3UACA

Multicopper oxidase cueo mutant c500se506q (data4)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
489
structure length
476
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHSHLLEHQDTGMMLGFTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Blue copper oxidase CueO
publication title An O-centered structure of the trinuclear copper center in the Cys500Ser/Glu506Gln mutant of CueO and structural changes in low to high X-ray dose conditions.
pubmed doi rcsb
source organism Escherichia coli
total genus 136
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uacA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uacA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uacA03
1JZGA 1AZCA 1OOWA 2XXGA 2RACA 3H56A 1URIA 1NPJA 1E5YA 1L9TA 4NB7A 5E9NA 2CCWA 1KCWA 2Q9OA 2A3TA 1CUOA 2B3IA 4HHWA 5I5IA 1PLAA 2H3XC 4YSUA 1KDJA 3ABGA 3FSVA 4G70B 3UACA 2I7OA 1RKRA 1AAJA 1GY1A 4K9JA 1AZBA 2VMJA 1DZ0A 2AANA 2JKWA 2XVBA 1JZJA 2FT6A 2OCCB 4BDVB 4YSAA 1E30A 2H47C 3HEIB 2DY2A 3QJQB 2AVFA 4HAKA 3FYIB 3PCYA 4YSRA 4JHUA 5I6OA 1IBZA 2IWKA 5AKRA 5ANHA 3FSZA 2LLNA 1SDDB 3V9CA 5I6MA 4DP1X 1J9TA 3BVDB 1SFDA 2WO3B 5LDUA 2PLTA 3T6ZA 1JOIA 3QJUB 1IC0A 2DYRB 3DKHA 4KNTA 1L9QA 1ILUA 2QPEB 1GS8A 3NSYA 2DV6A 3UAAA 2QDWA 4DP0X 4P5SA 2DWTA 6PCYA 2BW5A 2GC4C 4FA7B 1ZDQA 3OMIB 4FAAB 4CSPA 1N70A 1SHWA 4DP2X 2QDVA 1AZNA 1JZEA 2I7SA 4BK5C 4YSOA 2GBAA 2IWEA 4UANA 2VM3A 4YL4A 4CSZA 3FPXA 1GY2A 1HAUA 2FQGA 2UX6A 1NIDA 2J57A 5A7EA 4KO9A 4A2FA 2CJ3A 4AKPA 1SHXA 1SJMA 3C75A 2BP0A 4W9ZA 2HXAA 5I26A 1AR1B 3BQVA 3WI9A 2Q5BA 2TSAA 3IEAA 1MZYA 3KW7A 5AFAA 2EIKB 3X1FA 1V10A 1V55B 2PPCA 1AZRA 3NJNA 1M57B 1ASQA 2E86A 3ERXA 3GYRA 2GIMA 4ENZA 2UXVA 4GXFA 4YSEA 1MZZA 3L45A 4G7RB 3NJHA 1OCOB 3QQXA 3AY2A 1PMYA 1BEXA 2UXTA 1YLBB 2P80A 3TU6A 3NJKA 5PAZA 3N55A 1J5CA 1E65A 1NINA 2NRDA 5TK4A 4E9XA 2CAKA 4NAJA 3OMNB 3QJSB 4N8UA 2HX8A 2VW4A 3TBBA 1GYCA 3NYKA 4HHGA 3FT0A 4M3HA 2EIMB 3PXLA 4GP5B 4W1TA 2GC7C 1IBYA 3V9EA 1PZBA 3T6XA 4DP6X 1NICA 1PAZA 1PNDA 2YARA 1AG0A 3UABA 1OE3A 1FA4A 2AFNA 4HCIA 1PF3A 1OF0A 4KNUA 3ABLB 2AZAA 5I6PA 1AOZA 3IN2A 1KGYE 3N2JA 4YSQA 2HRHA 1TKWA 1DYZA 2BHFA 2GI0A 3TA4D 5B3SB 4EF3A 1IKOP 3OM3B 4YSSA 2EILB 4KOCA 1SNRA 1ZIBA 3OMAB 3SBQA 2XXFA 1A4CA 1NWOA 3FQ2A 3ZDWA 2XV0A 4NERA 1NIAA 2FQEA 4MFHA 4GY4A 5I5MA 1A65A 5I6KA 2PP7A 5AZUA 2XX1A 3TBCA 4RH4A 1RZPA 1PY0A 3SBPA 4E9VA 1ASPA 3NSFA 1J9SA 4G7QB 1T5KA 2HX7A 1PZAA 2VM4A 4A2GA 1AACA 4QLWA 4N4YB 4YSTA 1F56A 3PAVA 6PAZA 1E67A 2BWIA 1AQ8A 1AIZA 2VSKB 3EH5B 1QNIA 1SF5A 2BO0A 5PCYA 2FQDA 1ID2A 1KBWA 2VSMB 3OD3A 4BWTA 2YQBA 3PPSA 4F7KA 2UXFA 4HZ1A 1UATA 4DP8X 2HLEB 3GXUB 1E5ZA 5TK2A 2UX7A 2PP8A 3CZUB 3NJIA 2X88A 2GSMB 3HB3B 2BWDA 1OCRB 8PAZA 4G71B 4GYBA 3AG4B 4AKOA 2PPEA 2W88A 1J9QA 3H4HA 2YAQA 1NZRA 1ZIAA 1ZDSA 3EF4A 3NJLA 1WA0X 3OQRA 1PLBA 3WNIA 2BP0B 4F2EA 2BP8A 2IH8A 3NJJA 3AG1B 5B1AB 2N0MA 4WKXA 4G7SB 3NSCA 2IAAC 3UADA 1BXAA 1M56B 1SFHA 1TU2A 2QT6A 2YXVA 4BWUA 3S8FB 1BYOA 3T71A 2OV0A 1NPNA 2I85A 1VLXA 4ZK8A 3ZBMA 1AS6A 1NIBA 5B1JC 1A8ZA 3NSDA 4G72B 4AX3A 3CVCA 1KDIA 1V54B 1XB3A 1BQRA 5F7AA 1ET5A 2R7EA 1NTDA 3NT0A 1L9OA 5I6LA 4KOBA 1A4AA 2W8CA 2XV2A 3IBOA 3U25A 1SF3A 2FQFA 3G5WA 4HIPA 2FTAA 2YAMA 2PPDA 1HFUA 4YVNA 2PCFA 4YSCA 4BXSV 2MTAA 4A68A 4E9TA 4BWWA 2PPFA 3CDZB 2J55A 2IDTA 4HCGA 2WO2B 1GS7A 1CYXA 4DP4X 3QPKA 4Q8BA 3T6VA 2JXMA 2UXGA 4E9RA 1OE2A 3QJRB 1JVLA 2XYBA 1GW0A 3KW8A 1XB8A 2B08A 3WIAA 3CDZA 2QPDB 4F2FA 4HCFA 3FQ1A 3S8GB 1J5DA 2YXWA 1JERA 5I5JA 5F7BA 3SBRA 2J5WA 1A4BA 1GR7A 1WA1X 1BQKA 2IDUA 2MRYA 3JT2A 5IY5B 3H4FA 1NIEA 3ASOB 1BXUA 4P5RA 4Q89A 4GP4B 3EHBB 1N68A 2DYSB 4E9WA 2X87A 3DIVA 3ASNB 2DWSA 2XWZA 4HALA 1XMEB 3X1NA 1AANA 5EHFA 3ABMB 3CG8A 2ZONA 1WA2X 2PPAA 1L9SA 4YSDA 2YAEA 1J9RA 2BZCA 5B1JA 5I28A 1XB6A 2XX0A 3NJMA 1KV7A 1JZIA 4JKNA 4E9SA 2IDFA 2IH9A 2WSDA 4JHVA 4UF7C 3S3CB 2FJSA 3T6WA 2GB2A 3CVDA 5B7FA 3MBWB 9PCYA 1PZCA 1CC3A 3AZUA 3S3DB 7PAZA 2VN3A 2XLLA 4GP8B 4X4KA 3FU7A 4E9QA 2HZHA 1EZLA 1TEFA 3D12B 3EH3B 7PCYA 3MX0B 1ASOA 1JZHA 2TSBA 2BP8B 3UGEA 2XV3A 3JTBA 4KO6A 3FS9A 3QJVB 2J56A 2YAOA 1PNCA 1RZQA 3FU9A 1KYAA 1M9WA 4YVUA 1RCYA 3AW5A 3IE9A 3X1EA 5B7EA 1OE1A 4YSPA 1A3ZA 1KCBA 1W6WA 4DPCX 3X1BA 2IDSA 2CBPA 3AG2B 1ADWA 1JXDA 2CUAA 4WTQA 3PAUA 3TASA 4BDVA 1GSKA 2P80D 2R7EB 4AI7A 1AS8A 2VW6A 4PAZA 4A67A 2XU9A 3PAZA 1JXGA 2PCYA 1BQ5A 1CYWA 1HAWA 1SDDA 2Y1AA 3NJGA 3X1GA 4AKQA 1KBVA 3FSAA 2JFCA 1JXFA 4KO5A 5I6NA 1OCZB 3CVBA 1NIFA 1B3IA 3QJTB 4DP9X 1L9PA 5D4JA 1ZV2A 5D4HA 2VW7A 5B7MA 1PCSA 1AS7A 1OCCB 3FU8A 4DP5X 3IN0A 1PLCA 3NP4A 2H5UA 1ILSA 3ABKB 2HRGA 3FQYA 2ZOOA 1FWXA 2FWLB 4E9YA 1WS8A 2FT7A 3GDCA 3ZX1A 1QHQA 4KNSA 4M4RB 4DPBX 1OV8A 5D4IA 3EH4B 1EHKB 2ZWNA 1W8EA 3WKQA 1X9UA 1NWPA 3WKPA 2XUWA 3FPYA 4DP7X 1NDTA 1WAEA 4A66A 1JZFA 2IDQA 3T9WA 2Y69B 4A2DA 1QLEB 3X2QB 5B1KA 3DTUB 5B1BB 1IUZA 2PP9A 4BXVA 2OJ1A 1FFTB 2YAFA 3PLYA 1BYPA 3FSWA 2IWFA 2YAHA 1X9RA 4KO7A 1ETJA 3NJFA 3NP3A 2AZUA 3UAEA 3ZIYA 1W6LA 1CURA 4A2EA 4DPAX 4TXVB 3SQRA 3WNJA 4A2HA 3WG7B 1MG3C 2HX9A 1AZUA 2GHZA 3S3BB 3AG3B 1BAWA 1BXVA 1ZPUA 4PCYA 2BW4A 1MG2C 2EINB 1WS7A 1L9RA 4L0PB 1R1CA 4QKTA 1GS6X 1JVOA 5FC9A 2ZXWB 1AG6A 4AZUA 2FNWA 2EIJB 1TEGA 2CALA 3FU7B 3FYEB 1MDAA 2YAPA 4UAHA 1I53A 1ET7A 1ET8A 2FT8A 2BZ7A 3RYMA
chains in the Genus database with same CATH superfamily
2Z4QA 1JZGA 1OOWA 5D1QD 4WUUB 1DLHB 3DX7A 1H15A 2HTLD 4PREB 1ZS8A 3FFDA 1KPUB 4UINH 3BAEL 3MV9D 3QZWB 1ZVSB 1FJ1B 1DBML 2ZICA 4PJEE 5C8JA 1UVQB 5F7MC 2R2CA 3H0TB 5KBMA 3VI3A 3CMOL 3EFOA 3BSZH 3ILQC 5AB9A 1MREH 4WUUA 2PTUA 4GEJA 4P3DB 4PREA 1WSST 5FUZH 4ORGA 3RI5K 3IDYC 4FQXC 1HL4A 2QGBA 4F8TA 3P3UA 3FTWA 1BZ8A 2FEDC 4QMEA 2NX5E 1YPZE 3H0TA 1MXDA 4XPHL 5AOLA 3OC5A 3GZKA 3HZYB 4X50A 4BD4A 4AQZA 1SFDA 1CF8L 3B5TA 3HNTH 4HMCA 4PJDF 4DHLA 3FQWB 4UTBL 2K6WA 1LO0H 1TZHB 4EI5D 1SJHB 4PFEA 4Q2ZB 4ZX6A 2D31B 2EIDA 4IOSA 1NUFA 3GEWB 2J25A 2OBGA 4X6DA 4ELKA 2A7BA 1Q72H 2W60B 2BW5A 2RMNA 3HZYA 1ZDQA 4L05A 5C0RH 5LVEA 3QHZH 2O5ZL 5AD0B 5BRZA 3GLAA 1CO1A 2A9NL 3VA6A 1YN7A 4Y19E 5CJ5A 3LRGA 2NY1B 4MDRA 3WYRA 1HAUA 2AITA 3HBQA 1PS3A 3VXPA 1LE9A 2J57A 3U7YL 2W60A 3SEPA 3EJQA 4L4VE 5HYEA 5F9DC 3JWNE 2BMKA 4N2NA 1JZDC 2DWEB 2CGRH 3RA7H 4AYFA 4YFDB 4CNIA 3NA4A 3ZR5A 3OB0H 1DSWA 5IHBA 4PRHE 2A6KB 1OANA 3OKLB 3QA3B 3BUDA 1DDTA 2DQFA 2EIKB 5KBDA 4FNLH 4KK8C 2X9XA 2AJZB 1RPUA 4AIXA 2YD3A 1C5BL 3SDCD 3ERXA 4A1RA 2GIMA 2UXVA 4X6CE 1GHFH 3BAWA 4NXKA 3K2MC 4ZQKB 4KQ4L 5I19L 1U8NA 2FR4B 2ARWA 2BFGA 1J0KA 4X9BA 4EKXA 5CJOL 3REVB 3HRPA 1VFBB 1X7TA 3S3PA 4L0YA 1J5CA 1MFDH 5DD1L 1JBJA 1U2YA 1K8DB 4IJ3C 2AJZA 4B9CA 4AQEA 3J8F7 4N8UA 3RUGF 5JZ7C 4KRNA 1AHKA 1HIMH 2ADIB 4KXZI 4PTUA 3D52A 1F11A 2X4UB 3OSKA 1NBZA 1I1FB 5CGYC 2CHXA 4PBVC 3HR6A 4XBEL 3TO4D 3W5MA 5I1EL 5AB1A 3UBXG 4O4YL 4FZEL 3HAEG 4A7GF 4MZIA 2YPVH 3UZQA 2ADIA 1IAMA 4MAYD 4KY2A 4PY8I 5SWSD 3OXSA 5JW4R 3OHXA 3H6JA 4L48A 2J20A 4YR6A 5EZLA 1YMMD 3AY4C 4R96A 1XZ0B 2NY5L 2ZKHL 3OZLA 1PYWB 1UKQA 4OFIA 1HWWA 3FT4B 1K2DB 3G6DH 4JQVA 4N2EA 1MH5B 3O9WA 1T22B 4NM8L 3OKNB 4IKJA 2ZWKA 1NWOA 1EJOH 5CINL 3M86A 1JD7A 3EBGA 2OMVB 1DEDA 1JK8A 2OULB 1KIQB 3QJHA 4KU1A 3VXOB 1YMHA 1GSMA 2Q86B 1XZ0A 4NPKA 1XF3A 3B34A 1NC4B 4V1DE 4GQRA 4XN1A 3P40A 3MXWH 2APTA 2XETA 1K2DA 1PY0A 3FT4A 1DCEA 3MXVL 5KSBE 1T22A 3RP1A 1F0LA 2Z31B 3H9YA 1T3FB 3R4DA 4WI6A 4PW4A 3SCMD 2W80C 5I6XC 2LVEA 4F7TA 4UDTA 3GMLB 5CEZH 1HHHB 2YMTA 3KLHC 1NC4A 5HHPB 4LEEA 5GSRB 3TN0C 3OD3A 3TPKA 4M6OL 5J1AB 3GSUA 3HJEA 4HS8H 4F7KA 2DWXA 4G6AD 4Z7VE 3EG9B 1OKEA 3A67H 5EORL 2YFNA 3GXUB 5EEWA 1S3KL 1QUPA 1HHHA 2I07B 2MMXA 3B8SA 4D0DB 2MQ3A 3H2QA 2VIRB 3NSXA 4MMXC 2ZUTA 3F6JA 4FFZA 1D5XA 2BSTB 4X4MA 4XP9L 4PRNB 3BZEA 4ZPVB 2BC4A 1UWFA 1DJYA 1ZDSA 1ZIAA 4I85A 2P46B 3NRQA 4Y9FA 3NJJA 4LPXA 1D5IL 2VIRA 5BQDA 1Z1WA 2ED6A 3ZTJG 3F83A 1VFOA 1Z3RA 1CQYA 2AQPA 2IPTL 3ULUH 3CHSA 4PRNA 5EH1A 3H7BB 3VXTB 3CH1A 1E4XL 4KMQA 3VH8G 4L3CA 2WW8A 1HU8A 3DPBA 5D7IA 2H0EA 1VGEL 3MTXA 4QAMB 1MCLA 3VWKC 4WK4B 4Z3FA 3K2UH 1ET5A 3I9PA 5D1ZI 1GRWA 3Q2WA 1CGYA 2MNJB 1O9ZA 2A4EA 5CZXC 3F5WA 4KKLC 3VXTA 4JDTH 3ARRA 5BW7C 5HHXH 2EDOA 4Y2LA 1DQML 1EXGA 1EDHA 4TVPE 4QJ5B 2FTAA 2FL5B 1DBBL 5B3NA 4G5ZH 4S1SH 3N6YA 5ITBL 2EC8A 4ANVA 3N41B 4PGJA 3GNMH 3WN6A 4JFUA 2PYED 5I1AB 4H0IA 5LQBL 4GQ9L 3HMXA 2ODIA 1PKQE 1KCUH 2WB7A 3B3IB 4GRMA 5BOZG 1X5LA 5JOPE 2LLLA 3D0AA 1LP9A 4ZFFA 3VSQA 2FL5A 5E2TL 4NKDB 3S4SA 1FO0H 3QPKA 1QQDB 1P4LA 1MRCH 3X12A 3P9LA 4RMUA 3FQRB 3PG2A 1B4LA 3U9WA 4F7CA 2E8ZA 3H42L 5I1AA 2ZKWA 2BY3A 2QSVA 3HN8A 3O3DB 4NENB 5TF0A 3B3IA 5L2KB 1E3ZA 3MFGB 4Y8AA 1GGBL 1ZWIB 4WWKC 3ZDYB 1O6TA 2HG5B 3OPUA 3OPZH 3BP7B 4ZUSB 1KC5L 2TAAA 3T4YB 3KBPA 1UENA 2J5WA 5CNHA 3VFGL 3UPCA 2VOTA 5I0XA 5I1LB 2BOCA 4QRAA 4UNTA 3C5ZA 4ENED 1YQVH 4Z7NB 1R19A 1AMYA 3CZSA 2D4DA 3O3DA 1HQRB 4NENA 5IY5B 2JVUA 5L2KA 2Y2TA 3C60D 4UBDC 1VPOL 1ZWIA 4GW4A 2XWZA 2HG5A 2PWDA 1PTZA 4MX7B 4ZUSA 1AC0A 4G5AA 5DEGB 3T4YA 1AANA 3ABMB 4JAMB 5I1LA 5FOJA 2IIJA 3MRDA 3PL6C 3TV3L 3OZ9H 4UT7H 5BNXD 4PYHA 4E36A 1KFAH 2OSXA 3NZ8A 2NY4D 3QCTH 4MX7A 5HGAB 5DEGA 1ZANL 2YOAA 1UOVA 2YD0A 2J6EL 1JHTB 4JAMA 4XXWA 3NIGF 3QS2A 5LGHL 1P4BH 1N5YH 4QNPF 2XLLA 5D7SL 2C9QA 1T1YA 3KR3H 2Y06H 5DJZB 5EBWB 3ZO0A 1CMOA 2RTTA 4HSQA 4GH7B 3L54A 2KBGA 2XV3A 4I2XE 3SE6A 3K6SB 1JS4A 1JHTA 3FU9A 4FNSA 4JR9L 4YVUA 1NCUA 2BHYA 2ZAGA 3AW5A 2G3NA 3X1EA 4V2BA 2NPLX 5DJZA 1K72A 5EBWA 1WAAA 2BJMH 4OJEH 4XNMB 3QR2A 1KXVA 1T1XB 4HIXH 3K81A 3ECQA 3SDXB 5JIQA 1MI5E 1W6WA 3OAUH 4XMKL 2RQ8A 3R0NA 3K6SA 1RIVL 3RDJA 1MCFA 5ISZB 1CICC 1KXQA 3IU4L 4P23C 5KZCD 4IQHA 3PJSA 2A9MH 5DRXB 3RX8A 3ZL2A 3QGVA 5KVFL 1QUNA 4ANUA 2A5UA 4JO2H 5CLZA 4AGOA 1J1PH 4Z18A 1FNEA 3O6FA 3FK3A 2XQYG 3K8MA 2BVOB 1F4XL 2Y1AA 1PSKH 4QOKA 2RGSA 4C59B 3RDTD 4X5WB 2WXJA 1JXFA 3AM8A 4KJPC 4O2FA 4J7RA 5FGCE 5FKAB 3B7UX 3T0AA 4KTDH 4KKQA 4XNYH 5L0QB 3E6HB 5BS0B 1IARB 1F02I 1T7ZA 5FYJH 3BHBB 3SDAD 1M42A 1OGSA 3ULSB 3EYQD 3VCLA 1CL7H 1XIWC 1U91B 5D7LA 2Y7QB 1G9HA 4JRXD 2P4AB 4X5WA 3X3GH 2GJ6D 4DP5X 3DXAB 5J6GB 2CGZA 2MOVA 4JCWA 4PJ6A 4NJAL 4MQ7B 1ZGLP 3O6KH 4NQVB 3ZRCC 5I1DA 1AGCB 4NZFA 4X5XB 5BS0A 5I8OL 5BMFL 1EHLH 3TCTA 3WIHL 1BGXL 2GFBB 1RP8A 3ABZA 1I9RH 3BHBA 3MV01 1SGKA 4OJFH 3T3ME 3MV11 1U91A 4ZPTB 2Y7QA 3VFMB 1RZFL 1OV8A 5TDNB 3DXAA 3KLDA 3RPKA 2WV3A 3TZVC 1DQTA 3NN8A 4NQVA 3U9PL 4X5XA 3D4CA 2OZNA 2ZWZA 3UTZB 3ZE1F 4PJ5E 3ZYZA 5H35A 5E1IA 3MRNA 3QWQB 5IUCA 2EIZB 2X4OB 3WU1A 2YPKB 1JRHH 2QV4A 1LK2B 3EGSA 5B1BB 2GTZA 2PP9A 4KHTH 1NGQL 4FG2A 4L4JA 4RZKA 3T1FB 1HH6A 2DQEH 4N2OA 4XPTH 4KXAA 5FYKL 4ZNEE 3B9EA 1CXIA 1P5VA 3GBNH 3QC5X 4LU5L 1OM3L 3DK0A 4MA7H 3NP3A 2DS4A 1TR7A 3F12B 5B21A 3ZIYA 4A2LA 2X4OA 3CDGB 2XBZA 4ZZKA 1LK2A 5D2LB 2VUYA 3FB6B 5IQLA 3CFEB 5FDWA 2XZQL 3R7RA 4R7VA 4ELME 4AYID 2QVIA 3ALWA 2CSPA 1NGZB 3GBML 1IC4L 2Z92A 1J0IA 5DVMA 5HHNB 1MW2A 2QGDA 4UNIA 3KPRE 2AMUA 2JJTA 2WD0A 3FONB 3S2CA 4AZUA 2YD9A 1IRAY 4B96A 2FX8H 4DESA 2X1OA 1T2QL 1DVZA 2VL5B 3CFEA 3G6JF 1AIFA 3POCA 4JHWL 4JPQA 3RYMA 1XGYH 5F8RC 3TTSA 2APXA 3H56A 1NAKL 4M7ZC 2O1AA 1CFMA 1F90L 3MDJA 4L1SA 4LLQB 1BIIB 5T3ZL 1L9TA 5L8JB 2BM3A 5DK2B 4JPVH 2DLFH 4YHZH 1KJVB 5C3LD 3F84A 2V8LA 5AVUB 4LL9A 1JF6A 1G6RH 3RIAK 4TSBH 1KCSH 4TQEL 4DCQA 3D3VB 5J1SC 4QTHA 1R0AL 4PEEA 5DEZA 3RTLA 2YSSB 2MHAB 3P77B 4U7SA 1WE5A 5EBMB 2AVFA 4W81A 1YPZF 1NCBH 3WD5H 1HL8A 4CSTA 5ANMB 3UGUA 4FN0A 4QT5A 3BPNC 3FCTB 2HVKA 4YDVB 4ETQB 3ZN6A 1MJ8H 4LLDB 1DBAH 4XCEA 2AJXL 1PGRB 3NBNA 1SVZA 5HYIA 5CGTA 4PV1C 3RILA 3S5LB 4UQ3B 1LEGA 1Q38A 2CBQA 5E2WH 2QQNH 2MHAA 1UM4H 3OAWA 1U2CA 4K7PX 4YDKL 3ZRSA 3D48R 1TVHB 3TT3H 3OHXC 4D9LH 1U3ZA 4GT7A 3DOHA 5E8EB 3C6SA 2ARJQ 2DKSA 3QUYB 3DX9A 4EOWH 4YDVA 4PMEA 2B16A 3ARGA 3H2PA 3VXUD 2N0KA 5DMIL 5FM4A 4RGOH 1IQWL 4JQVC 4UQ3A 3O9WC 2BNQE 3SQBA 2WGNB 2Z3FA 5K9KB 5I9QB 1TVHA 4QXGH 3DBXA 5E8EA 3ETBF 3QUYA 3O45A 1RZKH 2NR6D 4JDZB 2CHDA 3WTTA 4NCDA 4PJ8D 4A2FA 1AFVL 1MCNA 3LH2L 5ICYB 1MLBB 2FSEB 3AVEA 4K94L 4N1CA 1GOFA 1V3MA 1BQLL 4MNQA 5T3XL 2BNUA 1I1RA 5AWNL 5A40E 3FAXA 4N26A 2GJRA 5HYJB 5C3IA 3MJ7A 2PXYD 2KUTA 2C7UA 1G7JB 2QTVA 3NCFB 4RVBA 3ESUF 5F7HA 3VTMA 1MLBA 2JI1A 4GXFA 4K23H 4W4OA 3EGDB 3GFUA 1FC2D 4FQ1L 4MJIE 1NMAH 1B4JH 3BKML 4HWUA 2XQBL 2EEDA 4P46B 5E5MB 3TU6A 4O4YH 3NJKA 3DUUB 2GSGB 4LRNL 4E9XA 2OMZA 4XVOA 3NABH 1G9EA 5GGVH 3RL2B 1F5WA 1IAIH 1QSFB 1YVLA 3RWJB 2WLYA 1X7QA 3FT0A 2A77L 5J89A 4GP5B 2EAEA 2BIMA 2ZSVB 2VXQL 3P4OB 5F2FA 3WSQL 5E5MA 4UQCA 4P46A 4NDMB 4MZ3A 3VDCA 4HUWB 5DI8A 3I02B 3LRMA 4AENB 4HQQH 4TQIA 5J1TC 3RL2A 1U8QA 2AV7B 5K39A 3P54A 3OR7B 2I27N 1MFBH 2OZ4H 3P4OA 4RMTA 2AXJA 5INCB 3HKZA 4DN4L 1MAKA 5I1HL 1BPVA 4NDMA 1XGZA 5H2BA 1RUKH 3IRCA 1PQZB 2XY2A 3I02A 2NY3D 4AENA 5G55A 1KYOK 5T5FA 3U1PA 2YEQA 1R3JB 4LLUA 2C4FT 2LV4A 1KTRL 2AV7A 3SPIA 2ZG2A 3UMNA 3A6BH 3V7MA 3U82B 4GY4A 4I3SL 3BUIA 4XWGL 3CTTA 4G6AC 5ILTL 1U8OB 2FK9A 4OTXL 5DS1A 4KPHH 2P43B 1MAML 2PTTB 3T65B 1E9PB 1AGEA 2ITFA 3MKGA 5GGSB 5ECGA 1A1NB 1XAUA 3FTZA 1FYTD 5DR5H 1AACA 4B9IA 2B1HH 4ZTEA 5BV7L 5CXPA 4H88H 1RJZB 4QRQB 4WI8A 3RAJL 2DF3A 2FX9L 2YPLB 4PIBA 4YHMH 4F8LA 4MD4B 1IC7L 4P3CL 5DJXB 3T65A 1OK0A 1A64A 2YQBA 1E9PA 5GGSA 2UXFA 1DJZA 1KBKA 4DVBB 2PYFA 3QUXB 3W57A 5DDHB 5HI3D 3EDEA 2D3JA 2YPLA 4MTMA 2OMYB 1E9QA 1EJFA 2WTPA 4MD4A 4NX0A 3K2KA 2V6HA 5DJXA 3K91A 1S9XB 4XBPB 1CS6A 5FKPA 1S9YB 4P4KD 3HC4L 5ICZA 4Z7QB 3C5ZC 3DI3B 4FXGA 3QUXA 4BQ8A 1XSIA 1MFCL 2VJXA 1GCYA 3VFSB 3WENA 3TM6A 3SBWA 1EFXB 2DEWX 2OMTA 2OMYA 4PB9H 1TU2A 1HHJB 2V37A 2B1AL 3L13A 4BWUA 5A6MA 4JGJA 2IG2H 1H5BB 1RU9L 5KJRL 1EQWA 3LKSB 3T71A 4ZW6A 1USZA 4FYSA 3TNNA 3D85D 3TXAA 1LVEA 3TF4A 2GJPA 1NIBA 3IJSA 2VXUL 3VFSA 2YZ1A 4G72B 4K71C 1EFXA 1ZT4B 1U3NA 4GKLA 3FTGB 1SUHA 1HHJA 4FKKA 5EU6B 1JF1B 2HAZA 5GZNC 5F6HJ 1KGWA 3UZVA 4XMVA 1B0WA 3MNWB 2IANB 4J3BA 1V7NL 5FA3B 1NFDE 4XPBH 2HKFH 1A4AA 4PJIE 1JPSH 2XV2A 5FLVA 3WTYA 4NUMA 4P4RB 3ZGIA 3G5WA 1CLZL 1ZT4A 3HRZB 3QEGL 4WDIB 3FTGA 1MXGA 5EU6A 1JF1A 2YUVA 4FLHA 2W5PA 4FI7A 5JR1H 1UYWL 2P5WD 3FUDA 1E3XA 5MEOB 3QDMA 3RVVC 2IANA 1DL7H 2PCFA 3NRFA 3QO0B 4JO4L 4OCWL 5F7EL 2QL1A 5FA3A 4GO9A 5TH2B 4D3CL 2OPCA 3WO4B 1HVXA 4KFMA 3THML 2YD4A 4AL8H 5ABDE 2J55A 3TEUA 4CDGC 2WO2B 3PIQB 3H55A 5MEOA 4AW7A 2ZF8A 3BESR 1G9ML 1N18A 1THCA 2AGJL 2D7NA 1IKFL 2EXYD 3FTVA 3QO0A 1S78D 3QJRB 3RX7A 5FAAA 4GI6A 4UIMB 1WIPA 4IGBA 5KOMC 5BZXA 3O6FC 1BWMA 2VH5L 4XP5L 4HISA 5GGQH 3PIQA 3O3BB 3HC3L 2V9RA 4NKOB 1JERA 2X89D 4QHUA 3SBRA 3AM8C 3KXFE 3NAAL 4UIMA 5I15H 4X80H 1WHPA 4GP4B 4AUUA 4U3SB 5DHDA 4ZFOB 2IH3B 3PWVB 2AABL 4U4BA 3WNKA 3IF1B 5DJ0A 3NEEA 3K80A 1NH6A 2B39A 2HH0H 2QKIB 4R9HA 3QZPA 4HK0B 1KTBA 1MCQA 1VA9A 2ZUUA 3OF6A 3W11D 3HG1E 4QWWC 1IVTA 4H0LC 4ZX4A 4XCCH 4U3SA 4ZFOA 1U36A 2IH3A 3ARVA 3KHQA 5CSGA 3HBZA 5HDBB 5DJ8B 1PPIA 3M8OH 2QKIA 3MUGB 4UQEA 3CU7A 3V4VL 3VFOB 2DQDH 1NJ9B 3V7AE 4BSVB 2BFVL 4L8CA 3LEVL 4MNHB 4GP8B 1CU4H 2IFFL 2XIBA 5IHHA 1RVFL 4RFOH 1YNLL 3RLSA 3TH4T 4MWFB 3QNFA 3F01A 4S1DD 3I3BA 1ROCA 4X6EB 4OZFB 5D71L 4A7UA 2BP8B 3CVHB 2WANA 4OFVA 3MUGA 3IJ8A 4BFRA 5KS9B 1MY7A 4U1GB 1NJ9A 3KPSB 5MI0B 4BK8A 4C4BA 3L3JA 4BSVA 4ZYKA 4P05A 1NCCH 4FYQA 2BP5M 3P9WB 1UA3A 1A7QL 5E2JA 3EYSL 5EU5B 4X6EA 4OZFA 1AGBB 2WZ0A 2K6YA 5CN2A 3V10A 4YWGL 3DGDA 3KJ6L 4M7LH 5AKSA 3KPSA 1ZLUH 3DHPA 4LLYB 4PLOB 3GHPA 1WV7T 3EYUH 5ESQB 2VW6A 5KTEL 5E8DL 1DANU 4F8NA 2IC2A 4LL4A 4XVJL 2JJTC 2YEVB 3QUMH 1KIRB 4PLJD 3X17A 4ERSL 5C0NC 3DURB 4AGQA 2VDQL 3O3UN 3K74B 1ZT7A 1JPFB 5I8OH 4LLYA 2EYRB 1MLCB 5KYUB 2P8MB 3QJTB 5I82A 3RWGB 3PHSA 3VFNB 2LT9A 3UP6A 2ZIDA 3HN5A 2Z8SA 4XZUA 5B7MA 2BY2A 1HZLA 4WJ5B 2BSRA 3PQYE 4G9FE 3KWUA 4Q4EA 2W92A 3H8NA 4WNSA 4YHKH 3O2VH 3N40P 4NKMB 3HZVB 4TQPA 1NCDL 1IM3A 2P8MA 2HRLA 3CE1A 2K7QA 3VFNA 2X40A 4OQTH 7CGTA 3V4PH 4NWUH 1JCVA 5AKTA 5AUMB 3FB7B 2K4AA 3DYPA 5IB4B 4LPYA 2HT4D 3GINA 3QUGA 3I9GL 2JK5B 4HC1L 4NKMA 3HZVA 5IBTH 3DMMB 2R0KL 4FNPA 5KW9H 1T80A 1IEAB 1UT2A 4JPWH 4LSQL 4OLXH 3D2UD 1RIUH 4BFIB 2XUWA 3MROA 1DFBL 3W0WE 3OHMB 2A6JB 5TE4H 3QZBA 5LBGA 5FM8A 3QFJB 5K9JH 3QH3B 4HEME 4A2DA 4QD2E 4M8UA 5A2CA 2L7QA 5IB4A 5DMYA 3HZKA 1MHCA 1QVOB 2OJ1A 1O0VA 2JQAA 1SY6L 1CVRA 3ARGC 3MBXL 5AVTB 4NP4H 1J5OL 2WGXA 3HI6L 5I0WA 4BFIA 2YAHA 5ALBL 1N26A 3SJVE 1E2VA 2A6JA 2V7NA 1UWEL 4P5TD 1IGTA 3QH3A 1K4CB 3MI6A 4OBSA 3QRLA 1LXMA 3KVDD 1QVOA 2CXGA 2HX9A 2PW1A 5KVDE 3F7YA 3B2VL 2ZNXA 4FL4C 1MNUL 2PTVA 2FECI 1ZA3B 4JRYE 1ZT1B 1QFUL 5DMKB 1A6UH 2NY7H 4KBPA 3APDA 3TWCL 1WS7A 5ECJE 1CD1B 5HHMB 2V2TB 1M7UA 2X2YA 3HAEA 4NHUB 1YA5A 3ALPA 5I9QC 4PV8A 3FNKA 2CDGB 2EIJB 4N0UB 3FFCE 4GAAA 4JFED 3D25B 1OP3H 3DVFA 1JYXA 3A4DA 3WLWD 2X1WL 3TBVA 1QG3A 1ACXA 1RMFL 4H1LH 4OFKA 5DMKA 1AXSA 2EE0A 2ZUQC 3ARXA 3GUTA 2V2TA 2NUPA 1ADQH 2XWBB 3K4ZA 4W4OC 3E3QE 5E00B 4RGNB 3N85L 2CDGA 3D39D 4ZJ9A 5DGRA 3D25A 4IBYA 5C7XL 5AZEH 5IT2L 5HHVH 1OQOA 5C9JB 1W16A 4FA8A 4YPGA 4ZFGH 4S0HA 3BUYB 1DZ0A 2AANA 4Y5YC 4YH6A 1QWNA 3QQ4A 3ZYIA 1TZIB 4GMTL 2LAGB 5FV2A 3P69A 4BDVB 4F27A 1RAMA 2GTWA 4V11A 5E00A 3WFDH 2H47C 1QLRB 2CCVA 4BHUA 4LRIA 1JN6A 2WBXA 5IB3A 5J56B 2AVGA 4PJCA 1H19A 3LIZL 5GRZA 1HL9A 1IGIH 5I6OA 4P46C 1C08B 2AK1H 4MJ6B 2BRQA 1OEZW 4ZBJA 4A6YH 1FSKB 1OCWH 2BCKB 4HUMB 5C9JA 3MRRA 4DP1X 3MCLH 3LH8A 4PCSA 5DC4B 2WCPA 2G5BB 4YHIA 1N9PA 5FGSA 1XH3B 4HJ0D 3ZKND 2AC0A 2XTLA 15C8L 1G7MB 1QLRA 4YN3A 1GAFH 1IC0A 2EZ0D 1OGPA 4ODSL 1I1AB 1JNNL 4MJ6A 4D9QE 3VGFA 1CLCA 1NGPL 3U0WH 3JUYA 1J8SA 4BZ1L 1PDKA 3BQUB 3S98A 2ICEA 1N70A 1SHWA 1AZNA 2I7SA 1KTLA 2ORBL 1QBLH 3MLVH 4Y9CA 4JFDB 1QTYT 3MOBH 1KCKA 1K3IA 2GBAA 4QRUB 2XA8H 1DVUA 3NIDB 4NN7B 3GTVA 1RPKA 3BKCL 3HOGA 1I1AA 4TRPH 1NMBL 2UVFA 3NDYE 4WAFA 3EZ8A 1FH5L 4OI9A 3BQUA 3ZUNC 4EI6B 2H3NA 1N6UA 4UT9H 4XH2A 3RNQA 3KJ4C 4NP9A 3B2DC 3WKNA 4WUUE 4B9KC 1NUNB 3Q6FB 4QRUA 5EUOA 3PP3H 4X8JB 4I7ZC 4UT6A 5E6YA 3BQVA 4A7QA 2TSAA 4OD2A 5BO0D 1T04A 1WPCA 5E1QA 1UWGL 4EZLA 1PZ5B 3D0LB 1CXLA 4LCWD 3VH8A 3NJNA 3H2WA 1KZYA 4I48A 1PLGH 4ODHH 1BF8A 5ALCH 4YSEA 1CDIA 4G7RB 4X8JA 4OGZA 2EKSB 3KBFA 3JWNH 1J1XL 4MCYB 4URTB 2F68X 3VB8A 1PZ5A 3QIBA 1YEHL 3CZGA 3BP6B 4K7PL 1E8ZA 1CLVA 4HGWB 4PRPB 4O02B 4JQIH 4PH8A 3OKDB 4PR5B 1XSKA 3O2DA 4HAGA 4LEBA 3KGTA 4OD3L 4JM2F 3GIZH 4HW6A 4P99A 5IJKA 4GRWF 1GGIH 2DBJA 4XRCB 4FXGC 4EZMA 4ABQA 3QUXC 1GMIA 4JEGB 4L1DA 2DKUA 2C9VA 4QXTB 3BP6A 4R4ND 3SBWC 4B9GA 1NGWB 3H53A 4PRPA 4O02A 2WVTA 5DLML 1JWMA 5EOQL 3BZFB 1JZ3A 5E24E 2G2PA 4HCIA 3HHRB 4XAKE 1N10A 4HWNA 4E0RA 3UPAA 4AQAB 3C5SA 4IIQB 1CE1H 4OAWB 3F7VB 2DDQL 1WTGT 2OR9H 3DETC 3LIUA 4QXTA 1NGWA 3MLZL 1NCGA 1OZUA 1AQHA 4LSSL 3BZFA 1VEPA 2LQRA 4Z0BL 2O6PA 4I18B 1WO2A 4IIQA 1KBGH 3SDDA 1FPTL 4MXVE 3K0WA 5IROD 4Y5XA 2VC2L 3EYOB 2F19H 4HWBL 1Q9WA 4KROD 3QG7H 5IVOA 3MMEA 5HI3C 4AIZB 3RPIB 4I18A 1ZEAL 2CR3A 2JLLA 2LTQB 2Q8AH 4NGHL 3EYFB 4N86A 4XNAA 1KJ3H 3S48A 3EYOA 4YHOH 1MHEA 2DQHH 2ATPB 1A3LL 2QVFB 4LSTH 2R29L 1IV8A 3V6ZA 2FJHB 4UAOC 1OSPL 4AIZA 4YJZL 2RBLA 3TYFB 3PPSA 3RPIA 4I9XA 4JG9A 4I0PD 1W80A 1UJ3A 4GRLD 4NXSA 4PJ9B 2G75B 2N56A 3U36B 3WO3B 1MIMH 3DSFH 4LEXL 3RVUD 3EYFA 4MCZB 5GS2H 2EEXA 1P7QB 4IGBC 4BJLA 3U2SB 4RFNB 1GC1H 2F8XC 2C3WA 3KCPB 3NPSC 5DURD 5IR1B 5K5YA 2FJHA 2B4CC 4G59C 3A23A 5E4EB 3GKWL 3TYFA 5J9PB 5IOPA 5TQ2L 2PETA 2L04A 1TDQA 3LZQA 1PLBA 5JHLH 1KWKA 3KPNB 5BZDB 3WL9B 2AXHA 3U2SA 2WJ5A 4NCC1 4F7EB 1AR1D 1R6VA 4U3HA 4WSGA 4W93A 5DT1H 5IF0B 4EQ2A 5IR1A 3Q8CA 2YJLA 3DARA 3FO2A 1EDQA 5E95B 4AM0Q 1NKRA 5EIQA 1L6ZA 5KSAB 4BSJA 5J9PA 4NN6C 2R69A 4MZRA 3FUKA 5DJYA 3JT0A 1UD4A 2XZCH 2UY6A 4GFXA 3KPNA 1A14L 3MGTB 4AEFA 4DEWA 3U1QA 1I3GH 1UYWH 3GI9H 1V54B 1XB3A 3QO1B 4XNXL 4DKFH 4EVNB 1A7BA 1MQKL 4JE0A 5KSAA 1UFGA 3U30C 2AK4D 5LN8A 2HMIC 2K9FB 3DECA 3MYJB 3GXIA 1LILA 3T0VA 3EF7A 2AQQA 1X5KA 2Z64C 1LM8V 1NCAH 1AZVA 3PHQB 1KCLA 2XG4B 3BGMA 3CX5J 1GYAA 2ISDA 4ZUVB 3ES6B 2CCLA 3PREA 3QO1A 5E4OA 3BW9B 5IIEB 1L4IA 3AS1A 4F80A 1B3JA 2GEEA 3BSZA 2WUBH 4G1EB 3MYJA 4EAEA 5KSVA 1TQVA 4QRRD 5FYLL 4R2GD 3AQYA 4XP5H 2O5XL 3UJTH 2XG4A 3KPQB 2PABA 1NBCA 2DI9A 4BQ6A 3ES6A 1E6OH 5C70A 3BW9A 3NZSA 1CYXA 1TVBA 4L3ED 1QP1A 1QPXA 5IQ9B 1DDHB 3BZ5A 2JXMA 4TVPH 1TTRA 1LEIB 4TS6A 2V3DA 5DMGC 2XYCA 3DROA 1CB4A 3BGFB 5D7IE 5C6PB 2I5YH 2XFGB 3NFNA 3KLSA 4WW2F 4D0CB 2R0WH 5I1CH 1IE5A 4QRSB 1RLBA 3DJZA 5IQ9A 4N5UA 1DDHA 1W72B 3BH4A 1F4AA 2AXWA 4JLRA 4B3EA 3FH5A 2VR6A 4X7CC 3W2DL 4JG1H 3REWB 4N2AA 3B6SB 1E4WL 4Q89A 2EE3A 3PHAA 1S7SB 1Q9OA 1OPGH 1MHHB 1WZ1L 2VMFA 2NMSA 2ZKXA 2XTJB 4A38A 3PWJA 1ZS2A 3PWPD 3EDJA 1A7PL 3CG8A 5JQ6H 3L9RA 4S1DC 4GIAA 4U6HB 1PEWA 4K55A 3EBHA 1KELH 3FF7A 4R6UA 1ITCA 3REWA 2FWUA 2VDNB 4U6TA 3B6SA 4NQEB 3U83A 4N8CH 2VDKL 5IK3B 1P84J 5E6ZA 2CO7B 4G6JH 1DQJA 3GRGA 3C09B 1TO4A 2DBLH 2YS4A 4MNGB 1K5NA 3F7PC 3IBEA 4IRJB 1BOGB 1TZGH 1EBPA 1CC3A 3AWEA 3OAZK 2VZUA 3JTTA 2K7PA 3V4UL 5CU5A 5K1NA 1HSBB 5C0CA 4NQEA 3NH7L 5DUBB 3T77A 3FU7A 3C8DA 1AE6L 2X9WA 4PCTA 5IK3A 3VXMD 1UM6H 3EH3B 3B83A 5GS0L 5IFHH 5MEND 2J4WH 2CO7A 1VKXA 3WIIH 3VFVA 2FYYB 4HIJB 5A3ID 4TLKA 4QIRA 3U7WL 1WWBX 3RRQA 5BJTB 5D1QB 3ZHDA 3QEQD 1BOGA 3KPOA 2ERJB 1MNNA 2VCOA 1EMTL 1M9WA 2KZWA 3WLBA 2RCSH 3MV9B 2GCYB 3LEXB 3BT2L 1HSBA 4UM9A 3JVGA 1B9ZA 2OL3H 3AACA 1OE1A 2APSA 4UNUA 5CEZD 3FJTA 5C09D 4HUXA 5L2KE 3DSNB 1BD2A 1BQHB 2FYYA 3KBHE 4HIJA 3O6LH 5BJTA 4XOCA 4XVUC 3QI9A 4DPCX 1CFTA 3ZDYE 1M2VB 5CBEB 1ADWA 3VD7A 2R7EB 4P49A 4L2YA 5GSVA 1AC6A 1I31A 2XNAB 4A67A 4Z7NE 4YX2L 3ATFA 3DSNA 2IH1A 4PSRA 2NXZB 3NJGA 4FQPA 4H1LG 3STLB 1VHPA 5I8EB 1JZ4A 3L81A 1M2VA 5CBEA 4IRZA 2QZQA 5D5MA 5I6NA 1MJ7H 1OCZB 4X7DC 1C1EL 1C12B 2XNAA 4CJ0A 3WY1A 4EI5B 1ZV2A 4RWYH 3C6EA 1PJWA 2V17H 4QXVA 3CD4A 1PCSA 2VSDA 4XN8A 4JJ5B 4K9EL 4W6YB 2OJZL 4FG6D 3LQZB 5AL8A 3STLA 4I88A 1KJMA 5D1XB 1J5HA 1DUZB 2OQJB 5KUMA 2VL4A 3MLUL 1F4WL 1UM5L 4H4NA 3U9UB 5DJAB 3WEOA 2HKHH 5FLUA 4NQDB 1C12A 4U1SA 5GRUL 4FLOA 4EI5A 3OKYA 4XNUL 4Z3IA 1OSEA 2YLKA 1WAAE 2OW6A 4PVLA 3E8UH 4JJ5A 1D5ZA 4LRIC 3LQZA 1ZLUK 5D1XA 2IXQB 2OQJA 1DUZA 2GJZB 4HX1A 4W70A 5IEKB 2WPGA 5DJAA 1UADC 5L6YH 2XN1A 2NZIA 4XCYA 4NQDA 2AJ3B 3N40F 3UTPD 1EBAA 5AZ2H 2MIZA 2G60H 1UC6A 4RX4D 2AJVL 2KDGA 1QLEB 3DJTA 5AAMC 4OGAD 3SDXE 4JY4B 5E6IA 2GJZA 4BXVA 5IEKA 3R1GL 2EVHA 4DH2A 1BECA 2F5BL 2YGPA 3SDCB 1IC5L 3IDXH 3MUHL 3FSWA 4TULH 2ICEC 5HVHC 5ISZE 2IWFA 1DCLA 3LZOA 1ACZA 1BAGA 3MODH 4MLSA 4Z7OF 2XPYA 1W6LA 1JG9A 4Z95L 4OV5A 1OTTD 2K1MA 2MOGA 3L17A 3QZNA 5IBUB 3M7FB 4JY4A 4KI5D 3LRKA 4AUJA 5CO1A 5F21B 3AS2A 1V7MH 1IGCL 5AVRB 2VABA 5BO1H 1N7ML 3I84A 5IB2B 3I50H 5BS0E 3CFCL 4NO0B 2DQTL 4XP4L 2ZX6A 4DFHA 2ZUWA 3HFML 3TO4B 1N3NB 1MDAA 5CD3B 3IGFA 4Z7UB 5AVWB 3SYOA 1OGAD 2OTUB 5IP4A 1I7TA 4F91B 3DXAE 3OX8A 5IMLA 2WYZA 1CDCA 4MAYB 5SWSB 4C4KO 3JWNG 1JTTA 2FO8A 3NZHL 1J1OL 4NO0A 1CUOA 3LB6D 1K5WA 3FSOA 4B53A 1YMMB 2CDFA 4BINA 3UACA 3W5NA 2K8MA 2ZXEB 4AV0A 3LKQB 3QIBC 2ZUSA 1AAJA 5EO1B 3V5HB 2OCFD 2VRAA 1PX8A 4KXCA 1HI6B 5DFWH 1A21A 4O2CB 2Z91A 4NNPH 4HLEA 2JSFA 3T8XB 3EDKA 4NQTA 4DKDC 5IJKC 2Y1YA 3HEIB 5CS7A 4FQJH 3DVGB 3POHA 5AW8B 4X7EC 3W1ZA 3JUZA 5D72L 4GSRA 5CKGA 2VZSA 3HG5A 4F8QA 4Z7WB 2N1TE 1HI6A 3RX9A 3LHAA 1SOQA 2WO3B 4F15B 3SCMB 4KMTH 2IPUK 3T8XA 4FFWD 1BFVH 1N59B 1OAQL 1OP3K 2DM3A 1V3LA 2XHNA 4JFOB 3VWJB 4LSPH 1OXYA 1URLA 1JZ5A 4DP0X 4P5SA 3KEDA 4LFHG 1CR9H 5D2LE 4DGIL 5B4MC 1C16B 5EZPA 1OAJA 4CSPA 5EEZA 3FRUA 2EXTA 2VXTH 3O11A 4W6WB 2R8SL 1FIGH 4L18A 2L0DA 1S7WB 2J1ZA 1LO4H 1PD0A 3BAJA 1NEZB 3FN0L 4IIQC 3M6DA 5TPWH 3SDDC 3VWJA 4ZMTA 3FDWA 4HD5A 2FB4L 5C08A 4Y5XC 2FH8A 1O5PA 5T1KA 3VGDA 2DTML 5IGXL 3A3YB 3DX8A 3RVTD 3WGUB 4XNZC 5DD5H 1DEEB 4HMEA 2DMCA 3EHBC 4BH7A 4ETYA 2VR7A 4EBQH 4ZODA 1NEZA 2FLRT 4TPRL 1UUNA 4KHXH 1PIFA 5EWIL 1YJDC 4URKA 2RHEA 5D93B 1OP9A 4PVBA 2AJUL 1BZ9A 4G6FD 1JUFB 4GAGH 4WWPA 5CZVL 1T2XA 3D3VE 5AB0A 4X8XA 2X28A 4OZ4B 1DEEA 1V05A 3E2HB 2GW5A 1OCOB 1UJ3C 2Z93A 3NJHA 3US1A 3QQXA 1INDH 5T1LD 1BEXA 2ZXGA 1KG0B 2VQUA 1NL0L 5ANME 4PRID 4X6DF 4O58L 1UACL 1YEEH 1KLFA 4YO0B 1WTLA 2EH8L 1U8HB 5CLXA 3VXSD 1OGTB 2UZXB 2F53A 4ADJA 1KENL 1R3IL 5FYLD 5B1CA 5E2VH 1PZBA 1HHGA 2Y6SD 2R4RH 4BSWA 4EIGB 2UUDH 2AERT 4LSSH 4DGWC 5LKNA 1GYUA 2F7IA 4OH2A 5DHVH 4KV5E 4NQXA 1BLNB 3G5YB 4Z0BH 2PYEB 4XN7A 3B1UA 1OGTA 1N8ZB 3QEHA 1MF2L 2FX7L 4P2QD 5I1IH 4XXCA 4BZ2H 3W82A 4JO8A 2NY2C 5GS1B 2OSLB 3WGVB 4YS4A 1I7UB 1ZVHA 4QRBA 1BLNA 4YSSA 3NACL 1KB5L 1TQCC 3EOBB 3P0YH 6FABH 25C8L 4DW2H 4R26L 4APQD 4PM1A 4ZAKB 8CGTA 1MCPL 3I6GA 1NMCC 4OGXL 5HSFA 3BEWB 1AKJB 5HYJE 1E7VA 1OSPH 2WXRA 1OAXH 1RZPA 2Q7AA 3GI8L 2B2XL 1MEXH 3SBPA 4YE4H 2H45A 2KQNA 4KZEL 5MHSD 1Z3GH 3RTQA 5IQOA 3C60B 1TUPA 4IMLB 3PPEA 1S2EA 3EJZC 4ZAKA 2OMXA 5JORB 1HNFA 1Y1DA 2X4SB 5TDOA 3B8YA 4IKKA 3FQTB 1AKJA 1WWCA 4CN1A 4EO5A 2GAZB 1AIZA 2Z8WC 5DUML 3T0BA 3IWVA 1YEWA 3GRWL 4JG5A 1G7LA 2HJFB 4U05A 4X9HA 1ZA6A 1U30A 3K6NA 3MYZA 4ZOAA 3RGVD 3T09A 4AYGA 3C2AH 1QSFE 4U1NB 1C9SA 2X7LA 1CT8A 3C60A 4YAQB 4Q4IA 2NY4B 5JORA 1GCFA 1NSNH 1F13A 2DQCL 5GS0D 3CZUB 3FQTA 1X3DA 1J87A 2F8VA 1FAIH 3P1VA 1EEZB 3IKCA 3PE9A 3E7JA 3F58L 4NUGH 2W59A 2WINA 2HJFA 3GHEH 1X5HA 2JV6A 3R8BB 1U21A 3CHQA 4FERA 5GJSH 3QXAB 2E6QA 3OWRA 1LMIA 3MNDA 3G5ZB 4Z3JA 2HWZL 5C0EA 4OM1L 3SPGA 5I74C 4YLBA 3BGFC 2UWEB 4OZGB 3ATEA 2WQVA 2YRBA 3RWHB 3GMMB 3UADA 1SFHA 3L7EA 3RZCD 4QO1B 2WMPA 4HA1A 1U92B 3MRKB 4OKVB 1MUJA 1QHOA 4ZK8A 3QXAA 4LDEB 3ETBJ 2RJMA 2J5LB 5E7FA 5EEUA 4LGRB 1CLOH 2IQAB 2UWEA 4M1CD 3IU3B 5KOVC 3RWHA 5E9DD 1F4YL 1SYSA 3T2QA 4QO1A 3SB3A 3BOVA 4U0RC 5DJCB 1CI5A 1NTDA 2QQLL 1L9OA 1JF5A 1WVZA 2FBOJ 2IFGA 3MRKA 2CH8A 4CBZA 3TGXA 1ZLSL 4HXBH 4CADA 5A2AA 1YEIL 4IBQA 4WI0B 2FD6L 4LOEA 1G6RA 3HBGA 3WMQA 2YPLE 4QGTA 4PRDB 3DC0A 5DJCA 3PGDB 4PCKA 1N64L 3UG3A 3CFKA 3Q5TA 4HEPA 1ZSDB 3SPCA 3SDAB 2WZ6A 1I1YA 1S7XB 2D7MA 4N1EA 1G9NH 1P9MA 2PPFA 3DGGB 2UZPA 4JRXB 4AYBA 2GJ6B 1KXHA 2VM9A 1NOLA 2ATKA 1TKWB 1VCAA 3QI9C 1G5AA 2ED7A 3FFOA 3FO9A 1BFTA 2CO1A 2E46A 3PGDA 1FLRH 4P2RD 3CZLA 3EFDH 4GUPA 2BVTA 4ZMLA 4Z7QE 4X4ZA 1YY8B 1H9VA 1Z9PA 3DGGA 5D7IF 4HIHA 4ODTL 2EDNA 1EWHA 1Y6NR 2OMNA 4JZNA 3WFHB 2VLRD 4TUKH 1GR7A 2MCPH 1WD8A 2MRYA 5EC2B 3BLPX 5D70H 2DYPA 2MPAH 3O41A 4OZHA 4P5RA 3K3QA 5ACZB 4MLIA 1YYMH 2NCEA 3UX9B 3D18A 3RVXD 3Q8AA 3HPJA 4HBCL 5DVLA 4WTZG 1JDCA 1KCVH 5FFGA 5EU6E 3IDGA 4PJDA 1FNLA 2X70A 1GYWA 4PD4J 4BK4A 4KXBA 1T89A 3WFHA 4G6KH 2YAEA 1P1ZB 2IANE 4HCRH 3UPRA 5B1JA 4FX5A 3NJMA 4KDTC 2Z35A 5T1MB 3HW7A 1FN4A 1UH2A 3X3FH 4UYPA 1M9SA 5D1XC 1LP9F 4CN6A 2XV6B 5HYSB 1PZCA 2W07A 3N41F 1CDHA 1P1ZA 4P04A 4Y4KA 4TF4A 4ISVB 4KXDA 1MIEH 3OKEB 5T1MA 1KYDA 2WB1A 4M8QB 1JZHA 5JO5B 5TFSL 4G80B 2SEBA 3FS9A 5E6IC 4B9FA 5HYSA 2NY0D 3HLAB 1MCEA 2M2DA 3CFMA 5DJ6B 1H6EA 1MCCA 4ZW8A 1YYLH 4PJAB 4N9GB 3E8VA 3OKEA 4JFHD 5ENWA 5FHAL 3RZWA 5EU4B 5KVEL 2VISB 4I87A 2RAMA 5GZOD 5D6CB 3VQMA 4X4YB 3D5OF 4DAGL 5HYQB 3WY2A 5C97A 5B38G 3ZSSA 3OKKA 2IDSA 3MRQB 4LSUH 3ZDYF 1JXDA 3BD4A 3HLAA 2IAMD 4AI7A 5DEJA 1CZ8H 3ULUC 2AJSH 3PWNB 4YC2C 2OA9A 2VISA 35C8L 3CHOA 4NWTH 2G9HB 3SIKA 5GRVL 3PDOA 3L5XL 4OLWH 5D6CA 5C0IA 4A04A 2VLME 1TTUA 1ZGLM 1M6UA 3HUJB 2X9ZA 4MA8L 1JGLL 1HEZA 3O3EB 4N0YL 4NSKB 4C4UA 2BY0A 3LNHA 1KBPA 3MRQA 3CFIC 4FC3E 3FW6A 5D2NA 2GT9B 4UB0H 5FHBH 2X05A 4HT1L 3B9KC 2A99A 4N2IA 4X9FA 5DA0B 4L5FE 1T5WB 1CIUA 2ZSWB 2V9QA 1BZOA 3RFZB 4WUKL 3TONA 2XWDA 2G9HA 2ARJB 3D8MA 3QUZD 4LGPB 5K9QG 5JIDA 4P2OB 2UZIL 4L1HA 4JM4L 2NQ3A 2R4SL 3O3EA 5HDBE 2O93L 1FFNB 4NNYA 2X6VA 1M7IB 5I71C 3QQDB 4W4NA 4XOBA 1U8KA 2IOMA 2HYMA 3LVEA 4HKBB 2WBJA 3G5XA 3OG6B 4QYAA 3Q0HA 4E9YA 3B2PA 3L5IA 3JBG7 1UKSA 3MRFB 1WAAF 4P2OA 3ZX1A 4KRMB 4LASH 3V5KA 5ABZA 4PJ8B 3Q13A 4XO5A 2OMUB 4G1MA 5C07B 4FNQA 1M7IA 1NEPA 3MNVA 3PGFH 3QQDA 1VZHA 5MP6L 1OTTC 5KS9E 1E9OA 2CGYA 3KPSE 4IBTA 1JGDB 4NBZB 3DBSA 5F9WB 5BUPA 2CBMA 4J1UB 1JI2A 4KZ0A 1JHLH 1KLUA 1RUPL 3H9HB 3Q8FA 5CFHA 3E1ZA 1L9NA 4PJ8A 2PXYB 1BA9A 2GITB 2V3FA 2A1WH 1IUZA 5C07A 3MVSA 2E7BA 3VTTA 3LHPL 4NHCH 3UYRH 2DQTH 4M1GH 1Q0EA 1ETJA 1ODUA 2K4WA 2NYYC 2E4FA 2D8KA 3MQIA 2ZUXA 3IJYB 4A2EA 4TXVB 4S1RL 1AD0B 4N8VG 3AUVA 1ORQA 2DQ6A 2GITA 4N0RA 4RAVB 4L8BB 4NEHB 1WBXB 5ITFA 1I9JL 1LTXA 3HI5H 4AG4L 4NRYB 1ND0A 3NDZE 5LO7A 4KVCL 2A6DB 3TO2B 4PP1C 5AYUH 3RWEB 1AD0A 5GGSY 3TVMA 1TEGA 5D8JH 3FU0A 1M4KA 4PJHB 2NT0A 2OXHB 3II3A 1AZCA 2XXGA 3WXWL 5IFAL 1HDMB 2WUCL 2VMCA 2ICES 1NOFA 1MFUA 1M7DB 5KBPA 5DQDH 3FTXA 5E9NA 5I1JH 3FO1B 2A6DA 2ZP9A 3QWRD 3I9IA 3TO2A 1H8LA 4KK9D 5KVDH 2VDPH 4WFFE 5MEPB 5I5IA 2CWRA 1PX3A 2Z7YA 4I13B 3CPUA 3L9BA 1G7IA 4WEBL 1JI1A 2NY3B 3AXHA 4X5QA 3U1SL 2AEWA 2OXHA 5IHZA 4FD0A 1J12A 1HDMA 1RFDL 5CCHE 4JDEB 4JPIB 1A1MB 4AOFA 1MCIA 1CFBA 4BFJA 3FO1A 1GZHC 3IETA 2QPFA 5CJQL 3KMDA 2B5IC 4FKEA 3QFJE 3PHOA 2Y36L 2CQVA 4EUPH 1W8NA 2V0AA 1CXEA 4QRTA 1QRKA 2G3MA 1LGVA 2AJYL 4MXWH 1A1MA 3KWVA 4HU2A 5HD8D 1QFWI 5I8KH 1JYNA 4J6RH 3IPFA 3VGHA 4XXCC 3C5JB 4AQ1A 3QJUB 3KYOA 3QDJD 3PF2A 3UTQB 1RH8A 5C2BH 4YFLF 4I5BB 4BFBD 5F7WC 5HI5C 1W91A 4ZMOA 1NAML 2OJEB 1S9WB 5INDA 2J1YA 2Y24A 4CKQA 4ANKA 1QEXA 4FAAB 5J6HB 4KUZL 1JZEA 3NJXA 1Q0XH 2PKDA 3SQOH 1PU0A 2XPGB 4UANA 5HHME 4F5CE 3RIFK 1UCBL 3GJFH 3UTQA 3AXIA 4JO3L 4LVEA 5F3BB 4ZW5A 4I5BA 5JTWA 4N0UE 4ZXBA 5AG8A 1RK1B 3LS5L 1I8MB 3V0IA 1N4XL 4MBRA 3KD4A 4P4KB 1CE6B 1G84A 2BP0A 1N0XH 3NCJL 4KKAD 3RBSA 2LU7A 2MPVA 2R1YB 3U48A 3RTQC 4FABL 3VG0H 3I6KB 2HRPL 2DQUH 2Q5BA 2H2PD 2QGCA 2B9BA 3LX9A 4Q6KA 4RGNE 4ZAKC 1GYVA 5F6IB 1SBSL 3VSUA 1A3RH 4PJCE 3OAYK 1NFIB 3QVAA 3FT9A 4DN3L 2PPCA 5HTSA 2D2OA 2VT0A 1I8MA 2E9JA 5E1GA 2BRRH 3D85B 4B0MM 2CIKB 5SV3A 1RZIA 2YUXA 3B2UD 2EDLA 5TGBB 4U1HA 3FU3A 2R1YA 2XQ0A 3T8VA 5LG6A 2HVJB 4C4KT 2XZZA 1GPOL 4JFFD 4V2CB 3HE6A 4UYQA 3C6LD 3KPPA 3VD9A 5G2NA 1E65A 3OJDB 4W9DC 5DD6B 2IQ9H 4LOUC 4N85A 4WI5A 4KNQA 3D07A 4WFED 1HH9B 1WFOA 3TJEH 2EDHA 3TBBA 3V6BR 4C56B 2XRAL 1W0WB 4H5SB 3K4DA 3VXRD 2HVJA 4XC1H 1A6WL 2ITCA 5EU3B 5FFOA 3SE8L 1F41A 5EFIB 2VZ3A 4FJZA 1CD0A 1DP0A 1NICA 2P5WB 3LD8C 3OKOA 4B7LA 5DD6A 1AG0A 4LLVB 4LLWA 4APQC 1GL4B 2P5EB 5GGTL 2CO6B 2WWNA 4GKSB 3ZUCA 4C56A 3CJJA 12E8H 5C0BA 1W0WA 2ODHA 2R56H 4KNUA 2FE0A 2YWZA 3HFFA 1T0MA 4JFDE 4AMKH 4H0HB 5C92A 4QDGA 1O7DE 3NIDE 1E2ZA 1FCGA 3JWOL 5EU3A 3WCYA 1ZTMA 5EFIA 2AMGA 4BCYA 2BHFA 4FQQB 5CCKL 1I7ZB 2ZOKA 2FZ3A 3QUMA 5LBSH 4TOYH 5GS3A 2P5EA 4PLKC 1P6WA 1GGCH 2CO6A 4GKSA 3KS0H 2YKKA 1R47A 1ZXKA 4FFTA 1DSYA 3FQ2A 5JHDB 3V0WL 5IFJB 2J5LC 3NMEA 1TEYA 2XKNB 4FQQA 3RGVC 1I7ZA 1MJUH 3QPXL 4FZ8H 2D7PA 3WUWG 4BH8B 3IFLH 2HPTA 3GWJA 1JPTH 1SXNA 3CIQA 1WICA 3CQQA 4XMLL 3O0RL 1WIUA 3NSFA 2I24N 1KJ2L 3N1QC 4RFEB 5JHDA 3S88H 4A2GA 2UUDK 4U6XB 1RULL 1A1OB 3ISRA 1P9MC 1SYVB 1E67A 2FVNA 4RQQB 3TV8A 1GVIA 3NCMA 1VERA 4NZ8A 2FHBA 3GZOA 2YD1A 1IFGA 2VSMB 3IDUA 3LS4H 4PRPE 1OP5H 4JO5A 2Q7NA 3HNVH 3AMLA 2COQA 2HLEB 3CUPB 1A1OA 2NXYD 4WO4B 1TXKA 5C6TH 3ZHNA 3ZQWA 1CGSH 2DTSA 3OR6B 4OV6F 3MRHB 3SY6A 4HPOL 1O9VA 4OLVL 5LLIC 2DQGL 1GIGL 4ODXB 4UZUA 2TRHA 4G9DA 1DQQB 1XDTT 3GSRA 4G6ML 3MX0A 4PG9B 1TTGA 5IJDC 2DM2A 2FIKB 5G5DB 4IMKA 4WO4A 5SWZA 1I8KA 4JFPA 2IAAC 3QIUD 4DQOL 1M56B 2JJWA 4YLQT 1TNNA 5B22A 1RZKC 4ODXA 4K5MA 5DVNA 4RSYA 1T89C 2X3AA 2XWCA 5B1JC 3BP5B 1MHPL 2QEJA 1XH1A 2WSKA 1SXSA 3LDBB 4JPKL 5K1VA 4KQ3H 2X4TB 4X7SL 1SHMA 3EOTL 5LCVL 1A7RH 4KAQL 5BVPH 5D7KE 2C3VA 3BO8B 1ZOXA 5DYOB 4H1LA 4Y4KC 3SPJA 5K33A 4F93B 4Z8FL 1RJLB 5JPMB 5D7EA 2HFEA 9CGTA 3MLWH 2ZCZA 3AXLA 4E41A 3VFUB 2F15A 3BO8A 1QNZL 4XXDB 2Q10A 4A7VA 1QASA 5DYOA 2XN2A 4HV8A 1K6QH 2MTAA 4Z3TA 4PP2B 2D2CC 1RJLA 3V7AG 5JPMA 3QAZB 3IJ7A 4ODTH 2WLNA 2YFOA 3UBXB 2AQ2A 3RI5F 4Y19D 3VFUA 3UYPB 1WFJA 4XXDA 4TSAH 4MYWB 3PDGA 2H0JA 1EO8L 4KC3B 4PJEA 4AXWB 3FOLB 5DUPH 5IVXB 1WK0A 4N20A 5DUJA 4FFYH 1NUGA 1AXTL 3PNRB 4HWZB 4Z0XA 3UYPA 4JMNA 4OF0A 5C86A 5F7BA 5JYMA 1CFQB 5L4FA 4HWEH 1D6VH 5D2NC 2NSMA 2AKRB 1YPZA 2RIKA 2CNYA 3U4KA 4FOMA 4H7VA 5IVXA 2QQQA 4J3OF 4K3JL 4HFWA 3IVKB 4ZUUA 2ZYHA 5BCAA 2DWSA 1NPUA 5LGYA 1UT9A 3GMOA 4J8QA 2B14A 1UGKA 4MXQD 4JHZA 2ZONA 2VXVL 3RX5A 3BIKA 5D4QA 1ES0B 4P5TB 1IT9L 2WBJC 2WXHA 1H6TA 3ASWA 4WWID 3V52L 4AWJC 1CBVL 4HJSA 2F8IA 4OFYA 2NY0C 5T8IA 3RNKA 4LIQL 2HPOA 3CBJB 3IVKA 3QC6X 3N43B 4LFHD 2DN7A 1JSYA 2IGFL 4PYGA 4Q9RL 1YC7A 1XL6A 5J6SA 2YGOA 4ES9A 2RH0A 1A47A 2BSSB 2DAVA 3HI1B 1ACYH 1JWSB 2VXQA 1RJYB 4HJGB 3VFPB 1XXFC 3MR9A 3IT8D 4FQHA 4XPFL 3BN9D 5J8OA 5E94A 3TEWA 4HOWA 1R5IB 3TEYA 3QORC 2OI9C 3QJVB 2ADYA 3F64A 1W15A 1RZQA 5JXAH 4E9LA 4O5LL 5F9WC 4UUJB 2CLRA 1RJYA 2YK1L 2ICWJ 4HJGA 3D39B 4M29A 3VFPA 3VQ2C 1PY4A 3V6FB 4HMDA 3FUMA 1HJBC 1ODAA 1U42A 5HDQH 4H20H 4D8PB 2LU5A 4HKXB 2VLKD 5EIIG 1Z2KA 4XVSL 4KZDH 5I23A 3BFOA 2O61B 4X6CA 2MCG1 1EV2E 1NBVL 4HJJH 4GAJH 3EBIA 2QKSA 4OCLC 2KERA 2P80D 2AXGB 4BFOA 2Z65C 4PB0H 1ZV5A 5FR3A 5CSZB 3IMBA 1AHWB 1PL3A 5BV7B 1HKLH 3EDDA 1A7OL 3IMVA 3LKOA 3MBED 2FWOB 4RRPM 4ZUWB 4D8PA 4HKXA 3TVMC 3C5XA 3ZZQA 2NW3A 5KYXA 2XTJE 2BIHA 4OGYH 3P4MA 4FXKA 4UIKL 1XGQB 3O6MH 3QEUA 5CSZA 1F1DA 2KPNA 1AHWA 3S2AA 4M6MH 4NQEE 2C4FU 3CN0A 2FWOA 4UZSA 2F58H 4AQOA 2YLHA 3MLYL 2C9PA 1Q9LB 4JN2B 1H3GA 4MNGE 3ZDZE 2XWXA 4WNQB 2ZT9C 2D0HA 1XGQA 4MGXA 4MB5A 3CVIL 1ZLWK 5K1JA 4EUPG 5J13B 1WS8A 2HTKD 3QIWA 4HPYL 3UTTD 2E6JA 5DZPA 5F89A 1LDPL 4AL8C 3HZMB 4GJTB 4WNQA 5D1QE 1F3JB 1JGUH 1THAA 4K8RH 1U8LB 4M5TA 1QO3B 1AVAA 3QG6A 5TE6L 1YC8A 3MV9E 3RGBA 3IS0X 2DH3A 3B9DA 1KZQA 1OAYL 4JREB 4AQ1C 4LCWB 3UAJA 1BQUA 3NFSH 4NZRH 3ULVL 2CKBL 5D6DA 5J0BA 5KSBA 2H1PH 4ONFH 3QULB 1L7IL 3SKMB 5CLWA 1F3JA 3N44B 4UQ2B 1QBML 2Q7YB 4HKJB 1IE4A 4KUCF 3CSGA 1IAKA 1OLLA 1R75A 2VWEE 2EJ1A 1PD6A 5TF1H 4EZJA 1JMXA 5A6LA 5JHLA 1J0ZA 2YRPA 1VFAB 1E27B 1FDLH 4HP5A 5LJYH 1HCZA 3GMQA 1CDJA 3QRGH 4ZXBC 1DUYA 5KYNA 2OK0L 1BG9A 4Z7VA 2ENYA 1BXVA 2C1OA 2BW4A 4NO2B 3IWUA 3P4LA 2Y4SA 2E6PA 1L9RA 1QHPA 3A6CH 4QTIH 3T0EC 3VD1A 5I0YA 1JV5A 5FC9A 1JK9B 3CX5K 1I4FB 1VFAA 4ZD3L 4AUYA 4NUJB 4QXUH 3WNNA 3WFEH 2F1EA 4Q6IC 5HY9B 5JOPD 4NPYB 1H8SA 1OT2A 3PP4H 5D1XE 3UG4A 2ED8A 2KC0A 4GUQA 3CU1A 3SO3C 1TJGH 3MV8D 3GM0A 4F37K 2YGVA 2FJUB 3AAZA 3BKJL 4N1HB 2G9KA 4NQDE 4H26B 3SYAA 5D7JA 1JK9A 1PLAA 2H3XC 2NNFA 3ME0B 4LOFA 5E4AA 2QHRH 3FSVA 3HE6C 4PS4H 5F6IC 5HY9A 3U7AA 4BE6A 1AY1L 4NPYA 2FBJL 4PV9B 4NAMA 4WTWA 1T7YA 1XQ4A 2Z0BA 3CSPA 4JZOA 4ZFZB 4MJHA 4Q9QL 5GZND 2XVBA 1E8XA 2A0LC 3VNYA 2PR4L 2P26A 2H7WA 4XHJC 4KROB 4I3RL 1U8PB 2O5YH 4ZFZA 3V9CA 3RWCA 2R1XB 4NFBA 1MCWW 5J12C 4X98B 5KUKA 1M05B 2V2XA 1AP2B 2VR8A 1MPAH 1ILUA 5GRJL 4DPRA 3EGXA 3UAAA 4KKAC 4NKIL 3KLAB 1U8PA 4G83A 4Y4HD 5F9OL 4AIEA 3V4VB 1PZ3A 3WFCH 2R1XA 3VRIB 2QDVA 4JKPL 1L3NA 4GRLB 1PKQA 1PZ2A 2WZPA 4X98A 4K3EH 1M05A 1AP2A 2E7CA 4FYRA 5FW6A 1EX0A 1T66D 4XC3L 1V8HA 4ZTOH 4DN3H 1FV1B 3LYRA 4HKZA 3B5GA 4L37A 3KLAA 1JFQH 4IRSB 4TLUA 1OARH 4CGUB 4Z7UE 4D8OA 2UVEA 1U8MB 2H6PB 3VRIA 1WP6A 2AEOA 4ZMQA 4DUVA 1SJMA 1DO6A 2CA4A 4W9ZA 1KLGB 5SWSE 1A7NH 3AITA 5EO0B 2FJFB 2ZX5A 3ISYA 1AR1B 3DO4A 2WK2A 1KGJA 3GPEA 4AM0B 4IRSA 3PDDA 3LKPB 4PJCF 1F8TL 1SXAA 1U8MA 2H6PA 5SX5K 5T33H 4CSSA 3S37L 2E86A 2NT1A 3BZ4A 4WV1A 2R23B 3UIYA 1KLGA 5JXEA 2BIOA 4MA1C 4YDIH 2FJFA 3FQ4A 5IHUH 5HDWA 1HYSD 3QW9A 2D7OA 1XGRB 3PGCA 3QPQC 2P8LB 4JUTA 3AY2A 4MCNA 1PMYA 4RMBA 3ZDXB 2ZUVA 3LKPA 2AK4B 4X9GA 2W9DL 4LSRL 2VDQB 3UBXI 1E28A 4P59L 2CAKA 1F3DJ 4HK3N 3WKML 4Z7WE 3GSVB 3L95B 4AEHL 3OXRB 3GJFK 3FH8A 1D9KA 2OL3A 3II2A 2P8LA 4FMVA 4ADIA 2I26N 5IMMB 4IMKC 4FNTA 4WO4C 1PAZA 4OLYH 2YARA 2J21A 1UB6B 2D3LA 1L7TH 4QRRB 3R0MA 1CD9B 1ED3B 4R2GB 2FWSA 3OXRA 2AAAA 3WXVH 1NC2D 4LAQL 3VO0A 2EDQA 3TNMB 3ZTNL 4HIIB 3MJWA 4I2XA 1ETZB 1WLHA 1DYZA 3SKNB 1UA6L 3MNMA 4R7NA 1SOKA 3HS0B 3WAJA 4QRRA 4LHUD 4ZS6C 3ALXA 4BHUI 4FULA 4N2DA 1FNSL 4DTGL 1EJ6A 2VQ1B 3AC0A 3AU0A 3F2LA 1UFUA 2WXMA 2ZPKH 1CD8A 4F57H 2VDLL 4MFHA 4GXUN 4OF3A 3SKNA 5AG9A 3APCA 1IX2A 4KK6D 2N7SA 4HC1A 2YD5A 4P9HH 3GHBH 4ICWA 4JFZL 4RH4A 4Y16A 4TUOB 4Y2DD 2G0LA 5ADPL 2VAAB 3T6QC 2XN9B 3IXTB 3ARED 4Q58C 3FMGH 4M4PA 2WTRA 5B8CA 1DLFH 1PZAA 4QRPD 4DGVL 5JPMC 2WXQA 4GO8A 4YSTA 2QQKH 5CUSL 1Q8MA 5FS5A 1TMQA 2Z4TA 3MGAA 2VMEA 3PWPB 1QI5A 4GT0A 5IB1B 1SY6A 4TUOA 4WSKA 1KBWA 1U6AH 4N2CA 3EAKA 2VAAA 2B8OT 3WHXB 2XN9A 4XNDA 2F5AH 4M7KH 2NY6C 2QSCH 2R9HD 4LPWA 5AALA 1U4EA 2NDGA 1E50A 2R59A 2Y07L 2DQJH 3K6IA 3PWPA 3U4BL 3VGEA 1BMGA 2M83A 1CBJA 1LO3L 1DE4B 2NQDA 2EYTA 4UMGA 1LEKA 2PYEE 5E5LA 4YZFE 4JKMA 2YAQA 3QRFM 3VXMB 4PGCB 2K3TA 4JN1H 3OTTA 5DS8B 4MQSB 1RD6A 1LK3H 3QEQB 5CR1A 5JW3H 1AQDB 5KVGL 3CZFA 1DVFA 3DHUA 3O4OC 5CGBA 3RHWK 3TOPA 1BYOA 4HLJA 5MERB 3IAQA 3VFTB 4KX7A 4YUEH 1EEQA 5B38A 5IHWA 1ZE3H 5DF0A 6CGTA 4PGCA 5L7XH 3WTXA 4YDJB 5E08L 1X5IA 5C0JB 1A8ZA 5GJTH 4XVTL 1FE8H 2OTPA 5T5FH 4AT6A 1FVDB 1TQBC 1EXUA 2CG9X 4FI8A 4CC4A 3T2NH 5LAXB 4ZNEA 3D08A 1OP5K 3L3GB 5ADOL 1MVUB 1YEKL 2DWYA 4EDXB 2EH7L 4I77L 5DEFA 3VFTA 4ALAH 4XX1E 4YQXL 4YDJA 5GGUB 3U25A 1FZJA 3F62A 4ELMA 1RURH 4POYA 3ELQA 3BAXA 1KOAA 3JWNC 3ARBD 4R0LC 1EGJL 5LAXA 4W9JC 1NCWH 2VDML 1MVUA 4N5EC 3DRTB 1FFRA 3QDGD 3KPRA 2VN5A 2XACC 4YVNA 2YD7A 4FYTA 1TO5A 4GSDH 4IU3B 1MAJA 3RIAF 4MB1A 4ZTPL 4FQLH 4YK4B 3IFNH 1BW8A 1XCQB 3UCQA 5DVKA 2F6AA 2HFGH 3S35X 3BPCA 2ITDA 4BZ1A 4PVNA 1IM9A 3IMRA 4M02A 2VLJB 4Q8BA 3VI4B 4UOZA 3DRTA 3T6VA 4JGNA 3NCBB 5F7FA 2C8NA 5DQ9B 4JO1L 5IJVB 5I1GL 5J11C 1LO2H 3KW8A 4I4WB 4KITB 3ATAA 3F3HA 1A9EA 5C0DB 1AO7D 2UWEE 4OZGE 5FK9A 5EG6C 3BP4B 3II1A 3ULVD 1DBKL 2VLJA 4UV4H 1WFUA 1OSYA 4NKQB 4ZOEA 3L5HA 5CFAA 1Q1JL 4FXKC 2IDUA 1T1WB 3GLDA 1NANI 1OAUL 2FGWH 4JFXA 4I4WA 5DVOA 1P4IL 1AHWC 3BEVB 1T03L 1IFHH 3T0WA 1A6AA 3SGDI 5C0DA 3A0OA 3DIVA 3LZFL 2VTFA 3BP4A 4IK7A 4OY9A 4M1DH 3FB8A 3MLRL 4NC0B 1BVLB 4BM7A 4AMWA 5BQ7A 5AOMA 5AOZA 3U79A 2KL6A 3CQFA 2WKOA 4DO4A 3APMA 3GXTA 1MWAL 3QQ9D 1INEH 1MCOH 3ARYA 1JTOA 3BEVA 3BDYL 3MRCB 4JFVA 3O4LD 3QIWC 5ERWA 3ZKQD 1S6NA 2DRUA 4JHVA 4LBEB 4KRPD 5I76B 1HOCB 3ROLB 1H6FA 2EYSB 2BNQA 2GB2A 1BVLA 3C12A 1OP4A 3D2TA 4J3OH 1EDYA 1IBGL 1S46A 3TBTB 5LUMA 3MO1A 5I73B 3VXNB 5EPMB 4CRPA 4DK5A 4NZDA 3MRCA 5HHQA 1R24B 3CXFA 4LB8A 3BC9A 3RWDB 1OGAB 4LBEA 4LNVA 4FGMA 4JRXE 3UAJC 1NBVH 2GJ6E 3FCSA 1GC1C 2EYSA 2NTFB 4RLDA 4EIZC 2YAOA 4CMMB 2MQGA 2DLEA 1WUNT 3TBTA 5B7EA 3VXNA 5EPMA 4PG2A 1X7SA 3VD0A 2A4ZA 2VC2B 1Z6JT 3EOAB 4GSUA 4JREC 1U3HA 1OGAA 2C1PA 5E8NB 1KIPB 4ODVL 4JY5H 4WTXA 5AW4B 5ESAA 5DHVA 3C08L 2CUAA 2JB5H 3Q1SL 4MJIA 3ILQD 3D69B 3FQXB 3ZK0A 1UZ6E 1T0PB 1C5DB 1TETH 4NZTH 4BZ2A 1RSYA 3EOAA 2J3SA 3PABB 2PCYA 4M6NL 4HWBA 4FQXD 3V8CA 3UJJH 1UD6A 1EHXA 4OCXL 2FEDD 2OP4L 2QGEA 4JM2A 1AQKL 2HTKC 3BH8A 2CJUL 2Q2EB 4KTYA 4FQ2L 3D69A 3FQXA 4DKEL 3UROR 4DP9X 1C5DA 5LDSA 3OVUB 2DIAA 2GY5A 2WQSA 3O8XA 2HFFA 3RPBA 1U4FA 1G94A 1S7QA 4XGZB 4UV7H 5D7JC 3L6FA 4E42B 1DQDL 3ECBB 5CP7A 3MJ9L 3O81A 3QNXA 5IQNA 3ZDZF 5TE6H 1QFWM 1G9MC 2H5UA 2YIHA 3MRMA 3K71B 4TLSA 4D9RD 4YBLB 2W1NA 4PWJA 3VGAC 4LLMA 3GDCA 1IGMH 4LCIL 4KNSA 3ECBA 3INUL 3MRPA 5MEQA 4L5FH 4AZ8B 3QDHA 4JUSA 2ZX9A 1W8EA 5EMYA 5DQJB 1AGFA 3KBEA 3EFFB 1W2KT 4ZMVA 3MV7D 3IKKA 4PJAE 4YXHL 5IWLA 2Q20A 2IDQA 3KYKH 5IJBC 3GB7A 5DC9B 4OCSH 4G6FB 3DTUB 3IDIB 2PW2B 2QR0A 4GI8A 5D7HA 4HXAH 1FFTB 5DQJA 2YAFA 5KN5B 1J8HB 5IVZB 1SDYA 4KK8D 4YPJA 2A74B 4OZFH 5I66B 5EF3A 3CVHH 5T1LB 1HSAA 3K5SA 2JCCB 2APVA 2QADC 4WW1B 4TKWA 5C0FB 3JWDL 3MA9H 4PRIB 1BJ1J 3WG7B 3BE1L 4J8RB 1MCWM 2GHZA 3VXSB 4R97B 3UBGA 1J8HA 1ZPUA 4B97A 4FNRA 4XODA 1OIOA 1YNKH 2K70A 2A74A 4A37A 3UGXA 5I66A 3GM8A 1S7UB 4TV3A 4WW1A 5JZ7D 2BXYA 3LRLA 4Y8DC 5HJ3A 3S34H 1A9VA 4NNXB 4MJ5B 1SQ2N 5A1AA 1CFVH 4IRSC 1FHNA 3CXDL 3AQXA 1B6DA 5FDYA 3VD4A 1TOXA 1NBYA 4LPVA 4PGZA 5CJBA 3K4AA 2BVPB 4WV1C 2PUQT 4I1RA 5JXEC 1S7UA 1QA9A 1QEWB 4XCFL 4RNRB 1FP5A 1MRFH 4MJ5A 1XF1A 2I7OA 4GB9A 4K2UL 3NESA 5LAPA 2PMZA 3VACA 5DZAA 5GHWH 1GY1A 5C07E 1FL6B 4JQXA 3ISWA 3QNYB 4M62H 2JKWA 1XGUA 4P5MA 4ONGH 3MLSH 3B2MA 3KXFD 4KTEL 2YOCA 4Y4HC 1QEWA 1D9KC 2WNWA 4RNRA 1HQ4A 4NJ9H 4GW5B 3BISA 4X7TA 3UO1H 2Y5EA 3F6IA 3OG4B 4BFEA 3N0AA 5JHBA 3FSZA 1NFDA 3PYCA 4NUQA 3FUJA 4PJIA 3BPOC 5CD5C 2X4QA 1P4UA 3HHMA 4WY7L 5CWSB 4NT6B 4WJG3 4GINA 4PRAB 5LDUA 3ULUF 4I8DA 4AC2A 2V8MA 3T6ZA 3MJ8B 1ETA1 2VDKB 1BFOA 1DQLL 1E6JH 4GW5A 2RFXA 1KN4L 4AQ8A 4HU8A 2ADJA 2YKLH 4Q7DA 2BNRB 2Y9RT 3LNDA 3KLHD 1B6UA 4MDIA 5DJ2B 3TN0D 2WWOA 5HHOA 3MJ8A 1G4RA 4OLZH 4OI8A 2VM3A 3LXUX 4YFEA 2OYPA 3LKRA 2KMWA 3MGOA 2UX6A 4D7PA 3NCYP 3U6RB 1XTMA 4KY1L 4DGYL 3DO3A 2W0FA 2BNRA 2WNGA 3D9AH 3N5AA 4O9HH 3GXDA 4Y16C 1SHXA 2OXGA 4WW2A 4YBQC 2YMXL 3FTUA 4QF1B 3WTUA 4HCRA 4MJ2A 1X9LA 3OGCB 2CLVA 5B8CC 4LVNC 1BX2B 5I30H 2F08A 1BOYA 3QDAA 4GMSL 4NRZB 3RZCB 4F9LA 3U6RA 3M1BB 3RU8H 1ASQA 1NM9A 1F6AB 5DRWB 2VZTA 2WP3T 1AKPA 4YDNA 3ZOAA 4RISL 3L45A 4GKNA 2EKJA 4JK0D 3OGCA 2XA3A 5I1KL 1BX2A 2X4NA 5E9DB 1A6ZB 5HVGB 3Q8BA 3HG1A 3HLKA 4KQ0A 1QYGL 4J28A 1F6AA 3VWKD 4HG4J 3RWIB 5CKAA 4FDWA 4ATTA 3Q01A 4DUXA 2BOBB 2X44D 2JH2A 1BAFH 2GC7C 4KKLD 5CZXD 5CSBA 3FC8A 1A6ZA 1QKZL 4L8SB 5BVJA 3TT1H 2VYRE 3MCG1 2R2HA 4WU7A 4G9FD 4ODUB 1DVFC 2CK0H 5FUOL 4QRFA 3RWIA 5JOFB 2HLFC 4JG0L 3P30H 4K3HA 4FFZL 3ABLB 3BDBA 3DX4A 4RDQF 1OQXA 4OD1L 4U1KA 4K4KA 4DZBA 4W9IC 4WFGD 4L8SA 4M93B 4F8OA 1GMEA 4C8XA 4JFZH 5F7DB 3RB7A 2ESVD 3T8MA 3HS8A 4CC4C 2GBVA 2AEPL 1GZQB 4P2RB 4ODUA 4HZLA 3VB9A 4HVBA 4TQ8A 5IZ7A 2IV9A 4KKZA 1FZOA 1RIHL