3UACA

Multicopper oxidase cueo mutant c500se506q (data4)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
489
structure length
476
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHSHLLEHQDTGMMLGFTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase CueO
publication title An O-centered structure of the trinuclear copper center in the Cys500Ser/Glu506Gln mutant of CueO and structural changes in low to high X-ray dose conditions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 136
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uacA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uacA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uacA03
1ETJA 1KBWA 1N68A 1OCZB 2EIJB 2XV2A 3NJIA 2YARA 5TK2A 3SBPA 1T5KA 1OF0A 1J9RA 2YAEA 3DIVA 3AZUA 2FNWA 1SDDA 1TEFA 4DPCX 1BXAA 3PCYA 1KYAA 3T6ZA 4YSUA 1GS7A 1ASPA 4CSZA 4A2DA 2Y69B 3WNJA 2XV0A 4CSPA 3S3BB 1PNDA 2YAFA 4JHVA 1OCCB 4JKNA 2YXVA 1OV8A 1M56B 1XMEB 4G70B 2DWSA 1J5CA 1WAEA 3OD3A 3QJVB 2GBAA 4F2FA 2H5UA 1NTDA 2XXFA 1J9QA 4FA7B 1L9TA 3UAEA 5B7FA 4E9VA 1NDTA 4UF7C 3D12B 3X2QB 4ENZA 2BO0A 4DP9X 2CAKA 5EHFA 1PCSA 1BAWA 2E86A 1NZRA 1AOZA 3T9WA 3OMAB 1WA2X 1ZPUA 2QT6A 4W1TA 4BWUA 1SHWA 1BQKA 1OE2A 1AS6A 5B1JC 1OCOB 3GDCA 2XUWA 3S8GB 3AG1B 1PAZA 2X88A 1NICA 3V9EA 4AX3A 2WO2B 3WNIA 2Q5BA 3ABKB 5B1JA 5A7EA 3N2JA 4E9SA 1JZFA 1PZAA 2HRGA 3ZBMA 1ASQA 3T71A 3T6VA 3S8FB 3QJQB 3ZX1A 2ZXWB 1E65A 4G7SB 3N55A 3OQRA 2HX7A 1L9QA 2UX7A 2X87A 3NP3A 3JT2A 3S3DB 5B1BB 2GI0A 3OMIB 5B7EA 4YSEA 2FT7A 1CURA 3BVDB 2OCCB 2HX9A 3KW8A 4YL4A 2I7OA 1JXFA 1NWPA 2I85A 3NJLA 3FSVA 1KDIA 2I7SA 1HAUA 4NERA 5B1KA 1E30A 1AQ8A 1EHKB 1L9RA 2JFCA 2RACA 3UADA 2B3IA 2IDSA 2PCFA 1ZIBA 1PNCA 2XXGA 1KCBA 2CALA 1AZCA 2NRDA 3TBCA 4YVNA 3WIAA 2H47C 1FFTB 1L9OA 1SNRA 2A3TA 2UXFA 3CVBA 3FPYA 2J55A 2PP8A 2HRHA 1V55B 4A68A 4JHUA 4E9QA 2GB2A 3TU6A 5B1AB 1AZNA 1BEXA 4AKPA 1GW0A 1URIA 2BW4A 4DPAX 3DTUB 1PLCA 3NSYA 2FT8A 1TKWA 3UABA 2R7EB 3NYKA 1ILUA 1E67A 1RZQA 3GXUB 3U25A 2CCWA 1DYZA 5I26A 3MBWB 1WA0X 1OOWA 2TSBA 3ABLB 1A3ZA 1GS8A 4A66A 2BP8B 2CUAA 2PPAA 3FSZA 5TK4A 4K9JA 2ZWNA 1OCRB 3NSCA 1JERA 4YSTA 4GY4A 3X1BA 5F7AA 1TEGA 5I5IA 2OV0A 1J9TA 1KDJA 1V10A 2QPEB 4WKXA 3NJHA 4YSOA 1KCWA 3CDZA 1TU2A 2EIKB 8PAZA 2PP9A 4X4KA 4YSCA 4HHGA 2XYBA 3H56A 4ZK8A 5B7MA 1OE1A 3ASNB 4YSQA 3X1EA 1CYWA 3BQVA 1BYPA 2PCYA 1CYXA 4NAJA 2YXWA 2CJ3A 3HB3B 3QJSB 1GSKA 3DKHA 2QPDB 4YSAA 4HCGA 3FU7B 2QDWA 2YAPA 1ET5A 2HZHA 2HX8A 3SBRA 4KO5A 5D4HA 1XB3A 1IBZA 5AFAA 1PZCA 4MFHA 1SF3A 1GY2A 4KNSA 3NSFA 4PAZA 4KO6A 1ZDQA 3CDZB 3QJTB 5I6LA 3ABMB 1J9SA 2P80A 5I6NA 4YSSA 2VM3A 3QQXA 1NIFA 1VLXA 1FA4A 2VM4A 2IDUA 5AZUA 2PPFA 2WSDA 1WS7A 2VW4A 1MG2C 2IAAC 1F56A 3NT0A 1JZGA 2XV3A 4Q89A 1RKRA 2DYSB 3PAVA 4HCFA 3AG4B 3IEAA 2BW5A 3PAZA 3IN2A 4PCYA 2N0MA 2BP0B 3IN0A 1QLEB 3NJFA 3QJUB 4NB7A 3ABGA 1JOIA 3WKPA 1PZBA 1A4AA 4G71B 3CVDA 4GYBA 4DP4X 3MX0B 1ASOA 3QJRB 3EF4A 1SHXA 3TBBA 2FQDA 3WI9A 3FSAA 3AG2B 2YAHA 4KO9A 3T6XA 2VSKB 2R7EA 2W88A 2W8CA 2IH9A 1ET7A 1QNIA 3H4FA 1R1CA 1ADWA 6PAZA 1AAJA 3RYMA 4KO7A 4AKOA 1SFHA 1OE3A 4WTQA 2BP8A 5D4IA 3V9CA 4BWWA 4E9TA 1JVLA 4AZUA 2JKWA 4G72B 2GC4C 3FYEB 5AKRA 4M3HA 2VW6A 4F7KA 2BZCA 4BDVA 2B08A 1JZIA 1W8EA 4GP5B 1ILSA 3UAAA 1NINA 1AG6A 3NJNA 3ASOB 2IWKA 2UXVA 1AACA 3NJJA 1A4CA 1WS8A 1AR1B 2FWLB 2DWTA 1I53A 2IH8A 2AZUA 1EZLA 4TXVB 3FS9A 1SFDA 3FSWA 4Q8BA 1N70A 5PCYA 1QHQA 2AVFA 1NPJA 3UACA 3FQYA 3C75A 2EINB 3X1FA 2HLEB 4HALA 2MTAA 1DZ0A 3FU7A 1J5DA 3FU8A 1PLAA 2Q9OA 5D4JA 4E9RA 5PAZA 2GSMB 2IWFA 4E9YA 1KBVA 3EH4B 1IC0A 4BDVB 3PXLA 5I5MA 1AS7A 1ID2A 4E9XA 3OM3B 3WG7B 1XB6A 2Y1AA 3PAUA 2QDVA 3SQRA 2CBPA 2AZAA 9PCYA 1GS6X 4DPBX 3FQ2A 1A65A 2BHFA 5I6KA 2IDFA 1AG0A 4HZ1A 4DP7X 5I5JA 4E9WA 2AFNA 5FC9A 4RH4A 4W9ZA 2DY2A 4HIPA 4EF3A 4G7RB 2YAQA 3AW5A 4L0PB 3NJKA 2FQEA 4BWTA 5I6MA 3T6WA 2IDQA 2BP0A 3FQ1A 4A2FA 1X9UA 3FU9A 3ERXA 5E9NA 7PCYA 3S3CB 1JXGA 2P80D 1WA1X 2IDTA 4GP8B 2HXAA 3G5WA 1A8ZA 3GYRA 1GYCA 2PPEA 4QLWA 1BXVA 1W6WA 3AY2A 2PPDA 2PPCA 2JXMA 4YSDA 2H3XC 2FT6A 1CUOA 3ZIYA 1UATA 1AZRA 4KNTA 3CZUB 2XU9A 4BK5C 3CVCA 2FQFA 2WO3B 1RCYA 3SBQA 1KV7A 2MRYA 1PF3A 4A2HA 4N8UA 2EILB 1BXUA 4UAHA 3PLYA 1YLBB 4KOCA 2J57A 2FJSA 1JZJA 2AANA 3KW7A 2TSAA 2XWZA 3NJGA 4DP5X 4DP8X 1FWXA 1JZHA 1A4BA 2UXGA 4KOBA 1PLBA 1W6LA 4G7QB 2EIMB 3OMNB 5F7BA 1IKOP 2PLTA 4M4RB 4AKQA 3AG3B 2VMJA 4GXFA 2FTAA 2BZ7A 1SDDB 1SJMA 1B3IA 1NPNA 1IUZA 2GIMA 1GR7A 2DV6A 1MZZA 2BWIA 3NP4A 3TA4D 4DP6X 1JXDA 1KGYE 1MG3C 1JZEA 1NWOA 3H4HA 2LLNA 1PY0A 4YSPA 2J56A 1HAWA 3QPKA 4YVUA 6PCYA 1CC3A 1AS8A 4KNUA 4A2EA 2UXTA 2XVBA 4F2EA 1E5ZA 4P5RA 4HHWA 3L45A 1BQ5A 3X1GA 2VSMB 3HEIB 4AI7A 5LDUA 2GHZA 2YAMA 4HCIA 1JVOA 3ZDWA 1PMYA 5I6OA 4FAAB 1AZUA 1MDAA 3X1NA 1M57B 3EH5B 1ZV2A 1ZDSA 2XX0A 1BQRA 1SF5A 1L9PA 3NJMA 4DP0X 1GY1A 3FPXA 2XX1A 4QKTA 1MZYA 2PP7A 4A2GA 1NIBA 2OJ1A 3CG8A 4BXVA 1ET8A 1BYOA 1NIAA 3EHBB 4A67A 1X9RA 3FYIB 7PAZA 1L9SA 2GC7C 2J5WA 1V54B 1IBYA 3UGEA 3EH3B 5ANHA 4DP2X 2YQBA 5B3SB 2DYRB 3IBOA 3FT0A 2XLLA 5I28A 4P5SA 2VN3A 3IE9A 3JTBA 1M9WA 1NIEA 2FQGA 3PPSA 1RZPA 2BWDA 1AZBA 1XB8A 2ZOOA 3TASA 1AANA 2UX6A 4HAKA 4GP4B 3NSDA 4BXSV 1ZIAA 4YSRA 1AIZA 4DP1X 1HFUA 2IWEA 1E5YA 5I6PA 3WKQA 2YAOA 4N4YB 4UANA 5IY5B 1NIDA 2ZONA 2VW7A
chains in the Genus database with same CATH superfamily
2BH0A 1V7NL 2ZKMX 5LBSA 4WW1B 4XPFL 3T2PA 4AGOA 1T5KA 3ZMEA 5I0WA 2GIXA 5E2UL 3VFNA 4P5TB 3HE7C 3OLDA 5TGBA 3OXSA 4AM0A 2KPWA 1KYAA 5J12B 5GGTL 3SDAD 2ZXEB 3IJ9A 4QO1A 4MQ7B 1QRNB 4UT6L 4C4BA 2CR3A 3T1FB 1X5ZA 3TVMB 4D3CH 2PWFA 2F58L 2X2YA 2IALB 5BQ7B 3CWGA 1OV8A 4AQ1C 4AYGA 1HL5A 4ZBJA 3RTQB 3OWEA 4BSWB 2DWSA 2XXCB 3I9IA 1J5CA 2AMGA 3LNIA 3OHXB 2ZICA 4ADJA 3IFNH 1C8PA 4K8RH 2H8PB 3I6KA 2ZP9A 3MKGA 1ORQA 3A67L 1GC1H 2A6KA 1F4HA 2ICEB 1UADC 2XWBA 4WFEE 3KWWB 5G5DA 2O1AA 3IGAA 3M1OA 4XMVA 5C0IA 2FAUA 3MLXH 4PRBA 3WDHA 2IGTA 2EH8L 3RKDD 1F97A 3U7WH 3ZL4L 3DXAD 1AVAA 1HSAA 5SX5H 4IKNA 1AS6A 5HP5A 2GBTA 2ILLA 3EGXB 1IEAB 2WO4A 3RA7L 4OZGA 4U1HA 2JB6A 4LL9A 3QDHA 5BUPA 2B16A 4ODUA 2VXSH 5JIDA 3ABKB 4ZPTA 4X6EA 5DJAA 4FL4C 4Z7NE 4K5LA 2YSSB 3DBXA 4L48A 3S88H 1JZFA 1PG7L 1YEEL 4FQCL 5ABAA 2ADFL 2AEPL 4DHLA 5F7WC 4R2GC 4GG6B 3CK0L 4PREA 5CSZA 4YSEA 2YGPA 4WI8A 3CZKA 4S0HA 3WS3B 3BMVA 2OCCB 2HX9A 3GMQA 4QRRE 5JQIB 1NWPA 2OMYA 4DZBA 4PRID 4FDWA 5K1NA 1SOKA 2OS7A 4G6AC 3NRFA 4HS8H 1HQRA 4IJ3B 3UIZA 3V6OE 4KBPA 1T22A 5I75C 2DWDA 2X5PA 4HJGB 2IG2H 2ADJB 1B88A 4F7MA 3GNML 1SNRA 1D5MB 4JUSA 4CA4A 5IW1A 4JG0H 4JW3A 4WI7A 2AXGB 1N3NA 5GQBA 2GB2A 1KGJA 1TMQA 2E74C 1SXBA 1ZTXH 2DWYA 3AREA 1KNOB 1UWGL 3HFML 3HRZC 3QXVA 5D6DA 5HDBF 2FYYA 4HS3B 3UEQA 4ODXA 2AEQH 1KPRB 1MVUB 1R0AL 4P4KD 3CSPA 3WLWD 1T3FA 2AQSA 4HUUA 2XPYA 3RPIA 3MI6A 3C5ZD 3PDDA 2BW4A 4MQ7A 1QRNA 5AAPA 3NSYA 3BGAA 5KW9H 3FQXB 5CJXC 3TVMA 2YD8A 4P23D 2CO6A 2VMFA 4M7LL 5AW5B 1SVBA 4HZLB 3RTQA 3MYZA 4BSWA 2NZ9D 1TOXA 2BSRB 3UYRL 4LEXH 2CUAA 4H8HA 2NY5H 1YHPA 3VGDA 2JK5A 1C5DB 1BV8A 2H8PA 1JHTB 5CEYB 1MCBA 1NMCC 4MXVF 4MDJB 1UFUA 5CEZD 1CFVH 1KB3A 1TCRB 1TEGA 2EDLA 4TUKL 3TN0C 3HKZA 4XOBA 4KK6C 4Y1AE 1TTRA 3VH8A 3VXRD 1A8JH 4ONFH 5DI8B 1N5YH 3PJSB 3EO0A 1FDLH 4NKMB 3HG3A 4XO5A 2Y7MA 1L3NA 2CHZA 5HDRA 3BH4A 4HWZA 5IZ7A 1JMXA 1XXFC 2WTRB 2BFVL 4ODHL 5I6XB 1AMYA 3QUXD 4HJJH 5ESVB 5EU4A 1I9IH 2YSSA 4IYKA 3MTRA 3NQIA 3Q8BA 4QMEA 4A6YB 4JREC 2P5PA 3LIUA 3FU5A 2HX8A 1S9YB 3SBRA 1FZKA 2VDOH 4NZUL 3NZ8B 3UTPD 4LLQB 3WGUB 4DSYA 1I1AB 1K4DB 3WS3A 5A3ID 2GITA 2NW2B 2CHNA 3E3QE 4LRNH 3D85D 2WLLB 4ZAKD 3WMQA 1GTFA 4D3CL 5HI5C 1E9QB 2DMHA 1KJ2A 4O02H 1KEMH 5TQ2L 3SOTA 1C1EH 2VR9A 3WELA 3CH8A 3ZT6A 1KTKE 3L5HA 4X2UA 3IFNL 4U1KB 5AZUA 4RLDA 1TJIH 5E24E 2BOCB 4V1DE 2PWGA 5BUAA 3LSOB 4RGNC 1FRGH 2O30A 5HGDA 2ADJA 2EEFA 4KRMB 4HCFA 1D5MA 3AG4B 3NJVA 4YHNA 4FLRA 4K7PH 5GRYA 1F86A 1U3NA 5SWZE 4YHYC 5JQ6L 2AXGA 3MLXL 4WNSA 4YPGB 1HH9B 3BGFC 3QEQB 3WN5A 1KNOA 2WJ5A 3ABGA 4HS3A 4AJVA 1KPRA 4FEMA 4KKCD 1F3JB 3ETBJ 4NLHA 2WCSA 2ZAGA 3H9HB 3MX0B 5I1KL 2G5BB 2OR8A 3HS9A 3RAJH 2Y6SC 1DVSA 4S1SH 1A1OA 5EBGA 4G6JH 5GGRY 3BT2H 3FQXA 2VSKB 5I1EH 2ZUVA 3N9GH 5DZPA 2W8CA 4AMKL 1LM8V 1NOLA 3D09A 1BVKB 2HVJA 2WVSA 5F0LB 1RUQH 4MAYD 4L4VE 3V0GA 3EJTA 4WUKH 5DZNA 4IOFD 3T1WA 1NGQL 1OW0A 1NBVH 3SDYL 1JHTA 5CEYA 4PW3A 4XNXH 3WV0A 2DWEB 4PP2A 4MDJA 4LNVA 1A64A 2XIBA 4WAFA 2ZXBA 2X40A 4C56E 3HUJB 4PSRA 4G83A 5FIEA 2E59A 5G4NA 3UPCA 5DI8A 5DMGC 2Q10A 2R4SH 5D7KE 2MQCA 2CLZB 3BZ5A 5IROC 4NKMA 1U8IA 4ORGB 3UAFA 1EX0A 4PLKC 3EG9B 3WNPA 1QHOA 4K3JL 2LLGA 4RFEB 5AZ2H 4HPOH 1CXIA 5BQDA 2B15A 4KRNA 5KTEH 4QF1B 2YN3A 4K9EC 4XVSH 5CS7A 1Z9NA 4YR6B 5ESVA 3D52A 4X6DA 1O9ZA 1PKQA 1ZTXL 3BP5B 4YLQT 1L7TH 4JKMA 2MTAA 4XE0A 4A6YA 4LVNB 1KTRL 3LPGA 2AEQL 1B4RA 2CIIA 1DBBL 3ULUC 5CKAA 1S9YA 4E41A 3HG1D 3NZ8A 1VGKA 5I74B 4FA8A 3N44B 2A0LC 1OK8A 3GJFH 4M8RA 1OP9A 4L4TE 1E9QA 4J3TA 2I5YL 2Y1AA 1KB9K 3L3GA 4W93A 2DMKA 2A1WH 2EEDA 1NDMA 3HMWH 2DQIH 2EC8A 4Y4FD 5IHWA 4O58L 5C08E 1HL9A 3WO3B 1ZGLA 1B9ZA 5HHXH 3BX7C 2ROYA 3OBAA 4FEIA 3KPMB 1J05B 2BOCA 5A16B 3LSOA 1VEOA 2X0UA 1TZIB 4HK3N 3WFEH 3BH8A 4OZHB 1U2CA 3FOMB 4ONFL 2VKXA 2CU9A 1N5YL 1EPFA 2C9QA 2EIBA 4A2FA 3FU9A 4I0PB 3FN9A 1FDLL 2GJZB 4X8GA 3MSPA 1WBYB 2LLLA 4MMXC 1D7DA 4FABH 4AVJA 1M7IA 1EO8H 4X42A 5DUPH 3H9HA 5D9SA 1RY7B 3AXLB 4OCRL 1BXXA 1IILE 1ZOXA 4XNQB 1U95A 3N41B 3V4UH 4ZUTB 2VR5A 4HJJL 4ZT1A 4YFEA 1I9IL 2H1XA 1ZLEA 1BVKA 4FQQB 3ILEA 3T2LA 2AEIT 5CHNB 4GRMA 2UWEF 4NUPA 4JKWA 2Q8AH 3GMNA 2RJMA 4WDIB 3SYQA 2ATAA 2VCOA 5HDQH 4H8VA 3KGUA 3CLFL 3V0EA 1Q1JH 1PLBA 4JPKL 5EIIG 1MY5A 1J8RA 3T0EC 3HUJA 1BP3B 4PGDB 5GRUH 4M3JA 2IC2A 3S0PA 1F3DJ 1KEML 3SQBB 1K4CA 1F11B 1NCUA 2CLZA 4Q9BA 5EIQA 4G7YH 1NQBA 4Y19E 4F7TB 3ULUE 4ORGA 4JPVH 1TJIL 2VLRB 4RFEA 1FPTH 2BSCA 5GZOD 4BUQA 1JZEA 4QF1A 2G2NA 3QJXA 1RSYA 2ERJB 1P6AB 1FL6B 4G9FA 4YK4B 1V7MH 1JYNA 1S5IL 5IMMA 4KI5C 3AB0C 1AYRA 2AV1B 1EBPA 1H0DB 4FG4A 4F2EA 1RUKL 3D30A 4W4OC 2GAZB 2IGLA 3T4AB 4YBHA 4K9EL 1SBSH 5LDUA 3BT2L 4FMFA 1I3GH 2ZXCA 4X99B 5I1EL 3N9GL 3RFZB 3PYCA 1E5BA 3EDEA 2DYPD 3OC5A 1DBML 3HNVH 1OSPH 4WUKL 5J8OA 3ULUL 2ZUTA 4Z3HA 3LVEA 2AK4E 1L9PA 1CDUA 1JFHA 2CRIA 3WS6C 5GGSB 5I17B 1J05A 1UH2A 2COVD 5ILTH 2OP4L 4IQHA 4X83A 3WJJC 4JO2L 3I6GB 1KTCA 3QGVA 4UAOB 6FABH 3DECA 4OH2A 1T04B 4ZTEA 4AVHA 5KOMC 5E9AA 2IV8A 1U8OA 3FOMA 2E3VA 1NLBH 3VXQB 3H3PH 1YEGH 3WHE1 1E5AA 5C07A 2K0RA 2G0KA 4L05A 3MRLB 5ICZB 2GJZA 1TTUA 4KVNH 4F57H 4ZFOL 1A21A 1WBYA 3ZUNC 4PY7A 2IOOA 4HPOL 5KANI 1OTTC 5IKCB 4J8RB 5KTEL 1P1ZA 2AGJH 1YJDH 4X7EC 4M29A 3CSYB 4ZUTA 3DIDA 4JRXD 4H8UA 4HIEA 3JTBA 1L4IA 1FC2D 2GEEA 3W9EB 1Q9OB 4QXUL 1SJEA 2R83A 4JFZH 5IGXH 1NLDH 1A14H 4OBRA 2QVMA 2VZSA 4OZGF 2HLFC 1GGCH 5FWRA 4KU1A 1TJGL 5KANG 5HI4C 1CL7H 5E8OB 1F02I 2OMNA 2AQ2A 3LPFA 3TA3C 5L2KB 5GXBB 3ZO0A 4JLRA 4KI5E 4WHYH 5HY9B 4PGDA 4HMDA 1BYNA 5H4YA 2A1WL 5EPMB 1TG8A 4IRZH 1XO8A 2YKLH 4QTIL 3ZDXB 1U2YA 3QDGB 4BQ9A 1FZOA 4F93B 2HG5A 1PAMA 4F7TA 2GFBB 1X5KA 3F58H 1W0YT 5EH1A 2VLRA 4KTYA 2Y69B 4IHOB 5E5RB 5IOKA 3QXDA 4NO3A 4Y5VB 3TWCH 1GHFL 3HC3L 4NCC2 2J6EL 3AQYA 3U30B 4QJ3B 2VN5A 3OD3A 4Q58C 5CCHE 1AZZC 1H0DA 3HJEA 2VE6A 1L9TA 5DUMH 4FABL 5K9QI 5GGVY 5DUPL 3PJNA 4IKLA 1KTJA 3T4AA 1CYGA 4NKOB 1MEXL 1HVXA 4ANXA 2EE2A 4ZMXA 5BJTB 3V4UL 2OL3B 3H55A 3HA0A 4MD4B 4X99A 3RFZA 3QUMB 2EDQA 3T9WA 3QQ3B 4OCYH 2QT6A 4NO0D 5JO5B 1UM4H 1KB9J 2CKNA 3CZJA 3VXUE 4CU7A 4GW4A 1MCSA 4D7BA 5K93A 1B2WH 1Q1JL 5DEGA 5KBDA 3I6GA 1MNUH 1EJ8A 3CFBB 3ESOA 5EN3A 1AQMA 3MLYH 5DC0A 1UA3A 3E1ZA 4FXGB 3RIKA 1K6QL 1TQCB 3MPCA 3QG7L 3B5TA 1E65A 3GS7A 3MJ9A 3MRLA 4FTVB 1I9RL 2UX7A 4G7YL 2NTSP 4N2BA 3JYBA 5E95B 4FQ1L 2ZOLA 3PRZA 1MW3A 4QGTA 2J12B 5IKCA 5E99L 3VXNB 4B6ZA 3CC1A 3CSYA 3B7RL 3PWPE 4GAYB 1PQZB 3KDMA 1QO3B 3ZT5A 1CICC 4ZMLA 3W9EA 5GS0H 1AH1A 2O72A 1NUFA 2HH0H 1TZOA 4MBOA 5TH2B 5DXWA 2JFCA 2RACA 1JFQH 3TZVC 1FNLA 3WCYA 5KS9B 1SBSL 2YD1A 1W15A 3C9NB 3WIAA 1U8HB 4DEWA 4NUJB 3CE1A 2ZPKH 2X2JA 1FGNH 4PLJC 1YDPB 2B2XH 4N0UE 4A68A 5HY9A 1DQDL 5EPMA 1OSPL 4PV8B 5DZ9A 3U9PH 3UOAB 4IRJB 5BV7H 5DMKA 3T04D 4GG6F 1UM5H 3ILDA 4GQZA 3QDGA 1AIFA 1MUJB 2EDDA 1M6UA 2WKLA 5DFTA 3TH4T 12E8L 2OZ4A 1URIA 4UOJA 3BCFA 4DO6A 4CDGC 5ILTL 4IHOA 2NY2C 1QBLH 1B3JA 4DGWC 5HPOA 5JYLA 4Y5VA 1ZE3C 1WHOA 4E68A 2Z7ZA 1E8XA 1NLBL 3WDIA 4OAWB 3WD5L 1YEGL 3PWJB 1A3ZA 3N04A 1GS8A 1NCCH 2Z4TA 2BP8B 4EBQL 5JMRA 4KVNL 3O2WL 5E8PB 4F57L 1KENH 1S3KL 4PR5A 4HIQA 1BD2E 4ZW5A 2H2SC 4LZKA 4EUPA 4U4IA 1IAIM 1ACZA 2P47B 4QRSA 3WFCH 1YJDL 3UC2A 5CJ5A 4R7NA 3T0VA 2OL3A 4FXKA 4XNMB 4MAUL 3G6DL 5DRNB 3WOVA 1VB9A 1EK3A 1ZA3B 3T5WA 3OLIA 1PLGL 2PP9A 3ARFB 1B0RB 4LP4A 4HW6A 5IB5A 5BW7A 4JFZL 4LHUG 3CHSA 1A14L 2VDRL 3UO1H 3N85H 3C60C 1F00I 1ICTA 1DVUA 5E9DD 4OLWH 4GQ9H 4U33A 5FLUA 1V05A 1CL7L 5DC9B 1DDHB 4P04A 3E2HC 3OSVA 4HV8B 2F6AA 1RK7A 2EE9A 2FLBT 3ZYJA 3DX7B 2AKRB 4OQTL 2EEBA 3F64A 2R0ZL 5MI0C 2R1WB 3V0AC 4LVOC 1KV3A 2YKLL 2R2BA 2YA1A 5GISL 4AGPA 4EPSA 3BQUA 3S98A 1BZ7A 3F58L 4W9IC 1EEZA 3L1FA 4KUCF 4MFHA 4PD4K 1F2QA 2B1AH 2FBJH 2P8LB 3JXAA 1MN4A 4Q4IA 5F9WC 1KGCD 4IOSD 3VXNA 1ZDQA 1IQDB 4JFDE 3DPDA 4M56A 4GAYA 4FN0A 1PQZA 4JHAH 5I6NA 3CGTA 3CZFB 4RGOH 2XZCH 4LSUL 3NN8A 2DQHH 5T1LB 3ARGD 3KWVA 4Y4HC 1VERA 5AB9A 4RDQF 5JIIA 2A9DA 1FFQA 5TH2A 2EP6A 5JW5B 1MPAH 2OR9H 5KSAB 4UZUA 1FAIL 2ZOWA 1DQVA 1OT4A 3NT0A 5KS9A 5ERWB 5CNHA 3C9NA 3WXVH 1U8HA 2ICWJ 1PFOA 1YDPA 1M4KA 4QOKD 4WK4B 1OLZA 3FUIA 4PV8A 4ONHB 3VI3E 1ZAGA 2HJLB 3QUKB 5C0NC 1UWFA 1JOIA 1UM4L 1MUJA 1SM3L 3OXRB 4G71B 2WXMA 3QHZH 1U4FA 4HWBL 2A9MH 4BFIB 2GTWB 2N3JA 5DHXB 4AENA 2O5NA 4P9HH 1IM3A 4I9WD 1EZVX 1MNUL 4LRIC 2YUXA 2NCEA 1J7VR 4UQDA 4ZUUA 2IXQB 5F89B 1KIRB 2XJLA 2O6CA 3MLWH 4WWKC 4LBEB 3MKKA 3MLYL 2EQDA 5E2VL 2BP8A 2JNZA 2V5SA 5E4EC 4B0MB 4XVTL 5E8PA 2WK2A 3ZE0E 2GC4C 2QQQA 3UTSD 3I2CL 5I23A 1YY9D 1BZEA 3LNDA 5D5MB 3JUYA 1XWVA 4WVRA 2B7DT 4P2QB 4Y2DB 1WZAA 1AY1L 3R0MA 5AB0A 3ARFA 1B0RA 4HQQH 1RULL 1AG6A 1PX4A 3HFFA 4UINH 3GMLB 4G1MB 1NCAH 2HH0L 2GY7B 2Y6TE 3VD5A 3RBSA 1H3WM 4NXSA 1JFQL 1HWHB 2A9CA 4X6BB 5FHAL 5SWSB 1JGEB 3GHPA 4PI2A 4YHZH 3VWJD 2IH8A 1DDHA 4OFYD 4HV8A 5ES4B 4Z6AT 4TNVK 2KZWA 3T3MF 2ZPKL 1FGNL 5HYJE 3DX7A 2AKRA 1NPJA 2YMXH 1O75A 1M7XA 3DHUA 1G4MA 2R1WA 5AW0B 3T08A 4HEME 3U9PL 4GSDH 5BV7L 4MNHA 1UM5L 2ZWSA 5CEXB 5GS1B 2WIIA 2K9FB 1MWAB 3H2PA 5AAMA 1U30A 3HUJF 2P8LA 4DJMA 2TAAA 2YBRB 4R97B 3JV4B 3D0VB 4EIZC 3CPLB 3NDYE 1WT5C 3K80A 3P2DA 1XB6A 5IEKB 3OKLB 1DBKL 3NMEA 1ZHLA 3JBG7 1G9HA 5T1LA 4ZNEE 1XF3B 3V4VH 4MHHG 5CGBA 3EJQA 1LHZA 5LN8A 3K0WA 1H5BA 5JW5A 5KSAA 3VDCA 3V0JA 3NVQA 1P4BL 2EO1A 3R8QA 3VSUA 2LU4A 3VG0L 4PUBL 3EYUH 4L0PB 2J4WH 3QQ4B 1DEEB 1JE6A 3PQYE 4ONHA 3UO1L 2HJLA 2XQBH 2V7NA 3WMSA 2FL5B 4RMBA 5ID1B 4ZSOE 2P80D 3P2BA 3N44F 5D1XB 3OXRA 3JWNG 4FG6D 5T5FH 1L6ZA 3BPOB 3DDFA 2GTWA 2XWJA 3SDAC 2YN5A 5T33H 1JPGB 4FNUA 1DVYA 5ITFB 1CD9B 3NFPB 1R6VA 4NNXA 4LBEA 4KFMA 4PEEA 2X9YA 3AT8A 1YLBB 5GSRA 4QTHB 1OP3K 2C1PB 2X1QA 4DP5X 4AGLA 2FBJL 4EZLA 1JRHI 1MHHB 1KG0B 4OZHF 4Q9CA 1FSKC 1X4ZA 5D5MA 4C54A 4NRXA 3KVPA 1ZANL 3N1MC 3I85A 1U8LB 1YPZE 2ZX6A 4RGOL 2ZUUA 4RGMC 3ESPA 1WZLA 4JFXB 2DQHL 1A5FL 5AEAA 3GMLA 2BIQA 4LESA 3L5WB 5IQ7H 5IW6A 3RKDC 2X2IA 5JLZA 3FONA 5AVSB 5DJZB 5AYUH 1QFOA 5J06A 3N41F 1MPAL 1PYWA 2H0EA 2OR9L 2PO6D 4XGZB 3ZQ9A 3OTTA 4R3SB 3EGSB 3HG4A 1BQLH 3WXVL 2G9KA 4LL4A 4QRTB 5F93C 1PY0A 1B0GB 3VD1A 3DTXB 1GTNA 1EH9A 4IBUA 1UKSA 3EZ8A 2ETWA 1RV6X 1ACYL 4FLHA 4OZIE 2K6YA 4XHQA 5K1JA 5DEFB 4P9HL 5IHZB 3KL3A 1HNYA 5FO9A 3D0VA 3S36X 3CPLA 2XWXA 4I3GA 1EDHA 4FZEH 2QADB 1IAII 3H3KA 2X10A 4ANUA 3AFLA 2E5EA 5E8NA 5BXFB 1ZSDA 4O2CA 3BOVA 4NN7B 3OC8A 1E90A 4PU2A 1BW8A 3HB3D 1BVNP 3VQLA 5AW3B 1EHAA 2FH8A 4RMRA 3DO7B 4UDUB 3POCA 3SBWA 3VSQA 2V9RA 4XOEA 1QTSA 5I73C 4N2OA 1MWOA 4EI5A 1BFTA 3KPRD 1QLFB 2FK9A 4UINL 3MCG1 3VFWB 2J1XA 1BAGA 5KYNA 3SGKC 1I4FA 5TE6H 3FK3A 2FL5A 4MKTA 4NOFA 7PAZA 1KYOJ 3VQ2C 1SY6A 2X4UB 1LILA 2AJSH 2JJSC 4P4KC 1NGYB 4ZFQA 3WLWC 1F1DA 4Z3TA 3SKJH 4PJFB 3SSGA 3EW3B 3GRWH 4BFEA 1EHLL 1JPGA 1PD6A 3VX1A 1JF1B 1ZT7A 2YMXL 1IBBA 4YXKL 3WFDL 3NFPA 3MV9E 3NIDB 4P23C 3ZKXC 1RZPA 4Q6KA 3HVNA 2BC4B 4Y5XB 1FZMB 3R1GL 1XB8A 2NZ9C 5IVXE 5IQ9B 4LVHB 4TRPL 4YHOH 4FKHA 5F9OL 4GSRA 2JJTA 4HC1L 1CG9B 2QQKL 3EFOB 3F6JA 1OARH 2MCAA 4UANA 3A6CH 1KG0A 4E9LA 4P2RD 1WC7A 4NM8H 3S4SA 2MNUA 2EDYA 2V2WB 2VLMD 2E6PA 2B1HH 1ETJA 4AWJC 1GIGH 4I48B 2OKMA 1OF0A 1VACB 2KQNA 4TM9A 3OAYH 2E7BA 4JFXA 3V4VL 1S7VB 5DJZA 4JQIA 4U6XB 3ZJAA 3RB5A 3VI4E 4AL8H 4XGZA 3GMPB 1M42A 4JRYE 1ZRUA 1DSYA 4LKXB 5JHBA 2DQGH 4R3SA 3EGSA 1BA9A 1TJXA 1G7IB 4KX9A 4FNTA 5FAAA 4HA1A 1B0GA 4NQCA 2CHXA 3HS8A 4PRIE 5DJDB 3QUXC 1XT5A 2EDKA 4WFHD 1H8OA 4BIKA 3UPRB 1M56B 4Y7OC 5E6SB 2YD7A 3T2NH 2XA3A 3SCMD 4F1ZA 2XQBL 2VMEA 5MERA 4G82A 1AGBB 2ICWA 2FZ3B 5DD1H 5E4AA 5KJ4A 5T5FL 5DEFA 5D2LE 4PIRF 3A21A 3QJFA 5IHZA 2AXHA 2X89A 4X6FB 4BFOA 5A3IC 5EOCL 5FYLH 1IFRA 3SZ6A 4ZAKC 3ZDXF 4GRWB 5IVNA 2XIIA 1NFDB 2D0FA 3HPJA 5I71B 4Y16D 4HH9B 3BISA 4NC2B 4GS7C 4X5PA 4DQOH 4CVXB 5JDSB 4JMXA 2LW3A 4TULH 2PWHA 3MRDB 3DO7A 2PYFB 2WTPA 4AX3A 3PREA 1FYTB 3ZDYB 3ZE2B 4U49A 3BO8B 3LIZL 4G6MH 1QLFA 4K3EH 3T71A 4OD3H 1P4IL 3LH8A 5DJYA 1L9QA 2Z7WA 1U93B 5C0GB 4FADA 2X4UA 3ZHLA 4KKCC 3Q13A 1BQLL 5CEZE 1QSED 2WXRA 4OUUB 4XMPL 5DS8B 1JMZA 4PJFA 3BKMH 1HINL 5MEOB 1JF1A 1RIUL 2V33A 3NFSH 3VA6A 3VXRE 2IANA 4Z7UE 5ESAA 4MZ2A 3BT0A 4Y5XA 5JHDD 1FZMA 4MAYC 1Z9PA 5IQ9A 4IOFC 4LPXA 4N2HA 2O5YL 1PX8A 3S37H 4EJ1C 3EFOA 4ANVA 1AZCA 3TESA 1HIMH 1G1YA 3DSNB 1KCVL 1JGDB 2UXFA 4R4FL 3B34A 1ZXQA 3VDBA 4I48A 4FZEL 1V55B 4J39A 1VACA 1DSWA 3TU6A 3KS0H 4K4KA 2NX5D 4YJZL 1OGTB 4NP9A 3C5SB 3UBFA 1S7VA 4LIQE 2WWMD 4U6XA 3RWJB 3KPLB 4U6VH 3FUEA 5LO7A 5CEZL 2KLTA 3UTPE 5LNGA 5INCB 3TXAA 4LKXA 1T0NB 3F01A 1PLCA 1XMWA 4ODTH 1ZMYA 3KCWA 1E6OL 2BCKA 5CP3A 3SDCB 3GXUB 3QH3B 3ZTNH 4WK2B 2GPZA 1I8AA 1DYZA 4KTEL 2FVNA 5FW7A 3KPPB 4LARH 4A66A 5DZLA 1U8KB 1ZHBB 5KS9F 4XPBL 4FKKA 2FZ3A 1KWKA 3CXHJ 2VB5A 1E3ZA 5DA4A 3DMMA 4X4YB 4FFVD 3WDJA 2O5ZL 4PG2A 1BG9A 1D5BB 4X6FA 2VLKB 4FNPA 3GRWL 4N5ED 3I74A 1L0PA 3NFNB 3PDOA 2OTWB 3D4YA 1LWHA 1I8UA 1JPFB 3H56A 3QZNA 1EJFA 1OE1A 4LIQL 5BO1L 4Y4FC 1ZXKA 4HH9A 3ULVH 2NNFA 2EDEA 4DN3H 1NMAH 5JW4Q 3MRKA 1TFHA 3EOAB 2V7HA 1OARL 3MRDA 2B39A 2PYFA 3A6CL 3GJFK 5DURB 1E5UI 5EA0L 2LE9A 1FYTA 3BO8A 4LCWA 4AJWA 2Y22A 5K39B 2DJMA 2WVVB 1FO0B 3FHAA 2JJVA 4HCGA 5T1MA 3ROOB 3JWDC 1U93A 4H7VA 4YPJA 1S7TB 3A47A 1PZCA 4TS6A 2EIDA 1JI1A 1IFHH 4FFWD 2QTVA 3E8UL 4OUUA 3NA4A 4X9YA 4XXDA 4W9LC 1XF5B 5MEOA 4I18B 2IEPA 3RZCA 3LKOA 3ESMA 3MRJB 4MJJA 1AGFB 1K5NB 5J6HA 4I0CC 3QQXA 2KQMA 4XWOD 5DD1L 3U9WA 2VM4A 3UBXB 1J8KA 4XMLH 2IPKB 2IBZY 1J5OH 2CA3A 2XV3A 1JGDA 4KKNA 3RWEA 4FA6A 3DK2A 3GJEB 3LEYL 5HJGA 5DHVB 2L7EA 3S96A 1FG9C 4CU6A 3E0GA 1PD0A 1QLEB 3BMWA 5GGTA 1OGTA 1EFQA 3C5SA 3WKPA 5JYMA 1YEIH 4QRUB 4UT6A 4DP4X 3KPLA 4HS6B 4EEEA 3MA9H 3HG1E 4GG8A 4TULL 4Q9RL 5INCA 1FVEB 1PFCA 1T0NA 5CD5D 5GZOC 3SDCA 1X7TA 1QNIA 4G6ML 1HN1A 5LBVA 1A2YA 2VIRB 4YE4H 1NCGA 4K3EL 2Y5EA 5G2NA 3IDYB 4FG2A 3KPPA 1FFPB 3LYRA 2D7OA 3F65A 4GI6A 3V9CA 4XN7A 3N40P 3ARED 4X7TB 4X4YA 3ZDZB 1I7ZB 1ZEAL 2LT9A 2XKNB 2VLKA 1R3JB 3BKML 3EYVA 4IM8A 1H6TA 4M8VA 3TIEB 3BYYA 4U1JB 2QKIC 3P30H 3CFEB 3NFSL 3NFNA 1ZY9A 1QRND 1N8ZA 1NINA 3RY5A 3BP6B 3ABZA 2JIXA 2IWKA 3TVMD 1MCCA 4JDZB 5SWQB 1AACA 4MZ3A 1YMMB 4K07A 4E5XA 4F9LA 1I53A 1GKOA 3EOAA 3RJDA 1HIML 2ZUWA 1M1SA 3APFA 3PFQA 1KSRA 4U1LB 3VM5A 2XC8A 5IHLB 2QHRH 4XAWH 5D72H 4AGNA 4Q2ZA 3A23A 4ELMB 3C75A 4RRPA 2R8SH 4ZUVA 4KVPA 3Q9PA 4KX7A 5KVDH 5E00B 4YZWA 3M86A 5D5MF 3S9DB 5JPNC 1BVZA 1FNGA 3FB7A 4NENB 2ENSA 3EH4B 3MRBB 4I77H 4ODTL 5LCVA 2WKGA 1Z3GL 1XF5A 3APNA 4YOKA 3S36L 1AC0A 5CIPH 2D7TH 4L1SA 3DX9A 5I1JH 5F96H 3Q3GA 4IIQC 4LARL 1K5NA 1SMOA 4K55A 1A7NL 2ITCA 4BELD 2JF1A 3VFPB 4HZAA 4OLXH 1M2VA 3FU3A 1CD8A 3O6MH 2X4OB 1FFOA 2WCPA 3WL9A 2WXFA 4AK1A 2WXKA 3GJEA 1J1OH 1W80A 1IT9H 3GK8H 4BWTA 4OCSH 2Y5QA 3ESUF 2JI2A 3BUPA 4NZTL 3NPZB 4GFTB 3MUHL 3JUZA 3O4OB 4HJEA 2HFGL 4H8QA 4HUMB 4OF6A 4ECNA 5ISZB 3EF7A 1OPOA 1UXWB 3IPEA 1G0XA 2E56A 2FIKB 3UP1A 2VISB 1RMFH 3P02A 2DIJA 5KVFE 1AZRA 2VIRA 4M6AA 2X6AA 4JM2B 4WJG3 3CVCA 1RCYA 3FCTB 1FFPA 1PF3A 3LDBC 2BSBA 3H6AA 2CGRL 1G43A 2AANA 3X11B 4X7TA 3WIHA 1ML0A 3B43A 1MRFL 1I7ZA 2UXGA 4B7LA 1E2ZA 2VXVH 1IFHL 3QUGA 3WJLA 1BFVL 1GZHC 4QXVA 4Z8FL 1J1PH 1WRFA 4AITA 4PHXA 4YMPA 4BFJA 5I76B 4I87A 4OJFH 3BP6A 4GUQA 4JDZA 5SWQA 2FATL 1VFOA 3JTSB 1XBRA 1YMMA 4XMLL 1R3LB 3RDJA 5I9QC 2BWIA 3JWNH 1U92B 3M1BB 4AYFB 1KLFB 4OGAD 4L0ZA 4YL9A 4U1LA 5KVFL 3GM8A 5GGVH 4TTDD 4L9LC 4JRXE 1CQKA 5L4JA 4ELMA 1G6RL 1TFPA 5KBNC 1IE5A 1KACB 4LHQB 4XBPA 3FOLB 4KUCD 1WVZA 1E6JL 5E00A 5E8EB 3VB9A 2BIIA 4P5RA 1YEIL 3X1GA 4G2AA 4M1DH 4Y1AA 2IQ9L 4NENA 5FDYA 4ONGL 3OKDB 5EO9A 1BX2B 1AHMA 2VWEE 3V6BR 3KYMA 5EUOE 3ZHDA 1UJTA 4LO9A 4YE4L 3DJ9A 4L8SB 5JXED 3PE9A 2FDBP 1P6WA 4WTXA 2XA8H 5HHOE 3RIFK 3U4BH 1EWHA 2C7UA 1ZVSA 3P69A 3TONA 3VFPA 5CCKH 1QFWM 1AFVL 2X4OA 1SVCP 1JRHH 1X4YA 1YNKH 3SGJC 2WD0A 2ORBH 4E41D 3ZXAC 1OSZB 1INEH 2FECI 2OJ1A 2ZX5A 2OJEA 4KQ3L 1GA2A 5K9KB 2N01B 3SB3A 4LLDB 3H6JA 1ZK5A 1QFPA 2E4FA 2ITDB 3UTQB 3D39B 4BGLA 1HILB 1IBYA 3QARA 4L8DB 4MLIA 4IBSA 3QZWB 1JGVH 1COBA 5DDHA 5ISZA 4XP5H 2EKSA 4X6CE 4DOHE 3VMNA 1TXKA 4CNIB 2CDFB 5D7EA 3F85A 2FIKA 1TQTA 2VISA 4GIPD 4K71C 3ZHNA 2VABB 1IBHA 4FYTA 1JAEA 3D05A 4HSQA 2LOEA 4JM2A 3W56A 4AW4A 2VDOB 2W5PA 1PEZA 1G0DA 3STBA 2CNZA 2YEZA 4UIKH 2DLTA 3X11A 1BF5A 3QCTH 3VWKB 1X5FA 4FX5A 1JK8B 1J0KA 2JLPA 4HKZB 4I77L 4UF7C 2DLHA 4O02B 2JB5H 5GZNA 1H3TA 4HX1A 4QHLB 4JFEB 3RE0A 4NGHH 2J1WA 1I3RB 1IAIH 2A4EA 5I76A 4DW2H 4M6OH 1MAMH 3EYFA 1Q38A 4H88H 5HTSA 1U6AL 4ZMYA 2BWQA 2R4RH 4PJFF 3BGMB 3MLZH 4LEBA 4LOUD 2CDGB 3WNJA 4B9YA 5EOTB 1U92A 3GLAA 3NIDF 4I7ZC 3M1BA 1KLFA 4B7IA 3TJHD 1KCSH 2ATKB 5CAYB 3ISWA 5KBLA 1UXSB 3GK8L 4ZX6A 4OCSL 1OPGL 3IM1A 4NQXB 4J3VA 2XIDA 4LLMB 1MFMA 5E8EA 1WIOA 3B4NA 3HS0B 3QEGH 1AD9A 2VXQH 4PGCB 4PJCE 1UOLA 5L8LB 1E42A 2CO2A 3ZKSD 4OBSA 3OKDA 1BX2A 1RP9A 4L8BA 4MA3B 3SOBH 1EIBA 1WFUA 4YQXL 1AOZA 2EABA 1SXNA 3BN3B 2D3JA 3OPUA 3UZQB 2VDKH 2XHNA 2RQEA 1JGUL 1MRCH 4G9FD 3MRIB 3ARGC 1OL0A 1LP9E 1A3LL 2R39A 2AF2A 2ZWLT 4DGIH 5IBUB 1J1PL 4HOZA 3E6FA 4OJYA 3UZEA 1KPVB 4DEPB 2X3BA 5K9KA 3EJPA 4LAQL 4RISL 2ITDA 4IMKA 5IHUH 2X4QA 3D39A 3UTQA 5KAQG 2GI0A 4FHBD 5B7EA 4TQPA 1HILA 1AO7B 3UGXA 3JVGC 4XVJH 3LZPA 3QZWA 5HGAB 4GRWF 3FRPG 1DUYB 3HRPA 1NFDF 3SY0B 2CDFA 3K2IA 5GGVL 5C08A 3ZU8A 4Z7OB 3GBML 4O5LH 1RHHB 3X3FL 4IMLB 5L0QC 4XXWC 4UT7H 2VABA 2DQFB 5B38B 5LGJB 1F2XK 1GGTA 2PXYB 3HC0A 3DJZA 4IW4C 1TSRA 4R5VA 1MJ7H 3ZDYF 3ZE2F 5DYOB 2C4FT 2YQGA 3CU7A 5C07D 3VWKA 1HJCA 1CLYH 5IG7A 1YY9C 4HKZA 2ZOKB 5DD6B 1P9MC 3RJOA 1L9OA 2V17H 3FPYA 4O02A 4PSPA 2HJFB 5EZJA 3SE4C 4YX2H 4MNQB 2CRMA 5HVHC 1N5AB 1I3RA 4IOIB 4TVPH 1HCVA 2ED8A 3SGDI 3HZKA 3U4BL 5HGBB 1XVSA 1H6EA 2GJ6E 2MOQA 3MRMA 1T7WA 1DVZA 4JS7A 4P57B 4ABQA 4MNGB 4X4MA 5GGSY 3V4PH 4X7SL 4Z95H 4KITB 3BGMA 4BZ2H 3VWJC 2ZXGA 2YRZA 3O3DB 2CDGA 5JPMB 1TZHB 5EOTA 3UABA 2ATKA 1UD6A 4P3DA 4TL4A 4PLOB 3EBAA 1RD6A 4IBTA 4L18A 1DJYA 2D7QA 1KGUA 1FUNA 4NQXA 2Y25A 2WINB 2R69H 3NZHH 1Z32X 4RAVA 3HS0A 4DKFH 3QJOA 4PGCA 3HHRB 3Q43A 3DC0A 1U2HA 3NAAH 2BP3A 2OMVB 3A6OA 3B2UD 1V10A 4MWFB 3HR5B 2VLRD 4YSOA 2NUTB 5AWNH 1JNLL 4QOKE 5J6SA 4FJZA 1EO5A 3ZSSA 1EGJH 4MA7H 1S9WB 1T83C 4ZK8A 1RVFH 3KXFD 2ALWA 4U7SA 3MUZ1 4UIKL 3EH2A 5ADOH 5I8KL 1UOWA 4NQEB 2R23B 2WCGA 4NAQA 1CYWA 1F0LA 2VNCA 2CXGA 2X12A 4XAKD 4DIXA 3B83A 4QWWD 2WC7A 4RDQG 1VZGA 1XZ0A 4I9WE 5E6IB 4Z3JA 1KPVA 3D3VA 3PY9A 3V2AR 3WEOA 2J2ZB 4M6OL 4DW2L 2J73A 2W0LA 4HAGA 2OR7A 4ZFOA 1KEGH 2FD6L 5AVQB 5F7FA 5I5RA 1CXHA 1DBAH 3BUIA 4Y8AA 4TLKA 4IRSB 2B4CC 1H8SA 2CBMA 3N43B 4KO5A 3WTTA 2WBJB 2CRYA 2QFRA 4QCIB 2JELH 4FG6C 5FWQA 3UTSE 3NSFA 4YHLL 2QR0A 2X6CA 3QI9A 4K73A 5HGAA 3WTWA 1JDDA 1FP5A 4RFNC 3SY0A 3U83A 2IAMA 2CA4A 2UYLB 3DURB 4HDIB 4Z3IA 1J9SA 1RHHA 3V0IA 5CMAB 3C2AL 3L3OB 3MROA 4PJGB 5B38A 5LGJA 2BY3A 4YDLC 3G08B 2PXYA 5B8CB 1VZIA 1HEZA 1FA4A 2IDUA 5D93B 2HUHA 5DYOA 2IAAC 3GJFA 2RMNA 2ZCHH 4M93B 4TOYL 4P4RB 2VT0A 1BEYL 3AWEA 1H3VA 2ZOKA 3CVIH 3OKMA 3JV5A 2HJFA 3FXIC 1F4YH 1QFWI 4IU2A 5FKAB 2XQYK 4MNQA 4WHDA 4FHJA 4JKPH 5AVZB 1AXTH 2VDKL 4WUUB 1HCZA 2DJUA 5HGBA 1BM3H 1EEQA 3ZL1A 1WH0A 1IGJB 4MNGA 4XMWA 5AAWC 1UXMA 3IDUA 5CSGA 1PZ2A 3VGAB 2PO6C 4JQVC 1WZKA 3JWOH 3II3A 3FSAA 3O3DA 3IK2A 5JPMA 3MC0A 3T6XA 1XF1A 2JXMB 4BHUA 1QYGL 3L16A 2V8LA 4URTB 4Z7QB 3IKCA 5T3ZH 5IM7B 4I4WB 5BMFH 3GFUA 4BWWA 1E3FA 1KIUB 3OKYA 2WINA 3KPQB 2JKWA 3E9TA 5TPWH 3MYJB 4NPYA 3KH4A 3QDGD 4LVEA 5C0BE 1A6TA 4NKDB 3B7UX 4MWFA 3HR5A 5HDBE 4ATTA 4WRLA 4ABWA 2NUTA 3IRZA 3B6SB 5EU5B 1V5JA 4M02A 4FYRA 3Q1EA 1RZJH 1JS4A 1MJ7L 3NJJA 5L8KB 2O4EA 4M8QB 1KIPB 2HJKB 3CLEH 2W0KA 3HB3C 4NQEA 4R6UA 1KMGA 2R23A 4M43L 4F7CA 4EN3D 1FVCA 2V17L 3ZGIA 4H25A 2VERA 1MQKH 3G9VA 3MOAH 3RWIA 1Q94B 1N8OE 1RZ8B 4KRPB 2MNJB 2GBUA 3EDKA 3Q1SH 5F3HA 2A6DA 3QW9A 2J2ZA 4G7VH 3RL1B 4CADB 4TV3A 4ZXBB 1CGVA 4ZUSB 3V79C 3FU6A 4MXVE 3ZDZF 4HOXA 3V4PL 4WGKA 4E9RA 5DUBA 2WBJA 5JW4R 3B2MA 1QLRB 1KBVA 4QCIA 1KFGA 1QABA 4WNJA 5T1JA 2Z31B 1BMGA 3L9RB 5IB4A 1BBDH 3ZUCA 3WG7B 2UYLA 3DURA 3M07A 4HDIA 4QRQB 1HHIB 1YEFH 3MREB 3L3OA 3T8XB 5L6YL 4PJGA 9PCYA 3CV5A 1F58H 5B8CA 3FQ2A 3NZHL 1BOGA 3KR3L 5D7JA 4DP7X 3BQUD 4ELMF 4R96B 4XN9A 2O5XL 5FKAA 3B7YA 4NWTH 3T2QA 1X7QB 2GSGB 2PW2B 2J8UB 2OSWA 43CAB 4IBZA 5E9NA 5CBEB 1RVFL 4NZ8A 3TO4B 3RNKA 5ADOL 4EDXA 1DVFA 1GYCA 3AM8A 4XNBA 4U1GC 3RHWK 5M94B 1GMEA 3FT9A 3P4LA 1K2DB 2JXMA 3VTAA 2G5UA 3P4OB 3OKKA 4PMFA 1WZMA 1XR8B 5CLWA 1TJHH 4S1RH 5HHPA 1FLRH 2W0PA 2A74B 1Y0LB 3TOPA 1KEGL 2OYLA 1PD1A 4JPQA 1DJZA 1DBAL 1EAOA 2WJ7A 4I4WA 1NC2B 1D6VH 3C08L 3SCMC 2FJSA 2WLHA 1M2OA 2XWTA 1IBDA 3KPQA 4BE6A 3DX6A 5JMOC 4W6YB 2ZKYA 3D2TA 5EIVA 1DL7H 2JELL 4N0UA 3HIZA 3MYJA 3GMMB 3HBGA 2IBZX 2YPVL 2YEQA 2XTLA 2D7MA 3KWXA 3POHA 4M4RB 3FMGL 4G6FB 3X3GH 3P40A 2EVHA 2VMJA 3R19A 2LU7A 4LCCA 1IM3D 1P2CB 3B6SA 1SJMA 2SODB 5EU5A 2WSKA 5AVUB 3RUGB 5JUEH 4M8QA 4Y16C 2BJML 4B3VA 2R51A 3OPZH 2ZCHL 1JZ2A 1KIQB 4OQTA 3H4HA 5IT2H 3B7SA 4JM2F 1CFBA 2YZ1A 1F4YL 4IRZA 1G6VK 4FRWA 3HCVA 1Q94A 1VESA 4ZMQA 4U0RC 2ZYSA 4CADA 1M3JA 3RL1A 1BD2A 4ZXBA 2QZ5A 1VPOL 4ZUSA 1PSKH 4RMVA 1BM3L 2V6HA 3BEVA 4HUVB 7TAAA 3ARFD 5C70A 4YUEH 4AJ0A 4FE9A 4KHXL 2ZCZA 2XY1A 3KWTA 1QLRA 3I02B 4O00A 3MRHA 5CKGA 4P2RE 2Z31A 4ZX5A 3L9RA 2OULB 3CZNA 3OVUB 4WTWA 4ADIA 1LEKB 2DQJL 3EH5B 3K3QA 1ITCA 4Z0BH 1HHIA 3MREA 3T8XA 3F7YB 3MOQA 2XX0A 5BMFL 1JWSB 4KXDA 1XEDA 4NUQA 3BPNB 3U4AA 1CGTA 1AR2A 4XPGL 5I15L 5TPWL 3HBPA 3HZMB 1UCTA 1KBKA 4J12A 3FRUB 1X5JA 5C0CE 4TLTA 1VRSA 4PWHA 4A2GA 3P4MB 5EOCJ 4CW1B 1X7QA 4WFHE 4YS4A 1N19A 4JG1L 3BWAB 1E8WA 43CAA 3GSNH 5CBEA 4CBPA 4PBWD 3K71B 4B0MM 1YEDB 1L9SA 3TO4A 2EVFA 1RU9L 2BERA 4OCNC 2WWMC 3FQUA 3IJEB 3P11H 5T1LD 5KEZA 1CFNA 1WFMA 2V3EA 4XZUB 2EUXA 5DRWB 3IBOA 4R7DA 5IB1B 2BOLA 3K8MA 1K2DA 3T6QC 1MQKL 1X6LA 3MOAL 5KSAD 3P4OA 3INUH 3SEPA 4DK5A 2ZZUT 2YHGA 3Q1SL 1NIEA 3V5DA 4G7VL 3KYAA 5DD0L 1Y0LA 3RJQB 1J8HE 1AZBA 2Q3ZA 1NC2A 4QTFA 1DO6A 4J4PA 4GP4B 4HXAL 4MB3A 4WEBH 1S7RB 3VB8A 4M5ZH 1KB5L 1DQTA 5CLZA 4AVKA 3CUPB 4FFVC 4Z23A 5I1GH 1DZ0A 4R7VA 4K5PA 4K0OA 1A1NB 4NQVB 2G3NA 5DQ9B 2ADYA 2EXYD 2YARA 3SBPA 5IR1B 3CMOL 1SLUA 4M4RA 2YAEA 1YEFL 4N5EC 3HBZA 5LG6A 3O2DH 5FYKU 3QDMD 3N0PB 1E4WL 1WBXA 1F58L 3Q7JA 3QDJE 4HIIB 4UNTA 3B9DA 3RX5A 3RUGA 2Q20A 1EV2E 4N87A 1BF8A 3W57A 3APMA 1BBJB 5D1ZC 2DF3A 2BS71 2XQ0A 3TPUA 2XTJB 3C5XA 2AP2A 4S10A 3GF8A 2QMKA 1PNDA 2W1NA 1E2VA 2J1ZA 3DGDA 1Z9SB 2HMIC 3EJUA 1DVQA 2K8MA 5DS2A 3WY1A 2OMXA 2P45B 2IADB 2UWEE 1FL5B 4APQB 4UM9B 5IFAH 3IJ7A 3P0VH 4P2OB 3RWHA 4G70B 4L0YA 1YN7B 3IFLL 4FQ2L 4K94C 2FHFA 5JHDE 4R26L 4DN4H 3C09C 3MNWB 2IH3A 3TCTA 5KBKA 2FJGA 1DN0A 2JKLA 3I02A 1YEHL 4FZ8L 4WJ5B 4FFWC 3MCYA 2D73A 4FMVA 1SQ2N 4RZKA 2QLVB 2BSTB 3F7YA 3SPIA 3VG9C 1KC5L 5DD3H 1RLWA 2NX5E 1JWSA 4WI6A 4KK9D 2WP3O 4P5KA 2LHAA 4XWOC 5FX3A 4HUXA 3EHBD 5HYJA 3ZHFA 4HLEA 1DL7L 3HZMA 2B9AA 2K8QA 1PDKB 2ZG3A 3DK0A 3LTVA 1N12A 3I6LE 4PS4H 1BMZA 1JI2A 1FL3A 2ZKXA 4OVUA 1P7QA 3P4MA 2W07B 4A7TA 1J48A 4E9SA 1PZAA 4CW1A 4LQFL 1ASQA 1BJ1H 3AMLA 1CU4H 3BWAA 5J1AB 3QJQB 1MJUH 5TE7L 2F15A 1OALA 3K71A 2PW1B 4PJIB 1IARB 2ZQKA 1PKOA 2AJZB 1YEDA 3H0TB 5HD8D 4PWIA 3OMIB 4M9PA 5SX4I 2X09A 2EO9A 3IJEA 4ZI8A 2YD9A 4XZUA 5DRWA 5IT2L 4PTTA 1F5WA 5CD5C 1WLHA 2VXTH 5EEXA 3GLDA 4QUOA 5LKNA 1PSKL 2NZIA 3IYLW 3STLB 2CGYA 4EI5D 2NSMA 4HIXL 3G5VB 4YUEL 3VFOB 1OGAB 1LO3H 4MA1C 3AREC 3QG6B 3L81A 3O6KL 4GIOA 4YVNA 2PKDA 5IUCA 4NQVA 5AW4B 1OCWL 5DQ9A 4AUJA 5C0EB 4W4NA 2B77A 4XHJD 1QZNA 1OLLA 2KZBA 4JHUA 4Z0BL 5LBSL 1M53A 4L1BA 3V4VB 4E9QA 5D8JL 1EHNA 1O9VA 1PVHA 3AXIA 4HIIA 1S9XB 2YA2A 3OZLA 4MXQD 4OZFG 3TVMC 4PJ9B 2Z6FA 1YYCA 5E6ZA 2VITB 4Z7OF 3HHSA 2D0GA 3IU3B 4CMHC 4J27A 4JFQA 1Z6JT 4H20H 2BMKA 2CUHA 3U25A 5DCCA 1MJ8H 2XZAH 3MJ7A 3OZ9H 2IADA 1FL5A 4OZGE 4JUTA 4APQA 2X1PA 1ZLDA 2PF6A 4P2OA 4YDKL 5EU6B 3RKPA 3A3YB 2ZJSH 2AJXH 1U3HB 1JZ4A 3FO2B 1N67A 3GINA 4QI3A 2J21A 1CXFA 3MNWA 3LKQA 1TYJA 3QNYB 1AQKL 2ESVA 1SRDA 2V5TA 1UM6H 1VFAB 2J5LC 2CMRL 4WJ5A 3LKRA 5MHSD 5IEHA 3INUL 5EF3A 8PAZA 1BVNT 4FD0A 1JCVA 5MENE 4PRDB 4Y9FA 4HAFA 4RX4A 4WI5A 5HVFB 4NQCD 3G5XA 4JGNA 1HESA 4AUUA 1L9MA 1IZKA 5I1LB 4WEBL 3NTCL 4LLWA 4M5ZL 3X1EA 4LFHG 2PCYA 4G8FA 2BDNH 1XSOA 2JVUA 4PJBB 3EFFB 5FA3B 5AVVB 3TJEH 2X89D 1MCDA 3GM0A 2KLRA 3SGDH 5J1AA 2XPZA 4OLEA 3TIDB 2PW1A 2HZHA 3MODL 2QADD 3GS4A 3BH9B 5K9OB 4XWGL 5D4HA 4Q0XH 5DEJA 3A6BL 5KN5A 4NC0B 3LH2H 4FC3E 3ZVVA 3O3BA 3EIFA 4IJ3C 2KT6A 3GO1L 1EEUA 4ONOA 1OY3B 2FECL 4W70A 4PCTA 3ABMB 3LY6A 3CH1B 5T1KB 4ABVA 1A6ZB 3P2TA 1QRNE 1CN4A 1RZKH 2AJUL 1MFVA 2CK0H 3EO1B 2VM3A 4HC1A 2PNDA 3STLA 4PVMA 2Z92A 3G5VA 2FR4B 2VW4A 3VFOA 1OGAA 3FFCB 3LQMA 4Q9QH 4XMKL 1F56A 1MAJA 2A4ZA 3QG6A 3WN5C 5EIIB 3ARDA 1LE5A 3I84A 3CBRA 4PJ8B 4NQSB 1PX3A 5ANMB 4LP5A 3LMJL 3PHSA 4PJ5B 3BN9D 2Q3AA 3IGUA 3B2VL 5C0EA 5CFHA 3O41A 3U0TB 3V4VA 3KG5A 3N43F 3R18A 3NJFA 1CFMA 3V95A 5DHEA 3IXTB 1QASA 1S9XA 2QTEA 3OHMB 1NCJA 1UUNA 1XFPA 2IAND 4M4PA 4PJ9A 2P42B 4HJUA 2R56H 3FO0H 5DMYA 3MZGB 3AJ7A 4PS4L 2QBWA 2JWYA 3AG2B 1OW0C 3QEHB 4PJGF 1NC4B 3F7QA 2XXMB 4OGAC 5DFVD 5IVXA 5E08H 4N3UA 1RUMH 2KDYA 1Z1WA 4TTDC 3QUYB 1WO2A 5EU6A 2Y24A 1TLKA 5T5FA 4QDGA 1U3HA 3FH5A 4MASA 4QAWA 3FO2A 4KMTH 5D4IA 3ZR6A 4E0RB 4ANKA 1PZDA 4BYHA 2P1YA 4M3HA 4MJIB 3B8SA 4Z7AA 2NY1B 1D5IH 4HJTA 3C5JB 1A0QL 3GTTA 1VFAA 4GG6E 3LZQA 3SKMA 1P5UB 5HGHA 5KYUB 3O9WB 4EXKA 4KZ0A 1IGMH 1JHLL 4PRDA 5JXEC 4JRYA 2UXVA 1Y6NR 3VFSA 1OP5H 3BD5A 3BAJA 5I6XC 1S7QB 4X4XB 4UB0H 1F4XH 1LO3L 1KELH 1UVQB 3LKSB 4JCWA 4KY2A 4PVNA 1F45A 4MQXD 4ZD3L 1UTDA 4KKRA 1QFWH 4Z7QF 3DMMD 1DQKA 4AQ8A 4XCFH 4B97A 4MQTB 5FA3A 1U3JA 1B0IA 2EDJA 2HLEB 5D2LA 5HPMB 3RX8A 1P5VB 1Z66A 3CSTA 1VEPA 2ENPA 3DETD 1J5DA 4QKXB 3GTNA 3TIDA 2CO3A 5K9OA 4AQEB 3BESR 4C55A 3IDJB 1QWUA 2VH5H 3DVNA 4H20L 1HHGB 3F6LA 1TO4A 2VJ0A 1CE1H 5LQBH 4G5ZH 1WUZA 2XZAL 4N6RB 2AAVA 3CH1A 5T1KA 2QDVA 4N9GB 1A6ZA 2O6FA 1FYTD 1L0YA 3QFJB 3F3HA 2ZJSL 4LCWD 2ITFA 1O6TA 2ZD0A 3FDWA 1RIVL 2FR4A 1GVIA 3FFCA 4NPKA 1I75A 5IV2B 3B5GA 2F53A 4M1CD 3PGCA 3K6SB 5EIIA 4MMZB 1GZPB 1J11A 2JI3A 1C5BH 3EDJA 1JF5A 1IC5H 1TLMA 2LR4A 4XCEB 2YAQA 4Q6IB 2AC0A 1F3RB 2QKSA 1G7QB 4NI3A 4NZRL 4UYQA 4ZS7H 2LAGB 4YC2C 3N06B 3L4XA 5IB3B 4PJHB 2QPSA 2AJ3A 4X5LA 4FNQA 5B21A 5LXGH 3RZCD 5J1SC 4YIQB 4HD9A 2W9DH 3GYRA 1TTCA 4DZ8B 4P07A 2BDNL 4LOUC 2VERN 2EDOA 4KQ4L 3QEHA 1NC4A 1U8QB 1T1XB 3LS4H 3TJHC 3TJEL 1YQVH 4HCRH 1O9WA 1T4WA 5ACLA 5TFSH 1AKJD 1D5XB 1MI5B 2Z7UA 1TZAA 1BXUA 1DJGA 4LSPH 4E0RA 4JCLA 1W0VB 4M5YH 3VFMA 4Q0XL 3B9KB 3WE6A 4N28A 3GRWA 4MJIA 2ZE0A 3OMNB 3C5JA 2MIZA 2J8UF 2RCSL 1RUPH 3EJZD 1KPUB 2E7LA 4K5OA 1RZKL 3WY4A 3IPBA 2KL6A 1WWAX 1RZFH 4AQAB 4UQ3A 3OB8A 1A6WH 5IIEB 3KZ8A 4I1PA 1IM9B 4S0SD 1XGYH 4KDWA 3TA4D 4POZD 3BWUF 4Q9QL 1UVQA 4DP6X 2FWOB 1TTBA 2NR6A 3QT2A 4G8GB 5IFHL 1MF2L 3R0NA 4WV1B 3DTDA 3CDYA 3WTYA 2B14A 1DQLH 1N4XH 4OFVA 2VUOA 4LU5L 3V8CA 2VLKD 5HPMA 3C6LB 1P5VA 4MD0B 2WANA 3L45A 4Z7IA 3GRGA 5JIMA 2Z1PA 4A6YL 5I1DB 2JIXD 3IDIA 3QEQE 5F44A 4EI6B 1YC8A 1MCLA 2GHZA 3OGCB 3B9EA 3IDJA 4ILDA 4WK0B 1HHGA 2DDQL 4FAAB 5CM1A 1HXKA 4M1GL 2C3HA 4IDJL 1JSYA 4N6RA 5DURD 3RUGF 4N9GA 1ZDSA 2OA9A 1SF5A 3L2NA 3M45A 2VLLB 1Q4NX 3PGFH 4M8UA 5IV2A 2KPNA 4MMZA 1IE4A 1GZPA 1EVUA 1L7IH 2DQDL 3BWZA 3CX5K 4AH2B 3QFGA 5E1QA 4OFDA 1C16A 5AZEL 1ET8A 3DLQR 1ZVNA 4Q6IA 1ANUA 1G7QA 1IGML 4H0GA 3MJ8A 5G4OA 4PJHA 3N1PC 4UILL 3HUJE 4UB0L 4M7KL 4YIQA 4PW9A 2J5WA 5ANHA 1QBML 1W0WB 1T5XA 1A3RH 3KHQA 2DYRB 5FV2A 1J0JA 2C26A 2PYEB 2XZQH 2WQWA 1T1XA 1U8QA 2VN3A 3QZBA 2EH7L 3MLTA 3MNVA 1VSCA 3F7KA 3AACA 1BQHG 1E8ZA 4KVCH 1D5XA 1HCFX 2YFOA 5K69A 1E28B 1OAQH 2FJUB 5AVXB 3VFUB 2PCFB 1W0VA 3PDGA 4V11A 35C8L 5MP6H 4KKBD 4QRRD 4OLYL 2IQAB 5HSFA 2CM5A 1WG3A 3D69B 3U6XS 1CE1L 1OCZB 5C2BH 5LQBL 2FEJA 3B2UC 1OXYA 3II2A 4MJ4A 1KPUA 4OGYH 1PZ3A 2QQNH 2FNWA 4FJYA 3DVFA 2G2RB 4AQAA 4DPCX 3KPSB 1KJMB 4PJDB 1XIWB 4UMGA 4MX7B 2DIEA 3V52H 3ES6A 3L4WA 1QZ1A 1FORL 3M88A 4DTGL 2FWOA 3BUDA 2HFEB 5ABDE 4O2EB 1T2XA 1C5BL 4NCDA 2GYSA 3HE6B 1IC5L 1OCCB 2XFXB 3NACL 1R17A 3F00A 4G8GA 4QWWC 4WV1A 5GGRA 4AIOA 1GOGA 3T4AC 4PJAB 1FN4B 3CSGA 3W5NA 2FUQA 3I50L 1YEKL 2XXFA 1NTDA 3C6LA 5F7NC 4MD0A 5IK3B 3RFZC 2K1MA 1NA8A 2DTSA 3LEXB 3O3AB 4OZHE 4PCSA 3NK3A 4MAZA 5I1DA 4ESKA 5C07E 1SVZA 4EI6A 2WXQA 2BNRB 3VJ6B 1YMMD 2CAKA 4UV4L 2OMZB 4B50A 5F1NB 1XGUB 3AS1A 1MCEA 2Y5TA 4OT1H 3UTTB 4CJ1A 5TFSL 3IETB 4O4YH 3VTTA 3GSQB 4UAOC 4P9ML 3LN5A 1BQKA 1TJMA 1L5GB 3MV01 1S9VB 4P46B 1QUNB 5F7LB 3ZT7A 3HE7B 4HFUH 2VZTA 5ADPH 3CHOA 4Y1AD 4LSVH 2Q7AA 2NNXA 4KXZI 5JW4N 3KGSA 2HCZX 2IH1A 4GKNA 3NP3A 1FYHB 1A6WL 3JT2A 3S3DB 1ZVYA 4AQ1B 1XGYL 3RI5F 5D7LB 4K8RD 4GAGH 3OKOA 3C8KB 4XC3H 1W0WA 1JXFA 2JCCB 4A2LA 2I85A 5J4MA 4KKLD 1J0YA 2VLRE 2PYEA 2F9BT 1DQLL 1C5CL 1RURH 4ICWA 4UTCA 3CN1A 4P2AA 3IT8D 1HAUA 4Q7DA 3P9WB 1LO2H 1LE9A 1E28A 5EBLB 5DD5L 2NLJB 2TRHA 3UADA 4AYBA 3WNNA 3LD8B 2HT4D 4YAQA 3VFUA 2PCFA 3IVKB 1UT1A 4OJCA 5BUGA 3UBHA 3TBCA 2NYYD 1H9DA 5CIPB 2IQAA 4U1IB 1N6QH 1CJYA 3D69A 3K2KA 4M48L 2X70A 1J5HA 1YN6A 3MRCA 4ORZC 3KLQA 4C4KT 3T8VA 1DSFH 4LHUA 4PJIF 5ISZD 1LK3H 3EADA 2WXHA 2H32H 4JL2A 2JQMA 4HUCA 4UIMB 5GS2H 5J57B 3PNWA 3KPSA 5AW2B 4Y5VC 5I1CL 4M6NL 1XIWA 3TH3T 4IEFB 4JM2D 4MX7A 3U30C 4Y9BA 1DANT 3JVFC 1G5GA 1OGSA 3Q8CA 3WNKA 4EN3C 1LDSA 3HE6A 4Y4KB 1TYEB 2XFXA 3RGVB 3FB5B 3WXWL 4EO5A 1TQSA 4GMSH 3WNMA 4PJAA 2CWRA 2J6WA 3ABLB 4MMYB 5GZND 1MFDL 1O7VA 4UV7L 2PPAA 5IK3A 4FXKC 1QX1A 4BEIA 1NFKA 4I85A 3LEXA 4NO2B 1T0OA 5A2AA 2VDNB 3QRGH 4NQDB 5SX4H 4QHUB 5BW7C 4NBZB 1NCWH 2FLRT 3FNKA 2Q7YA 5DMJB 2PCPB 2LU3A 3ARQA 3MLUL 2OMZA 5F1NA 1N9PA 3ECVA 2D2OA 3ARRA 1KCWA 3CDZA 4RFOL 3UTTA 1EDQA 1HHJB 4X9HA 4KVCL 5GRJH 2WXPA 4B9KC 4LP8A 1MDTA 3DRQB 3ASNB 2Y2TA 4IU3B 4P2CG 1S9VA 3AVEA 4P46A 1QUNA 4OZFH 3HNTL 4ETYA 5I1IH 3VFVA 3HRZB 4YGVA 3HE7A 1DO5A 1L6PA 5MP6L 3O4LB 3S3SA 1AQHA 3NEEA 1MCHA 1G7HB 5IQNA 3BQUC 2DM2A 4JHWH 2X38A 1CGYA 1MELA 1IL1B 4OGYL 3O0RH 2QQNL 1I8KA 3ZQXA 3CX5J 1KLGB 4A7GA 4OJAA 5L2KE 5SWZB 1UWYA 4FNRA 3IGLA 3V52L 2ZSVB 2ZSWB 2EDXA 3BUYB 1IBZA 3FT3A 4GOSA 1F8TH 3C8KA 2A9AA 3PNRB 3ZDXE 1AD0A 2JCCA 3QDGE 1RIHL 4JHZA 5HHOA 3UBXI 4LKCB 3CXFA 1NMCB 3P77B 4NQQA 4D0CB 3DGGA 1FNEB 3GZPA 4YSSA 4ZQTA 2ZYHA 4UWQB 2QQLH 1DJXA 5FGBA 3K81A 3LZFL 1BWMA 4XCYB 1TETH 3IVKA 4PJBF 3BPCB 3F5WB 1MH5B 2VXUH 3QS3A 5CIPA 2DYSB 4U1IA 5I2IA 1DN2A 1T21B 1NAMB 1O6SB 1NKOA 5TE4L 2CO7B 4WWPA 5FA4B 1LXMA 4O4YL 5C08D 1A3QA 3L3JA 4UIMA 1VGEL 1IEBA 3CVDA 4B3EA 1CLOH 4F20A 3EBHA 5HYSB 3CBKB 5DRXB 4JREB 2AJVH 2VC2H 3NCYS 3LRMA 2OZ4L 3TNNB 1W9XA 1GZQB 4QAMB 2W92A 4Y4KA 3RGVA 3VWKD 1NCNA 4LSVL 1E27B 3VRJA 3RYMA 4MMYA 1NAKL 4KZCA 3EXLA 3STZB 2FUTA 3F05A 2VZ1A 1YNLH 1JVLA 3IJ8A 1N64H 2YRPA 3CD4A 3F62A 2C5DC 2WIMA 3ARFC 3DOSA 3RX9A 4QHUA 4A7SA 4DKEH 4P3CH 4AEEA 1AGCB 4BDVA 3J27A 2KI6A 1OF2A 4ZO6A 1CVRA 1CR9H 3F7VB 5DSCB 1J1XL 2FB4H 4NIYE 1RURL 4RGNB 5F71A 2OL3L 3M17A 3QUML 2CLVA 1KYFA 1ODUA 5HGGS 1U8PA 3UJIH 4XH2A 4JFYB 1X7SA 3BGFB 2AZUA 1FNSL 2DLGA 4XX1G 3D0LA 1WAAA 3O4LA 2UY6B 3WNLA 3BLKA 2GK0A 1KY6A 4LEOB 1G7HA 4IK6A 3RU8L 5EOQH 4UDTB 1XGQB 4G43A 5KS9E 4XPHH 5AAMC 2G60H 2KMWA 3CHQA 5AOMA 1KLGA 1OZTG 1HX0A 2IVFC 2V8MA 5B3JF 2Q9OA 3AGWA 4EOWH 2H0FA 4WZ9A 1ITBB 1NCDL 1M3IA 3BUYA 1RZGA 4K2UL 2L0DA 4HP5A 3II1A 4LKCA 4AEHL 3ZZQA 2DM3A 3QYCA 1H5BC 5KSAC 2Z35B 2Q87A 3NCWA 3P77A 4D9QE 2X4NB 3WY2A 2JTYA 5ACMA 3T4YB 1QPXA 2NY7L 1JXJA 1A6VL 4Z0XA 1KN4H 2GUYA 3D3VD 1F13A 3QRGL 5KWYC 2DM7A 1IIKA 1NCWL 2D8KA 4BCYA 1LD9B 3F5WA 1MH5A 5CLTA 2ODIA 4XP9H 1ZLWK 4HIPA 1OEZW 1T21A 3GD1C 1NKGA 1O6SA 2EDFA 2Q0ZX 3QO1B 2EXYC 3RQ3A 1NGZA 5EZLB 1HK6A 3QI9D 2CO7A 5GRJL 5FA4A 1JZ5A 4QIRA 2B20A 2IAMD 1G7JB 2YRLA 1MCWM 3ZTDC 1W8NA 4ODWB 1FHNA 1I1CA 1XX9C 2FX8L 2BINA 4OW6A 4C59B 2VYRE 2PXYD 2Y2YA 3TFKD 2RA1A 3H9YA 1MWAH 3HW7A 3TNNA 3KH3A 4JHWL 3QVAA 5FKPB 2DD8L 1F6AB 3U46A 3VH8G 3P0GB 4HIHB 1T2JA 3O0RL 4O51A 3UX9B 3GDBA 2CKBH 3GI9L 4H40A 5JIQA 2EILB 4KOCA 4MNQD 3ZIMA 5AVWB 4ES9A 2JSFA 3E7JA 1OTSD 1OVZA 2E75C 1J0HA 3N42B 2NW3B 2QVTA 4HXBL 4L1TA 4LGPB 1F8TL 3GPSA 2FSEB 4G7QB 1AGCA 2NQCA 1IKOP 1HH6B 4JGJA 2GJ6A 4PJHF 2W91A 4NZJA 3FKUS 2ZIDA 5E56A 4OLZH 5FYJH 5LGHH 3TS8A 2BZ7A 2WBKA 4ZUWA 4TSBL 3AADB 2APVA 4NJ9H 5FGRA 1JGLH 1TETL 4KK9C 1FIEA 3AGVA 4FF9A 4JFYA 5H94B 3V7AE 1CDBA 3EHBC 4Z1PA 4B27A 4W68A 2CDEB 3VMPA 5GGUB 2AK4B 4MMXB 4LEOA 1MFCL 5FGCB 1RPQA 1XGQA 2AQNA 3QP3A 3T3PB 3ENEA 3P9LB 5BNXD 2XN9B 3BUTA 4KXCA 4CN1A 5M7QA 3V4PB 4R97C 5TJWK 3K6DA 3PP3H 4LPCA 3C6EA 5JNYB 1MRDL 1BQ5A 5D2NA 4BQ8A 1IGIH 4HGWB 5HD8C 5IHHA 4AI7A 4MS8D 2AJVL 4M3KB 1QHPA 3L13A 4BQBA 4K23L 1KZYA 5GIRB 4NQED 5FK9B 4X50A 2AI0H 1T2QH 2YLKA 2Z35A 4KJYB 3SBWC 2X4NA 3F12B 3T4YA 2VXQA 3NCBB 2Y36H 1SUHA 5IW3A 3T0EB 1N64L 3MUJA 4EI5C 1KF9B 1GY1A 3MZTA 7FABH 2NXZD 4NP4H 1Z5LB 5I1HH 4LLVB 4OSUH 5T1DL 2OMWB 4P3CL 2DLFL 1MZYA 3T0AA 2G30A 5DT1L 2WBJD 4NUGH 3UYPB 1SXAA 4U7MA 2FB4L 3QO1A 4JFOB 1EDYA 4LAJH 4YDJB 2A5UA 5EZLA 3A24A 3GEFA 3KVDD 4XHJC 4BKLB 5D5ME 2E7MA 4P2QE 1UC6A 1G7JA 2ISDA 5I19L 5KVEE 3CFCL 4MXQC 2HLAB 4ODWA 4J6RH 3NCMA 2YGOA 4F80A 3NCXA 2K3HA 5F3BB 4JKKA 2ADGA 4OD1H 4QGYA 2YD3A 5D7JD 5EOQL 5SWSE 3U6RB 4N0CD 5FKPA 4N9OB 1Q72L 2JJTC 3WEXB 4HIHA 4LSQH 4DGYL 1ZLUK 3HZYA 5FM5M 2V2TB 4EOWL 3T77A 3Q2VA 4YSRA 2PWEA 4HVBA 3DX2A 4FQLH 5E1IA 1TQUA 2YAOA 3WEAA 3MFFB 1NIDA 3IF1B 1RJLA 3MUGB 3ULVF 3PWPD 1DVFD 5E5LA 5BRQA 1HH6A 3AROA 4G8IB 5DLML 4LGSB 3BAEH 1AQDB 4R7XA 4MDRA 5KVEL 1KN4L 3OJMB 1IQWH 1ZV9A 2XG4A 4YSUA 5F6HI 4L8CB 2C7FA 5H94A 2DEWX 2WYHA 1NBCA 2FEEL 3UBXA 4H26A 2CDEA 5GGUA 4XP9L 4DF9A 1A4KB 2NY0D 2IPUG 3ISYA 3K8KA 2X4SB 3L1EA 3HZVB 3P9LA 2XN9A 2Z91B 5FFOA 5FHBH 3V4PA 3EGDB 2BVYA 4OJDH 4BZ2A 3KD4A 3R06B 5F8RC 5C0BA 4CVZB 3FSOA 1MNNA 2QADC 4XT1C 1PZ5B 1OAKL 2DQMA 3K6NA 3MGTB 1T5WB 1BJMA 2OJZL 1BAFH 1MWAL 4JN1H 1TNMA 5D1XE 5GIRA 4A04A 3ZLQC 3MDJA 1TU2B 4WTZA 1IGTB 5FK9A 2ICCA 4PJDF 4KJYA 3TA3B 1S9KC 3PL6A 3F12A 2DMBA 3ARYA 5C0RH 4BWUA 4KH9A 2DEXX 3BSZH 4KRPD 5LNDA 3GDCA 1D6EA 1GAFH 2D7NA 3ULSB 4DFHA 4WW2C 1BD2D 4ZXBD 1HZHH 4LLVA 3CN3A 1UJ3A 4PJAF 4B60A 2I60L 4JFUA 2CO4A 3NUKA 1T4KB 5BVPH 5B1JA 1ZWIA 3BN9C 3ZBMA 5FYJL 3F6IA 4BKLA 1XL6A 5KZCD 3BDXA 2XICA 4J23A 5AUMB 4F37F 4NJ9L 3GBLA 2MOVA 3N1QC 5GJTH 4JMNA 3KLDA 2ZXDA 2OMBA 4ZTPL 3KW8A 2LFEA 2C3XA 3AWGA 4RZCA 5F3BA 1QPPA 2Y7NA 3U6RA 3BKJH 5DFVC 3WEXA 1AGDA 1D7FA 3LNEA 4GB9A 1SYVB 2EXWD 4ZMZA 5TD4A 5ITBH 2H9GB 1ADQL 1MREH 4GRWH 4Y1TA 4D9LH 4FLQA 5FYKH 5HJ3B 3WEMA 2RIKA 1O5PA 2G75A 4KPHH 1W72H 1IGIL 4V2CB 4FFYH 5C09B 4EVNB 2WZAA 1HOCB 4ICXA 3MFFA 5GRWA 3TL5A 5E4IA 1A6AA 3CCHB 3CN4A 3IF1A 3M7OA 3K8LA 2AW2A 2J55A 4A7GF 4JPWL 4G8IA 4C83B 2AI0L 1T2QL 2C9XA 2E7DA 4CKVX 1BGXL 2WYZA 1QSFB 3DX1A 2Y36L 3MNDA 1WZ1H 2E4TA 4OLVL 2WM0A 5EULV 2JCCF 4PBXA 5FOJA 1YCSA 2YLHA 4NP4L 4BINA 1XH1A 4LASH 4JQIL 1G9NH 1NC2D 4J4PD 1GPOH 1DQQA 3ZOAA 3NZUA 5C0JB 3VXMB 4MQXC 1F1GA 2CJUH 4NUGL 4Y2NA 4LOVA 3DMMC 1LO4H 4KXZH 2X0WA 4YHML 4PG2C 1IGFL 3RWGB 5GS0D 3EGDA 3KM2A 3ILQD 4G6FD 2VR3A 2WQVA 3DETC 1KBGL 2Q3XA 4NX0A 3EBGA 5CINH 4F33A 3U0PA 4GKOA 1YYLH 1CICB 5F9JA 1PZ5A 4F7PA 5I71C 1QVOB 3MV8B 5DQDH 5FO2A 1HHHA 2Y06L 3EOBB 3MRPB 4XN2A 4Z5RA 1TU2A 3SPJA 4YLCA 1WIPA 4UZGA 4GI9A 2OBGA 1QI5A 2GIYA 1CT8A 2XYBA 4PJFE 2Q1EA 4NIKB 1BJ1J 3I9GL 3TBTB 3L2MA 2ZYRA 3NIDE 3ULSA 2ED6A 3S97C 2ZX8A 1FZJB 2V2XB 1BYPA 2YS4A 4QJ4B 3MNMA 4M1CC 2MKWA 2HPTA 1UZGA 1BFOA 2YXWA 3WKML 5I0DA 2CJ3A 2YWYA 4JX0A 2NY2B 4HFWB 1UKTA 1UYWL 5AUMA 1II4E 4N8CL 1M1XB 1IQWL 2RBLA 3TO2B 1EMTH 3RZCC 1WD9A 4NLAA 1J87A 1KCRH 1SF3A 1INDL 4KNSA 4UOZA 4PAZA 4KKZA 2O6EA 4UQ2B 1PJWA 5C9JB 3BAIA 4R83A 3MRGB 1ZT1A 2UV3A 5HYJD 1YNTB 5JW3L 3WU1A 1GJWA 1FLTX 2FWSA 3PV6B 3OJ2C 2H2PD 1UT9A 2IJ0C 1P7QD 1NIFA 1KB5A 2J88L 4B41A 4H0LC 1WAAF 5C0CA 4W9JC 1CD1B 1LO5B 1G9MC 5A6MA 1LEIB 2VQUA 2AQTA 5C09A 4EVNA 1MIMH 4WCYH 3C60B 4JZNB 5KSBB 1KZQA 2GG1A 4JN1L 4N0FA 2WXNA 4WU7B 4GW1B