2PW1B

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide eldkwnsl
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
232
structure length
221
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSQTYTCNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 2F5 Fab fragment heavy chain
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications.
pubmed doi rcsb
total genus 37
structure length 221
sequence length 232
ec nomenclature
pdb deposition date 2007-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2pw1B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2pw1B01
5C8JA 4WFEE 1U91B 4YHYC 2VAJA 3T08A 1LO5A 4JM2F 15C8H 5J4MA 4M6OL 4JZNA 4TVPD 1IEBB 1U91A 2R0KL 4Y16B 3WIHL 3QCVH 4M48L 4YDIL 3FB8B 1IEBA 2CUIA 4ETYA 1KCSH 4Y16A 5E7FA 4XVUC 3EOTH 2ZSVA 3BQUC 1P4IH 3WXWL 1CK0H 3FB8A 1I1YB 5DVOA 4M62H 3ARUA 4TTGA 1HI6B 4HLZH 4MAUL 1I1YA 5JXAH 3FOLB 1KIQB 1HI6A 4R90L 3SDCB 3ABZA 1HHGB 1NAKL 4ZS7L 4GLRH 5GS0D 1NUFA 1ZTXL 3FOLA 1FE8H 4UT9L 3HRZB 3SDCA 2V5RA 4NZUL 4WEBL 4KK6C 1LO3L 4FTVD 3T0EB 2EIBA 3K8LA 3HRZA 1CQKA 2ARJQ 4X5WB 3TBYB 1PD6A 3T0EA 3LQMA 2ESVB 4X5WA 3TBYA 3QPXL 4Y1AB 1PJ9A 2EZ0D 3O0RH 2R8SL 3KJ6H 1E4KC 4P4RB 1Q0XL 2ESVA 2GEEA 2XRAL 3GBMH 2R0ZL 3N06B 4Y1AA 1ZLUK 4O2EB 4FABL 1UB5B 1ZANH 1EJOH 3X13B 3TYGL 2OBGA 4P4RA 1JHKL 1A3QA 4O2EA 3O6ML 1E6JH 1UB5A 2HTKC 4WTZA 5IR1B 3X13A 3NA4A 1Q8MA 5KVEH 4JKMA 4NDMA 5DJXB 4JFPA 1CDJA 4K3HA 2L4OA 2MJWA 5KVGH 1UJ3C 1F6AB 4F33A 1PG7X 1QPXA 2HFEA 5DVKA 5IR1A 4PFEA 2EDBA 4JM4H 4XAKE 5DJXA 3S3PA 1F6AA 5TF1H 2YOCA 4K9EC 1WIPA 5JOFB 1D6VL 1JGUH 4HBCL 2EYRB 2OZ4A 4HIJB 4JQXA 5J11B 5I30L 5JOFA 1REIA 2EYRA 1UENA 4KROC 4HIJA 4EEEA 4U31A 2R69H 1HIML 4PJ7F 4S1DD 2Q8BL 3DO3A 4RNRB 4WI6A 4HF5H 2FEDC 2OJZL 4X7TB 1AJ7L 1MFCL 4OZ4A 1IL1A 4RNRA 4JJ5B 4Z7WB 3WJJA 3H42H 1TZIB 3O3AB 3E3QE 1RMFH 3OMZA 1F4XL 1NUNB 1E4WL 3VI4E 3B2UC 1IKFH 3OAZH 4JJ5A 4P2CG 4Z7WA 3LVEA 1TZIA 3HRPA 1U92B 3O3AA 1WEJH 1DQJA 4KZDL 4QOKE 1EO7A 5DQJB 4Y4KB 1UWEL 3F65A 2NXYC 2EIEA 5DQJA 3RWFB 1TZGH 2V5YA 4Y4KA 3TVMD 5DFWH 4KC3B 3GBNL 5HGBA 3WS6A 4IMKC 3RWFA 3HUJB 3QR2A 1FDLL 5F7MC 4ZFZB 3I6GA 3CZJA 4HPOL 4TYUA 4WGWB 1MRFH 1J1XL 3DUSB 5T3XE 3HUJA 4LSRL 4ZFZA 4LLAA 4WTZG 3DIFB 5I71C 4JPKL 2BSRB 3ARED 4PBVC 1FNEB 2AQ3A 1R24A 3A67H 4PG9B 3KWWB 3QI9C 4LVHB 2R0WL 3RVTD 1J7VR 4F37K 4RX4A 2BSRA 4JO3L 4PP1D 1FNEA 4PG9A 1Z9OA 3KWWA 4PR5B 5C08D 4HIHB 1OT1A 3GSNH 4WFFD 3FQXB 5F89A 3CVIH 4HBQA 3QG7L 2FJGB 4QY8A 4PR5A 4HIHA 4P57B 5LXGL 1HSBB 3FQXA 4R26H 1PEZA 2J6EH 2VR9A 1QFHA 2APWA 5DK0B 2AXGA 1AQDB 4LHUD 4P57A 1HSBA 4UU9B 4NNYB 4P4KC 1AQDA 4NM4H 4EI5C 2W9EH 3U7AA 1A6ZB 1AP2B 4JR9H 5MP6L 1LP9B 2BNUB 4K7PX 2GYSA 4NNYA 1OAKL 4ZNEE 4NFBA 1YQ2A 3QG6B 3WLWC 1S8DA 3TO4D 1A6ZA 1AP2A 4MB3A 3NPSB 1AO7B 1LP9A 2BNUA 1ZHLA 2AI0H 2NY5C 4QRRE 5HHOD 3T04D 5FO7B 4Z78B 1WISA 3QG6A 2QKIB 4NQDB 3FN3A 1AO7A 1M71A 5JA9A 4LVOC 3JV5A 3AS2A 5IBTL 2NY2B 5FO7A 4Z78A 4GMSL 2QKIA 1YECH 4NQDA 5LG1A 4HX1B 4KPHH 3PV6B 4ZAKC 5ETUB 1IQWL 1YEDB 5C0GB 5D1XC 1J0KA 3ZDZE 5DD0L 1NGQL 2DL9A 2DD8H 3OBAA 1A7NL 4HX1A 3DYPA 5DC4B 5ETUA 1XGQB 2VXUL 1YEDA 5C0GA 3NFSH 4NBYB 4JGUA 2K7PA 3IYLW 3O6LH 1U58A 4M8VA 4N0FB 5F44A 1XGQA 1PG7W 5DVLA 1F13A 3EAKA 1KCVH 1H3PH 4Y16D 5H35B 5K59E 4N0FA 4AJ0A 4YLQT 1OD9A 5EIQA 1RZ8B 5I1KL 5H35A 5CEZE 5IJKA 4QHUB 3BZFB 4M6OH 2R0KH 3RGVC 1RZ8A 3WIHH 1KXTB 3TYFA 4G8FB 2HMIC 4M48H 5IEHB 4QHUA 3BZFA 4YDIH 3TWCL 3RWCB 2BJML 4BSJA 2C7UB 1UEMA 1CD0A 3T4AB 5IEHA 1EXUB 4Z7QE 4DEPB 3KYAA 3RWCA 3CH8A 4J1UB 1RPQA 4QXUL 3BZDA 3T4AA 4F80A 4PV8A 1EXUA 3MROA 3HNVL 3PP4H 1D6EB 4XPGL 3KPRA 4R90H 3T0ED 4RWHA 4CKVX 3I3BA 1NAKH 4ZS7H 1NBQA 5F9WB 1KUMA 1T21B 4HC1L 2WINB 3UC0L 1ZTXH 2QQQA 2C3GA 3KYKL 1D6EA 1JF6A 1BMGA 4ZO7A 4UT9H 5GGUB 1T21A 5F8RC 2ESVD 3IKCB 2WINA 4YHOL 4L3CB 4Y1AD 1LO3H 5LQBL 1RUQL 1EHXA 4QRQB 5CEYB 5GRVL 5GGUA 1S9KC 2A0LD 3IKCA 4L3CA 4RMSA 4GXUM 5E7BA 5FM5O 2AEQL 2WUBL 3GEWB 4KRMB 4J12A 4QRQA 4HKJB 3O4LA 5CEYA 3QPXH 4S1RL 3ZO0A 3S37L 2R8SH 3DSFH 1TJIL 5TFSH 1KJ3L 3EYOB 4HKJA 1Q0XH 2XRAH 2R0ZH 3W39B 4CVXB 2HKHL 4FABH 4X4MA 5GGTA 3KHOA 3X12B 3E0GA 3FO0L 2ADJB 3OKDB 3EYOA 1Y18B 1JHKH 1GGCH 3W39A 4CVXA 2FDBP 3O6MH 3X12A 3QXTA 3MRGB 2ADJA 3RBGA 4JHAL 1Y18A 3PWJB 2AJ3A 3V6FB 2XWTB 1QOKA 3HB3D 3RFZC 1LP9E 3MRGA 2BX5A 5ICZB 3PWJA 1N0XL 2XWTA 5GGSY 5HDLA 4JG1L 4U49A 4ESKA 3QNXB 1UACL 5ICZA 3CSYB 3D3VB 2ED7A 1JPST 4OLVL 2UWEE 1P7HL 3CSYA 3D3VA 5I30H 5D1ZC 3S3SA 3UTPD 2O5ZL 4R4FL 3STBA 3MV01 1HIMH 1DBKL 3IDXL 5EU5B 3REWB 3RNQB 4FZEL 4PJ7B 3DXAB 1WBZB 2YD8A 2Q8BH 4PJGF 3V5KB 1T80A 4FQ1L 3REWA 5EU5A 1AJ7H 3DXAA 1WBZA 4PJAA 4Y4KD 5C9JB 5ESQB 2QSCL 3D0VB 2E8ZA 2PW1B 3KYNB 1RK0B 2F19L 3V5KA 4DKDC 1IBGL 1F4XH 1E4WH 1HCFX 2R1XA 3G9VA 5C9JA 5ESQA 3D0VA 3NFNB 2PW1A 2ZWLT 1RK0A 3BP7B 3CFIC 4KZDH 1CD1A 4JO2L 2C1PB 3B43A 4JKPL 4EVNB 3NFNA 3I2CL 3QO1B 3BP7A 4F2MB 2QADC 4MJ6B 2C1PA 2Q8AL 1GSMA 1MCIA 1CICC 4EVNA 3C8HA 4MCZA 3MA7A 3QO1A 4F2MA 4Y4FC 3GBNH 4RX4D 2YBRB 4MJ6A 1C16B 2QBWA 4I4WA 4X0KA 4J3SA 2O61B 5BV7L 1KLUB 1FDLH 4RAVB 3SE4A 4HPOH 5C0AD 4ZFOB 2YBRA 3F12B 1C16A 1J1XH 2NW3B 2F58L 3VFSB 4BKLB 2O61A 4MSWB 5J12B 1KLUA 4RAVA 1A3RL 1XCTA 4JPKH 4ZFOA 1QUNA 3F12A 2NW3A 1IEAB 2WWMC 4BKLA 4MSWA 2R0WH 5LKNA 5MENB 5BO1L 4JO3H 5EBGA 1G7LA 1JV5B 1IEAA 3VFUB 3HE7C 5T1LB 3QG7H 3TNNB 1RD6A 1HE7A 1JV5A 2G75B 1F97A 5C2UB 4Y89A 1MHHA 5LXGH 3QDJB 3RX5A 4OZGB 4TN9A 1AGCB 1N2RB 2Z31A 4HLZG 5T1LA 1CDGA 3TNNA 2G75A 3GJFA 3QDJA 4OZGA 3BYTA 1AGCA 1MEXL 4NNXB 1N2RA 1AO7D 1A6WL 2P42B 1OSZB 2YD5A 1YC7A 4NQDD 4NNXA 1NGYB 4LASL 3SKUD 1OSZA 2NY0B 1OAKH 3P9LB 4YR6B 1KG0B 2NY2D 1MCEA 4TUKH 4X6CF 5I74C 4GG6F 5DEFB 4D8PB 3P9LA 4YR6A 2VLRE 2IBZX 1T7VA 1KG0A 2C4FU 1RUAL 2NMSA 2FLBT 4QF1B 4MJIB 4XNYL 5DEFA 3UTTB 3PGCB 1HILB 4D8PA 5IBTH 3UPCA 5DZOA 5E2TL 4KKNA 4GMSH 5TPWL 4QF1A 2HT2D 4MJIA 2BK8A 1IQWH 3UTTA 3PGCA 1HILA 4R9HA 4JDZB 1JGVL 3W9EB 4YXLL 2AP2A 5DD0H 5DJ6B 2OI9B 1H3TA 1A7NH 2N4IA 2DB8A 3AROA 3W9EA 4JDZA 1K3IA 3MV7A 1I8KB 3MNVA 5DJ6A 4CDHA 3FJTA 5CP3H 5IMLB 3FQTB 5I15L 4FFZL 1I8KA 4RMWA 3HAEH 3GSNB 1DL7L 1DQDL 3PJSB 4NO5B 4PJ7E 2QHLA 5IMLA 3FQTA 2BMKB 2YD3A 1HYSD 4KDTC 5I1KH 3X14B 1T66C 3QAZB 3GSNA 5KANI 1CLCA 3ARVA 2UV3A 4NO5A 4DZ8B 2QV2A 3SGEI 2YA2A 3PHQB 4PJCB 4GS7B 1PVHA 4YIQB 3X14A 1AHWA 4KK5C 3KPRD 1YNLL 5B8CC 1X5AA 1G6RA 1J88A 1DVFB 2J6EA 4ZOEA 1V3MA 3TWCH 4JKKA 3D9AL 3PHQA 4PJCA 2BJMH 4YIQA 1OAYL 1DVFA 3QIWC 3B6SB 3VGHA 1KTKE 4HPYL 1TTFA 3O81A 3IXTA 3B6SA 1WICA 4TUJB 2P5WB 3HNVH 1O7VA 2I9LB 4KJQD 1N4XL 4XPGH 3BXNA 1BD2D 5J0BA 3RJQB 2Z8SA 4KQ3L 1WBXB 4HC1H 3O4LD 4TUJA 2P5WA 3UC0H 5LGHL 1AD0B 3KYKH 3EO9L 2ED9A 5D7LD 3WLBB 2BZDA 1QRND 4DWHA 4YHOH 1AD0A 5LQBH 4OLZL 1Q0YL 3WLBA 5HBBA 5JW3L 5ISZB 2R15A 3KPSB 5KSAA 4GRLB 1U93B 2AEQH 2WUBH 5MENE 3DGCR 5GRVK 4O2FB 5KS9F 5ISZA 4URTB 3T0BA 3KPSA 4S1RH 4GRLA 3S37H 3KPNB 1U93A 4JFQB 4YHKL 1MQKL 1T83C 1TZHB 1KJ3H 4O2FA 2WBJA 4QTHB 5HD8C 3V4VL 3A6OA 2HKHH 3KPNA 4XMLL 4JFQA 1MH5B 2X1PA 3FO0H 1F2XK 3FN9A 2HT4C 3U9PL 4QTHA 4X7EC 5JXEA 1MH5A 5E4EC 1RY7B 3T0VA 3D3VD 1T0MB 3FFDB 4Q6IC 4DVRL 2VUYA 4WRLA 3WIHA 1MAKA 4O02H 1PKOA 3MLVL 3MV9B 3B5GA 3BN9C 1T0MA 3W9DB 1N0XH 3FFDA 4NN5B 2D0FA 5EH1A 3C09C 5I1JL 1KEGL 3SDDA 3TH2T 4KXZH 4OIBA 2DYPD 4S1SL 3VMPA 3EDFA 5C07E 4XVJH 3QBTB 4OLVH 4WO4D 2EICA 4XTRD 4MJIE 4TNVK 3UTTE 3DXAD 3NCCB 2GK0B 2R4RL 4MQTB 2Z9TA 1D9KC 3U30C 2FHBA 3EW3B 2X6MA 1A4KB 2GK0A 1SVCP 1T1YB 4R4FH 1GHFL 3IDXH 1DBKH 4XP5L 5F1KC 4FZEH 5F21B 3IDNB 3TN0B 1A4KA 1M4KA 1T1YA 4P5TD 5I8EB 5C0JB 4FQ1H 3EDEA 3S97C 4P2RB 3TN0A 3IDNA 2QSCH 4YK4B 3VWJD 5I8EA 4HAGA 5GGQL 5C0JA 3C60C 1IBGH 4HGWA 5I6XC 4P2RA 1VKXA 4OGAC 2UVEA 1YMHB 2VITB 1VADB 4OF3A 3PV7A 3LRGA 1WWBX 4RISH 4YC2B 3T2PA 5D93C 4JO2H 4JKPH 1DFBH 1YMHA 3DX8B 3I2CH 4D2NA 1VADA 2WP3O 2NY3B 2L0DA 5EUOF 3MRHB 2PYFB 2Q8AH 1K4CB 3WO4B 4JRXD 3DX8A 2B2XL 4HMCA 4I0KA 4MAYC 2NXZC 3MRHA 2PYFA 1K4CA 4WHTA 1IKNA 4JN2B 4FQJL 1KIRB 3OJ2C 2F58H 5DQ9A 4FQXC 4TNVF 2P5WE 4YQXH 1A3RH 3Q2CA 5ERWB 3O2DL 1KIRA 2Z31D 5T1LD 1UM5H 1WQVT 5FGSA 3LQZB 2IANB 3QDJD 5ERWA 5MERB 1M6OB 5BO1H 5CGMA 5GRUH 5F96L 2X4NB 2B8OT 1RSFA 2P45B 3LQZA 4LEOA 1NEZB 2IANA 5MERA 4JAMB 1JZ3A 1M6OA 5SWZB 5J13C 2X4NA 3SO5A 1F4YL 4HZLB 5C3TA 1BQUA 3KPSE 1NEZA 2W38A 1SHMA 1JWMA 1XT5A 3DMMD 4Z0BL 5SWZA 4NO0A 5J6GB 1L7TL 1QD0A 4HZLA 3HA0A 3QFJB 1FFOB 4G6AC 1MEXH 1RZKC 5HYEA 5DURD 1A6WH 3NCYP 2OR9L 5J6GA 3FFCE 3U1SL 1JBJA 4B0MM 3QFJA 3WFEL 2GHWB 1FFOA 1QTYT 4FRWA 5F1IB 5K9JL 4HS3A 3ET9F 3BUTA 1EGJL 2JJTA 1OP3K 4BSWB 5F1IA 5BS0B 4GG6B 4R2GB 3DUUB 1D7FA 3N9GL 1JP5A 1K5NB 1MCKA 4LOUC 3MV7D 5FDWB 2Y4SA 4HK0B 4BSWA 5BS0A 3DUUA 1IAIH 1K5NA 3MV9E 5E2TH 3BRGC 3MCKB 4DOHE 3B9VA 5FDWA 1TCRB 4HK0A 3VD7A 5FCUL 3H8NA 3RNKB 3RY6C 4YXLH 1W0WB 3G9AB 2WQRA 3QIBB 1X3DA 3MCKA 2VZOA 3WMSA 1TCRA 4JGMA 3SE8L 3ISWA 3LKOB 4YEEA 5GJSL 3RNKA 2VOTA 3QZWA 5F6HJ 3RUGF 1W0WA 3QIBA 3L95B 3W0WB 3LKOA 1IM9B 5I15H 4WI3A 2VDRL 4E9LA 1JHLL 4FFZH 4P9HH 3K80A 3L95A 3CMGA 3MRKB 1DL7H 4KMQA 2W07A 3W0WA 2GTWB 1IM9A 4OUOA 4FXGB 4IIQC 1QRKA 3MRKA 4X83A 2NR6C 3ILQC 1DBAH 4P2RE 2GTWA 4JDVB 2CO7B 5TDPB 4FXGA 2HRPL 2A6KB 4Y5VC 1YNLH 1EV2E 3IFNL 4JDVA 5EU7E 1TNNA 5TDPA 5LVEA 4AQOA 1OAYH 1RFDH 2A6KA 3LRHA 5F7KC 4PJXB 2Z4QB 3NTCL 5L6YL 4F9LA 1KTDB 3MRQB 4HPYH 1NEZG 4PJDB 1NKRA 4Q9CA 1UGNA 2ZUTA 1M05B 4MQSB 3VFTB 1GVIA 4PJXA 2Z4QA 5C0BB 5MEQA 1KTDA 1VACB 1S7XB 3MRQA 4PJDA 5KSAD 3VFTA 1U8QB 4JPIA 4KQ3H 5C0BA 3TA3C 3O45B 2CO6B 1IC7L 3K4AA 1VACA 1S7XA 5ISZD 4GRLD 1U8QA 2F8OA 3EO9H 5DD5L 3FO9B 4Z77A 1NBVL 2H2SC 4UV7L 2WBJD 1WJ3A 3MUHL 1MHPL 1WZMA 5HVHC 4PJ9C 1NMCC 4LCUB 4OLZH 2X4SB 1U95B 1Q0YH 5JW3H 3ULVH 2HH0L 3LIZL 3UYOD 2CD0A 2R2EB 4ZSOE 1IRAY 5F7DB 5JXED 2DQHH 3E8UL 5I16B 4KGLA 4LCUA 3DVNA 2X4SA 4KTYA 3SGJA 4N5UA 3FTGA 2R2EA 2ZOLB 5F7DA 5KS9B 5C0NC 3T3PF 5EZOL 3VGDA 3I84A 5I16A 1CDYA 1NCCL 3GK8H 1OWWA 3HAEB 4YHKH 5DJ2B 1MQKH 3NZ8B 4OAWA 1ERNA 5KZCD 5CP3A 3V4VH 4FXLA 1T89C 2ZOLA 3E3QC 5HHVL 4LPYA 5DJ2A 3ORJA 3LS5L 4IJ3C 3ROOB 3S96A 2KPNA 1JPFB 3NZ8A 3BZ4B 3ULUL 4U6YB 3U9PH 1YMME 3SDDD 4NSKB 5ENWB 1U0QA 3QQNA 1V05A 1MHEA 3ROOA 1FAKT 1GPOL 1JPFA 2D7PA 3CFBA 4U6YA 4JZJC 4NSKA 2YPLE 5ENWA 2XI9A 3B9DA 2Y9RT 1WCQA 2PXYB 4HG4J 3B8SA 4X6CE 5BS0E 4GG6E 5I1JH 4KK9D 1DQQB 3OB0H 4LU5H 2PXYA 2Y25A 5KBNC 1F58L 2J3SA 4S1SH 5HPOA 1OF2B 3D69B 3VWKC 2XTJB 5IM7B 1DQQA 1NFDB 3EO1B 1BOYA 2R4RH 1FNLA 2CDEB 3NGBB 2NNAB 1L0XA 1OF2A 3D69A 3TZVA 5IM7A 1NFDA 3EO1A 4HC1A 2Y1VA 2CDEA 4XP5H 1C8PA 4LLYB 4CU7A 3GSUA 1E4XL 1U8MB 2ZG3A 3RVXC 1FVDB 1N6QL 5EOCL 2GFBB 4LLYA 4XX1E 3VXTA 4EDWL 3O3DB 1U8MA 5D7IF 1BEYL 2NY3D 4KKLD 5GGQH 4UNVA 2GFBA 3I6LD 5EN2B 5HI5D 1I9IL 1OP5H 3ZE0E 4DUXA 5L2KD 4UTBL 2F9BT 2VTFA 3ARDC 3RVWD 4U6VL 4M7JL 5EN2A 1OP5K 3CDGB 2CR6A 3NAAL 4XI5D 3OKYA 3VGFA 2B2XH 1HNFA 4OCRL 4RWYL 3IS1X 1FLRL 3CDGA 4PJXE 3P2TA 4L8BB 5ID1A 4QEGA 1YEEL 4ZOCA 3HAEG 2IAND 4M02A 2WK2A 1C7SA 4TULL 4L8BA 1U41A 5EZIL 1GOFA 4ELMF 4HS8L 2XA8L 2BXZA 1MLCA 3O2DH 5SWZD 4NO0D 4L3AA 5HHNB 2R2BB 5EU4B 1DCLA 3DVFA 3INUL 5F96H 5CLTA 3QFJD 3F6LA 4YDKL 3HNTL 1XCQB 4EUPH 5HHNA 2R2BA 5EU4A 4O51B 3HPJB 5BCAA 3G5ZA 1F4YH 3ARZA 4M5YL 3PF2A 2YWYA 4X6FB 2D03L 3NBNA 1XCQA 4O51A 3HPJA 4Z0BH 4IRJC 1XGTB 5CD5C 1L7TH 2ID5A 3U9UB 4X6FA 5KS9E 3WHXB 1JK8B 2OR9H 1UM4L 4UIKL 1XGTA 3MOQA 3U1SH 3U9UA 3QEQB 4LK4A 3WHXA 4K9EL 1JK8A 1FC2D 4KDVA 3WFEH 2YXMA 5ILTL 5A2FA 5CSBA 5AD0A 3CU7A 2BOCB 3O2WL 3FB7B 4Z8FL 2PN5A 3N9GH 1TLKA 1UKSA 3QIBD 4QHKJ 2BOCA 3CCHB 3GSQA 2E5EA 4ONFL 1MFBL 2YZ8A 3QUYB 5HTSA 2OTUA 3SCMB 5C0RL 4DK3A 3W0WD 3C9NA 5FCUH 1CBVL 1IM9D 3NZHL 4U1KB 1KB9K 3SCMA 2QHRL 5DZNA 1BAFL 1JNLL 3SE8H 2XTJE 5GJSH 5L0QB 1NFDE 5A2LH 1ZT1B 1URLA 4MMZC 1P6AB 4LVHC 1TQCC 4OCXL 2VDRH 2YSSB 4M5ZL 5FGCE 3QCUL 3GBLA 1DSFL 5DEGB 3AVEA 1RULL 5BVPL 2YSSA 1E28B 3DRTB 1LQSR 1G9NH 5DC9B 5DEGA 2HJKB 3WNOA 1I8MB 1E28A 2P48B 4LPXA 3JWNC 3FQWB 1SYSA 2JCCB 2DL2A 5H94B 2HRPH 3DRTA 3R06B 1MNUL 3IFNH 3VFGL 5FEBA 5D72H 5C0BD 2YR3A 4G8GE 2HJKA 3VMNA 1JWSB 1I8MA 3FQWA 5H94A 2JCCA 4PJIF 3R06A 2FGZA 3O9WB 5L6YH 3WJLA 4YAQA 3TIDB 3QIUB 2YHGA 3BESR 5JHDB 3O9WA 1QFWH 5EUOE 3TIDA 1SEBB 3QIUA 4Y4HC 5JHDA 4LSQL 3HTLX 5IQ7L 3QNZB 3AGVA 1KJMB 3BSZL 3LN4A 3FT3B 2DQUL 5DD5H 1CVSC 5F8QC 2LE9A 5JW4M 1NBVH 4UV7H 4PV9B 2AW2A 1EO8L 4WFHD 2XZCH 1MHPH 2X1XR 2APBA 3FT3A 2FX7L 4X8XA 3TO2B 2HH0H 3NCEB 3LIZH 1XH3B 4PV9A 2R1YA 4IOFD 3HNSL 5DD3L 3SGDI 1HHJB 2FBJL 3BIBX 5K9KB 3TO2A 3RTQC 5LBSL 1W0VB 3SQBA 5EZOH 4OCLC 4MJ4A 1NCCH 3VRLF 1HHJA 1LEIB 2JKXA 2GJJA 5K9KA 1AGFB 4U1IB 2E9WA 4P5KB 1QO3B 4KWUA 4OGXL 1W0VA 5ABDE 4NCDA 5HHVH 3JUYA 3T1WA 3LS5H 5T3ZL 1LEIA 3ULUH 1AGFA 2ZKHL 4P5KA 1QO3A 2AK4D 2PXYD 2AVGA 2RGSA 1UKQA 4YUEL 1DQMH 1JRHI 4JM2C 4X99B 3SDXF 1V8HA 5JPMB 2BVEA 3QEQE 5DA4A 4OIAA 3B9KC 3UMTA 1GGBH 2ITDB 4JFDB 4IDJL 2VDLL 3TZVD 3KYOB 5JPMA 1RIUH 5TDNA 5IG7A 3MGAA 1SVZA 2ITDA 4JFDA 4DGVH 4R8WH 3KYOA 2NYYC 4ENED 1F58H 1EA9C 2VAAB 3SJVB 3BGMB 5D71L 3FZUC 2F54B 2MOVA 4MQXC 3G6JF 2MHAB 3S6CA 5GS2D 1CQYA 5C71A 4ZXBC 3MRNA 4HJ0D 4YBQD 3SJVA 3BGMA 3UROR 2F54A 4UDTB 5IHZB 2MHAA 4N0RA 2Y6SC 1NGPL 5F7WC 1OY3B 2ZUWA 4JREB 1P4BL 1OT2A 4M6AA 4UDTA 5IHZA 1MCJA 2VZTA 2X05A 4PLOB 3BI9X 1N6QH 3RUGE 5EOCH 1NCNA 1QFPA 4EDWH 1GOGA 1BEYH 2LAAA 1Y0LB 5D7IB 1NL0L 1KPUB 4LLUB 3VG0L 1T03L 4U1JB 1CF8L 4QRTB 5FOJA 3UTOA 3RZCC 1BFOB 2PYEB 1XFPA 4NP4H 1S9YB 1Y0LA 5ADOL 1I9IH 4LLUA 3R0NA 4UTBH 4QRTA 4LCCC 2X70B 5D9SB 1BFOA 5IKCB 2PYEA 5E2VH 1HEZB 1S9YA 4M7JH 4U6VH 4WW1B 2H32H 1QBML 4ZO9A 3NAAH 5D9SA 2AXJA 3GFUA 1HEZA 4WW1A 2B1HL 1Q94A 3K2UL 4OCRH 3L1OL 2D2OA 3VXUB 3BOVA 4PJHF 3FT2B 1YEEH 4UNTA 5JMOC 4OF5A 5J7CC 3VXUA 1BZQK 3PGFL 4MNQA 1ETZB 1UQSA 5JHDE 2NCMA 4TULH 3FT2A 5EZIH 1S5HB 4XMPL 4HS8H 3H9HB 1QQDB 4GLRI 1H5BB 1ETZA 3ALWA 1MVUB 1S5HA 3H9HA 1QQDA 1H5BA 3K1KC 3INUH 5TH2B 2E7LA 1MCBA 1MVUA 1YY9D 3MRBB 5CBAB 3MBED 1I1AB 3VD4A 3LB6C 4YDKH 5E2JA 4HSQA 3G6DL 3W11C 3MLZL 1FSKB 4L1HA 4M5YH 3LCYA 1TENA 2D03H 3MRBA 3MX0A 1I1AA 3V9FA 3VE0B 5CBAA 5DJDA 4LQFL 1ZLVK 5EA0L 2Q76B 2Y7QB 1OGTB 4NWTH 5FGBA 4OV5B 2KBGA 3BT2L 1H3VA 3VE0A 2LTQC 4I9WD 3T3PE 1IGML 2Q76A 2Y7QA 1OGTA 3WYRA 1UM4H 1NMAL 4UIKH 4Z76B 4OV5A 1T04A 1XF2B 4APQC 2ZUSA 4K9EH 2EXYC 4N8PA 4G6FD 5ILTH 3FN0L 4TQEL 1XF2A 5MHSD 1JL8A 3O2WH 1BIHA 4BA8A 4IOSD 5D7KD 1HCVA 4Z8FH 1YDPB 2YN5A 3G6AB 3VRIA 2QEJA 1UZ8B 2OMBA 2YUWA 4BQBA 4YFLI 1YDPA 3G6AA 4ONFH 3T3ME 1UZ8A 2ZNWA 4HIXL 4U0RC 3EJYC 1KLGB 4Y8AA 1QVOB 3NZHH 3VFVB 2P24B 2QHRH 3WNMA 1BAFH 3QHZL 1JNLH 5CJQH 5D96B 2F54E 2O5XL 1KLGA 1QVOA 3VFVA 5L88L 2Q6WB 3U83A 2P24A 4MS8C 4L5FH 4F8QA 3O2DA 35C8H 1BJMA 4JPVH 2Q6WA 4M5ZH 3QCUH 1J0YA 1DSFH 3PL6B 3EZ8A 1RULH 4EUPB 2VLJA 2MSPA 4FN0A 1S9WA 2B5IC 5A2IH 5I8CB 2DLFL 4U05A 3PL6A 4EUPA 3P11L 1MI5E 2G60L 2XZQL 5D7IE 5I8CA 3QIUD 1MNUH 3VFGH 2P46B 3VDBA 2ADIB 2NTSP 1BZ7B 1ZLSL 2DICA 4V1DE 3ROLB 4L8SB 5EORH 2Y06H 5T33L 3QUXB 5KG9A 4DQOL 2ADIA 4ISVA 3P0VL 1BZ7A 1EIBA 4DKAA 1DN2A 4L8SA 1PZUB 4XXCC 1BVKB 2SEBB 5E6YA 5GZOD 4MJ2A 2WNGA 3B9AA 3QUXA 2NZ9D 4BQ8A 1FPTL 3WXVL 1BVKA 1XR8B 1AGEB 2JB6B 4LSQH 5IQ7H 2NY1D 1SYVB 4IHOB 4FFYL 2OYPA 3TFKD 1XR8A 1AGEA 3B2VL 4JO4L 4PRPD 4XCYB 5B3NA 2DQUH 5I9QC 2RAMA 2G5RA 2JB6A 5E0QA 3RKDD 1SYVA 1ZOXA 5JDJA 1EO8H 5I66B 1IVLA 4IHOA 1NGWB 1YEGH 4XCYA 5H37H 4ELME 3S4SB 5TE4L 4O4YL 2FX7H 5IW1B 2A77L 5I66A 4QGTA 1NGWA 1VENA 5EULV 3HNSH 3SDAC 4PGCB 5DD3H 2EYTB 3S4SA 5BXFB 4RBPK 2FBJH 5IW1A 1OHQA 2J7LA 5LBSH 3VW3H 4PGCA 2EYTA 5BXFA 4FZ8L 4KK8C 2PF6A 4GBXA 4KUCF 2ZUXA 4KKCD 4JFDD 4LIQE 1RJZA 4ONOA 2IAMB 4YUEH 2ENYA 2PO6A 1JWUB 5HGHB 1J0ZA 1ZHBB 1FHGA 4GS7C 2RFXB 4NYLB 1INDL 1BX2B 3SJVD 1JWUA 2BFVL 4IDJH 1ZHBA 2VDLH 5FUZL 1KBGL 2RFXA 4NYLA 3D1MC 3OZ9L 1BX2A 2XKNB 2Z35B 4HXBL 4RZCA 4EUPG 4YDJB 3QWRA 4S0TD 4WEUD 3CFCL 3QHFH 5GJTL 3HC0A 2N56A 4PBXA 5DQDL 2XKNA 2Z35A 3IDIB 3LPWA 4IRZL 4YDJA 5F6IB 1MHCB 4S0SD 4AQ1B 1GGYA 4M6ML 3ULVD 2ITCB 3IDIA 4D9QD 5ITFB 4JO1L 1MHCA 2EH7L 2F74A 4GQ9L 4PB0L 1NGPH 1UA6L 3C5ZB 1P4BH 1J1OH 2ITCA 4DFIA 5INCB 5ITFA 1RIVL 2PYED 1PKQB 1UWGL 3BHBB 3C5ZA 2UY7A 3ARFD 4NC0B 1A6UL 5DS8B 3BHBA 3MLUL 4Z6AT 1B88A 1NL0H 3VG0H 1T03H 1UKTA 1V7NL 4LPWA 1AKJB 3E6FA 5GISL 5ADOH 3EYVB 3OX8B 3VXUD 4U1GB 2EYSB 4MNQD 3L6FB 2DI9A 1RHFA 2J8UB 2J4WL 1AKJA 4ODTL 3S4SG 3EYVA 3OX8A 1QBMH 2EYSA 3L6FA 5FA4B 2J8UA 4HEME 2YWZA 3L1OH 4RSVA 4UINL 5IESH 5F7YC 5FA4A 2LV4A 4OCWL 4U6HB 3WFZA 2ZJSL 4FHBD 2JJSC 3PGFH 2VL5B 3RWGB 1CDBA 1SEQL 4KAQL 3DJ9A 2WQ8A 4RAUB 4N1HB 4U6HA 1I1AD 2D7TL 4RA0C 2VL5A 3ARBB 3RWGA 4FP8L 4RAUA 4P48A 1RHHB 4MDIB 3PWNB 3P30L 1S7UB 4OQ1A 3FMGH 1NUDA 4JFZL 1RHHA 4MDIA 3PWNA 5IB5B 4YHYB 5GRJL 1FZMB 4LCIL 3WSQL 1PLGH 1XF4B 1S7UA 3G6DH 1VGKB 3MLZH 4ORGB 5I75C 4PJEF 3RL2B 5IB5A 1YEKL 1FIGL 1XF4A 4P9ML 5EA0H 3GRWA 4FQLL 4ORGA 1HQ4B 3KPLB 3RL2A 3EYQC 3ZKNC 3H9SA 1IGMH 4YPJA 4RGMC 2C26A 4G5ZL 1NMAH 3KPLA 3VRLE 1ZGLA 2QSTA 1F90L 4NC2B 5J56B 3MRFB 3BQUA 5IJVA 5EU7C 2IQ9L 2BCKB 3FN0H 1FFRA 4TQEH 1CTOA 4YHPB 1WFTA 4NNPL 4X9IA 2H32B 3MRFA 1EHNA 4PJBF 4YHPA 2QSVA 4LSUL 3MODL 2H32A 2WLYA 5E2UL 2VH5H 5SX5H 4LEXL 4FQQB 4XZUB 2IPKB 5DC0A 3D48R 4HIXH 2A6DB 2NZIA 3VGBA 2VLJD 5TE7H 3CXHK 2VDOL 2C4FT 4FQQA 4XZUA 2GCYB 4ZO6A 2ZUQC 5MEPB 3QHZH 2A6DA 1CLZH 3BAEL 3RX8A 4Q97A 2O5XH 1JYXA 3DO7B 3G6JE 3U82B 5L88H 1ZA3B 1TIUA 2GCYA 1FRGL 5MEPA 1T2QL 3HC3L 3DO7A 4BZ2L 1C12B 2IPUK 4TUOB 3WFCL 2C3XA 4GAFB 5CBEB 1CXKA 4G6JH 2HLFD 2VYRE 4HK3J 1E4KA 3QPQD 1C12A 1PKQE 4TUOA 4NQCA 2N7BA 4L4VA 4LRNL 2WBKA 2FIKA 5CBEA 2DLFH 3QUXD 3N1QC 5HYQB 3MRPB 1VB9A 3P11H 1UYWL 4PYGA 2YUVA 3CX2A 2XZQH 3CK0L 3U7WH 1UJ3B 5FYJD 5I0ZA 4UBDD 2ZCLL 4GAJL 5HYQA 3MRPA 4DGYL 1ZLSH 4KKBD 1UJ3A 5T33H 1KGCD 5C0EA 4DQOH 3L9RB 5LWYL 3P0VH 3TCXA 2Z93B 4XHQA 1F4WL 4P3WA 4B50A 2H9GB 3VXMA 4L9DA 3L9RA 3D5OF 1RUML 1JZ4A 5CCKL 4GAGH 4R2GC 2H9GA 3UTSB 2FCBA 2OP4L 5DZLA 4PJHE 1CG9B 3RVVD 3B2VH 4JO4H 3QXAB 1CL7L 3UTSA 3MZGB 2HTLD 1CG9A 1I9RL 3HG1E 1G7JA 4GBXD 2H26B 3QXAA 3ZE2F 2XNAB 2VL4A 4O4YH 2AGJL 2IQAB 2CPCA 5DYOB 2H26A 2XNAA 2PO6D 4X6DB 4P3DB 2VLMD 4M1CC 1KV3A 5FUOL 1T3FB 2CRYA 2BNQD 4X6DA 1ZA6B 4FZ8H 2LVCA 25C8L 2EKSB 4H5SB 3IAGC 1T3FA 1ZA6A 3QDGE 3JTTB 2FEEL 3BE1L 4H5SA 3RP1A 1VDGA 5E9DB 2C3WA 3VI3F 1F3RB 1KXQE 4MJ5B 3JTTA 2DJ4A 1ROWA 1INDH 4XHJC 5E9DA 3DVGB 4GKOA 4IMKA 4MJ5A 5JLZB 5F1SA 4S1DC 5FUZH 4WUUB 4M7KL 4IEFB 5I71B 3OZ9H 3DVGA 4HXBH 1QLRB 3BPNC 3QI9B 4ODSL 3CFCH 4WUUA 5GJTH 4GAYA 4WI2A 4YHML 3C5ZD 5DQDH 3KPQB 4LPUA 3KPMB 4IRZH 5AZEL 1QLRA 4NQEB 4R4ND 3QI9A 5F97E 3ZSTA 4M6MH 4MA8H 3PWPA 1J87A 3KPQA 1I1CA 3K2MC 4JO1H 4NQEA 1NFKA 2EH7H 1S7WB 2AS5M 4GQ9H 4PB0H 1UA6H 3K8KA 1O7SA 3QDAA 1J12A 4PJFF 1L9NA 1CIDA 1S7WA 3RVUC 1UWGH 3EGSB 1QSFE 2ILLA 3TVMC 4BH7A 4ZFGL 1AGBA 3HHRB 4MNHB 4P4KB 3EGSA 4EI5B 2XTLA 1IFHL 3MLUH 4MD0B 5IVNA 1KT2A 2NLJB 4MNHA 1Y6NR 1DBMH 3PDDA 1V7NH 4P4KA 5CJ5A 3TF7C 4EI5A 2EDYA 1I3RB 4MD0A 4KRNA 5GISH 2APTA 4U0QB 4X7SL 1HYRC 5I1IL 4X8JB 3VH8B 1I3RA 3MLYL 2ADGB 4WI9A 3VD9A 4E5XB 2J88L 4LVOB 3PXJA 5HGDB 3VH8A 3IJHB 2ADGA 2J2ZA 4UINH 4XBGB 3MNWA 5DI8B 2YMXL 1N3NB 5HGDA 4OCWH 5D1XB 3IJHA 2ZJSH 1X5HA 4XBGA 1SEQH 4ZAKA 5DI8A 4R3SB 1N3NA 1GZPB 1KCUL 4PRDA 5D1XA 1CT8B 5ESAB 4K3EL 4FP8H 4KV5F 3LH2L 4R3SA 1GZPA 3SEPA 1CT8A 1MOEA 3P30H 5ESAA 4C59B 3H9SD 5F9OL 3VG9C 4JFZH 4NKQB 2EDHA 1Z9MA 5EU3B 5GRJH 4LCIH 3NGBC 3WSQH 3BQUD 3TO4C 3K46A 3RRQA 1AR1D 1F11A 1RJYB 3S37X 5EU3A 5MI0C 1Z3GL 3RGVB 1IC1A 1YEKH 3CFDB 4AIZB 4P9MH 3QDHA 2CUHA 4X6DE 2X4RA 1I7ZB 3MGOB 1RJYA 3RGVA 1A2YA 3VFOB 3LRSB 1OTUC 3CFDA 1MAJA 4EBQH 1A7BA 4G5ZH 2YEZA 3MGOA 4G9FB 1F90H 4HGKC 3VFOA 3LRSA 2WZPD 1UEYA 2IQ9H 1X5YA 4G9FA 4KK6D 4NNPH 2EXWC 4GSDL 4EXKA 4OV6F 3MFFA 5E9DE 5H37G 1UADC 3IF1A 5T1DL 1IAIM 5D70L 2A9NL 4AEEA 3C6LB 4JN1H 5JA8B 4Q74A 2EO1A 4LSUH 3MODH 5ELIA 5E2UH 4UQ3B 2Q20A 5CJ8A 1F3DH 4I0PC 4LEXH 5C70A 3NCBB 4Y5XB 1S9VB 5FAAA 3LKRA 4G8IB 3TLRA 4UQ3A 1LE5B 5IB4B 4JFFE 1WAAA 4KXZI 1T5WB 1S9VA 4NQCD 4L4VD 5KVFL 4PRHD 5HSFA 4G8IA 4JFEB 1LE5A 4QGYA 5IB4A 3BAEH 3CX5J 4NQEE 5HGGS 3VH8G 4WCYL 2X1WL 1D5XA 4HEPG 2HTKD 4JFEA 1T2QH 3HC3H 5I76B 3V5HB 3SE3C 3GSXB 3K1DA 4WY7L 3WFCH 4AT6B 5B39B 5IWLC 2XN9B 4NBXB 1XF5B 1NBZA 5I76A 4WNQB 3V5HA 3GSXA 3BH9B 4LRNH 4AT6A 1P6FA 4X5XB 5B39A 4TSAL 2XN9A 1XF5A 1KN4L 4ZD3L 1UXSB 3PP3K 3VXMD 4WNQA 3O3BB 1UYWH 4Z7VB 3BH9A 5IFHL 3CK0H 4YBLC 2XFXA 4PRBB 2PTTB 2ZCLH 2P5EB 4GAJH 3D0LB 3MV8B 5KOMC 1UXSA 3IDYC 3T8XB 5K9QG 1TJGL 4GW1B 4Z7VA 2X7LB 1MCDA 4YX2L 2KQMA 3ARGB 2X4OA 4PRBA 2PTTA 2P5EA 2GJ6B 3D0LA 3MV8A 5E8OB 3UTSD 4KROD 5LWYH 5H2BA 5T3ZE 4GW1A 2J12B 2X7LA 3ARGA 1F4WH 2UY6A 3TV3L 1A6AB 2GJ6A 4OLWL 4P2QB 1W72H 3C5JB 4XPHH 1V7ML 2RHEA 5D1ZB 1R5IB 3HLAB 1RUMH 2OS7A 5CSGA 2FEDD 2Z8RA 4OZFB 1LVEA 1A6AA 5CCKH 4P2QA 2OP4H 3C5JA 1EVUA 5D1ZA 4K3JL 2AEWA 1R5IA 3HLAA 5ALCL 4EQ3A 1NFIB 1WIUA 4MX7A 3O2VL 1CL7H 1PZ5B 3QUYC 3B2UD 1FZJB 3V79C 4PD4K 5D2NE 1I9RH 5BV7C 3WS3B 4G7VH 1NFIA 1HQRB 4W81A 2WBWB 4H20L 1PZ5A 5AAWA 1JGLL 1FZJA 3BUYB 4GXVH 4BJLA 2AGJH 3BO8B 4C54A 4LHQB 3U2SB 5CEZL 3WS3A 1QG3A 3THML 1HQRA 2NXYD 3HPLB 3VRJB 2F8XC 1S7RA 5L2JA 5L0QC 3DROB 3BUYA 3BO8A 1X5FA 5FUOH 3U2SA 1CGYA 4X80H 5FYLE 3FL7A 3HPLA 4PJ5D 3VRJA 3DROA 25C8H 1MUJA 3B3IB 5HYFA 1OAXL 1DQLL 4PJEE 3F7RA 4N1CA 1YYLL 4K07A 4OZIB 2IPTH 2V7NB 4WFGE 4P23C 5F88B 4WUUD 3BE1H 3B3IA 4F7CB 4Y4FB 1NUGA 2GSGB 1AXTL 4OZIA 2V7NA 1CICA 1P7KB 5H8DA 1SY6L 4F7CA 4Y4FA 3PWPD 3WIFB 2GSGA 3UJIH 5JIHA 2R1WB 2I60L 4YHNB 1P7KA 5B39G 4M7KH 3TJHC 4OKDA 1C08B 1L6ZA 4UILL 3VFRB 3VFWB 2O5YL 1BBJB 4YHNA 2NY6C 4DGIL 2CK2A 4OCYL 4YHMH 1CGUA 4NJ9L 3MSPA 4GQPH 2FECL 5AZEH 2ERJC 3UBXB 1BBJA 2M26A 1IAOB 2OMNA 3P4MB 3HE7B 4H0GA 3UBXA 4UIMB 3AMLA 4FG6C 3QEUB 1IAOA 4YWGL 3MLPA 3P4MA 3HE7A 5ESVB 5I1GH 4UIMA 4PJFB 3QEUA 3WNLA 1NDMB 3WLWD 1J05B 2YKLL 4ZFGH 5ESVA 1EBAA 1YPZF 4U7SA 4CRPA 5HI4C 1XGRA 1IFHH 1J05A 1FP5A 3PG2A 1MREL 3PDOB 2R0LL 4HUWB 4X9HA 2AV1B 5KSBF 3EO0B 5I74B 3G5XA 3OKOB 3PDOA 1A21A 4ZAKD 5EOTB 3MOBH 5I1IH 2A83B 2AV1A 5D1XD 3MLYH 5CIPH 3EO0A 2P5EE 4K94L 5FYKL 5AWNL 5EOTA 4NN6B 3U0TA 4OZHA 1IJ9A 2EC9U 2IPUG 5AYUL 4I18C 3BDBA 1QP1A 2ZCHL 2ZOKB 1MCWM 3IAQA 4NZTL 3NA9H 4FQ2H 2YMXH 5FIEA 5E08H 4NT6B 2BERA 5I1AB 4PRAB 3K4ZA 4P2QE 3OKKB 5EO1B 4TTDC 5J1AA 3NACL 1KCUH 2RR3A 1ZEAH 3RU8H 4NT6A 5I1AA 3LZFL 4K3EH 1W2KT 3BKJL 4PRAA 3LH2H 3OKKA 4NCC1 5E5MB 4LRIC 4WI7A 3KNBB 2ICES 3NOIA 3HMXH 3MLSL 1ORSB 1A6TB 1QFUL 4KJPC 5F9OH 2HMID 3GUTB 5E5MA 1LMKA 1D5ZB 3KNBA 2DN7A 1B0GB 1ORSA 4JFOB 1NQBA 1HN1A 1JYWA 3GUTA 2W9DL 1FYTB 1D5ZA 4G9FD 1Z3GH 4KDTA 1T1WB 4F7TB 1MJ7L 4JFOA 5B8CB 4LF3A 3MPCA 1F3DJ 1FYTA 4P99A 1YEHL 1A7PL 1CD8A 1T1WA 4F7TA 3GI9L 3UBXG 5B8CA 4C56E 1LK2B 1D5BB 3AXLB 5EBMB 3QIWB 2EDXA 5ALBL 4HMDA 1LK2A 3AXLA 5EBMA 3QIWA 4X4YB 4H25A 2FBOJ 4XCCL 1Q1JH 5T3XH 1YNKL 1N64L 4BQCA 1U9KA 5T1DH 4PLKC 3F8UB 4NPYB 3VI3E 1AE6L 4X4YA 5D70H 2A9NH 3UDWC 2CR3A 1EUTA 2NY4C 4P46D 4JFED 1IE5A 3BGFC 4NPYA 1B2WH 3O4OC 5L8LB 3E2HB 3MNZB 5E5RB 1WF5A 2HFTA 4EOWL 4GKZA 2AJVL 4C57C 1I9EA 3TP4A 2OM5A 3MNZA 1NPUA 5HDQH 3B4NA 3W2DL 3VU2A 1NH6A 3JUZA 1DLHB 3QDMB 4I8DA 2XN9D 3TIEB 4AG4L 2FR4B 1WCBA 4WCYH 1CFVL 5GGSB 3QDMA 1U3HC 3TIEA 2DIAA 3BKYL 5SWSE 5JTWA 2FR4A 1LO0L 3AAZB 4WY7H 5INDA 5GGSA 1T83A 3MV8D 4PJFE 2XA3A 4DKEL 1WFNA 4JGJA 2ADFL 4IBLT 3PXHA 1RI8A 3TJEL 2GJ6D 3OKEB 1MRCL 4HUUB 3NFPB 3SDYL 3VGEA 4Q6IB 5IW6B 2V9TA 1RUKL 4YDVB 3OKEA 4HUUA 1TJGH 1BBDH 1WC7A 4YX2H 4Q6IA 4OQTL 3L7FA 4YDVA 3LV3B 3GMLB 4I3SL 3C09B 1QFWM 3L5HA 3KAAA 1OTTD 3TV3H 2VXTL 4TSCL 3LV3A 3GMLA 4WGVB 2HVJB 4NJAH 5EUKB 1V7MH 1NCWL 2X4PA 3EDDA 3MUZ1 1D9KB 3U30B 2HVJA 2VDMH 5EUKA 4K3JH 5ALCH 2RCSL 3IDGB 1D9KA 1J8HB 5F7EL 1VPOL 5HYJE 4QHNB 3K8MA 3I6KB 2CDFB 2Q7YB 3T0DA 2B0SL 1J8HA 3IDGA 4H20H 1IGJB 1JGLH 4LSDA 4QHNA 3TNMB 4KV5E 5EB9A 3OTTA 3I6KA 2B7DT 2CDFA 5CEZH 2Q7YA 3C60B 2QADD 3THMH 5I6XB 3QQ9C 3TNMA 3VXSB 2IG2L 2OTPA 5I1LB 1CICD 4HW6A 12E8L 4Y4FD 3C60A 5CZXC 5D93B 1Q9LB 2H6PB 3GGWA 5HVFB 5I1LA 4ZUWA 2BNRD 3WHE1 1DEDA 1ZXQA 1R3IL 3VDAA 1DQLH 5J57B 1Q9LA 1YYLH 4WO4C 4XTRC 1NC2B 1T2JA 4MAYB 4RGND 4GKNB 1CFSB 1AXTH 3CFEB 5EU6B 5IVZB 2WWMD 1NC2A 1SY6H 1JYNA 5JIIA 4MAYA 4GKNA 1CFSA 3CFEA 5EU6A 3S7GA 2I60H 5IP4A 5IVZA 4FQXB 1CE1L 5IF0B 4P5TC 2Q1EA 3HE7D 4OKVB 1WZLA 3FCTB 4UILH 4YE4L 3GHBH 3FONA 5FF6B 4FQXA 5BJTB 4E41D 1AC6A 1W72B 3SKJL 4DGIH 3VWJC 4OCYH 4ZDHB 4KUZL 5IF0A 4NJ9H 5E2WL 1F42A 4OKVA 3FCTA 1CWVA 4NFDA 5FF6A 3K7UA 5BJTA 4J2XA 1W72A 4F3FB 1QYGH 4ZDHA 1XIWD 4WI5A 4RIRB 1OGAB 4PJ8C 5J13B 1WIOA 5HHMB 2Q86B 4XC3L 4EZMA 3EIFA 4YWGH 1EDQA 4F3FA 2VSCA 1EK3A 4AL8H 1SMOA 1EO5A 2WP3T 4MA7L 1OGAA 4RIRA 5E4IA 4F7MB 2Z8WC 1ZGLM 1K8IB 2Q86A 3QUKB 5CJBA 3DTXB 4OLXL 2YKLH 4MD5B 5DMIL 1WBYB 4ETQB 3T65A 4F7MA 4ZOAA 3QUKA 2A1WL 3DTXA 3F7QA 3TH4T 4MD5A 5FUCE 3KXFE 1WBYA 4ETQA 1MREH 3D39D 3DURB 5IBLD 1ZSDB 2R0LH 1LO2L 4XWGL 4F15B 1YN6A 5SWQB 4QLRA 1ZSDA 1KJVB 5SWQA 4K94H 5AWNH 1SBSL 5A43C 3V8OA 2H2PC 1KJVA 2IAMC 5AYUH 5DXWA 3MRMB 4NZTH 2IC2A 3K81A 3S34L 1FNHA 3GJEB 2E7BA 3DYMA 1Q9KA 3MRMA 3RY6A 3BKCL 3GJEA 3DMMC 4HWZB 4XBEL 3DBXA 3NACH 1MFDL 3NABL 1T66D 3V7AG 5T1MA 3BKJH 5EO9B 2KKQA 4HWZA 1FYTD 4XNXL 4OCSL 3MLSH 2QQNL 1QFUH 1PAMA 2VDQL 1J8HE 3OB8A 1D5IL 2XPGB 3RIAK 2EDNA 2IFFL 2AKRB 4IIQB 4L1DA 1KTLB 2APXA 1I7UB 1N5AB 5BOZG 2GITA 3QIWD 4KRPD 2XPGA 2W9DH 1XGPB 3V6OE 1MCPH 3S36X 4IIQA 3H0TB 4UT7L 4Y5VB 1MJ7H 5FXCH 1KTLA 5DJYB 1I7UA 4QRSA 5DUBB 1N5AA 2GJZB 1PY9A 2O93L 1RZFL 4HIEB 3VXSE 1XGPA 1U42A 1YEHH 1A7PH 4PG2C 1P9MC 4GRWF 2VDKL 3H0TA 3GI9H 4Y5VA 1JRHH 4JFXB 1ZGLP 2GJZA 2IEPA 3MYJB 4HIEA 2X4UB 5ALBH 2FX9L 5J6HB 3OR7B 2PR4L 3OJVC 1DUYB 4JFXA 5IB1B 4LP4A 2DIJA 2P8PB 2YK1L 3CU1A 1XGYH 3MYJA 3RQ3A 5J6HA 3OR7A 4G6ML 1YNKH 1N64H 4OLYL 4XAWL 1CU4L 5CIPB 5IB1A 2P8PA 5EU6E 3TA3B 3IXAB 1AE6H 3MC0A 1OAZL 1IC4L 4XVTL 2XG5A 1JGEB 1KPVB 3SE9L 3X3FL 1NC4B 4ZPTB 4OT1L 3QDMD 5CIPA 4M7LL 3TA3A 3IXAA 4PGJA 4EOWH 1JGEA 5HVHB 1KPVA 2ATKB 2AJVH 1NC4A 3MV11 4PJ9B 1NMCB 4ZPTA 4F7EB 1JJUA 3BFOA 2FIRT 4PGDB 1AD9B 4K55A 3KDMB 1VFBB 5HD8D 5A16B 1MJ8L 3W2DH 2ATKA 4PJ9A 5EFIB 4F7EA 5CILL 2D0GA 4PGDA 4AG4H 3DWTA 2HT4D 3KDMA 4JANB 5A16A 3RIAF 4OLEA 1CFVH 5EFIA 3ARBC 3BKYH 5HHME 1LO0H 4JANA 1FFPB 1I7RB 1JPTL 2KZ1B 5E1HB 4D0DA 3HMXA 4IJ3B 5I2IA 4HULB 5CHNB 4DKEH 3BN9D 5C0IB 1FFPA 1I7RA 1T89A 3VFNA 4QOKB 4ZOBA 2ADFH 4PRIE 1V3JA 3TJEH 5CHNA 2I5YL 4U1HB 2XKSA 1YPZE 2F5AL 3SDYH 5C0IA 4JZJB 3MXWH 5JOPE 4XGZB 5E95B 4QOKA 1C5CL 1RUKH 3MJ7B 4LAQL 4NZJA 1GGIL 4U1HA 2JJWA 4JZJA 1NCTA 1TQBB 4DZBB 4OQTH 3MJ7A 4I3SH 1D9KD 3L5XL 4JY4B 4MXWL 5C0DB 3FAXA 4Z95L 4G6KL 2BHZA 1DBJL 4I2XE 4DZBA 2VXTH 1JNNL 2EDQA 4JY4A 3VWKB 5C0DA 1EVTC 4WDIB 5C6TL 1A14L 1EEQA 1U8NB 3HS0B 4Z0XB 3HI5L 4MVBC 1NCWH 5K33A 3IRPX 3VWKA 2J5LB 4WDIA 1KIQA 2AJYL 4NKIL 4Z0XA 3HS0A 1XF1A 2RCSH 3C60D 1HHGA 1P7QB 5F7EH 1VPOH 4OGAD 5FYJE 4UI2A 3M45A 2UUDK 4O58L 5ITBL 1P7QA 4U3CA 2B0SH 4WHDA 4MGXA 3I75B 4KVCL 1ZWIB 4S2SB 4F7PB 2H45A 4MD4B 3UPRB 4GG8B 1FGNL 1V3LA 3EFDL 4YEFA 3RY4A 3I75A 2IG2H 1ZWIA 1NC2D 2YUZA 5DWUL 1ZLUH 4F7PA 3UPRA 4MAYD 5DVNA 1U8JB 2W0LA 3E6HB 2VERN 2NXZD 3ARDB 3EBAA 2V2XB 4BFEA 4FQHB 5E56A 1J0IA 1OSPL 5D5MB 1R3IH 3KJ4C 1U8JA 3E6HA 1CZ8L 3ARDA 5M95B 3RY5A 1OQOA 2V2XA 1IARB 4FQHA 4FQXD 5D5MA 2EIDA 1RU9L 3ULSB 2VISB 5HXMA 4ZNEA 4QRRB 2B4CL 2HYMA 2AJUL 2E3VA 1ZT7B 3ZE1F 1SQ2N 4NUJB 2F8VA 1GOHA 3ULSA 2VISA 4QRRA 4TVPL 2IMMA 1F02I 1XGUB 2YA0A 3V7MA 1ZT7A 4OF6A 1OGAD 4NUJA 2GIYA 4YE4H 2VZ3A 4IRSC 3SKJH 3HMWL 1RQ5A 1OW0C 1XGUA 4KUZH 3O6FD 5E2WH 4KKLC 3FB6B 4WFED 2X2YA 2VZUA 3Q6FB 4H88L 5HI5C 4G6AD 3MUY1 4OCNC 1KF9B 3FB6A 4XC3H 2EDWA 3RVWC 4D0BB 5HHQB 3Q6FA 3MQIA 4MA7H 4YGAB 1Z0NA 4NHUB 4JLRB 4IRJB 2XQBL 4IOIB 4QRPE 5HHQA 4R97C 4D0BA 2R2CA 3BMVA 4OLXH 1PFCA 4Z18A 5IVXB 5DMIH 4JLRA 4IRJA 1V3KA 4M3KB 5KAQG 2A1WH 4X7TA 3V2AR 1GYAA 3UAJD 4Y8DC 1EZVX 4LCWB 1LO2H 4XWGH 4OLUL 4LSSL 1U3JA 1HNGA 1UWXK 4BM7A 4LCWA 1EFXB 1U92A 2VQTA 3UX9B 5A3IC 1SBSH 1E0OB 3SPVB 1EFXA 1VESA 4Q6YA 1RVFL 4RMUA 2PNDA 1QHOA 4PP2B 2VABB 2HT3D 4HDIB 5CINL 1SY6A 3H2WA 3F7VB 1FVCB 1ES0B 3EKCA 3BKCH 5CJOL 4PP2A 2VABA 4XBEH 1MFDH 3FO1B 3NABH 2EDEA 3OL2A 1A47A 5JW4N 3DUSA 2BHUA 3F7VA 3ILQD 1FVCA 1ES0A 1WZ1L 4N5ED 5CMAB 4X4XB 1TQCB 3DIFA 4XNXH 5E70A 2PKDA 5GS3A 4OCSH 3FO1A 1O0VA 4D9RE 1WTLA 3V4PL 2VDQH 1D5IH 2BY0A 4O9HL 2IFFH 4DJMA 1EHAA 2UYLB 3CIQA 1T0NB 5DK2B 2ATPB 2EE2A 1P84K 1U8OB 2UYLA 4UT7H 3NIDF 1LGVA 1FZOB 2FJGA 4XAKD 1RZFH 1U8OA 1B3JA 1U8KB 2VDKH 5TJWK 5DK0A 1FZOA 1G0XA 1LEKB 3ZZ1A 3HCVB 4HZAA 5F7HA 2FX9H 4UU9A 5D5ME 2PR4H 1U8KA 4DKFL 1NC4D 4XNZC 5KTEL 2YK1H 1LEKA 3HCVA 4WWKD 4J3XA 1P53A 4G6MH 3VXRB 1ORQB 4PJ9D 4OLYH 4XAWH 1CU4H 4Y4HB 3WEXB 3Q6GH 1DBBL 3SY0B 3QQ4B 4OI8A 1OAZH 4XMKL 4XVTH 1BIIB 1ZHNB 4HWEL 3SE9H 2XQYG 3VXRA 1MIMH 2CGRL 3X3FH 2UWEB 1QR1B 4Y4HA 3WEXA 1G7HB 1WUNT 4M7LH 4S11A 5E5UB 4L9LC 3ARQA 3P4LA 5JPNB 1BIIA 1ZHNA 2UWEA 1FJ1B 1QR1A 2F53E 4N0CD 1VA9A 3W81A 4Y19E 4Y2DD 2ZG1A 4MHHG 5JPNA 2CDGB 1MJ8H 3Q5OA 3ARPA 5K9QI 2FRGP 1FJ1A 3SQOL 5CILH 3PV6A 3V0AC 5D2LF 1KOAA 5TQ2L 1HHKB 5D2NC 4GW5B 3QJFB 3JXAA 3RTQB 3NVQA 1PSKL 2CDGA 1JI1A 4QOKD 4OB5L 1ZT4B 3RGHA 3VGGA 2P8MB 3WFBH 5GZNC 5HYSB 5HVWA 3BN3B 3G04B 1HHKA 4GW5A 2FX8L 3QJFA 4ODUB 3RTQA 1VFAB 1JPTH 4Q58C 2JJVA 1ZT4A 4NFCA 1CDCA 3G04A 4XPAL 1I7TB 4ODUA 2ORBL 1VFAA 5IVXE 4JM2B 2HA1A 1C5CH 4JM2A 4M61B 3B9KB 3MTRA 5T3XD 2XZAL 3VWKD 1R6VA 4LAQH 3V6ZB 4LCWE 9CGTA 4G8FA 2OSLB 3SDCD 3VA6A 4LHJB 3B9KA 3T0AA 3WXWH 2IJ0C 3L5XH 3BPOC 3V6ZA 3QEGL 4Z95H 1EFQA 3HR5B 1J10A 4G6KH 4LGPB 4AMKL 5CD3B 2C7UA 5BW7C 3O8XC 5F9AC 1DBJH 4IOFC 2OSLA 3OAYK 4MAUH 1JNNH 3RDTB 2V2TB 1TITA 4X6EB 4J1UA 1A14H 5JR1L 5CD3A 4ZXBB 3HI5H 5BRZE 3BYYA 4YZFE 1TPXC 2V2TA 4LDLB 4X6EA 3C6LC 2AJYH 2ED8A 4NKIH 5FECB 4ZXBA 4WEBH 2NPLX 4NZUH 5DHVB 4Y5XC 4N0YL 5IV2B 1MCLA 4AIXA 5FECA 1WLHA 4O58H 5ITBH 4P2OC 4U1LB 3ARDD 4QHLB 4RCAA 5IV2A 4KVCH 4TNWF 5AUMB 1LD9B 2J8OA 4BFBD 1FGNH 4L8CB 3EFDH 3RZCB 4QHLA 1MWAL 4XC1L 1INQB 5C0CE 4OTXL 4X6BB 3EJZD 1NSNL 5DWUH 2AXHA 1JCKA 4YJZL 4LCCB 3RZCA 1O5DT 4QRRD 1INQA 3LS4L 1JF1B 4X6BA 1OSPH 4ENEC 3JWOC 4ODBD 3EYSL 4EXPX 3TYGH 2NX5E 1CZ8H 4LCCA 1YNTB 1JNHB 3DX6B 4LSVL 5TGBB 1OOAA 2IBGA 3OKDA 1RU9H 4GRWE 2CMRL 1J0JA 2VLRB 2B4CH 3CDYA 1YNTA 1JNHA 3DX6A 1NKOA 2AJUH 4LMQI 5TGBA 2G2RB 4ZMAT 3AMKA 4CN1A 2VLRA 4TVPH 3V6FA 4M6NL 4I0CC 3ARGC 3VXRE 4XNQB 4M1DL 2G2RA 4LFHG 4B5EA 5FKAB 1B90A 4ALAL 5FYKE 5DTFB 3T4YB 2VIRB 1D6VH 3HMWH 4HBCH 4DTGL 3N1GC 3QNXA 1MPAL 5FKAA 2E9JA 2IH1B 4IRJD 5FFLA 5DTFA 3T4YA 2VIRA 2CXGA 4W6XB 4OFPA 4H88H 3CH1B 4EIZC 2IALB 5CEZD 1U8LB 3ZKSD 2IH1A 3FO2B 4OD1L 3CH1A 1U8LA 3FO2A 4JVPA 2LTQB 3RNQA 4BZ1L 2OJZH 4PYHA 2CH8A 4WVRA 3HKFA 1MFCH 4PJ7A 3DLQR 4JRYB 4NQXB 5CWSB 3UJTL 2WSKA 4U7KA 3W5MA 1YEJL 3P0GB 4APQB 1OAUL 1F00I 4P2YA 5FHBL 2EEDA 4NQXA 5CWSA 3LD8C 3KYNA 4APQA 2C4XA 1AR2A 3U46B 4OLUH 4LSSH 1UWEH 4S1QL 4A6YL 3MRCB 4EKXA 1KCLA 3U46A 3ES6B 1TMCB 3R8BB 1FH5L 4NO2B 5DJ0B 3RWHB 3MBEC 3MRCA 4Z7UF 5IMKB 4OGYL 2YA1A 1RVFH 4U0RB 1G9MC 3WD5L 4NO2A 5DJ0A 3RWHA 3GIZL 4QRUB 5CINH 4H26B 4EI6B 1A3LL 1XEDA 2BY3A 5IMKA 5IROC 4JB9L 4LSRH 4XVSL 2K3TA 3UBXI 4QRUA 4EI6A 4H26A 5DGRA 3VFSA 1WZ1H 3VFPB 2W0KA 3TH3T 2E27L 1OP9A 1VCAA 4AH2B 4LPVA 1UCTA 2VZ1A 2XV6B 2OCFD 3VFPA 4NKOB 2QR0B 1FYHB 4O9HH 4O2CB 2G9HB 5MENA 2B5IB 3LAFA 4AH2A 3VFUA 2IFGA 2DKUA 2QR0A 4NKOA 4O2CA 2G9HA 4XCFL 2KUTA 4CMMB 1HHIB 5J89A 3C2AL 4C58B 4UDUB 4Y4HD 3KYMB 4KFZC 3PE9A 3EHBC 4ZS6C 1XZ0B 3OPZL 4CMMA 1KIPB 4AIOA 5MP6H 4DKFH 1HHIA 3NIFF 1XZ0A 1BM3L 1KIPA 4XXCA 1NGYA 4MB4A 3MRLB 4XMKH 4HWEH 2C3VB 1S7QB 5C07B 2CGRH 5I9QB 4NN6C 4OI7A 2VDNL 2EO9A 3RA7L 2C3VA 1S7QA 5C07A 4NRYB 1OAQL 1N7ML 2CLVB 5DMGD 3U0WL 3S88L 1NGQH 1NGXB 3DV6B 3SDAB 4NRYA 2K7QA 4R7DB 1EJ6A 2VXUH 4LFHD 5TQ2H 2CLVA 5EPMB 5E00B 1MLBB 1ND0B 4M9OA 1NGXA 3SDAA 4OB5H 4NZRL 5E00A 5EPMA 3T1FB 2FX8H 1MLBA 1ND0A 5C09B 4WHYH 3BGAA 4TRPL 5DFTA 1H15B 2CRZA 2YC1B 3HI6L 3B9KD 1E4JA 1TCMA 1S5IL 4GO6B 4NBZB 2NZ9C 4XPAH 5CJXC 5T5FL 2ORBH 1KELL 3KLSA 3PJSA 3IJSB 1H15A 2YC1A 2GQHA 3QO0B 4GJTB 2BMKA 4JRYE 2O26U 3C8KB 2NY1C 3AY4C 3BZEB 4Q9QL 5DSCB 4X7FC 2DQDL 3IJSA 5GGRY 4MQXD 4DZ8A 3H3BC 1JZ5A 3QO0A 1WGOA 3CDFA 3C8KA 4L4TB 4WW2F 4BYHA 5DSCA 3GSVB 3ZLQC 4DN4L 4L4TA 2Y6SD 4AMKH 3HC4L 4QXUH 3CAFA 3C6SB 3GSVA 1ZE3C 2DQCL 3AB0B 2FZ3B 1BQLL 3BW9B 1X9QA 3UZQA 2H3NB 1HH6B 1JZ8A 4WU5B 3C6SA 4ZUUB 4EJ1C 2FZ3A 3LN9A 5E6ZA 3BW9A 2I9LA 3F62A 2H3NA 5TDOB 3K74B 3D2UB 5DMYA 5DHXB 1M7XA 2VE6B 1HH6A 4WU7B 4WU5A 5JQ6L 5B4MD 2C5DC 3E2HC 1WBXA 4ZUUA 5D1QC 3RZCD 4N0YH 5TDOA 4BQ9A 5L8JB 4WU7A 1RUQH 3GMPB 3GNML 4KDWA 1H9VA 5IVOA 1IQDB 3GMPA 1MWAH 2YN3A 3LPFA 1QKZL 4OTXH 1NSNH 1T1ZB 3FRUB 1TJIH 4C55A 4PS4L 1IQDA 3WCYA 3FFCB 1YJDC 4DFHA 5CGTA 4LLMB 4L3EB 2VLRD 1BHGA 3HE6C 3LS4H 3DV4B 4KVNL 1T1ZA 5FUCC 4K2UL 2E6JA 3FRUA 3EYSH 1TZHA 3FFCA 3NIDE 4LLMA 2IF7A 2I9TB 3DV4A 2Z0BA 4LSVH 2DJUA 2CMRH 4JHAH 2F15A 4WWID 1ITBB 2I9TA 2V6HA 4R96B 1C5DB 1PYWB 3DETC 4I5BB 4DOHB 3QNYB 1Z9LA 4JG1H 3QEHB 4R96A 4M1DH 1C5DA 1KYOK 1EPFA 3LB6D 3PQYE 2JJSA 2VSDA 5L9DL 1UACH 3ARFC 3MV9A 3W11D 43C9B 4ALAH 4I5BA 3MXVL 4PY7B 1MY5A 3L3KB 3W9DA 3X3GL 3QEHA 2ZNXA 1MPAH 3L3OB 3T09A 1I8LC 43C9A 1QSEB 2P1YA 4PY7A 3L3KA 5IHLB 2QL1A 3LEYL 3QQ3B 3L3OA 4J3TA 3OJDB 1T2XA 1YQVL 1QSEA 2O5ZH 5I75B 2OR8A 1AI1L 1DANU 4OD1H 2EXYD 1KTRL 3H9YA 3QQ3A 1Z9SA 5SX4H 5D2LE 1FNSL 2A73B 3I02B 1B0WA 1T7XA 4PJGB 4BZ1H 4QTIL 3IFPB 4RGMB 4LIQL 3MLXL 2ARWA 3V6OC 3UJTH 3I02A 2A73A 1YEJH 2F19H 5D7SL 5C09E 1OAUH 4PJGA 1SJVA 3RWDB 3IFPA 2Q3ZA 1WSST 2XOTA 3VI4F 2MCG1 3GDBA 3HZKB 4POZC 4QWWC 5C2BL 1BFSA 15C8L 5J3HC 3S98A 2VLKB 5F9DC 4S1QH 2VITA 3HZKA 4N90E 4A6YH 4NC1E 3SN6N 4PLJC 3QCVL 2VLKA 3MGTB 4L4TE 2GI7A 32C2B 4MS8D 4OGYH 2EDRA 5J06A 5BV7H 3WD5H 3MGTA 1V5JA 2C9AA 2DTML 1WWWX 32C2A 5MEND 1A3LH 2ZUQB 4FFWD 1JZ2A 1SM3L 5IHBA 5IOPB 5B22A 2EC9T 4JB9H 3D39E 4JN2A 1G6VK 5IOPA 4ZSOB 2E27H 4U2ZA 1CL7I 2VUOA 2VWEC 2DMKA 4ZSOA 2BRQA 2CSPA 5EBWB 2Y5TB 5FV2A 1IGIL 1MFAL 2DS4A 3GO1L 1I3GL 3RI5F 2EEAA 5EBWA 2Y5TA 3ARWA 4JAMA 1Z2KA 4XCFH 1JVKA 1YMMB 1MIEL 2NY0D 5DJZB 2X42A 1U6AL 3C2AH 2DBLL 4FTVB 3O0RL 1R0AL 1YMMA 4W6WB 4L3EE 5DJZA 2YPLB 3OPZH 4F58L 1OP3H 5C07D 4LLDB 4N68A 4MJID 4LASH 3UTTD 1H3GA 2FEEI 1NJ9B 2YPLA 5T1KB 4F15C 3UEZA 1BM3H 3L3DB 4X6CB 2XWBB 1VSCA 3CZFB 5HPMB 3OXRB 5I1EL 1NJ9A 5JIPA 5T1KA 5KVEL 5HY9B 2RJMA 5I73C 1RUAH 3SDAD 1KN2L 4X6CA 3LQAC 2XWBA 3CZFA 1OTSD 4XNYH 4GG6A 5HPMA 3RJDA 2HLFC 3OXRA 2VDNH 3MMEB 4WUKL 4UZGA 4JM4L 5HY9A 4HUVB 3QPQC 5TPWH 1YN7B 5C3LD 4XRCB 1OAQH 2YZ1A 2FLRT 1N7MH 1JGVH 3MMEA 2WANA 3GB7B 4CAGA 3S88H 4KK8D 3VD3A 4HUVA 3ZDZF 4HJGB 1YN7A 4XRCA 2I27N 1JGUL 3GMQB 4KKAC 2CQVA 1QSEE 2DQTL 2X9WA 2IADB 3TESA 3PIQB 3FQNB 1UC6A 1LWRA 1NEUA 3GMQA 4NZRH 1DE4B 1HZHL 2IADA 2Z92B 3KHQA 5K59F 4JFHE 1DQDH 4TRPH 3PIQA 1DVFD 5FKPB 3HI6H 4HJJL 1K2DB 4P5MB 4DUWA 5L8KB 1DE4A 5T5FH 1KELH 2Z92A 4PJGE 4Y5YC 1NANH 5FKPA 3P9MB 1K2DA 4P5MA 3M17B 4J8RB 2R23B 4Z7WF 1A9EB 2Z91B 4Q9QH 5EIIB 3RVVC 2DQDH 1QBLL 3P9MA 4RGOL 1RMFL 3ALXA 1DUZB 2P5WD 3D9AH 5IFAL 3M17A 2Z8VC 1A9EA 4WW2B 2Z91A 3ZTNL 1WEJL 1BFTA 3BPNB 1KB5L 4J4PC 4Z7QF 2GT9B 4WI4A 1DUZA 2VLKE 3B83A 2LABA 1CVRA 4YO0B 3HC4H 4HS6B 4KTDL 2DQCH 2P49B 4V2BA 1BQLH 2GT9A 4YO0A 1N4XH 1M05A 4KU1A 4HS6A 4ZODA 1BQHB 1H0DB 3FHAA 3PWUB 4JHBA 1IEHA 3HUJF 5LGHH 3KPSD 4HGMA 4TVPE 3IU3B 4RDQF 3O45A 4CW1B 5JQ6H 3PWUA 5HGAB 1MRFL 3TVMB 3IU3A 4ZTPL 1CN4A 3FO9A 1Q72L 1L4IA 2EH8L 3MCLL 4CW1A 4Y0GA 3MLTB 1JNJA 3FFCD 5HGAA 3A67L 3GNMH 4XP4L 3TVMA 3IKKA 3SBWC 1J18A 1U95A 2VQ1B 1AXSB 2V9QA 3MLTA 5HI3C 2AQ2A 1KLFA 4HT1L 1QKZH 3KPPB 3S36L 1J8KA 1BQSA 4OUUB 2VQ1A 4PS4H 1AXSA 4GKSB 3AREB 3TPUB 4FQIL 5KS9A 5FB8B 3KPPA 4XMLH 4K2UH 3HAEA 4OUUA 1G6RL 2V5TA 2J6EL 3AREA 3MV9D 2ICWB 1OCWL 3TPUA 3SOBL 5C08B 3V5DB 4FTVE 3BZ4A 3IB4A 4NRZB 2ICWA 3ARYA 2CUMA 3FHQA 4DVRH 3KR3L 3V5DA 3MJ9L 4XX1G 1LP9F 5DRZB 3MLVH 3NIFE 4NRZA 1L7IL 1JHTB 1TDQA 1TQBC 4LHUB 2E8YA 3VDCA 2X1OA 4MA1B 5L9DH 1KEGH 3P3YA 3MXVH 1JHTA 1IZKA 3X3GH 4LHUA 1JMXA 3TBTB 2XIDA 2DWEB 5DFVC 1CS6A 3TN0D 3VG9B 4EIGB 4NM8L 3EYQD 1I1FB 4P2RD 1YZZA 1M1SA 3LEYH 3TO4B 2J5LC 1YQVH 4EN3C 3ARXA 4ORZC 5MI0B 5FGCB 1AI1H 3H6JA 1GHFH 1I1FA 2NNAA 4H0IA 3TO4A 2R9HD 3HI1B 4PGZA 3CLEL 1FNSH 3D85B 5AEAA 4QTIH 2DLGA 4LIQH 5JZ7C 3MLXH 3HI1A 2N7AA 3O6LL 2VB5A 1FVDA 3D85A 4RRPA 1MWAB 3CSPA 2JJUA 1BQHG 5JIKA 4CGTA 1LO5B 2DWDB 4G8GB 3O3DA 1MWAA 4CVZB 1FG2B 5C2BH 4K7PY 4G8GA 2DWDA 1KCKA 2PTVA 4CVZA 1FG2A 2ZSVB 1OL0A 3VCLB 4MWFB 5EUOB 3RL1B 4I0PB 1QFOA 3PDGA 1MRDL 3VCLA 4MWFA 5EUOA 4LGSB 3RL1A 4I0PA 4CMHC 1BPVA 1H3UA 3CMOL 2DTMH 2VO5A 1AR1C 4MXQD 3HZMB 5LGJB 4WHYG 4FQJH 1SM3H 1NAML 1K8DB 3HZMA 5LGJA 4LKXB 2AJSL 3PP4L 1RZIB 3NCFB 1K8DA 1RK1B 4LKXA 4QCIB 1BP3B 3L5JA 1RZIA 1YMMD 4RMRA 3SE3A 1RK1A 4YHIB 1I85C 1IGIH 1MFAH 5IWLA 4QCIA 5DT1L 4KI5D 3GO1H 1I3GH 1WWAX 4JKLA 4LHUG 2YPLD 1G9EA 4YHIA 4YBLB 1X4XA 5HHPB 3IDYB 3QRGL 1MIEH 4KZEL 2J1KA 5GSRB 5T1KD 5GHWL 2D7NA 4Y2DA 1U6AH 2DBLH 5BS0D 4MHHI 1R0AH 3DSFL 4R2GD 4HKZB 5HHPA 3U36B 3CNKA 5TFSL 5GSRA 4F58H 2DOCA 4RAHA 1CR9L 4M7ZC 5K9JH 1R3JB 4HKZA 3U36A 3BIKB 3AC0A 3QEQA 4FFVD 4NDMB 1EGJH 4JFPB 3CUPB 1GGCL 5C08E 4A6YB 4WFFE 1R3JA 4F33B 2HFEB 4U3XA 4RRPG 3BIKA 5I1EH 5HHXL 4ZUSB 3CUPA 3MRIB 1KN2H 1NCAL 3FB7A 4A6YA 3LOWA 1LE9B 4WUKH 2AXFB 4JY6B 4ZUSA 4M1CD 5LJYH 5BV7B 1YC8A 3MRIA 3CCHA 2LVEA 5DRWB 3OQ3B 5C0FB 2X9YA 3QUYA 4TPRL 1LE9A 2AXFA 4JY6A 4J3WA 5FGRA 2FECI 2W0FB 5DRWA 5C0FA 2A38A 1IM3B 4U1KA 2DQTH 3H9ZA 3RUGB 2UVFA 2W0FA 1YEIL 4I1NB 3SGKC 1IM3A 1JHLH 1HZHH 3RUGA 1ZT1A 5HHOE 4XHJD 4HJJH 4NOFA 2DKMA 5ADPL 4PJAF 2BVOB 3OKMB 3Q0HA 3Q5TA 4HH9B 4OZ4B 1IL1B 4P23B 3GJFH 2KL6A 3MBXL 2BVOA 3OKMA 4HH9A 3GJFK 4P23A 3NIGF 1QBLH 1A7OL 4RGOH 1DQJB 1KEML 4Y7MA 5IFAH 3ZTNH 5JUEL 3NTCH 1KB5H 1JWSA 4P3CL 3OAZK 2NY6B 1MCCA 4KTDH 3U4EB 4BQ6A 1A5FL 2DTSA 2ERJB 2FWOB 5HGBB 3RVUD 2BHYA 3BPLB 4NGHL 4HH8A 3U4EA 1H3XA 3I6GB 2FWOA 4K94C 1IC7H 2CK0L 4YFLF 1SEBA 1DP0A 1DDHB 2BVQB 2CLRB 3QNZA 1KJMA 1R24B 1WVZA 5HJ3B 4ZTPH 1DDHA 1Q72H 2BVQA 2EH8H 3MCLH 4OFYA 2CLRA 1W8OA 3BWUC 2VKXA 5SV3A 4IM8A 4XP4H 3E8UH 5HJ3A 2APFA 5F89B 5C0AB 1F2QA 4HT1H 2BVTA 1XH3A 4QY8B 3ZKMC 1P4LB 3S36H 2RBLA 5C0AA 3T0EE 1FVEB 4FQIH 1WV7T 2AXGB 1U8PB 1P4LA 1X5KA 4OZGF 5AYQA 1G6RH 5EIVA 4ZFFB 4KI1A 4U1IA 1FVEA 4NN7C 1OCWH 8CGTA 4NQSB 3GMNB 3DSNA 3SOBH 1U8PA 2ESVE 4RMTA 4I18B 4JG0L 1I9JL 4Y1AE 1L0QA 1GPOH 4ZFFA 3F5WB 3QULB 3WN5C 4NQSA 3GMNA 4I18A 2DBJA 3KR3H 2BRRL 3MJ9H 5KOVC 1AGDB 1S8DB 4K8RC 4X99A 2XTJD 3F5WA 4R0LC 2KH2B 1GZQB 3QULA 1ZHLB 2VXSL 1L7IH 3MRJB 3KLAB 3K0WA 4J23A 3DARA 1AGDA 4TUKL 1M71B 1GZQA 1F6FB 3MRJA 3KLAA 1G0YR 3DHMA 3RDTC 4G42B 3P77B 5IW3A 4LRIA 3V52L 1M7DB 3D85D 4NM8H 2VAAA 1ZKAA 1OTUD 1ZLWH 2LFGA 3FB5B 4G42A 1HH9B 3P77A 5JORB 2NTFB 5FYLL 5KSUB 4HV8B 1M7DA 4EDXB 1ZLWK 3OXSB 2Q87A 1UVQB 3FB5A 5C86A 1HH9A 4G8GD 4B7IA 4F37F 1E4XH 3CLEH 5JORA 1U58B 2NTFA 3GIVB 5KSUA 4HV8A 4EDXA 1WWCA 3UXFA 1Y6MR 2EXWD 3OXSA 3SKNB 2DQJL 1UVQA 4GH7B 3TGXA 1MI5B 3GIVA 4JQVC 2BY1A 1UH4A 3SKNA 3OSKA 4XWOC 4V1DB 1MI5A 4I0PD 3BD4A 3MJ8B 5D7IA 2I07B 1KPUA 1JFQL 4U1JA 4RDQG 4OFVA 5CLWA 3TYFB 2XICA 4V1DA 2LU3A 4I13B 4PJCF 3MJ8A 2I07A 4Z7WE 3UTPE 2NY4B 4BK5A 2X70A 3BGFB 5IKCA 3O4OB 4JE4B 2IBZY 3V6BR 2NW2B 4RWYH 4OSUL 5DGQA 2I26N 3UDWA 1FLRH 1MRDH 5GSVB 1BECA 5IB2B 3UJJL 1J9CT 3CMOH 4PV8B 3MROB 2NW2A 2MKLC 2ZP0T 1CGTA 4DAGL 1JGDB 5GSVA 4UOW1 3KPRB 3PHOB 1NAMH 5IB2A 4DK6A 1A7RL 2XA8H 2YD1A 1U2HA 4ELMB 1JGDA 4KQ4L 2AJSH 3B5TA 2GKIA 1U3HB 3PHOA 4J3OC 2XY1A 3FKUS 1EMTL 6CGTA 3ECBB 3HUJE 2R29L 4ELMA 1JI2A 1U3HA 2ZUVA 4I77L 3JWOL 1GXEA 3ECBA 4U1SB 1A7QL 3HNTH 1ZLVH 5DT1H 1BD2B 5TH2A 1K3ZA 3RKPA 3QEQD 3O4LB 4U1SA 4KY1L 1PEWA 5C0AE 1BD2A 3MOAL 4P46C 3QRGH 2HFGL 5D7LB 4KZEH 4U3HA 4J6RL 1QRNB 5GHWH 1KB9J 4Q7DA 4NQVB 2DQIL 4FA8A 5D7LA 1TTUA 1KC5L 1QRNA 2AJZB 4UB0L 1CR9H 5ACMA 1B9ZA 4NQVA 4Z76A 3IT8D 3QUYD 3GI8L 3SCMD 2AJZA 2AJ3B 5B21A 4LVEA 4OI9A 4M4PA 4YHLL 5HHXH 3P9WB 1NCAH 4XT1C 3CLFL 4XP1L 1MFBH 1MCHA 1BOGB 5KSVB 4O02L 2FJFB 3O6KL 4POYA 5C0RH 1FLTX 1CBVH 2JF1A 2X09A 1AO7E 3TM6A 4TPRH 1BOGA 5KSVA 2EDFA 2FJFA 4PLNC 4DN3L 5F9JB 4NQDE 4XVJL 1MQ8A 2EIZB 4P23D 5DD6B 1YEIH 5F9JA 4OCXH 4MNGB 2EIZA 3J7HA 2WAHA 2XG4A 2DYPB 5DD6A 5IMOB 3V95A 1OTTC 4LVNB 5BVPH 5ADPH 4WO4B 2FYYB 4MNGA 4PJAB 1Z5LB 1EAJA 4NZDA 2DYPA 5D7JC 2EDLA 5IMOA 3O9WD 3TJHD 3MBXH 2WM0A 4WO4A 2FYYA 5IUSA 3BP5B 2MQCA 2R1XB 2VLLB 1Z5LA 1LO4L 1VGEL 2NY6D 4ZO8A 5DRXB 3C8DA 5JHDD 5HDBF 5BQ7B 1G9ML 1A7OH 1KEMH 4OF0A 1CD1B 1H8OA 1QPPA 3BP5A 2VLLA 5DRXA 1LK3L 4RFOL 4PJIB 4P5TB 5JUEH 5BQ7A 1WZKA 4I3RL 4RISL 3ROLA 4P3CH 1U3YA 4FG6D 3LDBC 4N9GB 1DFBL 3VWJB 3QH3B 4MCZB 4PJIA 4P5TA 3BVNB 1A5FH 1EEZB 1H8SA 3MA7B 4UUJB 4OFYD 5ICYB 1FZKB 4I4WB 4X0KB 2SEBA 4LDEB 4N9GA 4NGHH 3VWJA 3QH3A 1EGJA 1DTUA 3DPBA 3BVNA 1EEZA 4UUJA 5EOQL 5ICYA 4PJ8B 2A6IB 4NIKB 1FZKA 2CK0H 4WJ5B 4DUVA 1CD9B 1QBBA 3BSZH 5HI4D 4UTAL 5IHUL 2D7QA 2WW8A 1T22B 1XCTB 4LAJH 3KPRE 4PJ8A 2A6IA 3ZSSA 2OJEB 4WJ5A 5M94B 4C4KO 2WWKO 4JRXB 1MAML 4YQXL 1T22A 4RGNC 4RBPH 1S78D 2OJEA 1G7LB 1AY1L 1UM5L 4JRXA 4ZTOL 5DO2C 1RJCA 3HR6A 2H41A 1UM6L </