3UACA

Multicopper oxidase cueo mutant c500se506q (data4)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
489
structure length
476
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHSHLLEHQDTGMMLGFTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase CueO
publication title An O-centered structure of the trinuclear copper center in the Cys500Ser/Glu506Gln mutant of CueO and structural changes in low to high X-ray dose conditions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 136
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uacA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uacA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uacA03
4BXVA 1ILUA 1QLEB 2FTAA 2YAPA 1TEGA 2XV3A 3PAUA 2PPEA 1GW0A 3FU7B 2P80A 1JZIA 2OCCB 3CG8A 4A2DA 3UACA 2PPCA 5TK2A 5I6PA 2UX7A 3V9CA 2H47C 4JKNA 1ZIBA 4K9JA 1AS8A 4NB7A 2XUWA 1DZ0A 1A65A 1JXDA 1ASQA 4KOBA 3FQYA 2BP8A 4A2HA 4F2FA 2FJSA 1UATA 1MDAA 5LDUA 1AIZA 1JVLA 4BWUA 3T71A 1AR1B 4F2EA 1GR7A 1L9OA 2BP0B 4G7SB 3NJJA 2GB2A 2Y1AA 3FSWA 1PLBA 4M4RB 3C75A 5I6OA 1HFUA 2WO2B 3UABA 3TA4D 3H4FA 5B7MA 2ZONA 3NSYA 4E9RA 1AAJA 4N8UA 2AVFA 1E67A 1L9RA 4YSQA 3NYKA 1NWOA 3EH5B 3NSFA 4G70B 1AG0A 3AG2B 2CBPA 1L9SA 4BXSV 3OMIB 3FT0A 1AZCA 3ASOB 1JZFA 2X87A 4DP6X 5A7EA 4YSCA 1IKOP 1N68A 2ZWNA 2PP9A 2W8CA 3MBWB 4HHGA 3SBRA 2YAMA 4A2EA 2J57A 3V9EA 3X1GA 2GBAA 3OMNB 4GY4A 4NAJA 2MTAA 1CYWA 3N55A 5ANHA 3CZUB 4W1TA 4E9XA 4KOCA 1PZBA 4PAZA 2CUAA 5PCYA 1PNCA 3NJMA 4N4YB 4YVUA 2I7OA 1MG3C 2BZCA 3ABMB 3FQ2A 1SFDA 1AANA 3WI9A 1X9RA 3PPSA 2FQGA 2IH9A 4KNUA 2YAHA 1JVOA 3U25A 5B7FA 3NT0A 1BXAA 3IEAA 4DP9X 2QPDB 3QJTB 3NJHA 3ABGA 4BWTA 1BQKA 1PZCA 1V54B 2FNWA 2UX6A 1BXVA 2PPFA 2GSMB 4KO5A 5B1JA 1RZPA 1OF0A 3AW5A 2RACA 3TBCA 2WO3B 2Q5BA 3KW8A 1AOZA 2H3XC 5I6NA 3IBOA 2J55A 4PCYA 2HX7A 4HZ1A 1OCRB 1AS6A 2JFCA 3IN0A 4HCGA 5F7AA 4GP8B 4KNTA 1KGYE 3PAZA 4UAHA 1WA1X 1A4AA 3CVCA 4YSOA 1W8EA 4FA7B 1KYAA 4F7KA 4KO6A 1NICA 1SF5A 2XU9A 1NINA 1V55B 3ASNB 3ERXA 1ASPA 1GSKA 5B7EA 1XMEB 1DYZA 2WSDA 4X4KA 2YAEA 1I53A 2VW4A 3AG4B 5I26A 1AZUA 4RH4A 4HHWA 1SNRA 7PAZA 2DWSA 3AY2A 1RKRA 5I6LA 2XX1A 2IDSA 1A4BA 3TBBA 3RYMA 1BYPA 2DWTA 1FWXA 2MRYA 1R1CA 2HZHA 3AZUA 1T5KA 1MZZA 1KCWA 2ZXWB 3FU7A 1E5YA 1HAWA 3X2QB 4HCFA 4KO9A 1WS8A 4WKXA 1GY1A 3GDCA 4YSEA 2R7EB 1GY2A 3NJNA 1IBZA 4BWWA 2N0MA 1IBYA 2CAKA 5D4JA 2HRGA 3IN2A 2BWIA 2XLLA 3ZDWA 2FQFA 1JOIA 2FQDA 2HXAA 1PNDA 4NERA 3S8GB 7PCYA 1A8ZA 3PCYA 2J56A 2BP0A 4G7RB 3NJGA 3ZBMA 1V10A 3DKHA 1YLBB 5B1BB 1BQRA 2DY2A 1NZRA 2PPDA 2XX0A 2P80D 1CUOA 1EHKB 2CCWA 6PAZA 3EF4A 4BDVB 2B08A 1E65A 1AS7A 2J5WA 2W88A 4HAKA 3L45A 3HEIB 2IWKA 4L0PB 3T6ZA 2B3IA 5E9NA 1AQ8A 5TK4A 3NP4A 2YARA 2PLTA 3CDZB 1M56B 1WA0X 2YAOA 5B3SB 1TU2A 4TXVB 1CURA 2UXTA 3WNIA 4E9YA 1E30A 1QNIA 3FPYA 2ZOOA 2Q9OA 1AZRA 1OOWA 1W6LA 4DP2X 4WTQA 4YVNA 2HX8A 2EIKB 4DPBX 3QJQB 1GS8A 2FT7A 3OQRA 3S3DB 1CC3A 2EIMB 2GI0A 1ASOA 3UAEA 3CVDA 1SHXA 2PCYA 2IDQA 1B3IA 4M3HA 4P5SA 3UADA 3UAAA 1VLXA 3DTUB 2VN3A 3PXLA 1MZYA 3X1BA 4QKTA 8PAZA 2YAFA 3GXUB 4ZK8A 3ABLB 1IC0A 4HCIA 6PCYA 3X1EA 1ZDSA 1ADWA 1PY0A 1PMYA 3H56A 3NJLA 3OMAB 4YL4A 5D4HA 2EINB 1FA4A 4AKQA 1AG6A 2YQBA 1J9SA 1F56A 5I6MA 5I5MA 3FSVA 4AKPA 3SQRA 1FFTB 1WA2X 1J5DA 4UANA 3FYIB 1TKWA 1AZBA 1RZQA 1OCCB 2BWDA 3IE9A 2XV2A 1KDJA 5EHFA 2QDVA 1EZLA 4G7QB 5FC9A 4A66A 1A3ZA 1HAUA 2IAAC 1M9WA 2AZAA 1J9QA 1KDIA 1XB6A 1NIDA 4UF7C 5I6KA 1BQ5A 2VSMB 3NJFA 4YSTA 1ILSA 2BW5A 1KBWA 3D12B 5AZUA 2GHZA 2VM4A 2AANA 1PLAA 1NIEA 4AI7A 2YAQA 2VW6A 9PCYA 3OM3B 4BK5C 5I28A 3UGEA 4E9VA 3CVBA 2GC7C 2YXVA 4HIPA 4FAAB 2CJ3A 2DV6A 2EIJB 2PPAA 1OV8A 2UXVA 4JHVA 2UXGA 1E5ZA 3KW7A 2R7EA 5AFAA 1M57B 2JKWA 3ZIYA 2BZ7A 2HX9A 4DP8X 2E86A 3QQXA 4GXFA 2PCFA 5IY5B 1SFHA 1NTDA 1GS6X 4KO7A 1PAZA 2DYSB 3TASA 2XWZA 3AG1B 2LLNA 3WG7B 1JERA 2HLEB 3S8FB 1OCOB 1QHQA 1OE1A 3QJRB 4BDVA 2IDUA 4Q89A 1JZHA 1TEFA 5B1AB 5B1KA 4A2GA 4YSSA 2X88A 2PP8A 3OD3A 3FSZA 3X1NA 1URIA 1JXGA 5I5JA 1X9UA 1SJMA 3QJUB 2GIMA 2PP7A 2IDTA 2Y69B 1NIFA 1OCZB 2QT6A 4A68A 1ZPUA 4YSRA 2AFNA 3ABKB 3SBPA 1NPNA 2XVBA 4HALA 1OE2A 1XB8A 3CDZA 1MG2C 2QPEB 4GP4B 1PCSA 3GYRA 1RCYA 4W9ZA 2BP8B 3PAVA 1NPJA 2BW4A 4DP4X 4GYBA 3X1FA 2XV0A 1BEXA 1L9TA 1N70A 3EH4B 1J9TA 1ET8A 1ETJA 3JT2A 2NRDA 4AKOA 2FT8A 1BXUA 3FSAA 4ENZA 3AG3B 3G5WA 4Q8BA 3T6XA 4DPCX 2UXFA 1NIAA 2FWLB 1SF3A 2TSAA 3SBQA 3JTBA 1NWPA 4DP7X 2JXMA 2YXWA 1AZNA 4E9QA 2EILB 1A4CA 1WS7A 2H5UA 1BAWA 1W6WA 4MFHA 5B1JC 3NJKA 4GP5B 3WIAA 5I5IA 2XYBA 2GC4C 4DP1X 3DIVA 1GYCA 1PZAA 4CSZA 2QDWA 3FQ1A 4E9TA 1AACA 2BHFA 3FU8A 1ZIAA 3TU6A 3NSDA 3ZX1A 1BYOA 1XB3A 1ZDQA 3S3BB 1JZGA 1OE3A 3T6WA 2OV0A 3FYEB 4EF3A 3WKPA 1JZEA 2HRHA 1KBVA 2BO0A 2VMJA 4E9SA 1J9RA 1L9QA 3WKQA 3T6VA 3FS9A 1PLCA 2I85A 4A67A 5F7BA 3EH3B 3QPKA 4DPAX 1ID2A 2FT6A 1L9PA 2IH8A 1NDTA 4DP5X 1JZJA 2IWFA 1KV7A 1WAEA 1PF3A 3QJSB 3N2JA 4YSUA 4P5RA 4YSDA 1ZV2A 4JHUA 2VSKB 1JXFA 1GS7A 4A2FA 5PAZA 3HB3B 2XXFA 1J5CA 2IWEA 4CSPA 3NJIA 4AX3A 5AKRA 4G72B 4YSPA 2DYRB 3EHBB 2AZUA 3FPXA 3MX0B 2VM3A 1ET7A 1KCBA 4AZUA 1CYXA 3NP3A 2A3TA 3H4HA 4QLWA 1NIBA 1SHWA 2CALA 3FU9A 2OJ1A 1SDDA 2VW7A 3QJVB 4KNSA 2I7SA 4G71B 3NSCA 3PLYA 3WNJA 3S3CB 2TSBA 4DP0X 3BVDB 1SDDB 2IDFA 4YSAA 2XXGA 3BQVA 4E9WA 1IUZA 1ET5A 5D4IA 2FQEA 3T9WA
chains in the Genus database with same CATH superfamily
4BKSC 4UT6L 1ILUA 2PTTB 3MRLA 4MA3A 3IFNH 2AK4D 3I3EA 5MP6L 1B2WL 3OAUH 3P2DA 3Q0HA 4TQHA 2J6WA 5I1EL 4NLAA 5AW1B 3VAEA 3BRFA 1ED3A 2R39A 2YJLA 3QRGH 4OZ4B 3ZL4L 1C16A 3H2PA 1TEYA 4OY9A 3RP1A 1V7NL 1WYJA 2IQ9H 1GYUA 3UACA 5C0EB 5JW3L 5E6UB 4O58H 5LGHH 1JXDA 1Z66A 2VLJD 2PNDA 3CHRA 1KJ2L 3OMZA 4M5ZH 4LOEA 2E8ZA 4NUJA 2AJUH 3KLHD 1R5WA 4N0YL 2ZAHA 5DYOB 3D07A 4DFIA 3IJ7A 2ESVE 4HOMA 4B97A 3LKPA 4X5QA 4S11A 1A6TA 1E0OB 2MOQA 1UD2A 1MI5B 4JHAH 2Y22A 4P99A 2DYPA 5D2LB 1UOWA 1OAYL 1RH8A 4MDJB 4MX7B 1QA9B 2H7WA 4HUNB 2EDNA 2AS5M 3WGVB 3D0LB 1DL7L 2P9RA 1A6AA 5DFWH 1IGFH 3VFMB 3ATDA 5E1AA 3T3PB 3MXVL 4LQFH 1YSOA 1OB1B 1Q9WA 4PG9B 5F0PB 5C0JA 4BINA 3RY6A 3OJDA 1BFVL 4EQ2A 3NSFA 4X6BA 3PWPD 2H3NA 3EYSL 3D33A 2YOCA 5HHNB 5M7QA 3WTXA 2AJYH 5H37A 5C92A 3EYUH 3Q1SH 1OSYA 5JQ6H 1A2YB 1R3JB 1CXKA 4IKLA 3LZLA 3S88L 3KL3A 2ZX7A 3ZO9A 1I7TB 4A2EA 3MRPB 2ATKB 2WLYA 3IMWA 3V9EA 1S9WB 1EHNA 4U1GC 4ISVA 4LRNH 1IZKA 4PLJC 4ZS6D 5FKPA 2Y7QB 2X1XR 3FFCD 3L3HB 3FQNA 1DBJH 5I2IA 3SN6N 5KVEE 2BFVL 3GUTA 4M7KL 5CD3A 3T0EA 1S7TB 4V1DE 2ZUYA 3F3HA 2UWEB 4K94L 4JQIA 3BAJA 3IS1X 1AANA 2KZKA 4AQ8A 1KYDA 4H0IA 2ITFA 3X14B 4D9RD 4ZFGH 1WSST 3NT0A 3RI5F 4BRVA 4M7LT 1IGCL 3KCWA 3S5LB 2AI0L 5KAQF 2EDRA 1FFNB 1TTGA 3RGVD 4OZHF 3D25A 3THMH 4W9GC 5B1JA 4BH8B 4XNZC 1PEZA 3OKNA 2Q6WA 1SJVA 4ATWA 2HCZX 2BOCA 2D2OA 2WLMA 2VQ1B 5D72H 1MCWW 5HHVH 4L8SC 5AAWA 3FRUB 1JYWA 2JCCA 2EEAA 5F1NA 1WAAF 4NIYE 4YX2H 3GF8A 2BY3A 4UCFA 2H6UA 2YKKA 4W70A 2A9MH 5IW1A 2Q8AH 4PJ5E 5DVPA 1IAOB 3MX0A 3PAZA 3T2OA 4Z7WA 1AQKH 4Q56A 5TJWK 2E9BA 3H42L 4FA7B 4X6CF 5HYJB 3F58L 2PW2A 2E59A 3WLWD 3GZPA 1RZ7H 2LFGA 5DC0A 1Z1WA 4BSWB 1A6ZB 1A9EA 2NY4C 4AEEA 3AWGA 2XN9D 4NGHL 1I53A 2VW4A 3WL9A 1FFRA 4RH4A 3UG5A 1ZOXA 4WFFE 3U9UA 3DV6A 3U46A 1IL1B 3H9HB 1M42A 1QLEL 5FDWA 1PYWB 3FU0A 3ARGD 3RTQB 2V5TA 2X7LB 4IBQA 2YD4A 3U30B 2F1EA 3BD4A 3II1A 4PJHF 3SJVD 2DWTA 1PX4A 3EGDB 1L7TL 4PCTA 1YQVH 5CILH 3FU7A 1DANT 4NN7C 4TUOB 2WNWA 1CS6A 3BKYL 1KENL 1TZHB 3HC0A 3MAWA 4I7ZC 4V2CB 4GRWF 1LP9F 2WZ6A 2ZP9A 2J1YA 4AZ8A 1MHCA 1URZA 2WWMC 1KCRL 3NSXA 5E1QA 4EOWL 3L1OH 3TX4A 1AD0A 3HI6L 4RWYH 4OV5A 1S7QB 5CSGA 3KL5A 4FFWD 3BP5B 3DYPA 5AKTA 2CDEB 3NGBB 4M4PA 4G8GB 3TPUA 3WNOA 1AYRA 1P9MA 7PCYA 4QRRB 3JBG7 1MNUL 5B3NA 3RZWA 2EE6A 2VZSA 2I27N 3C5JA 4JRYE 4KI5C 4ZPTB 4B9GA 1AGBB 5D1ZC 3ZBMA 2DN7A 3Q6GL 2Q7NA 3RWIA 4KZEH 1KCSH 5DD5L 1GZQB 1N10A 4P5MB 2F53E 4J8RA 2XKNA 1NC4A 1Z5YD 4JHWL 5C3TA 3CNKA 4ZTOL 5HVFB 4ADJA 2Y36L 4FYTA 1U95A 4HWBH 1YN6B 2QPSA 3NZSA 4Z8FL 1ZLSH 1UVQA 2UY7B 1YEDA 1QACA 1Z9OA 3PV6A 5DQDL 1P69B 5E9NA 2CR0A 1P5VB 3TS8A 3CX5K 4ZSOA 2CNZA 2D0GA 4J3VA 3MRHA 3L16A 4ODWA 1AGFB 3LVTA 3MBWA 3MV8A 1I4FB 1HSBB 3NIFB 3REWA 1DN0A 1VFBA 4XPTL 2WYZA 1SYSA 4JVUA 3BEVB 2YD3A 4LLDA 4RFNB 4BFIA 3ZR6A 3VFRB 3KD4A 3WE6B 2B8OT 3S4SB 1A4JA 5F7KC 3NJVA 1GS8A 2F7OA 4DEPC 3V5KB 1X9LA 2NCEA 4IK6A 2QSQA 4F15C 3M88A 4WY7L 2OP4H 1OP5K 5E2VH 5HHOA 1OAQL 4CU8A 4WO4A 3CVDA 2R69L 4BFRA 4JN1L 3EKCA 2X5PA 3CSYB 4YHPA 4IOFC 5ICXB 1YY8A 1S6NA 2VZTA 1DLHA 4PBDA 3B3IA 3Q13A 1R3IH 2LQRA 1OTUD 1U30A 3IDGA 2BC4B 3TWCL 4FYRA 4H8PA 3LOWA 4LLVA 5I8KH 5B39G 1RUKH 2IG2H 3GXUB 2H26B 3GTTA 5F44A 4AOFA 3G08A 4HCIA 3P11H 1EXHA 3T0ED 4KRNA 3VXRB 1V7ML 4DKEH 4LCIH 4HX1B 5TQ2L 3LS5H 4ZUWB 4PY8I 1FA4A 4XBGA 1BLNA 3L7EB 2M83A 1XX9C 4LP8A 4S1SL 3WEXB 3L3DB 2JKRM 1NCCL 3Q2NA 1YO4A 2VLME 1KNOA 5D1XA 4UANA 1T3FB 2EDFA 1CI5A 5DHMC 3HUJA 3MV9A 4OCWL 1BG1A 1MPAH 1EAPA 5T1LB 3T4YB 1FI8C 1V3KA 1CGVA 2NUPB 3CDYA 3EJZC 2P28B 4XCFH 3BAXA 2E7CA 1YPZA 2HFGL 5D9SA 1MRFH 2X40A 2VR5A 3NJFA 4GFXA 3B8SA 1KIUA 1BREA 2N3JA 2P5EB 4AE0A 4A04A 4K55A 4KAQH 1R5IB 2WUCL 4M6OH 3WJMB 2VM4A 2ZOTA 1X7SA 3FT2A 1PLAA 2OR7A 4GT7A 3KPOB 1I7RB 2F7PA 4M1DH 1PIFA 3R1GL 4RX4A 5DJ2A 3UPCA 2JTDA 3QNXB 2EH7H 2OL3H 3HAEB 1RL1A 2OM5A 1SXBA 1BZQK 2Y3NA 2Z0BA 2VDLB 3GINA 3DMMC 4KKCD 4WRLA 5BZDA 4NNYA 2IEPA 2DM4A 5DEFA 1YYLL 1FYTD 4Z9KB 5F9OL 3GJFH 4Z7QF 5BMFH 4K23L 3NQKA 1UCTA 3DV4A 2HRPH 1PY4A 2PCFA 1TF4A 1ONQA 1UM5H 2NT1A 3EJYC 3MXWL 2VLRB 1NBQA 3PP3K 1Z9SA 4OD2B 4MXQD 5EU7C 2NW2B 2L3BA 4JFUA 3TIDB 2AXFA 5ECJE 1JPFB 3MUY1 4XHQA 5AAMC 3L4TA 4NHUB 3VD1A 2GSIB 2K70A 2ISDA 3VTTA 4YSSA 4Z3EA 5CHNB 3FHQA 3JSSA 2Q0ZX 3HG1E 1X5MA 3SGKC 4UZGA 1DVSA 3T2LA 1K8IB 2Y69B 3KPLA 4OJEH 3S36H 3A67H 3HHMA 2EDHA 3MJ7B 3MRQA 3N0AA 2Z92B 5DJCB 2P52A 4PS4L 3PL6B 5CLTA 1LILA 2H8PA 2R1WA 4P59H 5LAXB 4WLCA 1T6WA 3O11A 3I3DA 1TJIL 1L0XA 2VUOA 4FDWA 1UH2A 5BQ7A 3BAEH 5HGHA 4WK4B 5KG9B 3OGOE 3PGCB 1DVUA 4X8JA 1UXWB 3KBPA 5B38B 2H1XA 4XO3A 3UP1A 3VX1A 4ELKA 4U1NA 1DDHB 3DETD 4X0KA 4BZ2A 3BSZL 5CWSB 3G5WA 3K5SA 3MODH 4H8QA 4JQXA 1P6AB 3STZA 2A4CA 1CQKA 1KT2A 3QUKA 4BA0A 4OF7A 2Z65C 4ONHB 2R59A 3LPPA 2X4TA 3UJTL 3MV8D 3WNKA 4HPYH 2O5ZL 43C9A 4F5CA 4OW6A 1IGML 1QYGL 3DARA 3DX9B 3U0TB 2K9UA 5IJDC 1ZV9A 2GEQA 1S5HA 4P2QA 1SLUA 1CBVL 4ETYA 4AQAB 2GJRA 1EQWA 2PW1B 4AIOA 3VU2A 4ZW7A 2QDWA 2B4CL 3FQ1A 4PV1C 5DT1H 2VLJE 1AIFA 5GSVA 5A2JH 5IJKC 5L4JA 2ZWZA 4PPTA 3H7BA 5HHOD 3WNPA 5SV3A 1ZDQA 3S3BB 4G3YH 4WO4D 5F1OB 1FYHB 2J20A 4FQXC 4EUPB 4TVSa 4ZNCD 2OV0A 2DJMA 1N0LA 4N8CL 5HHMB 1DLFH 3H54A 3DO4A 1ZPLA 2ENPA 3OSVA 1J9RA 1QG3A 4ZFQA 1KLUB 5DK2B 3U0WL 3CC1A 3CFQA 3C6EA 4HETA 1NSNH 1NFIB 2YXMA 3CLFL 3K1DA 1QUNB 4ZW8A 5KSAA 4OKDA 4XODA 4NN6B 3QWOA 5EEVA 1JWSA 4W81A 4WU7B 3CBRA 3IYLW 2AXGA 3ETBF 5E24E 1BLIA 1D6EA 3WO3B 4JY5L 5IGXH 3HAEG 1ND0B 3PWPE 4XNMA 1F6FB 1AY1H 4QF1A 1MLCB 4UT7L 3TZVC 1EO5A 2G3ZA 1TITA 1UJ3A 2BY0A 3MV9D 4RDBA 1FFOA 2VE6A 3L4ZA 4QNPE 4XP4L 5EN3A 2PCPA 5E6IC 2IGTA 5JA8B 1AHWC 2VQ4A 1S3KL 4NC2B 4NZFA 4M5YH 3A47A 3OX8B 2H2PD 1ZA3B 5JIDA 3EHBB 4U1KA 4XP1L 5AUMB 2KI6A 1MHHB 3GSWA 1DEEA 2ZZUT 1TQTA 4DNLA 4ZS7L 4ODTH 3L5WB 2OMZB 4LSRH 3T2PA 1NBZA 5LGJA 4GB9A 2VW7A 3BN9C 3QJVB 4R4FH 3PJLA 5C0CA 2PYEE 4D9RE 3L3OA 4RX4D 5CP3A 1ADQA 3NFSH 4JM4H 1TPXC 4XN2A 1DBBH 1EAQA 5IFJB 5A7BA 3GSNB 3ISRA 2ATPB 5JXEA 2XDHA 5GS0H 3FQTA 5GGSY 5IHZA 4UM8B 4GRWH 3SODB 3EO1A 1ZD6A 4HP5A 2XWEA 5I1DA 4OQTA 5IBTH 4B0MM 4AMKL 4UTAL 2Y5EA 4N6RA 5CR8A 2BNUA 1MW0A 3K6NA 2XVLA 3RDJA 1YEFL 1LTXA 2G2RB 4XNUL 3CZKA 5TK2A 2R9HD 4TNFA 3ULUL 2J6EH 4E42B 4P23C 4P06A 4N9GA 3PDDA 2W9DL 4MJIB 1SN0A 2YA0A 5DRZA 1N6VA 4URKA 1KCVL 2BP8A 2PKDA 2Y06H 1WIPA 5HI5C 2WTOA 5TE4L 4BWUA 2QFPA 4UV4H 2BVPB 3OLDA 4A7VA 1LEKB 3D3VD 1GR7A 1U8LA 4PJEE 3RL2A 4CC0A 5CZVL 4LLYB 1H8SA 3FSWA 4EDWL 3K8LA 1PZ2A 1QBML 4AJWA 1JF5A 1TNNA 3UBGA 4UINL 1ECYA 1B4TA 5AKVA 3CPUA 5KANG 5GPRA 3M6DA 4M00A 4XMPL 1D3CA 1RD6A 4U6YB 4HS6B 2JQAA 5H8DA 4NRXB 1C08A 3BCDA 4MCZA 5C0BB 4HIJB 2G5BA 3LNGA 4PMFA 4E5XG 3QBTB 1FE8H 1WFTA 4YAQA 2UYLB 3QA3B 4YXKL 3KNBB 4P2YA 1ACYH 3ULVF 1JGDA 2X38A 4QOKB 3CVIH 1TQCB 2QHLA 1TU2B 4RSVA 4Y5VC 3ZKNC 2C3GA 1N7ML 4HUWB 5CSZA 4NAJA 1LGVA 2O5YL 3OG4B 2XTLA 4ZPVA 1GOHA 3O6ML 4MMYA 2DDQH 4NPYB 5SWQB 3DJ9A 1XR9A 1VHPA 4HV8A 3HC4H 2I7OA 2EYSB 3C9NB 3MJ9A 4UT9H 4AYGA 1HZHH 4HWEH 1FZMA 1WUNT 3HBPA 4UYPA 4YDKL 2GJZB 1WISA 2LGNA 1OY3B 1RZKL 5H4YA 4MQ7A 2A77L 3IMUA 2A9NH 4AVKA 5A3ID 4P2QD 2QQKL 4ELDA 4RA0C 1TTRA 1BXAA 3GMRA 4QAMB 1R3KA 4DP9X 1BQHA 3KXFE 1RUQH 4MAYC 3HHSB 2FH6A 4PJDB 4TSCH 5T1MA 3TEYA 1ZV5A 1GXEA 5FKAA 3HZYB 5FLVA 4U33A 4PJGF 2L7QA 3W0WB 3U6XS 4G1EA 2A74B 3C12A 3FCUB 5LNGA 2DLIA 1HEJC 2Q5BA 2H3XC 3E8VA 3JV4A 5KS9A 4Q97A 2CXGA 2I9LB 1CLOH 1IJNA 4OU3A 5AG8A 5EEWA 2FB4L 1H5BA 3ZDXB 1FC2D 1RZ8B 3GIZL 2AC0A 1BA9A 5MENE 4U3SA 4HCGA 1JD9A 3B7YA 2DQDL 1ZTXE 5AYTA 2P42B 2ZKWA 4L4VA 4JFPB 5E1IA 3V4VA 5ENWB 1AGEA 5KSAD 3CQPA 3H9SA 4C4KO 3B43A 4P5TB 4Y4FB 5F2FA 4NJAH 1R4XA 3UJIL 4JFFB 1WZMA 4LPXA 1CG9B 3QHZL 1ASPA 1QKZL 4KDTC 2F54B 4LEXH 1XZ0A 2WY3B 4HUUA 1KULA 3AG4B 2NOYA 2R83A 4FFZL 1V8HA 3QNFA 3ZDZF 2Z1KA 4PP1C 2DWSA 5IFHH 2C26A 3LIZA 4GQ9H 1U8QA 3EFOA 4H1LH 4IU2A 5I6LA 1QTPA 3KM2A 5HD8C 3G5XA 4QO1A 3N44F 4YXHL 3TBBA 2EKSA 1A02N 4JO2L 1CK0H 4ZNEA 1U33A 2LVEA 3WN5A 1RJZB 2HZHA 1T5KA 1HEZA 2ZYRA 4QCIB 1BZ9A 1SLVA 3KZ8A 3BVWA 5KSBF 1P84K 5LBSA 3P40A 2JTYA 1B3JA 1WS8A 1I8MB 5B8CB 2ZYSA 1XZWA 5C0CD 4AE1A 3VQ1C 3NFPA 4YLQT 4I2XA 3SE8H 2CHXA 3HPLB 5C2UB 3FQUA 2YD9A 3IF1B 3ZTDC 1HHKA 5GIRB 1BX2B 5FUZL 4R97B 1BEYL 1QBLL 4RGNC 4DJMA 2QQLH 1TOXA 4GFTB 5SWSB 2AJZB 1RXLA 4NZUH 1XF4A 4NO0B 1TVBA 2VXTL 5HDLA 5B1BB 5CEXB 4G6JL 1U3HC 1CUOA 2APBA 4J4PA 4KPHH 1KB3A 3EBAA 3PY9A 3V6BR 3W9EA 3F7KA 3POHA 1BFOA 3DX3A 3IFOA 5L9DH 4KK8D 4PRBA 2OTWB 2D31B 4JKPL 2F74B 1OANA 4MZRA 1G9ML 1A1NB 4LOVA 4ELMB 5AOJA 5JUEH 3JWNH 3LCYA 4F24A 4OKVB 4NENB 2JKNA 3CFBB 3CMGA 3OAWA 3D2UB 2YARA 4JG0H 1HH9A 4PP2B 3G5VA 4CILA 3D8MA 1JP5A 2VDMH 4W93A 1F2QA 4ZYKA 4YC2C 3VDCA 4TXVB 1FYTE 3IJSA 4GS7B 1RSYA 4K9EC 5AYUH 5HDWA 2NY0B 5HJGA 1MCCA 2HKFH 2B0SH 5FUCE 3BO8A 1W6LA 2D3VA 5JHLA 3VI3B 1UYWH 4EVNA 3GGWA 2J5LB 3MUHL 2OR9H 1PEWA 3WS6A 4PJCE 1XH1A 3HE6D 1OAUH 3KPRD 5F6HI 3CMOH 4UTBH 3VX0A 4PYGA 4XN1A 1N19A 3FO9B 5FO9B 1SHXA 3VXOB 1XIWA 5EOQH 4N86A 2JXMB 1FL6B 3OKKA 3QH3A 1OGAB 4XVJH 3B2MA 3WJLA 1NCHA 3QUZB 1LL1A 2YAFA 4HD5A 3UO1H 1KEGH 1LO3L 1ZTMA 4D9LH 4CVWA 1W8NA 3I6GA 3MNVB 3CN0A 3US1A 3Q2WA 1IKNA 4PD4J 3QEUA 4KQ4H 4HC1A 1IAIH 4HEPA 1CVRA 1SJHA 4IRSB 2WJ5A 4AC2A 5IREA 3IETB 1G6VK 1EZVY 2EDBA 2JB5H 4M3JA 3BZ4A 1GH7A 3CSPA 4XAKD 5I5MA 1WA2X 4L5FL 4FI7A 4ES9A 3GRWL 2FBJH 3K8KA 4FFVD 3V6OC 4Z7VE 2BWDA 1F02I 1KDJA 4TSBH 2JELL 3OXSB 4PQXA 4Q6IA 1H6EA 1A3ZA 5IBUG 4K15A 2P5WA 4BFOA 2B1AH 2FWOB 3QEQA 3DPDA 2NY6B 1T1XB 4NWTL 5JOEA 3JWDL 1KBBA 3MLWH 2W38A 3QCVL 1EV2E 1EANA 2GHZA 2NY2B 3ZE2B 2NY3B 4FEIA 5CGBA 4M6NH 2VW6A 3CDGB 1OALA 1GJIA 1HVXA 2CLVB 4L8DB 2K8MA 4BK5C 4L4VD 3G5YB 4RESB 4PWEA 5H94A 3S5YA 4E9VA 5DHYB 4NM8H 4YHLH 3H9SD 4FAAB 2EKJA 1A4KA 1M1SA 5JQIB 2Q7AA 2VDQH 4FQHA 1J0YA 2NSQA 1R33A 5GSRB 1KGWA 1I85A 2WKOA 3ARBB 3MLUL 4PJDF 4MSWB 3MMEA 1YJDC 5IB5A 1PVHA 4Y1AE 5CJ8A 3L3IA 4KK9D 4NPJA 4K71B 5K59F 3BT2L 2AABL 4YHML 5FF6A 3N1GC 4MCNA 3A4FA 1SOXA 4M8VA 4NO3B 3CU1A 1GZHC 1QFUH 1RFDL 4OAWB 4PRPE 5IHUL 2CHNA 1UZ6F 1UTDA 1FHNA 1HU8A 4UB0H 3ZDXF 4BDVA 4A7QA 1P7BA 1LO5A 5A16A 3U6RB 4AIXA 2ARWA 3RIFF 1F4XH 1HDMB 5DTFA 1RVFH 4XP6L 4LF3B 5DJZB 5KVFH 3HCVB 1VGEL 3ETTA 4JE0A 1C5BH 2OTPA 5K9KA 4GMSH 1OCZB 2GFBA 3MDJA 1OK8A 1KLFA 2V6HA 4QT5B 4Y4KB 2AK1L 5I18L 1ZKAA 2EVJA 4BE5A 2X2IA 5GGSB 5E9DA 1U8NB 2QPEB 5EOTA 4H2CA 3GYRA 5B3JF 3ZE0F 2IH3A 3AU1B 1OM9A 5ESQA 4J3OF 1NPJA 3QDHA 2VISA 2VDKH 4FX5A 4PJIA 3EYVA 1USZA 1ORQA 2Y4SA 3JZYA 1J9TA 2ENSA 2YEZA 1N8ZA 1H3PH 2W81C 2WUBL 4AKOA 2WM0A 1LEIA 1KIQA 3EUUA 2ZWSA 5E2WH 3IDNB 3RY4A 5H35A 4Q9QL 4XAWL 4N68A 2WANA 5BJTA 1NIAA 1X5GA 4RAVA 2HVJA 3BPLB 3NEOA 1N67A 4M7JH 3ULVH 3BKCH 3HS8A 4Q4IA 3V6ZB 3CGTA 1QMUA 1VGKA 1SJXA 4GMTH 3EH2A 3IGAA 5CNHA 5C3IA 4MRCA 2R1XA 5C09A 5DO8A 1CF1A 1DO5A 2X4QB 4X6FA 4TRPH 5CLXA 4XNQA 4WV1B 2NPLX 4DQOL 4YDLB 2Z35B 4ZD3L 1AACA 3L95A 1RIUL 1D5XA 2OQJA 4XNXH 5I0XA 5HXMA 4X7FC 1N64H 4Z77B 1U3YA 1E28B 4L3FA 4UQIM 1I75A 1XIWD 2MHAB 3T6WA 2ED7A 2LOEA 2YRBA 2VR9A 4EF3A 3L9RB 3D3VE 4L9LA 4KX8A 1CFTB 5D5MB 1F3JA 3WKPA 4Z76B 1J8KA 4C83A 4ELMF 3OJ2C 4M6MH 4A6YH 2E7MA 2ZX9A 3O4OB 3ULUE 1L6ZA 1PD0A 1DVFB 4FNPA 3CH8A 1NOLA 3LYRA 4U2ZA 1N5AA 3NRFA 3LAFA 4M29A 3N41B 3G6JE 3DX6B 5GHWH 3TURA 4TTDC 3T3ME 1RZFL 2D2CC 4IIQB 1XF5B 1MI5E 3I85A 4IRJA 1JV5B 5I8OL 4IM8A 3MYZA 5HYSA 3WIHA 3M8OH 3EO9H 4PUBH 4N0CD 2WTRA 1D2PA 3TJPA 1NUGA 5D1QB 5K9OA 1EZSA 2WXIA 4ZO6A 2C1PB 3HNSL 2H1PL 2DYRB 2P5WD 4HS3B 4ZQTA 4FQIH 3QEQD 3VYNA 1NAMH 1JXJA 2V9TA 1INEL 3O8XA 4G5AA 1CLZH 5BO0D 1BFSA 2O6FA 2OJ1A 3RL1A 2PYFB 1SDDA 4DCQB 2AQ3A 2WKLA 3VG9C 1S9XB 1OWWA 4WHTA 4FXKC 1Z3GL 2CHZA 2F1AA 2EO9A 3BVDB 3GSNL 5EA0H 4Q74A 3BWZA 2C7UB 1EHAA 5BRZB 4IOIB 2OMTA 2ZX8A 3B5HA 5HPMB 5IM7A 2YFNA 3FXIC 4YE0A 3CZNA 2ZKHL 3N1MC 3U0PA 1JK9B 2WGNB 4S2SA 1DQQA 4MD5B 2UWEE 2NTSP 4LHJB 4G7VH 3BPNC 5D6DC 1U8OB 3ZKXB 2F5AL 1XTMA 3TONA 1M4KA 1U8MA 4JB9L 4KJWD 4D3CH 2R15A 3HPJA 2TAAA 1QASA 2YPVL 4NPKA 3VH8A 2H47C 4XCYA 4AIZA 5BRPA 4UQAA 3PABB 1T2XA 4R2GC 1ZIBA 3N6YA 2BOBB 5DGRA 4NQED 5DRNA 4I9WE 4UQ2A 4PWGA 4NUQA 5F89A 2DIJA 1MDAA 1XGQB 4XP9L 3MRNB 3U4AA 4YDZA 4ZTPH 1GHFH 3GXNA 4O4YH 1FZKA 1L0PA 1NCNA 4NZTH 4KITB 1G6RA 4W6WB 2FATL 5AVWB 3L5HA 3WS3B 1G9NC 2NQ3A 5DZOA 1Z5LB 3SO5A 3ILQC 3DYMA 1JYNA 1J1XL 3L3GA 3FOLA 1RIHL 5FXCH 4FTVD 4YHNA 3OVUB 1A1MA 2COVD 4AH2A 3B2VH 4JK0D 1U42A 2AVFA 1D9KB 3HFML 3ZZQA 4Z3TA 3K74B 3BAWA 4HK0A 2G30A 4W4OA 4JCLA 1U36A 4ZMZA 2W80C 5I75C 3BLBA 3GIVB 4WQOA 2LU3A 2QELA 1E4XH 4OZGA 1XGYH 4OCXH 5EU6B 4PLKD 4S1RH 4B3EA 5J3HC 4EN3D 3SKOB 2X3CA 2F7QA 4AGMA 5TE6L 5E6SB 4W9FC 2Y7OA 1AJ7H 3B6SA 4JM2F 4WTXA 5EUOB 4QTIH 3BCFA 5BO1H 5KBMA 3S2AA 3DJZA 5LHDA 1BMWA 2N1TE 4MCYB 4U4BA 5C09D 4R90L 1BP3B 5GJTH 5ITFA 1T89A 3QRLA 1KMGA 5T1KA 3V4UL 3DPBA 5FW7A 1BV8A 4HXAH 1B4JL 5DJ8A 4M8QB 3J07A 3C6LA 1JI2A 1GRWA 2EXWD 3EUDA 3RX7A 1V3LA 4IBLT 2E47A 1T1ZB 3T4AB 2WO3B 1K8DB 5TH2B 2R2BA 3L7FB 4DOHB 1IILE 4R3SA 3JVGC 3L6FB 3V95A 1ZJAA 5F3BB 4Y2DC 4AC4A 5MHSE 4FERA 1MAKA 5ITBH 5C0ND 3QNYB 4PVLA 1RUAH 1S5IH 4HMEA 2VDRB 1I7ZB 5T5FH 3SEPA 3K1KC 5JPMC 5L7XH 5CCKH 4EZKA 1A7PL 1FFQA 3P4MB 1Q94A 2DQJH 5KSVA 2VABA 3Q8CA 5F7YC 3MRFA 2W65A 2LU7A 1MUJB 5JXAH 2ZUVA 1UD6A 4R5VA 5FM4A 3TT3L 1MWAA 3DLQR 1U3JA 4IRJD 3NIFE 3FCSA 5E5UB 4LCWA 3KPRE 7CGTA 5I1IL 1NL0H 2X4UB 5I26A 2F6AA 1ANUA 1HE8A 4PRDA 1SNRA 4I3RH 2AKRA 4JFEA 1H8LA 3QHFL 1X4XA 2DBLL 5C0AA 1KTLA 4LSSL 3G9VA 1M71B 3L4XA 4JG9A 2ARJQ 5INCA 5HDBB 3HR5A 4ZX4A 1XGPA 1A3LH 1C12A 1O6VA 3RUGF 5HI3D 1HXYB 3AS2A 2MQ3A 2C4FT 1VFMA 4JHBA 4PRHE 1QR1A 3HZMA 5IZ7A 3L5XL 1XT5A 1X4ZA 4NT6B 4ONFH 3P3TA 3SIKA 4NYLA 1IQWL 1JOIA 3QPQC 4JFHD 4U6VL 3BUIA 4RQQA 3VXRE 2YFOA 4FE9A 1WWAX 1JWUA 1KJ2A 2Q8BL 5FGCE 3LEVH 3MRCA 3LRGA 4LCYB 4G6FB 4R96A 1BQRA 1NZRA 1JZDC 4JPWH 4M62H 4XXCC 1H3GA 4ODSH 1MY5A 2Y7MA 1QW8A 2A6JA 3EF4A 4WFED 1BM3L 5JNYB 2FZ3A 2C9XA 3JTSB 3SDXF 3AAZA 4L5FE 3PAYA 1J0JA 5IMLB 3E6FB 4GI6A 4X7EC 4GQQA 3MLRL 1QSEA 3CIQA 1JIBA 4MNGE 5DFVD 4GAYB 4P9HL 4J3OH 1X5XA 1KC5H 4U1MA 2Q87A 5J11C 1CE1L 1OTSC 1Z9PA 3HI5H 4FL4B 4XO5A 5EIIA 5EBMA 1IGIH 3CZLA 3S97C 1R19A 1AVAA 3ARFA 3NDZE 4FJZA 4BZ1H 3TBSA 4DERA 5J1AA 3K6SB 4XBEH 2QPUA 5EN2B 2V0AA 4ZFFA 4IDJH 1HSAB 1UB5B 3QIBC 5D93B 5LAPA 4F3FB 1N3NA 4LE8A 4IMKC 2BSDA 4UIMA 3SDCC 2X4NB 1E6JH 1WZ1H 4PGCB 3S3DB 3BZFB 4FQLH 4RETB 4TL5A 3CC5B 1BVKA 1Q0XH 3MOAH 2YPKA 2QR0B 5B4MD 3ZKMD 1E7UA 5FGBC 3GMOB 4OZIA 1XDTT 4A7SA 3QRGL 1CFVH 1ZHLA 1E9OA 1MHPH 1WTLA 1MZYA 1WK0A 8PAZA 2IQ9L 1TZAA 3OAZK 5GZOA 4WW2C 5IJBC 3NABH 6PCYA 4O58L 4YHOH 1KTJA 3H56A 3NJLA 4GAJL 1B0GB 3CFCH 4WK0B 4YZFE 3DX0A 5C08A 4MMXC 2FNBA 4M5ZL 3RWGA 1SEBB 3MA7A 2AJUL 3BFQG 3D85D 4TNVK 3QDJD 1ZE3C 2DL2A 3LPWA 4HKXB 3WTSA 3LQZA 4GSDL 2ICEA 3QYCA 2VZ1A 2YSSA 3OHXB 5ICYB 2R8SH 3QQ4A 5T1KD 5E8EA 5D7JC 2D0FA 2GEEA 2XIDA 4JHAL 4KK5C 3UOAB 3P54A 4FA6A 3WYRA 5CD5D 3C6LD 1ZSDB 3QORB 2ZCLL 2IAAC 3QEHB 1ZS8B 4UF7C 3T2NH 1IGFL 3UROR 1QLFA 4NBZB 4LSDA 4KMQA 2IALB 1NGWA 5D7LB 1KBWA 2QQQA 2A6IB 4XO4A 3PDGA 4IBYA 3VW3H 4H8WC 3OM3B 1ZT4B 2AJYL 4AUUA 5EO0A 3DBXA 3BW9A 3IJYB 5JQ6L 5JOPE 3IGLA 3KLHC 2H1LM 5IHWA 4WU5B 3IVKA 3VFOB 1QRNB 1QATA 4ODXB 5C0GA 2UY6B 2Y07L 5AOMA 2PPAA 4LRNL 4D2NA 2WLLA 4LCWD 1DBJL 3H6JA 4EMZA 3ZIYA 5KAQG 4XZUA 4DK5A 2EYTB 4KRPB 2IXQA 5EZOL 3QQXA 2QKIA 3F7YB 3FZUD 5C0AD 4GXFA 5D7SL 5KUMA 5AOLA 4ZFGL 1QSFA 3D48R 2ROYA 3MLSL 5EO1A 1JZ6A 4BFEA 4PW4A 4ZUSA 4NCC2 3HR6A 4WJ5A 2D7TH 1PZUB 1N9PA 3QJRB 4E41B 3RNQA 1T1WB 2IDUA 1JZHA 5B1AB 3T77B 4Y16C 4GKSB 1FVDA 4X4YB 1EUTA 3OKLB 1URIA 1T7XA 3NESA 4HIHA 5DQJA 2RFXA 5D72L 5HHVL 4ZS6C 3KPSB 3MNZB 4HJGA 1WZAA 2GIMA 5FFLA 3GFUA 2ZICA 3CCHA 3IAQA 3Q8BA 4P46A 3ZYJA 5HYIA 1A6WL 5CBAA 2MEJB 1CLYH 2J2ZA 4UM9B 4NXSA 2EQDA 2VWEC 1AQKL 4H20H 4XH2A 4PJ7B 4PWJA 2Z1PA 3OQ3B 3MREA 4I88A 4DP4X 5FO8A 5C1MB 3TVMA 5GGUB 4IKIA 1RZ7L 4PJBB 3QZWG 1FF5A 3N06B 5AVXB 3QARA 2X2YA 1JRHH 1B6DA 2DQEH 5TE7L 2FEEI 4XNDA 1IEBB 2FEDD 5HDBF 4C56B 5CJOH 1TCRB 3VXME 5DZJA 1KV3A 4UAOB 3U7AA 4OI7A 2X2HA 4HT1L 4GAAA 2YBRB 3FFDB 3U4BH 4A7GA 2TSAA 3LNFA 1CLVA 1EZUA 3TNNB 5IVZB 1U8JA 4H1LB 2VR4A 3BSHA 1I8KB 1MN4A 1YQVL 5CILL 4BQ9A 3VGFA 1MJJB 2EEBA 2R69A 5DWUH 4EBQH 3GPEA 1IM3A 4F27A 2EXTA 2H4EA 3FOMB 3L54A 2E6QA 3O81A 4JZJC 5GZNC 2FR4B 3WLWC 1GYCA 3DSFH 3L1OL 1PZAA 4HSQA 4NKOA 4RWYL 3BPCA 1Q0YH 2CCVA 2IJ0C 3IDMA 3ZX1A 2ITCB 3NCXA 4MMZC 1FQ9C 3HIZA 5TDNB 4JANA 3H3BC 3U6XA 2BO0A 5DURB 5DS1A 5FV2A 1IVLA 1I8AA 1IFHH 1ZLUK 4KZEL 2IV9A 1MFMA 4Z23A 3R0MA 1GL4B 3EDEA 4FTVE 5CN2A 4EQ3A 5GZOD 2LVCA 4CVZB 2IAND 4JBSA 1WP6A 3D34A 4EJ1C 4J6RH 5FFOA 3CHQA 4YPGB 4HSCX 1ZLSL 4FRWA 3UG3A 3TBYB 5SWZA 3MV11 1AXSB 2E76C 2HH0L 3EGSB 3QUGA 5MEPA 3P9WB 1DN2A 1OIOA 2CO6B 4NQSA 5DUBB 5F0LB 5J12B 4OD1H 5F9WC 3B2PA 1EDQA 2XXFA 3C09B 4W9IC 3MRDA 4RVBA 1LK3H 3NSJA 1CGSH 2YUWA 2FSEB 4N2MA 2E75C 1DJZA 4ZW5A 4JY4A 4JO5A 2VDMB 4LHUB 4AQ1C 1WFNA 3ZIMA 5AOKA 4ZRGA 1KFGA 1MCJA 4MD4A 3VFVB 5I16B 3VWJD 2FX7L 5HI4D 4JPVH 4KKQA 1U3NA 3RWJA 3T8VA 1JK8A 2OMVB 3IDIA 2XKSA 1RK7A 3JWOL 4PJAA 3WKMH 3BI9X 4M7LH 2OP4L 1MREH 5E2VL 2TSBA 3HMWH 2G4GA 4YN3A 5IW6A 3QFDB 4Y4HB 1Y0LB 4HH8A 3SQBA 3BP7B 5AEAA 3C8KB 2FIKB 2J8UA 4QEGA 1R3IL 4IGBB 2ZNXA 4OM1H 3S96A 1DJWA 4IHBA 1THAA 3RVUD 2BOLA 1P7QA 3II2A 1MCBA 3MV7B 5EBWB 3AB0C 3P11L 4YIQB 1J0HA 4S0TD 4DKEL 3U2JA 4LCIL 3LS5L 1KUMA 1BD2A 1WO2A 1FL5A 2ITDA 5EF0A 4F7PB 4K9JA 3VI4F 3BESR 3GHEL 4BYHA 3F12A 3LMJL 3W0WE 2Z8VC 4NZRH 1MPAL 3Q01A 4UUJB 3VM5A 1VKXA 4AM0Q 1WBXA 4DO6A 5HP5A 1OAZH 1OGTA 1U8PA 2FD6L 4LKCA 1MFAH 4PWFA 4XCFL 4GG8B 4HEMA 1UXSB 3UTTA 5I6XC 1Q0EA 4FCHA 2ATAA 2LU4A 3F65A 3KPNB 4WI9A 2ADFH 3FUJA 3RWCA 4P46D 1HFUA 1HCYA 4M6OL 3T0EC 1XFPA 1TMQA 3H4FA 4FKHA 4NQDD 1J10A 2J73A 3LV3A 4JFFE 3ZDYB 4AQ8C 4OVUA 1EHXA 2DQTH 3FN0H 2EH7L 5CF3A 2JQMA 5FHAH 4XMZA 1HIML 2OL3L 4MJ6A 4XWGH 4G70B 4IKKA 2EJ1A 3IGFA 3V0VB 3TVMD 2VN5A 3ZTJH 4J28A 3ASOB 3QDAA 4PJFA 3RHWK 4BSVA 4PBVC 3ZLQC 1OQOA 3NDYE 4G9FB 2VXVH 4YSCA 1NCWL 43CAB 2PWEA 1FZOB 3L1EA 1XMWA 2HMID 1OVZA 1UWGH 3FB8A 3BP6B 1I9JH 4Q2ZB 4KKBC 3CZUB 1PY9A 3AABA 4XNBA 1CXLA 4G8IB 4PJHA 1UM5L 4XGZA 2OCFD 1KB9J 4PD4K 4PY7A 5DD1H 3ALXA 4PLOB 4NKMA 3EYOA 5KANI 5K39A 3FO0H 1O9VA 2IH9A 3DOSA 3G7TA 4KNUA 4NQQA 5DD0H 3TIEA 3VD5A 4F9PC 4JDVA 1IM3D 3P2TA 4ETQA 1ERNA 2XFGB 3FU5A 4RGOH 4R8WH 3WOVA 2UX6A 1YUKB 2V7HB 4M8UA 2B9BA 6CGTA 1OF0A 2W0LA 4K7PY 2EEFA 5DWPA 5F1SA 3S36L 3TO4D 3UBFA 1D5MB 1SOQA 3A67L 4HGMA 4Z7OF 2Y7NA 1DJSA 1Z9MA 2NR6A 3EFFB 4U1GB 2VDRL 2BSSB 3IBOA 5FUCC 2HUEA 1YJDH 4P59L 3IDXH 3BAEL 1JF1B 1UH4A 4UAHA 3KAAA 3TT1L 1Y6NR 2FLBT 4HU2A 5KVDL 3VA6A 3R7RA 1I1AC 1MHEA 1W8EA 5EC2A 2BMKA 4N0UB 5E6ZA 3ARWA 3HHRB 3O2DL 2EVGA 1RIVH 5SX4H 5SWZD 2XICA 3AVEA 4F80A 5I1CH 1KEMH 1SVZA 2V2XA 4PW9A 1LDSA 4L1LA 3U79A 1I7UB 3HE7A 4XNZB 2J88H 4HPYL 1ZJBA 4UQ9A 2NQCA 5J7CC 2WCGA 4L8SB 4O5LH 4HZLA 5IHBA 2NNXA 3QUHA 3C8HA 4E9LA 4YLBA 4HS8L 3W5NA 4B5ZA 4PSRA 4OZ4A 3ZJAA 2JWYA 4NQCB 3HVNA 5DT1L 2ICWI 2MOGA 3IMBA 5C0EA 1S46A 1HN1A 4XMXA 2P46B 4UTAA 2N7SA 1PDKB 1OGAE 3QDJE 5KJ4A 5D4JA 4GQRA 2HRGA 2Y24A 1I1YB 1TVDA 1JWMB 1K5NB 2CE6A 4IRZL 1DLFL 2FQFA 3AC0A 4OCYH 2NY4B 4ODHH 2XG4A 4XMTA 3KJ4C 5DYOA 4QHPA 1NSNL 1P7QD 3MUUA 3F64A 4G7RB 3NK4A 3Q1EA 3VRLF 4B7IA 2NZ1A 3LNIA 3MGTB 4GI8A 1K4CB 5D2LA 4KZDH 3EFDH 1A7QL 3UCRA 4MDJA 4MX7A 3OAYH 3W2DL 1QA9A 2EDXA 2N01B 5IGXL 3D0LA 4QUOA 5BXFB 1BD2D 3B83A 1AY1L 4D9QE 2ZCKH 2JF1A 1E3FA 3V8OA 1UEMA 2XBTA 3AITA 4NN7B 4OCSH 1GGBH 1UGNA 1OB1A 1YEKH 4PG9A 3W56A 3QIUC 4WIQA 1OP5H 1K6QH 1G7MB 2JVUA 2HTLD 5FA4B 2WN2A 3D69B 2ZUXA 4KUCF 4AEFA 3UTTD 2FECI 1A2YA 1R3JA 4OFPA 2E27H 1I8LC 1I7TA 3MRPA 1XH0A 2ATKA 3BFWA 4ODTL 2XTJE 4F1SA 6TAAA 1F6AB 1S9WA 4LSRL 5KBLA 4PS7A 1IIKA 4QRQB 5I8EB 1MVUB 1T0NB 2Y7QA 1MLBB 4R4FL 3L3HA 3DIFB 3JT0A 3ZGIA 1NAMB 5D1ZB 1LDPH 1AZRA 1UGKA 3NFSL 4JCWA 1S7TA 4JM4L 3K6FA 1KB5H 5KOMC 3NQIA 3RVWC 2WLJA 1XD1A 2X2UA 1HZLA 1BDYA 3X14A 5GS0L 4W9EC 2I69A 4AENB 3S5LA 1T2JA 3GQFA 1CTOA 1BGXH 4G6AD 1FFNA 4TLSA 1NMCC 4UOW1 3RWDA 5IBTL 1AFVH 5KVEH 4L1BA 2HWZH 5IJVB 2MPAH 4BH8A 3QS2A 2PR9A 4BM7A 1BZEA 1T21B 3HNTH 4P2AA 5FM5O 5KTEH 2VQ1A 3ZE1B 4LARL 4ZBJA 3VO0A 3FRUA 2MIZA 4IOSA 5JW5B 2CBOA 4XMWA 3TESA 5ISZE 2Y06L 2QADC 3SGEH 1IAOA 1MKFA 1PJWA 4UV4L 1WTGT 3K6OA 4QLRA 3NA9H 4DEPB 5C6WH 3TJHD 4AGPA 5HYJA 4F15B 3PWUB 5KYUA 3GHBH 3HN3A 2RCSH 5C7ZA 2OSLB 2DTMH 4BSWA 4I3GA 1A6ZA 4N0FB 2WPGA 1UG9A 3RAJH 2X70B 4MNHB 2NR6D 2XWTA 4PV8A 3ESNA 1PCXA 2BRRL 3APDA 2R9HC 1IL1A 3UX9B 4RMWA 2BIHA 3H9HA 4OGZA 4Y0GA 3VDAA 1PYWA 4V11A 3RTQA 2WVTA 4FFZA 1VZIA 1VJSA 2X7LA 2ZE0A 3PP3H 3PWJA 4TUKL 4WDIB 3SHSA 2UUDK 2EABA 1ACYL 1SDAB 3EGDA 3VFGH 4P2RB 3BUDA 4KQ3H 3CVIL 3COOA 1JMZA 4XPHH 4HGWB 4YDMA 3WEOA 1G84A 3BKJH 2E56A 5JIHA 3NMEA 4RRPM 2V2WA 2UXGA 2WYIA 2DDQL 4GUCA 1JPSL 3ZTEA 4Y2OB 5AFAA 2WMPB 2JKWA 3Q6FB 3RWEA 3BVTA 1S7QA 3HE7D 1G9NH 4UT9L 3BP5A 4KY2A 4G8GA 4X5WB 2VLKE 4QRRA 1TQVA 4N2BA 4KROD 2A9NL 3QUMH 1CMOA 1RK0B 4PVNA 2HKAA 4KO7A 4ZPTA 2JJVA 1AGBA 1D2OA 4JGMA 4TSCL 4KJQC 3X3FL 5L6YH 4PG2C 2VXQA 2IANE 1A9BB 3SQOH 3S8FB 3WDHA 4WJG3 3H2WA 4LPWA 5EZJB 1GZQA 5AG9A 4P5MA 2V5SA 3RWFB 2NTFA 4P2OC 3QZLA 1BHGA 2K6YA 1VESA 3N42F 5I5JA 3IKCA 2YRZA 4S1DD 1QBBA 4CC4C 5JPNA 3DMMB 2WAHA 4KMTH 1SMAA 1JG9A 1CLOL 2DJ4A 2UY7A 2WTPA 3LXUX 3SBPA 4HALA 3FB7B 1OE2A 1FO0H 1P5VA 1UD5A 1XSJA 2O5XH 3D18A 4JG5A 4BFBD 2J1XA 3BGMA 4A63A 4R83A 3K0WA 3U48A 1AGFA 5A3IC 1I4FA 1HSBA 3AY4C 2IF7A 3GTNA 1UB6B 4NJAL 3X1FA 4N8PA 1JGEB 3SYPA 2OAAA 1AMXA 2F8VA 2H9GB 1MW1A 2VT0A 4LEXL 1LHZA 3WE6A 5EEXA 1FAIH 1CGYA 3BD3A 5J57B 3GKZA 5IFHL 2R23B 2WXFA 3V5KA 4GQ9L 3FAWA 4NZDA 1IB5A 2F2HA 3BHBB 2YPLB 2AJVH 1X4YA 4JVPA 4U49A 1P6FA 5LBVA 2N0KA 2O26U 1CK0L 3CSYA 5ICXA 2ZKMX 2EILB 2PN5A 4Z7UB 2BC4A 1PKQB 4Y9BA 4MFHA 5D8JH 1S3RA 2F8IA 1W0YT 3AXLB 3K7UA 5KSAC 3NFNB 2CU9A 2HT2C 2H26A 4YE4H 3VGGA 4B9FA 2F8XC 3QZPA 5DA0B 1HEHC 1RZIB 4HX1A 3FMGH 5I17B 3HB3C 4ZUWA 2R0ZH 3QYNA 2CR6A 3L7EA 3WEXA 3ZW3A 1U8CB 4X5RA 3L3DA 2DM7A 1IGYA 4DWHA 2CRYA 1T3FA 2MCPL 4JJ5B 2PF6A 3DX4A 2HRHA 1DVXA 3GJEA 4TSAH 5T1LA 3T4YA 4OUOA 3GRWA 2AP2A 2NUPA 1ZHNB 3PQYB 2E7HA 4F37K 1SPDA 4XOEA 5L9DL 2D03H 4KKPA 2EDQA 1E8YA 4NQDE 3WUWB 1PF3A 2CKBH 4IOSD 4JG1H 4P5RA 4A7UA 4YSDA 3WXVL 3K91A 5EPMB 2P5EA 3GT6A 3DSNB 3MLYH 1A7BA 1R5IA 1HTYA 1IFRA 5GJSH 5JUEL 3WJMA 5AENA 4FNLH 3KPOA 1I7RA 1NFDE 4M5SA 2LABA 4PGBB 4JO1H 3BN3B 1X9QA 5L4MA 5FHBL 3SGJA 2VDML 3FTGB 1FAKT 2NX5E 2CNYA 4FS0A 2L7UA 3KBHE 3TBVA 1EMTH 2PWGA 4LSVH 3DYOA 4FQXB 3PE9A 5AYUL 4AVHA 4EI6B 3FPXA 2E7LA 3SPVA 4K8RC 1CGTA 2HKFL 2B0SL 4GG6B 2A9DA 5KYWB 4IKJA 1UYWL 2CM6A 4N3UA 2G75B 3EGXB 3KE0A 2OR9L 2KZBA 3DGGB 4WW1A 3RTQD 3WNJA 3U9PH 5CU5A 3CMOL 4UTBL 5T3ZH 2VLRA 1GGTA 4YSAA 1NUDA 4OD2A 2NW2A 3L81A 3TIDA 4OGYH 2HG5B 1G7PB 1JPFA 2DPKA 1KY7A 4NHUA 3TZVB 2FTAA 1M3IA 4XRCA 4XVJL 5EUOE 4F8NA 1SEQH 5AVYB 3UO1L 2GSIA 3MRIB 3U1QA 4ENED 3QJZA 1NBVH 1GW0A 5E6IB 1CCZA 4KQ4L 4DO4A 4Q58C 1AHWB 2XCMC 2BSEA 3NG5A 2JB5L 4QRRD 3MJ7A 3HG4A 4JKNA 2Z92A 5DJCA 3V5DB 3PL6A 1DZ0A 2FBJL 4OIFA 3HE6C 5ID1B 2DMHA 1ZA6B 4LIQL 5TPWH 4A2HA 4X6DB 4TSBL 3FSOA 1DEDA 2VXSH 3QAQA 4URTB 5F0JB 5KG9A 2FO4B 2R4SL 3HMXH 3DX7B 2NNFA 3W57A 2JI1A 1TPXB 4PRIB 5CJXC 3PGCA 3MQIA 1UXWA 1L9OA 3NCJH 5B38A 1S7WA 2B1AL 3WNNA 2Y1AA 2R0LH 1BECA 1DVYA 2IO5A 1WZKA 1DDHA 4RFEB 2F19L 2WN3A 3MLWL 1ORSA 1QPKA 5TD4A 4HKBB 3HC3H 4X7TB 4HLZH 4Z7AA 3UTPD 2ZONA 2JJSA 3O45B 3FO1B 4MGXA 4ONHA 1L9RA 1H9VA 3WXWH 3IFPB 3DJRA 4N2OA 4L4TB 4NM8L 4P48A 4YHLL 5JIIA 4YPJA 5FM5M 3HW7A 1EXUB 3ZL1A 4BFKA 3Q06A 1JFHA 2OBGA 2OJEB 5GRUH 4P23B 3DX9A 3KDMB 2LAGB 1QLRB 1T0MB 1KXTB 4FFVC 2VN4A 5DI8B 5B22A 3U0TA 3WEBA 1EDHA 4PGZA 4R6UA 1DQVA 5A7EA 1ZE3H 3FAXA 4AQAA 2PW1A 3NIDF 4JY6B 3FTXA 4MNQB 4LSTH 3O6LH 3ZR5A 1INQB 4H0LC 1CYWA 5IMMB 3IFLL 1CXIA 4U1IB 1DUZA 3WE1A 5BV7C 3VRJB 4EUPA 5I9QC 4TMPA 3RU8H 1O6TA 2ZQKA 2DQIH 5D96C 4BQ6A 1MG3C 1AHMA 1UT9A 3PPSA 1KLUA 1QWNA 5DK2A 4QRPB 3U25A 2X4RB 3P0VH 1OTTC 2NNRA 1NFIA 1J5OH 2D4FA 4H8WH 4WJKB 1JUFB 2Y72A 4HJ1A 3NCMA 1QUNA 1F4XL 2J72A 3DO7B 1N6QH 1RVFL 2GG1A 1BQKA 2WV3A 4WU7A 2GJJA 3TEWA 1U91B 3B56A 2YO3A 1C5BL 2HVKA 1RZPA 4OZHE 2VOTA 3H55A 4GMSL 4J3OG 4U1SB 2XQYA 5DVMA 2CBTA 5D7IB 1MLCA 5AB1A 2F1BA 4KWUA 4FHKA 5DFAA 1F4WH 1MJUL 5JDJA 4Y5VB 3JTTB 2CRZA 3EYQC 1XGTB 2NUTB 4QXVA 1OCRB 1AS6A 4PV9B 5T1LD 1JDAA 1JNLL 1H3VA 4OFDA 5F72S 1WAAE 3OX8A 1ZA3A 5J9PB 5AUMA 1WA1X 1KXQE 2L8AA 4QGYA 2DTSA 1MHHA 1XBDA 4MA1C 1NICA 2OMZA 1H3PL 4JDEB 1MCEA 3VGAC 2FDBP 4X6CE 2P5ED 2O6CA 3IRZA 3BMVA 1W0WB 3QR0A 5B7EA 4MAYB 5GS3A 5LLIC 3I6LE 4YQXH 4HCRH 3PUCA 1NOAA 4OI9A 4M7JL 3P3RA 1G0DA 3BKCL 5FA3B 3D50A 5IFJA 2W92A 1E9PB 3GSNA 3PP4H 4EZMA 2ZJSH 4N25A 4R5TA 3ARRA 2F5BL 4UM8A 5DJAB 1FWXA 4XI5D 4FQCH 3UZVB 1L3WA 2WSPA 2YRLA 2ADIA 4KO9A 2YGNA 5AW3B 4E42A 4GO9A 3MJWA 1WFUA 3IDUA 1LP9E 4GRWE 2DWXA 2VLRD 3NJNA 4LLAA 4MJIA 5EDXA 1O5PA 1IBYA 1W72H 3IN2A 4N1HB 1J0ZA 1CDHA 1PG7W 5LGKA 4M6ML 4A6YL 1R3LB 2CMRH 1ZEAL 5IVXB 2BVPA 1FIEA 2CA3A 1LLAA 2JIXB 1LEKA 2J56A 4OGQC 3NJGA 4H4NA 4LLYA 1E43A 5DQ9B 4HWNA 3CFMA 5GHWL 5IB4B 5D2NE 2BSED 1O6SB 3HUJF 5F88B 4JFOB 4QRTB 3MCYA 5CIPB 4U6YA 3WS6C 3M8OL 3EO9L 4PUBL 4HS6A 4UTCA 1RI8A 5IR1A 4GG6F 4NRXA 4MAUL 5C0BA 4NX0A 4HIJA 4ZZKA 2DQUH 1YPZF 4KHXH 5IWLA 5AVRB 2YC1A 5CCHE 1I31A 4JZNB 2UYLA 5D7LE 3QA3A 4MS8C 4QWWC 1G43A 3KNBA 4PB0L 3ESPA 5IF0B 1WA0X 2IBBA 3AT8A 4N5EC 4QOKA 4FQIL 5A2LH 3SE3A 3VRIB 4HVBA 5KN5A 1MF2H 4OFQA 1TU2A 4IU3B 3EJCA 1NAML 4RGNB 1DSWA 4LEBA 1CLZL 4HUWA 4AY0A 2A6DB 1G7IB 4NPYA 4PN6A 1I1FB 5SWQA 4PGDB 5EA0L 2ODIA 3RDTA 1U3HB 2EYSA 3PIQA 1B0RB 3MRJB 4NOFA 4PI0A 2GJZA 3B37A 3LZQA 3TFKD 7FABH 1MJ7H 4N0CC 4EI0A 1PLGH 2X1WL 3ARPA 1TZ8A 1BJ1J 2PCYA 1U2HA 4J6IA 4G7VL 3BFOA 2J8HA 3HHSA 4PJDA 2EYRB 2X53A 1VEPA 4YHKH 4X8XA 3ZHNA 3HZYA 4Z7NB 1FVCB 4R4NC 4D3CL 5J89A 2A74A 4AUJA 4ZK8A 2C9SA 2MFNA 2LLGA 2A0LD 4YC2B 1S7XB 1ADWA 4E41E 1IMHC 5HHMD 5DJYB 1JZ5A 2I9LA 4ALAC 4XXWA 2Q7YB 1F56A 1KGIA 1RZ8A 2YN5A 3KPSE 4AQEB 3FC8A 4ZTPL 4H5SB 5LXVA 5DHXB 4AJVA 4GKOA 4HBCH 1M2OA 1UD3A 4JFPA 4O4YL 4NZTL 5DS8B 5ACMA 3J2PA 4A1RA 4P5TA 4Y4FA 3KBFA 4P4RB 3QDGB 3FN9A 4PJ7E 1UENA 1Z0NA 4F2MB 2G5UA 3QXUA 1KDIA 2F54A 3H2QA 3B2VL 4DVBB 1HXMA 2GJ6E 4FG6C 5HJBA 4PJBE 5F93C 2EVHA 3VACA 1ZTXH 2JKJA 4ADIA 2PXYC 1QX1A 5ADPH 2KYIA 3RI5K 5CCJA 3F01A 1E4XL 1XGYL 4OCXL 3SCMA 4ATTA 4RAUB 3WMSA 4S1RL 3S34H 4I48A 3RZCD 1L7IH 4QCIA 4MQTB 4UDUB 3D39B 1GIGH 2OSYA 2WB7A 1QFOA 4GQZA 4GSRA 1I8MA 1MWOA 4FQQB 5EEUA 5B8CA 1FHGA 1MCSA 4JS7A 4G8FB 3HPLA 1XEDA 2X4SB 3MUJA 3IF1A 5GIRA 1BX2A 4QTIL 5TTRA 3JVFC 3ARSA 2CZNA 5BO1L 4NCDA 5AAPA 1AKPA 2VC2H 2I5YL 4YHIB 2W9EH 5SWSA 5IY5B 2G3XA 2AJZA 1A6VH 4N8VG 1PL3A 4NO0A 4JQIH 1KXVA 3SB3A 2ZOWA 3OPUA 5GJTL 4NXKA 5CEXA 4KKRA 4PJ8A 3P3SA 1XEUA 4LP4A 1JERA 2EADA 2V9UA 4PLKC 3LVEA 1Z7JA 3BMWA 3GKWH 4HJUA 4EN3C 5IUCA 4WNQB 3NTCH 1JZ2A 2VIRB 4FI8A 3FSZA 4MJID 2OTWA 4IBZA 5GXBB 5E8OB 3SKJH 3AGVA 3LKNB 1A1NA 3N9GH 4QHMB 1R34A 3KJ6H 3ML9A 1QFHA 4ELMA 1H3UA 5ITBL 4NENA 3W39B 2IADB 1IBGH 1RUAL 1FZJA 4NJ9H 4PP2A 1HL4A 2B1HH 1MG2C 5ALCH 5T5FL 3HS0A 2DKMA 1DBMH 4FQ1H 5L7XL 5JZ7D 3F6IA 4UV7H 1D5ZB 2BDNH 3JWNE 4HULB 2FX9H 1TT6A 2WWKO 1NM4A 3FN3A 5DR5L 35C8H 3KVPA 3VI3A 1AKJB 3ROLB 4I3RL 1J12A 2NDGA 1HCVA 2VITB 5C0BD 2UZPA 4OCRH 4ZMOA 4BH7B 4UDTB 5CFAA 2VAJA 1CL7H 1ODAA 1UM6H 6FABL 1GKEA 1UUSA 3BWUC 4L9LC 5IOKA 3FO9A 3VXOA 3JTBA 4ZOCA 3GRBA 1CN4A 1KB9K 2JXMA 3WFHA 2DQCH 2C9QA 1USQA 3TYGH 1FL6A 3KYKH 4TNVF 5FYLD 1A3LL 3CV5A 4CNIB 2M2DA 1IVTA 5IVXF 5I23A 3HRZC 4TYUA 1YCSA 3IJ8A 3L17A 2WVSA 1Z9LA 3RDTD 1I82A 3ARXA 1E4KA 4KVNH 2FYYB 2BNRE 4IRJC 4QDGA 3WLBB 1REIA 4IRSA 4X9BA 2XACC 3KYAA 3IETA 1XB3A 3MLVL 5CGYC 3TA3C 3B9AA 3LEVL 5AD0B 2FWUA 3N43F 4CKVX 1WUZA 2E7BA 4JPWL 4M62L 5CGTA 3OKEB 3OXSA 4ODSL 2X12A 1GC1C 3BIBX 2D9CA 5IQLA 2FWOA 3UTPE 4LSUH 4BFJA 1T1XA 3GMPB 1Q9KB 1LM8V 1U41A 3UZEA 2C8NA 4NAQA 1Y6KR 3EO0A 3ZTJG 5BOZG 3VXUE 1KC5L 4XN4A 5LN4A 3BKMH 2CLVA 2YBGA 5JDSB 2GVYA 4NEHB 3G5YA 5K5YA 1MCQA 5DHYA 3HI5L 4K7PL 2XWRA 32C2B 4P5TD 1IGIL 1MRDH 4Y4FD 3LZFH 5ERWA 5IUSA 1LWRA 4B27A 4BZ1L 4NUGL 1XR8B 3U7WH 1NCOA 4XBEL 2F54D 2RALA 3DI3B 2PWFA 3CVHB 4GEJA 2DWEB 2ZYIA 4IDJL 4MVBC 3ARBA 4N2NA 5EORH 4MSWA 4QY8B 5I0VA 1E6JL 1PKOA 1WZ1L 2CALA 3FU9A 4DETA 4OIBA 4FQLL 3PLYA 3S3CB 3KGRA 1E4WH 1DZBA 3BAIA 3SCMD 3ET9F 4NO3A 4OAWA 4AVJA 3T9WA 3UZQB 1CFVL 3AM8A 3KCPB 3OGCA 1GYWA 3UAJC 4Y9FA 1MHPL 5FLUA 2B3RA 4JM2A 3U6RA 4HUKB 2AEWA 4FCAA 4KUZH 1HDMA 2G9HA 1THCA 2PPEA 3NABL 2XWCA 4LF3A 4YHOL 5DJZA 5BUGA 4V1DB 1EFXB 1CQYA 1XD0A 2OCJA 5EU3B 3V0GA 3CFCL 3F7LA 1EO7A 4QGTA 1M1XB 4QT5A 4Y4KA 3FUKA 5SWSD 2CJTA 2M8XA 1AS8A 2XUWA 1U8NA 4NO0D 1A65A 4XBPB 5L2KE 4Y8AA 5LBGA 5KYNA 2R8SL 4PJ8D 3AU1A 5KVFE 3ZKMC 4J1UB 3GXIA 3VG9B 2FJSA 4MZ2A 3UPRB 4WWID 4FXKB 1JVLA 1PBYA 5KS9F 3VXSE 4BIKA 4BV1A 4KGJA 3BIKB 1D6VH 4AM0B 4JO8A 4PB9H 5HGDB 5F7WC 1PLBA 2VM9A 5ESVB 3IDNA 3GSQB 3FU3A 1CXFA 1GGIH 3SBWA 4G5ZL 4NO2A 2WO2B 1M7UA 3BPNB 5F21B 2RBLA 5B7MA 4PJ5B 4JFXA 4N90D 3VW3L 1VIWA 3ARDA 2B59B 3DIDA 4JZOB 1NWOA 1VERA 2AXWA 3V6ZA 2EIBA 2CBPA 4DN4H 1KG0B 4J12A 4R2GB 4FHJA 2NY0D 1AZCA 4QRUA 4ZMWA 5DS2A 3G6DH 5DLLA 1XSOA 4L3ED 5CD5C 1IKOP 2X4QA 1MFDH 4WV1A 2J8OA 3ULVE 1G0XA 1G94A 3M17B 4HLEA 3AXHA 3UAFA 5C7XH 2Z35A 2MTAA 2X9YA 3C8DA 1R3HB 4P3WA 4PIRF 2CDGB 4TQIA 3QC6X 4IS6B 1E28A 5PCYA 1IV8A 2GK2A 3G04B 4Z77A 2EO7A 4YVUA 3BUPA 2VYRE 2YSTA 3L9RA 4LSQH 1DVTA 1CFTA 3LD8C 5D5MA 4Z76A 2FQGA 3N85H 3IU4H 3RPIB 2D7TL 3EOAB 3FH7A 4FMVA 1MEXH 1OHQA 2MPVA 1B2YA 2UZXB 1JGUH 4KQ0A 1DVFA 5D70H 1WGOA 2W5PA 2Y1YA 3V7MA 5I75B 5DZPA 5DSCB 3IJHB 1B90A 3DX6A 3SDAC 1KWKA 2DLEA 1A14H 1M2VB 3AREC 3QJFB 4J3TA 1F58H 2XTJC 4IIQA 1XF5A 3BH8B 1JV5A 3FRPB 1FVEB 4JRYB 1NCBH 1JF6A 4H20L 3B9KC 1J05B 5D1QA 1FO0B 2P8PB 3JQOB 4YHZH 5CEZL 2C1PA 4TV3A 4LCUA 4TTGA 4ZO9A 3VFWA 1VFAB 4NZJA 2F53B 3SDXA 4HS3A 4OJAA 1JRHL 1TKWB 2DQEL 1HI6B 4KV5E 2NY6D 2VGLM 1NINA 2VDPB 2GYSA 1ECZA 2PYFA 2Z91B 3IPFA 4DCQA 2Y5TA 4HDIB 1S9XA 4EE2A 2NY2D 2C5DC 2NY3D 5GS1C 5F7NC 5KVGH 1LXMA 4K3JH 2KDGA 2C7UA 3MBEC 5BRZA 4IOIA 5HPMA 1MQKH 2AEIT 1J8RA 1HHIA 1KCLA 1YY9D 1JK9A 4MJ5B 5DWUL 4EBQL 3QFJE 4MD5A 3BPOC 3BRGC 2Y25A 5FO7B 4Y2DB 4XWOD 1VACA 3ARBD 5JO5B 1KGCD 5F9JB 5E5MB 3V0EA 3DSFL 3ATEA 3LJ3A 4Z18A 1Q0YL 5KSBE 3RFRA 2FEDC 4C47A 4IMLB 5JPMB 3FTWA 1TCMA 1IBZA 1WCBB 2BOBA 1IBFA 3QXDB 4Q0XH 3F85A 1SVBA 4UMGA 3ZDWA 3BYYA 3K4ZA 4RMQA 3VXNB 4RBPK 1XGQA 1IFHL 2JJTA 4JM2D 2IGLA 1NMBH 4BFGA 1FNEB 2H32H 2A7BA 1U92B 3WS3A 4LMQE 4J6RL 4XVUD 1QP1A 3RHWF 1RZJC 1LWHA 4GRLC 3VWKC 2CKBB 2CO2A 1IAII 2DLTA 3T09A 5I1GH 4OH2A 1D9KA 2HAZA 3INOA 4WEBL 1NCUA 2BVOA 4JFYB 4OD1L 1RJCA 5F7HA 4WEUD 1LK3L 2W0KA 3GIVA 4N0RA 4Y19B 1LJMA 4TL4A 4GNKB 5C6TL 5EU6A 2PLTA 3CDZB 5E8DH 1TO4A 4JPVL 4HXBL 2K78A 1HYSC 3FUEA 5GGQH 3TO2B 2QLVB 4FNUA 3ESOA 4D7PA 2B9AA 2TRHA 2B16A 2VAAB 1KPUB 2ZXEB 1MREL 4M7LL 3HMWL 2FLMA 3DXAE 2V9RA 3ARDD 3IKKA 4G59C 2EIKB 2AJXH 4DK3A 1CFQB 4KMLB 2WKOF 4IIZA 2XWDA 1ADQH 4OM1L 3VE0B 4MCYA 3EG9A 1NQBA 3D4YA 2AHIA 4TNGA 3F7QA 3VVVA 4M8QA 4ZFOB 5EZLB 5J11B 3VWJC 1NEZB 2H0FA 1DQKA 5GQBA 2CRIA 3I74A 4K9EL 1JNHB 5AL0A 1T1ZA 3T4AA 1GW6A 4KY1H 1K8DA 5TH2A 4W9JC 3L7FA 5I8CB 3Q2VA 3B7UX 3L6FA 5IIEB 3KPTA 4ZX3A 2WIIB 5F3BA 3N04A 4HUVB 2KMWA 4M56A 4LU5H 1QVOB 4NZRL 1AG6A 3QNYA 2ZWLT 1SXAA 1NCIA 3QIBB 1OAZL 1R46A 3LN9A 4MDIB 3O2VH 4WGKA 2F0CA 1KZYA 2I25N 2X0UA 1MFAL 3OPZH 4TOYH 5IFAL 3SDCB 1I7ZA 4X2UA 4ANUA 1RZQA 3BZDA 3FJTA 5C2BH 1KBKA 2QVKA 3HG1B 4L9DA 3P4MA 3UBXG 1WPCA 2R29L 3RVUC 4Z3FA 2VZVA 3Q48A 2ADFL 1MUJA 4HWUA 4A66A 3ECUA 3WFCH 2CLRB 4TLTA 2X4UA 2QKIC 1I8UA 3O2DA 2VSMB 4PJIF 3VXPB 2DQTL 2E4FA 3CPLB 3MFGB 5D1QD 5FHAL 4XWGL 1KY6A 4X80L 5C0FB 1P6WA 4WW2B 4GLRH 1KELH 1PAMA 1ZLVK 1M71A 5DRWB 5TFSH 4MMXB 2VXVL 4AJ0A 5JHBA 3M1BB 3B4NA 2MMXA 5JOFA 2V3FA 3VSUA 5M94B 4JHZA 1JXKA 1UWGL 1WHPA 1HXYA 1I9JL 1LWJA 1EIBA 1OV8A 1R75A 1UACH 3Q3GA 4TUJB 4R4BB 4Z7UE 2CD0A 4F7MB 5EF1A 4CUCA 3BUQA 5D7JB 4NT6A 3LSOB 5AVUB 5JMRA 5BRZD 5DD1L 1DQDH 4ZAKA 4G83A 2K6ZA 3SYCA 5DD0L 3EZ8A 4BQ8A 3ELAT 2FJHB 3DURB 3MJ9H 4IRZA 1SFHA 1II4E 4DW2H 4FQ2H 1J8HE 4LCYA 4R8WL 2RQ8A 3TOPA 3W1ZA 3AG1B 3DVGB 3LB6C 1JBJA 4RMVA 2VLJB 3VCLB 3D52A 5A2BA 3L3JB 3ZHFA 4EDXA 3JTSA 2KPWA 3PHQB 1WVZA 3ILEA 5IMLA 4WCYH 3E6FA 3FF7A 4WTWA 2C3HA 3DWTA 3PQYE 4ZUUB 2H6PB 1YJDL 3QQ3A 2J44A 2XVBA 1J8SA 3NH7H 5BV7H 4KRLB 1KLGB 5FGSA 4FEMA 3U2SB 3IBEA 2ZUWA 4WENB 5B3JE 1UADC 3A22A 1QFPA 3CXHJ 5DZNA 4DTGH 3K6SA 3V4VH 3FT9A 4CBZA 3PWPB 1AC6A 5I1CL 3DX2A 5EN2A 3WHE1 3BQUC 1KEML 1HSAA 1UB5A 4F3FA 3ARQA 1X5IA 4FJYA 4X8CA 1D9KD 1ET8A 5T5NF 3TO4C 2X4NA 3MACH 4PGCA 1NDGB 3BZFA 4Q8BA 3LZNA 2XQYK 4Y16B 3CC5A 2P24B 4GXUM 2C9VA 5G2NA 4F58H 1K85A 2N7AA 2QR0A 3GMOA 2CO7B 5EU6D 3KWVA 3NZHL 4O5LL 3RKDC 1H3WM 4B9YA 3LIZH 3BUYB 2ADJB 1J11A 2IPTH 2ADYA 4OZFG 4U7MA 4UQCA 1ZLUH 3ORJA 1WEJH 3ZYOA 1MAMH 5J5EA 1MFEH 2PYEB 2VZUA 5I5IA 2CSPA 1OARL 5DMIL 2CGRH 3ESMA 4L18A 3QJOA 2LU5A 3P4NB 1B0GA 1S7SB 25C8H 3BAYA 1EJOH 1SEBA 4OCYL 4LLWB 1N5YL 4M6AA 4WUKH 3OC8A 1UZ8B 1HNYA 2HTKD 4HKXA 4QD2E 5DMGD 5TDPB 3ROOB 1A6UH 3OHXA 5ICYA 2DKUA 1IGJB 5FFGA 4IHOB 2Z7UA 5KW9H 3QXAB 1XBRA 4KZDL 2CGZA 1IGTB 3EFDL 3QORA 5F7BA 4FYQA 4HLZG 3EJRA 3NUKA 2FT6A 3QEHA 4X83A 4LASH 4YUEH 2IH8A 1NDTA 4X6DE 4WO0A 1RK1A 1ZS8A 2ZCKL 4N90E 1BIHA 1BYNA 1LVEA 3N2JA 1JL8A 2DAVA 4LPUA 4FFYL 1GGBL 1YEKL 4H0GA 2IALA 2R0KH 4YH6A 2A6IA 4FQJL 2VSKB 4POUB 5F7EH 4RMBA 4JZJB 4EN2A 4LMQI 1ZT4A 2ZTBA 1KIRA 3A3YB 4FXGC 3IJYA 1XTLA 5K1JA 4F7EA 4PHXA 3MPCA 2E27L 2XN9B 4N26A 4L3EE 1QFWI 4WU5A 1YNTB 3CVHL 1HOEA 3VFOA 3RLSA 1MCRA 1QRNA 4MMZB 1N2RB 4ODXA 4H8HA 5HDQL 3TH2T 5A2FA 4JUTA 5MERB 1DE4B 1JYXA 1LDPL 4OUUA 2FE0A 1T7ZA 3N50A 2JE8A 5HGGS 2WWKT 3FQ4A 4OZGF 4EO5A 2ED6A 2FJGB 3LPFA 3F7YA 3RNKB 2YD6A 3VFPB 1BWMA 1XGUB 2VLLB 2V33A 2WD0A 4MNQE 3CK0L 4K7FB 3X17A 3CFEB 3I50H 3MCKB 2ZUQC 3I9PA 5D4IA 1NGYA 3VMOA 1NH6A 2X4PB 1E4XI 3CTTA 3GMLB 1AFVL 1QLEB 5KVEL 2HWZL 3GXTA 2YMXH 1E5CA 4E41A 4AQOA 1T1WA 2KLTA 3T77A 4X4YA 4GKSA 5KTEL 3HNTL 3T1WA 1XO8A 3OKLA 5F9WB 3OZ9H 5CZXC 3HNVH 1QD0A 4O02H 1KSRA 3MNZA 4GXUN 4JAMB 3WEMA 3LPOA 4JPIA 4ZAKD 3BDYH 4R7XA 4M43H 2QJDA 4AQ1B 2YUXA 3S37H 1NKOA 1C16B 3EOYG 1QAWA 4UM9A 2Z8RA 5DZ9A 2LR4A 3TP4A 2YUVA 2AEOA 3O4LE 3K0YA 3KXFB 4G6FD 3NA9L 4JCMA 4PJ7A 2QLYA 4WWOA 5E8PB 4ZJ9A 1IC7H 1VF5C 1UATA 3GHBL 5DHVB 3QB7C 1WFIA 1QTYT 3HI1B 4X5LA 5GGUA 4PJBA 1SY6A 2DTML 4NUJB 3FFOA 4DKAA 2XI9A 1JHLL 5TF1H 5C3LD 1IEBA 5EBGA 1VZGA 4C56A 4N2LA 2MQGA 1B9KA 2EIDA 4J3WA 5CUSH 2YBRA 5E08H 5MENB 3AB0B 3FFDA 3OF6A 4YO0A 3OKOB 3TNNA 5IVZA 2FGZA 1PIGA 3D30A 4KTGA 1EJFA 1I8KA 3VFGL 3E8UH 2AW2A 4KQ3L 5E2UH 5TQ0H 3A21A 3DDGA 1MJJA 3ELQA 4XPHL 2DRUA 5E1AB 1AI1H 2ZKXA 4G6MH 4CVUA 3BKJL 5EMYA 3OJDB 1AO7A 2VXUH 3RIFK 3FOMA 2DMGA 3NCBB 2H3NB 4PI2A 4BUGA 2FR4A 2YK1H 1G9NL 1PQZB 1RUPH 2Q2LA 2F08A 4W1TA 2ITCA 5I6XB 1B88A 4OCNC 3MA9H 5TDNA 1A7RH 5FKPB 1JPGB 3WKNA 2GBUA 5ELIA 5I2IB 4HZAA 2VC2B 1E2VA 5L6YL 3GUTB 3T0EB 1OK0A 2OTUB 1Z32X 3SQOL 2DZEA 5JHDE 1ZXQA 2OJZL 4OLXL 3B3BA 2Y9RT 3BDBA 5C71A 3VTMA 3NRQA 4L1TA 4CVZA 4GW5A 4JDTH 4LVNC 4OZFA 4YBQD 3KVQA 4YPGA 3UJJH 4KMTL 3QUYD 3TBYA 3D25B 3QPXL 3EGSA 1LD9B 2PCXA 1FO0L 1KPRB 2O5XL 2CO6A 2Q6WB 5DUBA 4NNPL 4JFDA 4KROC 1BFTA 5C07A 1BG9A 1MCPH 4M8RA 3RY5A 1IZJA 4K5MA 3QORD 4RISH 5F7AA 1QQDB 4KNTA 4LHUA 4HUCA 1RHFA 4N9OB 3VFVA 1A4AA 2D7OA 2OZ4A 1PGRB 4OLYH 1Q9LB 2IDCA 3WNLA 1K4DB 2Q1EA 4Z7WB 1FAIL 3KPQB 4WHYH 3V4LA 1IT9H 2ID5A 2OMVA 4KU1A 3L5IA 1NEUA 1OSZA 1GSKA 2BJMH 5CKGA 3B8YA 1OP9A 5ESAA 3QFDA 1HL8A 4S1QH 4Y4HA 1Y0LA 3QQ9D 3BP7A 4X5XB 1DSYA 3C8KA 3WL9B 1BF2A 2FIKA 3MOBL 1RKRA 4IGBA 1FYTB 4KX9A 1QRND 3FU6A 5CFHA 1X5YA 3G9AB 5D8JL 2H0EA 3GRGA 3WBDA 1A4BA 2IDSA 4XB7A 5FDWB 5HYFA 2J1KA 1NLDH 2W07B 3MV7A 1HCZA