3UACA

Multicopper oxidase cueo mutant c500se506q (data4)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
489
structure length
476
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHSHLLEHQDTGMMLGFTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An O-centered structure of the trinuclear copper center in the Cys500Ser/Glu506Gln mutant of CueO and structural changes in low to high X-ray dose conditions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
molecule keywords Blue copper oxidase CueO
total genus 136
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uacA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uacA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uacA03
1EHKB 2OCCB 3CVCA 1URIA 3CDZA 4DPBX 4E9WA 2BZCA 1NIAA 2W88A 3X1NA 1A65A 1WAEA 2FQDA 4HAKA 3FPYA 4BDVA 1SJMA 5I5JA 9PCYA 2PCYA 3BVDB 3ZDWA 3FYEB 1RCYA 5I6MA 1PLCA 2XXFA 6PCYA 2DYRB 2HZHA 1W6WA 4E9VA 2EINB 5I5MA 4M4RB 1WA0X 1GYCA 2PPCA 2EILB 3QJTB 2XU9A 3ZIYA 3QPKA 4L0PB 3NJNA 4KO6A 3FQ2A 4P5RA 2EIKB 2IWFA 1SF3A 5B7FA 4AX3A 4N4YB 4YSRA 2IAAC 2EIMB 4AKPA 2WO2B 4JHUA 2HXAA 3QJSB 5TK2A 2IDFA 4ENZA 1ILSA 2JXMA 4F7KA 3CVBA 1OV8A 2QPEB 3N2JA 3T9WA 4E9RA 1PLBA 3GXUB 4E9QA 2NRDA 1FA4A 1PF3A 1OF0A 1SHXA 3OM3B 4NB7A 3FYIB 3FSVA 2DY2A 1AZCA 2Y1AA 1A8ZA 1ID2A 3AZUA 4NAJA 2AFNA 2DV6A 4DP4X 5D4IA 2Q5BA 1AIZA 1IBZA 1MDAA 3FPXA 4YSCA 2EIJB 3QJUB 3EH4B 1JOIA 1A3ZA 3JTBA 2VM3A 3FSZA 2PLTA 4YL4A 4JHVA 2XX0A 3RYMA 3UAEA 3NSDA 3NJIA 3KW8A 3NP4A 1JXFA 2IH9A 2QPDB 3CZUB 3NYKA 3PCYA 2YAPA 2HX9A 3PPSA 1GS8A 2PCFA 3NJLA 1ZDSA 3NJHA 3EHBB 5D4JA 4A2EA 1NZRA 3T6WA 2FJSA 2GC4C 2E86A 1AS7A 1NWOA 2BZ7A 2AVFA 4DP6X 3ASOB 1E30A 3NP3A 3WNIA 5IY5B 3X1EA 1PZBA 1E65A 3TBBA 4PCYA 2GB2A 1SFDA 1ET5A 4HCGA 1TEGA 1ILUA 2X88A 1WA1X 1XB6A 1KV7A 2GIMA 5I5IA 1TKWA 1JERA 5B7MA 5B1AB 3X2QB 1X9UA 4YSEA 1TEFA 3FSAA 2ZXWB 2VW4A 4ZK8A 5B7EA 1L9QA 3H4FA 2H5UA 1OOWA 4YSQA 2BP0A 5A7EA 3CDZB 4X4KA 4YVNA 4DP1X 4E9YA 1PAZA 3T6XA 5PAZA 1PLAA 3ERXA 2P80A 2PPDA 4E9TA 3AW5A 4KNSA 2JKWA 1AG6A 4YSTA 1SF5A 2YAEA 2ZWNA 2YAQA 1KGYE 1NIDA 1NWPA 1BAWA 1CUOA 2H3XC 4G70B 4RH4A 2UXFA 4G7SB 3X1GA 2HRHA 1V10A 3NSFA 2I85A 3FQ1A 2BP0B 3S3BB 1PZAA 3CVDA 1WS8A 2PP9A 1OE1A 1JZIA 1RZQA 3S3CB 4AKOA 2CAKA 1AACA 1IBYA 1L9TA 3NJGA 2QDVA 1AZRA 4HIPA 1AANA 2GHZA 3NJFA 2OJ1A 3ABMB 1OCRB 4HHGA 1PCSA 3DIVA 4W1TA 1ZIAA 3ABKB 4KNTA 4MFHA 2ZONA 3UGEA 3ZBMA 3BQVA 2CCWA 2R7EA 1QHQA 1NIBA 2BWDA 4DP5X 4E9XA 1BYPA 4BWTA 1FWXA 5AKRA 5F7AA 3MX0B 3SBRA 1GSKA 2I7SA 1GY2A 1E5YA 1TU2A 5EHFA 5LDUA 3V9CA 2UXTA 4BWWA 3JT2A 3NJJA 1AAJA 1PMYA 1SFHA 1MZYA 2DWTA 3TA4D 2XYBA 5I28A 1EZLA 3ABLB 2B3IA 1XB8A 3X1BA 4F2EA 3OQRA 1M57B 1GY1A 3TASA 5B1KA 3ZX1A 2YAMA 2PPFA 1IUZA 1OCOB 3PAVA 1B3IA 1VLXA 4A2FA 4AKQA 1KDJA 1JZHA 1W6LA 4UAHA 3IN2A 1NDTA 3UAAA 1AQ8A 1L9PA 4AZUA 3MBWB 1CC3A 2ZOOA 3CG8A 2AZUA 3PAZA 4A66A 3NSCA 2I7OA 1BQRA 3WKPA 5FC9A 3EF4A 5F7BA 2J57A 1MZZA 1I53A 1OE3A 2BHFA 4GY4A 2UXGA 2XV2A 2BW5A 1SDDB 4HHWA 1WA2X 2XXGA 1J9TA 4A2HA 2MRYA 4HZ1A 1A4BA 1AZUA 2J5WA 4WKXA 1KCBA 2YAFA 2J55A 2LLNA 3OMIB 4G7RB 4K9JA 2WO3B 3H56A 2B08A 3C75A 2FT6A 4YSDA 1PNCA 1L9SA 3HB3B 3U25A 3AG2B 2TSBA 4FAAB 1A4AA 3L45A 8PAZA 2UXVA 3TU6A 5AFAA 1IC0A 2XUWA 1AZNA 1NIFA 3FSWA 4NERA 4YSPA 3T6ZA 5I6OA 1A4CA 2YAHA 1IKOP 1WS7A 2BP8A 2YQBA 2YARA 3X1FA 3UADA 4BXVA 2AZAA 1PNDA 3QJVB 4TXVB 1SNRA 4YSUA 2H47C 3OMNB 2CALA 2VSMB 4A2DA 1UATA 2BW4A 1ADWA 4N8UA 1N68A 1GR7A 1OE2A 4GP5B 1JXDA 4E9SA 1HAUA 1KBVA 3DTUB 4FA7B 2YAOA 1AZBA 2GC7C 1AS8A 2Q9OA 3AG4B 3QQXA 4DP0X 2P80D 4PAZA 1KYAA 2HX7A 3IEAA 2GI0A 4A67A 5PCYA 4HALA 3WI9A 5I26A 1BXUA 5ANHA 3KW7A 3S3DB 1F56A 4G71B 3QJRB 1MG3C 1AR1B 4KO9A 3SBQA 1KCWA 2XV0A 2XWZA 2FNWA 2FTAA 1BQKA 2BP8B 3T71A 3NSYA 5I6KA 4HCIA 1L9OA 1BQ5A 3AG1B 3FU8A 1X9RA 3UACA 1CYWA 4UANA 4AI7A 1N70A 2CJ3A 1HAWA 2VW6A 3S8FB 1XMEB 1ETJA 3GDCA 4QKTA 5E9NA 2PPAA 2RACA 1CYXA 2VW7A 1YLBB 1DZ0A 1SDDA 1GS7A 3T6VA 2UX6A 4EF3A 1JVOA 1PZCA 1J5DA 1J9QA 1HFUA 4GP8B 5B1BB 2FQGA 1M56B 4GP4B 2XLLA 3H4HA 5D4HA 3DKHA 2PP8A 4W9ZA 2IDSA 1V55B 2HX8A 4YSSA 3FU9A 3FU7B 4DPAX 3HEIB 3OMAB 2GSMB 2BO0A 2TSAA 2MTAA 1KBWA 2A3TA 5B1JA 2VSKB 1BEXA 2CUAA 2DWSA 1R1CA 1DYZA 3G5WA 3IBOA 2JFCA 1AOZA 4YSOA 5TK4A 4Q8BA 3GYRA 1ET8A 1E5ZA 2J56A 5B3SB 4GYBA 2XVBA 2WSDA 1T5KA 1MG2C 3QJQB 1CURA 4YVUA 2CBPA 2YXWA 1GS6X 4BK5C 3SQRA 2QDWA 1RKRA 3AY2A 1ASPA 4BWUA 1AS6A 4QLWA 1FFTB 3FS9A 4M3HA 1E67A 1NPNA 3EH3B 3IN0A 4WTQA 3WNJA 2N0MA 3FU7A 1JZFA 4DP2X 4GXFA 3ASNB 1NICA 1J5CA 3V9EA 1BXVA 1OCCB 7PAZA 1M9WA 5B1JC 2Y69B 2IDUA 4DP9X 4G7QB 4KO5A 4CSZA 1GW0A 2VMJA 2IWEA 1OCZB 1ET7A 4CSPA 2HRGA 3WKQA 1PY0A 4KNUA 2IDTA 2PPEA 2UX7A 1NTDA 5I6LA 1ASOA 2FT7A 3PXLA 3OD3A 3NJMA 2DYSB 1J9SA 3FQYA 3PAUA 4JKNA 4DPCX 1ZV2A 1NINA 4G72B 1ASQA 1BYOA 2IWKA 2FQEA 3N55A 1QNIA 2R7EB 5AZUA 1QLEB 2W8CA 3FT0A 2IDQA 2GBAA 1JZGA 2VN3A 1JXGA 2BWIA 1ZDQA 3D12B 2IH8A 2XX1A 4HCFA 1NPJA 2FQFA 1JZEA 4KO7A 1ZIBA 2FT8A 2VM4A 4P5SA 5I6PA 2HLEB 2FWLB 1AG0A 4Q89A 6PAZA 1JVLA 1SHWA 4YSAA 4KOCA 7PCYA 5I6NA 3TBCA 1W8EA 1NIEA 4BDVB 1KDIA 1BXAA 3SBPA 4BXSV 2X87A 2YXVA 4A2GA 1JZJA 1L9RA 4F2FA 4KOBA 1V54B 3AG3B 2QT6A 3IE9A 3NT0A 2XV3A 3PLYA 2OV0A 3S8GB 3NJKA 3WG7B 2PP7A 4UF7C 1RZPA 1XB3A 4DP8X 2AANA 4A68A 3ABGA 4DP7X 1ZPUA 1J9RA 3EH5B 3UABA 3WIAA
chains in the Genus database with same CATH superfamily
4X9BA 3I3EA 3GBNL 4PRDA 3S5LB 1IV8A 2Z65C 3BPNC 1H3UA 3K6FA 4OH2A 1QFWL 4AV5A 3U46A 2GEEA 4GG6F 3BUIA 4O5LH 3GTTA 4O51A 2XZAL 2DH3A 3ELAT 4TUUA 3BGMA 3VE0A 1YEIL 3BSZA 2VDNL 5KVFE 3ZT6A 1H6UA 4HWBH 1YUKB 2FATL 2ICCA 4PYHA 4YE4L 2EINB 4LBEB 4FHKA 1WO2A 1WVZA 3RFZC 4PGZA 2C4FU 3Q1SH 5HJGA 2YQ3A 4OGXL 3NIGB 1MI5A 5JPNC 2Z0BA 2HLAB 3GSNA 1ZEAH 5DMJB 4AIEA 1T0MA 5LWYH 3V7AE 4JJ5B 4HYTB 1U8MB 3G5VB 5DRNA 1CQKA 1E27B 1NCDH 2CIKB 4PV8A 2GCYA 4WVRA 1U8OB 3WUZA 5MEPA 4KAQL 3BP7A 5T3XE 2B4CH 2K45A 1LO0H 3QUYB 3KR3H 4NNXA 1S7WA 1YG9A 1WEJH 4YDKL 5FA3B 3GXUB 5IB5B 2A9DA 3I50H 1OF0A 5AB1A 4ZZKA 5HYSA 5DO2D 1ZT7A 3SQOL 2NX5E 1LMKA 3ECBB 5IB4B 4KMTH 3OWEA 5KBNC 1T0NB 2CIKA 2NY1C 2RQ8A 1IGFH 2YUXA 1KJ3H 5IEKB 4ADIA 4L1TA 4X6CF 1EGJH 5GZOA 2VL5A 4LU5H 1QASA 4I4WA 3TEYA 1IGIL 1K5NA 1MI5B 1FLTX 2MPVA 3QCTH 1TJHH 3HVNA 5K9KA 1MCNA 2JMRA 5JHLA 1EJ8A 1TVBA 1FRGH 2QPDB 2X10A 3CZJA 3ZHNA 5AUMA 1KV3A 3ESOA 3CK0H 2DICA 2ZSVA 2HUHA 5C8JA 3K6DA 4N8VA 4XCNB 4YHPA 3DV4A 3R06A 5TQ0H 3T0XA 2P49B 3EHBB 4KKAC 2VH5L 2ZX7A 4FNLH 5IW1B 2EVIA 3VXTB 1WBYA 4ICXA 4UUJA 3K6NA 1OAUH 2YOAA 1LNUB 4Q2ZB 2WKOF 3ULVE 2QPFA 3BP6B 3QCUH 4OLWH 3U7WH 3D4ZA 4JDEB 3G5XA 3ZTDC 5JW3L 2GW5A 1ECZA 2F5AL 2XIBA 4NKQB 3DDGA 3N5AA 3O9WA 4QOKE 5ICZB 1WBXA 4RIRB 2HRPL 2ESVB 1WZ1L 3O2WL 1E0OB 1ITCA 1T0PB 5B1AB 4GAJL 4MJIA 1C7SA 1UA6L 2XA3A 1TEFA 3CUPA 3FSAA 2ZXWB 2K7PA 2VW4A 2C1OB 3HG3A 4HT1H 4PRAB 1KXHA 5B7EA 5EUOE 5DMGC 2EYTA 3RWDB 1Q4NX 1G87A 3EYUL 4DQAA 1QRNA 4QXVA 2QR0A 1XCTA 3BZEB 4N2AA 4LE8A 1BQLL 1JNHA 2CCVA 2V7NA 5DJCB 2BY0A 2WP3T 4P2QB 1YYCA 3DX7B 4W9LC 3O6LL 5F0MB 4YSTA 5F8QC 1H6EA 4YHNA 3KLAB 3DHPA 5HHXH 5JXAH 3MLVH 3HPJA 3SN6N 5J1AB 2VDQL 1A7NL 2HVKA 3NZ8A 5CJQH 4IBUA 1DJHA 4CVUA 5C0JA 1G84A 3BMVA 5E4OA 1YC7A 2R56H 2WM0A 1YECH 5GGVY 3LHPH 3POCA 3D05A 5JPMB 2W92A 3RP1A 1XXDC 3QZWG 4UNIA 5DFWH 2I27N 4KQ3L 3WENA 3QO1A 3HZVB 4N8CH 1TVHA 1IFRA 5DMYA 1RUPH 1A3LH 3FN0H 3HKZA 4DKFH 2XY1A 3MV8A 3B7SA 3EFDH 4Y4KC 1WC7B 2BFVL 4PJBA 1G6RB 2P47B 3LB6C 3UZVA 1FHGA 1LO2H 1USQA 2ZWYA 5DC2A 2ICWA 2H32H 3UTZA 3HZ3A 3TCXA 3VFGH 4HHGA 3L95B 1YHPA 5D7KD 5J6HA 3SPJA 5FKPA 2Z35B 4PM1A 4YDVB 3VD4A 1MCFA 5I1GL 3V10A 1RSFA 4ZUVA 1YDPA 3RDTA 1S7SB 4IGBB 3FULA 1BYPA 1VEPA 4H2AA 3RI5F 3F58H 4ZNEA 4G6AD 2OXGA 1T7ZA 1D5XB 1MQKH 4NHCH 4OBSA 4L29A 1XEUA 4MD4A 2A38A 4M5ZH 1M1SA 5C08B 3B3IB 4JO3L 4BWWA 3QR0A 3MV7D 3L1FA 1PMYA 4XRCA 1PS3A 4XWOD 4YNYA 3BGAA 5HYSB 4P9ML 4FULA 3CBJB 3BQUB 4RGOL 1GVIA 5F0PB 3OQRA 1M57B 2VZTA 5IQNA 5I30L 3QXTA 2PPFA 2YBRA 1A9BB 2LGNA 5D2LB 5CGYC 2EZ0C 3K0YA 3MA7A 3TFKC 4LCCC 5DJDA 3NG5A 1JDDA 4IBSA 3KGRA 2CNYA 1OP3K 1CC3A 2ZOOA 4PTTB 1C8PA 2PW2B 2QZQA 2AZUA 2BXYA 1XL6A 3MC0A 1VADA 1I8LC 3EF4A 4NC1C 4I18C 1C16A 2WGNB 4OSUH 4ELMB 4NNYA 4K5NA 2E7BA 3RFZA 3EGSA 1CLOL 2IMMA 1W72H 1IC1A 4P5TA 4PRIE 2XXGA 1L0XA 3JWNC 1E6OH 3UAJA 1BBJA 2BVTA 1NGQH 3UTQB 3WAKA 3HFMH 4KTDH 5EA0L 2PO6A 1G7MA 5J11C 2J5WA 1FFQA 2YAFA 4FFVD 4I77L 2DQDL 1MFCH 2AMUA 2FT6A 2FWSA 4H0LC 4M6OL 2JCWA 1FZOB 3SDAA 2VR5A 3V7AG 4BKTC 3RBSA 4HWZB 4HJ1A 2K3TA 1SXBA 1IC0A 1XGYL 3MKKA 4XHQA 3N43B 5C3TA 5IJCC 5AW6B 2W07B 1NIFA 1R3KB 4FTVD 4MSWA 2CGRL 4TVPL 5JXEA 3BAJA 4BA0A 3U36B 5GSRA 5CJOH 5AAMA 3PGCB 1AGEA 1I7TB 5GS1C 3BKMH 3PJSB 5AW1B 2WQVA 2X4TA 3CIAA 4ODSH 2FRGP 3EFFB 4B6ZA 4OBRA 2VC2H 3PP3K 5FPIA 4YHKL 1F1AA 4YXLL 2AAVA 4MNGB 2QLYA 1G7LB 2ENYA 1AZBA 2GC7C 3SYAA 3T0ED 3WFEH 2X4NA 1M7IA 2NSXA 5CSZB 3QUYD 5I6XC 4F80A 1N7MH 4Z7VE 3LH2L 4AK2A 3CXDL 1WG3A 1L5GA 2DWYA 1MG3C 5D5MB 4ALAC 3MOAL 2XV0A 5EO0A 2EE6A 1RZIA 5T5FH 4X6DA 5BVPL 1KTDA 2BOLA 5I82A 4KZEL 5EOCJ 3DA0A 1FL6A 1H3PL 4K23L 3IB4A 4A63A 5B3JE 2R29A 2F0CA 4IEFA 3UACA 3US0A 2H1PL 3OJVC 2QV4A 3MAWA 1YEEH 1S7XA 3HG4A 3O4OC 2EVJA 3ZT7A 5IQMA 1P4IL 1KJVA 4N85A 3X17A 3JV4B 5JDSA 4C4KO 1HQ4A 5L7XL 3O3EB 5KUMA 1CZ8L 2XOTA 4Z76B 1XL4A 1KT2B 4LNRB 3S37X 4HS6A 4WNSA 5TF1H 4TM9A 4LCCB 1JZDC 2OMVB 3DMMC 3KWUA 1OWWA 3F6IA 4JVUA 3WUWG 3KLKA 3LYRA 5BS0B 2R2BB 3LN5B 4Z7WF 2BM3A 3L4TA 1G7IB 4N2IA 4WFHD 1CBVL 2AJXL 4R7DB 2BK8A 2Q3ZA 1NBVH 2FYYB 3FOLA 4OLVH 3FU9A 4I18B 3TH2T 4KITB 4FJYA 2IV8A 1IVTA 3L3OA 2BO0A 5D93B 2HN7B 3HAEB 1XZ0A 2AABH 5DO8A 4OUUB 3TJPA 4BKLA 3ZK0A 5B1JA 4GQ9L 1RK0B 3Q48A 5BVPH 1MJUL 2WN2A 2IH1B 2BNUB 4XWGL 3J8F7 1MFAH 3UH8A 4BQ8A 2Y1ZA 1YYLH 3GI8L 1JIBA 3BJLA 3GYRA 3RY6C 4LB8A 3GT6A 5IJKA 4PWJA 4F8TA 2VDLH 1Q94A 1G9NH 1J88A 1AD9B 1MG2C 3QJQB 2VR6A 1VADB 4ODVH 2BJML 2AVGA 5IQLA 1FZJB 3BPLB 4WO0A 2FDBP 3GRWA 4JM4L 2WK2A 4PJEB 4P2QD 1S9WA 1MFBL 2CKNA 2QDWA 5JR1H 3AY2A 4HAGA 1IGFL 3B4NA 3NSXA 3SGKC 3STLB 3TO2B 1BQHA 3FS9A 4Z3FA 5D7LA 3LKRA 5D1XC 1JZFA 3QORD 3GJFH 3ASNB 1DDHB 3ALWA 3EJUA 4LRNL 5HYIA 3RUGA 5TE4L 1FRGL 2O6CA 1DSFL 2FJHB 1WFIA 3R19A 1ET7A 4QTIL 5JHAA 4U2YA 4LHJB 1J8HD 1VFAB 5I6LA 4G1MB 4FQXB 1FZKA 2X12A 2Y9RT 4YFLF 3CSFA 1SBSL 3KZ8A 5BS0E 1J9SA 4YE4H 3FQUA 3HMWH 3LNIA 3IBEA 1FORL 2P52A 4K73A 1GAFL 2N4IA 3NACL 3UPAA 3CHPA 5SX4I 3U4BL 3AJ7A 3HN8A 1GCYA 4ZUVB 3B43A 2KZWA 2C3WA 3Q1SL 4TNGA 4CBPA 3GTNA 4J3OG 2Y7NA 2D3VA 5IJDC 4UIMA 4OCLC 5D5MF 4PUBH 4KNQA 1M6UA 1N6QL 1ZDQA 1FGNL 2GPZA 3OXSA 1URLA 4GIAA 4WUUA 2IH8A 2H32A 1FI8C 2KL6A 3CFMA 2G5BB 3AQDA 4HKXA 5MEOA 3LH9A 3GXTA 4QI3A 3V5KB 3DOIA 4HS3A 1WEJL 5D1ZI 3SGKA 3VXUD 1H3WM 3FT2B 3HNTH 2DMBA 1UH2A 1WUNT 3BX7C 4X7SH 4Y4KD 5FUOH 3SKNA 3MLRH 2PW1A 2IAMD 5I23A 3UC0H 4LOUC 3SDXB 3W9EB 1MNUH 4CU6A 4Z3EA 3B5HA 4OJAA 4Z6AT 2IADA 1H0DA 2KYIA 1K3ZA 1GJIA 4A7GF 5KZCD 2FSEA 4RAUB 3RVTD 3SDDC 2EH7L 4U1SB 1J05A 2W81C 2AW2A 4F7CB 4DP7X 5I2IB 4J3OH 5EORH 3T08A 5GS0C 5CJQL 4XBEL 4ZFOB 2Q86A 2VB5A 4F7MA 4EIGB 3MTRA 1JNNH 2J8UF 1BVZA 4F58H 3QNXA 4EPSA 3VFRB 3H3BC 2HT3C 6FABL 3MYJB 1AE6L 4JFDD 1S3KL 5EBWB 4MJIB 3ZKMC 4Y19A 3L81A 1EDQA 1NGWA 2NY5C 3K8LA 1F3RB 4KRLB 3SOBH 5EF3A 4TQPA 3GPEA 2APFA 1AO7B 1MUJA 2EDHA 3CDYA 3NJNA 4BM7A 2ZWLT 1NCHA 1IGTB 3KNBB 1A5FL 5SWQB 4LSVH 4PJIE 2ZPKH 3DROB 3QRBA 2BP5M 3FQXA 4FXTA 1JN6B 1UD2A 5MEQB 3B2XA 4M1DH 2X4RA 4FNPA 1LEGB 4XNAA 1A2YA 2A6IA 4P48A 2FUTA 3LPGA 1FA4A 1LP9F 1NGYB 3NTCH 3FYIB 5FM5M 2DY2A 5FB8A 1MCWM 3GMNB 1UKTA 4JX0A 3RUGF 3CN1A 1GYWA 3C87A 3BVXA 4I0CC 3RGHA 4BCYA 3CCHB 4MD5B 2NXZB 4PLNC 3NEXA 4UDTB 3K91A 4RGOH 3MV01 1PAMA 4O2CA 3ROOB 1KIUB 5CJBA 1MDAA 4FYRA 3TGXA 3CZFB 4V1DD 1NC2B 4XX1E 2XWBA 3G6JA 4LOVA 3S3JA 1JOIA 3NRPA 4GMTH 1S3KH 3GXMA 4FFYA 3TPKA 2YBGA 3FCSB 4HKBB 1TJIH 4Z3IA 1YPZE 4PRHA 5FM8A 4ERSL 5BNXD 3BE1H 1T0NA 1TZGH 2EIZA 4WK2B 5AOJA 1I8MA 1U8CB 3H54A 1UH4A 3U79A 4BZ1L 2QSQA 5I8CA 1P2CA 1TTGA 2ADIA 2X4TB 3I6GB 3ZTEA 5IFJA 4Y9FA 2PCFA 1LDPL 5ID0B 1VF5C 3EO0A 4PCKA 1LQSR 1NZRA 4OIFA 3HI5H 4MMZB 4AYID 3JVGC 3UJIL 2XHNA 4OF3A 2D8KA 3NP3A 3CLFL 3MLWH 3U7YL 3CQFA 3MNVB 3GUTB 1E65A 2BS9A 1CD9B 1NKGA 4JGMA 4TYUA 1ORQB 3NTCL 4DN4H 5JHBA 2GSGA 3ETBF 3NGBB 2WB1A 1TF4A 2XNAB 1XO8A 3QCVH 3BT2L 4PJ5A 2BC4A 1R3HB 4JCMA 1GC1L 2UWEF 4J2XA 2IMNA 4OFQA 3HR6A 2J12B 2FGWL 4MDRA 1KV7A 2ZIDA 5EZPA 3VFVA 2QADD 4X6BB 3IF1B 3T0EB 3F58L 4EKJA 1I4FA 2EAEA 1BZ9A 2GFBA 4LSUL 3F7VB 4K3JL 2B15A 1MFVA 1LJMA 2DD8L 2CLRB 4XVJH 1MCKA 2UVEA 3KPSE 5GISH 4AYEC 3EJYD 2ZCKL 4X9FA 1OVZA 4DK5A 4YC2C 4RMTA 3K81A 2G3MA 3DBXA 5I71B 1SN0A 2XZQL 5KYWA 4GEJA 1TETL 4WAFA 2XJKA 3ARPA 2AHIA 2JKWA 5D2NB 4F8OA 4HCRA 1B9KA 1SY6A 2ZXGA 5F2FA 4DKEH 3QZWB 1WWCA 1MCBA 1OP3H 1PG7L 3ZDYF 1AQKH 1DJIA 4ZUUB 1BZQK 3MRKA 3WFEL 1N4XL 1L3NA 2NXYB 4OLYH 1AGFB 1AQHA 1HH9A 2WXNA 5GRVK 2OMZB 3PL6B 3QQDA 4Y9EA 4DN4L 4H4NA 1RUKL 2XTJD 3QCVL 3BT2H 4G9FB 4TNEA 2HA1A 1ACCA 1NMCB 3KLQA 3PWPD 2F54A 5J56B 1HI6B 3GI9L 4TTDC 5TDPB 4B7LA 5DS2A 5ACZB 4JPSA 2F18A 3CPLB 4YPGB 3RAJH 3D39E 1P69B 4ISVB 3Q7JA 1K5WA 1OAKL 3RWFA 3P2TA 1OPOA 5IMLB 5ID1A 4PH8A 4I77H 4TF4A 4Z7NB 2H1PH 1A4KA 4XXCC 3AROA 4XN1A 3MCLL 3QBTB 4F92B 1Y1UA 2EH8H 4KNTA 3T3PB 1MHEB 4FF9A 4XAKD 2VXTH 2OMUB 1JPSH 2R7EA 5BUAA 4ZPTB 4NKOA 1IEBB 1DQDL 3GSXB 3APMA 5F7AA 3CFKA 5I8KL 3ULVL 3T0VA 4GAGL 2J88H 3H9SA 4UBDC 5IB3A 2OX5B 3CFIC 3GM8A 3V9CA 4FLHA 3DARA 4MCZA 4UT6H 3IDYB 5DMGD 4BSVB 1CDHA 3FN9A 3OKYA 2MMXA 5JYMA 4OT1H 4AV0A 2WHVA 4A6YB 3TNNB 4OZGA 5TFSH 4S1QL 1HCFX 1L0QA 1U3HA 5FV1L 3SIKA 3WLWD 1OQXA 4C83A 2FGZA 4NI6A 1CL7I 3IPFA 5KS9A 3BOVA 2D2OA 1GXEA 2AXFA 5FUCC 1RK7A 2CPCA 3D2TA 2FH6A 5K1VA 1L9PA 4S1DC 1RIVH 2ENPA 2WLKA 5IFHH 3P9LA 1NGWB 1A4KB 1E40A 3DX7A 4AQ1C 4GBXC 4P2QA 2H2PD 5ICUA 4AJVA 2QMKA 1I9RH 2BHFA 3CAFA 1X5ZA 2F58L 3SPCA 4ZMTA 1ZVSA 3RL1A 1VESA 2QVIA 4HDIA 3WU1A 4NQCA 3HNVH 2MRYA 1IU1A 4WEBH 1H3PH 4CUCA 3TYFA 1HZHL 5D7JD 4WKXA 2J55A 4AQEA 5D70H 4ONOA 2QHLA 2QQKH 4XI5D 5ETUA 3EJQA 2YPLB 1BSIA 4NUMA 4IJ3B 3ZVVA 4I8DA 1COBA 3DTXB 1XCWA 4X0NA 4PJDA 3J2PA 2VDOH 3IKKA 3WFCH 2X41A 3TU6A 3BZ5A 4ODHH 1AZNA 1AFVH 1UC6A 5BOPA 4L3CB 4NERA 4C4BA 1XGUB 4NQDE 2BNQE 4TLUA 8FABA 3WXVL 2HFEB 5AW7B 3V5DB 4EAEA 1NBCA 3MODL 3X12A 4EXPX 1C5BL 1E3XA 3UJJL 4YHPB 2AJXH 1CXEA 4TQHA 2DKUA 3S37L 4FXKA 1MXGA 3HMXA 4D3CL 4S0HA 3Q06A 3NRQA 3NABL 2Z91A 1T1ZB 1FSKB 4FHBD 4BFNA 1J8KA 2XKSA 1MHHB 3WEBA 2RGSA 5L2JA 2PYEE 4GP5B 4ORGB 1HAUA 4XPHL 3Q6FA 2Z1PA 1Q72H 1SJHA 5HY9B 4QPEA 1VCAA 1KEML 4L8BA 2UWEE 2JKJA 2P9RA 5D1ZD 2OMXA 3VQ2C 1P4BH 4JG9A 1VJSA 3DRQB 3TOPA 3MNVA 3GJEB 5I76A 4XZUA 5E2VL 5EZIL 1IAKA 2FJUB 1EXUB 2J5LC 2OP4L 5F93C 4PJDE 3VRLF 2FNWA 4RGNC 5KSBA 2HJLA 5FW8A 3ZRCC 5I6KA 3GMOA 4NUJA 2ROXA 5ITFB 3VJ6A 3I6GA 5EEWA 2CIIB 3T09A 5LGHH 1X9RA 1EZUA 4HOXA 1E27A 2DTSA 4KDWA 4PV8B 3L5IA 1J8SA 5EU6E 4M9OA 1ETJA 5DJ8A 1P84K 2RACA 5JIKA 3S8WA 4Y4FB 2B4CL 4UTCA 1MFDL 3GMQB 5J8OA 3KR3L 5IEHA 1MPAL 5C0AD 3ZKXC 3MI6A 5E94A 2IFFH 1ND0A 3WEAA 3Q43A 2Y36L 4ZMYA 3PF2A 1YNKH 5JYLA 2XQYK 2FJFA 2WWKT 4D0BB 3H4HA 2RCSH 1A9VA 4FFYL 1SOXA 2BHUA 1A2YB 2A6IB 2HX8A 4LU5L 1BECA 4Z9KB 2HN7A 2ICWJ 3HAEA 3S5LA 3UL4A 2GIYA 2LAAA 3BDBA 1G6RL 1Q1JH 3IJSB 4XCEB 5E1QA 3MLUL 4FMKA 3RTLA 1RURL 2E9GA 4WHCA 1NMAL 3B2UC 2QVKA 2VSKB 4EZJA 2F8OA 1H8LA 1PQZA 3C8KA 4F9PA 3RVUC 4Y2LA 4CL7A 1IGTA 2R59A 4G43B 5ES4B 4PPTA 4UOQA 4Q8BA 2PTTA 4M7ZB 4AEFA 4JFEB 3UMTA 1KEGH 5LB1A 2WC7A 1LLAA 4U49A 1O7VA 2Z31D 1UD6A 2RALA 4PV1C 1THAA 4J1UA 3Q6GL 4FHJA 4RAVA 4CC4C 4L2YA 3ARUA 4QF1A 4LCWE 4Z7OF 4ZS6D 2A73B 3MRMB 1B0GB 2FWOB 5I18H 4PS8A 4CVZA 2EDLA 2ZXDA 1UT9A 3SQRA 2XG4A 3VGGA 2F5BH 3U6RA 1YNTF 2UYLA 1WZLA 4NQVA 3I02B 1MNNA 3RWEA 5FV2A 4IRSB 1A6VL 4NN5C 1EV2E 1GTFA 1CTNA 1OCCB 2IDUA 4X6DB 4B9ZA 4DP9X 3F2LA 5DFAA 4JZOB 1OCZB 2DIBA 4H13C 3MLPA 4GSQA 4JFYA 2Z8WC 1A9EB 2V7HB 4DO5A 1RURH 1L5GB 2AV1A 3LXUX 2FIKA 3ZGIA 3U0PA 3OZ9L 2OFQA 4KK5C 4DPCX 1ZV2A 1DDTA 5J06A 2IWKA 3GIZL 4QCIA 2X4NB 1P1VA 1HOEA 2Z0UA 3BZFB 3FONB 3LV3A 2H45A 3MO1A 1N59B 4IU2B 3OKDA 2ZXBA 4DOHE 4BFIB 1OGAE 3NFSH 1KC5L 2D7MA 3P0YH 2XPZA 1T6WA 3HHSB 2E7MA 2IC2A 3O2DL 4YDJB 2AJUL 2L0DA 4AT6A 5DQJB 5KVFL 5F7UA 3BEVA 4RGNB 4WWKD 1MCOH 1UWEL 2PR4L 5G5DB 1ETZB 1NGZA 5J11B 4PW4A 4XC3L 4L8SB 4LSUH 1UUNA 2F1EA 2AKRA 4R3SB 4KOCA 4WFGE 3OKLA 4NFDA 1U2YA 4HOWA 1IAKB 3TBCA 3BIBX 1HYSC 1NIEA 5D9SA 5KTEL 2YFOA 1R3KA 1E4KA 2IPTL 4DKFL 3U0TA 2DQIH 4IM8A 4CSTA 1L9RA 4UQIM 1H8NA 1V54B 4FE9A 4YIQB 3Q9QA 2FR4B 4H25A 1NL0L 3ULSA 3B9AA 4NUPA 2ATPA 2CRIA 4PRPD 5I1IH 3QDMB 1T21B 4KKQA 2NX5D 1L6PA 1PGRB 2BZDA 2XWDA 5IHUH 4BIKA 2WKGA 4A68A 2WLJA 3VFUB 3WMQA 1TZGL 3UBXI 4EDXB 4YJZL 3CVCA 4JZJC 1BQHB 4BZ1H 3CDZA 5E2TL 2O6PA 3PDOA 3FT1A 4H1LB 1D7FA 3QB7C 3R8QA 2IALA 5E5UB 1S9WB 1CGYA 4LIQH 1OY3B 3PE9A 3KL0A 3MRLA 2B1HH 5FO7A 5AD0B 3L5HA 1W6WA 2DLFL 2FNBA 3T2NH 4KU1A 3UZEC 3BKJH 4G7YL 5HI4C 4WI3A 3KE0A 1GH7A 1V27A 2ZX8A 3UG5A 4NJAL 4AH2A 2YQ2A 4TV3A 3DSFL 2VN6A 4RZCB 2M1KA 3QRFM 4ZOAA 2YWZA 3EZJB 3S6CA 2IPTH 2EDKA 4AV4A 3IPBA 1X5HA 2BIMA 4AX3A 3RI5K 5KSBE 5A3IC 4I0KA 1RZKC 2BCMA 3QJFA 4K15A 2EC9T 3C5SA 1U8IB 2E75C 3DVFA 5J1SC 2L7EA 4JDTL 3PV6B 5IUCA 5DU7A 2BFGA 5SWZD 5DWPA 1BCIA 1W9XA 1A8ZA 3NZUA 4YFLI 1S7SA 4IGBA 4LSQH 2AK4A 2CO3A 4D9RE 1TLKA 4KTDL 4OT1L 1RZJC 3D85B 3FNKA 1ZLUH 1HE8A 5F7WC 4HUNB 2MOGA 3CMOH 1XH2A 2WBXA 4NGHH 4WJG3 5GS0L 2WKLA 4XVTL 3MGTA 4JQIH 4YXHH 4KZDL 3C12A 3MV7E 3BAYA 3GKWL 4P06A 4AUYA 3D39A 2NNAA 4Z7WE 4OCMC 1TUPA 1AQKL 3HHSA 3B6SA 3UBGA 1E4WL 2R0LH 2EO9A 3K74B 4YDNA 3OGCB 3MLZH 5KBPA 1QBAA 2Q6WB 2Q87A 3V8CA 2FHCA 3JVFC 1UH3A 1DBAH 3FO2B 4JUSA 3RU8H 3FBKA 4LEEA 4YWGH 3MA9H 4LLMB 1QBML 5D7JA 5GJSH 3NJHA 4IK6A 1ZA3A 1XH3A 4FNUA 4XNZB 2N01B 1DCLA 1RUAL 4HSAC 4YH6A 1F4HA 1N8ZB 2XBZA 1OAKH 4J6RH 3HRZA 3WL9A 3FQRB 3WNIA 4H88H 4HK0A 1N5AB 2VYRE 4EXKA 4PCYA 3SJVD 1OL0A 5BQ7B 3II1A 4BQCA 1RZGA 2DQCL 3QFDA 3VI3A 3SPGA 4MDIA 1G7LA 3RGBA 2FATH 5EBLB 3V0WL 1PZSA 2X88A 4AL8H 1MRFH 2PNDA 3BKYL 5T1KA 5I8KH 5B7MA 2YR3A 4ODHL 2XTJE 4X6CA 1T83C 1R75A 2NUTA 4Z7VF 3MV7A 1YNTA 3X13A 2FWOA 2H5UA 2LVEA 4WV1A 2PF6A 1Q1PA 4H8WH 5KYYA 3RNQA 1KJ2L 4EI5C 2WNXA 3TP4A 2IG2L 4P57A 4R7LA 2WQ8A 3X11A 3GD1C 4JLRA 4J3VA 4XNQA 3GGWA 3HLAA 3E6FB 4ZAKA 2WTPA 4MSWB 4NZFA 5L4MA 4XP6L 4H20L 1WGVA 3ATBA 4HIJB 4ICWA 1ZLWK 1ACYL 4FOMA 2J4WH 2KPNA 1NGPL 4GKNA 1KJMA 4M61B 2H3XC 2O6FA 4RH4A 1T4KA 1EEZA 4IOSD 1VAHA 3OJDA 5HYJD 4JZNB 2Q2LA 2ZJSH 5DJ6A 3QDGE 2NY1D 1I1AD 1MW1A 3ULUH 4DVRH 4P5KB 3AS2A 4L4TE 3P69A 2EEXA 4X7TA 1LD9A 4M62L 3KD4A 3ZZSA 1ZS2A 4FQIL 4U1HB 3M6DA 3CDCA 2HVJA 1AACA 3GJFB 2E59A 2QQQA 1XD1A 3GSRB 2X70B 1BD2B 3QI9A 2FZ3A 1GC1C 3ARDA 5CU5A 4XB7A 5D70L 4G8GE 5B39B 3FU3A 1D9KD 3LPPA 3ZN6A 3ABKB 5C0CE 3V6FB 1BFOA 3PIQA 4P2AA 3HG0A 3FO1A 1DSWA 5KVEL 4MMZA 4E9XA 3RZCA 4NM4H 4N1EA 3SBRA 4JPIA 5BOJA 4XWOC 5IFAH 5ELIA 4WI2A 1T3FA 2I9TA 5ESVA 2HSIA 3GMMA 4YDIL 4MASA 4UQEA 1FCCA 3CVIL 3LXCA 3R0NA 2Y3AA 1QLEH 2ZKMX 1T6BX 2DWTA 4HBQA 3ABLB 3FO1B 1ORSA 5B22A 3S37H 5FM4A 3G5VA 2HJKA 5DRNB 5ALBH 2OMXB 1A0QH 5EBMB 4PFEA 5A16B 1DN0B 1S7TB 2C8NA 4FDWA 2J8UA 4BFGA 3NGBC 4K9EH 4MNQA 2B16A 4PJ7E 1X7QA 1DJSA 4LRNH 3WEMA 5IHLB 1WFJA 5E99H 1JK8A 5DUBB 2NCMA 4R97B 2UWEB 1DSFH 2HVJB 1D5MA 2OTUA 1J12A 2FX8H 3NIDE 4KROC 4N9GA 3ZE0E 2BDNL 4ODWB 4R7NB 4A66A 4LHQB 1AOHA 5K33A 5DVPA 3HJ0A 4PI0A 1EO5A 2YZ1A 2MWCA 4A6YL 4K3HA 2XETA 1KYOK 5I8OH 2ZYRA 1FL3A 2Z4QA 3KPPB 3MLVL 3WLBA 4Z7WB 1D7BA 1E9QB 2H2PC 4PJAA 2V9UA 4YC2B 1FYTD 3T04D 1TVHB 1NA8A 4CNIA 3D07A 3QQ3A 4PD4K 2QL1A 5I9QB 4S1DD 2J73A 4X99A 3OMIB 3OLDA 3PWLA 1A47A 4YDIH 3KNBA 2APWA 4JFPB 5TH2B 4PSRA 1QI3A 3FAXA 3HB3B 5F6HI 3GXIA 1UASA 3II2A 4ZT1A 1HWWA 4MMXB 3RA7L 1KYDA 2Z4TA 4ZQTA 1AXSB 1URZA 5JLZB 1FGVH 2YWYA 3QZNA 3PWUB 3UPCA 2CSPA 3N6YA 3HC4L 5J13B 1MY7A 1MPAH 1A4JA 1YJDL 1LO2L 1ZHLA 1IAIM 1YNTB 5KW9H 1T5WA 4EI6A 1OGTB 2CO4A 1ZT4B 1GIGH 3AC0A 3ARYA 2ZAIA 3OZ9H 5E4EC 5AAWC 5TDOA 1JPTL 2CO7A 3L3JA 5F9WB 1I82A 5JHDD 1OSYA 1EERB 4XNBA 1YY9C 1T1YB 1KCVL 2D73A 3ZYOA 1ZA6A 1QZ1A 3WJMB 3NQKA 3MUHL 4FADA 5CN1A 2O5XH 1JXDA 1W0YT 4JO3H 1OAXL 3HB3C 3KPSB 3RPIA 2X28A 4CILA 4Z77A 3AG4B 2VLJE 5G55A 3OX8B 1TOXA 1KGWA 1M7XA 1JNNL 2VMCA 5D7JC 2EE0A 1MFMA 5J13C 3LRLA 3W82A 2BSRB 3UTSD 4EDWL 2E8ZA 2JSFA 3RJDA 4YLBA 1JGEA 1I3RA 2JK5A 3T3ME 2Y7QB 3ZYZA 1UOKA 5IB3B 3QZPA 1KIPB 1L9OA 2IGTA 5HHNA 4ZTOL 1ODUA 1PX4A 4WI0B 3CHRA 2QHRL 3CFKB 3QDJA 4HX1B 1NLDH 2ZSWB 4DERA 4XP1H 4XGZA 3GMRA 3ZTJH 1AQDA 4JJHA 1DBJL 2CJ3A 2XT1B 3RZCD 2J6EH 1RUPL 3FN0L 1ES0A 3LD8B 3MRBA 4UIMB 2I5YL 2ZG1A 4AGLA 1Q9OA 5EU6B 4M00A 3HZYA 4L9LA 1AHWA 2VW7A 3BIKB 4OD1L 2DYPB 2EXSA 2W0FB 3E1F1 4ZX4A 1NC4A 2VO8A 3KXFB 4WUUD 1GZQB 1L3WA 3LKQB 5HGGS 4AQ1B 3IRCA 2FJGA 4ZMXA 5LXGL 3EJYC 3Q8CA 4S2SB 5T5NG 4ODXB 4Z7NE 2F54B 1CF8L 1VEMA 1JYWA 4UM9B 3GNML 2VLMD 2NXYC 4UYQA 3DKHA 4MBRA 3GHBL 3PL6A 1X5MA 2R1WA 2V5MA 3JZ7A 3MBXL 4W9ZA 5EN2A 1BVKB 2Q76B 3LN4A 4DCQA 4X5QA 4KK9D 4YSSA 2DS4A 4AVKA 1U93A 4LRIC 2H4EA 2VN7A 2VLKA 5E6SB 3MPCA 2A3TA 5DHVB 4XVSH 2PWEA 2PR4H 3BE1L 3VB8A 3N0PB 5AOIA 3RTQA 5DK0A 3P73A 1KBGH 1T2XA 3STBA 1IILE 1WD8A 4FKKA 2AK4D 1BD2A 4XE5B 1F4WL 4XZ4A 1NCNA 4JS7A 2C7FA 4UTAL 4MS8C 4NXSA 2F7RA 5DJAA 4I1NB 4ODBD 2ERJB 4X6EA 3U1PA 4JRYE 1YPZB 1UJ3A 4XP9H 5K39B 3FB8B 1HC1A 3GSNH 1UZ8B 5ANMB 5BRZD 2Y06H 1NL0H 4MBOA 5IVZB 4P9HH 4QR7A 2BIHA 2IEPA 1H8SA 1AS6A 4JMNA 4Y19D 5KVGE 3T0EA 5AVQB 5C0GA 1GYAA 5HDQH 3WNJA 2QVTA 2Y72A 4BFBD 5DZPA 5HHQB 4UB0L 2Y7MA 3O4LB 4M5YL 1W8OA 3GIVB 4QRQA 3FHAA 4WU7B 1I1AB 5AOKA 1MCPL 3QWOB 1UXLA 5DHEA 1QPKA 2WOBA 2UX7A 2XBTA 1P9MA 1YEWA 2R69H 2JI2A 1I1YB 5GS2H 1N0LA 5DHYB 3VYOA 4QHNB 5HYJB 3FQYA 2CUIA 4HSQA 2COQA 2YD6A 4X4YB 1EUTA 2YA2A 3X13B 4N0RA 5AYTA 1QNIA 3A4DA 2W9LA 4U6XA 3TEUA 1KJVB 1PY9A 3MV9E 1KBBA 2EIZB 3FH8A 5CEYA 4ZUSA 2QLVB 2VDMB 4U0RB 4HCFA 2A6DA 3KBEA 3QEQE 3MLTA 1XGRB 5HD8C 3H2PA 4KO7A 5B4MD 4G5ZH 4AL8L 4LKCA 2CLZB 3ROOA 4B3EA 4B9YA 4L8CA 3DGDA 3SGDH 2V7HA 1RZ7H 2OCFD 2V3EA 3FQNB 4DN3L 3EFOB 3FTZA 4PW9A 4YXLH 1U8JB 1NAKL 4YZFF 1H9DA 2E9WA 4S0SD 4HFUL 1CICA 1YMMA 4LSQL 1U33A 4LLMA 1S2EA 2QT6A 4KTEL 2HFGL 4U3SB 1YN6A 2IQ9H 2XV3A 5D6CB 3R4RA 3SGDI 2VRQA 1TTCA 2XZCL 4YEFA 4LPVA 3EYSL 5GRUL 3GSVB 3SYCA 1HSAA 1AQMA 1XB3A 5I1JL 3MOAH 1TQTA 2CR3A 2XG4B 3I6LD 3D39B 4MD0B 3TA3B 1IRAY 3E2HC 5IJBC 4DK6A 4KUCF 2RTTA 1ZSHA 4U3XA 1I7UA 2VQ1B 3BN3B 4J3UA 4K07A 4GAGH 1CE1L 4ZSOE 1GSMA 5EV7A 2BOBB 1WAEA 2UUDH 4HAKA 4X8JA 1WGOA 2WSKA 2CKBA 1S8DA 4G42B 4DJMA 4FQ2H 1BFVL 3PXHA 1FFPB 3PHOB 1FNFA 3EYOB 3HVDA 4DSYA 1EZVX 1A3RL 1PDKB 4NIYE 4U4IA 2G60L 4L0PB 4Y9GA 4PTUA 5DZ9A 3PWPE 5DGRA 1MWOA 3PV7A 5C08E 3RTQD 5FGSA 1YMHB 3NAAL 3C09C 4G6ML 1T1WA 4BELD 3UTSB 3TESA 4JUTA 4YSRA 2AXJA 2JCCF 5IFHL 2OXHB 3U6XS 1ESOA 1N64H 1T89C 3IGAB 5EN3A 3ZTNL 2JJSC 1LQBC 5LCVH 3DMMB 3B8SA 3EYSH 4LLWA 4ZQKA 2BY3A 1HTYA 1CGSH 1XF4A 4BEIA 4E68A 1PF3A 4LF3A 4EN3D 2B59B 4HGWB 5TQ2H 4KGLA 2X6AA 4QD2E 1AKJB 1N6QH 4K7FB 3KHOA 4Y4FA 1PLGH 3WFHB 2ADGA 4WUKH 2HT3D 3QNZA 3FU0A 5D93C 1PSKL 3MMEA 5JOFB 4N2OA 4N24A 3HNTL 4X7SL 1B4JL 2JI3A 3FSZA 4HWNA 4WUUB 2X2IA 1ID5I 1NKOA 5F7KC 2BIIA 1AGBA 3D87B 1T89A 4FNRA 2WQXA 5FXCH 3UYPA 2VIRA 3WFCL 1J0KA 4YHYC 3TURA 2OZ4L 1AFVL 4XXDB 3CZUB 1V05A 5I74C 3VO0A 3F5WA 1GMIA 3ULSB 5C0CA 3GSQA 3L48A 1KNOB 3TBWB 4BH7A 4XZUB 1N3NB 4J5VA 2P8PA 3D5OF 4FA6A 1E9PB 3FRPG 4L5FH 5CLZA 3WXWL 1EHXA 3HHRB 1CXIA 2FJSA 2IANB 2RJMA 5D9SB 5DQ9B 2ITEA 1Z3GH 3HCVA 4NWUL 4M7ZC 3UGUA 4ZJ9A 1J5HA 5EU6A 2AKRB 3NABH 1E30A 2I69A 5FYJU 1V7ML 1VDGA 4FLQA 2NYZA 1N18A 3LKSB 5TQ2L 4D9LL 5FX3A 5I19H 3PGFH 5SWSD 1TEYA 2ZG2A 1Z66A 1TCRB 3OG4B 1MW3A 2EDOA 4FQ1H 4HLZG 4IJTA 4L0YA 1E8XA 5JOFA 1HCZA 3STLA 1TZIA 3GSVA 3ZKSD 3PPEA 4B5ZA 5KANI 1F1DA 2PYEB 4LPXA 1L9QA 4TSCL 5CXPA 4EE2A 1FGNH 5MEND 3T3PE 3MRHB 1ED3A 4X4KA 4DP1X 1E2ZA 3ORJA 1O6TA 1XZWA 5FYKH 4OCRH 1WH0A 2L7QA 3ERXA 2C7UB 4GI9A 4E9TA 4PLOB 4TRPL 3AMKA 4YXKL 5A6LA 3LNDA 4X5WA 3Q05A 3UTSA 3KLLA 3TYFB 2JQMA 5DEGB 4Y5YC 1KTCA 2C1PA 3B2PA 3L3OB 3WE6A 2CRMA 4APQB 4G7SB 4LLYB 1JGVH 1F00I 1PDKA 4I2XB 4I3GA 1L4IA 3M7OA 3RVXD 3S3BB 4UNTA 1WS8A 1IM9B 1RUQH 4MYPA 4KV5F 4FABL 4CMMA 2PP9A 4NQCD 4QF1B 4XT1C 5CR8A 4PJGA 4QRAA 5DK2B 2WUCH 3VDAA 3QCUL 2AV7B 4OLWL 4P23D 5ICZA 2G0LA 4K55A 5HDRA 5T1MB 4ZTOH 3BAIA 3EH2A 1VENA 4C59B 4HS8L 4QHLA 5F3FA 1NLDL 4JREB 5I1HH 4C83B 4G8GB 1VPOH 4JFHD 3I84A 2VN4A 5IP4A 3ARBA 4JDEA 4MB1A 4PWGA 1R0AH 3AT8A 4OZGB 2XWEA 1NPUA 4N68A 3BPOB 3TCLB 1NIBA 3EO1A 1L0YA 4X5XA 3MN8A 3O4OB 4WHDA 3CFBB 2XQBH 1JF1A 4U3SA 2I7SA 2HJFA 3KL5A 3L2LA 4NQDB 4KK6C 3DNKA 2DQHL 5FYKE 2YRZA 4MDJB 2CDGB 3IVKB 4KKAD 2NSQA 5EWIL 3N85L 2QSTA 4FXKC 5MI0C 4B27A 5AUMB 2CNZA 3DETC 3KPOB 4GAFB 3O45A 4X6EB 1VGKA 2PCPB 1JTPA 5IEHB 3MBXH 4M8UA 4ES8A 1M7IB 5GZNC 1MSPA 4WWPA 5CZVL 5IMLA 4W9EC 5LO7A 2AK1L 3K6SA 1UVQA 3NFNA 5BW7C 2F53D 2EUVA 4NM8H 1QFUH 2LT9A 4AZUA 1CN4A 3MXVH 1HOCA 1WWWX 3FO0L 3LHPL 2CHWA 3VXOA 1CGVA 5E8EA 1D2PA 3EKCA 4O9HL 2ZAGA 4H0GA 5I0ZA 2RH0A 1MRDL 1U30A 1WFNA 4Z18A 3RJOA 3SJVB 2MSPA 4L3AA 2YSSA 1EJOH 4N6RA 3V4VH 4ODXA 3VD9A 3QJZA 3GS7A 1DJZA 1GZQA 3LKQA 4WQOA 2ZUYA 3A6OA 5B4MC 5C3LD 1HCVA 4FL4B 5HD8D 1RHHA 3VDCA 4Y5VC 4N28A 3VD1A 5EWIH 4MJHA 4QT5B 3PAYA 1AHWC 3JTTA 2ITCA 5I1GH 4PB0H 1EAQA 1FLRL 1X4ZA 3GJFA 5AFAA 2JV6A 5FKAA 3PWPA 4OD2A 4LAQH 4Q9BA 3SDCB 1NCUA 2Z91B 1L7TH 4OCWL 3VWJC 2VLKE 5IGXH 1MCPH 1J87A 2Y5TA 2Y7SA 3EYVB 5E5RB 5JIPA 1FUNA 1TCMA 4KI5D 3RWCB 2OK0H 2R0ZH 1BMZA 4PJBE 2CCLA 4LOFA 2YPKA 1OO2A 4MMZC 2OMNA 1CLVA 1NBZB 2IGFL 2J1WA 4LGRB 5CZXC 3RVXC 3TEZA 3X3FL 3TO4C 4GT7A 1SXAA 2BRRL 2Z31A 5ESQA 4OIBA 4WGKA 1E2WA 3IDXL 4N90E 3JV6B 3L9RA 1RJZA 4HC1A 1P4UA 5E9DD 2V8MA 4P49A 3VXMB 3DUSB 4JRYA 1JGDA 4NSKB 1EO8H 1QQDB 1QRND 1IM3D 2J88L 1S78D 1GR7A 5I1DB 4QHLB 3C6LD 3DO3A 5E6IC 4LFHG 4NOFA 4XXWA 5AL0A 1AO7D 4N6RB 3OF6D 1BWWA 2HX7A 2IDCA 3IEAA 4RFOL 4G5ZL 5AG8A 2XN9E 4GKOA 3VXRD 1DCEA 2GI7A 1N2RA 3BSHA 3SPVB 4X7DC 5JW4Q 4ZMOA 4YHIA 4WI6A 3ILPB 4LSDA 4OZGF 2QMJA 3VX1A 4MB4A 4X6CB 1D5BB 5E2JA 5AKTA 4OFYD 2OMWA 3SQBA 3EAKA 4FD0A 3QXAA 1NGQL 4WWOA 1GGBL 5EA0H 4JM0A 3BSGA 4BSWA 2PYFB 3TJHC 1T22A 4B5EA 2VR4A 3K8KA 3P4MA 3WFBH 2G4GA 2NSMA 4OGYH 1UB6A 4U0QB 3G6JB 1PU0A 4ZAKC 4LHUG 1IE4A 3G9AB 1TMCB 4TLKA 2F58H 1KY6A 5LGJB 1VGKB 1YJDC 2PCPA 5JQ6H 5IESL 3K5SA 1M6OB 3ZUNC 1VSCA 1RQ5A 3IVKA 3UYOD 5CP7A 2UX6A 1QAWA 4B9CA 1UM4L 4G9FD 3MKGA 1WAAF 3MRDA 2X6UA 4HG4J 1EVUA 3B2VH 2DQTL 1P5UA 3T8XB 3V6OE 4XPBH 2IQAB 3AXLA 2Z4QB 1FL3B 1BBDH 4YHOL 1GGYA 1Q0XL 3QXVA 5CCJA 5FWQA 4LGSB 4MS6A 5I9QC 4QGYA 3FU7B 5IMKB 5E70A 3K4ZA 2TSAA 4AG4L 5DVLA 1LE5A 5AOLA 1YEFL 4N0FB 1DR9A 2DWEB 1MI5D 12E8L 3HE6D 1KUMA 3KJ4C 4PJCE 4FTVE 4CMMB 4BSWB 2EC9U 4KRPD 4LT7A 3QHZH 1HYSD 3NIGF 4NZUL 5JPNA 4PJ8C 3SE9L 1I9IH 4HMEA 4XVUD 4ZFZB 2EQDA 1INEL 1JHLL 1BM3H 2CDFB 4Y16B 1E6JL 3N1PC 5AG9A 3KEHA 4KX9A 5HP5A 2IQ9L 5ESVB 2HRLA 2OMZA 3RDJA 3APCA 3H9SE 1CFNB 4M3HA 4AGMA 2ZCLL 1ZVYA 4P3DB 4RFEB 5AVYB 4WTQA 1A1MB 3HIZA 3HZMA 3FT3A 4GXVH 2Y2YA 3BKYH 4PJXF 3B9EA 1HHJA 1MH5B 2VMJA 2OZ4H 2OPCA 4P8QA 4Q4EA 2JQZA 3SDXA 3W9EA 5IROC 1SYVA 3BGFC 4DKTA 4AM0B 2EEFA 5CKAA 1OGAB 1FG2B 4KPHH 2GJZA 4R96A 2ITDA 4MQ7A 4O2EB 3F83A 3AFLA 2GJ6A 4AYFB 1VFUA 1FNLA 3MCG1 5E6IB 3WLBB 5DGQA 5IK3A 3E9UA 4HBCL 5E95B 4IBWA 4ZQKB 4FZ8L 4L5FL 4Y1TA 1NINA 1LK3L 2P45B 5GXBB 2OSWA 2X89D 4XMWA 3CX2A 5AZUA 2W8CA 3K5RA 4OM1L 4L1HA 2D4FA 1M42A 3CC1A 5EOCL 4AGOA 4KTYA 1T21A 1XDTT 3PJLA 4J12A 3EJRA 1NJ9B 2X4SB 4H25B 1ZRUA 5IWLA 3ARFD 5MENA 2FT8A 2H0JA 3SCMB 5BCAA 3MV8E 1VA9A 2GG1A 2E7HA 2EP6A 3VFWA 1TIUA 3OSVA 3ZRFC 1BHGA 3O6FC 3HBQA 4KKCD 4BXSV 2GK0B 1PLGL 5D6DA 4QRUB 1T04A 2H6PB 2HG0A 4J4PC 4JO4L 5MP6L 1OARH 3QIWD 1QKZL 1V7NH 4TNWF 3S8GB 3IXTB 4IOFC 3ZGHA 4ZX6A 4UF7C 3LQZA 4TRPH 3UTPD 1IAIH 1U8MA 2NNXA 2OP4H 1TXKA 3GKZA 3MTXA 4BFIA 3DX6B 4NN6C 1DQIA 1LK3H 1I7RB 2NW2A 2IBZX 2W38A 2ARJB 4IKIA 4W9HC 4F7TB 3EGXB 5LAXB 1KZQA 1GL4B 1CVRA 1LE9B 3E3QE 5IFAL 3U1QA 4CA4A 3X1NA 1Q94B 2NY0B 2XG5B 1SJMA 3TO4D 3ZDWA 2EXTA 4QTFA 4QHUA 3AWGA 2YD1A 3Q2CA 1FORH 3LNEA 2HZHA 4L8DB 5HPMA 4KI5C 1WA0X 3UBXG 4RCAA 5D7JB 4RRPM 1CLZH 4FEMA 2WAQA 1BPVA 4A39A 4MMYA 3VH8B 2FEEL 3OJDB 2EYRA 3V6BR 4IRSA 4JY5L 4NZJA 5F3HA 1FNSH 4IDLA 1T4KB 2EIKB 3J27A 3WO3B 4GKNB 2VMFA 3EDDA 4FFWD 4JHUA 2BDNH 2WZPA 5TDNB 5C0BB 2CKBB 1AZVA 5FW6A 2Y2TA 1J8HE 4XPFH 1RJLA 4Q97A 1JDAA 1IAIL 4TPRL 3M8OL 3LKOB 3QS2A 4P5MB 4E9QA 3S2AA 4IKJA 1SHXA 2ZUWA 4X9YA 1I1AA 2UZXA 2AFNA 3JV4A 4JFZH 5JDSB 1NCWL 1PQZB 4M3JA 5FUZH 5E8PA 4WW1A 4BD4A 1K9TA 3LCYA 3MZGB 4ANKA 1A3ZA 4AEIH 1XCXA 2EYRB 4HIIA 4YL4A 2V2TB 3QIUC 1PYWA 3NCFB 4LBAA 2FO4A 3FXIC 1TSHA 4ZMLA 2NQDA 3HC4H 5GJTL 4RWYL 3GUFA 3PCYA 2YAPA 5E9DE 1ZSDB 1YUHB 3QORA 1T7YA 5E0QA 1BAFL 4OCYH 1ED3B 5E7FA 5KSAD 3OSKA 2CGYA 3N9GL 3NCEB 3CDFA 5ADPL 3MRLB 1T7XA 1AS7A 1EJOL 5BZWB 1K8DB 1BVLA 1WD9A 1AO7E 1UKSA 4TPRH 1WYJA 4JKMA 2NLJB 1MAML 5D1XB 4V33A 4RFNC 3GRWL 2X09A 3INOA 2L7UA 3SO3C 1MRCH 1E5AA 3A0OA 5TE7L 3JYBA 3UC2A 1OWRM 1XVSA 2R0KH 4P4RB 4LSPH 5IBUB 3DURB 4PVBA 4PJDF 1XB6A 3TA3C 4KGJA 1JI1A 2HLFD 3TNMA 4J39A 4MJ6B 5G4OA 5J12C 2GK0A 1JPEA 3EBIA 3NCBB 4YBHA 4EUPH 1O7DC 4MXQC 4OCWH 5E08L 2UY6A 1PIGA 2FX7L 3BESR 3DSFH 4JHWH 3TPUA 3ZU8A 4HJJL 4S2SA 2BSSB 4HUVB 1WAAE 4H1LH 4Q6IC 4NN6B 1VZGA 2W07A 1XGQB 3Q0HA 1IM3A 2X4PB 5F7NC 1FHNA 2QHRH 3OKLB 1JUFA 4NZTH 1Q9OB 4AUUA 1CXLA 2PPDA 1UG9A 4OV6F 4NRXB 3C09B 3ZE2F 1AG6A 1EO8L 2YAEA 4YDZA 5IHZB 2NNFA 2GTWB 1MCSA 4KVNH 2TRHA 4HHAB 5HHNB 4OD1H 3L2MA 1D7DA 3MMEB 4OV5B 4JHZA 1KWKA 4HQQH 3TO2A 2BP0B 1Z9MA 5JQIB 1WAPA 5FFOA 4NNYB 1FVEA 1W8NA 1EH9A 5EO9B 3FUNA 1OP5K 1MRCL 4JBSA 2F15A 4MA8H 1M71B 1CT8B 5TTRA 3F12A 1WZKA 1SYSB 2CHDA 4PVLA 3IU3A 2A4EA 4IKNA 1DBMH 1UCBL 1AANA 2GHZA 3EDEA 6CGTA 2HWZH 2WXRA 3QWQB 2JB5H 3JWOL 4XMKH 3B7UX 3GDBA 5DS8B 4BE6A 1N9PA 2DWXA 1ODAA 1QBMH 1ZIAA 3C6EA 4PIRF 4W1TA 4GEIA 3T2OA 3T2NL 4F8PA 1DEEA 1OD9A 4HJEA 1G7HA 4R26L 3BQVA 3KCPA 4HIIB 5IG7B 5C0FA 2AC0A 1AR2A 4N0CC 4U7MA 4K3JH 5GGSY 1L7TL 4BWTA 1A7QH 5TDOB 1DBBH 1ZVSB 1X5XA 3BIAX 2ORBL 5A2FA 1OF2A 4R7DA 2MOQA 1C1EH 3QEUA 2B7DT 3Q5YA 3HOGA 5D8JH 1S8DB 2GSIA 1SEQH 3K7UA 3HZYB 4YLQT 3P9LB 4O58H 4DZ8A 3ZKXB 5IMOB 1IT9H 4I5BB 4HS6B 3MJ6A 4YDVA 4HA1A 4ZUWA 5CLWA 5B1KA 5C86A 4NRYB 2F08A 2CJTA 5DI8A 4EQ3A 1U3HC 1KDJA 1EIBA 3F04A 3C8KB 4LEBA 3TZVD 4WI0A 1SZNA 4PHZA 4RMBA 2OYLA 5ITBH 3T1FA 3T65B 3UAAA 4KKRA 3MREB 3RPBA 1JCVA 1W15A 3MBWB 5GGTH 2DIAA 1A25A 3VNZA 5EU7C 3V4PA 4AYBA 3K72B 3F7YB 5KSAA 5ISZA 5BQDA 4P04A 5INCB 4KFMA 2NOYA 5MHSD 4GBXA 5H37A 3VUAA 3BJ91 4G3YH 3CFNA 1USZA 1R46A 1JHLH 3LTVA 4FG0A 1M6OA 3IGUA 4A2HA 2QADC 3FRUB 2CK0L 4EBQH 1IQWH 4U1LA 4TSAL 4FNQA 4UZUA 2HVKB 3LEYH 4ZBJA 3RIFK 1BX2A 2ZOKB 4AITA 4YWGL 3D2UD 3MLTB 5GJSL 4J3WA 3GSUA 3AXHA 1VFBB 1T22B 4WFED 1OB0A 4XCFL 4ZD3H 2NT1A 4HUCA 3I02A 2UXVA 5ADOL 1JSYA 1PCXA 2XA8H 4MTMA 3DVIA 1DSYA 4KY2A 1M7DB 3MJ8A 4DAGL 4UV7L 4G1EA 3BDYH 4DVBA 4M1GH 4HUUB 3CUPB 2G2PA 4PJCA 1RPQA 4RAVB 4XPBL 4K5LA 4YHOH 5GGTL 4DKAA 5IMMB 4PLKD 1UJTA 4G6FD 4ZUUA 3R1GH 4LKXB 4OJDH 4HG4K 2WWNA 4A7VA 3EZ8A 3VXSE 4XBGB 4WTZG 4K94H 3O4LA 4G8IB 1E3ZA 1MWAL 1X5AA 1G7QA 2F8IA 3MOBH 1LP9B 1UA3A 2P80D 4G8FA 2XTLA 3QFJE 1U92A 1UYWH 3DETD 2D31B 3MSPA 4IMKC 4RX4D 1U21A 1N0XH 4H20H 2A1WH 4Z7NF 1PD6A 3I6SA 3K2KA 2MJWA 3FB6A 3KW7A 4GO9A 3O3DA 1MIML 4KO9A 5LWYL 4XCFH 4ACPA 1Z2KA 2NY0D 4LCYA 1BM3L 1GKEA 1KPRA 2I9LA 4XPAH 1PL3A 5HVFB 1O9WA 5DA4A 4PGEA 2QKIC 4YDMA 4WEBL 3QUXA 8FABB 1HZHH 2BSBA 2O4EA 2D2CC 1QFWM 1YEGH 1NM4A 4YZWA 4JPKL 1XH0A 3UYRL 2BC4B 1CFVH 1HHIB 3FHQA 4UANA 1ZLWH 4AI7A 4XE0A 2VL5B 2OMYA 3IMSA 2X40A 1P6WA 4FYQA 4M62H 3FTVA 3QXDA 1LGVA 4POZD 4JANB 3FT3B 4MQTB 5DJDB 3HLAB 4GQZA 3V0EA 4YUEL 4RFEA 4G5AA 2HMID 1VCBC 1V3KA 5EZLA 2EKSB 1E42A 3VJ6B 4DF9A 4K94L 3HS8A 2NMSA 1EO7A 3NH7H 2DWDB 1K4DA 2WZAA 2GJJA 2WVTA 1CFMA 4DUVA 1GHFL 1AY1H 4GP4B 1IKFH 3VXOB 1U8OA 4MJIE 4Z3HA 3O8XD 2IDSA 3H9SD 1G1CA 2WZPD 4NZ8A 2A9MH 1D9KB 3TZVC 5FFLA 2NY4C 1NANH 3CN0A 4YL9A 2VL4A 4XPAL 2ICWI 3H3PH 4KMTL 5ANME 1IMHC 3RKDD 5E5LA 3WL9B 1PX8A 2EYSB 5GIRB 3D4CA 4ANVA 1GGTA 1CQYA 1KG0A 2WXLA 4TUJB 3QDJE 1FO0H 2WW8A 5I15H 4DGWC 1KIPA 4FQLH 4O51B 4JE4B 4M7LH 3DXAE 4D8OA 5ILTL 1CGTA 5CU9A 5E99L 4OAWA 2WINA 5EZJA 1V5JA 1J48A 2HFEA 4JHAH 1G0XA 1JGEB 1I3RB 2P7TB 1SXZA 5LG1A 2BSTA 1JWMA 1OARL 1QA9A 5IKCA 1J1PL 4X4XB 4BWUA 2FO1A 2V9RA 3B7YA 5BVJA 2NNAB 1MWAA 4NQXA 2ZYHA 5T5NF 3OKNA 2X38A 2QKIA 2O6EA 3CZNA 3IN0A 4ZPTA 1GTNA 4Z77B 5MI0B 3TTSA 1PG7X 5FK9B 3DO4A 3QPXH 4WEMB 4P57B 2G75B 4F33A 1YQVL 4ZFGH 3RLSA 4JO5A 4AQZA 3QUMA 2P42B 1FQ9C 3KYMA 3TN0B 1DLFH 4LAJH 2WB7A 2W9DH 4OI9A 1GGIL 1KIQA 3ULVC 5DFVD 1NFIB 3TV3H 4WEUD 1QRNB 4P59L 4HJGA 1ZHLB 2NDGA 4G6AC 2R1XA 2LABA 3QJOA 4K7PY 3L9YA 2RMNA 5HHPB 3WJJC 5D1QA 5BQ7A 5D4QA 2VN3A 5JW5A 5FO8A 1QTPA 3ZMEA 1F13A 4NXKA 2L8AA 1N10A 2QKIB 3GNMH 4W6XB 1MCHA 1DFBL 1JZEA 3O0LA 5JO5A 4OB5L 1WFTA 2M2DA 2C4FT 4RMQA 4XPFL 2IPKA 3VW3L 3TNNA 3QFGA 4FL4C 1SHWA 4IBLT 4FN0A 5LXVA 4PV9A 4XBPB 2E76C 3LXAA 5T3ZH 2XI9A 3QJXA 1A21A 5IW1A 5IBTH 5D1ZA 4GRWH 2D03L 4ZW6A 2YPKB 3LVTA 2G5BA 2QTEA 4M93B 3D3VE 3E8UL 4P2RA 1JK9A 1LEKB 3NN8A 4TTGA 5C9KA 4P46B 4H44C 3KJ4B 4JG1L 2QVFB 4MNQB 3UABA 4NOBA 5BMFH 1R3HA 1XCQB 2J8UB 1OAYH 4HWEH 2O26U 2OCCB 5DQ9A 5T1LD 2XY2A 5L2KB 1CDGA 4HQQL 1JF6A 2W88A 3TZVB 1P4LB 2YIHA 1EAOA 4NAMA 3KGTA 1B88A 1CFTB 2G9HB 2IVFC 1BLIA 1DQVA 5AOMA 1U8IA 5C0IB 2J6EL 5FO9B 3TPUB 2BVPB 2BVOA 1RCYA 2VDNB 4N25A 2A5UA 5FYKU 5I6MA 1TQCB 5GRYA 5KS9E 1FC1A 2FJHA 3JT0A 2DLEA 1H6FA 1OT1A 4XN7A 1JFQL 3GINA 3QSKB 3FQWB 4FCAA 3K6IA 1CIUA 3HG1A 4AGNA 3GRWH 2WWMC 3QG6A 1OAJA 4WFHE 4Y4HD 3LKRB 4OSUL 5T3ZL 2J3SA 3UEQA 1BFOB 4N4YB 2MIZA 4AKPA 1MY5A 2WLIA 3MXVL 5LN4A 4EO5A 4RRPG 2C9XA 3CSTA 3FO0H 4PJEA 5DMKB 3IETB 3MFFB 1ILSA 3P4LA 4GO6B 4F7KA 4KJWD 2EUZA 1J0HA 2J44A 3VTTA 2FBJH 2X70A 5I1EH 2BSEA 4GOSA 3HI1B 4BSJA 5FYJD 3SHSA 4JM2A 3OLGA 4LCYB 4X6DF 1FE8L 2OSXA 3NCYS 4O58L 5DD1L 4N3TA 3AGVA 2HJFB 1F4WH 5B39G 1J5IA 5MENE 3QJUB 4X8XA 5CEXB 4LFHD 1RZ7L 3JTBA 1BAGA 2Q20A 2XVKA 4XP9L 3LKNA 2WUBL 3V0GA 3ARGD 3V0IA 5E2UH 4EOWH 1T7WA 3A67L 3NP4A 2MTPA 2V5TA 4G8GA 1IVLA 5T33L 4OZHA 3RWHA 3O6FB 4KRPB 4S1SL 1FZMB 3GBNH 3PPSA 4R5VA 4YO0B 2M26A 3EBGA 3G04B 4M6OH 4RA0C 4A2EA 1U3NA 3A5VA 2X9XA 4FFZH 4QRRB 3E6HA 2JJWA 2LU3A 1A14H 4JFXA 1YEJH 4JL2A 3O6KL 1IM9A 1UCBH 2NUTB 4AMKL 4E36A 3O3UN 5E0FA 2AQSA 3L4XA 2NY7H 5I1EL 2WQUA 4HUWB 2R69L 4H8HA 1RV6X 4JR9L 4GW4A 3GSUB 5GGRB 3QIWC 1O7SA 2BVYA 1ILUA 1YCSA 4F7CA 2IAMB 1WA1X 4MXVF 1TMQA 1M9SA 3ALXA 4R4ND 1DBBL 1RZIB 2ZOKA 3V0JA 3T2PA 1VERA 2Y4SA 5IJKC 1WCBA 1J86A 1CL7H 4X98A 5DQDH 1RLBA 4NQEE 5F7FA 4BH8A 1EHLL 5HDBB 4P4KA 4OGZA 5AYQA 4G8EA 1F0LA 2DYPD 3WJLA 1A6TB 1GGBH 5CSZA 2A9CA 1LE9A 3QRGH 1PAZA 1ZMYA 5C07E 3WUWB 1Q0EA 2MCPL 2P80A 4NGHL 3F6LA 4R4NC 1HKLL 2VCOA 4NNPH 4CVXA 3BPCB 3IFNH 3AW5A 5F7DA 1SF5A 3B5TA 4P2OA 5KUKA 1NWPA 4QHPA 5B1CA 3WFZA 4HOZA 1GGCH 3KGSA 2NY3D 1E4WH 2R0LL 1G0YR 2VDQB 2OI9C 3LHAA 2XKNA 5B8CA 3KPRB 4KY1H 3X1GA 2KZBA 3E6HB 2HRHA 3MOBL 1MUJB 2HKHL 4OQ1A 3GHPA 2IO5A 5KS9F 2NX5A 1BG9A 3DYOA 3US1A 4Y4FD 1RK1B 2NY2B 1IL1B 4Z0XB 5C09A 1UT1A 4R4BB 5EU5B 1UD4A 4KJYB 4L4VA 4EI5D 4AJWA 1P4IH 3KG5A 1WK0A 2IANA 5ALCH 1LO3L 3V4UL 5L7XH 43C9B 1S9XA 2VNCA 1L9TA 4C56A 2IJ0C 3PWVA 3VXRE 3FO9A 1AHMA 4I0PD 1FIEA 1E4XL 5EMYA 2ZOWA 4GKSA 4R6UA 1GW6A 3X14B 3UBXB 1CFVL 4OD3L 2GITB 1G9NL 2VERA 3I6KA 3NMEA 1G7HB 1A64A 2BIQA 3Q2VA 4N1HB 4ODVL 3ZDZB 2PO6B 1X7TA 4LL4A 3LQAC 4L05A 5L8LB 3GBEA 1BFVH 5ADOH 4GO8A 1QHQA 1PKQB 4DP5X 3BISA 1BJ1H 1KPUA 1MN4A 3U30B 1HEZB 4ODTH 5DRWA 1X5JA 2E9IA 5JXEC 2G60H 2ZCHH 5HYFA 1WZ1H 3HI1A 2AABL 2AQ3A 5E94B 4WHYH 3H6AA 4K3DH 5M94B 5F7EL 1FH5H 1M71A 3CFTA 4GQ9H 3GMQA 3JT2A 3CC5B 3ESNA 1XTLA 2JLPA 3C5ZA 1CD1B 4NO2A 4TSBL 2CBQA 2X7LA 1XB8A 2BIOA 1NEPA 2ZT9C 3IDJB 3GHEH 2VLKB 2ZCLH 3CVHB 1KCKA 5F9JA 4L1LA 4HXBH 1A9BA 1EMTH 1I3GL 3SO3B 1XIWD 1HNGA 2Q76A 2GBUA 3H9HB 4Z7QE 3QS3A 4YBQC 5IJVA 4HKJB 3X3GL 4ZW8A 2COVD 4OF6A 1UOLA 1WZAA 4PTUB 2ATPB 2LHAA 1MHCA 2FCBA 3Q5OA 2FYYA 2UVFA 2BVOB 3FOLB 2R56L 4XO5A 4OVUA 4PWIA 2OQJB 5CILH 1YECL 2ICES 5C0IA 3DX8A 4P2YA 3BWAB 4FG6D 3IMVA 3VWKA 2YEZA 1SDDB 3JWOC 8CGTA 3GBMH 3MOQA 4ZYKB 1JPFB 1IO4C 3VFTA 4JPKH 2XYCA 5IQ9A 2KUTA 3C6SA 3PFUA 4Z76A 3JV5A 1UWXK 4KRNA 1S7RB 2ZUVA 3SE3C 4M03A 1PPIA 5CBEB 3CSYB 2IPUK 2R2CA 4XMLH 3AABA 4FAAB 1YN7B 4JFTA 3MV8B 3K3QA 4I7ZC 5F3BA 3EADA 3NH7L 3E8VA 2WCGA 1CS6A 3FONA 5IW3A 3D18A 3HZVA 3N43F 3O3AB 1EMTL 3U9UB 3BKCH 5F1IB 4XVUC 3S88H 3KWWA 4Y4FC 1CJYA 1QPPA 1PW3A 2OM5A 25C8H 4FS0A 4JO4H 3EIFA 4OM0H 3VSQA 3PP4H 4DO6A 3DTXA 1RZ8A 3LNFA 3L3DA 1MFUA 5E6ID 3ULUD 4K5OA 5FDWB 1EJ6A 3QULA 3ZKQD 3MJ7B 1UB6B 3S4SG 5DJCA 4HF5L 4OQTL 2LLLA 1ZHKA 2V2XA 3QFJB 4OB5H 3FTUA 5DJ2B 2D4DA 2IAND 3WI9A 1A6WL 1WLHA 4JN2B 4WWKA 4R7VA 1DQKA 5L6YL 1KB5A 2EYTB 5EFIB 4DFHA 3E80A 4IRZL 4UILH 2ZUXA 2ZKHH 3GRGA 3DGCR 5JA9A 5HYJA 4NKDA 4LSTH 1B0RB 1YYMH 1JV5A 1YEHL 1F8TL 5I24A 4PRNB 4F3FA 5JHMA 2AXFB 3CZLA 4ECNA 1NDMA 3D30A 4Y2DA 4JO2L 3WMPA 2WVUA 1L6XA 4HLEA 3FUHA 3D34A 5BVJB 4O9HH 1B4LA 2VW6A 4IKKA 25C8L 1NAMH 4Z95L 3GDCA 3PABA 4Q6KA 1A7PL 3ARDD 1CYXA 3TONA 1H8OA 1T03H 3MFGB 4IRSC 4K0OA 3ET9F 3E7JA 5GGUB 5I1HL 5E9AA 4UINH 2YSTA 3MCKB 4GINA 2F7QA 2ZSVB 3AQXA 3NFPB 3OKMB 2AJVL 4ELMF 4R90L 1TZAA 1UJ3B 1I1CA 4HGKC 4K7PX 4NPYB 4KUCD 5CLTA 3TIEA 5C2UB 2ZF8A 3VGDA 2BMKB 3BKML 3WKNA 1X7QB 3AGWA 2ITCB 1SQMA 4ODSL 3RKDC 4UILL 3MACH 3KPTA 1I7RA 1OPGH 4NYLB 5EBMA 5BUGA 4PMEA 3ARFA 4R7XA 4GUPA 1IX2A 1NH6A 3H42L 4A7UA 4P2RE 3LQZB 5DT1L 5T3ZE 5ACZA 2H26B 4D0DA 5BJTA 4HIXH 3OAWA 4Z7UB 3IJYB 5D2LA 3T8MA 3QUZD 1O0VA 3DYMA 2VR3A 1M2VB 2RFXB 4GYBA 3V0FA 2VKXA 2Q8BL 3R4DA 5A40E 4GRLC 1KLUA 5E7BA 4OZFB 4YNYB 1X5GA 2YXWA 3DUUA 1U8CA 1UJ3C 5F9DC 1T2QL 3QJHA 5I76B 4KKLC 3WFDL 3LAFA 4PRHB 3W5MA 1ASPA 2DM2A 2G0KA 2DD8H 4MA7H 3MZTA 4UINL 1OANA 2X4OB 4F7PA 4QLWA 4AM0Q 5HY9A 3FDWA 1OSPL 1XCQA 1CIDA 1RIUH 1XT5A 4NQED 4WU5B 3D85D 2Q7YA 3HI5L 5L2JB 3VQ1C 1M9WA 2BVEA 4LMQI 5KSUB 2K8MA 3M1BB 4P23C 4PGEB 3JYCA 2VQUA 5CSGA 3NIFE 3VI4B 1UWGL 3R0MA 2AJYL 4H8UA 1UQSB 3QT2A 3D09A 1SUJA 1FYTE 1N67A 3BVNB 1ZHNB 3EOBB 4L5FE 2A4CA 3OD3A 3FTXA 1AH1A 4GAYB 3H42H 4WW2F 5E6IA 3VFVB 3V5DA 4AVIA 3D3VD 4RDBA 4G8FB 1JN6A 1D6EB 2DLTA 5CJ8A 4NJ9L 3VQMA 1BQUA 2VN5A 2OK0L 1WBZB 4OLEA 3EDKA 3O41B 3WSQH 5G4MA 3VD5A 2AXWA 1FFOB 3CIQA 2NUPA 4FG2A 4XOBA 1C5CH 1R47A 3B56A 4U3CA 4WY7L 4JLRB 1RMFL 3MUZ1 4B97A 4F2MA 4KMQA 1KBGL 1SMDA 4ONFH 5EF2A 5IIEA 2DI8A 1KN2H 2R1XB 3G3LA 4DVBB 1RL1A 4TULL 2PWGA 2W94A 1UOVA 3MV7B 5AVUB 1JNHB 2JQAA 5FCSH 4LLUB 4GKZA 1KBKA 5GGQH 3QO0B 3Q2LA 1DBML 4UQCA 3MLSH 4MWFA 3THML 5IB2B 3BAXA 3SE3A 5JR1L 5KYXA 2B3RA 4JVWA 3P77B 3FUFA 3RWJA 1AXSA 3L4ZA 5DR5L 3CXHJ 3BLKA 1I9IL 4EI5A 1A6ZA 4QYOB 2YD2A 4DKDC 4HJUA 1X7SA 1MWAB 4NQXB 1RAMA 4DPBX 2WYTA 3KLSA 3QHTC 2ORBH 4V2CB 1DVFA 4ENED 4X4XA 4C56D 3DI3B 1ZXKA 2A74C 4UIKL 3BP6A 3S35L 2FEJA 4BDVA 1WDAA 3JBG7 3MCLH 2BSTB 5IT2L 2PYEA 1XFPA 4PY8I 4QHKI 4TQ8A 2Q6WA 4ZW7A 5CMAA 4FZEL 3MROA 4UMSA 1UFUA 4M02A 4CN4A 4WEEA 2OR9H 1WUZA 1JTOA 4ZTEA 2AEPH 1QX1A 4GRLA 3AB0C 5FW7A 4AYMC 2NTFA 4U1IB 4PBVC 2DQTH 4YDLB 2Y07L 3H8NA 5C07A 2IAAC 1G9MH 1QSFB 2RQEA 4WI5A 4XI5C 3ULUF 4OJFH 1FV1A 2MCMA 3VM5A 1JZ8A 2HXAA 4I4WB 4AY0A 4ZYKA 2V5RA 1W0WB 3KLHC 1TJGH 4LK4A 4PS3A 4HCRH 1M4KA 3O11B 3DTDA 5FM5O 4LLQA 5HHMD 1CF1A 4U1MA 5GQBA 1G4MA 3OV6A 1A6AB 5IM7B 4UTBH 2JLLA 3FQTB 2DQMA 1BPLB 2N7BA 3DJTA 2BNRB 1CMOA 4ZI8A 4PREB 3ARBC 4NAJA 3I85A 2DV6A 4L2LA 1P0SE 3LEYL 1BZ8A 2Y7OA 3RUGB 1N2RB 4TSBH 3T0DA 1ZGLP 4WJ5A 1JHKL 2AGJH 3GXFA 4U1SA 1WBXB 4RIRA 4CN1A 5ABDE 3C60C 4A55A 3STZB 2WOYA 1KB9K 1ZS8A 4GFTB 4DGIL 2FHFA 4KK8C 3BYYA 2AQRA 4PSPA 3VVWA 3QK0A 1OM3H 4XBEH 1CE1H 1JGDB 3CH1A 3KPNA 3LX9A 1IBGL 5KYUA 4AC4A 3AU1B 3BXNA 3CFEA 4U1NB 4I9XA 1AD9A 5C97A 3ZSTA 2NR6C 3DRTB 4GAYA 2D9CA 4OFKA 1AGCA 2E86A 2H32B 1DJWA 2XFXA 4K2UL 2J72A 5EO1A 3UO1L 3W56A 4JY6A 4PGBA 3N40P 2CHXA 5K9OB 2JB6A 1WFUA 3T4AA 5H4ZA 3TT3L 1IGCH 2GB2A 1NFDE 3UBXA 3MODH 1CXKA 4DQOH 1C5BH 4C4KT 1SM3L 1K5NB 5EC1B 2FR4A 2Z9TA 3LZPA 1RHHB 5HI5D 4XBGA 4Y5VB 5IOKA 2OA9A 3OTTA 2X44D 2ZCHL 1I31A 3MJWA 1FZKB 3Q2NA 4GRMB 3U4EB 4ACTA 2WLHA 3CJJA 1ZJBA 2APVA 2KH2B 3DBSA 3IDUA 3RNKA 1NGXA 3QUZC 2XWTB 4MAUL 3WHXA 1LO5B 1LDSA 2D0GA 4ILDA 2YMXL 5LJYH 3TN0C 4PB9H 4P2OC 3IJYA 3L54A 1AMYA 1K2DA 2EIBA 3KPLA 1HOCB 3VWJA 4KNSA 5I0DA 1HSAB 4N2FA 5BS0D 7FABL 5L2KD 1KGYE 2NLJA 3DX2A 4JJ5A 5F96H 3UBFA 1NLBL 2Y6TE 5EBLA 3V4PH 1KTLA 5K9JH 1UD8A 3SE4A 2RCSL 5SX4H 3GLDA 2ODHA 2UXFA 3TWCH 4K8RC 2Z64C 4AJ0A 1CE6A 1V10A 4MYWB 1WWBX 4TN9A 1BX2B 4O2CB 2D9QB 3TT3H 4BH8B 1A9EA 3NK3A 5I17A 1ZSDA 1HHGB 3K46A 3QFJD 4MDJA 4PJHF 1Z3GL 4NWUH 4LEXH 1OB1B 5D7SL 5HGAB 4AKOA 4CU8A 4MX7B 3GC3A 4NQDA 4WSGA 3WGVB 4B9KC 4JFFD 1XGRA 2Z92A 2WBJB 3IFLL 4U6YB 2X4RB 2R51A 3S34H 2XC8A 1SLWA 3K71B 1DTUA 4WO4C 5C0RL 4BZ2A 1XR8B 4ZTPL 3GSOA 1NCJA 3VRJA 3L2NA 1KIRB 1QW8A 4UT9H 5AAPA 1B0GA 1E8ZA 5E23A 5AKRA 1DZBA 3BH4A 4KKZA 1DQTA 5T1MA 1DVYA 5LBSA 1E5YA 1IAII 4DGYH 4Z1PA 1O9ZA 5E8NA 2I07A 1KT2A 1UM6H 2UZIH 3OR6B 3LS4H 3Q8AA 1XAKA 5E00A 5FYKL 2BINA