2PW1B

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide eldkwnsl
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
232
structure length
221
Chain Sequence
b'RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSQTYTCNVNHKPSNTKVDKRVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2F5 Fab fragment heavy chain
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications.
pubmed doi rcsb
molecule tags Immune system
total genus 37
structure length 221
sequence length 232
ec nomenclature
pdb deposition date 2007-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2pw1B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2pw1B01
3I85A 1PKQB 2HKHL 3QIBA 3S37X 4M5YL 5HYFA 4HJGB 3RVUC 1PZ5B 2R2EA 2XICA 2I27N 1B4RA 3CXDL 3RNQA 2IBZX 2IPUK 1X9QA 2D4DA 3RL2B 3W9DA 2M26A 1BGXL 3QJFB 4OQTL 2I07A 1QR1B 4PGBB 2D9QB 3KYNA 1KIRA 2YA0A 1ODAA 4MDJA 4Y4KD 2M8XA 3U9UA 4WW2B 4UQ3A 1I3GH 1FLRL 3T0BA 4QCIB 1NGZA 1ULVA 1AHWC 1EO7A 4WUUA 1NBQA 4TN9A 4N0YH 1QLFA 5EU4B 3TO4D 1YMMB 2FO4B 3BP6B 5BZDB 1DQQA 1GVIA 1NFDA 5B8CB 5IB1A 3VXTB 4HD9A 1K2DB 1OCWL 3C5SB 4XPBH 1O7VA 1KEMH 1L7TL 2BVTA 2VXSL 3IDYC 1QEWA 1B0GB 3K0WA 2BSSB 3ARXA 1AIFB 4XC1H 1A5FH 3TV3L 5EU7C 4X4YA 5EPMA 3BKCH 4G6JH 1OWRM 3FRUA 4PGEA 5HYJD 2D7PA 4ISVB 3VE0B 3DI2B 3UDWA 1TZIA 4X0KB 2LAGB 2VXVH 5HDBE 1C1EL 2WUBL 5GZND 3C08L 5D7KE 2EDHA 4WENB 5D7LA 5H94B 3TC9A 1CTNA 1EH9A 3G5XA 2DQTH 1URLA 3FJTA 1NCBH 3EYVA 4F58L 4CL7A 4PY7B 1R3KB 4ZFFB 4Q7DA 3QG7H 4XRCA 5L8KB 3GSOB 3P77A 4RA3A 4I2XA 4NZUH 2DQDL 5DQ9A 4U6VL 4AZ8A 3WSQH 1UCBL 3V6OA 4F9PA 2VTFA 4RGMC 1GC1H 2YN3A 5D2NC 4Y2OA 1ZT1B 5SV3A 4UQ2A 4DGIL 5J6GA 5SWZA 2YKLL 5EU3A 3SHSA 3QRGH 2FR4A 4QHUA 5HGAA 1FDLH 4KVCL 1HQRB 2YRLA 1KYOK 4PRBA 3VFNB 5I19L 5E0QA 3EYQC 1NCAH 1V3JA 4MA3B 4CN4A 1Y18A 1W0WA 1ZHKB 3ZDYE 1TZHA 2UY6A 5ITFB 1J0ZA 3PQYA 3RAJL 1HHKA 3P0VH 5IFJB 3P2TA 4UIKL 2KKQA 4MNHB 5DJXB 5IEHB 2MHAA 3JV4B 3ARVA 3L5XL 3PWUA 4KC3B 4MCYB 4YEEA 3PWLA 5IJVB 1IC4L 1SJHA 1TTGA 3VRJA 4KI5C 2EDKA 3RJQB 3WE6A 4IMLB 4DAGH 2P4AB 4ZODA 5EZOH 2EDXA 2XTLA 3VWKA 2Z35A 5C6WH 4OFVA 1MHEA 4QRRE 5E2WH 2X9XA 5I9QB 4DKFL 3BDYH 1SM3L 2ARWA 1FAIL 1P1ZA 4M03A 4R8WH 3T0EC 4MD4A 1MCSA 1QFPA 5IESL 2YEZA 1VFBA 5DC9B 1Z9LA 3C6LB 3WHXB 1DN0A 3MLTA 4OF7A 2AK4D 4JR9L 4DTGL 1ONQB 1AE6L 3PP4H 4LVHC 2HT2D 3VG9B 1CIDA 4RWYH 3BZFA 5IEKA 1K6QH 4A2LA 2P8LA 4P0DA 4XT1C 1I1AD 2OM5A 2R1YA 3VWJA 4J8RA 1QVOB 1N2RB 1PX3A 3WDIA 1BP3B 3NZ8A 1NCCH 4HZLA 5E8NA 5FECA 3EDKA 1OLLA 3O41A 2X10A 4N5EC 2WINB 3CSBA 1ZEAL 3U9PH 5GISH 5IHUH 4GRMA 2MKWA 3IF1B 5FA3B 3IKCA 1KN2L 2FECL 3IFOA 4M3JA 3C87A 1RZJL 2E9WA 4UB0H 1FZJB 3LRSB 4OI8A 4PGCA 4JKLA 1UM4L 3V0AC 2C3WA 2VLJD 3X3FH 1OAUL 1F90H 1ZGLB 1FIGL 1G7MA 1S78C 3CXHK 5GRUH 3T0AA 3CSGA 1FFPA 5IHBA 2ZUTA 2ESVA 5IFAL 1BM3L 2XYCA 4LBEB 5JORB 4Z0BH 3SKNB 4LLQA 1NAMH 1RZ8B 3FT3A 4YHOH 2UUDK 4YR6B 1YNLL 2XQYG 3CCHB 4QTHA 2G5BB 3RUGF 4U05A 4JAMB 3E3QE 4KK8C 1NEZB 1KXQE 4HKZB 3HZVB 3DX8A 1WAAA 5H35B 5DJ8B 2ZCKH 5IB5A 5JLZA 1SVZA 1U8LA 3MFFA 3FO2A 4Z77A 1PD6A 4O58L 3KPRD 1FORL 1BMGA 3H0TB 3I6GB 1Z9MA 1LO5A 2CK0L 3WMSA 4GRWB 3UTTB 1AXTH 1F3DH 4GMTH 4GOSA 2PYED 1A7RH 4YHNB 2W0FA 3AXLA 3UTSE 4OZ4A 4FA8A 1CU4H 1OAKL 4LIQE 2FBJL 5DK2B 5HI3C 2FWOB 3CC5A 4NO0A 2Z92B 4WDIB 3EYFB 3BE1L 3D85D 1WQVT 3FO9B 4UT7H 4PUBL 1LK3H 1FG2A 1BVZA 3GRWA 4NC1C 4S1QH 1IC7L 4ODSL 4N9OB 3S36H 5L2KA 5J1TC 1MIMH 5SWSA 5L88H 2VXQL 5IMMB 1GH7A 2R1WB 4FG6D 2LTQC 5AYQA 1NFIA 1K8DA 2DWEA 3QJHA 3C2AL 4FQXB 5JW5A 3FB5A 4U1JA 5I15L 1A3QA 3QXWA 5E00A 4LSSL 1IGMH 3RZWA 4OZIE 1Q1JL 3LKSA 4ZUVB 5GGVL 1HXMB 1JRHL 2FZ3A 3RVWC 4TSAL 4LPXA 1Q0YL 3MRIB 3QIWA 2E8ZA 1KUMA 1EJ6A 4UINH 2ILLA 4XPTH 4ZO8A 2ZOLB 3IETB 3BPCB 5ESQB 3VXOA 5KVFL 4ETYA 4FQQA 2PN5A 5JMRA 5IOPB 3CLFL 2WBJD 3KYOA 3DNKA 4TSBL 5C09D 3WO4B 3PDOB 4U3XA 2E6QA 4PJDE 1GGYA 4PJBE 1VDGA 4B41A 4DCQA 3NCJL 1GRWA 3OX8A 5IVNA 1MCDA 1HI6B 5F71A 3NAAH 5JOPE 3UTPE 4GAYA 1GJIA 1HH6B 3VW3L 4KQ4H 4KDVA 3H3PH 4N8VG 4JFOB 3KG5A 1NGYB 1CICB 4Z7UA 5B3JF 1R3LB 1XF4B 2P42B 3IJHB 1RJLA 3GO1H 4JM2B 3HI1B 3SKOB 4Z7NE 5E03A 5HPMA 4LARH 2R39A 3KS0J 4RA0C 3BUYA 2DN7A 1NLDH 3O0RL 5D1ZC 1JWUB 4Y19B 3RWHB 1INQA 5HHOE 3SE9H 3WFCL 4ZMAT 2ADFH 3QIUD 4K3GA 1DFBL 4XH2B 2QSTA 4AIZB 5DEGA 4F7EB 1TTUA 5IB4B 1VGKA 4GBXA 4JY4A 4E41A 1KCVH 1R24B 5T5NF 4JRXE 5C0CA 3GMQB 4P99A 1KCLA 1QQDB 4NQEB 4NRYB 5EC2A 2ARJA 3FB6A 3VG0H 1AHWB 3DVGA 3PHOB 4OFKA 1QD0A 2Z0BA 5E6ID 2DI9A 4PJIA 5AD0A 2AEPL 2VN4A 4KRPC 1JNNH 3I75B 1P7QA 2VDQH 2DQIH 4M1CD 3IDYB 2BC4A 4O2EA 3UC0L 3M1BB 4TUKL 4POYA 5CINH 2GW5A 5C0IA 2A6IB 3QPXL 5C08B 5B21A 2WW8A 5A16A 4IRJC 4LPUA 3U0WH 1HINH 2O61B 4YWGH 1V8HA 4OCWH 5I1DB 2MWCA 3ILQD 3HR5A 2CUHA 3DGGA 5ILTL 1C12B 4L3ED 3BQUC 4FQ1H 3B2VL 1MFCH 4PRHB 2ICWJ 4PJAE 3BEWA 3QDMD 3UJTL 1YYMH 1LEIA 3HUJB 4D0DB 1RZ7H 4MD5A 1DBBH 3EDEA 3BN3B 5K9OB 1MAML 4JDVB 3WFDL 4NUJA 4ZXBD 2VZ1A 2FD6H 2JTDA 4UT6H 3B3IB 4ZUTB 4AL8L 2YPVH 1BQLH 3DRTB 2Q76A 1IM3B 1KBGH 4AQ1B 4OZGB 4X7FC 1E6OH 1A6VL 3N1GC 4TSCH 3DRQA 4I18B 3H7LA 4MJ6B 1X5KA 3OAUL 2EEAA 4BSWB 4DEPB 4Q74A 4TNWF 5T5FH 5FUCE 1G7PB 4GS7C 1HK6A 1NEUA 3QT2A 2YPLD 5FCSH 4Q6YA 1A7PL 3W9EB 3D39E 4TUJB 3VMOA 3ROLB 3ZHLA 2VLKB 3LKRB 2VL5B 5MEND 1CZ8H 5EBWA 1A0QL 2P5WD 1OF2A 1E4WL 4JRYB 4OLZH 3BKJL 4ZO7A 3TWCL 1D9KD 1BQHB 4YDJA 1KC5L 4L29B 4OGAC 5CCKL 1T7ZA 4CDHA 1S7XA 2BVUA 1DBAH 1PKQE 1UXWA 4P2RA 4X6CA 1CFQA 4PP2A 4RGOH 5IQ9B 3GRWH 4K7FA 1FRGL 5CJ8A 5HI4D 4HPYL 2RR3A 4TTDC 4HH9B 4M7LH 4HH8A 4KVNH 1NCDH 4MZ3A 4YXHL 1K3IA 4LSUH 2V2TA 4YE4L 4HGMA 1HH9A 3QIBB 1N3NA 3VMNA 4L5FH 3D0LA 1WLHA 1U3ZA 3A6CH 3FMGH 2ZUYA 3ZSTA 4LCWD 4YEFA 4XP1H 2IMNA 2EDFA 3RNQB 3VFVA 1MCPL 4OBSA 3OGOE 4HUNB 2FX8H 4QHKJ 1G7QA 3VFUA 1DLFL 1YMME 3I84A 2I07B 5CD3A 3O3BB 2CD0A 4LRNH 3KYNB 4FQLL 1KIRB 1G7LA 4OCXH 1N5YH 3MA9L 4MDJB 4GJTB 4Q9RL 3GBMH 3U9UB 1G9NC 1YNKL 3G9AB 1B88A 4KHTL 4P5TD 4LNVA 4UQ3B 3ZE1F 4N8VA 5JW4M 4TULH 1FH5H 4KK9C 2R9HC 3LEVH 2VZUA 4MMZC 4GRLA 1DQQB 1LILA 1NFDB 3K80A 3L6FB 3VDCA 1A47A 4JPVL 4D0CB 3IAQA 4UOW0 4UI2A 4XWGH 1MOEA 4MXQC 4X4YB 4I48B 1I8MA 4UILH 3OAYK 3O6LH 1QP1A 5EPMB 1REIA 1WUNT 2WLYA 2R23A 1RY7B 1CFNA 3KLHD 1G6RA 3L3HA 1TZIB 5J1AA 2J88H 3OJ2C 2QSQA 2IPTH 3SKUD 4P49A 2BNQA 5T3XD 1N0XL 2EEBA 1SY6A 1DL7H 1JPSL 4IDJH 4K71C 4P4KD 2WM0A 4B53A 1DBML 1KJMA 3MLSH 2X2YA 1NMBH 4TUOB 1HWGB 3VRIA 4K2UL 4XRCB 4G8IA 3ARFD 4KK5D 5DQ9B 2F53B 3MBED 1QRND 5KVEL 1FL3A 1I7RA 5AZEL 5A43C 4UQ2B 2A9ML 4CGTA 3QXAA 5CGYD 1C5BL 4DW2L 4TQEL 3K2MC 5SWZB 5M94B 4P9HL 2FR4B 4H0GA 5ALCL 4QHUB 5HGAB 2EDBA 5GS0H 1JGEA 4PRBB 3ARZA 4G6ML 1J18A 2RCSH 1Y18B 3UX9B 1S9KC 4RX4A 1KJ3L 3DMMD 4OIIL 1TZHB 5HPOA 5EZJB 2LTQB 1F8TH 3HLAA 3PQYB 2R4SL 2VMFA 3OTTA 3GIZH 3GMOA 4LHQB 5ANMA 3PWUB 1Z3GH 1M4KA 3PWLB 3KHQA 2Y7QA 5J4MA 3RPKA 2N7BA 4OCSL 3QDHA 2V7NB 3VRJB 1ZVHA 2Q87A 1MIEL 3WE6B 1MHCA 4ODTL 5CKAA 2HKFL 3QUML 1YEHH 2Z35B 4HW6A 3CLEL 2X7LA 1KB5B 1N4XH 3LS4H 4N1HB 4KJWD 4XHQA 1P1ZB 1CK0L 2NMSA 2UVEA 3MV7A 4KZEH 2YEZB 2ENYA 4HAGA 3GK8L 1SYSA 3W0WA 4LPCA 4JHAL 2V9RA 4K3JH 4G5ZH 2WP3T 3NCEB 2QQKH 3JUYA 1S8DA 5IEKB 4YDVA 1H15A 1FNEA 2P8LB 4YHPA 1A02N 2NYYC 4J8RB 4PRDB 2E8YA 2YD8A 2GITB 2GY7B 4HZLB 5E8NB 4ELMA 4BJLA 4WFEE 4HWNA 3O41B 1QSVA 4CADB 3U1SH 4EZMA 3QZWG 5EUKA 1I4FA 1MFDL 3IKCB 5HVHC 3MBXL 4FTVA 4QHNB 2ZCHH 4M1GL 4GG6A 4OT1H 1M6OB 1DUYB 2COQA 4NZRL 4XMLL 1G7MB 3VRLF 5JQ6H 3V6ZB 4FFVC 2ESVB 2E6JA 1YEEL 3JVGA 5I1EH 5ITBL 5DGQA 4LLQB 3E2HC 2ICCA 5D1ZB 3CGTA 3FT3B 4L4TA 3WHE0 3VXRA 4JLRB 2AXFA 1QBLL 5SWQA 2O26U 1UH4A 1TCRA 4PJXF 3SDXF 4GRWE 5FKPA 1K4CA 2HLAA 1S3KL 1T1YB 3DX8B 5KSAA 1IM9A 3WLWC 4NNPL 5D71H 1OB1A 3MFFB 3FO2B 4Z77B 2ED8A 2CIKA 1QSEA 5JZ7C 4R90L 4NSKA 1FVCB 3QCTL 4ODVH 1EO8H 3SGDH 1F4XL 1U8OA 4XNUL 2EDQA 5L9DL 3RQ3A 2W0FB 3AXLB 2OL3L 4APQD 3LS5L 2GTWB 2ICEA 4JCMA 1RUML 4LP4A 3V0WH 4JB9L 1UCTA 4KUZH 4K3DL 3HAEG 1J0IA 4ETQA 3MGTB 4WU5B 3OXRA 4LSTH 5C0RL 4YH6A 5BS0D 3EYSL 5I8OL 1FG2B 1CFTB 4O5LL 3HB3D 5BRZD 3BP4A 5EBGA 1D7FA 4L8BB 4IRJB 1ZVSA 2NR6D 5KG9B 4MCZA 3MXVH 1K85A 4WI4A 1ZT7B 4UNUA 4CU8A 2FL5A 3TBYA 3B2UC 3BIKB 2IG2H 1FO0A 4U1IA 2WWMD 1MRFL 2DWEB 3MLXH 1XGTA 5JW5B 3FB5B 4U1JB 5FHAH 4JPKH 3P73A 1AJ7H 5E00B 4PJ9D 1IGYA 5CHNA 5DJCB 1G9MC 5JQHC 5F3BA 3LKSB 3K2UL 2C3HA 4MHHI 4XPAL 1IT9H 3RJDA 1G6RH 1I7ZA 1I8LA 4RCAA 2FZ3B 3LOWA 1FHGA 4RZCB 3ZTNH 3B8YA 3QIWB 4KV5E 3MLVH 4S10A 1A4KA 5C0ND 5I18H 3OF6D 1OOAA 2F9BT 1NH6A 1SY6H 4PP1C 1KNOA 4GS7B 4B7IA 2RQ8A 1OP5H 1DR9A 1G1YA 4O2FA 3VXOB 5A2LH 2D3VA 1LO4H 3KYOB 1GZQB 4HKBA 3H9ZA 3MRPB 1XR8A 4GW5B 4RGNB 3W2DH 4PJEF 4OM0L 2D7QA 3O45A 3U48A 3CFEA 4MB5A 5I73B 1QLEL 3KYAA 4FQIL 1SVCP 2VDRH 3OX8B 3TO2A 4WEMB 5D8JL 3GBNH 4CVXB 4GAYB 5DMGD 4XVUC 2NY4D 1G9EA 1JPGA 3GMMA 1BAFL 2ZKHL 1GGTA 4HIIB 1HKFA 1MCCA 3S4SG 4Z7UB 1MEXH 3QUKA 3W39A 2XTJC 1X4ZA 2OZ4H 1RJLB 2Q3AA 1T2QL 4N0CD 4M3KB 4LLAA 3MCKA 1UWXH 5CWSA 4ZFGH 5DUBA 4G80B 4CMHC 1OTSC 2Y72A 4NQEE 4QXTA 1VFUA 2VLRB 5T3XL 1INQB 2X4NB 2GJ6E 4KKLC 4P5MB 3JWDH 4Y0GA 4ODHL 4QWWC 4O02H 3B83A 3CX2A 1GGBH 1IBGL 2HLFD 3QQ4A 5DR5H 5EA0L 5F1KC 3MC0A 1BZQK 2DJSA 4ZDHB 2Q1EA 3QZWA 4LQFL 3HE7A 5CGMA 4K3EL 2AJXL 4P23A 1VGKB 4GBXB 3FT2A 4LMQI 2QQLH 5E2UH 3WNLA 5C0CB 5D1XA 4H25A 3N06B 1MJJB 4X80H 2CSPA 5EC2B 2ARJB 3FB6B 4EUPA 3O3AA 2AJVH 3EJZC 3LB6C 5C08E 2MQCA 4NUGL 1JVKA 5E4EC 2VXTH 2FEEI 2R0ZL 4GXVH 2Q86A 4DQOH 4FXGA 4Z76A 1J8HE 3DROA 5AD0B 3KPPA 3D3VA 3I50L 1P7QB 2DQGL 2BC4B 4O2EB 5C71A 4M48L 4V1DE 3AS2A 4AT6A 2EDNA 1JNHB 1H3TA 5A16B 3IDJB 4HUUA 1Z2KA 3U6RB 3OZ9L 4M7JH 3SDAA 3HR5B 5E99L 2X70B 2JIXD 1IC1A 3WJJC 3TEUA 4F9LC 1T66C 4I0PA 4K71B 3BEWB 4LAQH 4OZGE 1AGFA 8CGTA 1MH5B 2BNRA 3W5MA 5I1HL 5DUPH 1LEIB 3RZCA 1OPGH 2GY5A 1FAKT 4M6ML 1TPXC 2J6EL 4LSQH 43C9B 1CLYL 1FGNL 1A6UH 1UB5B 4MD5B 1AY1L 2PXYD 4NUJB 2CDEB 3FQUB 4H8WL 3ULUH 3HAEA 1IAIM 4HAFA 5JUEL 3E6FA 3G6JB 4BH7B 3DYPA 1NPUA 3CSPA 2Q76B 5MP6L 1T20B 3K1KC 1IEAA 1T2XA 3D6GA 3DRQB 4DGYL 3LN4A 1UT9A 2PW2A 4N8CH 3H8NA 2EE9A 4G8GD 2HG5A 4LCYA 3FT4A 2H3NA 1Q9LA 4NQDB 3NPSC 3ZE2F 3GMRA 5FGBA 4S2SA 4UOJA 2UZIH 1FV1A 4DZ8A 3FRPA 4G7YL 2EDEA 3MRFA 5KVMC 1NDMA 2DYPA 4M43L 1HIML 5EBWB 2Y1VA 1OF2B 5KTEL 4Q2ZA 1U58A 5CJQL 3KJ6L 1IC5L 3SBWC 5D5MB 1D5IL 1EFXD 5D2LA 1N6UA 3B9KD 2AI0H 2VZSA 3JXAA 3L5HA 4P2RB 5DEFA 5GS1A 4X9GA 1CFQB 4DUXA 1U92A 3JWOH 3VXSD 3UBXG 2LAAA 5IMLA 4UV7H 5ADOL 4NJ9H 5AZ2H 2NXYB 4Y1AA 2PYFB 4ELKA 3U4EA 2XKNA 5E6YA 3VA6A 3SDYH 5H37G 4LASL 1FO0H 2NY5L 4EI5C 2X40A 4ZG1A 1HH9B 1ZLWK 1N3NB 3VGBA 5FUZL 4YO0B 4OZHA 3L9RB 4H20H 4HUWA 3MR9B 2IAMD 1RZKH 3AREA 3EZJB 3RU8L 2H45A 2YUWA 4JFDB 2GUOA 3T65B 2MNUA 3S88H 1G7QB 3MRNA 4CRPA 4D8PB 4M4RA 5CD3B 4P3DB 2F19H 3O2DL 1NFDE 1XF5B 1RULL 1G7LB 3PWPD 3MLRH 4FN0A 4P57B 5EORL 2B0SH 2X6MA 4XMPH 4OKVA 5D1XC 1K3ZA 1AD0A 5HVHB 5F1SA 2DBLH 3KYKH 5F6HI 1FP5A 4K94C 3VGHA 4RWHA 4GAGL 4EN3A 4KMLB 2AJUL 2APFA 4GRLB 4XWOC 3BH8A 1J1XL 4N90E 4PJ8A 1WC7A 4WEBH 3PJSA 3PGDA 5ID1A 2XZCL 2F54D 5D7LE 3E2HB 1XGYL 1YEGH 2DM7A 1SEBB 3LKNB 1I8MB 1DQLH 1IGCL 5E2VL 5TE4L 1A7QL 1WISA 1G6RB 3L3HB 5CS7A 5GS2D 3GSRA 5DJZA 3LHPL 5J1AB 2OLDA 4JQIH 5C0GA 2DL2A 1DVFD 2FB4H 2AKRA 3SDAC 4I2XE 4M6AA 2HYMA 2WWKO 4X6DB 1RV6X 2CO6B 2J8UB 2KZ1B 3V6OE 4FP8L 4HPOH 5HHVL 2P7TA 4PGDA 1ZGLM 1X4YA 4LSPL 1Y0LA 5B4MC 5HGBA 2VDPL 1WV7T 3GHBH 4BELD 1PG7X 5SWZE 1ORQA 2Y25A 3GKWL 2GJJA 3VRIB 3SOBL 3STZA 5T33L 2RAMA 4G8IB 4ZFZB 3DV4B 2M2DA 4QF1B 1FL3B 1I7RB 5HD8C 3PQYE 2VR5A 3ELAT 3HNSH 3QXAB 4RFEB 3VXMA 3P0YL 2H2PC 4OJFL 4JZJC 3VI3E 1G84A 2XV6B 1FL6A 1JGEB 1U93A 1IL1B 2F5BH 5FGBC 4R26H 1CLCA 4JGMA 2BVPA 4V2BA 3RGVC 1UWGH 4EUPH 1BFVL 3E6HA 1X5IA 3RIAF 4ERSH 3HLAB 5D1QA 1YEKL 5HGHA 2UYLB 1OGAD 3PGFH 3GMOB 1J5OH 2PW1A 4WO4D 5ANMB 2UWEB 4ZAKC 2V17L 2KUTA 2EXYD 5AUMB 3S5LG 3QCVL 4FABH 4F57H 3VFPA 2GFBA 3HC0A 1MHCB 1JNLL 2OQJA 4XTRC 3MTRA 4ODXB 4Z7VB 5GJTH 3ARBC 3D9AH 4WHYG 3OPZL 4YX2H 1BJ1J 2X7LB 3I9GL 4ZUWA 4LOUD 5C0AA 3HNVL 5FYKH 3W0WB 1JHLH 3KPLA 4U33A 1U3HC 4KTDH 3ALWA 3QFJA 4Y5VC 1LO2H 5HHXH 5JDSA 4MXWL 1QFOA 5FGRA 1A1MB 4YDVB 1IZJA 1FNEB 4YHPB 2Q20A 4OLXH 4YHMH 5D7IF 3ARYA 5KSUA 3HAEH 3INUL 5BZWA 2L7UA 3KPMA 3LEYL 1IZKA 4U6XA 4AG4H 3O2WL 4LDEB 5F88A 2ESVE 5EUKB 4KDWA 3E8UL 3RX8A 1AC6A 2BJMH 1LE9B 3LKPA 3TCLB 1A64A 2OP4H 4OFPA 4XCCL 2QQQA 3JTSA 1IAII 1HHHA 2MQ0A 4UU9A 3TA3D 2UUDH 1T03H 4GG6B 1FIEA 3SDDA 1R3IH 3CDGA 4OLYH 1TETL 2XTJB 2J12B 4OB5L 3E0GA 1WAAE 1ZS8A 4WU7B 3V7MA 4OQTA 2OK0L 3HZMB 4XAKE 4J3XA 3NCMA 3VFWA 5DVKA 1TVDA 1UH2A 1Q94A 4F37K 2E9JA 4L4TB 1ZGLP 2BZDA 3VXRB 2V5RA 3RX7A 5SWQB 4CMHB 3Q1SH 1FQ9C 2Z31C 4JG0H 1T6VN 5E94A 1K4CB 1VFMA 2HLAB 3NIDE 4PJHF 4XC3H 1CD1B 1IM9B 4CVZB 4KXZI 5IVXA 3RI5F 1OB1B 4MLSA 4Y4HC 4JM4L 1Z0NA 4NGHH 1AKJD 1L6XA 2ADJA 1QSEB 4X7SH 2JE8A 4NSKB 1FZOA 3W11D 4N0FA 1VSCA 3VGEA 4AQOA 4Y4FA 2DMCA 2VR4A 1ZSDA 3EDJA 3LQAC 4XX1G 5JOFB 4GW4A 1BEYH 5L2KE 4HS6A 1UG9A 4X7DC 1E28B 5SWSE 4TOYL 3KPSD 3OXSA 4JDZB 4EBQH 1OVZA 5EH1A 1GIGL 3CVHB 1X5AA 4FQCL 3X17A 1NKOA 1LP9F 5EOQH 3TBVA 1YEJL 4XNXH 3ARWA 3NZHH 4ETQB 3RY6A 2VDOH 3OXRB 5D7KD 2D0FA 3ROOA 3THML 4YPGA 3BP4B 3SDCA 1ZVSB 1MCKA 1UKTA 4MCZB 3ZKND 3LPGA 1YYLH 4ZQKB 3TBYB 5BW7C 1CD9B 3L5WB 2BK8A 2NCMA 2ZUVA 4NKIH 4U1IB 4Z95L 4LFHG 1RD6A 1YPZA 2VDKH 3F12A 4JKMA 5GGVY 5BV7C 1IGYB 1AQKH 1GAFH 1U8QA 5CHNB 3S3SA 1TPXB 4A6YL 3GI9H 2EZ0C 5F44A 4FQJH 2VQUA 5F3BB 2DLFL 1QACA 3LEXB 4ZD3H 3L3OB 3SCMD 4LHUD 3VI4E 3V8OA 1I1FB 2B1HH 4K9EH 1BIHA 1DQDH 4X4XB 3WJLC 1JJUA 2Y9RT 1CGTA 2Y23A 5GRWA 5GZOC 1V5JA 1ZWIA 4RGNE 1NUNB 5FF6B 5I1KH 1KNOB 1NLBH 5EO1A 5IROC 3NPSB 2Y6SD 4WI3A 4O2FB 3HA0A 1B0WA 3V8CA 3O6FA 4U0RC 5EU6A 4UTAH 3B9EA 2DQEH 1YDPB 1UKSA 5EC1A 3ES6B 4X9HA 3GKZA 5FEBA 2FCBA 4Z7UE 1P9MC 5L7XL 1TIUA 4QXGL 3T2PA 1KCRL 5D7JD 5CZXC 3RDTA 1J1OL 5ACZA 5DJYA 1B90A 3TO2B 3BD5A 4J2XA 4E5XA 2AXHA 2DI8A 2EDRA 3CH8A 3EO9H 3H2WA 1JPGB 2FJHB 2A83A 3LD8C 3QP3A 4OV5A 3HE6D 2IANA 3SDDC 4PJCA 2E27L 2DWDB 3QUKB 2HP4A 3W39B 1F6LL 2RBLA 5DJDA 1DTUA 3CH1A 4WHCA 3MCKB 5MEOA 3OSKA 1INDH 1BREA 1LQSR 2YA2A 4OTXH 3A6BL 3TBTB 4E41E 3MUHL 4S1SL 4YHIA 5DUBB 3GHEL 5C0CE 1I7UA 2D7MA 2VC2L 5KZCD 1B4JL 5DVNA 5A3IC 2C26A 5HY9B 1NUGA 3F62A 5JW4Q 1KOAA 3TNMB 3H9SD 5JPNA 3HE7B 1PBYA 4YHLH 4P23B 4UBDC 2BVOA 3FT2B 5IK3A 4PJIE 1I1CA 2R2HA 4HWUA 5D1XB 4H25B 2OMNA 3OJDA 4PS4L 4NWUL 1MQ8A 3ARTA 4EUPB 4TNVF 2ZOKA 3O3AB 1MSPA 4G42A 1MI5A 4CNIA 4D9QE 1OAZL 2NY0D 1QBMH 4YJZL 5FYLH 2H26A 1NGPL 1H0DA 3K8LA 3GIVB 3SJVD 2BERA 1MWAL 3DROB 3KPPB 5C0FA 3D3VB 1UEMA 1CXFA 4M6NL 1C5CH 4PBXA 1S7TA 3RY6C 3O9WD 4KKBC 3HCVA 1A6WH 4TYUA 1XAUA 3QR2A 2HJFA 3WV0A 5FCUH 1CFVH 2NLJA 2V2WA 4HUUB 3MJ7B 4YBQD 3SDAB 2HKHH 4WHDA 5JW3L 3U7YL 4PJ7F 4M5YH 4PRAA 1EEYA 4U1GC 4I0PB 4M6OL 3CXDH 1WFNA 3KJ4C 1AGFB 2BNRB 3RZCB 3HNTL 3LRHA 4IJ3B 4JFXB 4L8DB 1BGXH 5ICXA 4OQTH 1G7JA 1XGRB 1CD0A 3MA7A 2BXYA 1ND0B 4GW1A 4MGXA 2OTPA 2D7TH 3CFJA 5HHQA 4BFIB 4LKCA 1FLRH 4R2GD 4PLKD 3UJJL 5L8LB 1MJ7L 4RAUB 3GMLA 2MMXA 5A2KH 3GSVB 5EBMA 2PW2B 3K4DA 1TQBC 3EO1A 1WBZB 1QBBA 3DGCR 5IUSA 3FT4B 1OCWH 1Q9LB 4ONHB 1L7TH 3KPQA 4PTUA 2VXSH 4S2SB 1FV1B 2R2BA 4P2RE 4JN1L 2XQBL 1FGVL 4X6CE 3MRFB 5D9SB 1NDMB 3MV11 3RHWK 3TV3H 1H8SA 4XCFL 4DGVL 1QUNA 4Q2ZB 3SO3C 4F7PA 5J11B 1U58B 1YMHB 5DQJA 4R7DB 4OD2A 5T1LD 1JTOA 4XBEL 4ZAKB 4NFCA 4XZUB 5D2LB 1FC2D 3OV6A 4FOMA 1CE1L 3QNXA 1AO7D 1C1EH 2WUBH 3VDAA 3NCFB 3C08H 3HN3A 5DEFB 5GS1B 1QYGL 1U92B 1PVHA 4OGZA 5IMLB 1T7VA 2FATL 3G6AA 5ICYA 3QUXD 3ARBB 2LABA 4S1RL 3HI5L 4F58H 4Y1AB 4ELKB 3U4EB 3WS6C 3C9NA 4Y4KA 1YEDA 1ACZA 2DQDH 4U6VH 1Q9KA 4JO1L 1UCBH 1OARL 1U3HB 5MI0C 3IGAB 3RKPA 1BZ7B 3QNYA 3BP7A 4XB8A 3AREB 3TO4A 4DGIH 4P2OD 4QYOA 1S5HA 5I16B 1T3FA 2YKLH 3FO1B 3AM8A 3SGJA 4KVCH 3BD3A 4MS8D 5I19H 4NKOA 4XVJL 1QO3A 4ZNCD 2XZAL 4OKVB 1AD0B 1MRCL 4MA7L 1V7ML 3RAJH 5HYJA 2CQVA 4UIKH 4FFYL 1KTDA 4LCIL 2HT3C 3OAYH 3RI5K 3L5XH 4HFUL 3ZDZE 4EN3B 2RFXA 4XI5C 5HHMB 3BH8B 3U82B 1IARB 3MGOA 1JZ5A 5IHZA 1IC4H 3PJSB 4JO3L 4D9LL 3PGDB 2BNQE 4YAQA 4X6DE 1JGUL 1CLOL 4ZUUA 4FS0A 3JWNC 5JW4R 2I24N 1S7SA 4MNQD 1UC6A 5IV2B 4DKFH 4HLZG 3AGVA 2O5XL 5GGRY 5E8DL 2Z31B 1EBAA 1FAIH 3GSRB 1AP2A 3V5DB 5IESH 5CD5D 2DM3A 2ZZUT 5C0GB 4YBHA 2AKRB 1IQDB 4JR9H 5F7UA 4DTGH 1AE6H 4POZD 1KENL 2P7TB 3QDGB 1H5BA 4I77L 3MYZA 1ORQB 1F5WA 1L0QA 2YMXL 3STZB 4AENA 2GCYA 1OSPL 3ARGC 2AQ1A 1BD2D 3ZKXC 1ZEAH 4P5KA 3UXFA 4MAYC 1KN2H 1JMZA 4N0UA 2W38A 1J12A 1RZJH 3O3EB 3VXMB 1UM4H 2BP3A 5ANME 3UAJC 1ZA6A 4WFFD 4U6HA 1OAUH 1FL6B 1FIGH 5E5UB 1U93B 4XXCC 1X5HA 3DUUB 4RFNB 4K8RC 4YNYB 5IFAH 1BM3H 4M9PA 4P2CG 1KTRL 3F7RA 1VFOA 2HJLA 3E6HB 1UYWL 5MEQA 4KHXL 4Z7VE 1CD8A 1YNLH 1I8IA 3BISA 1BOGA 4LRIC 1MCWM 5KW9L 5DMJB 3MV01 4ONFL 5IQ7L 3MV7E 2AK4A 4YZFF 3W0WE 1W2KT 2AERT 2BRQA 3HPLA 3MLUL 5F9JA 2GFBB 3WUZA 4RAVA 1NMAL 1DE4A 4O58H 2BCKA 2MCG1 3LN5A 5KAQF 3SQBA 1I1AA 1VB9A 1FORH 3WNNA 3FFDB 1JZ3A 5HYSG 5CGTA 2CK0H 1XCTA 2XXCB 4ZUWB 4DOHE 2Z8RA 3O4OC 5C0AB 1SJVA 4N8PA 4PB9L 3KPLB 1XH3A 4XP9L 2YUZA 1OAKH 2FX7L 2FBJH 3RRQA 1CXIA 4ZOEA 4NHUA 5JDSB 1UM5L 4FTVE 3BE1H 1FZKA 2VLJA 1NCNA 3DO7A 4U0RB 4PUBH 4OKDA 5J6HA 4GKZA 4GG6E 4NHCL 1IC7H 4ODSH 3TH2T 1F4YL 5KSUB 4KJYA 3MCG1 5BZWB 2XTJE 2VXQH 2OXHA 4P46D 5DD6B 3B5GA 2IJ0C 4HIEB 5F88B 2CIIA 1NGXA 5T3ZD 4LSVL 4YC2C 4D94A 3LKPB 1MUJA 4RAHA 4L4TE 4TRPL 3VXRE 3JTSB 3C2AH 1HHHB 1JGVL 4AIOA 3ULUE 3Q5YA 5I15H 3OKEA 3SDDB 4JRWA 3CDGB 4LSSH 4OD3L 3T3PF 1MVUB 1QSZA 3MLWL 3K8MA 4F15B 3KPRA 5HVFB 4R4NC 2YBRB 1Q1JH 4O9HL 5I74C 3JZ7A 3VFWB 3ZDYF 4WV1A 1QSEE 1Q94B 5GGVH 1JRHH 1L4IA 4TSAH 3NMEA 3S36X 2PYEA 5DMIL 4LNRA 1Q0YH 5E94B 1RUPL 3R0MA 3UYRL 4Y5YA 3SQOL 3WIHL 5TDNB 2FEEL 4XPGL 5IBTL 4U1KA 4MQXD 5H2BA 3X14A 1ZVYA 1R6VA 2CLZA 4MXVE 5IVXB 4LEOB 2NQCA 2P1YA 3D85A 1J05A 2ADJB 5KVFH 3OJMB 5B38A 1Q0XL 2BY2A 3ABZA 3DETD 4WIQA 3LPFA 2HTKD 5GRYA 2BOCA 3CLFH 5DTFB 1FNHA 2CKBL 3G6DL 4GMSL 4TSBH 5A1AA 4GW4B 3RNKA 4HS6B 3O4LB 5CZKA 1GL4B 1RJYB 3B6SA 5HBBA 2AP2A 3OXSB 4HIHB 3MRMB 3NCJH 3MNZA 4HJ0D 5JW4N 5I1GL 4WWKC 1EJOL 5L2JA 3SE8L 3VW3H 1DJSA 2Q6WB 4YHYB 5DZNA 3B5TA 4MSWA 3W81A 2N7AA 2XG4A 5ESAB 3LV3A 4LHJB 4YPGB 1JF1A 5EB9A 3C09B 1NC4D 1WIOA 2HTLC 4HIJB 2A6DB 4PD4J 1RFDL 4WNQA 1WITA 1NCWL 3D0VA 4LDLB 3MREA 5KSBB 2BHYA 3ZMRA 3O0RH 4U1GB 4MZ2A 3T4AA 1YPZB 4YFDB 3DSFL 3MLZL 2UY7A 4PJXA 3KJ4B 1RZIA 3Q0HA 3WFCH 4G6AD 3EGSA 4Y16D 2MCPL 1U8QB 1DFBH 4HK3N 2LQRA 5DUML 4OUUA 5DRZA 1RHFA 1Q72L 2X9WA 4Q9QL 4NYLB 5C09A 1R5VB 3TF7C 35C8L 1KB9K 4HWBL 5TJWK 1JTPA 5LCVL 3FZUC 4W4NA 1CDJA 1ZWIB 3HKFA 5KS9A 1TQBB 4QRQA 3GSUA 2I5YL 4BZ1L 5EO1B 2AEPH 4FFWC 1GHFL 3BUTA 3UC0H 2E7LA 4GKNA 4TUKH 3FO0L 5EU6B 1CS6A 3C6LD 1FSKB 2XA8L 4LQ1A 1IAKB 1L9NA 3CVIL 3QPXH 5EC1B 2HFGL 3QUMA 4MX7B 2E7CA 4ZYKA 3ZSSA 5DA4A 4NN5C 3FONA 3RDTB 5ACZB 3K8KA 5DJYB 1JIBA 1N26A 1T0NA 4E5XB 4JEGB 5ILTH 2PTVA 4HGKC 3RA7L 3B2VH 1AR1D 3B9DA 3VFMA 1E4JA 4OV5B 3QIUA 3UJTH 2AABL 2IANB 5GS3A 4PJCB 4HMCA 3EOBA 5DSCA 3J8F7 5JDJA 1M05B 3CH1B 1WTGT 1MAMH 3BPNB 2ZUQB 3WFDH 3MXWL 3EBAA 3IU4H 1A6PA 1X5XA 4AL8H 1I7UB 3Q5OA 2CUIA 2VLMD 1YJDC 1A6VH 2H1PL 2HFTA 4OZFA 4Y5YC 3OAUH 1JI2A 1JWSA 5TGBA 4N0RA 3P3YA 4NCDA 5J3HD 1TCMA 4WTXA 1IVLA 2GSGA 3RWEB 1FVDA 3L3DA 5A2FA 4OZIF 3QFDA 1A7PH 2BVOB 4YUEL 2D7NA 2HN7B 2HT4D 3D3VE 3MV9D 1EEQA 4N1EA 4NCC2 3BGMA 5KBNC 1A0QH 2ORBL 2XN9D 2ZOKB 1E4WH 4G42B 4LKXA 3BKJH 5DDHA 3TWCH 3S96A 3F7YB 4CNIB 2GTZA 3U30C 4UZGA 2Q7YA 2H8PA 1KC5H 2QADB 3FB7A 3IU3A 4YDLB 4L3EA 5D96B 5CCKH 3UTTD 1CVRA 4HDIA 4HSQA 5CSBA 5C0FB 2X4UA 2X4RA 4F80A 3DBXA 5FYKE 3QDMA 4GO6B 3AS3A 2WLZA 1S7TB 1FRGH 4OLEA 3P11L 3HCVB 2VUOA 4RMVA 1N59A 4ALAL 2HJFB 2BNRE 2MQ3A 4HPYH 3VD9A 4NC0B 3O8XD 1TENA 1A1OB 2NLJB 2V2WB 4YXHH 4PJBF 4ZXBA 4QOKB 4YE4H 3C2SA 4CN6A 5K9QG 2WP3O 3DLQR 5GRJL 2OL3A 4L9LC 2WQRA 4PRAB 1A3RL 1EEYB 3KNBA 5ETUB 1RUKL 3PGCA 4X4MA 1B6DA 1HCVA 5F9OL 3L3JB 1MCPH 2YSSA 3EOAA 4XBGA 4FZ8L 3ARDC 5ICXB 1DLFH 4H26A 2E7HA 4GW1B 4JPWL 4WHTA 4FQXD 4FQLH 3MA9H 5MENA 1BBJA 3QUYC 3ZKXB 4Q9RH 3MJ6A 3OG6B 2JJUA 2P5WA 4BH8B 3ULVD 1YNKH 4KHTH 4MAYB 4LKCB 3U7WL 3BDBA 1QFUL 2Q7NA 1D9KA 4C56D 4UT9H 2YRPA 4LDOB 3RWIA 3GMLB 5K59E 5I1IL 1XIWC 4X9FA 3C60A 3EO1B 5CEYA 3S3JA 5D2LE 5KOMC 4JPVH 4LCUA 4KDTA 1GZPA 2PO6C 3TZVC 2HWZL 4JKPL 5D6DA 2ZUSA 1Y6KR 2I9TA 4U1SA 3CFCL 4QXUL 5T3ZL 1GPOL 4F7PB 1VCAA 5DQJB 4Y1AE 4OD2B 4LF3A 1P5VA 3MJ9L 1LD9A 1U42A 1CTOA 1EPFA 4XPHL 3QNXB 4B50A 1B0RA 4W6WB 1N0XH 2EKSB 4HLZH 4LCWA 3HMWL 4JO2L 1CFBA 4WI9A 3EYOB 1KGCE 2QQNL 4KKCD 1ZLWH 2P46B 4W6YB 5TDPA 1N5AA 4OZHE 1JPSH 3NABL 3G6AB 2OJEA 3E3QC 4WTZG 3VD4A 1E4KA 4CVUA 1DBMH 4JFYA 4K2UH 3C9NB 4Y4KB 1YEDB 1VKXA 4IRZL 4P5TA 2EXWC 5KVEH 4EQ2A 2GI7A 4PV9B 3QUZD 5AZEH 5DYOA 3IJYA 4IOSD 2QJDA 2A9MH 3BP7B 3QNYB 3TO4B 4QYOB 1C5BH 4DW2H 4TQEH 4PJAF 1T3FB 3WFHA 2F8XC 4P9HH 1FBIL 5ALCH 3BH9A 4PG9A 5HHME 3O6KL 3PDDA 3CU7A 3HZYB 4Y19D 4G6MH 5E2TL 4PRIB 1JBJA 2ADIA 4NKOB 1QO3B 3WYRA 1KJ3H 4OIIH 5DJAB 3GSQA 4XNYL 4YC2B 5HYJB 5LXGL 1GOGA 4KGJA 1KTDB 3QHZL 3CNKA 3CSYA 2XIDA 4NOBA 4D3CL 1CIUA 2C4FU 5F8RC 4ZPVA 2RFXB 4NQED 2DQCL 4OCSH 5IHZB 3BGAA 3REVA 4WY7L 5DFWH 4YAQB 1JGDA 5CEXB 1MIEH 4OCYL 2XNAA 3BEVA 4UDTA 4ODTH 4ZUUB 3Q3GA 2HKFH 3QUMH 1P6FA 5F7DA 5I75C 1J11A 3CLEH 4NO3B 4JGUA 3EFDL 4LPWA 3ARFA 1AP2B 1CK0H 2I25N 4RIRA 3MBEA 1QRNA 5EN2A 5I8EA 3RIFF 4LGPB 3GK8H 2A74A 2VZ3A 4JHAH 4ODUA 5C08D 3MO1B 1YY8A 5I8KL 4J3WA 1BVLA 4NKQB 1JZ4A 1ZLVK 1PAMA 5CSZB 3AMLA 4LLYA 1H5BB 2AJZA 3D1MC 3VXME 1KXTB 4PLJC 1YA5A 3ARSA 4MJID 3DWTA 2J7LA 1WF5A 4JG1L 3DOSA 4PRHD 4AENB 2GCYB 5FO7B 2XPGA 5GHWL 3RKDD 1U8JA 4X9BA 1RURL 4P5KB 1ZANL 1U8HA 1MFDH 4U1MA 3MBXH 4OZFH 1JWMA 4ZUSA 4WW2F 2GIYA 4M1GH 4OV6F 4AYFA 5C9JA 2AJ3A 3I6LD 1ZA6B 4NPYA 4NZRH 3C60C 4XMLH 5HHPA 2CRZA 2DOCA 1CI5A 5GGQL 5J1SC 1UB6A 2IBGA 2H32A 5D6DC 2WBWB 2J6EA 1YEEH 5ITBH 2HJLB 1JPFB 4F3FA 3UO1L 2W07A 2P44B 1OTTC 1I8IB 1QBLH 1BOGB 3EYQD 1K8IA 5GRZA 3Q5TA 4I3SL 4XCNA 2VLKD 5C0AE 3SGDI 1S3KH 2VN7A 4QTIL 3NGBB 3VFOA 4KRMB 3TN0C 5E7FA 4JRYD 4NNPH 3FOMB 1KCUL 3C5ZC 5F9JB 5FYLE 3QFJE 1YUHB 4RAVB 4XGZA 2BCKB 3LN5B 4JGJA 4R90H 2Y06L 3QCTH 4F33A 1HKLL 1F4XH 4XNUH 4KI5D 3V9FA 3IDNA 5L9DH 2X44D 2OL3H 3RWDA 2A6JA 1XH3B 2CK2A 4MNGB 3LS5H 1EBPA 2L4OA 1RUMH 4XB7A 1TTFA 4JB9H 3T0ED 4K3DH 1ZXQA 2VLJB 3ZYJA 4PB0L 1MLBB 5J6HB 4GKZB 5T1KD 5C0RH 5I8OH 3EYSH 4O5LH 3P9MB 4KJYB 1QFWI 3CK0L 4NN5B 4JQVA 1W0VA 1VPOL 1NGXB 2CIIB 1IE5A 1PYWA 4PGJA 3S9DB 3N1MC 2AGJH 2DTSA 2SEBA 1P7HL 1MRFH 3F65A 4N5ED 2QL1A 4PBWD 4JFED 2F74A 1N6QL 3UPAA 1QKZL 3WUWG 2A0LC 4YHKL 5HVGB 4AEHL 5JXEC 1JTTA 2EYTA 5IVXE 43CAB 1WK0A 3K2UH 4WV1B 3O2DA 4KMTL 2R1XA 4LCCC 4XPAH 4IRSC 1S78D 1WFOA 2V5SA 2PYEB 2QKIB 4LNRB 1G7HA 1KLGA 1GGUA 4WFGE 2VYRE 4Y5YB 4APQA 3DXAD 1YY9C 2FYYA 4U1KB 3EDFA 4QT5B 3X14B 3BZDA 2CLZB 4MWFB 2NY6C 2R56L 3OJVC 4JREC 2YA1A 1J05B 2YC1A 5DD5L 4PGZA 5F89A 3GSNB 4KK8D 3PXJA 5B38B 2G9HA 1S9YB 5BS0A 3QCUL 3Q6FB 3L7FB 2BOCB 4OSUL 4LLUA 4UUJA 3TYGL 3QQNA 2YZ1A 5FUCC 3ULVL 5D7IA 3RNKB 1FFOB 1NDGA 4OM0H 3WIFB 3GMNA 1I85C 4WW1A 1P2CA 3B6SB 1QLEH 4FQIH 3IAGC 4WJ5A 3MNZB 1D5BA 4AMKL 3BWAA 2QHRL 5KSBE 1U0QA 4FNLL 3P4LA 1BAFH 1JGLL 2F53D 2ZKHH 3V0VA 4PJ9A 4ZFOL 1YPZE 5GGRB 4CN1A 1JF1B 2LU7A 5HI3D 1PJ9A 2VAAA 2N4IA 2XQYK 1T2QH 4WNQB 1U8NA 1JI1A 4LPYA 3D0VB 1II4E 3MREB 5FHBL 4JFHE 3QULA 3SKMA 2NY1C 4L9LB 3IVKA 4Y5XA 1OWWA 5F7WC 1J7VR 3FAWA 5K33A 3T4AB 5T3XH 1MHPL 1CQKA 1RZIB 3OF6A 5T1MA 4ODHH 5BVJA 1VEPA 1I9RL 4PJHA 1IBGH 5EA0H 3ARDB 3NA9L 3KPOA 4OUUB 4LQFH 2VXVL 4K3EH 5DRZB 4X98A 2AJXH 4WW2C 3M45A 4HWEL 1PKOA 4DKDC 5C09B 3AAZA 5EU6E 3K1DA 4GLRI 5BMFL 5CSGA 5F6IB 4GRWF 5DLML 4NUGH 1NAKL 2JK5A 5B8CC 5IJKC 5KS9B 2LVCA 5IWLC 2WIIA 3BPLC 2R0ZH 3GSUB 3RVWD 1WCBA 1KTLA 2B4CC 1KV3A 1TMCB 1UEYA 1MFNA 2J1KA 3I50H 3TZVB 1LP9A 2ATKA 4M48H 3BI9X 1ED3B 3UPCA 1MJUL 1GC1L 3B4NA 2BFVH 5C07A 5C7XL 3QUMB 2IANE 3TJEL 4PJCE 3Q2CA 4NQSA 4ZYKB 2APBA 1F6AA 1MPAH 3OZ9H 5JNYA 5E99H 1OD7A 1T0NB 4M62L 1I9EA 4DK6A 4ENEC 2Q8AL 3VFMB 4O00A 3QIUB 3GJFA 3N1QC 1P5UA 2VZTA 1T83C 5I1HH 3EOBB 2H32H 4M6MH 3MRKA 2J6EH 1CLYH 1FGNH 1H3GA 1QTYT 3BJ91 3ULVF 3D25A 1AY1H 1PLGL 1KG0A 5EUOA 1BECA 4H8WH 4AEEA 5JUEH 2L7JA 1YC7A 1SEQL 3QI9C 1HSBA 5M95B 5MP6H 3EYUL 4J4PC 4C54A 4DGYH 1JWSB 1MCLA 3BIAX 1MI5E 2ZJSL 5D1ZD 2MPAL 1JUFA 3D5OF 1UZ6E 1R5IA 2GSGB 2ATPA 1A6TA 1O7SA 3QFDB 2DQUL 4G7YH 3EFFB 4M43H 3F7PC 1T89C 3QEHA 5FXCH 3BGMB 1HIMH 3BYYA 5KTEH 2YD1A 4LKXB 4M5ZL 5DDHB 3U36A 5CJQH 2GTZB 1D6VH 1IC5H 2VXUL 3KJ6H 1D5IH 3P4NA 4X4ZA 1G0DA 2YK1L 2J8OA 2JIXA 3H9HA 2H8PB 1UGNA 2IC2A 1HXYA 3IU3B 4OFDA 5LG1A 1RK0A 1NMCB 1U6AL 4HDIB 4LLWB 2X4UB 1CE6A 3VJ6A 4DK3A 4TVPD 5I9QC 5ENWA 5ADOH 3G5VB 5I75B 3CPLA 2AEWA 4KRPD 4U7SA 4DN4L 5C6PB 2APVA 2PXYA 5J0BA 3DVFA 4ZXBB 4A2MA 3RTQC 4LASH 2NY5H 4JM2F 2OSLB 2EYRA 4M4PA 1EUTA 5CIPA 2WWKT 2OL3B 1IFHL 2P8MA 3VG9C 4IRJD 5FUZH 3LQMA 2ZSWB 4HV8A 2D03L 1ZKAA 3PGCB 1EMTL 4WI5A 3IFNL 3RU8H 1UJ3A 2YSSB 3GJEA 1QLRB 3MV8D 1M1SA 4XBGB 1UXSA 3NFNA 1AI1L 3BQUD 3I02A 4H26B 3UJIL 4WHTB 3O2DH 1RULH 5EORH 5I8CA 4EIGB 1NC2B 1AGCA 3QYCA 1BBJB 3WXVH 2PR4L 5E24E 1M7DA 4PTTA 5J06A 1A9EB 1DANU 1EFXA 1MCBA 1Z5LA 3WDJA 2X4PB 4PJDB 5AG8A 4GAGH 1DZBA 5INCA 5DJ2A 5TF1L 3B9KA 1EAPA 2AJUH 3C60B 1NBZA 5CEYB 1J1XH 3VXSA 1GZPB 2XZCH 3TH3T 1F2XK 5KANG 2WQ8A 3V7AG 4A6YA 1XGYH 3F6IA 4PG2C 3QWOA 2NW2A 5C0BA 1IGCH 3MRCA 5E2VH 5TE4H 3R8BB 4U1SB 2I9TB 4KZDL 1A7QH 4AEIL 4UT7L 5FO9A 4LF3B 3EUUA 3LHPH 4GKOA 4BFGA 1PEWA 3MLPA 1E0OB 4NKDA 1EX0A 2ZNXA 5LGJB 1A7BA 4LCWB 2IAMA 3C5ZB 1F4WL 1A7NL 1T21B 4FP8H 5HHVH 2DKSA 2DKUA 1N5AB 4S1DC 4R7NB 4LLVA 4LSPH 2FH8A 2VDPH 4OGAD 5IBLC 3WEXA 2MTPA 3GKWH 1ES0A 3PWPA 2QHLA 3SOBH 3HUJF 5T33H 4PJFA 7FABL 5I71B 1YN7B 1VKXB 1V3LA 4P5TB 4KKAC 4JRXB 4PRIE 5B39B 5DYOB 3IJYB 1G7IA 4TTDD 1CR9H 5HYJE 3I6KA 5DFTA 3S6CA 5KAQG 3QO1B 3P0YH 3U0PA 3WFHB 2D7OA 1CL7I 3BFOA 1IGIL 1WZMA 2CXKA 3MRDA 4OZGF 4OJFH 2EIZA 5DHYB 4XNMB 1P4IL 3BH9B 4LGSB 4PG9B 1SJEB 2VLRD 5TE7L 1RSFA 5CEZD 4QNPE 3VGGA 1YEIL 2ADIB 4D9RD 5TPWL 3MUGB 1BFVH 3GSQB 1MCEA 5I6XC 1YEKH 3PUCA 4X7TB 5FK9A 1DVFA 3T04D 5C0CD 3AVEA 4ZPVB 2ITDB 2V17H 2OYPA 3PWJB 3QCVH 3TVMC 3ZTJG 1AFVL 4KK9D 4KJPC 1JGDB 1KCKA 2R9HD 2XNAB 2VIRA 1JNLH 4UDTB 4KI5F 3Q3GB 4XP6L 3OKDA 1P4BL 5F7DB 3OPZH 3BRDA 3I9GH 1L0YA 4B7LA 3IRPX 3SE4C 1P7QD 3ARFB 5IKCA 4HKXA 4OI9A 4CDGC 5I8EB 3CZFA 3HNVH 4G9DB 4MXQD 3CUPA 3P9LA 4ODUB 1YY8B 3M07A 1BVLB 4JREB 1WWBX 4IMKA 4MXWH 1W0YT 1VFAA 1DN2A 4N0UE 5F9DC 1MWAA 3OKOB 4LLYB 3EHBC 3WO4C 2DAVA 5EOCL 1MREL 2X9YA 3IRZA 4O2CA 1UACL 1CXHA 2XPGB 3INUH 3KAAA 3LEYH 2NZIA 3O2WH 3DX9B 2IMMA 2VDML 3HRZB 3MJ8A 5ESVA 1U8HB 4KK6C 1K9TA 4U1MB 3E8UH 3OBAA 4JZNA 4IS6A 4BSVA 5JO5A 4WO4A 4ZUSB 1KB5L 2W9EL 4XCCH 4LLMB 1CICC 5CILL 1YQVL 5C9JB 1MY5A 4MHHG 2AJ3B 5DK3A 4NPYB 4JM2C 5F93C 5FM5M 2K7QA 1FPTL 5FYJD 1LE5A 1FNFA 2AK4E 1TETH 4OB5H 2EDLA 3RL1A 4HK3J 3PWNA 3PABB 4NFBA 1OTUC 1NFDF 5LBSL 2P5ED 1UB6B 1XGPA 2OK0H 5DO2C 2NX5D 3JTTA 4X6FA 4AJ0A 5F1OB 1CFSB 3TJHC 2YZ8A 5D93C 2NY1B 2VDQL 4NQDD 3PF2A 1GC1C 4GH7B 3BYTA 1K8IB 3WS3A 3BXNA 4XCNB 2F8VA 1NBVL 5DT1L 5IR1A 4NO2A 4Z7QF 3QXVA 4YK4B 5IW1A 1LEKB 3CFDA 3QBTB 5ICZA 4MNGE 4JHWL 5DHXB 3EJYC 4JM4H 1BWWA 2R0LL 2W0KA 3GB7A 3SPVA 5IG7B 4F33B 2UZYB 2VLJE 2I60L 3DSNA 1X4XA 2XFXA 5HHNA 2B2XL 1M7XA 3WFEL 3MMEA 1LEGA 1YYML 5I1JL 5CIPH 3RWDB 4ODBD 1K4DA 2A6JB 5D70L 3BPLB 4TOYH 1WJ3A 1OL0A 4Y2DC 1DBBL 3BMWA 1GIGH 5FDYA 5J12C 6FABL 4FQCH 1OT2A 5GSRA 4MJ4A 3TA3A 1I9JL 1YEJH 2FD6L 3IXTA 1T1XA 1XZ0B 2CRMA 3THMH 1EERB 2BMKA 3K74B 3MRRB 2VO5A 4X83A 3ZT6A 4ZOAA 4JFDD 3KR3L 2JJWA 3KPRE 3I2CL 2NYYD 2X1PA 5IVOA 1PYWB 4JHBA 2SEBB 4Z95H 3HFML 2VQ1A 3V2AR 2E6PA 3SGKA 2PYEE 1WWWX 3OAZK 2AK1L 2F74B 5DD0L 3G08A 1XR9B 4TVPL 4OLZL 4WRLA 3TYFA 3SE3A 4A6YH 5EOTB 1DQJA 2DMBA 5F97E 3QI9B 3VGDA 1EDQA 2VOTA 4I18C 1KULA 4FFVD 3DYOA 4G8FA 1U3YA 4DEPC 5CJXA 5E9DD 1FJ1B 1KLGB 5K9QI 4MAUL 4QRPA 4APQB 5DRXA 1PGRB 3KPSA 1U8KA 4EOWL 4HULB 3TM6A 5LGHL 1KPRA 2YC1B 1WICA 2Y5EA 4L5FL 5BS0B 1MRDL 1G1CA 4RRPA 3WLWD 4LLUB 3OG4B 4C83A 1ZHLA 2FHFA 4AM0B 5L7XH 2GQHA 4QXGH 5JZ7D 1KCRH 3GMNB 1MNUL 4HJJL 4S11A 1J1OH 4WJ5B 5BVPL 1ACYL 1BLNB 3FOLA 1D5BB 3KPTA 3BWAB 3MROA 1JMXA 1JN6B 4JO4L 5K9KA 1TITA 5DK0A 3FQXA 4PJ9B 3JV6A 4MQTB 4PJXE 2E27H 1VESA 1X5FA 2VAAB 4UNVA 2YR3A 5E8PA 1XCQA 1WIUA 1U8NB 1M7IB 3QIBC 3RPIA 1S7QA 1VACA 3RTQB 3SCMA 4LHUA 4XNQB 1RIUL 5GS2H 3A6BH 1ERNA 3MODL 4S1SH 2FRGP 1MY7A 3QULB 3GHEH 3TESA 4HWZA 3IVKB 5TQ2L 2VC2H 5C09E 3RP1A 1B4JH 4Y5XB 5GPRA 2W91A 2H9GA 3KLAA 5MEPA 1A3LL 3M8OL 5T1MB 4G43A 4JPIB 4NP4L 5BVJB 3B2UD 1INEL 5KS9E 1J1PL 1RMFL 2XACC 1DSFL 1A22B 2EYSB 3GEWB 4F8TA 3DX7A 2OS7A 4PS4H 4U6TA 3AAZB 4NWUH 4HS8L 1CXLA 1JYVA 1RU9L 5D7JA 5C70A 2WZPD 1OAZH 4L3CA 1T04A 5F7KC 2JK5B 3NIDF 1NGPH 8FABB 2DS4A 2ZSVA 4H1LG 4PYHA 1QR4A 5DMKA 4UAOB 2FBOJ 1WCBB 1KTLB 3GI8L 2NY4B 1MWAH 2X09A 3OR7A 4M6NH 4FRWA 3HE6A 2ATKB 4N1CA 5CEZL 2XZQL 1BQUA 5C07B 4PP1D 3BRFA 3UDWC 1HDMA 5CZVL 1IGTA 1BBDL 4NQSB 1JV5A 1F6AB 2X89D 1U8IA 5F6HJ 1IAOA 1UWEL 2XA3A 5JNYB 3GUTA 5JW3H 1G9NL 2PF6A 3O3DA 3R0NA 5LQBL 5HVWA 3MCLL 1MCOL 5FA4A 4PREA 4M6OH 4BK5A 3UPRA 1IKFL 5IHLB 3GJFB 1TQCC 1HWHB 2D4FA 3HPJA 3HNTH 1I7TB 3H9SA 3MRKB 4XVUD 5DRNA 3SE3C 4URTB 1YZZA 3D25B 3V6OC 2B39A 5EUOB 4F9PC 5LWYL 2YD9A 3LDBB 1HSBB 3BX7C 1KACB 2XTJD 1B6UA 3WFBL 3UJJH 1MJ7H 1YEHL 1XF3A 4Z78A 3SJVA 1JUFB 1YECL 4Z7WA 1OTSD 1R5IB 3H3KA 2ATPB 1UQSA 3VH8G 4F7TA 4L3EE 4J12A 3ARPA 4KKLD 3O9WA 4KAQL 4JN1H 2XQBH 1FGVH 4QWWD 3QDME 1JZ2A 1KIPB 3QEHB 3C5JA 5I6XB 4JJ5A 1U95B 4XCFH 4NQCA 5HYQA 5MHSD 4DGVH 1DQTA 2BSED 3ILPA 4OF0A 2D0GA 3NTCL 3GSXB 4ZSOA 1U36A 3FN0L 1WWAX 3P4NB 2FX9L 3H9HB 1HXYB 3OGCA 3LZFL 1CE1H 1RK0B 3TVMB 3WIHA 3LB6D 3EJZD 1SYVA 2BHZA 2K1MA 1QYGH 5FYJL 1EAJA 1H3PL 1OAXL 3VWKC 3HS0B 7CGTA 1F11A 4X4ME 4S1RH 3CFBA 1XGQA 3CPLB 3BAEL 3HI5H 1FFNA 4Z7UF 2PXYB 5HDLA 5ECJE 3CD4A 5K9JL 5ISZD 2EYRB 4L4VD 5JQ6L 4JO1H 5FB8A 1OARH 1WCQA 5CIPB 5MENE 3RWGB 2P8MB 2P5WE 4MJ2A 4HV8B 3TFKC 4HK0A 4LP5A 2AV1B 5TH2A 5A2JH 1UJ3B 4OCLC 3VWJC 3GJEB 5DRWA 3VXUD 1KIQA 3MLYL 5J9PB 3STLA 3CJJA 5DWUL 3I02B 2EEDA 1T66D 5DD3L 2FJFA 5EWIL 5GGUA 5I8CB 2KDGA 5FOBA 1NBYA 3MOBL 1AGCB 4XVJH 2OR8A 1WBXA 1AXIB 4GG8B 1MRCH 4MA7H 1V7MH 1NKRA 4WWID 4FFYH 4BZ2L 5T1LA 3CMOL 3Q48A 4LCIH 1Z5LB 4HFUH 5INCB 5DJ2B 1EAPB 1AO7A 4NZJA 1NBZB 1NL0L 1EO5A 4JFZL 4JO3H 4D9LH 3RBGA 3VXSB 4CU7A 1YNTA 4PBVC 4LCWE 1CLOH 3QUXA 4XMKL 1U8PA 3QWOB 2VLLA 2NW2B 1BF8A 5C0BB 5D93B 3MRCB 2NZ9C 4NKMA 2IADB 1M71A 1WT5A 2O5XH 4Y88A 3MRJB 5FO9B 1WZLA 5DVLA 4HWBA 1SJXA 4NKDB 3O11A 3L95A 4RMRA 1BJMA 5KN5B 5BO1L 4QHMA 3D2UB 2IAMB 4P2OA 4M61A 1KENH 2X4TA 4LLVB 2GJ6B 5IIEB 2CMRL 4MDIA 4I77H 3BHBB 3WEXB 1OW0A 5C6TL 2YMXH 3ZKMC 4PJFB 1QFWL 3RWJA 1OSPH 1QRKA 2O93L 4HXAL 4N9GB 4K7PL 4G9FA 4NNYA 4Y2DB 4DZBA 1JE6A 1T1WA 5J12B 2IPKA 3I6KB 3G6JF 4EI5D 4PFEA 2JB5L 3U0PB 1G6RL 5DI8A 4JY6B 4FQHB 2EIZB 3TGXA 3V6FA 4M1DL 1C7SA 5DJ0A 3OKLA 1J8HB 1ZK9A 4HQQL 3FTGB 4OQ1A 4MNQA 1VERA 1BX2A 1C16A 4V1DB 4ZS7L 1UYWH 4KHXH 3WXWL 3O81A 2DKMA 5KW9H 2ED9A 1DVFB 5D1XD 4ONFH 5IQ7H 4HXBL 1QRNE 5D5MF 1A8JH 1MQKL 1MCIA 3KYMA 2X4OA 1ZA3B 1XF1A 4GUPA 3AUVA 2X4QA 4MD0A 1EEZA 3MLUH 4Z18A 2MSPA 2VIRB 1NMAH 4OGYL 1D6EA 3OKDB 1KJVA 3PIQB 4XWOD 1ZLVH 5FDWA 3QIWC 3VFGL 3D3VD 5IKCB 2CDGA 1BD2A 4HKXB 3WKNA 1XGUA 3CZFB 4LVNC 4PB9H 3HC3L 4XP9H 3CUPB 3EDDA 3G5YB 3P9LB 4PJ5D 3VFRA 2FX7H 2XWJA 1UM5H 1VFAB 2EC8A 3H7BA 3RVVC 2IGFL 2JCCA 2E5EA 1FYTB 1QFHA 3SDAD 5M7QA 1T2JA 3FCTA 4NHCH 3DARA 1NAMB 5ERWB 4IIQA 5FYKD 4RGNC 1EGJL 3QG6A 5I2IA 4OBRA 4XP5L 3T08A 5F70A 4O2CB 1F4YH 2IWGA 5I73C 2DB8A 2XY2A 1G9ML 1HZHL 5B4MD 3ZHKA 4C55A 3MJ8B 1BQSA 5ESVB 4EVNB 2AJYL 3QDJD 1U2HA 4LSVH 4O51A 2ZWLT 4BSVB 4IS6B 5JO5B 3ZO0A 4F7MA 1LNUB 4TRPH 5F96L 1JGVH 5DHVA 5C0EA 3VCLA 1N8ZA 4R6UA 5HD8D 3P4MA 3ZKQD 3BKML 2R2CA 1LE5B 2DQHL 2ZG1A 3OKKA 4OD3H 2NY3C 1MCNA 3RL1B 3MLWH 1J88A 1XGPB 4O9HH 2H2PD 4GXVL 1C5DA 3DUSA 2ZCLL 4X6FB 5IMKA 4PRPD 1CXEA 1F3JA 3IDIA 2JJTA 3NCCB 2R2EB 3B5HA 5EIIA 2FLRT 3V52H 1A2YA 1TVHA 5F1NA 2CO7B 3S34L 3GMPA 3WS3B 5DMIH 3DX6A 3BXNB 3W9DB 4X5WA 5IR1B 1RUPH 4YFLI 3RGVD 3UYRH 3SQOH 3WIHH 3ZDZF 5IW1B 1OAQL 4XPGH 5F3HA 3L5IA 5IBTH 3CFDB 5GS0C 5ICZB 4GBXC 2DIAA 1D5XA 3QA3A 1MFAL 5E8EA 5LKNA 4ZAKD 2YXFA 1PKQA 4X6DF 4YHZL 1Q0XH 2J8UF 3GB7B 3MUY1 1NGZB 3SPVB 4KTEL 4WUUB 4HJGA 2CKBH 3G6DH 4GMSH 2XFXB 5HHNB 1QLFB 3MMEB 4P46A 3DIFA 3RL2A 4XTRD 3QAZB 5IB1B 3ARBD 3QJFA 2RGSA 1NEZG 4Y1AD 2JLLA 1QEWB 3MJ9A 5I1GH 5GSRB 2IFGA 3SE8H 2L0DA 3ZDXE 2OTWA 3H6JA 3IXTB 1T1XB 1U3HD 3FRUB 4PGEB 3BT2L 4QCIA 2BMKB 5EZIL 3LSOA 3G04A 1RFDH 2GK0A 3BSZL 5BZDA 3IXAA 4P3CL 5EIVA 5D7LB 3C5SA 1DBKL 3QQ9C 2VQ1B 3G5XB 3KWWA 2LE9A 4OIAA 3EYVB 2G60L 3DSFH 3MLZH 4XBPA 1TQCB 4K23L 3G08B 5D7SL 2MCPH 2UWEF 2YOCA 3P77B 3QQ3A 4GQ9L 4I2XB 3VE0A 4H5SA 3TYFB 4X0KA 5DUMH 1S7RA 3DJ9A 3CVHL 1Q72H 1DQJB 5C1MB 3FN9A 4Q9QH 5ACMA 4DFHA 5BS0E 5I66A 5J6GB 35C8H 1I8KA 4HWBH 3AC0A 4Z7VF 4W4OA 5EU3B 3BVNA 4UV7L 3QSKB 2H2SC 5LCVH 4QRPB 4CU6A 5D7IE 4WGVB 3H42L 5E5MA 2XWBA 3BO8A 5IVZA 4WCYL 2I5YH 4C58B 4BZ1H 4W70A 2Z31D 2OZ4A 4LEXL 1W0WB 5DQDL 1DUZA 1GHFH 3BMVA 5CAYB 3SGEI 1PZUB 1HHKB 3FO0H 2XA8H 1NC4A 1ZT1A 3CVIH 5IB2A 2MHAB 4JQXA 4C83B 1ZHLB 2HFGH 1F4HA 4Y4HD 4DN3L 3QDGD 1BJ8A 1MLCA 1SJHB 1HQRA 4R4FL 2A9NL 2PNDA 5IMOA 5SX4I 1WEJL 3KGRA 2XXMB 3FOLB 4FXLA 3MROB 2ICWA 4MA3A 3RA7H 2BNUA 3VWKB 1LHZA 3FAXA 5DK0B 1MHEB 2B8OT 1MCQA 3FQXB 3MZTA 3PV7A 1PY4A 2NXYC 3JV6B 5ITFA 4Y16A 2D31A 2AABH 4GG6F 1FC1A 2OJZH 3HMXL 4MD4B 1VFBB 5E8PB 5KANI 1P4LA 1XCQB 2DQFA 4IDLA 4PJHE 4MCYA 1DN0B 3MLTB 1S7QB 1VACB 5HDQL 4LHUB 3MXWH 5IJVA 5C8JA 2JJTC 5KJRL 3VMPA 4NT6A 4HWZB 2FIRT 3MRGA 3BZFB 1X5YA 1NSNL 1T5WA 2ID5A 2VDLL 2H1PH 3KLAB 5MEPB 2R1YB 3VWJB 4P2QD 4G43B 3NZ8B 3QEUA 5FECB 3O2VL 3ZKSD 4HFWA 3C6LA 4GRMB 4YUEH 3IFOB 3DX7B 1ONQA 2VSDA 4WUKL 4PGCB 2EC9U 1N7ML 2ORBH 2EZ0D 1MFBL 5C07E 4GRLC 2DDQL 4L3CB 1T04B 4RFOL 1QVOA 1FFPB 1RJCA 3F6LA 4MXVF 4AH2A 4BFBD 3OR7B 5D72L 5BQ7A 5GZOD 2WINA 3BN9C 3HE6B 2XI9A 1EUUA 5FA3A 4QTHB 3P11H 4DJMA 4TTGA 3LRSA 2AVGA 4ALAH 3T1FA 1HDMB 4HG4K 1U8IB 2BY3A 5JLZB 5IB5B 1U8LB 2PKDA 5EUOE 5GRJH 5CBAA 5CBEA 5KZCB 2ERJB 1XFPA 5DHVH 4D2NA 4LBEA 5DFVC 1A3RH 1CCZA 5FA4B 1RUKH 3C8KA 4PREB 5FM4A 1LO5B 3UPRB 4FMFA 5F9OH 5CZXD 1CL7L 2VKXA 2R4RL 3RGHA 4K94L 3HPJB 3V6BR 3H9SB 3NCBB 3VFTA 4BQBA 4FZ8H 1RZFL 2ENSA 1AGDA 5DRNB 3MACL 4OZ4B 4NWTL 1NEZA 4LSRL 4JPWH 4R9HA 3N85L 1RAMA 4HKZA 3CAFA 3QRFM 3PNWA 3MV9A 2AW2A 1OGTA 4EQ3A 3SDDD 3CC5B 4NO0B 3HTLX 2AJSL 5DJ8A 2XN9A 5JHDD 3U7WH 3EAKA 1QFUH 1AD9A 1PG7W 2NY0B 3ZE0E 3FFCD 1GSMA 4JE4B 3LKQA 3H0TA 3I6GA 2Z93A 2E9IA 5L2KB 5I1IH 3UTTA 3SJVB 5SWSB 4Z7WB 2IF7A 3VFSA 5A3ID 5F21B 5FYKL 3K4AA 2HWZH 4JKPH 3TPKA 4TNWK 1NFIB 1K8DB 2FWOA 3QJHB 3U79A 4LK4A 5F7LB 5HYQB 3K3QA 4NQCB 3O8XA 4WDIA 3S37L 3CFCH 3ILPB 4QXUH 1T7YA 1LDSA 5T3ZH 1GPOH 4UBDD 2AAVA 1CDGA 5FAAA 3JWDC 3MJ9H 3OGCB 3WD5L 4XPHH 3QWQB 1SYVB 3HMWH 1FYHB 4JO2H 5IMMA 5JR1L 2QQNH 2OR7A 3O4LD 5C2BL 3NABH 4EJ1C 3U4BL 3WIIL 3CFBB 1XGQB 3T8XA 4JDTL 3KS0H 5F1IA 1UM6L 1T03L 1T7WA 3CU1A 1FG9C 3VGFA 1I75A 2AXJA 3MRBA 3U7AA 4IRZH 4LVNB 4KKBD 5LVEA 1BQHG 1TJIL 5FB8B 4C56A 1F58L 2VWEE 5ID0A 4FQQB 2JELL 2V9QA 3D48R 1F3DJ 4ZUVA 5TH2B 2HRLA 5DRWB 5JIKA 2VITA 1KIQB 3VXPA 3STLB 3VXQA 3VD3A 3GFUA 4ZFOA 3V4PL 4C4KO 1UFUA 3O6KH 4DCQB 5E2TH 2FJFB 4MMXC 4Y8AA 5FOBB 1NBYB 5FIEA 3VXSE 1WBXB 4QHLA 2OCFD 4XNYH 4WI8A 3BPCA 3HG1A 5LXGH 5ESQA 5T1LB 3QHZH 5C0BE 4KJQC 4D3CH 4NBYB 4KGLA 1JF6A 1AO7B 2DQCH 4UDUA 3PDOA 3UCRA 2NY3B 2IH3A 3JVGC 4IOFC 4WY7H 1F02I 4R97C 4KH2A 1KFAL 2BX5A 5HPMB 4OCYH 1YNTB 3BUYB 3QUXB 3AY4A 1KXVC 3ULUC 1U8PB 1HI6A 2FGWL 2VLLB 5I17A 4U1HA 4NKMB 1HH6A 2EO1A 2KQMA 1M71B 5TFSL 3EFDH 3HC4L 5I30L 5KSAC 4JFOA 3MUZ1 4LU5L 3PWPE 5EU6D 5EG6C 1R3LA 2CGRL 3QUZA 3IJHA 1AR2A 4PJFE 3O11B 3L95B 5DEGB 2O5ZL 1PQZA 4JY4B 4E41B 5I8KH 1CGUA 4QHMB 3SKOA 4PJGA 5F7EL 4P2OB 4M61B 4M8VA 2BY1A 4YBLC 1WSST 4C57C 4MDIB 1JWUA 4G6FD 3DVGB 3ARRA 1TZGL 4JG1H 2EH7L 4W68A 4Y19A 1S7VA 3RWJB 5GHWH 3HRPA 4G9FB 1QNZL 3QEQA 4PJIB 4XH2A 1RURH 1ZANH 3PHSA 4ZOCA 4AIZA 1I9IL 1KCSL 2M1KA 5BXFA 1R24A 5DVOA 2IPKB 5C0IB 2JB6A 3JWOC 1JHTA 3IDUA 3PL6A 1AHWA 1XF2A 5DJ0B 1JHKL 3PHOA 5GGQH 1IEBA 3DGGB 4MNQB 1C16B 3UO1H 4UIMA 1CLZL 3M1BA 2WK2A 3LVEA 4J1UA 1RZKC 4U0QB 3KXFD 4I3SH 4ZS6C 3LQAL 2A6IA 5K59F 4QTIH 4WI2A 1FN4A 2O61A 5D2LF 3KYMB 1CXKA 1KCUH 3L1OL 4GUPB 4MD0B 2X4QB 2HT3D 5I1DA 4OLUL 5EOCJ 4OGXL 4FFZL 1I8LC 2A77L 1KJVB 4MJIA 4XI5D 2Y06H 1C12A 4RMQA 5FDWB 4P59L 1FYTE 1HKLH 4PRHA 4RSVA 4TPRL 2PTTA 2CDGB 1BD2B 3MRHA 3LIZL 3R06A 1IEHA 3VD5A 3HUJA 3NOIA 2FJGA 3BWUC 5DD1L 2XWJB 4JDVA 3BP5A 3H7BB 4QOKD 5AYUL 2JCCB 4ZUTA 3FCTB 5D2NA 5C0JA 4IIQB 1IM3A 3FQRA 4XP4L 5BV7L 5C86A 5I2IB 4KWUA 5E1AA 2W59A 4YDJB 4BSWA 4YPJA 1UENA 2ZPKL 2OX5A 1VHPA 3CK0H 1S7XB 1F00I 2AEIT 3NFPA 3RVTC 1E4XH 1UXWB 2XKUA 4X6CB 1VPOH 4PP2B 4OF8A 4O51B 4YHLL 4K7FB 3W9EA 3TLRA 2BDNL 4GRWH 2VLKA 3LKRA 4OUOA 3ARGD 2Y4SA 4I9WD 5C0EB 3NCYP 5CJOL 1QHPA 1VEMA 3P4MB 1N6QH 1QKZH 4MAYD 4F2MA 4JRYA 4Z8FL 2V2TB 3OKKB 3Q6GL 5AG9A 1L7IL 3LPWA 3V4UL 1CBVH 1BQHA 4YHKH 4AEHH 2LV4A 3CFIC 3D0LB 4UNTA 3DUSB 5TE6H 5ACLA 4CJ1A 5IMKB 2R8SL 3UAJD 3IDIB 4MJ5A 4KMTH 1QSFD 3EO0A 3RBSA 3ALXA 3VFVB 1A2YB 1TVHB 5F1NB 2F5AL 3GMPB 4WUUE 1I3UA 3DX6B 4K8RD 2EH8L 5SX5K 2QSCL 3VFUB 5E5RB 1D5ZA 2MOVA 1GOHA 5F3HB 3VD7A 3HE7C 3DVNA 3T0EA 4P23C 1TLKA 1D5XB 2R56H 3QA3B 5E8EB 4Y89A 5DD5H 5FFLA 4YQXL 5ADPL 5T1KA 1EVTC 4N8VB 3S4SA 3QCUH 3RWCA 1HHGA 4OSUH 2DL9A 3TYGH 4LLDA 4JVUA 3ULVH 4P46B 3DIFB 1A6AA 3N9GH 3O3BA 4AMKH 2QHRH 4PV8A 1ZMYA 4FNLH 1W8NA 4MLIA 3S8WA 2OTWB 4JFEA 1JGLH 2D7TL 2NW3A 3LKOA 3PL6C 3IFLL 4POUB 4JY5L 2R23B 1CFNB 5GJSL 3OAZH 3LSOB 3G04B 5E8OA 3WNKA 4X6EA 4YZFE 2BNQB 3F7VA 1E27A 2GK0B 2WUCL 4J3UA 3L6FA 3IXAB 3WNMA 1HCFX 5FHBH 4I0PC 2V6HA 4D0CA 4CMMA 3KWWB 4PRID 3IJSA 3RZCC 3DXAA 1MHPH 4JFFD 4XBPB 4IJ3C 1KJMB 4I48A 1PFCA 4HIXL 4QRPE 1I9RH 1RI8A 3QQ3B 3KPSE 1D3CA 4FQPA 4CW1A 4H5SB 3NA9H 1S7RB 1I1RA 4HMEA 4HWEH 1RIVL 2X42A 4YXLL 1HEZA 5I66B 2YPKA 1I8KB 4NOFA 3BVNB 5BMFH 4R4ND 3RKDC 4G7VL 1FNAA 5DLMH 1NAKH 5J57B 3D18A 5E5MB 2XWBB 3BO8B 5IVZB 1JP5A 4TUOA 4QRSA 1CDIA 1DUZB 4YGAB 2F53A 2VR9A 1U9KA 4L1HA 5F9AC 5DC0A 1MJUH 3L7EA 4KPHL 3PE9A 5J11C 1NC4B 5IB2B 2HMIC 3G5ZA 2BVQA 4NN7B 5C7XH 2C3VA 3TJEH 3RY4A 2Y7QB 1MLCB 4Z5RA 3LN9A 4MA1B 3T3PE 5GS1C 2NY2C 5IMOB 3K46A 3NN8A 4M62H 2ICWB 4JANA 2VJXA 2BNUB 4PPTA 4OIBA 5IW3A 2Q8AH 2YD6A 1WWCA 5EZJA 4Y16B 2D31B 2LFGA 5F7FA 3MV7B 4PIRF 1A1NA 3IKKA 4WWKD 1P4LB 2DQFB 4MVBC 1SYSB 4NJAL 4DUWA 3PWVA 4BYHA 1WGOA 3V4VH 1PLGH 3NFSL 4M93C 4WFHD 5KVGL 4DUVA 5C8JB 2V7NA 3MFGB 1SEQH 5LAXA 2HTLD 4NT6B 3AREC 3MRGB 1DDHA 1S8DB 3BKYL 1H15B 1T5WB 2EE6A 3EYUH 4DOHB 3X3GL 4WGWB 1HOCA 2PCPA 2ZJSH 1KB5A 2MPAH 3QEUB 4LGRB 4ELMB 3EOYG 4HFWB 1F2QA 5IVXF 12E8L 1I4FB 1LK2A 3UBXA 4AK1A 2ZNWA 2DQUH 4FTVB 5GGTL 4S0SD 2P48B 5CUSL 3WN5A 3ORJA 3T3MF 5I0ZA 4EN3C 4M5ZH 2VXUH 2YK1H 4PJ8C 4S0TD 4PRDA 3RVXC 2GITA 4AH2B 1U6AH 4CADA 4R97B 5BQ7B 3FZUD 4BKLA 4HC1L 2P43B 1CDYA 1NUFA 2OTUA 15C8L 4HUMB 2AXFB 1TCRB 5F7HA 5C2UB 3MUJA 4QHNA 1A6ZA 5FKPB 4K9EC 2DJUA 3T1FB 4FFWD 5JMOC 5TQ0L 4DN4H 3H9SE 2W60A 1M6OA 2W0LA 5KSAB 1DUYA 5E1HB 4OLVL 3UMTA 2ZUUA 1JZ7A 3V6ZA 5CBAB 5CBEB 2CIKB 4PD4K 1IFHH 5KVDL 1HQ4A 5KSBF 2D03H 3C8KB 1EMTH 3A6OA 1J0KA 3IFNH 4KROC 1U8OB 4R3SA 1W72L 3QWRD 5D1ZA 4YBLB 4JLRA 1YPZF 3VFTB 1AI1H 4OFIA 2MJWA 3UJIH 1AGDB 1NGQL 1I3VA 3SJVE 1ZT4A 4Z7WE 2ICEB 3MV9B 1T1YA 3PNWB 1OGTB 2PR4H 5CLTA 2CRYA 2K3TA 2XN9B 1AD9B 4LMQE 4ACPA 4NQCE 3LKQB 1FVCA 4HG4J 2DTML 2G5RA 2Z93B 4ZSOE 2NXZC 5TF1H 2FHCA 4KRNA 2NY7L 4RFNC 5JIHA 3VFSB 4M02A 2G2RA 2FL5B 3BDXA 5D1QC 1FO0B 2GTWA 4JVWA 5HGDA 1DBJL 1ZLSL 1RJZA 1CF8L 1XGTB 3FQWA 3O8XB 4KZDH 3P73B 3RUGA 4AEIH 3MGTA 4WU5A 1CFTA 4NNXA 2QBWA 1B3JA 1LDPL 4L8BA 4IRJA 2UVFA 4PY8J 5KG9A 1F4WH 1A7NH 1ZT7A 1NANH 1I7ZB 4Q58C 3MV8A 1IGJA 4H88L 3BIKA 1S9VA 3T8XB 3BQUA 4OLWL 5F1IB 4X5XA 1A4KB 2DMKA 4KUCD 4PJCF 5FM5O 7FABH 3MRBB 2F58L 4K8RL 5DJCA 2ICES 4HHAA 4DVRL 5FOJA 4BQ8A 3JBG7 4C56B 5L0QC 5ID0B 4GT7A 3SKJH 1AXSA 2GHWB 4HKBB 2VITB 1IGIH 3HZKA 3VXPB 1XR8B 5BOPA 5L8JB 4RZCA 3VXQB 1P4IH 3S5LA 4QRRD 3O45B 4ZFOB 3CFEB 1AO7E 1P7KA 5TE7H 1YEIH 2AQ2A 4Z7OF 5TPWH 4QHLB 2GK2A 1XMWA 3WN5C 3ARDD 3GMMB 3HG1B 1CGSH 2B7DT 4RMUA 1CDCA 3QUYD 2E7BA 4I8DA 1GZQA 5F9WB 3MRPA 4UDUB 4F15C 4GW5A 2D2OA 3W5NA 2IQAA 1UZ6F 2IH3B 2WSKA 1AFVH 4ZNEA 3V5HA 5CWSB 1AGBA 3C6SA 1EEUA 1XIWD 2DICA 4XP6H 5KSVA 1P4BH 1SBSL 5I17B 4QXTB 2P24A 4WEUD 5GRVL 4CVXA 1DCLA 4U1HB 3MRQA 1HYRC 1TXKA 4HIIA 2PO6D 2XRAL 3TZVD 2F15A 4GQPH 1VGEL 1V3KA 2VERN 3QQ4B 3QUZB 3IDXL 3QZWB 4HF5L 1PQZB 4J3VA 5HSFA 4G9FE 4PJGB 4JHZA 3QPQC 4K7PY 4U1NA 5AAMA 2C3XA 1RUQL 4Y4FC 1O0VA 1T0MA 4G80A 5INDA 5E08L 3BRGC 5EOCH 1MREH 3T0DA 2VLRA 3HR6A 1X7QA 2X4NA 2VQTA 4P5MA 1S7VB 2A1WL 2DLEA 1UACH 2Q86B 4FXGB 4Z76B 3QEQB 4OFYD 2VDMH 4ZDHA 4EDWL 4UV4H 4YHYC 4MNQE 5BXFB 1KB5H 2W9EH 2Q3ZA 2JB6B 4AT6B 1MJJA 1JHTB 2EXWD 5CILH 3C09C 3PL6B 5GSVA 1YQVH 4NZDA 3SDCC 2MFNA 1FPTH 2BHUA 2Z91A 1XF2B 3ISWA 2EDYA 1IEBB 5FGSA 5LBSH 3UTSD 5HI5C 1KN4L 3ARQA 2Q8BL 4MB4A 2VE6A 4UIMB 1RIHL 5C3LD 5H37H 2ZP0T 4J1UB 3TT1L 1NBVH