2PW1B

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide eldkwnsl
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
232
structure length
221
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSQTYTCNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications.
pubmed doi rcsb
molecule tags Immune system
molecule keywords 2F5 Fab fragment heavy chain
total genus 37
structure length 221
sequence length 232
ec nomenclature
pdb deposition date 2007-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2pw1B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2pw1B01
3REWA 2R69L 3MV11 2GTZB 3BKCH 3QXUA 4IIQB 3TT3L 1DN2A 3QUMA 3V7MA 2IAMC 3TN0D 1KTRL 4BQ6A 3SDAB 2F54A 1M71B 1EHAA 4X7DC 4LKXA 3QUZC 3MYZA 5ESVB 2I9LA 3CFEB 2FATL 3RUGE 1AGDB 1XZ0B 5IW3A 4EQ3A 3HPLA 4R4ND 3PGFH 3QULA 1OTTC 2G5BA 2QHRH 1S3KL 1LP9B 2ADFL 3GMLB 5ITBL 2AJXH 2OXHA 3WFHB 4Z7UE 4CGTA 1LO0H 1HKLL 1T0PB 5IW1A 4PRDA 3RJQB 1MFDL 1WBZA 2I27N 1VKXB 4U7MA 2O61B 3O4LA 4BM7A 3VCLB 1L0XA 3BAEH 2I26N 4YPGA 3ECBB 1LD9A 4P9HH 3U7AA 2PW2B 3LIZL 4LLYB 1GZQA 4KV5E 1E6OH 4F7CA 1DSFH 2GFBB 3ARRA 5JW3L 1G9MC 5FKAB 1IZJA 1CQYA 3VE0A 4HGWA 1KJMB 5J1TC 2YUZA 4JGJA 3EO9L 5GZNC 3LKSB 3EOTL 3QDGD 4WU7B 4PJDE 4D9QD 4L9LA 1QFHA 2X4UB 4PGDA 3V9FA 3ECBA 5C92A 3MA9H 4KUZH 1F4WH 1BIIA 1SJEA 2XA8H 3WN5C 5C0IA 2R8SH 5F3HB 5GS2D 4ZG1A 3EJZC 4JFHD 4AG4H 1QZ1A 3V6OC 4RWHA 5B38B 3QDJE 2P45B 4JCMA 4Y5VA 4RGOL 3MNWA 3VFWB 3PWVA 4GG6A 2WLYA 3NTCH 3ARBC 5ETUA 1ZWIA 2CXGA 3CCHB 3MRHA 3U0TA 4APQA 5C0AB 1TCMA 1HIML 2YPLD 2HFEB 3MROA 3QH3A 4RSVA 4U1KA 3SJVE 3ZDYE 3ILQD 3QZWA 3AXLB 4Y4KD 5KOMC 1FGVL 3FN9A 3JVGC 1UCTA 3KDMA 3VDAA 1TJGL 4XVUC 4LF3B 3FOMA 5JDJA 4IRJA 4NZTH 4P2RA 4Y5YC 4HGMA 2F8VA 4ZQKA 5DRWB 3PV6A 1F3DH 4J3SA 4R9HA 3QCUL 3U2SB 4PRIE 2F19H 2HFFB 1LVEA 2K7QA 4YDJA 4BUGA 3QAZC 3KHOA 3PGFL 4OZFA 4OLWL 4PJAF 1L7IH 4G6JH 5TGBA 3FQRA 3LN5B 3O4LE 1QSFA 1HKLH 4DZ8A 4HUXB 3QJFA 4U1NA 1CDUA 4PG9A 5IHZB 3ZHLA 1NKRA 1AGFB 1K6QL 3MLUH 1QHPA 2EDRA 4JZJB 3U9UB 1ZEAL 4XBGA 1OAKL 4WW2C 5D7JC 1DVFC 1IM3B 1C7TA 1AO7D 3B2UD 4JRXA 2YN3A 2JF1A 3LEYH 5C0CE 4EOWH 2R2EA 1JF1B 2DQJL 4LRIC 1NGYA 1IE5A 4H5SA 4HW6A 3VG9B 2VE6A 5CAYB 3BHBA 4GAYA 3K4DA 2H32H 4G5ZL 4RFNB 1D5ZB 2X9XA 2VXVL 4Q0XL 5MI0B 4OZIA 4LLVB 4GAJH 4JHAH 4Z7VA 4GKNB 5C0CD 2EXWC 1SY6H 5CGYC 2A77L 3LD8B 1I4FB 3TN0B 1IC7L 1U8OB 1HNFA 3REWB 3W0WA 2BXYA 4P46B 1X7QA 4YHML 4JM2A 1SY6A 5EOCJ 1PG7W 1U2HA 5E8DL 3G6JB 3SDXB 3OMZA 5EBWB 3FT4B 3ARED 2Z8VC 1R3LA 3HZYB 2JJSA 1A6WL 3SKNA 1IC4H 1NKOA 5C0BB 1VADA 2H2PD 2NCMA 4QHKJ 3I50H 3BRGC 4GMTL 4U3XA 2R9HD 1I1YA 4QHLB 3O3AB 1TFHA 5IM7B 1FO0L 5GRVL 5FGBC 4P2QD 15C8H 2C1PA 4AQOA 1MFCH 4ZXBA 5JIKA 4GXUN 4M93B 1CQKA 4JFZH 3UTZB 4OCXL 1HYSC 1ZA3A 5IF0B 1X6LA 3UTPD 1QFWL 2N1KA 3QFJE 1YMME 3N9GH 4PJCA 5GGRB 3T2PA 1KEGL 1FLRL 5C0AD 3NN8B 3HRZB 3QI9A 1FYHB 3SKOB 1ZGLM 3ULUC 4LU5L 4TVPH 4YIQB 2ZUUA 3ZTJG 3ARBA 2AW2A 5LBSH 1J12A 1PG7H 4OZHB 4X4YA 3DETD 3H9YA 3ZHDA 3JWDH 4GW1A 4ZODA 1J5OH 3FN0L 3MCLL 4I5BB 1MVUA 4AM0B 1GC1C 2ICWJ 3VFNA 3G08B 5GSRB 1T6VN 4HXAH 3CMGA 3BE1L 3CXDL 2IADB 1VEOA 3B9KA 2IQAB 2J2ZA 4JREB 5CINL 4FN0A 3NACL 1FNEB 1KULA 2AJZB 2KBGA 4Y19B 4MCZA 4HH9B 1HEZB 1CS6A 4ZQKB 5INDA 3CIQA 1FGNH 4NZUH 1FNFA 4XBPB 4NKMB 3A67H 3T09A 2YPLA 4ELMF 4QRTA 1TJHL 4P59H 4V1DA 4J3OC 1V7MH 1T7YA 2DIJA 4MAUH 1YNKH 3MLPA 1IFHH 4JN1H 3TH2T 2X5PA 4YJZL 1JPST 3AY4C 2N7BA 2DQHH 5J9PB 5JW4R 1JGDB 1EIBA 2DBLL 5E6ID 1ZLWK 4W4OC 1QP1A 3KPRD 1FJ1B 3IXTB 5HDOA 3QDHA 1PVHA 5JA9A 5C09B 4RAHA 3SE4A 5F1OB 4ZO9A 5JDSB 1IKFH 1KB5A 1XF1A 2XV6B 4J6RL 1ZHKA 3K1DA 1PKQB 4DTGH 4KH2A 3WIHL 1BD2B 4XZUA 4L4TB 4OZFH 2B1HH 1BJMA 3GMMA 5D2NE 2DM7A 4WFEE 5HPMB 2VIRA 4ONFH 1KN2H 4JG0H 1QBLH 2HTKC 1A7RL 2HJLB 3FFCA 4N9OB 4OI8A 4HIXH 3WFBL 3GBNL 1MCWW 1OGAB 4ODSL 4X7FC 4X4MA 1MY7A 1QNZL 4ZS7H 3DMMD 5LAXA 5KTEL 3EO0B 5JPNA 4LGPB 3FB6B 4ZUSB 4HUWA 4JR9L 1OP5K 3LZFH 4LVEA 5C71A 4OZIB 5DLMH 4OGZA 4EZMA 2C1OA 4IM8A 2M8XA 1K2DA 2DYPB 4QTIL 4LDLB 3UZQA 1MI5B 1JHTB 3FO0L 3HTLX 3HUJF 1ORSB 3P2TA 1BX2A 2W38A 3O4LD 1REIA 1QRKA 5C0JB 1WZ1H 4YDLC 5I6XB 5IB3B 4M48H 3PDGA 3R4DA 1WBYB 2W91A 1LE9A 1F90L 1CFVH 2P24B 2I24N 3SQOH 4GAGH 4CU7A 2FZ3A 3C2AH 1T7VA 2VAAB 1T04A 3QDMD 3OKLA 1XZ0A 5T1LB 1O7SA 1I7TA 1BZ7B 4DZBB 2KZWA 5FO7B 1A4JB 1AQKL 5HYQA 5KSBE 1JF5A 1HSBA 4NRZA 1ZT4B 4M7ZB 1N0XL 2EH7H 3QUKB 4Q6IA 1JGEA 3T04D 2VLRB 2X4OB 5LJYH 2IAMD 1XF4B 1ZHNA 3TFKD 1AXIB 4OI7A 2IEPA 1X5LA 2MKLC 5EORL 1OP9A 3E0GA 4Y8DC 3K8LA 4ONFL 2UY6A 4G3YH 3VFTB 1LD9B 1N5AA 4J3TA 4LF3A 5IK3A 5ECJE 1P53A 3VFPA 5DSCB 3V5DB 5J89A 3QSKB 5GGSB 2FJGA 5DD3H 1EO8H 4KI5E 4OSUH 2HKHL 1UJ3C 2VXQH 1EVTC 2DKMA 4PJDF 3PHOB 1KNOB 4Z7OF 3QH3B 3DUSA 5KSBA 1D9KD 3PQYB 4UILH 3TVMB 3QI9D 1CT8A 5ACLA 1AGCA 4K8RD 5IEHB 2EO1A 2G60H 3DXAA 5JPMB 5J6GA 4DFIA 1P6AB 2NY4D 3U9UA 4ONGL 3QPXL 2NY3C 4MQXD 1GH7A 1XCQB 2HTLD 4RDQG 1KCKA 3TVMC 4OLWH 4RMTA 2BP3A 5ICYB 1V5JA 3N1FC 3P9MB 1XF2A 3GSOA 1R0AH 5BW7A 5TGBB 2PF6A 3TJHD 4JO4L 2DLGA 1F2QA 3L5XH 1C8PA 1C7SA 1VENA 5ILTL 2JB6A 3D48R 5H8DA 3NVQA 1BJ1H 3QEQD 1KCUH 4F33B 5HHMB 2AEPH 4Q9RL 3RVXD 1H8SA 4LVHC 1CD9B 2DKUA 5LG1A 1Q9KA 5HGBA 1FBIH 3SKJH 1T1YB 1MCWM 1UKSA 4HWBL 3LEXB 3KPRB 2F53A 3U0TB 2B0SH 1N5YH 5DMGD 4S1DD 1DVFB 2VLKD 3ILPA 3CZFB 1HILB 3I75A 2IH3B 4KTYA 3PJSA 5CLWA 2AXGB 3RWEB 3FOLA 3AB0B 4H1LB 1RZ7H 4BELD 2D0FA 1TTGA 4KDTA 1MHCA 2BSRA 4NIKB 1HN1A 4POUB 2B1HL 5ALBL 4LKCA 1PD6A 5EU6E 3GMRA 4DGYL 2FJFA 5CSZB 1RK0A 5E1HB 1VESA 3MLXL 1GZPA 1NC4D 1JGUH 5J6HA 1OGAA 3QUZD 3QQ4B 3OL2A 1N64L 3LKPB 4GLRI 4DOHE 3FQNA 5F9AC 1LQSR 2GSIA 2GUOB 4L8SC 2ZCKL 4APQD 5KVDH 4YDVA 3L9RB 5CZXC 3NZ8A 5ESAB 2E6JA 4XNUL 1OP3K 2UZYB 4H5SB 1CE1H 3VXRD 3MJ6A 3EYQC 3T2OA 4MAUL 1DQJB 5C3LD 5JHLH 3ULSB 4MHHI 4WW1B 2VSCA 1LO0L 1NUFA 3LQAL 4N0YL 2DQDH 3MRKB 4P2RD 1S7SB 5E1AA 5I1DB 4A2MA 4PRDB 3VXRB 5DQ9A 1G1YA 1CXKA 1G0DA 1A6TB 1CDYA 1UEYA 5FM4A 3CFJA 5EUKA 4C59B 3VJ6B 1S7UA 5FM8A 1NFIA 3NZ8B 5ESAA 5HJ3B 2CKBA 3WJLC 1WWBX 2XWBA 3FQWA 2AS5M 4WUUE 3NCYS 3MCLH 4JO2H 2WBWB 5EWIH 3MGOB 1MAJA 2FD6L 4PY8J 1I9IL 2XTJB 3MV8E 5BVPL 5T1KA 5TJWK 4X5XA 3QG6A 1NCUA 4RMVA 3UBXA 4PY7A 3ARDC 1ADQL 3T0BA 5A40E 5A2JH 4HEME 4L4VD 4POZD 3ARUA 4F15B 3O6KH 1G7JB 2VH5L 5CEZD 5F1NA 5I6XC 4OM1L 1DFBH 2Q76B 4EBQL 2FGZA 2DQGL 2W65B 2XRAH 4HV8B 4M5YH 3H9HB 3GSWA 2QV2A 1GC1H 3HNSL 5I71B 4LCWE 4UQ3B 3WNLA 2V5TA 3PABA 2IBGA 1A4KB 4A6YA 3DGCR 1DANT 1NSNL 5D7LA 2KH2B 2YBRA 5D2LE 4LSUH 3FFCB 1U58B 5JIIA 2EDYA 4M7LL 4WTWA 3VRJA 1P69B 4HIXL 1U3HA 5DEGA 5BQ7B 4XRCB 3TA3A 5EUOB 4RFNC 1MIEH 3O3EA 4QOKB 5MEPA 1YEEH 5ADPL 1HKFA 1OCWH 3LQMA 4XWGH 2FD6H 5E5RB 2WBJC 3NA9H 4X6CB 1OTTD 3DWTA 4WTZG 4PTUB 1SM3L 1MI5A 4K9EC 3T8XB 1ES0B 2FR4B 3J7HA 3DRQB 3WFCH 4E41B 1KNOA 3MR9B 2E9BA 4FP8L 3H7BB 4AH2B 5KBNC 2BSSA 3DX6B 1WWWX 1M71A 4JN1L 4KK6D 2PCPA 4NZJA 4O00A 2AV7A 1CI5A 1AJ7L 4WW2F 4WCYL 2Q6WB 4OQ1A 3MJ7B 3BAEL 3MOBL 4UV7L 4PRPA 2HKFL 1V7NH 3AU1A 5A1AA 3GNML 4P9MH 4P4RA 3QWRD 3OKMA 2V7NA 2E7MA 1WLHA 1EDQA 1LGVA 4NFBA 3NACH 1ZAGA 1HH6B 3VXSB 2VLJB 1A7OH 5HVGB 3FT2A 3JUYA 3GI8H 3ZTNH 3W5MA 1QR1A 1HIMH 1AJ7H 4X9BA 5FCUH 3SDDC 3WEXA 5I1LA 3CFCH 2ZUTA 1J0YA 1SMAA 4XX1G 2CK2A 5M94B 1NBZA 1TCRB 4MX7B 4Z7NE 5KTEH 1IAKB 5GS1C 4NNXB 2VDNL 3AAZA 5LVEA 5BOPA 5E9DA 1ED3A 4KI5F 4ZOCA 1TTUA 3CLEH 1VDGA 2A9NH 2APWA 3KPRA 2ESVA 1R3JB 1T21B 4GKSB 3WD5L 2PTTB 3K8MA 4P3CL 4U1HB 5KSVB 3MFGB 2BNUA 3E8UH 4MA1C 5M95B 1CLZL 3MRMB 4JRYE 3TLRA 1WT5A 1HXYA 4G42A 1TZGH 5EN2B 2DD8H 4LHJB 3UTPE 2XA8L 4D94A 1BEYL 3PL6D 1KJ2H 1YMHA 2HLFD 3I2CH 4OLVH 2R2HB 4MD4A 4ISVB 2X2YA 1QO3A 4U0RB 4X6DE 2DQTL 5FYLD 4POZC 2XQBH 2JKXA 5F88A 3UAJC 4L4TA 4WVRA 4PRHE 4JAMB 1XF2B 4P4KD 4ZPVB 2Y06H 2EE2A 3E3QE 5A43C 2XN9A 5EU3A 3SKMB 3F7VA 1A6WH 3C5ZC 1KEMH 3RDTD 1A1MA 3OBAA 3REVB 1SJEB 3VW3L 1SBBA 5HHVL 4U6XA 3TFKC 2Q7YB 3GK8H 1R3IH 5L7XH 2CK0L 3MRMA 1KTDB 2H1PL 5SX5K 2H26B 3FQTB 5KVEH 1Y18A 4U31A 4NBZB 1W0VB 1PKOA 4TSBL 5TE6H 3MRJA 4QWWD 1P7QD 1S9VA 4WHTB 1RU9L 4DAGL 4LLWA 2YPLB 4OKVB 1FFPB 3IDXL 1TVHB 3CZJA 3H3KA 5EU4B 1FNAA 3RQ3A 3HUJB 2JK5B 1JMXA 2I5YL 3CX2A 5FYLH 4QXUL 4S1SH 1XGQA 5GGRY 1PZUB 4PGEA 4XPFH 1WBXA 3IF1B 4JHAL 1EBAA 5GRYA 2IAMA 4HMEA 5DD3L 3WUWB 2V17L 4MXVF 2NY3D 4MQXC 3FB7A 1VFAA 2X1QA 5IBTL 1JL8A 2DJSA 1J86A 3D2UD 4FOMA 1MHEB 4LASL 2P46B 5CZVL 4MDIB 5FM5O 2NY4B 4H8WH 5HHMD 5CGMA 3TN0A 4GG6E 3VFRB 1HCVA 3U46B 2J4WH 3DYMA 5IMOB 3F6LA 1B2WH 3BKJH 3RFZC 2P8MB 5KSAB 2BNRE 4C56B 1MI5D 1JPTH 2GK2A 4IIQA 1J1XL 2AV7B 1IGCH 2A83A 4NGHL 5HD8D 1KOAA 2Y23A 3GMQB 2VE6B 1TJGH 5F70A 5C6WH 1WUNT 4YFLI 1UYWL 1T2XA 4LLQB 4ZXBB 5BS0D 5CJXC 1MCRA 3SCMD 1QSEB 4FZEH 3TYFB 4UIMA 1FV1B 1KEML 3MBEA 3NFPB 1B0GA 1MCSA 4R7NA 4ZS7L 2Y36L 2QQLL 1UZ6F 3QFDA 4L3CA 5F7FA 3UPRB 4Z76B 2NX5B 4JFEB 2VITB 1MRCL 1K8IA 3GSRB 1QUNA 3QCTL 2WWMC 4L3EA 4HK3N 4AIZB 5C07E 5EZJA 1SYSA 4PJGB 2VZOA 1JJUA 4UIMB 3JV4A 5F1SA 2BVYA 3BGMB 4GO6B 2ICES 3GSVB 3D6GA 5JW3H 4LPTA 4BSVB 4UU9B 1NMBH 1I7RB 3EFFA 4EI5A 2WIMA 5FCUL 3T65A 4K8RC 3VXQB 5IB5B 1WZLA 2UYLA 2AI0L 4JM2F 1HILA 3I75B 4GW4B 5C6PB 1FRGH 3U82B 5JW4Q 5JW5A 3ZKNC 5F3HA 1MFAL 4X7SH 4U3CA 5F96L 1RK1A 4N5EC 1JPSH 1YEHH 5JQ6H 4TTDC 5D1QA 1GGCL 2I07B 4NQUA 4ZNCD 4IRJD 1CLYL 3TJHC 4PR5A 5F9OL 1ZTXL 2EE3A 4RCAA 5JO5A 3UJIH 3A6CH 3JXAA 4QF1A 1EUTA 1RUPL 1NMCC 1QBML 1FGVH 5FV2A 1L6ZA 2Y7QB 2FX7L 3MRFB 4NQCE 5B8CA 2J3SA 3HUJA 1YEJL 2JK5A 4I8DA 1T0MB 3JV6A 3NPZB 3FB5B 1MFEH 2X4OA 3L95A 4RFOH 3VMOA 5MEQB 5EN2A 1SM3H 4M1CD 4HBCL 1LEIA 1JGVH 3EDEA 5C0FA 5BZWB 4HKJB 1MFNA 1FCGA 3CFDA 5DJDB 5E94B 4Y1AE 2AJVH 3H42H 5AAMA 1Q1JL 1HSAB 1B4RA 5HVWA 3PP4L 4C56D 1YEEL 4HWZB 4TVPL 3NBNA 4HKBB 4F2MA 3CX5K 4PJ5D 4M9PA 1AIFB 4PJIA 1XGTB 4BK4A 3NA9L 3DUSB 3OKOB 4X99B 1D5BA 1AGDA 4LLAA 2AXFB 1C08B 1N6UA 3KPMB 1IM9A 3S6CA 1NUGA 2HFGH 5DEFA 4BK5A 1S78C 3O8XB 5IJKC 2VTFA 3DVFA 3RWGB 3IJSA 4LCCB 4PLKD 2R1XB 3FQXB 4HXBH 4OFYD 2ZOLA 4AEIL 1I85A 3O2VH 3FFCD 4JPKL 3WLWD 4XB8A 1FVCB 2IPTH 2Q86A 3O6FC 4LHQB 4DK3A 3GM0A 1ZT4A 5DR5L 2JJVA 3KVQA 1WEJL 2PO6C 4KVNL 1D6EB 2EKSB 1XEDA 4EDXB 1KIUA 5FO7A 4F7TB 3BOVA 2EDQA 3W81A 2E7BA 3GSQA 4M61A 5DTFA 1AD9B 1INEL 5T1MB 3F7YA 4LP5A 4HAGA 4Y5XA 2UWEF 4NO5B 5GGVL 3LB6C 4Z0BL 1H15A 3C5JB 3IU3B 4QYOB 4GW5A 4L9DA 4WNQB 1X5KA 5GRUH 3TT3H 2W0KA 3V79C 3BYTA 1VPOL 1B6DA 1NBVH 3QXAA 3EO1B 5FYLE 1HH6A 1SBSH 4ZUUA 4KTEH 4X9GA 4V1DE 3VGGA 3MC0A 5DEGB 5BQ7A 1KENH 1AO7A 4G6MH 4PGBA 1J1OH 1PFCA 4JQXA 3O6MH 1KLUB 5T5FH 1C5CH 3FFDB 3NFSH 4NT6A 4PJIF 2IFGA 2DWEA 3S4SG 4OAWB 4NQCA 4X8XA 2ICWI 2C3XA 1NLBH 5GRXG 4AM0A 1PLGL 4ODHL 2DN7A 4MDJB 3B8SA 4FMKA 4YNYB 5I0DA 3EO1A 3BGFB 1FFQA 4ODWA 1YDPA 4N5ED 5BO1H 4N0YH 5HHQB 3C8KB 3AS0A 3MGTA 3TWCH 1ZV5A 3ULVF 4FZ8L 4U33A 3OG6B 4X5LA 5SV4A 3BDYH 1D9KA 1AD0B 1F90H 1JV5B 4XC1H 3ULUE 1GAFH 2NY6D 4N0FA 5E8PB 4I1NB 4XI5D 2NQCA 2YKLH 1OD7A 5HDQL 2Z91B 5F7KC 1JK8B 4DN3H 1T1WB 3G5VA 3BZFB 5ENWA 3V0WH 5C86A 1OB1A 4CVZB 4LQFH 4OLXL 4O2EA 1GIGH 1KV3A 4KRPC 5IBLD 2HVKA 1FP5A 4XNMA 3RRQA 4DUXA 1I7TB 3PGCA 4MCYA 3IFOB 5LGHL 2V5MA 4KMTH 5LWYH 3RKDD 5HHPA 3MA9L 4PJ8A 3MO1A 4QHKI 3E6HA 2EDEA 1MHPH 3WKML 1T2JA 2R4SL 1GHFH 4ZTOH 2V2WA 5F93C 1TZIA 5D2NA 3LKNA 4RFEB 3H3PL 5GISL 1MFCL 1FAIL 3UO1H 3SCMC 3QIBA 1IKNC 5DHYB 4G6FB 3MRKA 2JCCE 3BVNA 2IH1B 4QWWC 3MRLB 1DR9A 1G9NL 3ARGC 3OR6A 3D87B 2Y36H 3CDGB 3D39A 2F5AL 4LVNC 4MAYC 4PLKC 1NEZA 4YPJA 1RZJL 2LTQC 2YPKB 2IF7A 1P7KA 1WC7A 5EC1B 5L0QB 4XCFH 3CFEA 4G8FA 4OD1H 2DQIH 5K59F 3GSUA 3MV7B 4JFDB 3H8NA 4ODTH 4RISH 5DMGC 1LDPL 3V5KA 5FUZL 3IDIB 5EU7C 5EOCH 1SEBB 4MQ7B 5SWZA 4FNLH 1F4HA 4JANA 3SDYL 3TBWA 2ADFH 4AK1A 1UM6L 3GIZL 1NC4A 1LEGB 2HJKA 4X7SL 4JN2B 5B8CB 5IVNA 4ONGH 5I0ZA 3IDJB 4C4KO 1C5BH 3WN5A 1L7TL 3BP7A 2LVCA 2VL5B 5ANMB 2R15A 4KAQL 4NC0B 4HPOH 5HI3D 2UVFA 4Y1AA 5DD5H 2D31B 4NFCA 5IFHL 3KWWA 1QFWM 2NY1D 1UZ6E 1OSPH 1PX3A 4QRPE 4LP4A 5CEYA 1MLCA 3QHZH 2P49B 4JZOA 3IJHB 5MEOB 1UM5L 5E8OB 4P2RB 2YA0A 4OCSL 3JVGA 4OV5A 1NQBA 3QDGE 3NFNB 1ZT1A 1FVCA 4Y88A 5IBUB 1L0YA 1S5IH 2KDGA 3QT2A 4OLYH 4KUCF 3SGKA 4CVUA 3VXUA 4RMWA 3GSXB 5CJ5A 2VXTL 2JIXA 25C8L 2Q8BH 5ACZA 1BOGB 2DOCA 2WZPD 1A0QH 3F65A 4FQIL 2D7PA 4XBGB 3LPFA 4I77H 3FZUD 3B3IA 3PHQA 3CH8A 4AQ1B 3X3FH 2RCSH 4JGMA 2YPVL 4MJ5B 2OL3B 4KK9D 4Z77B 2V5RA 3DHJA 1UC6A 4AIZA 2EH8L 4WY7L 2ATKA 4PJHE 5I1AA 4ZFOA 2XG4A 32C2A 4W6YB 3UBXI 1C1EH 4XAWH 1QNZH 2XI9A 3TBYB 1NDMA 4BKLB 2NY6B 2XZQH 2WP3T 5TDPB 1NJ9B 3GSQB 3NIDE 3ZL4L 5FO9B 1ZVHA 1S9KC 2HT3D 3SDXF 2HH0L 1EA9C 2CIIB 1X5YA 5JW4N 1GRWA 5ALBH 3WHE0 4R8WL 4XNQB 4UQ3A 1NAMA 1YEIL 3PUCA 5C2BH 3WNMA 4CAGA 5D7LD 5I1CH 4YPGB 3I02A 1XGPB 2ZOLB 3VFVB 43CAA 4U1IA 3LCYA 2PYEE 1FNGA 3ZSSA 1A64A 1DN0A 3SKNB 4QXWA 1J0ZA 1NDMB 3PHSA 5IGXL 1TENA 3T4YA 2SEBB 2IPKB 3KG5A 4J6RH 4OZGA 3HMWL 4BZ1L 5BXFB 3O2DA 3CNKA 4X98B 1F11A 1LP9F 1T5XB 4MB5A 2VDKL 4UNTA 4JFXB 5HHXL 5T3ZD 4LHUG 4JHZA 2CDGB 3AGVA 3G9VA 2F54E 5CHNA 3L7FA 2YHGA 2ERJB 3WUZA 3S35X 1Y6KR 1ROWA 1GOFA 2GKIA 1V7NL 2GFBA 1F3DJ 2UWEE 2H1PH 2DICA 1ZGLA 5H37H 4HKXB 1RUKH 4NZUL 3IT8D 4R96B 4FA8A 3EYUL 4OF3A 4YR6B 3OJMB 5I1JL 4YHZL 2FDBP 3KLAB 3DNKA 1CXHA 3CU1A 1K85A 1DQLL 5FXCH 1ZHNB 1UENA 2V2XB 2BJML 3ZDXF 1CFBA 2BRRH 1S9YA 4PUBL 2LE9A 3ZE2E 4LU5H 4K94L 1DUYA 1DL7H 4ZDHB 3ZKQD 4M7KH 1I1AD 2I60L 3WN5B 1CDCA 1MCOL 3S36X 1MFBH 4XHJC 2AKRB 4KROC 5MI0C 3DUUB 5IG7B 1WFNA 5T1LD 5IB3A 1S9WB 3QDJA 3D25A 1MRFH 3BUYB 1A21A 3RUGF 1FLRH 2DQFA 4ELKA 2X6MA 2A9NL 4E5XA 1Z2KA 4HBQA 2PO6D 2UZIH 5DK2A 2AEPL 4X5WA 3ZZ1A 3I02B 3KYAA 3ULVE 1YNTB 3R0MA 4KQ4L 2WNGA 4X4ME 5I66B 2AJSH 4IHOA 5BV7B 5J13B 2BHUA 3MLWL 3D25B 3C6LD 1KLGA 3FZUC 1P7HL 5I30H 4HIEA 2W9DL 3O9WC 1IL1A 5LCVL 1SVCP 4MNGA 1A3RH 1UYWH 5IBLC 2KQNA 1UWGH 3GMMB 4DKEL 4NM8L 4EQ2A 1U0QA 3KXFA 4PJXA 3VD4A 2CLZA 3KWWB 2NY2B 3RBSA 2F54D 2IADA 3OHXA 4OTXH 5E2VL 4U6VL 4Q97A 3X14A 4ENEC 4EXPX 3I6KB 2Q1EA 1MJJA 1IAOB 3T3ME 3PGCB 4MCYB 2LU3A 4HJGB 3RDTA 2G9HA 4M1CC 5D8JH 2EYRB 2LU4A 4X0KB 3V4UH 4PJ9A 1U8JB 1F4XH 1NFDE 4M43L 1A6PA 5CZVH 3NH7L 1UEMA 2HVJA 5E9DE 3VFMA 1ZHLB 3I3DA 3HRZA 4U05A 3MRCA 2Q20A 4X8JA 4OD3H 1F02I 1VFBA 4UBDD 5TE4L 4L5FL 4JRXE 2DQEH 1CFNA 4HZLB 5EOTA 5A3ID 3KLSA 3TNNB 3RWIB 1INDH 3GMOB 1FL6B 3UTSD 3V0VB 1IAMA 4F9LA 3V4UL 3O3UN 1KT2B 2V9TA 1H0DB 4MWFA 4PIRF 5TDOA 4HWEH 1HOCB 1N0XH 3HR5A 4RAVB 2NXYD 3QEUB 4A6YH 3QCUH 3U6RB 3QXDB 5FUZH 2IBZY 1A1OA 3G6DH 1YECH 2AJUH 1I7UA 4PRPE 4GMSL 3BIBX 3TN0C 1M05A 4OF7A 5I8CB 1GGCH 2DQDL 3P77A 3EHBC 2CK0H 3D0LA 1A9BA 2ADGB 3ARSA 4K3DL 5E6YA 1V3JA 1E4WH 1YMMA 4RWYH 8FABB 3C5SB 1J0KA 1LK2B 4P23D 1RULL 4O02L 4JFOA 4HXAL 5EC1A 3IJYA 3V6BR 1A14L 4JQIL 1IEBA 3HHRB 1NEZB 4F7MA 2AEWA 1RZ7L 5IMLB 5F89A 1NMBL 1H15B 3C5JA 4QYOA 5ADOH 5E8PA 5I73B 2A6DB 3EOTH 3M17A 1IBGL 3N0PB 2R4SH 5E8EB 3OXSA 3BWAA 4YQXH 4XNYL 2XNAB 4Z77A 4DUVA 4PJ7A 5DRZB 5SWSE 3B2VH 4KVCH 5F21B 1MIML 1G7JA 5DRXA 4YEEA 5IB1B 2DI7A 4R8WH 3DURA 5I76A 1A14H 5EB9A 1NAMH 3HI1B 2ZPKL 2Y5TA 4JDVB 3LN5A 1J8HD 3MBXH 4XMKL 4EUPH 2FYYA 4XPTH 1OP3H 2EDLA 3FFDA 5DK2B 1BWWA 5DJAB 3RZCA 1AGBB 1X4XA 4MJIE 2R39A 1FZKA 4NNPL 4QXGH 1W8OA 4WWID 1BQUA 4JDZA 5D70H 3BD5A 3U4EA 4JHWH 2P5ED 3QPQC 4KU1A 5C0CA 1S7VB 5JQHC 4ZDHA 3TWCL 1V05A 4PRPD 4S1QL 3M45A 3KGRA 5F9JB 3O9WB 5E4EB 3HC4L 3RWJA 4DVBB 5SWZD 1ACYH 3FAWA 4U49A 1YJDH 3DV6B 5JUEH 4E0RA 2XTJD 4XC3H 2BHYA 3QNXB 1GSMA 3G5YA 2X70A 3U9PH 4UILL 3VXSD 5IKCB 1S9XA 2CD0A 4XVTL 4HH9A 4E42B 5KANG 4EXKA 4L8CA 3C09C 5B22A 3O6LL 2GSIB 2HYMA 3NH7H 5C0GB 1RQ5A 3VFGL 4ZAKB 2DDQH 3BKMH 4PJ9D 4QHNB 5E2TH 1B3JA 4L8SA 5KN5A 1FNLA 4WUKH 4JO3L 4LCUB 5DD5L 5D7LB 5TE4H 5JO5B 1UB6B 3DTXB 3IS0X 4NHCH 3U6RA 4YWGH 2D3VA 4TNVK 3ZL4H 1DBAL 3VD3A 5DC0A 1Z9MA 4XP9L 1HQRA 2ZG2A 5E56A 3DSNA 4YFLF 2F53D 1TVBA 1FAKT 1I9RH 1KTLA 4X80L 3IDGA 1W0YT 3QEGH 2QQKL 5MENA 3INUL 1AIFA 5FUCE 2QADD 4H0GA 4OM0L 3OJDB 4OTXL 1KN4H 1JMZA 3QIUD 3I6GA 2F9BT 2XN9D 3T2QA 1BREA 3OB0K 2Q8AL 4HS6B 1YPZE 3D69B 12E8L 3BPOB 3VXPA 1H9VA 4QGTA 3MBED 2W9DH 2P1YA 2GJZB 1ZSDB 3AREC 4P23C 4Z7QF 5IIEB 1IAOA 4QTIH 3KJ4B 4HD9A 3VFUA 3I6KA 3CFIC 1EPFA 2KL6A 5DD6B 1MJUH 4MXWH 2XFXB 1CGWA 6CGTA 4LLYA 1FYTE 3VXMB 1RJLA 4ODSH 4L3CB 3JTSA 2YR3A 3HE6D 4HV8A 5E2TL 3L3IA 3X13A 5F44A 3ZDXE 4P5KB 1YQ2A 5D93B 4YHOL 4X4XB 3VXTB 5DFVD 4OT1H 3EYFA 1EEQA 4GQ9L 3MREA 1NH6A 3TBSB 2G5RA 2ADJB 4XNZC 1GGUA 5DJ0A 2AEQH 1FL6A 5TFSH 2RFXB 4S0SD 5KSBB 1QQDB 4P2CG 4JB9H 3RWHA 1YNKL 2BNQE 3V52H 4WFFD 5CEZH 1IILE 1M7IA 2P8PB 5FUCC 1E28A 3MUGB 3VH8A 1S8DA 5I1HH 4NWUL 1AQKH 4OD2A 3FJTA 4NQEB 2OZ4H 1FGNL 3Q3GA 2NZIA 2ADJA 5FHAH 3H9ZA 5D1XB 5GRWA 2BXZA 4LLUB 4ZD3H 1DCLA 1CFTB 5AWNL 5IUSA 3GZKA 3TA3C 2B2XL 1MJJB 5JOPD 3QWOA 4XPAL 5CWSB 4OLUL 3BE1H 3QJFB 2NR6D 1X5ZA 1CVSC 4PR5B 3GIVB 1WIOA 1WIPA 2UZXB 3H7LA 1I1FB 3FQRB 3PQYE 1U8IB 1G7PA 3WS3A 4I0PB 1H3VA 3IDJA 3L6FB 1T66D 4YHPB 4HG4K 3IGAA 2O5YH 1HI6B 3F7PC 5TQ0L 2AJ3B 3IU4L 4R4BA 1Q9KB 5HGBB 4RIRA 2ICWB 3EOAB 5H94B 3QNZA 2D7TL 4LOUD 5LBSL 3OKNB 1YJDC 2VDQL 4OIIH 3VD5A 1BQSA 2ZKHH 4ZUTB 3TNMA 4WO4B 4K7PL 1P7KB 3CXHJ 5ADPH 5GGTH 3GRWL 2QQLH 4JVUA 5EU6A 4JPWL 5FDWB 4PB9H 4HCRA 5FYKU 3HRPA 4J23A 2IH1A 3NZHL 35C8L 1I3GL 4M7JH 4PRID 3CFBA 4O02H 1P6FA 3KPMA 4JG1H 2GK0A 4MA7H 5DRNA 4OFYA 3B3IB 3PHQB 5DURB 2HWZH 1RIUH 4JPIB 4JM4H 1BZQK 2F8XC 4N1CA 1VACA 4WFHD 5CMAB 4EUPA 1KJMA 5TF1H 3IDMA 1J1XH 4FS0A 5FYKH 5DMYA 1AXSB 3IF1A 5LQBL 1NCNA 2VDPL 1ZT7A 1G6RH 1IGYB 5DFTA 1Q94A 3T0WA 1I3GH 3CVHB 4WEMB 5J3HC 4QRPD 2IWGA 1UCBL 4NP4L 3DO7B 2XT1B 3D39D 2NZ9C 4KZEL 1YEGL 1OAZH 2Z93B 4Q58C 5BV7H 3NCFB 3EDJA 4I0CC 3W0WD 1I9IH 4H8WL 1MUJB 3WJJC 5DUBA 2V17H 3HZVA 5D1QC 3U30B 3RUGB 4QXUH 1W72H 4OGYH 2EXYD 4KK5C 2D7QA 2R56L 3QUYB 5IQ9A 5DXWA 5JIPA 2B8OT 2JCCF 3B4NA 3DECA 3R1GL 5K9JL 3MOAH 2D2OA 4PP1D 4LCUA 1RU9H 4DAGH 1SYVB 4YDIL 5FYJH 4GW4A 3QJHB 1EO7A 1WCQA 4O2CB 3VXRE 3C5ZB 3W9EA 1U3ZA 1L7IL 4G6JL 1U9KA 3H6JA 5ID0A 2K1MA 3S5LA 5L7XL 3IKKA 4XP6H 4O5LH 1LEKA 1WVZA 4RGNB 3EAKA 4I0PC 1G9ML 3KLHD 2CIIA 2L7JA 4IRSD 4K23L 3EFDH 2F19L 3WHE1 5CJQH 3PWUB 1CD8A 4Q9BA 2XTJE 3MV8B 2XQBL 1AE6L 5B3JE 1CF8L 1P1ZB 3X13B 1JZ5A 1LO2L 4TQEL 1ITBB 4Y2DA 2HRPL 4D0DB 4HWBA 3THMH 3RPIB 2YXFA 2Z4QB 3EDFA 2HFGL 4QHUA 1NBZB 3MLYL 4BFIA 3UYPA 3VG9C 2PN5A 3SKUD 3M8OH 2XQYG 1B90A 4EIZC 2OTPA 1N7MH 4PBWD 3FT2B 4CU6A 4JFPB 4L4VE 4LOUC 3SJVB 3DUHA 3MXVL 3P4NA 1RJZB 3PWUA 3ZT5A 1U95B 4F57L 3VFSA 5TPWL 2RJMA 2MTPA 4Q9QH 3ZYJA 2NW3A 1HCFX 5DK0B 3ME0A 1LO3L 1P9MA 3BP6B 3FFCE 3QIUC 4J7RA 5JHDE 1A6UH 3OAYH 5L2KE 4PG2A 2O5ZL 3BZEB 2XNAA 5FYKD 4MS8D 4Q2ZB 1XR9B 5MEND 1F97A 5JOPE 1N0LA 1PAMA 3ZDYF 4BH7B 4ODWB 1OAXH 3F6IA 4WTZA 1HOCA 4MD5B 4MDJA 4YNYA 1Q9WB 3OXRA 3DTXA 1ORQA 3PF2A 4CMMB 2PUQT 4IDLA 3K2UL 4KK8C 4Z7QE 3QCVH 5DDHA 1C12A 3I3BA 2VDLH 1N3NA 2FSEA 3MFFB 4G9DA 4WEBH 1IC1A 3OZ9H 4Q6IC 1UADC 4P2OB 5KZCB 4P4KB 4PJFE 1CR9L 5EUOA 4LBEA 5T5FL 3BKYH 1SEBA 4ODHH 3HB3D 1IVLA 3MYJB 4GRMA 4B53A 4Z5RB 2FATH 4M9OA 4XH2A 4OT1L 4FABL 2R1YA 3BUTA 4AL8H 1MPAH 3DGGA 4G8IB 2FGWH 2P5WD 2AK4E 3SE9H 1UZ8B 3C60A 1EEYA 5F8RC 4J8RA 4WWKC 4F7EA 3TJEH 2C1PB 1KENL 4G6ML 1UM4H 1ZVSA 4L3EE 3ARYA 2KQMA 4GRWB 3ROLA 2I07A 3WUWG 1ZE3C 1UXWB 5IM7A 2GCYB 2R29H 3LKNB 3WMSA 3WDHA 2EYSB 3V0VA 1XF5A 4OAWA 3MNWB 4ZYKB 4LARL 5FA3B 1N2RB 1VFMA 3MRIA 5DHVB 5B38A 1WFTA 4OUUA 5EDXA 1BM3H 1JGLH 4K8RL 4FFWD 5D4QA 3RY6C 2AGJH 3AS2A 1SJHA 5C08B 1T22A 1U3HB 1FC1A 5C0EB 3GSVA 5L0QC 1E4JA 1A7QH 3BMWA 2PO6A 2DLTA 1BMGA 2YD4A 4JRYB 7FABL 3EDDA 2WQ8A 2H2SC 4CNIB 4W70A 3FONB 5D7SH 1QSZA 1I8LC 1WK0A 2PXYD 5FYJE 1C08A 3Q6GL 4OBSA 5GJSH 5DFVC 2E27H 2OJZL 3UPRA 1EZVY 3MBXL 4X9FA 4AEEA 3DVGA 3QFDB 4UUJB 3S98A 3MUZ1 4G43A 5FGCB 3AMLA 4P46D 5CIPH 3V0AC 4HIEB 2ZUYA 2XWJA 4XXCC 1BAFL 1U8NB 4NQTA 1NCCH 5D2LA 5IHZA 3KLAA 3KXFD 4IHOB 1HH9A 2R0KL 4X5WB 5BVPH 5BZWA 1DEEA 4HJ0C 1LP9A 2EEDA 2FLBT 3VFSB 3QWOB 5BMFL 1KPVB 5DD1H 2ED7A 5CD3B 3LEYL 1DANU 3HNVH 3MRDA 3SDCB 4M6ML 3O8XC 4Y1AD 5F6HJ 3WS6A 3R06A 5HVHB 2VXUH 4TOYH 5HYJA 2NR6C 4M62L 4H1LH 4RMSA 1HHIA 1QD0A 1PZ5B 4LCYA 4F7PA 3QIWB 1I3UA 5LXGH 4GSDH 1DUYB 1DEEB 5IHLB 5CGYD 5ID1B 3IU3A 3RWIA 4GMSH 1J0JA 1D5MA 1MFAH 3WFEL 1YEFL 5I1DA 4PLJD 2X09A 3OGCB 4HWUA 4TSAL 4LMQE 5IROC 1AY1L 1JGUL 2ICEB 4XPTL 4X7TB 1BD2E 1MELA 4R4FL 4R3SA 3JWDC 4WUUA 1SEQL 4DGYH 2PYEA 4JQVA 1CGSH 1RUQL 4XVSL 5K9OB 4TRPL 3C60C 1KJ2L 3QUYD 4R97B 2QQNL 2BNRB 4ZUWA 2ITCB 2DJ4A 1KB5L 4O2CA 2YK1L 3T0DA 1A7BA 5I17B 5D7KD 5E7FA 3GMRB 5ALCL 3HNTH 5T1LA 3LKOA 1ACZA 4X9HA 5ICYA 2J1KA 3DVNB 3QFJD 4GUPA 2O61A 4H8WC 1QSEE 1FCCA 2EDBA 1QTYT 1KPUA 1Q72L 4HIIB 4YHIA 4I48B 1YYLL 4ETQB 5A2FA 5ILTH 2YUXA 4P2OC 3H9SE 1CGYA 2ZCHH 4HKBA 4F2MB 2IALA 4ODBD 2AABH 3U1SH 3VWKB 1U6AH 4FTVE 1SEQH 4PJBB 1QLEL 5B3JF 3O6FB 2VLKB 5DQDH 4JFQA 2XZAH 2VLRE 1AY1H 1MFDH 2XIDA 1QR4A 3ULVD 3FB5A 4PFEA 3DGGB 43C9A 2NY0B 2YOCA 5D1QD 4YXHH 4U1MB 1R0AL 2BRQA 1LHZA 1U3HC 1JHLH 4NWTL 2IPUG 4I3GA 3KPSE 4MDIA 2XKNA 5B38G 4M3KB 2AJUL 3P9MA 3C8DA 3GIVA 4PREA 3VCLA 1I3VA 3GMPB 1UA6L 4P5TB 1N6QH 4K3JL 5GS1B 1AI1H 1RZ8A 2VXUL 3DYPA 3GJFK 5IMMA 5IESL 2MPAH 1MCIA 2HG5A 1NMAH 4YHKH 3TGXA 4MS8C 3S34L 5FECA 4MSWA 1Y6NR 4LAJH 2VXQL 3T2NL 2E5EA 5I74C 4OQTH 1INDL 4AENB 5IOPA 3MOAL 1U93B 1ND0A 1UH4A 3VXQA 3NABL 1XIWB 4LLWB 3VXNB 3TBVA 5DSCA 1F2XK 3VFPB 1QQDA 2IGFL 2QBWA 5F1IA 1R3KA 5LGJB 1C5BL 3P0YH 2CDGA 4GXVH 4ACPA 4IJ3B 3IFPA 1T2QH 4IMLA 4NDMB 3BRDA 5BRZB 1JTOA 2C4FT 2DBJA 4LSTL 4QRSB 4P48A 2DB8A 4Y1AB 4S10A 4HG4J 1JVKA 2Y72A 3SDDB 1DJSA 3FOLB 3TPKA 5CEXB 4NQDE 1Y0LB 3VDBA 3KPRE 2C4FU 3F7RA 3GI9H 1CE1L 5ABDE 4PJ7B 3KPLB 4ODXA 2NXZD 4YDLB 3B6SB 4CVXB 3ULUF 2AK4D 2NNAA 4OLZH 1TDQA 4HS3B 1UKQA 4MQ7A 3GKWH 3QI9B 4PJAB 3C6LB 1BEYH 3C60D 4DCQA 3QUYC 4U1JB 4BH8B 4YDKH 3NA4A 1NAML 4M6NH 3K80A 1M4KA 4OZ4A 2Z91A 3MRGA 1PYWB 4R2GB 5ESQB 1QEWA 3UTQB 1MIMH 5CFHA 8FABA 5EBMA 4NO0B 3IFNL 4U6HA 2W9EL 4R97C 1YEIH 1UG9A 3T77B 2ATKB 4LQ1A 4NZRH 1J8HB 2VC2H 3EZ8A 4OUUB 1UXSB 4LIQH 2FSEB 3O2DL 4ZPVA 3GSNL 4HWBH 3B9KB 3W5NA 1BLNB 5F7DB 2Z8RA 1YQVH 5EPMA 2FX9L 5IEHA 3AUVA 3HFMH 4LPYA 2GY7B 2VAJA 1M1SA 3WNNA 4FQHA 1KC5H 1YEKL 1ZS8A 1F42A 3UTSA 4IMKA 5E0QA 3MJ9L 3V8CA 5T1KB 2FCBA 4M1DL 1BD2D 2GJZA 5GIRB 4NQCD 5D72H 2MCG1 4TSAH 2FBJL 3E2HC 3LH2H 3TIEA 5BVJA 1FNHA 1KB9K 5F71A 3ROOA 5EZIH 3HE6C 2ESVB 4OZGF 3A6BH 3S35L 2JTDA 5GGRA 2VUOA 1UT9A 5HHOD 3ZKND 3GBML 4M02A 3VMPA 4H0IA 2B39A 2FH6A 4XVUD 4PJFA 3G6DL 2HVJB 1QLFB 4ELMA 4LDOB 1TCRA 4MX7A 3VXUD 5I15L 4O2FA 1A6AB 3SO5A 2GEEA 4KKAD 3MFFA 1HHKB 2PXYB 3O3AA 1W72L 2FB4H 4JKWA 4U2ZA 2ITDA 4X4ZA 4ZFGH 4GBXD 5IVXF 3A6OA 3GSNH 4OSUL 5C9KA 3ZYZA 1FVDA 4H1LG 1X4ZA 5DVMA 3SO3C 5IFHH 2VLJD 3KNBB 5C0GA 4RQQB 5DJXB 4JFZL 1I3RB 2G2RA 4TNVF 1M7DA 5KVMC 4E42A 3EBAA 1KCVL 2C1OB 2ZP0T 1UA6H 5HGAB 2YPKA 1QFWH 3SKOA 3WIIL 4EDWH 3QNXA 4OF0A 1G0YR 4GRLD 2H2SD 4PPTA 1NEZG 3MLYH 3E1F1 5D5MB 3QDMB 2XKUA 2R23A 1U8NA 3KYKH 3BVNB 3VGHA 4YFEA 4KZDH 3VWKA 5KAQF 1ZA3B 5IF0A 3NCMA 1KXTB 3BP4B 1LDPH 4MXQC 4RA0C 4BUHA 3OKNA 1I3RA 2G2RB 2GYSA 2GTWB 5A2LH 1X9QA 4H0HB 1ZVYA 2Q8AH 3U4AA 4AMKL 1OQOA 3EYSL 2NNAB 2X05A 4PJHF 3V6FB 5MENE 1QRNA 1H3PL 1I7ZA 1IQDA 4GXVL 1AR2A 5C0BA 3VGDA 4R90H 3QUYA 1OGTB 1KBGL 3PGDB 4Z78A 3WLWC 3BIKA 4KY1L 1CL7I 2HVKB 5J12C 3G6JA 2H2PC 3O4OB 4QOKD 4FXGB 2P5EA 1ETZB 5FYJU 2JCCB 5DUPH 1S7QB 1T5WB 1E0OB 4K2UL 1HYRC 3NCBB 4TULL 5IW6B 2ARJA 1CZ8L 2R1WB 2GAZB 2XWBB 4RZCA 2DLFL 3ARFD 4YR6A 3KJ6H 4Z7VB 5CIPB 1QOKA 1GJIA 4HKXA 4QRPA 1U8MA 3D18B 1KJ3H 4G6AD 2W59A 1CN4A 1L7TH 3C8KA 1RZFH 3V6ZA 5D2NC 5JUEL 4XMLH 1I1AC 1EEZA 3IAQA 3ROLB 1JNHB 4PJIB 3BT2L 2R0LL 2EDHA 4QRRB 3CGTA 4PYHA 4MAYA 2AJYL 1BGXH 1CBVH 4X4XA 4ZD3L 1HNGA 2WUBH 3ARBB 4TYUA 3BQUB 4IBLT 4M6AA 2FJGB 3EJYD 3I6LD 4PGBB 1R5IB 1CLYH 1EV2E 3BWUC 3RY4A 4QRPB 3DJ9A 2X4UA 3VH8G 3U7YL 5D1XC 1H5BC 4S1RL 4YHNA 3MRNB 3QIBD 4L8BB 3MLWH 1YQVL 3MRGB 4LSPL 4CKVX 3QO0A 5FUOL 2GI7A 5HGHA 3H3PH 1MHCB 3CFJB 5EUKB 1ZSDA 3CVIL 1CXLA 4FFYL 4KPHL 2A6JB 4PJBA 5DMIH 4DGIH 4B41A 4U1KB 3C09B 2XA3A 4PS4L 4X6DB 1YUHB 2CDFB 4X6FA 3ZE2F 4X7TA 4Z95L 1ZWIB 1OW0A 3CCHA 3LS5H 4N0UB 5E03A 4HGKC 5FK9A 2JELH 3TBTA 1NCCL 3KYOA 4PJHB 1MLBA 2CKNA 3H0TA 4U1SB 4UTAL 4IRSC 2EC9U 4XVSH 5FGBA 3G5XB 1VGKB 1U8QA 3LIZH 3EKCA 4FFYH 3OTTA 4WI4A 3SGKC 1BQHA 1LE5A 3QFJA 1NDGB 2PW1B 2RHEA 3QUZB 4LSPH 4ALAH 4FZ8H 2Y1VA 4HKZA 1II4E 1X5GA 3FMGL 2WANA 1OQXA 4JKPL 3O2VL 1NFIB 1A1NB 5EIVA 4HPYH 5IB2B 3C08L 3KYOB 1FL5A 1FZJB 3HUJE 3QXVA 3G6AB 2CLZB 4WW2B 3NIDF 5K9KA 1MNUL 2CR3A 4KJWC 2BVQA 1YECL 1VFAB 4QEGA 1BGXL 2ERJC 4OUOA 3MJ9H 1FC2D 5GGQL 1RY7B 2Z35A 1YZZA 1HWGB 1D5MB 4CN6A 1S7WA 4D0CB 3SGDI 3C2SA 1FH5L 4UQ2A 3UROR 5C0FB 1T7XA 4NQVB 1N6VA 4MHHG 3G6AA 4C58B 1FL3A 1RI8A 2DI8A 5DI8A 5F7EH 2NPLX 5IEKA 3SDDD 1NGWB 3WFZA 3TV3H 4JN2A 2BNQD 3UYOD 3FOMB 4OZFG 4K3JH 3MTRA 4QO1A 5KZCD 5FGSA 2J8OA 3RGVA 4AL8L 5F7WC 5IVOA 1S7TB 1YNLL 4YHLH 3CH1B 4KRNA 4M4RA 2W60A 4OLEA 2BOCB 1UJ3B 4RGND 4QKXB 5C7XL 3GEWB 2Y07H 4Y4FD 3WNKA 3TBTB 2V2XA 4JAMA 4BQ8A 5DUMH 4OZGE 3S97C 4LSUL 3KR3L 5KW9L 1FO0B 3B9VA 5DJ8A 3WIHA 1RFDL 1XGPA 2UUDK 4JO1L 3U1SL 1CE6B 5KJRL 5L88L 5CJOH 1T4KA 4UU9A 2NY0C 3S5LG 2MSPA 3HS0A 3SQOL 5F72S 2UV3A 5C07B 3AREB 5GJTL 2J7LA 2GITB 2YD7A 1V3KA 5CBAA 1OWRM 3IJYB 1Q72H 5C0RL 5IVXE 2FO1A 2M1KA 4TPRL 3QO0B 4NNYA 3O6KL 5D1ZD 1PY9A 3UC0L 2VL4A 3UP1A 5FO8B 1RUMH 4WI8A 3X12B 2XXCB 3NTCL 1IT9L 1A7PH 1C16A 1U91A 5C08A 1JWMA 5TPWH 3V95A 32C2B 4IDJH 1JPGB 4MGXA 2VERN 3ALXA 3RI5F 4WI6A 4R26L 5DHVA 1RIVH 3IDGB 3PWPB 3VDCA 4WEUD 1NCDL 4PP2B 4QRRA 4D0DA 4K3HA 3DXAB 4LSQL 3BD3A 2DI9A 5F9JA 2GTWA 1A1OB 1MCEA 3TVMA 2G5BB 5M7QA 3U9PL 4PLJC 2A74B 4PJDA 4WHCA 2I9LB 4EJ1C 3FB6A 3V6ZB 1NAMB 1EEUA 2A0LD 4G8GE 4BSWB 1IFHL 1U8LA 3V0WL 5E08L 4YHZH 1Q9LA 5EG6C 3OZ9L 4LSVH 4OJFH 1NGQH 5HGHB 5IB4A 2EEAA 4XT1C 3S5LB 2VLLB 4N1HB 2A6IA 4N9GB 5SX4H 4QRQB 4YXHL 2XPGA 5E9DB 4GAYB 1GL4B 1EFXB 5F8QC 4E41A 2MHAB 1BD2A 2GJ6E 2ZUVA 5E99H 3QG7H 5H2BB 1FVDB 3AFLA 1KB5B 1FSKB 1HSBB 4HPYL 4NRZB 4MLSA 5CZXD 5JXED 4EI5D 2AI0H 2VL5A 1V3LA 5AUMB 5DA4A 4OZHA 4CN1A 4X4YB 4AT6A 2OCFD 4JKKA 2PNDA 1WBXB 1G7HB 3RX7A 2CRIA 5IP4A 3CUPB 3OXSB 4Z7WE 3NPSB 4F3FB 5T3XE 1KIQA 1VSCA 3ET9F 1S7VA 2E6QA 4CVWA 3B8YA 3FB8B 4LEOB 1E28B 5MERB 3X3GL 3L3JB 5EBLA 4PRPB 2FECI 3ARQA 4RA3A 4NKMA 3O2WH 1CTOA 1XGRA 3Q0HA 4TSCL 4J3UA 1CZ8H 3SDCC 3BPNB 5T3XD 4HLJA 4F57H 1GGIH 4XGZB 1OARH 4A6YB 5MEOA 3RZCB 4UTBH 5IFAH 1MREL 2XKSA 4IDJL 4Z95H 2WIIA 4PJ5B 1T5WA 4YAQA 2CH8A 3HN3A 4A2LA 4L9LC 4R4NC 2X4QB 5DWUL 4J4PA 1EO5A 5EU3B 1F6LL 3FKUS 2EDKA 3VI3F 3T0EB 1IQWL 3RX8A 4ZMAT 5BZDB 3PGDA 4MNGE 4RRPA 3VXMA 5I1EL 4GRLA 5CP3A 1PKQA 1RMFL 5T1DL 3EFDL 2P44B 2J88L 3LPGA 4EIGB 15C8L 1EXUA 3DROB 1H3WM 4PY7B 1AE6H 4FQPA 1FZOA 4PJ5A 2O5XL 2Z4QA 4XNMB 5A16A 4M5YL 2HWZL 3SE8L 3RUGA 3QEGL 2OYPA 4NOFA 3LKSA 3P9LA 1FN4A 1JUFA 2H32B 4DVRH 2CSPA 3QO1A 1QBAA 4CUCA 5FKAA 4ZUVB 3B5HA 1T0NA 5DO2C 4OFVA 1RURH 2ENYA 4V1DB 5D2LF 3DIFB 3WKNA 1DBBH 4G7YL 3O3DA 1T83A 4O4YL 3TH3T 2FEDD 4OGXL 3RTQC 1E4XI 3ARVA 1EXUB 5DHXB 2JIXD 4HT1L 2H6PA 3P3YA 3HNVL 5AG9A 4AT6B 2LAAA 4K3EH 1JI1A 3QUXA 1P2CB 1JZ3A 3S34H 5INCA 3VXSA 4ZFOL 4EUPB 4MB4A 2J5LB 3PP4H 1RD6A 2BY0A 4EN3A 1WV7T 3PP3K 4I2XA 4U6YA 1E6JL 3WSQL 1P5VA 2B20A 1X7QB 1WICA 4UBDC 2L4OA 3LS4H 1EBPA 5HYJB 4NJ9H 3T4YB 1F3JB 1QKZL 1CXFA 1F58L 4OD2B 5GXBB 3IRPX 3OKDB 3VH8B 4DKAA 3ZDZF 2QJDA 1TETH 3BPLC 1IGIL 3CSGA 4KMLB 4WWKA 2FBJH 5IHBA 1G6RL 3I84A 1FL3B 2R2EB 4MMXC 1XIWD 2AP2A 3Q6FB 2AXGA 3RWEA 3RX5A 5I1EH 4FHBD 5DQ9B 5JXEC 4NQXB 3MLTA 3GDBA 4H20H 3BJLA 4KTDL 5D7LE 4K8RH 4XCYB 5I75B 1AKJB 1OSZB 1FG9C 1YY8A 4IOFD 5H2BA 3L6FA 4QCIA 1JWMB 4ZNEE 4NZRL 4WW2A 1CU4L 3P30H 4AIOA 4HMCA 1UQSA 3LN9A 1IKNA 3WNOA 1KF9B 1DQTA 5IFJA 2OK0L 4NBYB 4ZOEA 4PV8B 3BPOC 3U83A 2OL3A 5HYSA 1L4IA 5ICZB 4XNYH 4H88L 1CYGA 5F9WB 1B0RB 2AK4A 3RWDA 4NDMA 2E8YA 5SV3A 3SDCD 1HK6A 1MCCA 2R2BA 4KDTC 5FDWA 2RQ8A 2R0WH 4YC2C 4LLQA 1M7XA 1ZK9A 3W2DH 1JGVL 1I8IB 4EVNB 4ZOBA 3MA7B 4LNRB 4DCQB 2P8PA 2Q76A 2VRAA 3CC5B 3QP3A 1MHHA 1JWSB 4L8DA 4LFHD 4OCWL 3MODH 2APFA 4X6DF 2O5YL 5HI4C 3U7YH 5C0RH 3O0RL 2A6DA 4AEHL 1NL0L 4M1GH 1QBMH 3AS1A 1FHGA 5GZND 3NGBB 4JZOB 4NO0D 3RVVC 4KKAC 1JPGA 5EZOH 2OR8A 4LPVA 3K46A 3L3OB 4G9FA 4Y2OA 1TJIH 1DLFH 5IQ9B 4FQIH 2EKSA 1I75A 2YEZA 1HZHL 4Q6YA 1QVOA 4NBXB 1DFBL 3FN3A 4OJFL 5IVZA 1LEIB 1UZ8A 3C60B 4RGMC 3RDTC 3IYLW 4W81A 5GS3A 4QRSA 3U79A 2APXA 3RTQA 1S5IL 1A3LL 2ZUQB 5HTSA 5J06A 3MNVA 2BX5A 1F4YH 3P0VH 2FIKA 3TO4C 5EU4A 4BFEA 1FPTH 2OQJB 2A0LC 3GHEL 3WO4B 1FFPA 1Z9SA 1QVOB 4YBLB 2RGSA 5EO1B 5FOBA 1ZT7B 4JFED 1KJ3L 2QADB 3JWOC 4Y16B 4EUPG 2DS4A 4RMQA 4L5FH 1RK1B 1BVKB 1KELL 3WDIA 4LLDA 3OAUH 1ZGLP 1AH1A 5KVFL 5DQJA 5JW5B 4G9FE 3ULSA 3TO2B 1LDSA 2XTJC 1CT8B 2MQ0A 1X5JA 4XXDA 2X4SB 5F7EL 5IR1A 1UB5A 3SCMB 2WINB 3TNNA 4YHIB 4Y4FB 1UCBH 1BX2B 1A1MB 3RGVD 4Z7UB 3CFBB 1OF2B 4TPRH 1E4KC 2OR9H 5EA0L 3CFDB 2C3WA 4MNQA 4GBXA 1KJVA 3D0VA 3W82A 3HC3H 3MXWL 3L95B 5MEQA 1DQQA 4XHQA 4XCEA 1CF8H 2XFXA 1AC6A 1JRHH 3P4LA 4IS6A 3HG1B 3MRPA 2P4AB 2G9HB 3GSXA 3KLDA 1U95A 2DQGH 4FQ2H 4NYLB 3U0PB 5F7UA 2EIDA 4XTRC 3FMGH 3VWJC 3LAFA 1Z9OA 1JCKA 3TZVA 2ICWA 3HMXH 5H94A 5I1KL 3KNBA 1AKJD 3MSPA 3AY4A 4JR9H 1T04B 1GPOL 2EXWD 3QR2A 3ZMRA 3BPCA 5DJ8B 1UH3A 3D3VE 4BFIB 4FQXA 5I16B 4KGLA 2BVQB 5E2WH 4XCYA 4XPGL 4K7PH 3TM6A 4KROB 3RWJB 1IAIL 1WIUA 4HUMB 3O6LH 3L1OL 1LK3L 2AEIT 4YWGL 1J9CT 1FG2B 4PV9B 5KVFH 1QRND 5AZ2H 3M1BB 4JO3H 2BC4A 5EBGA 2FWOB 1N5YL 2YZ1A 2F54B 3N85L 2R9HC 4N0RA 4BQBA 3GJFB 3OSKA 3BGMA 1A2YB 5DT1H 1KJ2A 4NO2B 5GRVK 4KPHH 1XGYH 3OKEA 5IESH 1MQKL 4D9LL 2R4RH 3TVMD 4E9LA 3BQUA 5ID0B 3MV9D 2DLHA 2CUIA 3FCTB 1P7QA 3N1MC 5IWLC 3VGFA 1GGBL 3BFOA 4RNRB 4JDVA 4ZAKD 1KACB 1ORQB 3UPCA 2P5WA 5T3XL 2OZ4L 3RVVD 1X5HA 2X44D 4PJ8C 1UXWA 5DJCB 2Z9TA 5KVDL 3MNZB 4GSDL 1NGXB 4HFWB 1CK0H 1EJOL 3OF6D 2V6HA 4E41D 4IRSA 2NTFB 5DQDL 1ZA6B 2CUMA 1K4DB 4TUJA 5CINH 2EE6A 5JQ6L 4IRJC 1WCBA 4NM4L 4P23B 3MYJA 4XMPL 1H5BA 5AYUH 3RL2A 4PGCB 1F3JA 1MJ7L 5F9WC 1PG7L 3KS0J 5HHOE 3BX7C 3CAFA 3CX5J 4KUCD 4RGOH 3VXPB 2AEQL 1CGVA 3FRPG 3D3VD 4XNZB 3F58H 1U58A 1OGTA 4OZHF 1OOAA 3FQUA 1MHEA 2VDQH 2W9EH 3JTTB 1A02N 4M6OH 2Z92A 4OF6A 1CTNA 2E7HA 1V8HA 4YK4C 1KCSH 5J11B 3VG0L 2NY4C 1XIWC 4GBXB 1JWUB 2ZWLT 1HQRB 3D85D 1RPQA 2FRGP 4G43B 4BZYA 3MA7A 2EIZB 5TDNB 3ZE0E 3L5XL 1EK3A 4P46A 5JOFA 2IQ9H 3UZEA 3QDMA 4U4BA 3RNQA 1UWGL 5GZOC 5KSVA 3VXMD 1YNTA 3VFOB 1T21A 1BFVL 2PO6B 2KZ1B 5HYSB 4NPYB 4AEFA 4FFVD 3WO4C 3M07A 4L29B 4X8JB 3HNSH 3ZKXC 1AO7B 4HS3A 1T89A 1OTSC 3NMEA 4MZ2A 4HWEL 2EDWA 3MNVB 1MRDL 2CKBB 3X17A 5JHDB 5E08H 1YN6B 1Z9LA 4F58H 1DQDH 4D3CH 4NKQB 4YBQD 5D96C 3EYVA 3LN4A 4QXTA 3RBGA 4YGAB 4YHKL 4G5ZH 5D71H 2LAGB 1XH3A 2R69H 1HINL 3L3OA 4DTGL 2ZNWA 1NCDH 4M7KL 4AZ8A 4OV6F 3IAPA 4WO4C 5D9SB 1NANH 4Y19E 2B4CH 4H26A 3GBLA 4LAQL 5IWLA 1P7QB 4MXWL 4W68A 1HHGB 3CVHH 1KLUA 2BMKA 3ZT6A 4FQLL 1J0HA 1YPZA 3UTSB 4WHYH 4UOW1 4GAGL 4F9PC 3DRQA 2RAMA 3EYQD 2CJUL 1BFVH 1U8HA 3HG1A 2GT9A 4ZPTA 2EDXA 5IB1A 2IPUK 3QEQE 1P4LB 1ZMYA 1J1PL 1NAKL 2PYFB 1B0RA 2AK4B 2MMXA 3BP7B 4PJFF 4HFUL 3LMJH 3N1PC 4EN3C 3FO0H 4FXKA 1JF6A 1S7XA 4ODTL 3ARGB 4F9LC 3B9DA 2C26A 3GSNA 4L3EB 5E8EA 5JIHA 2Q87A 1ZLUK 2NY7H 1QLEH 4PTTA 3RWFA 5DO2D 2APBA 2C9AA 4PJCB 2VLME 2BERA 2AGJL 1S5HB 2IBZX 2DM2A 3BPCB 3I2CL 3KYNA 3HNTL 1HSAA 4ZUWB 3K81A 5HGGS 5DC4B 5IGXH 1Q9OB 4YQXL 3UBXG 4FMFA 1X5AA 4BQCA 5T33H 4F7CB 1IGYA 1KPRA 2DTMH 1GGIL 4S0TD 2MOVA 3IFNH 4PJDB 3N50A 3OV6A 4JCLA 1ZLSH 4MJIB 1KN2L 4JG0L 4KMTL 1G6RB 2ZOKB 4Y4HA 4NCC2 3TJEL 4YO0B 4OZIE 3CPLA 2BJMH 3D85B 4QF1B 5B39G 2E7CA 4WDIA 5I8OL 4FQJH 3VWJD 1GOHA 1I8KB 1DL7L 3GKWL 4XB7A 5CWSA 1G7MA 1OHQA 4G6KL 4XMPH 2QR0A 5ITFB 4J3VA 1KT2A 4POYA 5FO8A 4HUVB 3SDAA 3TO2A 3B2UC 3IXAA 1AGCB 3Q3GB 3UPAA 1WTLA 3HC0B 3D85A 5JHLL 1JRHL 1JK8A 5CKAA 1TETL 1T3FB 3L3JA 5EBLB 5JNYA 2UY7A 1A7OL 4MAYD 4TOYL 4FQ1L 1NCAH 2R0LH 2NTFA 25C8H 4WCYH 1QFPA 2AJ3A 2VDKH 2IMMA 3WYRA 3O4LB 4ZSOB 1IC5H 3CLFL 2EYRA 3KPLA 4ODXB 4YHPA 3S3SA 3EW3B 1G7QA 3JWNC 5DD1L 3WCYA 3P11L 3L3KB 3OB8A 3SGJC 1MQKH 4D9LH 3P4OA 3WFCL 5KSUA 3TZVC 5FB8B 5TDPA 4XP5H 1UJTA 2QQQA 5EC2A 2UVEA 3SDDA 2BSED 1UQSB 5I1IL 3UDWC 2XKNB 3Q2CA 3WL9B 4C4KT 4XPFL 4GG8A 1FNSL 5I1AB 3QIWA 2JELL 4QRQA 2DQEL 4Y2DC 3LSOA 5DUPL 5D5MF 5C0DB 3DYOA 2CO6B 4YXLL 1T03L 4UAOC 3WS6C 5GRUL 2B5IB 1FZMB 2FO4A 4WJ5B 4OGXH 3MUGA 1IT9H 4HF5H 5H35B 4NP4H 1JHTA 2GJJA 4OCYL 1LE5B 1B4JH 1EGJL 2ZSWA 4M7LH 1DLHA 2HFEA 1U93A 3MROB 3MJ9A 2NX5D 3ARFB 3BPNC 3RNQB 5MHSE 5D93C 1TIUA 4QHMB 4OD1L 1S9WA 4XNXL 2P8MA 5KSAA 5DMKB 1R3JA 4HDIB 1G7LB 2J88H 4GS7C 3RHWF 1IGJA 3KHQA 4HUNB 4K07A 3GMPA 1CDGA 3RVXC 3FB8A 4LEOA 1JNJA 3LKOB 2GSGB 2YC1A 4JFFB 4KJYB 2D0GA 2VZ1A 4JQVC 3X3FL 5CEXA 5BW7C 3DBXB 1YY8B 4W4NA 3NIFF 1AKJA 3U0WH 3C9NA 5JORB 4MJ5A 5FIEA 3WUWA 3QDJD 3F5WB 4YXLH 1IC7H 5DURD 3VWJB 4FQXD 1T20A 4NKOB 4LCCA 2FHBA 2APTA 4OFKA 5AEAA 1OM3H 4PBXA 2I60H 4HF5L 2V7NB 2BNQB 2J8UE 2X40A 4O51A 3NCYP 1MPAL 3T2NH 5EU7E 3CLEL 1QFUL 2OP4H 4J3XA 1DDHB 3ULVH 2Z31A 3O3BA 1VA9A 1T0NB 1K4DA 2A9MH 1WQVT 2YUWA 3CZFA 3ZYIA 4R4BB 1OAUH 2LU7A 4OZHE 4JO2L 5GSVA 3KPSB 3SPVA 3IGAB 3P73A 3BEWB 5GGUB 1DBKH 2A38A 4JFXA 3WL9A 1LP9E 3GKZA 2A73A 4FNLL 2FBOJ 3U4EB 4X98A 1XR9A 1PBYA 4NO3B 1OAQL 4MJ6B 1UWEL 5D6CB 3MLVL 1A8JH 5E99L 3E3QC 3GB7B 1P2CA 4ETYA 1WJ3A 2VR5A 5E00A 4CMHC 1HHJA 1RUAL 1JPSL 1YEHL 1G9NH 4ZXBD 2F74A 1NGQL 2X42A 4LSSL 1XF4A 2R0ZH 5DZOA 2ADIB 1N64H 2MCPH 3IRZA 2ZUQC 4XPHH 3SGJA 1BBJB 1MH5B 1FIGH 1WWAX 5E70A 1U8KA 1Q0XL 4R7DB 3KPNA 2XYCA 5AZEL 1D3CA 1K3ZA 4XCNB 2YBRB 5DRZA 6FABH 2DQTH 2IALB 5JR1L 3VWKD 3LDBC 3JWDL 4CRPA 1J5OL 5DD0H 1AGEA 3DX9A 4HIJA 3STZB 4YX2H 2QR0B 9CGTA 3PIQB 5IB5A 1Z0MA 1ORSA 1AD0A 2XQYK 3G04B 2ZNXA 3BI9X 4KUZL 1AP2A 2YSSA 1JFQL 2XZZA 1R24A 3WIFA 4BSVA 4TRPH 3BP6A 4YO0A 1BVLA 4KTDH 5AYUL 5C0AE 1MRCH 4DN3L 1U8HB 3C5SA 5DC9B 5ACZB 1K8DB 3IU4H 5HD8C 3MACH 2BY1A 2QSCH 4J12A 4JM2B 1INEH 1DQMH 3JV5A 1CFQA 3D5OF 3Q6GH 3SOBH 1M7DB 4LMQI 4XBEL 1JNNH 3OKEB 3HLAB 1YEFH 4OLZL 3C6SA 4Y7MA 1IGIH 3ARTA 1GC1L 2OXGA 3GO1H 4PRIB 3O8XA 4HK0A 5L8KB 5JTWA 4B7LA 1MAML 5JW4M 1B0GB 3NFPA 4JFFD 1I7ZB 4LIQE 4AEIH 2Q8BL 2NY2C 3BWAB 5CP7A 1PQZA 3GUTB 1UWEH 3E2HB 4G8EA 4BZ2L 4I77L 1H0DA 5TDOB 5BO1L 4ZOAA 4O2FB 3NCEB 4CN4A 1FFRA 2DIBA 2R4RL 2BVPB 4HWZA 1XGUB 4N90E 5HHQA 3PG2A 3HPJA 1EAPB 2HP4A 2VWEE 4KJQC 2IFFH 4K3EL 1HQ4B 4U7SA 4DW2H 2HT4C 4HK0B 2GIYA 3VFMB 4Y4HD 1F8TH 1MF2L 1PW3A 4L4JA 4KI1A 1LEKB 3U4BL 2B7DT 4N90D 4DN4L 1A1NA 4MXVE 1AGBA 3TO4A 3VWJA 1DBML 3BXNB 2VIRB 3RZCD 2DMCA 5EORH 3MRIB 4HJGA 3F12B 1OLLA 5CD3A 3LKPA 1KJ2B 2YD2A 4NO2A 3GHEH 4Z0XB 4HT1H 3GJFA 4EN3B 3ZTJH 1QPPA 2O93L 3STBA 3GSWB 1WFOA 1CIDA 2YC1B 1PJ9A 5DEFB 2DLEA 1VGKA 2HLAA 5EOQH 3G6JE 1RUPH 3HMXL 4DVBA 2VQ1A 5I9QB 4CADA 1JWUA 5C0BE 1IGTB 4QHMA 3FO1B 2HMID 1VEPA 3UEZA 4TTGA 4M61B 5DTFB 2EIBA 4ALAL 4O51B 1FZKB 4EDXA 5DGRA 4PB9L 5F3BB 1T1ZB 2P5EB 5E94A 3CVHA 5H35A 5KS9E 1RJYA 1XCTB 1WISA 4XP9H 3RL2B 1MHPL 3WKMH 4C57C 5IG7A 3C9NB 4RBPH 1G9NC 5D5ME 4I4WB 3LSOB 5A2IH 5EPMB 1Z3GH 1DQQB 3F58L 4ZFOB 4OIIL 3VFGH 3MLRL 3D2UA 4M6OL 4JY5L 5DZLA 2VMFA 3DXAD 4K94H 2WP3O 1S78D 3EO9H 4HIJB 3STZA 4D9QE 5GSVB 3S88H 1UGNA 1BJ1J 4OZ4B 2ZZUT 3O41A 3QUXD 3RNKA 4R96A 3IDNA 3TT1L 2HRPH 1S8DB 4NSKB 4FZEL 2WWMD 4P99A 1QA9B 5DJDA 4DOHB 1MH5A 4LNRA 4HKZB 5ACMA 1I1CA 3EOBA 1FZMA 2FO4B 3QQ4A 5E2UH 2BNQA 3BD4A 2VQTA 2P43B 2BHZA 4XI5C 2YPLE 2PW1A 2VXSL 5C0DA 4RZCB 4ERSL 3BDYL 4PBVC 3TBSA 1G9MH 1D6VL 2ARJB 3TEUA 5EOQL 2HAZA 2K7PA 2HKFH 3ALPA 4AJ0A 2VUYA 1I1FA 2VZUA 5D7IB 3UJTH 1GGTA 4MMZC 3IVKB 4PV9A 2JCCA 4UINH 5J12B 3TESA 4Q6IB 4LAQH 1F58H 4GRWE 4P5TA 5BXFA 3AM8A 4UQ2B 3G5ZB 4DZ8B 3GHBL 5DUBB 5C09E 4HHAB 4ESKA 5FK9B 4MNHA 1QSFE 3BJ91 4JY5H 1N59A 3TYGL 4XMKH 1HINH 3U2SA 3KPSA 3CXDH 4RRPG 1K5NB 1RIHH 3MPCA 4XCCH 4HZLA 4V2BA 5EOTB 1Q9LB 1KPRB 4HUUB 3FCTA 5EU5A 1A9EA 2HLFC 3LKQA 2A1WH 1M7IB 3H9SD 2VZVA 4UDUA 4C54A 1KG0B 4IOIB 4IJ3C 4R0LA 3CFKA 2AV1B 1ND0B 1NGYB 3QUZA 2J8UF 3TCLA 3H3BC 4M00A 1TZHB 3MRHB 1VGEL 3PDOB 2H32A 1MCNA 2E9JA 5CSZA 1BVLB 3C5ZD 2GHWB 3ARDA 5F7MC 3VFWA 3F5WA 4Z0BH 3GSOB 4ZTPL 4U6TA 5DRNB 3VXTA 4KFZC 1CICC 1A5FL 3BISA 3D2UB 3KYMB 3WHXA 4K7PY 1A7QL 3RU8H 2VKXA 5DJXA 2CRMA 2Y5EA 5SX5H 5KVEL 1U3JA 2AXFA 1GPOH 4UV4H 5ERWB 5FA3A 5BOZG 1JYXA 1RJLB 4JHBA 2O5XH 4KHXH 2FH8A 1AXTL 4JJHA 4NQSA 2XY2A 3W11D 5FYKE 4U1MA 1O5DT 2CDEB 3MXWH 1RFDH 1M6OB 3DO7A 3CSYB 2J6EH 2HFTA 1SVZA 1IGMH 5EFIA 4WUKL 4NGHH 3P0YL 3GBNH 1N5AB 4M62H 2HN7A 1CE6A 2NY1C 3MUY1 3KYNB 2C3GA 5E5MA 5EU6D 1BP3B 3WXVL 3Q5YA 4C56A 1QYGH 3CDYA 1BBDL 2MKWA 2FGWL 2BZDA 1TQBB 3GMLA 5I1LB 4Q0XH 4AYFA 1PSKH 4BFBD 2D03H 3VGAB 1UB5B 2VDNH 3HC4H 2WBJB 3RGVB 2VLRD 1SMOA 2GT9B 4YBHA 1A3LH 1BOGA 1FIGL 1I1RA 3OKYA 5JLZB 4K7FA 3T4AB 2YRPA 5DJYA 1OTSD 3QNYA 2UYLB 2CPCA 4ZUTA 3VXUB 3ULUL 2CIKB 4LLMA 4NN6C 2EH7L 1RUKL 4DFHA 1KG0A 1UM6H 4OLUH 1XGQB 1KUMA 4K94C 5IJKA 1I8MB 5DMJB 3EOAA 3LQAH 4FQQB 1X5FA 1LO4H 3RNKB 3MZGB 1JNNL 2PTVA 2Q3AA 3HAEB 2P47B 3QXWA 3UJIL 4QNPE 3ABZA 4JDTH 4BSWA 4O58L 3L5WA 4TNWF 3QHFH 3VXSE 2WW8A 3EOYG 3L7FB 3RU8L 3L3GB 4U1JA 4BH8A 1S5HA 3S37H 1MJ8L 2YUVA 1AHWA 1GCFA 3TC9A 4UTAH 3HG1D 3UYRL 2VO5A 4YHYC 3BH9B 3OKLB 5ESVA 5LGKA 3ESVF 4NUJA 3OKKB 3S37X 1IQDB 1AD9A 3V6FA 3UCRA 3V4PH 3LRSB 2IPKA 4OZGB 4FXKB 4KWUA 3N1QC 3IXTA 3F7QA 2OS7A 5IJVA 3B9AA 2L7UA 4YHOH 4M8VA 1JWSA 1A6AA 2WUCL 4L8DB 3V5KB 3VXNA 3HLAA 1OM3L 4BJLA 3VRLF 3TCLB 3WNPA 3RJDA 4NPYA 4P46C 3L3GA 5TQ0H 4OCXH 5FKPA 4WWKB 2RFXA 4IOIA 4JFYB 4RDQF 3THML 2NY2D 2A6IB 4N9GA 5EU5B 3IJSB 1UWXH 2H3NB 4JQIH 2XN9E 2WMPA 3L3HA 2EIZA 3QWRA 1C1EL 2WV3A 3QHFL 3BDXA 4F80A 1DVFD 4X83A 3IDYC 4ZNEA 5CEYB 1FNEA 4NKDB 1X6NA 2H41A 4WV1C 4I2XB 2C3HA 2RIKA 2P8LB 2N4IA 5EC2B 3CUPA 4FG6D 3HC3L 4JRYA 2ITDB 4ZXBC 5GHWH 4Z0XA 3SE4C 2X4PA 3J8F7 4ZAKA 2DMKA 5IIEA 4LHUA 4KI5C 3LRGA 4ZSOA 3TP4A 2BVEA 4KKCC 5IQ7H 4XP6L 1DBJL 4XRCA 3TA3B 3QAZB 4MVBC 4G8GB 3O6ML 4KJWD 4PJEB 4R3SB 4WUUB 3SO3B 3BKCL 3U4BH 4HQQH 4XHJD 4Z7WA 5IB4B 2X4PB 3IDNB 3R8QA 1C12B 2OL3L 1ZHBA 4LASH 1F4XL 1SBSL 4M43H 5C8JB 5EO0B 3GMNA 3OXRB 1PDKA 3LV3B 5BRZE 4PJAA 3MMEA 3HS0B 1X44A 4J4PC 4FQHB 4P3DA 5B21A 3B83A 1SHMA 5GGSA 3SPVB 2K3TA 1IL1B 1RHHA 1AFVL 4F7TA 3GBMH 3VFTA 2Y9RT 2YA2A 1OW0C 4GS7B 2NW3B 3IDXH 4Z7WB 2CKBH 4MD4B 4LCWB 4BZ2H 1LO2H 1ZANH 2EYTA 1S9XB 4JQXC 1OD9A 4EI5B 1WEJH 4JM4L 4OM0H 4GRWF 3SJVA 3NN8A 4JO1H 4PRAB 2Y5TB 5DK3A 2IG2L 4L29A 1JZ7A 1I9RL 4S2SB 1NDGA 3L5IA 3O0RH 5D2LB 1MI5E 4JKPH 3SE8H 4WHDA 1JTPA 5C9JB 3GK8L 3LHPL 3G5VB 5ENWB 3RAJL 2AV1A 3DSFH 3LB6D 1IJ9A 4D0BB 4PD4J 4UUJA 5D7KE 1K9TA 4WFED 2AJSL 5FGRA 2CKBL 4PJ5E 3RWFB 3QNZB 5I19L 3FO1A 4DKFL 5DVKA 5K9QI 4I9WD 2EDTA 2X4SA 1AHWC 2J4WL 4Y2DB 3KPOB 3MQIA 2RBLA 3B6SA 3I85A 4CVXA 4OCNC 3E8UL 4IRZL 2F53B 4CJ0A 4X6CE 4KROD 2X4RB 4P2QE 3UXFA 2GY5A 2Z35B 2R23B 3BSZL 3T0EA 4S2SA 1UM4L 3V4PL 3E6HB 3RGHA 4RNRA 5CSBA 5D7IA 3IVKA 3HPLB 3QHZL 3IFOA 3PE9A 2IBBA 3SDAC 1KIRA 3HE7D 5CSGA 4HBCH 2BMKB 2AXJA 5I8CA 1GGYA 2CGRH 2ESVE 3CVIH 1UACH 1MVFA 2BY3A 1DQLH 2YZ8A 3NCJL 4FFZH 1RK0B 3FQWB 2VWEC 1D5ZA 4Z7UA 4PLOB 2Z31D 2DQUL 3SCMA 5GRJL 3RGVC 3C08H 1D9KB 1W0WA 4CDGC 4NWUH 1KTKE 3TH4T 5T3ZE 4G6FD 4FG6C 5E6IB 3MV8A 2SEBA 4U1GC 5T3XH 5EZOL 5D7JA 1F6FB 3EYFB 2APVA 3L5WB 3U30C 1P84K 4FQLH 2DL9A 1XF3B 5GS1A 2Z31B 3TT1H 1T7WA 1JYNA 4LK4A 1J87A 2MJWA 4PJEA 1U8MB 3D18A 3SEPA 2F5AH 4HC1H 4NQCB 3QQ9D 3ROOB 2D03L 1J1OL 1RZIB 2DWEB 4WENB 2FIKB 4P5TD 1XMWA 2EDDA 4Z9KB 4Y19A 3U48A 4Q74A 5HHME 2YD8A 4BZ1H 3JBG7 3VE0B 4M7ZC 5CUSL 5E00B 1RHFA 1Q8MA 1M6OA 5DJYB 5FO9A 2R0WL 5CBAB 1SYVA 4ZTOL 4PD4K 5C0EA 4WTXA 1Z3GL 5DVOA 4OCMC 4JM2C 1BQHB 4P49A 1DEDA 3RWCA 3KXFB 4PJXB 3ZE1F 3N9GL 1KEGH 1R5IA 3G5XA 1JN6B 7CGTA 4H1LA 1BFSA 1LE9B 3LHPH 3RIFK 2RB8A 1Q0XH 4DVRL 2F15A 2D4DA 1TVBB 5C0NC 4K3DH 1J0IA 4XNXH 1JZ2A 2EZ0D 1KCUL 2AK1L 1HWHB 1U8KB 4R7DA 3VWKC 3RIFF 4PRNA 4ZO6A 3NIGE 1W72A 4BA8A 2E7LA 5EZLA 4Y4HC 2B1AL 5CIPA 1EUUA 5HVFB 2CMRH 4O5LL 2HJLA 3PL6C 3LZFL 3QI9C 3LRHA 3LQAC 2Y7QA 4BKLA 1CFSA 3DX8B 4GKZB 4Z5RA 5TH2A 3VJ6A 2VITA 3BP5B 2NY5H 1TVDA 1AFVH 2X4NA 3TBYA 3G5YB 4NQVA 2GSGA 4W4OA 3ESUF 3S8WA 5BRZD 2Y07L 1A6TA 2OL3H 1PGRB 3GGWB 3SE3A 1HXMA 1NFDF 2VXVH 3U7WH 4Y4FA 5L2KD 4MAYB 3O9WD 1CFTA 5D96B 5I18H 1P84J 3Q1SH 1CLCA 2I9TB 2BVOB 3KPOA 4Z7OE 1EO8L 3DVGB 1R6VA 5JXAH 1MJ7H 1BVKA 1IC5L 2XACC 4YDVB 5HVHC 1KIPB 3Q5TA 5HYEA 3BZEA 1EH9A 4C56E 3QIUB 3FRUA 2ZG3A 4MA3B 2KPNA 4RIRB 3T0ED 5I15H 2Y25A 1OT2A 4JPVL 5F7YC 5GGQH 3O41B 4R90L 1HHHB 4KK6C 3LVEA 3IXAB 2ORBL 4DUWA 5FECB 1K4CA 4NRXB 2VXSH 1INQB 4ERSH 1N26A 1MLCB 1ZTXH 2J6EL 3MRDB 3SDCA 4RBPK 3HZKA 3A6BL 3MR9A 5IMMB 1KGCE 2EYTB 4U6YB 5IFJB 4RFEA 2CQVA 4HX1B 3MCKB 4W6XB 1K8DA 4NNPH 4D8PA 4JFPA 4JZNA 4N0CC 2FNBA 1S7WB 4Z76A 3HMXA 1CDHA 1CICB 4N0UE 1MSPA 2Y06L 4I4WA 4OM1H 5BS0B 2PTUA 2FJHB 4BFGA 5CZKA 3KPTA 4ZTPH 5CBEB 4LCIH 4NO0A 5T3ZL 3LQZA 4G9FD 3GMNB 1PYWA 4OQTA 5KS9A 4HH8A 4NHCL 2V7HA 3EFFB 1JZ4A 3QEQA 3VFOA 3JWOH 1MFBL 1BF2A 3HG1E 1J8KA 1F4WL 3FQTA 1ZLSL 4QOKE 3C8HA 4LQFL 3B2VL 4KVCL 1OPGH 3BDBA 5T1KD 3OR7A 5JR1H 1YC7A 4MNQB 1F11B 1X5XA 3DMMB 1NCBL 2OM5A 3IETB 2E27L 2OJZH 1JN6A 1K8IB 1FIEA 1N3NB