2PW1B

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide eldkwnsl
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
232
structure length
221
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSQTYTCNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2F5 Fab fragment heavy chain
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications.
pubmed doi rcsb
molecule tags Immune system
total genus 37
structure length 221
sequence length 232
ec nomenclature
pdb deposition date 2007-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2pw1B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2pw1B01
1BVKB 2ICEA 3DXAA 3GFUA 2FGZA 1CL7I 2CJUH 4JJHA 5FOBA 3OKDA 4OFDA 3LKSA 3S88L 5SWSE 3DROB 3LEXB 2J8UA 1SY6A 1JGUL 3OJ2C 3BMVA 3BKCL 5I1LA 4OUUB 2GKIA 2EDFA 3OWEA 3P9LB 3TNNA 2I9LA 3VWKC 1VGEL 4L5FL 1PD6A 1BJ8A 5L2KB 3E8UL 5C09E 3L5IA 1FZOB 1PKQA 3U0TB 1F58H 5JNYB 7FABL 3IDNA 5FHAL 2FEEL 1EX0A 1A14L 3RI5F 1UENA 4HIXL 4I3SL 3FO2B 4AENB 1DJSA 3RIFF 2NLJB 4Q2ZA 1M05B 2OJZL 4RAVB 3FT2A 1ERNA 5ENWB 1C5CL 1M7IB 1FAIL 3SJVA 3VRJA 2HRPH 4JLRA 4S1RH 1UADC 3LMJL 4XCCH 1DQDL 1ZA6B 2W65B 3CD4A 1XF2B 1UACH 3SEPA 1F8TL 3MR9A 2HT2C 5JOPD 3MLXH 1GAFL 1ZLWK 1MPAL 4NZTH 1CDHA 3PP3H 1NAKL 4LCWB 3QDAA 2VXVH 1CE6A 4NUJB 4L8BB 1RIVL 2AI0H 5ITBH 2A0LC 5FM5M 3AB0C 3BH9A 2OLDA 3WN5A 1XF1A 1NL0L 1UWXH 4L9LA 4Z0BL 1RJZB 5FA3B 3LN9A 1G7LB 2EDHA 1S7TB 2EYSA 4OF5A 1A47A 1DUYA 3BPOC 4Z7QE 2I25N 2BY2A 3C6SA 5HHXL 4PJXF 3WN5C 4PRDB 3VH8B 4L9LC 2PTTB 2Y7QA 1UM6L 3WL9B 3RHWF 1FORH 2IALB 3QDGD 4NKMA 3PG2A 2H3NA 3MV8B 4LDLB 1LE5B 4KROC 3HA0A 4QRRE 5I9QC 3S3PA 3GBML 3OXRA 3S37H 1I3GL 3E0GA 2X10A 1JGVH 3QIBB 1PLGH 4YNYA 1RHHA 5EO0A 5I6XC 3W2DL 5T3ZL 4IOFD 1G9MH 2UY7A 1CE1L 4MQSB 5MERB 3BD4A 5C3LD 3ULSA 4WWKA 3S98A 5I15H 1F02I 4EUPG 4YHYC 2CUMA 1MSPA 1CICD 1KJ3H 3SE3A 3WJJA 2NY1B 1RUPL 3DXAE 3EDJA 5D71L 2FLRT 2DF3A 1MH5A 2ITDB 3B83A 3FQWB 3QPQC 1IM3A 4OZIF 4JGUA 5CUSH 3RGHA 5JW3H 1K8IB 3UAJC 4WWKC 3HNSH 3T65B 4XNXH 4JN1H 3VRIA 1TJIH 3OR6A 2MKWA 1DBML 4AIXA 5D1QD 4Z8FH 2WBJD 3G6DL 5EOTA 4DGYH 4N90E 1E27B 1UWGL 3FFCB 5KS9E 4NNXA 3TWCH 5AEAA 4U1JA 2E7MA 2NXZB 1RD6A 4WI6A 2H9GB 3BPCB 2I27N 1HINH 1F42A 4BZYA 1HSAA 5FOJA 4N9OB 4R96A 1KPUA 3G5XB 1QZ1A 4LSDA 4X9HA 5E2TL 5IF0B 3ULUH 3PWPE 4X5WB 1FVCB 3P0YH 4N0UA 5E99H 1TZIA 2GT9B 2Z92B 4I1NB 1RUML 1WIPA 3B9VA 2X41A 1D5ZB 1A0QL 4MAYA 4ZTOH 1MEXL 1VADB 3MJ7A 3V5HB 4GXUM 1P1ZB 2CIKA 4KKBD 5MEQA 2PW1A 2X1XR 1RFDH 3HG1B 3WS3B 5IW3A 3U2SA 2X7LA 4G80B 1QYGH 3VD9A 2IG2L 5DEFA 3BPNB 3BYYA 4DUXA 2KQMA 1RPQA 4U7KA 1U3HD 3AROA 4PBXA 4Y2DD 1CFSA 4WV1A 5E8EA 3MBED 1BVLB 4JFDB 2DQCH 3T8XA 4XPHL 3HC3H 3RL1B 4NNYB 4F58H 3IVKB 2HJKB 2AV1B 3K1DA 3P40A 2XTJE 5ICYB 3DMMB 3ULUC 1A4KA 3EUUA 4YUEH 4F7PA 4XXDA 3UTTE 3BYTA 4DOHE 4BFIA 3EYFB 2J8HA 3OJDA 5EC2A 3OG6B 3HUJB 3O2WL 4O9HL 4WDIB 3W39B 1BFVH 3R0MA 4G8GB 5B39A 1R3IH 2ERJC 4N0FA 1KEML 4NQCD 1CLZH 2QHLA 3MRMB 4HIEB 3L7EB 2FATL 3U6RB 1AQDB 2KH2B 5F88A 5C71A 3KG5A 3BISA 1GHFL 2UZYB 4JKPH 5HYJA 1WTLA 5GS1A 1DBAL 1R6VA 2A9NH 3KPQA 4PG9A 4DFIA 3EYOB 3MV11 4K3HA 1HIML 1WWAX 3MLRH 1KLUB 5LWYH 2F5BL 3T0DA 4Y1AE 4GT7A 2CRMA 2ADIA 1VB9A 2EKSA 4OZHB 4ZUSA 1HWGB 1V7ML 3QULB 4Z7UF 1GCFA 3O3BB 5ANME 2V5YA 1YDPA 1DEEA 4XCYA 5F7HA 1JTTA 5ESAB 4PTTA 4OF7A 2WIMA 5HGHB 3FZUC 3STZB 3EGSB 2IBZX 4HWNA 3ARBB 2ICWB 1X5AA 3N1FC 4YXLL 4HIIB 2MCPH 4HJ0D 1MCRA 1DUZB 2J4WH 4S2SA 3EHBD 5FGBA 1RZKH 5ESVB 3SOBH 3RVVC 4QHNA 5EOCJ 1EXUB 1QEWA 3RUGB 4OZ4B 4AYFA 1CZ8H 3FQNB 1KEGH 5HDLA 5E2VH 4GAYA 1TPXC 4XP6H 5EU6D 2WQ8A 4ZOEA 3RKDC 3SGKA 2APTA 2HLFC 2J6EL 1F4YH 1JPTH 5TH2A 4CN1A 2FX9L 4KHTH 5L8KB 1XIWD 3K2UL 5TQ0L 4XMLH 1BQUA 3HZYA 2KL6A 4OTXL 2AEPH 1XF5B 3GMLA 4KAQL 1T1XA 1FZJB 4MJ5B 4P2QE 3TYGL 3BW9B 4I2XA 3D3VA 2X4UA 1T2JA 4Z7WE 1KIPA 3BKJL 1RZKC 5DFTA 1CLYH 1T22B 3NN8A 1LHZA 1V7NH 3QQ3B 3OL2A 1EEQA 4OB5H 2G2RA 5E7FA 5J89A 1JHKL 1RQ5A 2XYCA 4FQCL 32C2B 2PN5A 1FNHA 3TYFB 2BZDA 3K0WA 2Q8AH 5IVOA 4F3FA 2CK0H 5CSGA 2H26B 5C8JB 2VQTA 2A0LD 3BP6B 1QSED 4QRPD 1WQVT 1NCTA 2VXQL 2WUBL 2ARJA 1H3VA 5IK3B 4GQ9L 2H1PL 2Y36H 3CX2A 3H0TA 1S5HA 4HCRH 4GXVH 3LN4A 1ES0A 1LQSR 3KYOA 4F2MB 1CGVA 4MQ7A 1S7UA 5FK9B 1J18A 4TVPL 1G1YA 3VGAC 2PCPB 1KN2H 4HUWB 1JN6A 2EYTA 1IGFH 5HYEA 3CDGA 2W9LA 3FTGB 2NY7H 3GSOA 4MWFA 1DEDA 3I6KB 4KQ3L 4NSKB 4R2GC 3JV6B 2UWEF 3EJZC 3QFJA 1MRFH 5IMLB 1IC7L 2BDNL 4LLDA 4LARH 5CBEA 4AMKH 3F8UB 4HCRA 5D96C 2C1OB 3IFNL 1XEDA 4YZFE 4XWGL 2NQCA 2VSCA 2P7TA 4S1QL 1J1OH 5I8EB 1RIUL 4UDTB 4ONGH 1A7NL 1S7VA 4WFED 1NCCH 5EUOB 5AZEH 4RGOH 2OR8A 3UO1H 5DGRA 2R0WH 3HAEG 2Q3AA 2ORBH 1GGCL 1I9RH 2GCYB 4G6ML 4JVWA 2B1HL 5F44A 4X7EC 1T04B 4ACPA 3AVEA 1EERB 4J3XA 4TNVK 5E4IA 2AP2A 3BO8A 3G6AA 4NC2B 5J56B 1T2QH 1OPGH 4ODHH 1P7QA 1MI5B 2D31A 4ZXBD 4LLMA 4F8TA 5FUCC 4NZUH 3SDDC 1FIEA 3D18A 1MRCH 5ICXB 4EXKA 5I1IL 1UWEH 3WIHL 3BIAX 5I1EL 3L3HB 1YUHA 4HT1L 3C60B 1H3PL 4UTAH 4MA7H 1MCKA 2KDGA 2M2DA 5K9OA 2VLRD 2F53E 43CAB 2WINB 5C1MB 3CFEB 1MCOL 4N0YL 5E7BA 4C57C 3OR7B 3P3YA 4KU1A 4ZO8A 3GI9L 1MQ8A 5FB8B 1YMMA 2DQDL 4HZAA 2BNRE 2OBGA 1T6VN 5IB1A 1GOFA 4QOKE 1FVEA 4J1UB 2GSGB 4YDKL 4UIKH 5TF1L 1RURL 2ZG2A 1Z2KA 3SKMA 4JPKH 1NFKA 5MI0B 5K9JL 2SEBB 4KTDL 2DKSA 3VJ6B 2UYLB 5FUOH 2APFA 4OGAC 2NW2A 5IB5B 3QI9D 4AIOA 1FE8H 1Y6KR 3RWHA 2P1YA 4JY5H 4JZNA 4FQXA 3Q6GL 1DQTA 3DARA 3MRIB 2BVUA 1X4XA 2XQBH 2R2HB 3GNML 3F65A 3WKML 1FYTD 1U8JB 2BSSB 2RBLA 1FJ1A 3KPMA 1YEDB 4PJ5B 3EDDA 1I8MA 3NPSC 3DLQR 4NN5B 2DTMH 5IGXL 4FQXC 1FGVL 5H37H 8FABA 3BUYB 2D7NA 3HCVA 4YBQC 2YXFA 1S5IH 3MQIA 4QXTA 1PEZA 2EDWA 4TUKH 5DMKA 4PR5B 3FJTA 2RCSH 4R0LB 2FYYB 4HC1H 5GRVL 4CVXA 3VXRA 2CLRA 2AV7B 1YPZF 3V7AG 2X4TB 2OP4L 1OQXA 1UZ6E 3G6JB 1P4BL 4U0RC 5DK2A 3M17B 4MJ4A 4OCWL 2YS4A 4XVSL 3L9RB 2BNUA 4KMTH 2DQEH 4J4PA 3VXSE 1YEGL 5E5MB 2YWYA 1MLCB 1YECH 3AMLA 4MQXC 5JQ6L 4XTRC 4NQSA 1BOYA 3RZCB 3LH2H 1N5YH 1UM4H 4Y7MA 4W4NA 1HHHB 3VXMB 3B6SB 4J4PC 4PJGB 3SGEH 4HC1A 4EVNA 2B39A 3F12A 4HLZG 4DUVA 3BH8A 2YPVH 1S7SB 5HYQA 4HPYH 1I1YB 2EKJA 3MLPA 5E2JA 2O5YH 3TA3B 5KANG 3RWEB 1JI1A 2BVQA 1LEKA 3U0WH 5C0CB 2QKIB 1ZHKB 1CGSH 1JHLH 5HPOA 3ARDA 3X14B 2LVCA 2ICWI 3KPOA 2AK4B 4PIRF 1WZ1L 5T5FH 3IS1X 3LEVH 5J6GA 4FQHA 5FKPB 4ISVA 1AXTH 3HB3C 1EEZB 3L3GB 4MD0B 5GRJL 3UYOD 2JE8A 1K4DB 3OQ3B 2VAAB 4WI7A 5DJ6B 3FB8A 3BHBA 4PJBF 1D6VH 3N06B 3M45A 4KGJA 3QXTA 3ZE1F 1FGNL 2HT4D 3ILPA 3LSOB 4DN4L 4XC1L 1MREL 2E5EA 2EDDA 4LVOC 4WO4B 5FYKH 1LO2H 2IH3A 4ODSL 2CKBL 4M6OL 4RIRB 5DRWA 5C0BD 5HD8C 5FHBL 2A74B 3GKWH 3OSKA 3P0GB 1UVQA 3HNVL 1T0NA 4ALAH 1NLDH 1QFUL 4KKLC 4MJIB 4Y88A 4YH6A 2I9TB 4AZ8A 3MRJA 4BK5A 3T0EC 3HZMA 4MA1B 4XB7A 5E95B 4JG1L 4WI9A 3UCRA 1JWSA 1QOKA 4JFHD 3BT2H 4NQXA 1FZKA 4KK5C 1TZGH 4C54A 4BZ1H 2W60B 1TTGA 1S3KH 3MFFA 4WEUD 4JO3L 3GSQA 1DP0A 1FN4A 3DSNA 4NC0B 4XNYL 1ND0A 3SBWC 3VA6A 1VHPA 2YUZA 2ZCKL 1XGQA 1JZ6A 4NO0D 1JFQL 1I7ZA 4HUKB 5FA4A 5DJDB 4KJPC 4LAJH 4MNGE 2FJHB 3VMNA 5J7CC 3GRWL 2ZKHH 5D7LB 5TFSL 5I76B 1IAIH 3SQOH 3CDFA 3DGGA 1WWCA 3ZT6A 1MJUH 1G6VK 2IANB 4Y5XA 3VRLE 1TVBB 3SN6N 2MJWA 5CJBA 1EZVY 4JFEE 1QG3A 1I1AD 3QG7H 5FGRA 1F3JB 3VGGA 3VFNB 5I1AB 4YC2B 3S3SA 2X4RB 3MLTB 3N9GH 1N64H 4AIZB 1INQB 1NSNL 1FNEA 4XBEL 3CU7A 3I84A 4JFZH 1DQQA 3HN3A 4JFPA 2H2SC 4ZAKD 1NDGB 1JMZA 2FO4B 3QDJD 3MRLB 3O4LA 3QIWD 3V6OA 3CAFA 2YD9A 5JZ7D 3LIZL 3V0WL 3HI1A 3K46A 4JDVB 1EHLL 1QACA 3ZDXF 3BAEH 2DL9A 1NFDA 2VXTL 5IBUG 1ZWIB 5DUMH 4Y4HC 3WEXA 4JM2B 1QNZL 1X5XA 3V6OC 1QBLL 4FFWD 3S4SB 4LLQB 3OTTA 4GRWF 4D9LL 3QB7C 1JYNA 1OSZA 3KJ4B 1VFAA 3HLAA 4OM1H 2JCCA 1EAPB 1AGEB 4FZEH 3MV9B 2NY2B 4D9QE 1QR1B 2VABB 2Q86A 4K3EH 1FG2A 2BRQA 5GSRA 3LHPL 1ADQL 3KLHC 1S7QA 5F3BB 3SDDD 2J88H 3FHAA 5F1NB 2DWDA 4GUPB 1FFQA 5C08B 4TSCH 3VXOB 4NP4H 2YPKA 3LOWA 4Z18A 5I1HH 4URTB 3TH4T 4K3JL 5IEKB 2OXHA 1DQJA 1JWUA 5CKGA 4FQQB 5CHNA 4P49A 5IMKA 1BJ1H 1XF3B 3CLFH 2DIBA 3GSNB 4L4TD 4RWYH 3V5DA 1RJYB 1KBGL 3CCHA 4NWTH 4PRHA 4WUUB 5DURD 2V17L 2G5BB 4LPYA 1OTTC 1BHGA 2Y06L 4X98A 3C5ZB 3QIUD 5AZ2H 4WJ5B 2W0FA 4KGLA 3ULVC 5ICZA 1NPUA 2A38A 4KRPD 1HNGA 2H32B 4K2UL 5F7MC 4YDJA 5DTFA 3QPXL 5EU3B 2BC4A 1IMHC 4JFFD 4CU8A 5I74B 3ESUF 5D1XC 3REVA 5IVXA 1BAFL 4K9EH 4U1SA 3AM8C 3GUTA 2MPAL 1IL1A 1YN7B 4O4YL 4GKNB 1GGBL 3IJHB 1PG7X 4H26B 1XH3A 1TQCB 1ORQB 5MHSE 2ADFH 2LABA 4OGXL 5SV4A 4P2CG 4WEBL 1O7VA 4Q9RL 4QEGA 3CSPA 1ZT7B 2XKNB 4U6YB 3K74B 5TE7H 1JUFB 3VXTA 1II4E 2XN9E 1D9KB 1ZLUH 4M1GL 4Z5RB 2ZNXA 1K9TA 2VZOA 4LCUA 1FVDB 3FQRB 1RK1A 4ZPVB 1UXWB 1Z5LB 5KSBF 1G6RH 1WBYA 3WXWH 1S8DB 3EOYG 4KKAD 3H9SE 4P2RD 2ZSVB 1LO5B 2VLME 3O4LE 4GW4A 4HBQA 4RGMB 3JUZA 4PV9A 4LEXL 3SO3B 1AO7E 4KHXH 3L3KB 5D5MA 1I85C 5BW7A 4LPVA 2P43B 4K9EC 4GAJH 1S78C 1B4RA 3L5XH 4TTGA 1IGMH 3RTQA 4C56E 2AXGA 1PZUB 5LXGL 5C0JA 3IF1A 1HQ4B 2DL2A 3PGCB 1G6RA 4MQXD 5FYLH 2F9BT 3FL7A 2D9QB 3JTTB 1U8NB 2A1WH 2X4QA 3RTQC 4LCCB 5FYJD 1S9YB 5IIEB 5L8JB 5AWNL 1Q9KB 2Q76B 5IM7B 3CFDB 5E9DE 1BLNA 5F70A 2VH5L 4NFCA 4JPWL 4PJ8A 4WFHE 3MV7E 3UZQA 1QLEL 5EO9B 4GSDH 2MSPA 5D9SA 2CO7B 3NH7H 3QA3B 3VFUA 1DDHB 1GSMA 4OLZH 3QEQB 4YXKL 5F1SA 3SDXA 3L95A 1HXMA 1IC5L 1F6FB 3SDAC 3P4MB 3RL2A 4G5ZH 4Y4KA 3AU1A 3S5LB 4IM8A 4W4OA 3I2CH 2YD7A 5BV7B 2GJZB 4ZFOA 5F9JB 3D39A 5DRXA 3Q6FA 2P5WA 4RMSA 3WE6A 3AS1A 5HXMA 3IFLH 3QEGH 4LLYB 3HB3D 3VXPA 4F15B 4JREC 3VFOB 4Y4KC 2ADJB 1RAMA 4LMQI 4PRAA 5HVHB 4WU7A 2BK8A 2LTQC 3C9NB 3OBAA 3QUMH 4LGPB 4FABH 4LPWA 1FL6A 1MCWW 3GSNL 3THMH 3O2VL 5IW6A 5DHYA 4YXHL 3CFKB 2AAVA 2QLVB 4NHUA 1F11B 3PABA 5AD0A 5E5RB 3VFSA 4LSRL 1ACYL 1H5BA 3MA9L 3MRNB 2BOCB 4JPIA 2VR5A 5CSBA 1I4FB 5JOPE 1R3HB 1OARL 1MFNA 3OXSB 3BWUC 3G5ZB 3LKNB 2ESVD 3DX6A 3QEUA 2VUOA 3DURB 3QUMA 4M00A 1C08A 1DBBL 4ZOBA 5HHOB 5MENB 1NJ9B 3UX9B 2WANA 3NCMA 2GTZA 3FONA 5C0NC 1DE4A 3I6GA 4UTBL 2IAMB 5GZNC 1FIGL 2V2TA 1O7SA 3IU3A 3H9HA 3VFRB 1UKTA 2DLFL 4HKBB 4S1SH 4LPXA 2KQNA 4JM4L 2NXYB 3UC0L 2HKHL 2FECL 5JHDA 1FL3A 1S9WA 1FFOA 1KJ2B 4X7FC 3OAZK 3MSPA 3EBAA 3PDOA 4KK8C 4PGCB 5I1DA 5K59F 4HS8L 2Z35A 4GBXB 3SE8L 5MEPB 3ZL4L 2YRZA 3T1FA 3QDGE 2GITB 3MLZH 5EC1A 1BQHG 1HKLL 1KUMA 5CJOH 3O8XB 2HH0H 4FTVB 1DLHB 5IFAL 1WV7T 1L7TL 4JQXC 1BBDL 3CFCH 1ONQA 3GMQA 3ALWA 3TN0A 4Y5VA 3FB5B 3U0PB 1GZQB 4OT1H 4OZGE 1P2CA 3J7HA 4XWOC 5I8OH 2H2SD 2VWEC 5F9WC 5GISH 3BKYL 3MRGA 5JXEA 2R8SL 5GGSA 1WAAA 4G6JH 3GI8L 3TN0C 1CXKA 2QQKH 2HFEA 1SJHB 2DMBA 3RI5K 4YHOH 4FNLH 2X09A 1AHWA 2VISA 1BM3L 2NY0D 2F19H 1OWRM 3RIFK 4Y4HD 4EOWH 4XP5L 5CIPH 4PJGF 5JXEC 4KK9D 4M7JL 4XMPH 2O5ZL 1IEBB 1MFDH 2HJLA 4D8PB 1T0MA 2R23A 1VEPA 1UM5L 5DDHA 2AJVL 3KJ6H 5EBLA 5E24E 1YQ2A 1FBIH 1JZ5A 1S7WB 1J8HA 3TBVA 1AHWC 4E42B 3SDCC 5TE6L 4OQTH 4ODVL 4NOBA 5CGTA 3H6JA 2E6JA 4Z77A 1U8MB 2ARWA 4MNHA 3TBYB 1WISA 5F7KC 3H2WA 4JHAL 1S9VB 1TDQA 5BV7L 3NCCB 3BP7B 4OLYL 3TBTB 5EIIA 4BSVA 5CIPA 1W72L 1RK0B 2YR3A 5C92A 3EYSH 2FJGA 2XIDA 4HAGA 1RZFL 1CL7H 4L3EB 3GBNL 1PYWA 4Z0XB 3F6IA 3QNXB 3KPPB 5DUBA 3KPRB 4P5KB 5FKAA 1SMAA 1PZ5B 5EORL 1KYOJ 4OCSH 1PEWA 4WW2C 1J0ZA 1B2WL 1ZA3A 2BOBA 3ULVD 3RHWK 5DD3L 4R8WH 4EDXB 5L7XH 4BSWA 1YMHB 4TSBH 1LP9A 1KC5H 1TFHA 1I1FA 2EEAA 3NFNB 3T2PA 5D1XD 1QRNA 4KTEL 4N8CL 2ZUTA 1N6QH 3VFWB 5ESQA 4PJ7B 4GKSA 4MHHG 4U1HB 4CN4A 5I75B 3BSZL 3LPFA 1KPVB 2F54A 4M48L 5D7IF 1I7UA 1KG0B 1A02N 2FIKB 1IVLA 5ISZB 4UOJA 1N7MH 1KJVA 3U4BL 2EDYA 4ONFH 2XFXA 4JKKA 2XA8H 1JTPA 1MY5A 1FH5L 5F7WC 4LNRA 2HRLA 3VG0L 3TPUA 4DJMA 5I16A 5T3XH 5CAYB 5TDNB 4NQCE 1YEFL 1LO0L 2X70B 4KK6D 4U1NB 4M03A 3KYNA 1RZJH 4CAGA 2PTVA 5ID1B 2FEDD 3KPLB 4FMFA 1S78D 4PJEE 1VGKB 4WTWA 2FD6H 2PYEB 2R29L 1T1YA 3RA7L 5A16A 3GJFH 3X3GL 4QXGL 1AFVH 4N8VG 4W6WB 2R0KH 1NAMB 4ODXB 3KPSD 1W2KT 4PJXE 5JMRA 2R2EA 4ELMF 4F33B 1A7BA 5F89A 5I1JL 2X4OA 4XBPB 3NZHH 1C7SA 3FQXA 4CDGC 4OF8A 3DVFA 3C08H 1OAUL 1JPGA 2QHRH 3CH8A 2IGFH 1SVCP 3ZSSA 4JM2F 1OW0C 1HZHH 1KULA 1NGWA 4POZD 3GJFA 4RRPG 4QTIL 1PG7L 3NTCH 1RZJC 3O81A 4C4KT 3KXFB 4MD5A 1F4AA 5T1DH 3VD5A 1BREA 1TNMA 1OTSD 5GSVB 2HWZL 3GMPB 1S7RB 3ZT7A 2R4RH 2IPKA 3HFMH 1YNLH 3QRFM 1TQBC 5DA0B 1N8ZB 4RX4A 5E6IB 1NC2D 4OIAA 4QF1B 5FAAA 5GZOC 5DRNB 5F7UA 1CBVH 3V6FA 3MYJB 3T0XA 4OZIE 4P46D 1U92B 4JGMA 5EU6E 2F74A 3UTSA 5F9OL 4PJHF 5FYLD 4ZXBA 3OKEA 5IFJA 4F9PA 4GH7B 4P23C 4EI5B 3RQ3A 3S88H 1JHTB 2BNQA 2EIZA 3DV4A 3MLSL 4Z7UA 3BKCH 5SWSB 1QSZA 1B6DA 4NQED 2G9HB 3VFVA 1VGEH 1X5YA 4L5FH 3QXAA 2YUXA 4KPHL 2DQTL 2HVKA 5E5UB 1E6JL 2Q6WB 5C09B 4LSQH 1ORSB 2O93L 2RGSA 1DQLL 4GG6A 4JRYD 3D85B 1A14H 3F5WA 4F8QA 1QLFB 5IBTH 2EDRA 3HRPA 1QVOB 5D7JB 2OJZH 2OTWB 1I7RB 2V2XA 3QT2A 3S37X 4ZNEE 1U8QB 3PGDB 4XPTH 4OIIL 3CDCA 4R3SA 5GS2H 2BJML 3LRSA 2D2OA 1QSEE 4QRPE 5GZND 1DQDH 4C58B 1L0QA 4WHTA 5GS0L 5ILTL 2BVEA 2V5SA 3QI9A 3TVMD 1BMGA 3RU8L 1LK3H 1IQWL 1MPAH 1E6OH 1HCVA 1MCPH 2YPLD 4NO5B 1U8KB 3ARRA 2I5YL 5MEOA 1RIVH 3OKKA 1JPFA 1HDMA 3MUJA 4OCXH 4GG8A 3MROA 3DUUA 1NL0H 1SYSA 2OL3B 4Y5YA 2C3WA 4HUVA 2GHWB 1GC1L 4PS4L 5GQBA 3FO0L 3MRFA 1NLBH 2ZNWA 1EDQA 4F9LA 1JMXA 3CXHJ 3QUZB 4GRMB 1R5WB 5HHXH 4NBYB 1AD9A 2FGWL 5J11C 4X6BA 5HJ3A 3BGMB 4Y5YC 5BJTA 1A5FL 4OGYL 3ARXA 4LSPH 1LVEA 4M43H 4LHUG 4PY7B 4D0BA 2VDPH 1KENH 5E8OB 4CVUA 5FEBA 2Z93A 2V9RA 3GBMH 4WFEE 4DUWA 1U8LA 1I8IA 1I3GH 4QRRB 2X4PA 4PLJD 3IXAA 4DW2L 1NGXA 4Q6YA 3BIKB 3MLWH 3EZ8A 3W2DH 5KVFL 3L5WA 2DQHH 3HE6B 1CE1H 3HZKB 2Y72A 4P4KC 4M62L 5ADPL 5E70A 2DWEA 4HPOL 4K23H 1YJDL 3SDCD 1KN4L 4N5EC 2Z4QB 3BZ4A 1QD0A 1KPRB 2CRZA 3D48R 5DEZA 1RUPH 5J3HC 1N4XL 2WIIB 5C0EA 2VZVA 2B5IC 2NNAA 3DXAB 3PL6D 3DIFA 4PJ9D 4NO2B 2EH7H 4HXAL 2PXYA 1MCNA 4TUJA 5DYOB 2C3VB 2WBWB 3QCVH 1MCJA 4RGNB 2HN7B 3JV5A 1R24A 2X1PA 2ZUWA 2VLRE 3L3DB 3DUSB 4M8VA 1AIFB 1A3RL 4M5YL 4X6DF 3HPJB 3G6DH 2I9LB 4D94A 3VD4A 2PXYC 3DHJA 3VWJA 3OV6A 1J1PL 4QLRA 4F7EA 3DX7B 2O61B 3UTQA 3D87B 3IDNB 4S0SD 1OM3L 4JKMA 3CIQA 3B8SA 3VWJC 1IEAA 4Q2ZB 2VDKL 5E2TH 1LO3L 3FT2B 3EW3B 4P9HH 1LDPL 3ARTA 1F45A 2FX7L 3LS5L 3SY0A 1Z9SA 3PWPB 1GZPB 1RUMH 3VRJB 1A7RH 4KKNA 3QISA 3WV0A 3ZHLA 5L9DH 1RZIA 4FFYL 4OLXL 4XCNB 1MEXH 5B4MD 3VDBA 2ICCA 4LVNC 5ACZB 2FB4L 1FYTE 2X89A 4FZ8L 2IG2H 4QHKI 3LEXA 2NW3A 2YUVA 3I75B 3FB6B 2AEQL 3TO4B 2FL5A 4OUUA 4WHCA 5I2IB 1AQKL 4IRSB 4YHZL 3QAZB 1BZ7B 1B0WA 2AJ3B 5A3IC 5E2UL 3V0VB 5L2KA 2EYSB 1MCSA 1FZOA 3U0TA 1CIUA 4FQ1L 5IEHB 1Q1JL 2A77L 4P9HC 15C8H 3VI4F 3BX7C 2Y7QB 5EPMB 3CC5B 5DR5H 3ZE0E 3UTTB 3FO2A 4RNRB 4AENA 4DOHB 2NLJA 1M05A 2P42B 1KB5B 2H3NB 4RAVA 1A6AB 5LKNA 1UYWL 5F9AC 1RUAH 5ENWA 2PO6B 1M7IA 2JJWA 2OL3L 3L3IB 4MB3A 4FP8H 3ZKND 2XRAH 1AXIB 4X7SH 3ARUA 3FRPA 2EXYD 1ZA6A 2W65A 4OGZA 1XF2A 3DO7B 4XVUC 5JQHC 3H8NA 3GMOB 4IBLT 3O9WB 1C7TA 1GHFH 5IROA 3ARWA 1KCLA 1SMOA 5DO2C 2C3HA 3C8KA 1UZ8B 4LCWA 5GHWL 3NACL 4L8BA 3MRRB 4HWEL 2YBRB 2AEWA 1HIMH 3NABH 3NGBB 1GYAA 1CYGA 4HV8B 2EC9U 5FA3A 3K4DA 2HTLD 2UWEE 3TT1L 2GJ6D 5BRZD 1KYOK 4Y1AB 4M9PA 3WNOA 1XCTB 3HNTH 4JZJB 4P5MB 3TJHD 4LDOB 3VRIB 3OR6B 2HFTA 1IC4L 4PRDA 3VH8A 5CJXC 1ODAA 2EXWD 2PTTA 4F7MB 5C86A 1TTUA 1YPZA 5ANMB 3C2AL 3WL9A 1WLHA 1ROWA 2IALA 3V0AC 3MV8A 1OCWL 1LE5A 5GZOD 3MRCB 2X9WA 3P9MA 4R7NB 5AYUH 3O6FD 1CLOH 1SY6L 3NCYP 1HSAB 3QIBA 3QUXC 4FG6D 4LKCB 1KPUB 2FDBP 4PJAF 1IJ9A 4AL8H 4OKDA 5BMFL 1MJ8L 4P23D 1TZIB 4HS3A 4M61B 5MERA 3EYVB 5J12B 4XAKD 4G8FB 4MAYB 1E28B 4P3CL 5MEQB 1DL7L 3K80A 5C0BE 4KZEH 4Z95H 5BS0D 3HHRB 2GY5A 4G6FD 1UEYA 3FQWA 3W0WE 5KSAB 5ACLA 4XHJC 1ITBB 1K8IA 1SJVA 1J1XH 5HI5C 2FX9H 1MNUH 4NHCL 3NIFF 2NY1C 3QIUA 3K2UH 1CFSB 4WV1B 4JFHE 5E8EB 1D5IH 4BH8A 4XVJL 5HDQH 2XG4A 3BDYL 1E27A 4KAQH 4PTUA 4PJ7F 5JDSA 1F58L 1A4KB 5I17B 3BKJH 5HY9A 1AKJB 5KOVC 2H9GA 2HFGL 3BPCA 4GKOA 2BP3A 4X9BA 4XGZB 4Z7WB 3PDGA 4MA3B 3SDYH 4HKZA 3QHFH 2Z9TA 3MO1B 1JHKH 3G5XA 4FQCH 1PQZB 4YGVB 4OCYL 5IF0A 4PB9H 3HE7D 1HHJA 1PDKA 1SYVA 1CXLA 4X5WA 1FVCA 6CGTA 1Z9OA 5H37G 2GT9A 2NXZC 2Z92A 2EH8H 4L8DB 4S1RL 4WFFD 1D5ZA 4XCCL 4TTDD 1F5WA 4ZMAT 5F7EH 3QR2A 1VADA 1W8NA 1T4KB 4HIHB 5FIEA 3MLXL 2VMFA 3V5HA 3IDMB 2WUBH 3T2QA 5AG8A 3HG1A 4GQ9H 1N3NB 2H1PH 4G80A 4JVPA 4FQPA 1D6EB 3UTPE 1ZEAL 5GS1B 2DM7A 2AI0L 3CFJB 4P2RA 1QFOA 5ALCL 3QDJE 1CF8H 4DFHA 3CFIC 3RFZC 5DEGB 3OX8B 3DBXB 1BVLA 1NANI 4JFDA 3G08A 3RL1A 1CT8B 3GMRB 3IVKA 3BPNC 5DJYB 2HJKA 5DWUL 2AV1A 1EMTH 2VZSA 5J57B 5ICYA 1EFXD 3DMMA 4KDTA 3S3JA 1DSFL 5ACMA 2DBLH 3WUWB 4Y4FC 4LCIL 2BDNH 3P11L 3X11B 3EYFA 3UJJH 4LP4A 1MIEL 5JW5B 3HUJA 3KNBB 2DIAA 1TTFA 4XWGH 1JNJA 3DMMC 4WDIA 4QT5B 4X9FA 3W39A 5CBAB 4QWWD 2IEPA 4G8GA 3S37L 3C09B 1A7NH 2UUDK 2OZ4H 2XQYK 2E9IA 3ZKQD 3MRMA 4WUKH 4HIEA 3S36X 1G9ML 3L7EA 4U1MB 4XBGB 1AQDA 1QEWB 3U48A 3TZVB 2YD2A 4OBRA 2IWGA 2RJMA 4G7VH 4JFYA 4EXPX 1JWMB 1MUJB 1FFNA 1KJ3L 4L4TE 3EYOA 4PLKC 2J7LA 2PW2B 3O11B 1JNNH 35C8H 4G6AC 1I7TB 4PRBB 1KLUA 5CUSL 2XZAH 4PJIF 3WIHH 2P48B 5I1EH 2OZ4A 4OZHA 3WDIA 3QULA 5T3ZD 4ORGB 2IMMA 3O3BA 3A6BL 1MCOH 4MCYA 2Y1VA 2VUYA 2F53B 4JFFE 3BZEA 1U2HA 1EO8L 2R4SL 3FFDB 3GI9H 5HGHA 3LS4H 4AK1A 4BFGA 2DQGL 2E9BA 3STZA 4K7PY 3EGSA 2EDKA 2V9QA 3ARBA 2ICWA 2BNRB 4DN3H 2HA1A 3Q2CA 4PJBE 1HINL 4HIIA 4QOKB 3TJEH 1ETZA 3U46A 2OK0H 2NY4B 2YC1B 3WIHA 5TF1H 2VN4A 5K33A 3P0YL 5F93C 2AERT 1EXUA 2Y6SC 5TQ2H 2ICES 3RUGA 3ARBC 3B2UC 4OZFG 4XVTH 5F96H 5K9JH 5D1ZD 2RB8A 4OZ4A 2W38A 1IAIM 3FQNA 5HGDB 2ED9A 1RFDL 3FOMA 1S5HB 4JG0L 3Q6GH 3MMEB 1HYSD 2D4FA 1ES0B 4P2RE 1OGAD 3QFDB 1U3ZA 3WKMH 3QUYB 1S7UB 4U0QB 1UH4A 3WFHB 4CN6A 1VPOL 5AYQA 4HGMA 3EO0B 3OG4B 1T7XA 4F58L 2D7PA 5IKCA 4MJ5A 3ETBF 5TDOB 4ODWB 3P4NA 5C0AD 5HBBA 1T22A 1MLBB 3QQ3A 5T1LD 3MTRA 2B7DT 4X6EB 5FYJE 2OCFD 3LAFA 3TFKD 4X4ZA 4PY8I 3TYFA 1P4BH 5DO2D 4F57L 5I1CH 1BFVL 2AXHA 4XVSH 4NC1E 2H26A 1R3IL 5C8JA 1T66C 5IESH 1S7VB 3BP6A 3FT4B 1N0XL 4ZDHB 2E7CA 3VXSB 3E6FA 2FHCA 5IK3A 5JQ6H 2BERA 5D6CB 4F2MA 1FV1B 2A9NL 3G6AB 5F6HJ 3P9WB 2EDEA 2CSPA 5I73B 1JF5A 2PCPA 1P7HL 3JWDH 4HUWA 1L6XA 3PP4H 3FTGA 2X2YA 3TF7C 4GRWE 3I6KA 1YNTB 3JV6A 2XICA 3QUXD 2VC2L 4OD2B 2MCG1 2QQNH 3C6LC 4UAOB 2C1OA 1WZ1H 3HS0A 1RUKH 5CEXB 2WK2A 4D0DB 4PRNB 4EEEA 5EBMB 5I8EA 3VD3A 1OTUC 2OJEB 4UDTA 5KS9F 1CI5A 4CMHB 3BXNB 2MCPL 4EI6B 1Z3GH 1KGCD 2E9JA 5EUOA 1ZVHA 3SOBL 3HR5A 1DVFC 5DVLA 1AJ7H 1FGNH 2ESVE 1T04A 4MYWB 5HI5D 4BQCA 1MREH 3JWDC 1NDMB 3EFDL 4MS8C 1KEGL 4AEHH 3SGJA 5E2VL 2WZPD 1MI5A 4Z7OF 5IQ7H 5HHNB 3RVTC 1RU9L 2NR6D 5CJ5A 3T0WA 1F4YL 3L3HA 3R4DA 3C60A 3SGJC 3T77A 3DSFL 1IGIH 1X5ZA 43CAA 2WINA 3ZSTA 3CFEA 2AEPL 5E8PA 3BPLB 4ZYKB 2VRAA 3OR7A 2LVEA 5IJKA 3D25B 4OQ1A 2ZUYA 2AABL 1DFBH 3C60C 3QRGH 2D7MA 4M8QB 1CLYL 1OAXL 4RBPK 4J1UA 4JO3H 4OB5L 3KAAA 3GK8H 5H8DA 1IGYA 2IFGA 1IQDB 2GSGA 2VR9A 1IM9B 4X6CF 2RHEA 5IJKC 5ITFA 3CUPB 1YEKL 3QO1B 3VGHA 4RZCA 5DK2B 4JFXB 4NQDD 5IHZB 1IILE 4IOSD 4UB0L 3GRWH 5TFSH 2CK0L 3G5VA 4P5TB 4XX1G 4MNGB 2UYLA 4X4MA 2BNUB 3V8OA 4UUJA 1NGZA 2VLKD 3TLRA 5IB5A 5KSBE 3MLUH 2VXSH 2Y36L 3MOBH 3ZTNH 5MI0C 4HCRL 4GXVL 1A8JH 4U05A 3MGOB 2R2HA 2FJFB 1NSNH 2BSSA 1U8JA 5JR1L 4C4KO 1YEDA 4Y4FD 4R7DB 1CLCA 4UOW1 4WHYG 3HR6A 4KMLB 2GIYA 1KN2L 1RZGA 2FR4B 5DXWA 3OPZH 3BUYA 1HYRC 4U3CA 4PJCF 5E08L 3V0WH 1OB1B 1EHLH 2PKDA 1XGYH 4I0CC 2DI8A 2VXTH 3M1BB 2FO1A 4P0DA 1MRFL 4NN5C 4LNVA 4OLWL 4PR5A 4NZRH 4LARL 2R0LH 3ARDB 2FYYA 2X9XA 4PJDF 2OMBA 4Y16D 1CVRA 1IKNC 3WFCH 1YEHL 5JA9A 1CGYA 2AV7A 3VE0A 4E41D 5BOZG 2X4TA 4D9LH 5HI4C 3G6JA 4TVPD 3VFTB 3M17A 1FLTX 2A6DA 3DVNB 3MNWB 3L9RA 4R0LC 2V5TA 4YR6B 4IRJD 3W9DB 4C55A 1NCCL 3FB8B 5AZEL 3BHBB 5E5MA 3GBLA 1ADQH 5EFIB 1MLCA 1U0QA 4R6UA 4BH7B 5C9KA 4FXKB 2R0WL 5F97E 1I9RL 3AUVA 3H7LA 1HWHB 1EAJA 3EJJX 3RZCA 4JHWH 4JN2B 3ULVE 3NIGE 1GXEA 1HHHA 3VXMA 4PJGA 3VW3L 1OPGL 5J1SC 3ARQA 3S97C 2VN7A 1S7SA 1A6VH 4I5BB 4KJYB 4L4VD 2XXMB 2V17H 3RZCC 1I1YA 3CSBA 1YY8B 3RWEA 3P73A 2Y06H 4YHLH 4FQJH 2QKIA 1ZHKA 1HXYA 2R69H 3X14A 5DMIL 2V6HA 5J8OA 2AK4A 2Y6SD 1C12B 3TA3C 4XP4H 5FKPA 1BAFH 3L3GA 3VD7A 3GSQB 2LE9A 4O4YH 4UILH 2B4CH 1K4DA 5DJ6A 1OP3K 1ZLVH 3ZO0A 4Z7WF 3U36A 4U31A 4UIKL 2FHFA 4MXVE 4OGXH 5T33H 2C7UA 2J2ZA 5L88H 3S36L 3LSOA 3G9AB 1AI1H 1GRWA 1JNHB 2UY6A 5CEZD 4WO4A 4Y5XB 3CLEL 4RIRA 1NBVH 4WGWB 3QQ4B 1FE8L 3WFBH 4JY5L 1YC7A 2XN9B 3BD3A 2YPLA 3ILQD 4OCLC 4KH2A 4HS6B 2XQBL 1QPPA 2A74A 2RAMA 4XNQB 2E7HA 4CW1B 1FSKB 4WO4C 1UJ3B 1Z9MA 5C07E 2AXFA 1Y6MR 5K59E 1JZ2A 3KPSE 2W0KA 3H9SB 4LEXH 3HPLB 2OXGA 1FNGB 3O4LB 4BYHA 3I6LD 1WFOA 5D7IA 3DTXA 1AO7B 3MUGA 3PNWB 5EO1B 1KFAH 1S5IL 2NMSA 4QXWA 2B4CC 2W60A 4TUKL 5I8KH 2XTJD 4XCEB 2ADGA 1T66D 4C56B 2RCSL 4H5SB 3OF6A 4HC1L 1MCIA 1VFMA 4JQVC 3A6CH 3TNMA 2NY3B 1R3JA 1KIQB 4LPTA 2FJHA 4LRIC 4HK3J 1I8KB 1WTGT 5D7LA 5I76A 3ZE2F 4XX1E 5D70L 2Q86B 4YZFF 1LNUB 5C0FB 1DQMH 2Z91B 1IGCH 4KMTL 5DJ8B 2IANA 2VH5H 1S7QB 5E9DB 1TVBA 2AJUH 3PWUB 3WXVL 3AXLB 3MV7B 5I1AA 1F3JA 2GW5A 4LLVB 3VXUD 1QKZH 3D2UD 2X4RA 2YPKB 3LH2L 3MLTA 3IDYB 4AIZA 5FYLE 5DD1L 1INQA 4YXKH 1JWUB 3UPCA 3F7YB 3KDMB 4ODTL 1OAKH 4E5XB 2YPVL 4PJ9A 4ELMA 2FO4A 3CCHB 3C6LD 2CXGA 5F6IB 1CXIA 5SWQB 2O5YL 1L0XA 4JDVA 4NQEE 4MCZB 5ICZB 1LGVA 1JHLL 1A2YA 4ENED 4JM2A 5IBUB 5DTFB 2MTPA 1CQKA 4LLQA 3S4SA 4LF3B 3KYAA 1DVFD 1H9VA 4JRYE 2XI9A 3GSNH 5D7SL 5T5FL 4CMMB 1JGEB 3WMSA 1AC6A 1AXTL 1EAPA 1AGEA 3O2VH 2QJDA 3QYCA 5CMAB 5IT2H 2CR6A 4LBEB 1QR1A 3RX8A 4EIGB 4YXHH 4ONHB 1EBAA 5F7NC 1XH3B 3PWVB 3GHEL 3ZKMC 5AUMB 5F3BA 3HI5L 1S7XA 1D6VL 5F1NA 3KJ4C 1ACYH 3MA9H 2H32H 5C08A 3VXOA 1FLRH 3NCBB 5IEKA 5FYKL 3VXTB 1LO2L 4FQQA 4WW1B 1XF3A 1DBBH 2E8ZA 3FRUB 3SE4A 5D93B 1T89A 4UTBH 4WUUA 3KYKH 5KVMC 3GKWL 1FIGH 4ALAL 1NLDL 4KRLB 2DM4A 5IV2B 1FL5B 1T2XA 2DLFH 3C5ZA 3UDWA 2HKHH 3KR3H 4WJ5A 4OFIA 4PV9B 3SE4C 5D5MB 1X5HA 2XWJB 4GLRI 2MQCA 3AMKA 1CR9L 1F4XH 4UQ2B 5EU3A 3BT2L 3K2MC 3IDJB 4BZ1L 1E4KC 3C5ZC 4P2QD 2R15A 1S3KL 3UDWC 4PYHA 5M7QA 4DCQB 5GXBB 4HH9B 1YN7A 2P44B 4GKNA 3QDGB 3IJHA 3QXDB 4H26A 4K07A 1L7TH 1BBDH 2X4QB 3CVHA 5I30L 2E7BA 1ZT7A 2XKNA 4I48B 4OV6F 1IAIL 4U6YA 3SQOL 2PF6A 1N6UA 1INDH 1TQCC 4NCC1 1D9KA 4HKJA 4OZGB 4AQ1B 5FGSA 5B8CB 4I0PC 2C26A 4BKLB 1HHKA 4Z5RA 5JHLL 3QG7L 1FVDA 2R8SH 4EZMA 3SPVA 4ZPVA 1UXWA 3GI8H 1FDLL 4LP5A 3N9GL 3MA7B 4OF0A 4YPGB 2BRRH 1CICB 1HXMB 1WBXB 3DETD 1S8DA 4JFZL 5HHVH 2ZSVA 1MFAL 1D9KC 1ZSDB 4V1DD 4AEIH 4DKEH 3FQTA 1A21A 2ED7A 2O5ZH 3L3KA 5JIKA 4JRXD 1VFBB 1UM5H 3BN9C 1RZ7H 3FQUB 5HI4D 5BRZA 5DZOA 3KPNB 5TE6H 3UROR 3VXPB 4UBDC 3LN5B 1ZHNA 4ODVH 5D1QB 4RGMC 5DUML 3V2AR 2WBJB 1F3RB 2YN3A 3SO3C 4HFWA 4WU7B 1P84J 1HCFX 2WLZA 1HQ4A 2VDLL 3EOAB 3JSSA 3MXWL 3PGCA 1MHHB 1YEEH 4PRPE 4UNTA 4J23A 3SKJL 3JTTA 1GL4B 1U8NA 5BV7H 4OLYH 4QTHB 1KF9B 4FZEL 3ISWA 5IIEA 5DHYB 4FRWA 1I3VA 3O6FA 3BRDA 1Q9KA 2Q76A 1RZFH 5IM7A 4K3EL 3CFDA 2CH8A 2APXA 4NHUB 3GBNH 4DQOH 3PABB 5AD0B 3ROOB 1WVZA 3VFSB 2JK5B 4LCCC 2VDNH 4JPIB 4PJHE 2XA3A 1DDHA 5I1HL 4ZFGH 3QEQA 4JANB 4G7YH 5C0DB 3P4MA 4L1DA 1C08B 4LVHB 3QDMD 5DD3H 3CLFL 3S5LA 3L3JB 1YYLH 4RWYL 1MJ7L 5F9JA 2GTZB 2VITB 1DE4B 2FX8L 3C5JB 12E8L 5KANI 1U3HB 2I07B 3KLSA 4CU7A 4N8CH 3QJHB 5AZ2L 2ADJA 4Y2DB 5EU7C 5EG6C 1FL3B 3MBEB 1FFOB 5BV7C 4R97B 2ATPA 4HD9A 1WC7B 3C9NA 3BSZH 2Z35B 3KVQA 4NNPL 4LIQL 3SE9H 2Y23A 5JUEH 4F15C 4PRID 4K9EL 4CADA 5DJ0B 5HVHC 4YHPB 2KUTA 3K3QA 2BX5A 1F11A 2ADFL 2JJSA 2EDXA 3N1PC 2C4FU 1BX2B 3F6LA 3UZEA 1ONQB 1KJ2H 4H25B 4UNUA 3MRNA 2BOCA 3BDBA 1I4FA 4OF3A 1R3HA 1JYXA 1YEFH 1V3JA 2ZCLL 3OXSA 3G5ZA 4ESKA 3LKNA 4MAUH 4NQCB 2VLJE 5BVJB 3DURA 3JTSB 5HHOA 1A9BB 1M1SA 1G6RL 4YBHA 2VOTA 3PDDA 4MJID 2R29H 1NUFA 4V2BA 2VISB 5IB2B 3MCLH 1BOGB 3L6FA 4HKBA 5INCA 2EC9T 4P59L 4KHXL 2GJ6E 4RQQB 3MOAH 5BRZE 1KJ2A 4QY8B 4OSUH 2R23B 3MRDB 5HI3D 2IAMC 4PJXB 3L5XL 2OYPA 3TBVB 5I1JH 1SHMA 3DYMA 1IGML 4GBXA 4PGZA 5MEPA 2NXYC 4OFYD 2GITA 3RGVD 1BQSA 2WWMD 2C9AA 3O8XA 4FTVA 1DLHA 2CRYA 4I4WB 4NPYB 5DQ9A 3WHE1 2A1WL 4GBXC 4NYLA 5EIIB 4ZFOL 1X44A 1MHPH 1IC1A 1D3CA 1KXQE 1OF2B 3FB5A 3ZZ1A 1GZQA 1I9IH 5C6TL 2EIBA 3RDTA 1AR1D 4XAKE 5A2KH 3X12B 5DMGC 4OLZL 1SJHA 3MRBA 5BS0E 2MFNA 3QCUL 2BOBB 4OZIB 1KLGB 5F9DC 3I3BA 2APVA 5EU6B 1BPVA 1BD2E 1IEBA 2W1NA 4D8PA 3G5YB 3L1OH 1HHGB 4X6DE 3MV01 5BQ7B 1S7WA 5BO1H 1V3LA 4E42A 1UCBL 3TBWB 4GRLA 1XIWB 1BFSA 3EOTL 5CEYB 3U7WL 4AJ0A 5I18L 2FZ3B 4Y8AA 2APWA 4GKSB 1U8MA 3TBYA 2M8XA 3UPAA 2DQTH 2FBJH 4NOFA 3QUML 1E6JH 1PJ9A 1Y18B 3BE1L 4FABL 1S9VA 1HH6B 3BP7A 1DQLH 3TBTA 3THML 3B9EA 3MJGX 4PJAA 1RK0A 1U6AL 2HG5A 3P4LA 2XFXB 4N0CD 3HMXA 4G9FD 4NZDA 4WNQB 3ET9F 4KZDH 2YD1A 3FCTA 1H3GA 4OIIH 4WFFE 4Z0XA 5I16B 3QNXA 3KPPA 4APQD 1A6WH 5FXCH 3KPRA 4NBZB 1MFBL 4H8WH 1PZ5A 1QSEB 4QRPB 3QCTH 3VMOA 1FFPA 4MMXC 2VZTA 3CFBB 1IQWH 1J0JA 4EDXA 3JWOH 3EO9H 4QHUB 5C9JB 5IW1A 2I5YH 3NFNA 4H1LG 5CGMA 1W0VB 1CTOA 1KT2B 3QEHA 3IYLW 3VFWA 4PJ7A 3BQUA 4PS4H 3ZKXB 3WO3B 5F89B 4B7IA 1EFQA 2FIKA 2YK1H 5ISZA 2GK2A 2DBJA 3MLZL 3IAQA 2VKXA 1U8OA 4CU6A 5I6XB 2EZ0C 4PLOB 2HH0L 4LLAA 1UT9A 4I0PD 5I75C 1YN6B 2MOVA 1NGWB 5GS0C 4H8WC 4ZSOA 4YDLB 1NAMH 4LQ1A 5TDNA 4MD5B 3PF2A 4M3KB 4YHYB 1UKQA 3ARSA 4OT1L 3JWOC 4DW2H 4U1NA 5I8OL 3EZJB 5KVFH 3LKRB 5E6YA 2OM5A 4M6MH 2KPNA 4DVBB 2VL4A 5ID1A 1IBGL 1OHQA 3KPLA 4PGJA 4G6JL 4M62H 4R90L 1VGKA 4JFED 3ARFD 2PYEA 4B7LA 1YJDH 4FNLL 2YD6A 1GC1C 4NQUA 1N4XH 4ZXBB 3OKEB 5IFJB 4XMPL 4QRSA 1NAMA 4LSUL 1MFDL 1IEHA 2WUCH 2QTEA 4N8VB 1LO4H 5T3ZE 3KJ6L 1JBJA 2BNQB 1FBIL 1GOHA 2EIZB 4F33A 4NIKB 4X4YB 1X5FA 4XBPA 4F7CB 4PJFF 3GHBH 2VLRB 4M5YH 5KVEL 4P9MH 3QXAB 3T3PF 1J1PH 2HVKB 1E4XL 1UG9A 1OSPL 5C7XL 1X6NA 4LK4A 4PJAE 1OM3H 3QQ9D 3KXFA 4FN0A 1CK0H 5J06A 2DDQH 1F97A 2ZCHH 5GSVA 3ZDYE 3MRKA 2DJ4A 2VDKH 1K6QH 5I66B 5LQBH 1LDPH 1YJDC 4G8IB 1N8ZA 3LRSB 5E6IA 3RVXC 5HSFA 4ZQKA 1B6UA 2BSRB 4QF1A 2D7TL 4LASL 4FFYH 5F71A 3MYJA 1U92A 3QI9B 1P4IH 1EEYB 1F3DH 4O2FA 3NMEA 1QA9B 4R8WL 2FRGP 1OGAE 5L7XL 4TSBL 5E6IC 3NIFE 1KC5L 4FZ8H 1I1CA 4EI5A 3AS3A 3DX8B 3ARZA 1FYTB 5MP6L 1R3LB 1JHTA 4YK4B 5HYSG 4R4FH 1X5JA 2AEQH 1HDMB 5SWSA 1Q38A 5JORB 3T1WA 1AQKH 2MKLC 5IOPB 3FN0H 3SCMD 2G9HA 4ETQB 4B50A 4OI9A 4EI5C 5E2UH 5FCSH 1OWWA 5FCUH 5L8LB 5C0AE 4GQPH 1YYMH 1H8OA 3VCLB 2VDMH 2NY6D 4M6NH 2Q6WA 2QEJA 4FQ1H 5C09A 1ORSA 3AS2A 3D85A 1F2XK 1P6FA 1N7ML 2K7QA 4PV8A 3RY5A 3ARGD 2XA8L 1QVOA 5D7JA 1I7RA 4D0BB 2XWTB 2JELH 3CMGA 5BVPL 3PGDA 3LRGA 2GYSA 5B38G 4RMRA 2OL3H 5T3XL 4NRXB 1LK2B 1I8IB 1P84K 4H0IA 4W6XB 4TVSa 1GGYA 1X9QA 2ZSWA 4KJQD 4POUB 5KSVB 1NANH 5D7JC 1FQ9C 3L5WB 5F21B 5MEND 1XGUA 3DO3A 3DNKA 4NO5A 1U8KA 2H8PB 2FD6L 3NACH 4M1DL 3GIZH 2HLAB 5C0EB 4HWEH 3VFMB 1AFVL 3J8F7 5FGCE 4YHKL 4AG4L 3TT1H 2UWEB 5IVZB 4WFGD 3ZTJG 2V7NB 3JV4A 1WITA 4BJLA 4GRMA 3C08L 1T03H 4LOUD 3H3BC 3BGMA 2QHRL 3C2AH 3WNPA 5EZOL 2IGFL 2VL5B 1IE5A 3UTQB 2VR4A 3IB4A 5E8OA 5DMGD 3QUZC 3NTCL 1KGCE 4FFZL 5E00B 1LEIB 5T1DL 4UV4L 4QRRA 4FXGB 1HH9B 2R0ZL 4EN3D 3M07A 1CD9B 3BIKA 5DZLA 5FO9A 2P5ED 3SY0B 3HZKA 4WFHD 4ZUWB 2VQUA 1ZLWH 1CBVL 3BVNB 2R2BB 3RVUD 4P3CH 2Z4QA 1KPRA 4PJIE 3FN3A 1MCWM 4TULH 3HE6C 5C0BB 3A67H 4NO2A 4HF5H 1IAKB 1QP1A 3T4YA 4G9DA 5DYOA 2C3VA 4LFHD 2HN7A 2NW3B 2OI9B 1TJHH 4NHCH 3L3DA 3DUSA 3N1QC 3TO2B 1YY9D 2FL5B 4JKWA 1AIFA 3FFCE 2L4OA 4D3CH 2MQ3A 3HPJA 4XNUH 1HNFA 3JWNC 4KI5F 1A64A 3BDYH 4XVJH 1FP5A 4KWUA 4R26H 3QJFB 3MNZA 4MA8H 4OKVA 4ELKB 3DX7A 2O61A 1R5VB 4RGNC 5D2LE 2CGRL 4LSQL 2DYPD 3HMWH 5KS9A 2IPTH 2HFGH 2AKRB 3LRHA 1NGQL 1FO0B 3B9KD 5IBTL 4GJTB 2DD8L 3MPCA 4OCYH 4NO0B 4NQDE 5EZIL 4XPTL 3PWPA 4I77L 1GZPA 4BQ8A 4H0HB 3MNVB 1XAUA 2VLKE 4KVNL 3MGTB 1U36A 3D0VA 4XCNA 3FMGL 1M7DB 1VSCA 1LK3L 1IAOB 3NIDF 1I1AB 2EC8A 1E6OL 1GGIH 5ACZA 1MCPL 3C8KB 1BIIB 1KB5H 1ZEAH 3I75A 4TN9A 5ALCH 3FB6A 4OCXL 4PJEF 5DI8A 3TO4A 4ZNCD 4ZAKB 5I2IA 4IRSA 4QGTA 4W6YB 2EZ0D 5DF0A 3QIWB 4M5ZH 1BZ7A 2AJ3A 3MOQA 3V0VA 2QSQA 5GS0D 2YN5A 3QO0B 5DUPL 5DWUH 2Z31A 2NX5D 1NLBL 5IEHA 1DSFH 3TO4C 4LCIH 4IRSC 4Q97A 5DVMA 3P11H 3QAZC 4OLUH 1YPZB 5EPMA 3CC5A 1EPFA 4E41E 3UTTA 4RNRA 4LSPL 4X6FA 1LWRA 1AY1H 4TVPE 4M43L 1KB5A 1MIEH 4G6KH 4KXZI 5ERWA 1A6AA 2VDPL 3GDBA 1KENL 2PO6A 1YC8A 3E3QE 3L3IA 3UYRH 4OLEA 3P9MB 4LKXB 1B0RA 3SKNB 4HDIB 2NZ9C 3DO7A 3MLWL 1KCSH 3SDDB 2DQHL 3GMOA 3ECBB 2PO6C 4HS3B 3X3FL 3O9WA 2CLVA 3K4ZA 2JIXD 1UZ8A 3V52L 1NGPH 2GAZB 2OR9L 3CX5J 4K23L 3MRRA 1WT5A 1AH1A 2YD8A 2YBRA 4L4VE 4QRTB 4NKDB 4L4TB 3O9WC 2ZOKB 2EH7L 4HV8A 4X7DC 3B2VH 5DURB 5DFWH 3QCVL 4HJGB 4JPVL 4Y1AA 2J8UF 1XCTA 4JZJA 4P5MA 1WT5C 3NCFB 3SE3C 3WJJC 2J5LC 3QIUB 5H2BB 3A6BH 4KRPB 2YMXL 4BH8B 3NGBC 4F7MA 5ANMA 3CJJA 2QADD 1KCRL 1R5IB 1WF5A 3ARED 1EO8H 2R4SH 4PTUB 5JDSB 4O2EB 4JFFB 3CNKA 2DQGH 4AQOA 3D9AL 4PGBB 5HY9B 4P2OD 5KVDH 3MRCA 5J13B 3FO9B 1G9MC 4R7NA 5GRVK 3LQZA 3B3IA 2LAAA 1TNNA 4HKZB 4BM7A 1EVUA 5GIRB 4LKCA 4PJBB 3DYOA 1HHJB 4P9HL 1SYVB 3RY4A 4ODBD 4M61A 4MNQD 1A7RL 3EYVA 4Z7OE 5CEZE 1XGRB 4G8FA 5L9DL 1R3KB 1E28A 3IFOA 3NPSB 1FZMB 4JO4L 1HEZA 4EUPA 4K8RH 4NJ9L 4JG0H 5DGQA 2BVOA 4Q0XH 5F7DA 5KSAA 5J12C 4G42B 4MAYC 2GK0B 2ITCB 4P2RB 3DRTB 4YE4L 4KI5D 1VPOH 3I6LE 4X9GA 5CINL 2YZ8A 4RAUB 1JF1B 2V7HA 3G08B 5KSAC 1T3FB 3NAAL 2L7JA 2JLLA 4LLWB 4X6CE 3TV3L 4P2QA 2DM2A 5D72H 5I17A 1AKJA 15C8L 4WV1C 4XGZA 4JVUA 4Z7WA 4MA3A 5DR5L 3C8HA 3GGWB 1ZTXH 3MO1A 3OHXB 2AJZB 1PQZA 4YGVA 3VGBA 1RUAL 3GSVB 4S1DC 4F57H 5EZLB 4FP8L 2XRAL 4L8DA 4X7SL 4K8RC 2VDQH 3F7VA 3AC0A 1GH7A 1CFVL 4N0RA 1T4KA 1H3XA 1N0XH 4HIHA 4I9WD 4KVCL 4L3CB 3IDMA 5KW9L 4KFZC 3VXUE 1MAML 1T1ZB 3VG9B 1F6AB 3LKQB 1N3NA 1IGJB 4ZTPL 2HMID 4JFYB 1D6EA 5SX4I 1HOCB 2IC2A 1FFNB 3CFJA 5EN2A 4PJCE 5DEGA 3BZFB 3NABL 3OX8A 4NRYB 3DBXA 5HDBE 4JRXA 1NQBA 1CT8A 3GMRA 4Z78B 5DJYA 1ZS8A 5GS1C 4I3RL 2CPCA 3MRHA 3TH3T 1WICA 3HNTL 3EJYD 2BCKB 1KLFA 4PJDE 2VTFA 5CP7B 1CQYA 3R1GH 3WUWA 3MUZ1 4GRWB 2VC2H 4MCYB 3X11A 3WIIL 3MGAA 1XR9B 3O3AB 1F90H 3BZEB 2QSCH 5JW5A 3KNBA 4XP1H 1BWMA 2R9HD 4QT5A 3ZYJA 5CBAA 1RVFH 1NEZG 2NTFA 5SWZD 1CD0A 5AYUL 1CLOL 4DTGH 2PNDA 1ETZB 3U46B 4AL8L 5KN5A 1OLLA 2BHZA 3QUKA 2UVFA 4U1MA 4XBGA 4K71B 2W91A 5ETUB 4WTXA 1OD7A 5T1KD 1Y6NR 3TZVA 4C83B 1G0YR 3C09C 4TNWF 1MVUB 4X8JA 4OIBA 1JWMA 3EFDH 1MUJA 2ESVB 5TPWL 5FGBC 3EKCA 4RSVA 2K9UA 3IFPB 4KZEL 3QDMA 4Z95L 1RU9H 2XKUA 3FOMB 2PW2A 3O11A 3VWKD 2X1QA 4A6YA 1UQSB 1FPTH 1I7TA 3LKOA 4PRBA 3BFOA 3TZVC 5I1GH 2CUIA 1XMWA 1J1XL 4IJ3C 1MNUL 4ORGA 3ULUF 3DSFH 4P2YA 4MVBC 1D5IL 4XPAH 5HDQL 5GGSY 2AJYL 3SGKC 2F53A 4ZS6C 5IKCB 4DVRL 2N56A 3FFDA 1UB5B 2AABH 2AW2A 3P4NB 1X4ZA 4IS6A 1OAXH 2BNRA 3SDYL 2HT2D 3QHFL 4RMQA 2NY5L 4JEGB 4QOKA 4PB9L 1YEKH 2YC1A 3SJVD 3GMMA 3ZE0F 2EH8L 4UB0H 1KCKA 5F7EL 1H15B 1U8PB 5HYIA 4OZFB 1Q9OB 1T7YA 2NY4C 5HGDA 1A6PA 4A2LA 4ZD3H 1B88A 2GTWB 3E6FB 2NYYC 2HKFH 5KSBB 1AP2B 5CGYC 3MMEA 1RUQL 3DECA 4PJ5E 1H0DB 5DHVA 5IHUL 3QFDA 3QUYA 4V1DE 5JR1H 2DLEA 2NY0B 1WFNA 3WFHA 4Y4HB 5FYJL 5I8CA 1CF8L 4JRXE 2IMNA 4ZODA 3EO0A 5CCKL 1N6VA 2CO6B 2CD0A 5E08H 4DKDC 2D3VA 3UBXG 1EMTL 4KROD 5INDA 4YIQB 1ZKAA 5TDOA 4PGDB 4ODWA 4PUBH 1F4WH 5DRZB 2DBLL 1LMKA 4OLWH 1MLBA 1SEQL 2BHYA 1W0YT 4HGWB 3UJJL 4X6EA 1YEHH 3ZE2E 3HS0B 1ZT1B 43C9A 3RJQB 4O00A 2UZIL 2OZ4L 3RWDB 3FT4A 2EO1A 4OCRL 3ZT5A 1BBJB 3O4OB 4WUKL 4ZDHA 3HR5B 3QPQD 5HHPB 3VXSA 1S9KC 3DHMA 3O41B 3UAJD 4WWKD 5A43C 4BUHA 5TGBB 4G7VL 5D6CA 4HMCA 1FV1A 4UNVA 2E6PA 3QWRA 4JO1L 3QDME 1NCBH 3U4EB 4HBCH 4QYOA 1JIBA 4DEPB 3VW3H 4YPJA 1CDYA 1JNNL 35C8L 2RR3A 4U2YA 4F7TA 4Z7VF 1WCBB 2XZAL 4PP1C 5C0CE 1KACB 5IMMA 1YEJL 3QXUA 5D1XB 1FC2D 3T77B 4U6XB 1YNTA 2IADA 5ABDE 5F3HA 5E8PB 4OD2A 5DMIH 4PRIE 3LS4L 4YHNA 5CEXA 4D0DA 4PRNA 2EDQA 3RZWA 5EBMA 4OFKA 1T21B 4DN3L 2OJEA 3BXNA 4EI6A 1IGYB 2OR7A 3TJEL 5ITFB 2OK0L 2HTKC 3I3EA 3K7UA 1CDIA 2AJSH 4RZCB 1ACZA 3E2HC 3NCEB 5TQ2L 4WGVB 4APQA 5F96L 4XVTL 3G5VB 4MX7B 3S36H 1P7KB 3I50L 5EU4B 1BFTA 4CMHC 2AQ2A 2JKXA 1NDMA 3MZGB 3PWJB 1NGZB 4UUJB 4GLRH 3VA2C 3CLEH 2M26A 2R1XA 3T0BA 3DWTA 2AQ1A 5HHNA 1EHNA 2ENSA 4MJIE 3MRQB 1QUNA 2ZPKH 3ULUD 4HULB 3N1GC 1U9KA 5C6PB 5L6YL 3GM8A 4UOW0 3JBG7 3TEUA 1RZGB 4XNZB 4M7LT 5DVKA 3REWB 4RFEA 3KPSB 4IDJH 4ZYKA 1SJEA 3CX5K 1TJGL 3D25A 5GGRY 5FO7B 4IHOB 5C0IA 4M8QA 3CK0H 1KIUA 3BP4B 1OY3B 3BPLC 5CP3H 1IQDA 1IM9A 1KOAA 3CUPA 3VE0B 4KY1H 1L4IA 3QO1A 4JFXA 2A6DB 5IHZA 5I1CL 3T0VA 3GIVB 2MMXA 3CSGA 2P8LA 1TIUA 4Z76B 4P5TA 2YHGA 4MNGA 5D70H 5F1KC 5IESL 4XAWL 3ARVA 5GJSH 5B3NA 2ZUVA 1H3TA 1X4YA 4HQQL 4TPRH 2Y9RT 1WEJH 5D7KD 3WXVH 3U1SH 1I8LA 5HYJD 1NC2B 4U1LB 5JDJA 3MGOA 1KV3A 5J6HB 4JFEA 3S5LG 3C5SA 2FJFA 3GKZA 3LQAL 4P46B 4ZO9A 5DD1H 3L5HA 5CP3A 2DRUA 4R7DA 5IR1B 4ODTH 4JCMA 2LTQB 2V9TA 1I8LC 3JWDL 4XC3H 4NUGL 2FR4A 3PP4L 3FZUD 1OB1A 1DN0B 3P73B 5KAQG 1QPXA 5DQJB 2BFVL 4U33A 4X80L 1EA9C 3M1BA 1HXYB 2E27L 4NQEB 4FQLL 3LPWA 1CWVA 4YWGL 3RVVD 2QQNL 1T5WB 1RUKL 3W81A 5D7SH 2GEEA 1S9XB 3VFTA 4JRYB 4LHUD 4G9FE 4M1CC 3DVNA 4EBQH 3X13B 1Z0NA 3MNWA 1Z3GL 2H2PC 3ARDC 4YR6A 3W9DA 3U36B 3GHEH 5EFIA 4X8XA 1JPSL 3HI5H 4X7CC 4BH7A 4FXKA 2E9WA 3RKDD 2R1WB 2C7UB 5BCAA 4BFBD 5D2NE 1AJ7L 2HLFD 3L7FB 3WFZA 1D5BB 3Q1SH 2Q7NA 4JN2A 1G7PB 3TVMB 4AEHL 5IQ7L 5I71B 4MVBD 4HK0A 5GRZA 3OJMB 5KG9A 2YPLB 4I5BA 4KJYA 4KDVA 5E2WH 3W0WD 4D0CB 1YY8A 2AXFB 3QZWG 4NQVB 2XZQL 1UCTA 1IGIL 1VFUA 5EH1A 3ZYIA 1IRAY 5D7IB 3DTXB 1CR9H 3MUGB 3D3VD 4UIMB 2WSKA 4XMKH 1C12A 3QG6A 5CILH 1DFBL 3QRGL 4Z7NF 5E6ZA 4M93B 3PV7A 2ADGB 3O45B 3MFGB 3S96B 5C0RL 4K7PH 3ROLB 4AT6A 3GK8L 3P77B 5DJXA 5F9WB 3OKNA 3TNMB 2BVYA 1R3JB 5I30H 3PHOA 2COQA 1XF4B 2OSLB 1HE7A 1Y0LB 4L29B 5CFHA 1JNHA 3MJ9A 3QH3B 3MLUL 3EYQC 1XGTB 3QQ4A 2CDGA 2VXSL 1NGYB 5JHLH 2XN9A 3MOBL 3ZTNL 4JY6B 4R9HA 5A1AA 4ZUTA 4Q9QL 1FDLH 4HS6A 1K2DA 4XNQA 4CKVX 4R2GD 3UTPD 4CW1A 4LQFH 5JMOC 1UJ3A 2KZ1B 3EJZD 4Y5XC 1MFAH 3ARPA 2WV3A 3H9SA 3PL6B 4LFHG 4PJ9B 3H9YA 4ELMB 3HPLA 3WHXA 1FNGA 4Q9BA 3OPZL 1MAKA 1AO7A 5LGJB 5EO1A 3PNWA 1MELA 4LSSL 4AY0A 1FSKC 1XGYL 1UJ3C 3QFJD 5E0QA 1U95B 4XCEA 1A2YB 5GGTH 4NZRL 4C56A 4H5SA 1MCBA 2D03L 2R0LL 2VDLH 5EZJA 3MYZA 2CR3A 3GB7B 2ZOLB 1AE6L 3MXWH 4MB4A 5DFVC 3WFCL 1PFCA 3V7AE 3ZYOA 3SKJH 2K7PA 3IXTB 3SKUD 1KIQA 1GGTA 3SO5A 2BSED 1I8KA 1K3IA 4WW2B 2QR0A 1LNUA 4EN3A 5C0FA 2Z91A 1EBPA 5DJ8A 4TRPH 5E9DA 2Y07H 3PWUA 1S7XB 5EIVA 3AXLA 3MV7A 4PP1D 4LLVA 1AGBB 4J6RL 4TSAH 5GGTA 5EU7E 4JHWL 4PJHB 3HC4H 5SV3A 4DKFH 1P7QD 4OBSA 2OX5A 3EOBB 3F7YA 3KDMA 3VXQB 4LL9A 4AEEA 4E5XA 5CD5C 1A6VL 1MJ7H 3KLDA 3Q3GB 4HW6A 2FX8H 5SWQA 1CDCA 12E8H 1A7OH 3IDYC 4I18B 4EDWL 4YHLL 4FQJL 4MCZA 4ERSH 4WCYH 4OJFL 2DTSA 3R0NA 1ZT4B 2R69L 1EK3A 2VAJA 5F6IC 1TCRB 4LF3A 5FYKU 1YMMD 3DI3B 4NNPH 4LIQH 4XP4L 1B9ZA 4CMMA 1JGEA 4JY4B 4M7KL 3VFPA 5CMAA 4LBEA 3B9KA 4OGAD 4ONHA 4UILL 2B4CL 5A40E 3PWVA 1I1RA 5IJVB 5AUMA 4DAGH 3CVHB 5T33L 3K4AA 5IB3A 3FB7B 1T7ZA 1HHIB 1VCAA 5L88L 1BJMA 1MHCB 1AI1L 5MENE 2R56H 4N1EA 2ZCLH 3IDIB 4NM4L 4UZGA 3FHQA 4HKJB 1NBVL 1EZVX 1FRGL 4WW1A 3WFBL 4FQXD 1HHKB 4RWHA 3AY4A 3FRUA 3SPVB 4YBQD 5B22A 2AQ3A 2LAGB 4MXQC 2VE6B 5IV2A 1FL5A 3FQTB 2EDNA 4GS7B 3D6GA 4P59H 4FQIH 5D93C 5JLZB 2XWJA 3OB0K 4JDTH 4WFGE 2GJ6B 8CGTA 4UQ2A 1B4JH 5BRZB 2VLLB 1KFAL 2IF7A 2GUOB 3IDJA 5EU5A 5JW4R 3O3EB 1ED3A 5I8KL 1NFDF 1ZHNB 1D5XB 4MZ3A 4K55A 4MJ6B 4HFWB 1C1EL 4DCQA 4HH9A 1NC4D 1OP5K 5BW7C 1DANT 3VXRD 3QDGA 3QXDA 4Q9CA 1BFOB 4XTRD 4MSWB 4IEFB 3A6CL 2AXJA 4I48A 3O6FB 4J4PD 4NQTA 1DQML 5C6TH 1IGCL 2P5EE 1BWWA 2Y5TB 1QFWI 2AJUL 4OZGA 3RPIA 3OKYA 4P23B 5B8CA 1CFTB 4Y19D 4BKLA 5TDPB 4N5UA 3GMNA 3T08A 1QKZL 3V4VH 2JIXA 5GGRB 5GGUB 1N59B 1BZ9A 4WTZG 1PY4A 3MA7A 4YPGA 1CICA 1WBXA 3B5HA 3U9PH 3QCUH 4PJ8C 4IOFC 1ZSDA 5BS0B 4G6FB 3DRQB 1OAKL 3ULVF 1QFHA 3NIGF 3UMTA 4PJFE 1VFBA 4UMGA 3OAZH 4S0TD 3FQUA 3IDXH 4KUCD 4X9IA 1CICC 3WSQH 4X6DB 3T3PE 1UCBH 3KPNA 3LN5A 3EOTH 5D1QA 4W4OC 2W59A 3U7WH 2WBJA 5I18H 5KSUB 3ARDD 2ATPB 3EOAA 3PWNB 4O5LH 1MWAB 3NZ8A 1MHHA 3BE1H 4L8CB 2EE3A 1VESA 4L3EE 4P2OA 3K81A 4QTHA 5D1QC 1RZ8A 4CADB 1MIMH 5IT2L 1U6AH 5K9QI 5DS8B 3BEVA 3HE7B 1GPOH 2FHBA 4XPGH 3ROOA 5HD8D 2JK5A 3LKPB 1FLRL 3BI9X 1X5LA 4MXVF 3Q5OA 4KKLD 3IRPX 3UP1A 1HSBA 1MFBH 1TLKA 4JANA 3T0ED 9CGTA 5C0DA 2N1KA 4ZFFB 3L3JA 1H5BC 4NFBA 5I1KH 4KRNA 2VITA 4KK5D 3KYKL 3C5JA 2DQIL 3CVHL 4KKBC 1G7HB 1U3HA 2I07A 3L6FB 1G84A 1QBML 3QJHA 4ZOCA 5INCB 3KR3L 4Y2DA 4KC3B 2DIJA 3MBEA 3T09A 2NX5E 1WC7A 1F4XL 1PBYA 5FYKD 4KJPD 1U3HC 1N2RB 4Y2DC 3TBSB 3VMPA 3MBEC 5DJ0A 4R97C 1CCZA 4YHPA 1B0GB 5DQ9B 3PGFL 1BX2A 4NYLB 5E8NB 2ZJSL 3WHE0 3O3DB 4H25A 4RFOL 4RAHA 1JZ4A 4NQCA 1INDL 5BVJA 3RDTB 3JTSA 2E8YA 1A9BA 1IBGH 4R90H 25C8H 4Y5VC 3NFPB 2P47B 3N50A 3MRBB 5F1IB 2BRRL 3DX9B 3JXAA 4PJEA 5IB2A 2Z8VC 5HHVL 3GJEB 1BOGA 4AEIL 2C5DC 4DKEL 3I85A 1M6OA 4OCMC 4RQQA 3PHQB 5EA0L 4LSUH 4QY8A 3MRDA 1QHPA 1RZ7L 5DJZA 5KJRH 4PJXA 1UH2A 1VKXB 4GRLB 4OM0L 6FABH 5KVEH 5SX5K 3U79A 3KLHD 5J1AB 4FQ2H 3KLAB 3EAKA 3UTZB 1E4XH 1YEEL 1OSPH 5JOFB 5C7XH 4I4WA 4NPYA 4O02H 4CVZB 1AGCB 1V05A 4FA8A 1QO3B 1LE9A 3JUYA 4PJAB 2IQAB 1OF2A 3B4NA 2HG5B 5CWSB 5F6HI 2DQJL 4QCIB 1ZGLB 4MNQE 3FCTB 4DQOL 4IDLA 5EIQA 2YKLL 5CD5D 2ED8A 3QDHA 3X12A 2VDNL 2CK2A 5J0BA 2D7TH 3OAYK 4LASH 1OTTD 5D1ZB 1ZK9A 2ZP0T 4U6HB 4ZFGL 4X0KB 4G7YL 2Q3ZA 5GGVH 4AM0B 1FFPB 4OZIA 1KLGA 5HGBB 5DT1H 5EU6A 3VWKA 1YYLL 1OAZL 4PRHD 1SEBB 1J12A 1YQVH 3P30H 1OGAB 2EIDA 5IW1B 3IGAB 3G5YA 4UDUB 1HHGA 1PX4A 2XXCB 5MP6H 4KI5E 2A6KB 5BQ7A 3BRFA 1T6WA 3DI2B 3TBWA 4P4RB 5EOQL 1XIWA 2QBWA 1XCQB 2EE9A 3QEHB 5CEYA 2FZ3A 3BQUB 2JJTA 2AGJH 5H35A 5AAWA 1TZHB 1Y18A 5FUZH 3ALXA 3SE9L 3EDEA 5JUEL 5C0AB 1HH6A 1HQRB 1XIWC 1A6TB 5T1LB 4NO3B 1U8OB 5LG1A 2JJTC 4WNQA 2N7AA 1NUGA 3PWLB 5BVPH 1CU4L 2BMKB 4ZSOB 2XV6B 1OVZA 1WFTA 3D1MC 1KJ2L 4ZNEA 2ZUXA 3MODL 3CPLB 5C2UB 1PSKH 3NIDE 4I9WE 4MXQD 3BP5A 1QFPA 4LCYB 1QSEA 3QNZA 4QRPA 4MAUL 3AS0A 3Q5YA 3CFBA 5JW4Q 1WAAF 1G9NH 2Y25A 4QHUA 5C9JA 2DI7A 4M1DH 5DC9B 2XNAA 5GJTH 3RP1A 3MCLL 1AC0A 1W0VA 4I13B 4KXZH 4N68A 1KT2A 3T3MF 5C07D 1ZE3C 4QRSB 4H1LB 3MOAL 1JYWA 3ARYA 4OSUL 4YHKH 4LHQB 4AG4H 5FGCB 3RTQD 2LQRA 2WQRA 4KV5F 1MCDA 4UINH 3RKPA 3QUXB 1E4JA 3TIEB 3RWJB 2YXMA 2X40A 5J9PB 5EZOH 1CN4A 4IRZL 3ZKXC 2DLGA 1YN6A 3IT8D 5DLMH 4ODUB 5SWZE 3DPBA 1MHPL 5JW4N 4FFZH 3F7QA 3Q5TA 4LAQL 4UV4H 2R0ZH 3SDAD 1I9IL 4PJ8D 5DK3A 3MRKB 4QNPF 1G9NC 4WW2F 2IBGA 3LKRA 4MQTB 1EHAA 4DVBA 3IU4H 4YDLC 2F8VA 1WGOA 3P2TA 4ZQKB 4NT6A 1JZ8A 1IKFL 4CL7A 1KB9J 1NH6A 3KYMB 4ZFZB 2G60H 4KUZH 4WHDA 4Y4KD 5JA8B 2DI9A 4O2FB 1WWWX 2I26N 3PP3K 1VEOA 4PJIB 4RGNE 3O6LL 2J8UE 2A2QT 2B0SL 3D39D 4CJ1A 2HVJB 3HMXL 2P5WD 1NMCB 1LP9F 1I9JH 4W68A 4WI4A 4J7RA 4N8VA 3L1OL 5CLTA 3UJIH 1A3LH 1AGDB 4I3GA 1UA6L 5DA4A 4NRZA 4X4YA 5BO1L 4HJJH 1UWXK 2QV2A 4F7CA 1DBJH 1AXSB 4K3DH 3QNYB 4P99A 4ZXBC 2VLRA 1PKQE 4BSJA 4F9PC 3ESVF 2VNCA 3V79C 5EBWA 1JV5B 4NWUL 1X5GA 2VZ3A 2FBJL 3OAUH 3V5KB 4U1KB 2CGRH 2IBZY 3PXJA 2N7BA 5D2LB 4DGIH 2AK1H 1NGQH 3JVGA 4G8EB 4RRPA 5GGQL 4L3AA 4PV8B 2DD8H 3SJVE 4KZDL 2W07A 2XWBA 5B39G 5I66A 5EZIH 1N26A 1XGPB 4G8IA 4GW1B 4NQDB 4I77H 1PAMA 5C0ND 1A6WL 2BSRA 4KVNH 3JVGC 3B5TA 2ZSWB 4H8WL 4ZS7H 3FMGH 2VLKB 2FEEI 3L3OB 3QCTL 5CZKA 2Q7YB 1XGUB 1EEYA 5HHQB 1QA9A 4QHLB 3JWOL 5DD6B 4KK8D 3N85L 3DX8A 1M7XA 3EO9L 1INEH 1UJTA 1FYTA 1R3LA 2I24N 4Y4FB 3QI9C 5JHDD 5JORA 5HYSB 5JO5B 5IOPA 5KVGH 4ETQA 5EUKA 3WUWG 4TQEL 5DUPH 3VCLA 4TNWK 4YK4C 3UXFA 3LDBB 3JV4B 2MNUA 2YK1L 1OAQL 3CVIL 2FH6A 1T0PB 4ZPTB 4XWOD 1Q9WB 5T5NF 4Y16B 4OLVH 3T2OA 2D7OA 5SX4H 4YO0B 4E41B 2XWTA 1LILA 1V8HA 5D8JL 3T2NL 4F9LC 1NAML 3TN0D 2FH8A 4NRXA 3TGXA 1LK2A 3VGFA 5B38B 3LVEA 1VACB 5DD0H 4IRJB 1JGDB 1I9EA 4Q6IB 5KSVA 4IMKA 3IDGB 2DMCA 3EO1B 4HUNB 3DV6B 5FO9B 1G7IB 5JXED 2VIRA 3X3FH 4M6ML 5E4EC 3EIFA 3V52H 4LGSB 2H8PA 2VKWA 2OR9H 1G7JB 2VXUH 4IMKC 4NJAH 1CDUA 2HLAA 2HAZA 3VFMA 3OKMB 4GKZB 3PUCA 2X9YA 1BECA 4L4VB 4O51A 3T4YB 4WI8A 4E0RB 2CKNA 2WUCL 4G9DB 1LO4L 1AR2A 3WUZA 4JPVH 4OCNC 1J8HD 4JZOA 3LD8B 2B2XL 2UWEA 5IVZA 1L6ZA 1RSFA 2JB5H 2V7NA 1RULH 3INUL 4HGKC 1T5XB 4LPCA 4YX2H 3GHBL 1J8KA 2QSTA 2YMXH 3PQYD 2EDOA 1IGTA 4P9ML 3HKFA 1U58B 3MNZB 1KCRH 2VL5A 4OKVB 5CJ8A 1SBBA 4KRMB 4MB5A 3D9AH 3P4OA 2G75B 5KS9B 4LHUA 4PRPD 3S35X 4GG6F 5E00A 1ZHLB 3HI6L 3K8MA 1CK0L 4WU5A 1LEIA 2DDQL 4N0UE 1L0YA 4FXGA 4YDVB 1HH9A 2ZCHL 1K6QL 5LQBL 4OD1H 3ZKSD 2YWZA 4GMTH 1KTDB 3I9GL 4ZUWA 3F7RA 3T4AA 3BVNA 3D0VB 3H3PH 2R2BA 3V9FA 4WI2A 1P4IL 1NUNB 4JO4H 3WO4B 2V5RA 2EO9A 4Z7VA 4NJ9H 2X4SB 5C0BA 4BUGA 1FO0H 2AVGA 3ULUE 1CFNB 3WJLA 1IAKA 4D2NA 2HT4C 1EUUA 3W0WA 1BGXH 5TE4H 1QRND 4OV5B 1XR8A 4R4FL 4O58H 4YE4H 2ZG1A 3TO2A 5DI8B 4TOYH 3S9DB 4E9LA 5CINH 3FN0L 4OF6A 1Q0XL 4JKLA 2XG5A 3WJLC 1ZGLP 3QJFA 2F54D 3NAAH 4NM8H 1G9EA 5FCUL 4ELKA 2DN7A 1YYML 1R5VA 4UT6L 2VDML 3VFGH 2Z31B 2OI9C 4M6NL 3TV3H 4KI1A 2XTJB 5B21A 2CIIA 4X6CB 1JNLL 2AKRA 2MQ0A 5HHMD 1FO0A 2IFFL 1CD8A 4X6FB 2P8PB 3VGEA 2CMRH 5ERWB 4NO0A 2JELL 5KZCD 1MFCH 2D0FA 3WFDL 5F8RC 5BOPA 3RPKA 5HPMB 1B0RB 3MNVA 3MGTA 3EDKA 1QQDA 3RX7A 1CFVH 5D7KE 2JB6A 5EWIH 1M7DA 1Q94B 4KVCH 5HYJE 5ADOH 4RMVA 5KW9H 5DC0A 2RQ8A 1MAMH 2VLJD 1IAOA 2CLVB 1I1AA 1VDGA 3VXUB 1RV6X 3D2UB 4ZTPH 5BZWB 1K5NA 1BIIA 4X99B 3GIZL 4XB8A 1SBSL 5HYFA 4ZAKA 1H8SA 5T3XD 1I1AC 3QDJA 2CDEA 4PJCB 1A6UL 5IROC 3C6LB 2ID5A 3HTLX 3QIWA 4QRUB 1KCVH 3QO0A 4I3RH 1R0AH 1MQKL 1KELH 1I3UA 4QXUL 4ZAKC 3WNLA 1P69B 4PJDB 4L1HA 1GJIA 1T03L 4G3YL 3WIIH 3QIWC 5JZ7C 1NCWH 1DVFB 5HVWA 1UB6B 1Q9LB 2PETA 3U82B 1IFHL 3PIQB 3LQZB 3B3IB 4LKXA 1QBBA 4FFWC 3SKNA 1BJ1J 4HDIA 2BXYA 3NCYS 1DZBA 3TIDB 3O6MH 3SDDA 4B5EA 4NZJA 4RX4D 4U1GB 3W9EB 1Q0YL 3ECBA 4H0GA 4FS0A 3ZDYF 3CMOL 1FNAA 3IFOB 2GAZA 4JO2L 3QIBC 4YLQT 3UTSD