDWA 1DL7H 2GSGA 2CRZA 2FX8H 1JRHI 2IMMA 4PRID 3HC0A 2DJ4A 5KVDL 2IAMD 3WEXB 3VXSA 4NQEE 1L9NA 1ETZB 3CH1A 2H3NA 5IIEB 5GS1A 1ZHBB 3NCBB 3H9YA 1FFRA 2XFXB 1U93B 4JZOA 5JQHC 4AY0A 1INQA 3FN9A 3SHSA 4QYOB 4FQ2L 4TOYH 3VW3H 3LH2H 3LKPA 2VXUL 2ATKB 4OCRL 4TSAL 2ZUSA 3RIAF 3UJJH 1NLBH 2HYMA 4DOHB 3RWHB 5CEZD 2PNDA 1QLRA 2DB8A 2Z0BA 3TWCH 3NIDE 3TPUB 1MVUB 3QO0A 4JY6A 3MOAL 3T0XA 2W60A 3B2VL 2J8HA 4NN6C 3QIUA 3TH3T 3WIIL 3C5ZD 5JW5B 1XF2A 5F3BA 3FQNB 2DD8L 3V0WH 1WFTA 2UWEE 4A2MA 4B5EA 1FL6A 3MA9H 4L4TA 2BFVL 3DMMA 2QHLA 5LQBL 2DQEL 5HGBA 2IH1B 4KTEL 1NPUA 3WFDH 3F7VA 5L7XL 1TCMA 3FOLA 1INDH 2DM2A 5ILTL 4PBWD 3QIUC 3MREB 4ZUWB 4M5YL 2CLZA 3RGVB 3T0EA 3B5HA 4Z7UF 2PYEB 3QXDA 4HV8A 1VPOL 1BBDH 3WFHA 4LLDA 3DMMC 4XC1H 4AT6B 1VACB 3P0YL 3V5DA 2BVPB 5C3LD 1T1XA 5KSAB 1QKZH 2VWEE 4XMPL 5ITBH 3GJEA 1NGYA 2MWCA 1KB9J 1A0QH 2VDOL 2XXCB 3ULUC 2HJLB 3OF6A 3VMNA 1T0MB 3P9MA 3O3BB 3MJ7A 1ORQB 5CJQL 3BEVA 4H8WH 4R7NB 3CXHK 5MEOB 1MCSA 2PO6D 3BQUC 4R4NC 3IXAA 1ZT7B 4OF3A 4PB9L 4FFWD 5B3JF 1PEZA 2FR4A 2DYPB 1TQCC 4LBEA 2DN7A 5IMMB 5JHDB 1CLYL 5C0IA 4EOWL 5K33A 1JPFA 5JW4N 5J6GB 1IAOA 1SY6H 3LQZB 5CZVL 4S1SL 4S10A 1IEHA 3QXUA 4MAYA 4BQCA 4K7FB 1CFBA 5I0DA 5F72S 4YEFA 3MJGX 4WTXA 5FO8B 1RUPH 3TVMB 1DANT 4RFEB 1K6QH 1EFXD 1NCBH 3WMSA 2DKUA 4HAFA 3VA6A 5CBEB 5C6WH 5LBSH 2I27N 2EDNA 3V6FB 2O26U 4MAYC 4GW1A 3CVIH 5GRJL 3NA9L 1WZ1H 1PQZB 3MX0A 1YNKH 2DQGH 3IDJB 5IKCB 5CWSB 1YEEL 2YS4A 2EE2A 4G9FB 3MBXL 1A9EA 1F45A 3CGTA 3ULSA 3BP7A 1QHOA 4WI8A 3ZYJA 1N4XH 3GKZA 4HWNA 3H9SE 3N9GH 1OAKL 5IM7A 4YXLH 25C8L 1HHHB 1MFCL 1A6PA 4ERSH 2RQ8A 2DMCA 3ZHKA 2QQNH 4JZNA 1BOGA 4JPIB 1J5OL 4OCYH 3BWAA 4NM4L 2IQ9H 4MYWB 4U1JB 1ITCA 5C0CB 1HWHB 1KF9B 1JZ7A 1KNOB 4WCYH 3MMEB 5I19H 4XCFL 1S9YA 3SCMD 3BQUB 4LVEA 1WLHA 3OR6B 3ROLA 3DRQA 5FHBH 1TQCB 2I5YH 3OAUL 2ZNWA 1XFPA 3LKQB 4DGIL 1KIQB 1CIDA 2I07A 3C2AH 4HJ0C 4LIQL 5L88H 3GSRA 1T1YB 4N9OB 4GG6A 1BVKA 4G7VH 4CN1A 2Z8WC 1LP9A 4U05A 4U6VL 5D2LE 3P9LA 4LSPL 4F7MA 2DLTA 3U7YH 1UB5B 2XTLA 3W2DL 4ZD3L 3MJ8A 1L7TH 1BEYL 4UQ2A 1KULA 4PRNA 1KPRA 2R0LH 3D3VA 3SOBH 3VI3F 4KMQA 4JGMA 4WW2A 1H3PH 3MRJA 3DHMA 1S9XA 4W70A 2F19L 2OK0L 5GSVB 2F8OA 2OCFD 2DQJH 4I3SH 1NL0L 5E5MB 1DVFA 4WU7A 1K4DB 1XGRA 1AO7D 2I24N 3ARGD 1TDQA 2FJGA 3STLB 5E2WH 3VWJB 5D7LD 3MGTA 4M8QB 5DJDA 1HYSC 2E27L 2LQRA 3HUJE 4NO3A 3X11B 4D9QD 2R23B 3CXHJ 1CFTB 2YUVA 4F15C 1M4KA 2VH5L 2VE6A 2BSTB 3QWRA 3WHXA 3VXMD 4UOW0 1QSFB 2YSSA 1DVFC 1MFDH 3OL2A 5FYLL 3AB0B 4CU8A 1QNZH 3F58L 1TJHH 4TTDC 1LO4L 1OD7A 3KXFE 4ZTPL 3UTSB 3SGEH 1J0HA 4LVOC 5HHVL 3LPFA 4YX2H 4UINL 3SDYL 1YEHH 3FN0L 3LKOB 4JB9L 2DQFB 4RAVB 1ZHNA 2P5EB 3MCG1 1KCRH 3LN4A 2OR7A 2CXGA 3LOWA 1MIEL 3SPVB 3HG1D 3OKKA 4X6CE 4WI4A 1A2YB 1ZT1A 2H41A 3MV8B 4G7YH 3QCVL 3VGBA 1HQRB 4OI7A 1MQKH 1NGXB 4HUUB 1C8PA 4K8RC 2BSRA 5AUMA 3NZHL 7FABH 2RBLA 4P4KA 1FFPA 4G6AC 5CGMA 4YZFE 3RUGE 3VMOA 2EDFA 4HUMB 3B5TA 4UOW1 1B0WA 4BSVA 5EA0H 4KWUA 3U36B 3WXVL 3VJ6B 2LU3A 1HYRC 2UWEF 3IFLL 1UEYA 1EGJL 3SQOL 2A6JB 2VDKL 5L8JB 2BERA 1CLOH 1S7SB 3G6JB 4P4KC 5DZNA 4PRHE 4HF5H 2BNUB 4EN3D 3PNWB 1JPSH 1MWAL 5I1IL 3EOYG 4OT1H 3TO4C 3ARFD 3MV7E 3T08A 4L3AA 3O81A 4N0RA 1DZBA 2NX5D 4XXDA 3HPLB 5E00A 1SMAA 1MJ8H 4N90E 1JGEA 2VO5A 3DX6A 1QBLL 2DQIH 4XX1E 2P24B 3JTTB 1SJEB 2V5MA 1AGDA 1DE4A 2Y72A 3WN5A 2NY5L 2JB5H 3FRPG 3QUYC 3D39E 1JZ3A 4ZS7H 2EH7L 4NO0D 1OAYH 5C2BL 1U8JA 4XWGH 3QFDA 5GHWL 5I8KH 5FECA 4O51B 3GBML 3MZGB 4BQBA 5FB8A 4L8DA 3IFPB 5JA8B 3B5GA 4P5MA 1EJ6A 1CE6A 2RAMA 4J3TA 1MCOH 4ZNCD 4PGEB 1OSZA 4PJIF 4XNUL 3VMPA 5CD3A 5IW3A 3KPSA 3GSNB 3IETA 3PHQB 5IW6A 1G7PA 4IDJL 5GGSA 2H2SD 2P8PB 5F7HA 5DO2D 2ARJA 1L6XA 1F6AB 3H3BC 1IC5L 1ED3B 2RCSH 1DQQA 3RY6A 3SO5A 5FOBB 4X4YB 3VG0H 1YQVH 3MLZH 1I85A 5HHOD 5KSUB 5E8EA 2F5BL 4U1HA 5HHXH 1FFNA 1OARL 3SE8H 5IMOA 1YNTB 3QNYA 1U8HB 1I1CA 5ACZB 5C07D 1N6QL 1OHQA 4YO0A 3TV3H 5KJRH 5CIPA 3WS3B 4MJIA 1FVDB 3RY6C 1J8HA 3QP3A 2JB6B 2XZAH 3TO4B 4JQVC 2VNCA 4Q58C 4Z7UB 1HINH 1OW0A 1IQDB 2CLRA 2HVJB 1M05B 1URLA 3L5XL 1MI5D 1AXTL 2FHFA 5DGRA 1HKLH 4YHKL 2BRRL 3PWLB 2VLRA 3QUYB 2Q1EA 3O2DH 2DBLL 4PGZA 2AV1A 1K8IA 5DR5H 1FNSH 2J88L 4M9PA 4N0CC 3WNNA 5LXGH 4PY8J 4JDVA 1S7WB 5DWUL 4LSUH 3QIBB 1LO2L 3O0RL 4UV7H 1ZLUH 3EOBA 4FTVA 2ZCKL 3T8XA 4G6FD 4Q0XL 1ZE3C 1AGCA 1NBQA 1PVHA 1UWXH 2CKBH 4U1KA 5IB5A 1AE6L 5JXAL 3VFWB 3UZVB 1O5DT 3BAEL 1F11B 5D8JH 3PWJA 1OWRM 1DLHA 4AG4L 1U8IA 2DMKA 4O00A 2LU7A 2XIDA 1OTTD 3IU3B 2X4UB 1KEML 3FRUA 5TPWH 1EJOH 3SJVD 1P7QD 3GMPA 4JRXB 4WEUD 4HKBB 3FO1B 3HZVA 4JKWA 4MAUL 2FX9L 1U8NA 1F4HA 4OLVH 5D2LF 4DN4L 2IG2H 3HC3L 5GZNC 5F21B 5L6YL 1H3UA 3HS0A 1F42A 1FE8L 2X4SA 5IB2B 3M17A 1AGEB 3QHZL 3K80A 3PQYD 2R1YA 4H5SA 5HY9A 1A1OB 1I7ZA 3VWKA 3B3IA 4Y4FD 4L3CB 5E2TL 3DYPA 2CD0A 5GS3A 4G8FB 4TULH 3MOBH 4ISVA 4UV4L 3AREC 3IAQA 3EFFB 1VSCA 4M7KH 3BYTA 4OGAC 5K9QI 3HZYB 3K74B 1T21B 4HZLA 4J1UA 4RX4A 3UC0H 4FZEL 2C1PA 4N8PA 1KCSH 1JNLL 1LO5B 1WBZA 4AH2A 3HUJF 5KBNC 4QXUH 5HDQH 3MQIA 5CGTA 4JG0L 3GB7B 5BO1H 3KPPB 1Y6NR 4JY5L 4LKCA 3L7EB 2VITA 3QO1A 2JIXD 2X89D 1RUQL 4KJYA 5HD8C 4M7JL 4FP8H 4NZJA 1VGEL 3KWWB 2HG5B 1HI6B 3O3DA 1MCBA 5DDHA 1U8PB 4LRNL 2IPTH 1IAKB 1BBJA 3AXLA 5LKNA 1GOGA 2PYFA 3GDBA 1XGPA 2D7NA 3NABL 1UKSA 1QACA 4NWUL 5K9KA 1T04A 1SHMA 2D7TH 1RI8A 1MFEH 4HIIA 3PWUB 4QTIL 4HK0A 2KZ1B 3A6BH 4XP5L 2UWEA 2Z35B 1PKOA 5C08B 4LSQH 5D72L 1DQJA 1T5XA 2NY2D 3EYSL 2AEWA 3RA7L 4PJ8A 4ODTH 1J8KA 3QEQE 2A38A 4NKOA 4XAKE 5D1XB 5BV7H 5DQDH 3AREB 1R3HB 4NQUA 2DAVA 5AAWA 4M3KB 4ODXB 5F9OH 1E4KC 1UXWB 1RPQA 3CDCA 4I4WB 3K8LA 1BVZA 4UIMA 5BMFH 4M1GL 3STBA 5TF1L 4QTHA 3DSFL 3DGGA 3ULVE 1HILB 4JZJB 5T1KB 3LZFH 1S5IL 4NUJB 4P3CL 3P11H 3LV3B 4IDLA 4EBQH 2NTFB 4HH9B 2R2EA 4I2XB 2GKIA 4FFVD 5DJZB 4PLKD 4X6FA 1YEGL 4WW1A 2XA8L 1NFIA 2BSED 5DURB 4X7DC 5GRVK 1DBKL 3HI1A 4AIOA 2BY0A 5DSCA 3JUZA 4I5BA 4LP4A 1J0IA 1IFHH 2VDQL 2Y5TA 2R1WA 1T0NA 4P99A 4GBXA 5BZWA 4U6TA 1CFSA 3BKJH 3QEUA 1FZJA 3VA2C 4NNPH 1VKXA 5E1HB 3C8DA 3F7YB 4N1HB 1UVQA 3BVNB 3H8NA 3HAEA 4UILL 1KYOK 43C9A 3MLRH 3FQRB 1R5VB 4HWZA 4MB4A 5GS2D 3RTQA 2BJMH 3FB5A 4Q9CA 1FCGA 3QUMB 5E94A 4U1SA 2O5ZH 2J7LA 4R26H 3SDCA 1G6RH 2A1WL 4PV9B 3UZQA 4BM7A 3H42L 5EC1B 2Q86B 4ZSOE 2CJUH 3JWNC 4POUB 1JK8B 1TCRB 4KDVA 4JJ5A 3V7AE 5GGUA 4YDJA 5E4IA 1NCCH 5FDWB 3UYRH 4KI5F 4D8PA 5DD5L 4P2YA 3IAPA 5FA4A 2VB5A 3O2WL 3BH8B 3C09C 4WHTB 5DYOA 3VFRB 4X9GA 4XPBL 4XP6H 3ZKSD 1MCKA 3SDCC 4HS8L 4LFHD 4ZTOL 3SDDD 1K4CB 1F3DH 5SWZD 5I76A 3H9SA 4NQXA 3D2UD 4H1LG 2HFGH 3MUZ1 4IRJD 4NOBA 1X5FA 1T5WA 1CGUA 1ZVHA 4H20L 4RQQA 3TN0C 4I77H 1U8KA 2QLVB 5FHAL 5E56A 5TGBB 1KJ3H 1LQSR 1YMME 2IGFH 5C8JB 2BVTA 4YBLC 4K7PL 4FFZL 3RWFB 3HMXA 4PV8B 1ZAGA 2EEBA 5DJXB 4MXWL 3PV6A 1I1YB 2FL5A 1RK0A 3MPCA 4E0RB 1T2QL 3MXVH 4GLRH 3NN8A 2F58L 2C4FU 4EJ1C 4LCYB 1G1CA 3ARRA 1FPTH 2DI9A 4PJIB 3UTZB 3KDMA 3UJTH 2VISA 3MR9A 1F4WL 5D2LA 1X3DA 3NCJH 1ZLVK 1HHKA 3FO0H 2VERN 3LQAC 1WCBA 3IFNH 4RISL 2WW8A 5TFSH 4BFIA 2F54D 3DPBA 4E42B 4KHXL 1RZGB 1XF5A 1TZGL 3CPLA 4HXBL 4BH7A 1INEH 3L7FB 2PTTA 4H1LB 3MV9E 4ZOBA 4W4OC 3OG6B 1C5DB 2DDQL 2MHAA 4UTAH 3KPRB 3FQTA 2FBJL 1KJMB 2FJFB 1GOFA 1IZKA 1QVOB 2XT1B 3C09B 3I50L 3KNBB 3DVGB 3RGVD 5FUCE 3D1MC 4XCEA 3TC9A 1ERNA 5CEYB 3ZT5A 2PYED 4Y1AB 3P4LA 4ELKA 2VDLH 4K3EL 2WIMA 1EEUA 3D18A 1RSFA 3B9KC 5CLTA 3CFCH 3HUJA 5SV4A 1NC4B 3TN0B 5KTEH 4HWBH 1GRWA 5IEHB 4QCIB 5J1TC 3BXNB 3BX7C 5DTFB 3PL6D 3D85A 4XHJC 3OKDB 1J87A 3FFCE 5DFVD 3FAWA 1Y18B 4XGZB 1UJ3A 5I16B 4YBLB 3C5JB 5EZOL 3KXFA 4MJ6B 5TE4L 3ARBB 5C0RL 3GZKA 4X5LA 4MD5A 3MRBB 1T7ZA 2VC2H 1KYOJ 2XN9B 4PP2A 5CSGA 1RZFL 5KZCB 1NCAL 3C9NB 2DYPD 4IOFC 1NGQL 1OB1B 2OTUB 1AXSB 2EO1A 3QRGH 4PJAF 3HE6A 3LHPH 3AU1B 3EDFA 3TYFB 1K2DB 1UJ3C 4E5XB 1JP5A 2VDRH 1L4IA 2APFA 4CMMB 4NT6B 5DK3A 3ZMRA 4Y4HB 2MCPH 3U7AA 4KJWC 4KU1A 3QQ4B 1F13A 1GIGL 2VIRB 4OD2B 3WNKA 3WIFB 2ADGB 3KPMB 3VRIA 2ADJA 4HEPG 2R0WL 3HE6C 5J3HC 4UBDC 1ZLUK 2XKNA 1MFBL 3QULA 4AYFA 4D94A 3RUGA 5F93C 1FO0B 3L6FA 4DZ8B 3REVB 4OV5A 3QIUD 1LD9B 1ITBB 1NFDF 3T0DA 1GOHA 1QD0A 1YYLH 2DLGA 4JRYE 4NN7C 5DHVA 4LSVL 2E6QA 2X70B 3S97C 3RZCA 4PJCE 4L4TD 1NCWL 4P4RB 3DMMD 1LE9B 4WNQB 5BRZE 1IC1A 4PRHA 3B9KB 2D9QB 4ZFOB 2L4OA 4MNQB 4KDWA 1RMFL 1JHKL 3MV7A 3ESVF 4RGND 4QXTA 1R3JA 3ULUD 4IEFB 4ZPTB 1XR9A 5JHLL 4KZDH 3T0ED 1IGJA 4QHMB 2ZG1A 3O8XA 1C1EL 2J8UE 3QEGL 3UMTA 3LEXA 1FNAA 3DX9A 5DK0B 4NJAL 3G9VA 1CGTA 5AYUH 3BQUD 4R4ND 3D39A 1U8OB 3U46B 4D0CB 2ICEB 1OAQH 5FM8A 4YPJA 1QSEB 2HRPH 3I02B 3OF6D 4Z7WE 4OJFH 4MWFA 4TVSa 2Y7QB 3O8XC 3P4MB 4V1DB 3GMOB 4C56E 1WF5A 4OLWL 4LCCA 4PY7A 3ET9F 1WAAE 5CHNB 4EVNA 1BLNB 3HI6L 3LKRA 4HFWB 4R96A 5DMJB 2HRLA 4B0MM 5EBMA 5FKPA 4NHCH 4V2CB 3VXRE 1JZ6A 4M6OL 2YRLA 2EXWD 3CXDL 2AVGA 1MAMH 3VFTA 4OZFH 3HCVA 2FLBT 3C8KA 1LO3H 1TXKA 4LCCC 1NCNA 3S8WA 1GXEA 3FB8A 2YUZA 4MAYD 4JFEE 2ATPB 4M93B 5M94B 1B9ZA 2B5IB 1NUGA 1P4BH 4LMQI 4XMLL 4Z18A 1NLDH 5ICYA 5FXCH 3GMRB 2F74A 4HLZG 2Z91A 4XNYH 2BY3A 1HIMH 2YXFA 2NY7H 3JV4B 4OF6A 5EC2A 4KI5C 4UZGA 5C92A 1PX4A 2GTZB 5LGJA 2ZUQB 2EKSB 3WNLA 1I3RA 1AD9A 1KJ2H 4U7MA 4AENA 1RZIA 2E7LA 4JVUA 3MRDA 3I75A 2X4RB 1W0VB 5ENWB 5AWNL 1OM3H 1MREH 1I9RH 1G9NH 2HAZA 4XPAL 4DQOH 4AM0B 3T1FB 2R0KH 2X09A 5F71A 1FVEB 4J8RA 5DZLA 4NGHH 3TJEL 3UTSD 4NQCE 5BS0E 2P8LA 2EYTA 2Z92B 3G6AB 2AEPL 4PREA 1TJIL 2HFEB 3BWUC 1T20B 5EPMB 2BMKB 3GRWH 5FA3A 2MSPA 4BQ6A 1DFBL 4HJ0D 4PB0H 5JDSA 4G8GB 3EO1B 4I48B 4GW5B 3RWIA 2JJSC 2VN7A 3IF1A 1LGVA 3BP4B 2PR4H 4N5EC 4P5KB 2AAVA 4LSSH 2VAAB 3SE3C 4PJ5B 1E6OL 1FBIH 3MV8D 3V8CA 4XNQB 1NBYA 4NKIH 1YPZB 2M1KA 5JXEA 1MLBB 3OGCA 2F8VA 5EUOE 5SV3A 3BRFA 4FQ2H 2NY3C 1IE5A 4XBPB 1ADQL 7CGTA 3MRFB 1T1WA 3RWEA 2DQUL 5FO9A 3P77A 2XA3A 3FFDA 3QDGE 1NAMA 1A6ZB 1KLGA 4NZDA 5HPMB 5B3NA 1KFAH 2ZUWA 3DROA 3HLAA 4LU5L 2O93L 3WIIH 4NP4H 2VDPH 3CUPA 4WEBL 1HYSD 1TZHA 4X98B 4OF8A 3VXQB 2FX7L 2R0ZH 3FB7A 1N5AA 3BPLC 4D0DA 1DVFD 4TUKL 2DQEH 1UZ6E 3MROB 1U8MA 3KPOB 5TE6L 4TTDD 4C83B 3S4SA 5JOPD 1A6AA 3FQWB 1WZKA 5GISH 2OQJB 1IAIH 2BNRB 4YWGH 4HS6A 1T83C 3IJSB 4Z0XB 3Q2CA 3STZB 3PJSA 1I3UA 1J18A 1N64L 2XTJE 3AS3A 1JWUB 4JFPA 1RJZA 3SKJL 3VGAB 2H32B 4F37K 5F1NA 4ODBD 2HJFB 1V5JA 1OQXA 5CLWA 1HDMA 1QBAA 3M45A 4GMSL 4K9EH 3N1PC 2YZ8A 1QFHA 4N9GB 1MJ7L 4K8RD 5I1JL 5H94B 5CUSL 2NY3B 4KROD 3L95B 5I1CH 4PB9H 4G6AD 2EE6A 2V7HB 3NH7H 3KJ6H 1PDKA 2FWOB 2A73B 2R4RL 3GMNA 4PTTA 4EOWH 4LKXB 1MOEA 5F1OB 4LOUC 3QR2A 3WSQH 2PXYA 2A77L 4PGDB 3WXWH 3HMXL 3WUWG 4JG1H 3QEQA 5CJOH 1UA6L 4P4KD 2ZCHH 3RI5F 5LAXB 4WU5A 4X6BA 3WJLA 3BIKB 3IVKB 1AQDB 3TO4D 4HK3J 4EI6A 4ONHA 2VQUA 4JFOB 5CP7A 2ZSVA 3BPLB 1QQDA 1TNMA 1K5NA 3RDTC 2J2ZA 1LEIA 5GSRB 4U33A 4ZYKA 1UWEH 2P42B 5C7XH 4HD9A 4JQXC 5HTSA 1A7QL 1OPGH 1M6OA 1Z9OA 4MSWB 4HCRH 4KVNH 5GRJH 1SEBA 1BQSA 2GJ6B 3O4LB 2YOCA 2G5RA 1A6VL 3EGSB 3QDJB 3WDHA 3QUYD 1YEEH 4QY8A 2DQCH 3SGDH 1QRNB 5F89A 1Z3GL 3JV0A 4LPWA 4DAGH 1F58L 2HLAB 1UCBL 5EFIB 4FQXB 1Q0XL 4L8SA 4QHKJ 4KK6C 3ULVC 1J1PH 3NTCL 1UACH 2EDKA 2VXVL 1KPVB 5HJ3A 4HIHA 4NC1E 1IBGH 2GCYB 5F9JA 4MHHI 4XP9L 3MODH 3FAXA 4S11A 4PJAB 1KCVL 3JWOC 3WUWB 5HGHB 1U42A 2OR8A 5HGGS 2NMSA 4XCFH 3BHBA 2WWKT 4R7DB 3RY4A 4X4ME 4XCCL 4CADA 5DRZB 1NQBA 1JWSB 1UQSA 1L0QA 1CDCA 4QOKB 3PABB 5EUKA 3OAUH 2W07A 3OHXB 5ICXB 5IVXF 1S7TB 4APQA 1FFOA 1MLCA 1JWMA 3E2HC 1KLUA 3KPSD 1F4XL 1TENA 1YY8A 3I6GA 3OB0K 5TF0A 4G6KL 2ZG3A 3QZWA 5TDNA 4ZSOA 5GRYA 2EIZA 5M95B 4U6VH 5CILH 5DRXA 2H8PB 4R3SA 1UB6A 4PTUB 5D1QA 2PTUA 2AXJA 4LSPH 1NFDB 3MUY1 2LTQC 5D5MF 4EUPH 1ZTXL 4CVZB 3RDTB 2OJZL 5E8PB 3T77A 3ALPA 3DTXA 4OCWL 3FOLB 1KT2A 3CVHH 1DLFH 4OZIF 2CLZB 3M1BB 1MJUH 5D1QC 3K3QA 5CD5C 4N0FB 4MJID 2ARWA 1J8HD 4QRTA 3KVQA 2GSIA 1MUJB 3DVIA 5GS2H 2NY0C 4OLUH 1P1ZA 1A7OH 1YMMA 1V7NL 5C09E 2ITDB 5HHMD 2X1XR 2ICCA 1I8MA 1N7MH 3ILPA 3O6KH 4K07A 4K2UL 4UI2A 2AV7A 5KVEL 5H2BB 5E8DH 2VH5H 2VLRD 3IDXL 1YJDC 1G7HB 5EO0A 1EHLL 3BDBA 5LCVL 1LNUA 1I8LC 3OKLA 4Z7OF 1W72A 3QH3B 2EYSB 3S96A 5HHVH 5BVPL 1K8DA 4UINH 2DQDL 4NQTA 4FTVD 3SDYH 5IJKA 4HKZA 3C08H 5IESH 1TPXB 1YEIL 4PJBB 2NW3A 2VLMD 3QAZB 1GGTA 1Q94A 4JB9H 1EAPA 3GJFH 4YAQB 1LEGB 2Z4QA 4HS3A 2G9HA 5GZND 3K4ZA 5HSFA 4MCYA 2WBWB 4LCUA 3EYUH 2ZSWB 4EI5C 2FJHA 2PUQT 1UWGH 3MV9A 3OR7B 4QHLA 4P2CG 3MJ6A 5EUOF 1CTNA 2Q6WB 2LTQB 5D7JA 3DWTA 3C60A 5DVOA 1DQLH 3V5HA 3BRDA 2QSTA 3H9HA 2WBKA 1CGSL 1E28A 3ARED 5GIRA 4IJ3C 4N0UE 1WITA 5DEFA 2ZUYA 4OGAD 4QF1A 4CJ1A 1WCQA 2ZCLH 5ESQA 1QEWA 5DI8A 3NPZB 2EDHA 3NCEB 1FDLH 1BFTA 4GAJH 3WXVH 1ZS8A 3WE6B 4ELME 1X5AA 5JIHA 3ZT6A 4F58L 1IL1A 4X9FA 2NY0B 3CMOH 3F6LA 4OGYH 3CFEA 1JZ4A 3TBVB 3FFCA 2AK4B 3IB4A 1MPAL 1CK0H 1RZKC 1RAMA 5DURD 5HD8D 4OZ4A 1MWAH 4M1DL 4RX4D 2P1YA 2GT9B 3ARTA 1KXQE 2VDNH 3B9AA 3G5VB 4Q2ZA 4PRIE 2W9LA 4U7SA 4ETQA 3DV6A 3NPSB 2OTWA 3BZFB 4NBYB 3W0WB 3L3IA 4ZDHA 1G7QA 1OGAB 2V17L 1DN0B 5FGBC 3LKNA 4G6MH 2CRMA 5IHUL 3DUSA 3S7GA 5IFHH 1JHTB 3HTLX 3RWCB 5C2BH 5GHWH 4OFIA 3GBMH 4TUJB 4OZGF 4POZC 4HQQH 1YECL 3MLSL 3P73A 3QXAA 4EI5B 1RK1A 5IQ9B 2AERT 3LS4H 4CAGA 1L7IH 1TZIB 2ESVA 2APBA 2GHWB 4IDJH 5C0BE 3QJHB 5EN2A 3FOMB 4GRWF 3QUZA 3QI9C 5GGSY 4PJCA 4U1IA 4YDLC 4ZAKA 4PJ8D 4ZFFA 5BRZA 1B6UA 2ENSA 2ICWJ 4FXKA 4MNHA 5F96L 4HFUH 2XQYK 2NW2B 2NPLX 1G84A 1OAUL 2CKNA 3A6CH 1IM9B 4RAUB 2VXQH 4QRQB 4XPHL 1B0GA 4O2EA 1PYWA 2J8UA 1UM5H 3QUZC 4F7TB 1C08A 1NBZB 5IB3A 5L2JA 4H25B 1CXEA 4GAYA 2JCCF 1ZVSB 1AGFA 5HVHC 1OT2A 3NIFE 3GSXA 1NAML 3BJLA 1TTFA 3UPRB 3TBTB 4BK5A 1IGFH 3JVGA 4OKDA 2YUWA 2AJUL 3PWPB 4UT6H 4Z7WA 1UZ8A 1Z5LB 4U6XB 1RVFL 3MRGB 2ID5A 1BP3B 4C56A 5HVWA 2BRRH 1G7MB 3L9RA 1C5BH 3BPCB 1WAAA 3H0TA 2A6IB 1GGCH 1KIUA 1IQWL 2EXYC 3PUCA 4LAQL 1Q72L 1JF1A 3FB6B 3JVGC 2D7OA 1KXTB 4Y2DA 2YA1A 1OGTA 3VXRA 2R4SH 3FMGL 1R3KA 3R1GH 4UNVA 3VXUD 3ULUH 3LCYA 1SBBA 4JKMA 1VB9A 1AE6H 5EO9A 5JXAH 1ORSB 1CN4A 1P84K 3BAEH 4JFEA 5CJXA 1EHNA 2YC1B 3V4UH 3KPRD 4TSBH 2GAZA 3ALXA 3ARPA 3MLVL 4L8BA 4S2SA 1KEMH 2PW1B 3G5XB 4ACPA 3QI9B 1VERA 3BPNB 2R9HC 2HWZH 5HI3C 3EFDL 3SDCD 1S7VA 2GJZB 4O4YL 2IANB 4UDUB 1Z9SA 1OAZL 3BGFC 2ILLA 1WBYB 4P9ML 3TN0D 2G75A 1WIUA 4YUEL 4KKBC 3E3QE 3KYNB 3CZFB 3CAFA 2GY7B 4K55A 5EZLB 5DEGB 2IBBA 2YRZA 3F12B 4GJTB 4WGVB 5HVHB 4P9HC 3C8HA 3H9SD 4F7EA 4N8CH 4MQTB 5F3HB 4NQCA 5BS0A 5DUBB 2D03L 1P9MA 5JMOC 2IH3A 4TQEH 3EOTL 2XN9D 4XVUC 3MBEC 4PG9B 2ADIB 3P0VL 1RZ8B 4CVXB 3NCYS 3ETBF 4QRRB 5IUSA 3TYGH 2CDEB 5DD1H 1SEQL 5F7MC 5I1LB 1FNEA 2DM7A 3QIWB 3WIHH 4DEPC 1AIFA 5FB8B 1MHPL 3GSWA 3N0PB 4ZUVA 5I1GL 3ULVL 1MEXL 1RUQH 3MRPA 3SGKA 4JANA 4UUJA 4I0KA 4YHLL 4C54A 1RD6A 4PJ7F 2NY6D 5C0JB 5EUOA 3MCLL 1JUFB 1WWCA 2CK0L 4OD3L 5IVXB 1U95B 5BQ7B 5BZDB 2ZOKB 4L3EB 1X9QA 5J1SC 3V79C 3OXRA 2GI7A 2BVOA 1PKQB 1AKJB 4QEGA 4NWUH 3MUGA 2O5XL 4MMXC 4ZUTB 3IKKA 4M7LH 1KTDB 1D5XB 4ZXBB 3X14A 3IS0X 3SGKC 5L9DL 3VH8A 1U8LA 5EOCH 5DVLA 1QUNA 5D5MB 4WRLA 3WNMA 3BGFB 1BECA 4YHZL 2VN4A 3KYOA 3GHBL 1FZMB 3HE7C 5D72H 1NJ9B 3CFDB 3BZEB 3EYSH 1T1ZB 3RKDD 2AJXL 4GRMB 3ZE0F 2LV4A 4XHJD 1T3FB 2W0PA 4FQHA 1MHEA 3U2SB 4HWEH 4OZIB 4JLRB 1DUYB 4LF3B 3G5ZB 3OKMA 3WS6A 4AMKL 4HLJA 4NM8H 5F9WC 4KHTL 2BNQB 2EECA 3L3OA 5FK9B 1SYSB 3S9DB 3KPQB 4DGYL 3V4VL 3CFBB 3MBEB 2XG4A 1HXYB 4IOFD 3D85D 2Y06L 4G8EB 2EDEA 1C5CL 3IFOB 1IGIH 4LLYA 3UZEA 4CL7A 5T1DH 3WS6C 2BC4A 5KSVA 3MFGB 4FZ8L 3NFSH 4WEMB 1BAFH 1GAFH 1R3LA 1JGUL 4KJWD 3MRLA 1U2CA 1KTLA 3ZYIA 1OP5H 1P84J 5JUEL 5E1AA 5H8DA 4U1LB 3CSBA 5IVZB 5IOPA 3HE6D 4RCAA 4OD1H 3BO8A 2PCPA 4UBDD 5I17A 3GGWB 4F9PA 4Z7VE 2A9NL 2QQKH 3PIQB 2W9EL 4U6YB 3UBXG 4D0BB 4HKXA 1WC7A 4NQSA 4CMHB 2QJDA 1DUZA 5D2NE 3ARDA 1TJGL 32C2B 4UILH 4LK4A 5FCUH 4AEHL 2D0GA 2DJSA 3GMPB 4BUGA 5CMAA 4X7TB 3MV01 1N2RB 1XIWA 5F1IA 2YN3A 1CF8L 1PSKH 1XGQB 5D9SB 3HE7B 3GJFK 5CP3A 2OS7A 4JRWA 3VFPB 3ARDC 3K4AA 4CW1A 1S7UB 1ZGLP 2BOCA 4PS4L 1I4FA 3S36L 5K9JL 3QDME 5F9WB 3IRPX 4K8RH 4KQ4L 4PRHD 3VGHA 3T4AA 5JLZB 3O2WH 3VCLA 3UCRA 4L5FH 3S6CA 3O11B 4XPBH 5ID0A 5E03A 4L9LA 3MV7D 4OFPA 5LGHL 4HS8H 3GSQA 4XWOC 3O2VH 2CIIA 2A83B 1CGXA 2VABB 1JGDB 3O8XD 5T5NF 1T22B 1F4YH 3F62A 1ZGLA 3UBXB 1EEYA 1YEDA 4P2RE 2H6PB 4J23A 4BSWA 2UVFA 4IRSC 2UZYB 4FRWA 5DA4A 5GGVY 3CLEH 3NIFF 3D39D 4NQEB 2ZOLA 5E7BA 3E6HB 4NKMB 1CD1A 4I0PB 5D6CB 4TOYL 4JM2F 4X4ZA 4X4MA 4F7PA 3LH2L 4WWKC 1FLRH 3ROOB 2FH6A 3OPZH 3UJJL 1NLBL 5D93C 1TVHB 3W5MA 4NC1C 1T2QH 4MX7A 4OZGB 3JTSA 2WLYA 5TH2A 2CDGA 2QQQA 4N5UA 3CSPA 4NNXA 4JHZA 3RWJB 3NIGE 1A3QA 2ZPKL 3NFNB 5I1KH 2FO1A 4A6YB 1E4XH 1OQOA 2X4OA 3O6FA 3V0WL 3BP5A 1F4WH 4PRPB 4XRCA 3MA9L 2GK2A 3I2CL 3QUKB 4BFBD 3EHBC 4KI5D 2PETA 4K3GA 5FV1L 3ZE2E 1Q9LB 3L5WA 4P46A 5B8CB 2ICES 5A40E 1U2HA 5FYKH 2VZOA 3WFDL 4LLVB 1INDL 1RHHB 3HKFA 2MFNA 1NBVH 2CKBA 1FJ1B 2X4QA 2FBJH 3ZZ1A 5C07E 3VFGH 4NIKB 2KZWA 1BBDL 4MA1C 2VZTA 1NC2B 3TBSA 4YE4H 5JPNB 2EICA 1NANI 4IOIA 4FMKA 2HFFA 1MCJA 5C09A 4RGMC 1A1MB 4K3EH 1ONQB 5B38A 2AJVL 4OFYA 2JCCB 4RMQA 1A0QL 2HTLD 2WIIA 3RHWK 4IRSB 1MI5E 3BDXA 3MRHB 5D7IE 4H8WL 4JFQB 2ENYA 3EKCA 2Z93B 3RFZC 4WO4A 4URTB 4LDEB 4N5ED 5IQ7L 4U31A 1K85A 2Q7YB 2LAGB 4QRUA 3NAAL 1DQTA 3EIFA 1AR2A 1V8HA 5IMKB 1A9BB 4BK4A 4WWKB 2CMRH 2P5WB 5C0RH 1KEGL 3W39A 1HSAA 2NY3D 3Q3GB 4JN2A 4LP5A 5EIIB 4BKLB 1LE5B 1RZFH 4RFNC 1CFQB 4LNVA 1NCAH 2NXZC 1A7PH 1BM3L 1SY6L 1WBXB 4HUXB 5J8OA 4LPVA 1H3XA 5MI0C 2XZQL 4OIBA 3ILQC 1PLGH 4LLMB 3ME0A 4Z7NF 3SJVE 3V9FA 1NCBL 4R2GC 2NZ9C 3DHJA 5LBSL 3BEWB 1Y6KR 1I1AA 4N0UA 4KV5E 2EC8A 2BVEA 4Z5RB 4LLQA 3CVIL 1S7QB 2OL3A 1WZ1L 3RX7A 5MERA 1EERB 2EDLA 1YNKL 2DQGL 3AVEA 2BSSB 1I7TB 2C7UA 4ELMA 2GJ6D 3LMJH 3O4LD 6FABH 1AJ7L 3QDJD 1UXSA 1N4XL 3VFVB 4AIZB 1P7KA 1I1AC 5ICZA 4LGRB 4RGMB 1BGXH 3DV4B 4ERSL 4UNUA 2X5PA 1KJVB 2QQNL 2G2RB 4OCYL 2IQ9L 4F2MB 1KCLA 1MHHA 4WCYL 3S34L 5I19L 2FIKB 4G80B 2WWKO 4PRIA 4OCXH 3QEGH 2XWBA 4Z78A 2I9TB 2XICA 3IDMB 4KKCC 3FKUS 5KW9L 5FHBL 2I5YL 4D3CH 2NY4C 3O3AB 5CFHA 1JGLH 1U58B 5E2VL 5EULV 3LRSB 4M4RA 4QOKD 2NXZB 4RDQF 1H15B 1T2XA 1AD0B 4NRYB 4MJ4A 4XP4H 4OLEA 2UYLA 5J6HA 4QKXB 3EDEA 5L88L 1FGVH 1KIPB 5LWYH 4PJ7B 1H3WM 2NLJB 4G7VL 4LOUD 3KPLA 1CT8A 3G08A 3DX7A 1BX2A 2OSLB 2VR4A 1EZVY 3UTQB 3U7YL 5JOEA 3VD4A 1ZK9A 4R2GB 3D0VA 4NHUA 5DJCB 1L7TL 4YDVA 4GKSA 1H8OA 5TDPA 4NRXB 3C5ZA 4P3DA 5C0BA 3SOBL 2IBZX 5BJTA 1H3PL 5EOTB 2PXYD 1RHFA 3V6ZA 4TNVF 2DQJL 5DK2A 3RJDA 4HEME 4QXGL 3DXAE 4XAKD 2E7HA 1CLZL 5E2WL 1HH6A 5GRVL 1S7RB 4R97C 1G7IB 5MENB 2A74B 3GIVA 5EIVA 2OM5A 1H8NA 1A6TB 4GOSA 3GM8A 4KK6D 3ULVD 3MRKB 2BXZA 3H6JA 5CGYC 5C0DB 1Q9WB 4KMTL 1BQHG 4D2NA 5I71C 1MFDL 1E27A 1Y0LB 5D1ZB 1TJHL 1OY3B 3RNKA 3JBG7 4ZO7A 5F6HJ 5IMLA 2HJKA 4AZ8A 4JM2A 1BWWA 5HHPB 3ES6B 2X4PB 3PDDA 4YX2L 2NY4B 2AS5M 4Q7DA 3IGAB 1YEHL 4S1RH 4JREC 3TJEH 4PR5A 1HCFX 3KS0J 5KN5A 3TESA 4WDIA 5C0GB 4CNIA 1KCRL 2PW2B 3BKML 1KENH 3IDUA 1U3HC 2W0FB 4BSJA 5DVKA 1MCWW 4JM2C 5ESVA 5L2KE 5FF6A 1XH3A 4XX1G 2W0KA 3LEVH 5T3XD 4LHUA 5HHNB 4X6CB 4G7YL 4OIIH 1FZOA 1JPGB 4OUOA 3L5HA 4RNRB 7FABL 5FM5O 3CX2A 3IJYA 1OP5K 1YN7B 3BH9B 2P4AB 3MO1B 1A1NA 2CR6A 4KGJA 2E9BA 4MQ7B 3EYVB 1QLFB 1HOCA 5EA0L 4U3CA 1EFXA 3BN9C 1BQHB 3HNSH 5EBLB 3BW9B 4HUVA 5EDXA 4LCWB 2YPVH 1RIHL 2YPKB 1VFBB 1CLOL 3X12A 5D1QD 4AK1A 4R97B 5DC4B 4ZFGL 1BD2E 5CD5D 4NJ9H 4FNLH 1UM4L 3ZE2F 5MEPA 3QEHB 1D9KA 1KB5B 2NY0D 2VLJB 4HF5L 2B2XH 1JE6A 4FXGB 3LN5B 4RA3A 1U6AH 5E5RB 3SDAC 3KPNA 5I8EA 1EO5A 4ZFZA 4OT1L 3AMLA 4WEBH 4B53A 2AK4D 2W38A 5ALBH 1OT1A 4LHUG 5SWZE 5JR1H 1MJ8L 1F3RB 1JYWA 5IROA 4PJEE 1H9VA 2FX7H 3HAEH 2DQIL 1MHCB 2QADC 1T6VN 3IDGB 3O9WA 4W6YB 3WFBL 1DEEB 1JV5B 1D9KC 2JB5L 4YFLF 3I6KB 3RIAK 1X5HA 1NMBH 4ZS7L 4JFFB 4JVWA 4LLWA 1OAYL 1VGKA 4XWGL 4ESKA 2VR5A 4FA8A 3LRHA 4FABH 3O45B 1IGYB 1QOKA 3DURB 2XNAA 4MGXA 1U3HB 2K3TA 5IFJB 2YEZB 2VLLA 4FMFA 3O9WC 5HYFA 3BI9X 4X80L 1HHIB 1MCOL 2AK1H 4EEEA 5IB4B 4N8VG 2DTMH 4DOHE 4EI5D 1CICB 1FIEA 4H26B 1ES0B 4E9LA 4P2OA 4HWBA 1JMZA 5GPRA 4NPYB 2QKIA 3VFSA 1IM3B 3CSYA 4ENEC 5GGVH 2FSEB 2RCSL 5CUSH 3VG0L 3EO9H 3B9EA 3LEYH 3MLZL 4HKJB 1EVUA 3ZDYE 3U0PA 4D9LH 3MV9D 5HHXL 3MFFA 4Q9QH 1BIIA 3MLTA 2R4RH 5EOCJ 4X8JB 4GUPB 3C5SA 2Y07H 2VLKB 5ADPH 4X5WB 4XZUB 5KJRL 1AGBA 1IM9D 3DIFB 3SDAB 1WIPA 3LQAH 3KYAA 4Y5XC 5ETUA 4BH8A 2PYEE 4ZS6C 1GVIA 1HH9B 2E3VA 3DX8B 1XGUB 1C16B 3QJFB 2QADB 2CGRH 3L3GB 4QO1A 4MS8C 5EZJA 4N8VB 1XF4A 3FFCD 1A6UL 3GUTA 4Z76B 3QFJB 5GGQL 2B1HL 4BYHA 3TZVB 1FNSL 3MNVB 5FGSA 1T7XA 2YWYA 3ZTJG 4LSUL 1M71A 1Z3GH 1G1YA 1SM3L 3S3SA 1RUAH 5J4MA 2CKBL 5B22A 1Q0XH 2ICWA 4POZD 3FCTB 5DJYA 3IU4H 3AC0A 3NTCH 3MRCB 4JQIH 5JHDE 3BN3B 1H5BB 5D8JL 4OF7A 4Z7VA 1CE1H 1NEZG 4XP9H 2IPKA 1HZHH 3CH8A 1V05A 5TPWL 1RZ7H 4IHOA 1EJOL 1U3JA 1JHLL 5D2NA 5ACMA 4WJ5A 3SDXF 2HVKA 4PRDA 5DD6B 2YMXH 3A0OA 1J12A 1S8DB 3L3HB 3QI9D 3OTTA 3QUXC 1QA9B 3W81A 4OLVL 2IG2L 3FT2B 2OI9C 4Q6IA 2IAND 3BKCH 1WUNT 4I9WE 4RDQG 3O6MH 2ESVD 3Q0HA 4L8CB 3MLUH 1QO3B 1YEKL 2FH8A 2VZ1A 2W92A 5DD0H 4TULL 4R90H 3MOBL 5DVMA 3MACL 4Y5XB 3QUZD 4G9FE 5DS8A 3QDMA 4RRPA 3WD5L 5DMGC 4M7KL 5BRZD 4MVBC 3GI8L 3VXTB 1ZTXH 4JHAL 4YIQA 4ODUB 2B1AL 3AGVA 4U1MB 4PRAB 1E6JH 1FNGA 1VESA 4NOFA 3S5LA 1KCSL 5KG9B 3ULUE 4HWUA 4OZFA 4HHAB 2FBOJ 4NQVB 2W65A 1MCCA 1NEZB 4QXUL 3CCHA 3DVNB 5C0CE 5HDQL 1MRDH 4P2RA 3RWGB 3BISA 3PDOA 4UDTA 2MKWA 2EXYD 4XCNA 3VRLF 5IEKA 4FP8L 1S5HA 1SJHB 1R0AH 1EEZA 3CFJB 4AQOA 2IPTL 5FIEA 3JV6B 4KZEH 5DVNA 4C56D 1IKNA 3BPOC 5DHVH 3VRJA 1QSZA 3NOIA 1CL7L 3CDGA 1WZMA 1EXUA 4L3ED 3LAFA 2M26A 3BZDA 2D7TL 1MFEL 4Y2DD 3S5LG 3VGFA 3VXRD 3QUXB 1G7LA 5HI3D 1OTUC 2IBZY 3WLBA 3A6BL 1EVTC 1FL3A 1RURH 1IKNC 1H8SA 5JDJA 1W0WA 2AKRB 2WBJA 5IW1A 4ODTL 4JPVH 4JFED 2DWDA 2CXKA 1HWGB 2MQ0A 3T3PE 4GKZB 4JO1H 4I18B 4KKBD 3W82A 1FQ9C 3MRRB 5BV7L 5JPMA 5D6DC 5DQDL 1KOAA 2ED7A 2OX5A 5DMIL 3HRZA 1J9CT 5DUML 5F6IB 4NO5A 4QRSA 1I1FB 1HEZA 2QHRL 3IDIA 4HLZH 5I1HH 5BMFL 3WJJA 2X4TB 5EH1A 2D0HA 2WBJC 1NAKH 3QNZA 4XHQA 1ND0A 3NFPB 4U7KA 4M7LT 4PY8I 4MJ5B 3SKNB 2RFXA 3D9AH 3P11L 4GH7B 4EBQL 2DMBA 4JGUA 5FGCE 3RL2A 1XF1A 1AC0A 1QSFE 2Q76B 1MI5A 5I73B 2DLEA 4JY4B 5D7IA 4X99B 4F58H 1CFNA 4GW4B 5DQJA 4NQCD 3UTSE 3VDCA 5BS0D 1IARB 1N0LA 3I3BA 2XKUA 4V2BA 3MRIA 5HBBA 1IFHL 4RBPK 4LCIH 1DBBH 4IIQC 3BKJL 1LK2B 1JN6B 4KRLB 4DN3H 3ZDZE 1BOYA 2P5EE 2Y4SA 3WV0A 3GEWB 3CC5A 3FQUA 2AXGB 2GUOB 4JDZA 2D7PA 2DWEB 1UQSB 4L4VB 3U0WH 3TBYB 3MV8E 4JHWH 2BJML 4KUCF 4X6EB 5IHUH 4DZBA 3EDDA 3RVTC 3RJQB 4UU9A 1YDPB 3R8BB 3NMEA 3BESR 4APQB 3WL9A 3SJVA 1P7QA 2O5ZL 4R26L 1G6RL 4KXZH 2CJUL 4HIEA 3MLSH 3FTGA 3HE7D 4ZQKA 4LLUB 2VSDA 2WK2A 1NCCL 5HYQA 1BZ9B 2H32H 1IZJA 1L0YA 1WV7T 2V9QA 3QISA 3UYRL 1D5ZB 1ZV5A 5IR1A 5KOMC 3QQ3A 4RWYL 4PJXB 1N8ZB 1A7RH 3EJYC 4PGCA 2IALB 4X7FC 4Y4FA 3G6JE 3ALWA 4Y8DC 1PG7W 3WFCL 2HT2C 1PZ5A 4PJ9A 5IG7B 5TQ0H 5CBAB 3B43A 2HFGL 3T4YB 4Z8FL 3NZ8A 3QNXA 4I77L 3MGOA 2NZIA 5F96H 3RWDA 1NUDA 1FN4B 2BXYA 3TIDA 3MRQB 2P46B 1KJ3L 1OAUH 2IGFL 4J3VA 5MEQA 3PV7A 5T33H 5JOPE 4X4XB 4XPHH 3JXAA 2H9GB 3TPKA 4KJQC 2HN7B 4E41B 5EU6B 1UC6A 4OKVB 4IIQB 2JIXA 3MXVL 1UJTA 3D87B 4H0IA 5HYJB 1NDMA 3MYZA 3MYJA 2AJUH 1MY7A 5EBWB 1EO8L 2I26N 1MCHA 3SDXA 3LKSA 1FPTL 1RVFH 1X5YA 2D31B 3AS2A 4P23A 3GMQB 3FQXB 4Y0GA 3UJTL 3V8OA 4WV1A 5DJAB 3NCJL 4ZUUB 3FO0L 4HCRA 2CUMA 3IFNL 3LD8B 1IQWH 5JO5B 5C3TA 4F8QA 1FC2D 3C6SA 1KGCE 4M61A 1BFOA 1CBVH 3CX5J 5E4EC 3ARDD 2M2DA 3F7RA 3KYMA 5DUPH 4WV1C 3ARVA 1IGTA 2BDNH 2OJEB 5CINH 2W91A 4CU7A 5CZXC 4PUBH 1ZWIA 3DXAA 5DF0A 1I7RA 1X4YA 5CEXA 4NKDB 3MLVH 4G3YH 1WEJH 3VDAA 4JFXB 2VDLL 3U1SL 1LDPH 1NC2D 2AJ3A 3EFDH 4UQ3A 4XWOD 5J12C 3MLYH 3HRPA 4O4YH 5FO7A 3CFCL 1BVLA 2AABH 4Z7UE 4OLZH 4HWBL 4QRPA 2V5SA 4XPTH 2V7NB 4F9LA 4IRSD 1KG0A 4Q9RL 4P9MH 1CXKA 1KPUB 5C0EB 3SN6N 4F57H 1IILE 4YBQC 4KQ3H 1I8IA 4KRMB 1HSBA 1XCTA 1JFQL 3ZKXB 4HIJA 1GPOL 3R06A 3FO9B 4G42B 4WWKD 4O2CA 4P2QB 1IT9L 1N0XH 2IADA 2YR3A 4F9LC 1TMCB 4KKLC 1OCWL 2H26A 3LHPL 1ZLWK 2P7TA 5B3JE 4YNYB 3IJHA 5FYKE 2MQCA 2VDRL 2Y9RT 3SKOA 5HDOA 2FDBP 3U4EA 1FYTB 2IFFH 1X5GA 3C6LA 2MCPL 4DCQA 5EO1B 2OXGA 5L2KA 3IKCB 3CVHA 1SEQH 1IEBA 4NRZB 5IHLB 1U8QB 1FG9C 2NNAA 4WIQA 5I66B 3KJ4C 5I1GH 3EHBD 3ULVH 1MEXH 2NXYC 2C3WA 5E4EB 3DBXB 4JRXE 3ZHDA 3ZHLA 4KKAC 2Z8VC 3C6LC 5KSBF 3VXNB 4OD3H 4G43B 2CIKA 4BZYA 3JWOH 2EDXA 1YYLL 3FO2A 3KLSA 3ECBA 2AP2A 1C12A 4JRYB 4HX1A 1UKTA 2E6PA 1ZHLA 1BD2A 5IB1B 1QYGH 1IEAA 5EU4A 2SEBA 4QWWC 4MDJA 5L9DH 5J12B 1X5KA 4OLYH 3MOQA 5E8NA 2FHBA 2R2BA 3HPJA 4G9DA 3GMLA 4JAMB 4WUKL 3V0VB 3VFMB 2ADFH 2GFBA 4KRPB 4KI1A 3SDDA 4O2FB 5SWZA 4KZDL 3GHBH 3KLHC 5T3XH 1ZT4B 3GJFA 3BZ4A 4LL9A 4IRJA 4PJEA 1CG9A 5IF0B 1U91B 1QR4A 2V5YA 2JK5B 4MJIE 1RV6X 1J8HE 1VFMA 4DJMA 3OJMB 5AYUL 1WWAX 3TCLB 4NDMB 5HYEA 1TTUA 1OAQL 5HHME 4O02H 3WEXA 2HRPL 3DUUB 1T66C 4RAHA 1ETZA 4OJFL 5CCKL 5FYJE 4DGYH 3K81A 3KHOA 4JHBA 5IIEA 1KN2H 1ZHBA 4WO4D 2XFXA 1U93A 4P57B 1NGZB 3EDKA 4QYOA 3SQBA 3P4OB 1QZ1A 4GMTH 3Q5YA 2ATKA 5IK3B 1F02I 3SGJA 3ILQD 4PJHF 3RWHA 1ZA6B 1VFOA 3TPUA 1MVUA 4NHCL 2NZ9D 4OUUB 3U7WH 1MAML 3TBWB 5H35B 1IKFH 4KH2A 2Q3AA 1CZ8L 3FQNA 1YJDH 4TVPD 3RVXC 1LMKA 3U0TB 4MDIB 5C08E 3SGJC 2W9EH 3INUH 1A14L 5CSZB 3VI3E 4HMCA 4L29B 1BJ1J 1NLDL 3L3KB 2IH1A 1RULH 1X5JA 3W9DB 3QYCA 4WI7A 3MA7B 4XNYL 3O3EB 2OYPA 1HIML 1N3NB 1I1AD 1CD9B 2NY7L 3MREA 4OB5H 4ZUWA 2E9WA 1AR1C 1RJCA 3F8UB 3RGVA 5MEND 5DJ6B 3P3YA 1RUMH 1BZ7B 2PYEA 2XQBH 1KJ2L 1BPVA 1D5IH 4AT6A 1VACA 2M8XA 2BVPA 1W72H 4L4JA 5HDBF 4DQOL 3G6JF 5E5UB 3EYFB 5KSAA 5D71H 3SGEI 4LQ1A 1ULVA 4OAWB 2COQA 5BOPA 4NUGH 4KKCD 2HJLA 4MD0B 1T0MA 3O3BA 1ORQA 5I1EH 2Q8BH 3FT3B 2NY4D 3X3GH 3GBNH 4YHOH 1YA5A 4R7NA 5MEOA 3GRWL 5KSAC 2JKXA 2X6MA 1ZT7A 4M6AA 4PB0L 3V6BR 3NBNA 4WENB 2GK0B 1J88A 1M7IB 3TA3C 5F44A 2DYPA 2PR4L 2FCBA 5IMMA 1F97A 5JHDA 4LSSL 5JOFB 2VXSH 1YN6B 1FBIL 5J6GA 4NKIL 1RZKH 3LQZA 3UTTB 2BRQA 4K7FA 5SWQB 1MAJA 5I8OH 5FO8A 5E6YA 3TVMA 4RFEA 5FFLA 3WFZA 5CBEA 3BOVA 3QDGB 3T09A 5IP4A 3F5WB 4LCWD 1KFAL 3V6FA 4KDTC 2ZPKH 1GGIH 4XNZC 4NP4L 2VDPL 5C0BD 2NTSP 1PQZA 4X5XB 3BRGC 2VLJD 3IDJA 5IKCA 5A2JH 5CWSA 3F7PC 3TVMC 4G9FA 3BD5A 3I2CH 4P5TB 2EIBA 5FUOH 1XCQB 2R0ZL 2YD2A 5ACLA 2YD7A 5CGYD 5C0FB 5SWSB 1HQ4B 2YD6A 4WFFD 3GNMH 1HHHA 5KANI 2AJZB 4PJFF 3P4NB 1CDYA 4JPIA 4MD4B 2O61A 2DTSA 5GISL 1IAIL 4U1JA 4Y16C 2VL5B 5C0CA 4YWGL 4XBEH 4ODWB 3RGHA 1KNOA 3MMEA 2EEDA 5JIIA 1HXMB 1SYVB 4CU6A 1WICA 3BQUA 2F53B 3UTOA 1F90L 1U3HD 3OR6A 4R0LB 2AJVH 3TA3B 2VZUA 2D7QA 1NCDH 4JM2D 2XTJB 3M8OH 3U48A 1SJXA 3LKQA 1KIQA 4NYLB 4CDHA 5IQ7H 4K9EL 5AZ2L 3MSPA 3WO3B 1ZANL 4ZPVB 4L1DA 5SX5K 1T1YA 2OLDA 2GIYA 3NAAH 4PJIE 5I1CL 3D25B 4ZMAT 4JFDB 1X4XA 4DGVH 1I1RA 3NH7L 2R69H 3KJ6L 1KEGH 4Z77B 1Y6MR 3T04D 3VXUE 3BN9D 1UB5A 1Q8MA 2D2OA 2EIDA 4LHUD 4YDIL 3WSQL 3WXWL 1BM3H 3NGBC 2GITB 4JG1L 4GXVL 5HVFB 5E08H 5CJOL 4XNZB 2CDFB 2XZQH 1OF2B 4DVBB 2ZCHL 3KPRE 5GSVA 3HA0A 3SDAD 1FV1B 5E5MA 3BFOA 1K4DA 2AJSH 1P69B 4GKNB 3STLA 3VWJA 3WIHA 1UWEL 4M8QA 5C7XL 4YK4B 5T1LB 5LG1A 1OPGL 2FB4H 2QADD 2YBRB 3X11A 4HCRL 4KVNL 1V7ML 3VFNB 2R23A 1D9KD 3VDBA 1CFTA 5KVFL 5DMKB 1I7UB 4YC2C 2BSTA 4Y16B 5BVJB 1QSFA 2DQCL 2XRAH 2C5DC 3ZL4L 5GQBA 3TO2B 3TT1H 3DVFA 4DAGL 2FZ3B 1AJ7H 3VWJC 4GRLB 3UTSA 3GM0A 4HJJH 1J1PL 4PBVC 1UACL 4Y5VB 3EW3B 3O9WD 2KQMA 1IBGL 4K23L 2XN9E 5JIKA 2VQTA 4HGWB 3LKOA 4IRZH 3MODL 2DQFA 4RAVA 3GK8L 3N1QC 1XGYL 2ZOLB 3S34H 2P5EA 3PGCB 2QSVA 3AB0C 4K3DL 3ARUA 2KL6A 4P9HH 3SPVA 1QSVA 3QPQC 5KW9H 1A2YA 3QQNA 4ENED 4M6NH 4L1HA 3MV8A 3RL1B 1B88A 1MJJB 1CXLA 5E2VH 1HQRA 5EIQA 1NGXA 4HUUA 1KIRB 3NGBB 4P2OD 1MCDA 4GFTB 2BOBB 1FZKB 1VFAB 4JPWL 5CILL 5KSBB 5F88B 2C1OB 3U36A 3VJ6A 4X6DF 2EDDA 2R2CA 5F7DB 1A22B 1JF6A 2A6JA 5IJVB 3EAKA 3KPTA 3D69B 1S7SA 3G6JA 5JORB 3CVHL 2BNUA 5SX4H 4MNQE 3ZKQD 3PNWA 1DLFL 4MS8D 3W9EB 4AL8L 3DOSA 1MJUL 4YC2B 3BP6B 4BFGA 1W0YT 1G9MC 3H7BB 3HPLA 4FFYH 3JWDC 4QXGH 1ZA3B 4HW6A 3U6RB 3NVQA 1CLZH 4OLUL 2EH8L 4WHDA 2ZZUT 1A7OL 1V3LA 1VADB 5DRNB 2P24A 1BJMA 1SJEA 3JTTA 5F7LB 3UXFA 1N7ML 4YHNB 3O6KL 4PJGF 3QCUH 4ZOAA 2F5AL 3V95A 1KUMA 3T65B 5E8DL 1QSEE 1WGOA 2B4CC 2VUYA 4KMTH 1CL7I 2FEDC 4O51A 4QNPF 4KUZH 3TNNB 2Q8AL 3IFPA 2ZUUA 1XT5A 4V1DE 1ZSDB 1H0DB 3S35X 4F3FB 5F1SA 2L7UA 4PGEA 2BVQB 1RJYB 2F9BT 1D5BB 3C08L 5IESL 4YR6B 4PJHB 5HGAB 4JR9H 1UG9A 3GSNA 2CK2A 3PHQA 4RIRB 2XACC 5DHXB 3QUXD 5F70A 1CGWA 4RZCB 4JO4L 4QHUB 2P8PA 3BKMH 3HR5B 4UTBH 2R29H 1II4E 1NUFA 1F6AA 3EYUL 1IJ9A 1ED3A 1UWGL 2GEEA 4I0CC 4LSRH 1HHGB 4LDOB 5FOBA 1QPXA 4X4YA 5JZ7C 1MCFA 1TFHA 5KSUA 1DQLL 3MRNB 3P2TA 4DUVA 1E4WH 2XWJB 1B90A 1FHGA 1MY5A 5IBUG 1YNTA 5DMGD 1U8HA 1Z9LA 4MVBD 5ACZA 3TNMB 3FRPA 3CNKA 4HUWB 2ZCLL 5E6IC 3WS3A 3DO7B 1FVDA 3TO4A 1UM6L 1M7DB 1WTGT 2JB6A 4UAOC 1WZLA 3QPXH 1FDLL 4GAJL