3UACA

Multicopper oxidase cueo mutant c500se506q (data4)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
489
structure length
476
Chain Sequence
b'AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHSHLLEHQDTGMMLGFTVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase CueO
publication title An O-centered structure of the trinuclear copper center in the Cys500Ser/Glu506Gln mutant of CueO and structural changes in low to high X-ray dose conditions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 136
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uacA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uacA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3uacA03
2N0MA 3AG3B 2GC7C 1WA2X 5I6LA 1W6LA 3AG1B 4M3HA 3H56A 2FQDA 1SDDA 1PAZA 2VW7A 2QPEB 1YLBB 5I6MA 1PNDA 2BZCA 2BZ7A 1XB3A 4G7RB 3X1NA 3ABKB 5F7BA 4HCIA 1OF0A 4A2FA 1WAEA 1CC3A 2WO3B 2ZONA 3TA4D 2ZWNA 3PPSA 1JZIA 1BYPA 2IDQA 3NSFA 4ZK8A 3GYRA 3OMAB 2VN3A 1PZAA 4EF3A 3JTBA 2BP8A 1OV8A 1R1CA 1WS7A 1J5DA 4DP8X 4GY4A 4YSTA 2FT7A 4HHWA 2PP8A 1OCZB 3WIAA 1RCYA 2YAOA 2XV2A 1TEFA 2GC4C 2PLTA 2UX7A 1PLAA 3ASNB 5B1JC 2GBAA 4AZUA 2VW6A 2B3IA 6PAZA 1A4AA 3QQXA 3PAVA 2DWTA 3U25A 5B1JA 2JXMA 2OJ1A 5I6KA 1DYZA 1J9QA 1MDAA 4ENZA 2HLEB 5TK2A 1NIBA 4BDVB 2ZOOA 1MG2C 2BW4A 1AZBA 2MTAA 3NJGA 3TBCA 3UACA 2AZAA 1OCCB 2TSAA 3TASA 5AZUA 3ZX1A 1A65A 2IAAC 4AKQA 1NDTA 3FT0A 3H4FA 2I7SA 2AVFA 2FT8A 3GDCA 4G72B 2I85A 1IUZA 1ET8A 2XXGA 3X2QB 2Q9OA 1BAWA 2YARA 3HB3B 3IBOA 1ASQA 2Y1AA 4P5SA 3EH4B 1L9OA 3UGEA 1NIAA 1OCOB 3EF4A 4RH4A 4A67A 3IN0A 1A3ZA 2BP0B 5B1KA 1ZIBA 3CDZB 3G5WA 4A66A 2XU9A 2XWZA 2B08A 4F2FA 3T6ZA 3FU7A 2CUAA 1KGYE 4KNSA 2J5WA 1ET5A 2VSMB 1NIFA 2DYSB 2IH8A 2PP9A 2VW4A 1NIEA 3IN2A 4K9JA 4E9XA 1URIA 2HX9A 3RYMA 3H4HA 1PLBA 8PAZA 4E9WA 1JZJA 4NB7A 2HXAA 2R7EA 1J9RA 1VLXA 3QJQB 3NJFA 3ZDWA 3OQRA 1HAWA 3DTUB 1A8ZA 4UAHA 4FAAB 1ZV2A 2EIKB 4YSQA 2GHZA 2A3TA 2E86A 3FU8A 4A68A 4AI7A 2HX7A 1AQ8A 1J5CA 2OV0A 1SFHA 4W9ZA 2CAKA 3AG2B 4GP4B 3S3DB 3UABA 3EH5B 4N4YB 1E5ZA 4JHVA 4BXSV 1KV7A 4E9QA 4DP2X 2UXVA 3NSCA 3UAAA 3CVDA 3NJNA 5I5JA 4PCYA 3AY2A 3QJUB 1JVLA 1QHQA 1IKOP 2BW5A 2GSMB 2XX1A 5AFAA 2ZXWB 3NJLA 3T9WA 2WO2B 1SF5A 2AZUA 3ABGA 4DP5X 4GYBA 4QLWA 2AANA 2PCYA 3DIVA 3IE9A 3FU9A 1AACA 4KO9A 4YL4A 2BWIA 1W8EA 3PAZA 2BO0A 2IDSA 3OM3B 4HHGA 1KYAA 1QNIA 2X88A 4JKNA 1RKRA 4KNTA 4WKXA 3T6WA 1QLEB 3QJVB 1BXAA 5I6NA 3N55A 3X1EA 1L9TA 1SNRA 4A2EA 4QKTA 1EZLA 5AKRA 2XUWA 3PLYA 1ZDQA 4E9TA 3AZUA 3FSZA 2W88A 1JXDA 3FQYA 2IWFA 3N2JA 4F2EA 1E30A 2HZHA 2JFCA 3FQ2A 5B7FA 5A7EA 4AKOA 3WKPA 3NP4A 1UATA 1NINA 4KNUA 5I5IA 2VMJA 1AANA 1JZHA 4YSPA 5D4IA 1FA4A 4DPCX 1ILUA 1SFDA 1PZBA 4YSDA 1F56A 1BQKA 1SJMA 1JVOA 4DP6X 2UXTA 2TSBA 1L9PA 3KW8A 1GSKA 1BYOA 5F7AA 3FPYA 4G7SB 3NP3A 2HRHA 3MBWB 3NSDA 2J56A 2IH9A 2HX8A 4MFHA 4E9VA 2IWKA 1MZYA 1A4CA 2CCWA 2H5UA 1GY2A 3S3CB 3OMIB 1ASPA 1CYXA 1RZPA 1E5YA 3ASOB 4HALA 2J55A 3S8GB 1ETJA 4HCFA 5I6OA 4JHUA 3DKHA 4E9YA 1A4BA 4Q89A 4NERA 1AZUA 3NJKA 4AX3A 5I26A 5PCYA 1V54B 1IBYA 1SHWA 1GR7A 4GP5B 3ABLB 4BWTA 5B7EA 1W6WA 3X1FA 2FWLB 2EILB 1DZ0A 1JERA 3V9CA 3TBBA 3UADA 1SF3A 4KO7A 1B3IA 2EIJB 3AW5A 3MX0B 4N8UA 2IDTA 3WI9A 1KBWA 4GP8B 1TKWA 3FQ1A 1PF3A 5LDUA 2YAMA 1JXFA 2VM4A 1ZDSA 1KCWA 2H47C 2QDVA 1CUOA 1M56B 4YSEA 3QPKA 1CURA 1TEGA 1WS8A 1NPNA 3UAEA 1M57B 1SDDB 2PP7A 2MRYA 1OE3A 2W8CA 4E9SA 2RACA 1J9TA 1OCRB 9PCYA 1MZZA 2I7OA 4UF7C 3CVBA 1HFUA 3WG7B 1PCSA 1V55B 2GI0A 1JZGA 2UXFA 4A2GA 2IWEA 3WKQA 3JT2A 4BDVA 1PZCA 1AS7A 1ASOA 1XMEB 2BP8B 2X87A 2IDFA 2FQEA 2QT6A 1X9UA 2VSKB 3NJIA 4A2HA 3X1BA 2CALA 2Q5BA 3FYEB 5B1BB 5B3SB 1ID2A 3SBPA 3V9EA 2YAQA 2FNWA 4A2DA 5FC9A 4DP9X 5I28A 3FS9A 2DYRB 1AG6A 3IEAA 1FWXA 1XB6A 4BWUA 2EIMB 1AG0A 2GIMA 1PNCA 1KBVA 1TU2A 2BP0A 3CDZA 2FQFA 1SHXA 4NAJA 3C75A 1JZFA 2YAFA 3TU6A 3ZIYA 5I5MA 4L0PB 4YSSA 1L9SA 2YAHA 4WTQA 3GXUB 2Y69B 2XYBA 4HCGA 1FFTB 1XB8A 4DP7X 3S8FB 2WSDA 1BQ5A 1MG3C 4DP4X 1JOIA 4G71B 2PPFA 2YAPA 3HEIB 3OD3A 1V10A 2JKWA 4YSAA 1T5KA 2GB2A 4W1TA 2LLNA 3L45A 4HZ1A 1JZEA 4YSRA 5D4HA 3NJMA 2PPEA 3BVDB 4P5RA 1L9RA 3EHBB 2J57A 1E65A 2CBPA 3AG4B 5PAZA 1CYWA 3FU7B 1ILSA 4KO6A 1KCBA 5EHFA 4DPAX 1E67A 3CG8A 1NWPA 4M4RB 4CSPA 4KOCA 3NJJA 1OOWA 2UX6A 2YXWA 5ANHA 1AZRA 1AZNA 4TXVB 4DP0X 1AR1B 2UXGA 2XV0A 1AZCA 2R7EB 1OE1A 1NPJA 2CJ3A 4CSZA 2QPDB 4HAKA 1GY1A 3T71A 6PCYA 1RZQA 2XLLA 2QDWA 4YVUA 1GW0A 3PCYA 1WA0X 5E9NA 3QJRB 2FQGA 1BXVA 4YSOA 3NJHA 1GS7A 2PCFA 3X1GA 1AS8A 1GYCA 2PPDA 4GXFA 3SBQA 1ADWA 5D4JA 2XVBA 2PPCA 3CVCA 5I6PA 3FSWA 1PLCA 3ERXA 3SQRA 3FSVA 4AKPA 5B1AB 1ZIAA 3SBRA 4FA7B 1OE2A 3CZUB 1L9QA 1PY0A 4DP1X 1HAUA 2YAEA 2FT6A 4UANA 1NICA 1AAJA 4E9RA 4YSCA 1KDJA 5TK4A 7PAZA 3T6VA 2FTAA 1GS8A 1KDIA 1BQRA 3QJSB 3FPXA 2P80A 1EHKB 5B7MA 1X9RA 2OCCB 2YXVA 2YQBA 3WNIA 4X4KA 1ZPUA 1JXGA 4G7QB 3PAUA 2XX0A 4BXVA 3T6XA 2EINB 1ET7A 3WNJA 2DY2A 2NRDA 1NTDA 3NSYA 1WA1X 3ZBMA 4BWWA 1BXUA 3EH3B 4YSUA 3QJTB 2DWSA 2XV3A 3BQVA 4KO5A 1M9WA 3KW7A 2BHFA 4KOBA 2DV6A 2H3XC 3FSAA 2P80D 3OMNB 1N68A 2HRGA 3NT0A 3FYIB 1NWOA 1NZRA 4G70B 1IC0A 2BWDA 1PMYA 4F7KA 2AFNA 2XXFA 3PXLA 3D12B 4PAZA 1BEXA 4DPBX 1AS6A 2FJSA 1N70A 3S3BB 2PPAA 4YVNA 1AOZA 4HIPA 1NIDA 3ABMB 2VM3A 7PCYA 1I53A 4BK5C 4Q8BA 1GS6X 1AIZA 2IDUA 3NYKA 1IBZA 1J9SA 5IY5B
chains in the Genus database with same CATH superfamily
1FZMA 3UROR 4PM1A 3RNQA 4R7XA 3TPUA 5KBDA 4E5XB 1D7BA 3H85A 2IALB 4MJHA 4DETA 3VRJB 3VB8A 4OF8A 4G1EB 1FNHA 2Q1EA 3RWFB 4GRWH 3MV11 5F9JA 4ZFGH 1JHKL 1G6RH 4L23A 5FCSH 3QUZA 1Q72L 1FVCA 2EYRB 5AKTA 4XP9H 3C6LA 3WFBH 5FECA 3CZNA 3RVTD 5EIIB 3TFKC 3I75B 5A6IA 1TKWB 2FSDA 1LO0L 3KBFA 3U0WL 1UKQA 4GAFB 2BP8A 3BAEH 2XC8A 5DUJA 1OPOA 1R1CA 4MCYB 3RDTC 3ROLA 4JFFA 4YHYB 4HFUH 2B59A 2WV3A 3HS8A 4ZYKB 2D31B 3O8XA 3QIWA 2FT7A 3K1KC 3GPEA 3HI1B 3C2AL 4A6YA 2EH7L 4EN2A 2AJSH 4N8VB 2NZIA 1MRCH 2VW6A 1MCJA 4TLUA 2EUWA 5CEYB 3M46A 4Z3IA 3PU7A 5EF1A 3U25A 4XE5B 1PFOA 2JJTC 2J8UF 2RQEA 4J3WA 3AADB 4AXWB 5HYIA 2F5AL 5I6KA 2R2EB 4XNUH 4WNQB 2VKWA 3INUH 4CBPA 1MG2C 5DJYA 4KPHH 2H2PD 2Q86A 3OXSA 2EC9T 2GTWA 2ZKXA 3S35X 4E41B 1VEOA 1ZTMA 2IH3B 3L3KA 4X6FB 5ESVA 3IJSB 3EJPA 1GA2A 3F83A 3WY2A 3TZVB 3FRUB 5B22A 2VABB 1WWAX 4IJ3C 3IFLH 3L5JA 1BM3H 3NZHL 4H8QA 4JY6A 1CGVA 2VN5A 1BA9A 2APBA 3J27A 5HGBA 5IHHA 3BZEB 1IAMA 3PGFH 5BOJA 2O61A 3IWUA 3T09A 4ZUSA 4M1CC 3U4BL 2F7RA 3QDGA 1A3ZA 4P99A 1XD0A 1S7UB 3QI9C 2ICEB 3S8WA 4TUUA 3G5WA 3H2WA 3E9TA 4DZBA 5DEFB 3QUXD 3MR9A 1G4MA 4H8HA 4KTGA 3WFHB 3SHSA 1NIFA 1W0YT 4LRNL 1VADA 3IN2A 5D7SL 3WGUB 3H7LA 4OD2B 3UBXG 3HZYA 2V9RA 1R5VA 2AGJH 4KTDH 1S9KC 3K2MC 2RR3A 3D51A 4LCYB 3FRPG 4XMKH 3L7EA 4PRID 1C9SA 1RZIB 3BVXA 3QHFH 3WL9B 3V8CA 4YDJB 4PW9A 5DLLA 1GZPB 2OQJA 1MLBA 2N4IA 2X05A 4B27A 4DGVH 3D08A 4LU5H 2FWUA 1TNMA 4IIQB 5SV4A 2A3TA 1JDCA 3MLSL 1J5CA 4MZ2A 5D2LA 3EYUH 3O3UN 4L1TA 5D1XC 4N2LA 2WQXA 5D6CA 1FG9C 5SV3A 3X13A 2B4CL 4LVEA 2HFTA 3S37H 1WH0A 2EDWA 2IV8A 2ZKYA 3PQYD 4QCIB 3NSCA 2BSRB 3D1MC 1R5WA 1MVUA 2VT0A 3QNZB 4LF3B 2WXOA 1XGPB 2FBJH 4WENB 4LLDB 2PTVA 2K8MA 1TZGL 2LVCA 3B8YA 1Z7JA 3H9HA 2J1WA 1D5BA 3VCLB 1R3LB 3AT0A 4ZUTB 4MTMA 4ZMTA 1U8CA 1BFOA 1UZ8A 2WQ8A 3K2UL 2ATKA 3FU9A 2JKJA 4NC1E 2QFPA 2YD4A 2XKNA 3QPQD 1FL3B 2BRQA 4L9DA 2VOTA 3UBGA 4JG1L 1RU9L 5F89B 3VYPA 3EFDH 1TYEB 3FN0H 4JHWL 4DEUA 1M3JA 2WXRA 1MCPL 3RY6A 4MHHG 1Q4NX 4OFYD 1FYTE 5GGUA 3ZW3A 1WZMA 3VD5A 5GS3A 1PSKL 1F3RB 5DZNA 3ZDZB 4IHOA 1N5AB 5EZIL 3P77A 1MEXH 2R0LH 4CC4A 4G9DB 2C5DC 1HX0A 4Q0XH 5SX4H 1UATA 2DDQL 1MCBA 4D7PA 4NUPA 4NO2B 4GO8A 3ZK0A 4OSUL 1L5GB 1G5AA 1NDGB 1T3FA 4KK8C 3PFUA 4Q6IC 1CK0L 4UUJA 5B3JE 4JKWA 1TQBB 2KS0A 1H9VA 2VLKB 4HUXB 3TNNA 1JG9A 4LO9A 4DP6X 2V5RA 5CJXC 3HUJF 4M8QB 1F00I 2VR7A 3CFCH 5BVPH 1IO4C 4KX7A 5IIEB 3ZDXE 5AAWA 3ARGB 4PSPA 3VFGL 5E70A 1FCCA 4JPWH 4MFHA 5K1JA 4WU7A 3UYPA 4HHAB 4NM4L 4TLKA 4CBZA 5E4IA 3ARDB 1B4RA 2NX5B 2V2XB 1JGIA 1G7QA 3HR6A 2DIEA 4JB9L 4KY2A 3S8GB 3F6JA 1DVFC 4GS7C 5AW0B 5BRZE 3IKCB 1YZZA 3STLB 3NQKA 3VXPA 5AVWB 1CGSL 3SPIA 3OLIA 3D39E 3CXFA 3KPMA 4KAQH 1S7WA 3Q8FA 5DURD 4MJ6A 4PRIA 4DEPC 5ANMA 1JERA 4P4KC 4P9MH 3GSUB 4TSCH 4S0SD 4WW2B 5BZWA 3ZL4L 4PJGF 2R56H 5AW1B 2B9AA 4N2FA 1F8TH 5DJAA 4N8UA 3WJMA 2KZ1B 3EYOA 1MSPA 2UZXA 3QXTA 4LEXH 5CJOH 1IC4H 4JHAH 3RWDA 4KMTL 3HS9A 1GXEA 3JWDC 5HHME 5I9QB 4EDWH 3BMWA 4PHXA 3VD2A 1JAEA 3DVNB 1SYSB 3U0PA 3E6FB 3PABB 4FL4C 1O75A 2AK4E 1DUZA 2HN7B 3BVVA 1N59A 4AQAB 1EFXB 5C0RL 2Z4QA 4N2IA 5CEXB 4S2SA 4I9WE 3N9GL 4FLSA 1BIHA 4HS6A 4P2RB 1ZHBA 25C8H 1I75A 2IWEA 1T1WB 4PGEA 4TTDD 1K85A 4MMXA 5T1MA 4D3CL 3KGTA 4BQ8A 3RB7A 3QZWA 3QP3A 1L9NA 2B7DT 4NQDE 2A73B 2FQEA 2HVKA 1I9JL 3JWOL 3OF6D 3OKOB 4TUKH 5GSRB 5CJ5A 4MXVF 2E9IA 4GNKB 2CRZA 4TOYL 3W2DL 3K46A 2P24A 5KSUB 3ETSA 1CD0A 1T0PB 1RIHH 3WEMA 3KS0J 3GI8L 4OFYA 1M4KA 1A4JA 2MNWA 3B9KC 4TMPA 1TJIL 3SDCB 4QO1B 4LKXA 2DM4A 2XQYK 4FQXD 3OHXB 2P5WE 4HKJB 4PVLA 3GMMA 3B6SA 2EVHA 1KTLB 1MRFH 2FUTA 3BVTA 4MX7A 4PJ5A 5BV7L 3CSGA 5HHOE 2BP0A 2PO6B 3HG4A 1OTTD 4S1SL 4FDWA 5F71A 4HAGA 3MRMA 2XRAL 1L7IL 4OT1L 2CJTA 3WKMH 3RP1A 3EOTH 1A9EB 3P4NB 3B2PA 1OSYA 1CFVH 2DMCA 1X3DA 3EGDA 3QUYA 5CGYD 3V4LA 5KJ7E 3U79A 2GJZA 2Y69B 1S7TA 2Q3XA 4HCGA 4GT7A 1V05A 1K3ZA 1M7DA 1ZVYA 4WGVB 5JMOC 2E7LA 3LPWA 4MA3B 5EZPA 2XWEA 2DN7A 4AZ8B 1E6JH 4LKCB 1XCQA 1QA9B 2E8YA 3MFFA 2ZNWA 1GC1L 2Z35A 2VN6A 4FEIA 5E2WH 5LKNA 3L45A 1P4LA 3QQ9C 4HZ1A 3JBG7 2GJPA 3HI5H 3RL1A 3RUGE 1BEYL 4XCCH 3VTMA 3AQZA 1A7OH 2G3NA 3QJZA 4A2LA 3QAQA 3T6QC 5L6YL 1BQUA 4U1IA 4I77L 3LYRA 3L2NA 4KO6A 1E9QB 5DQJA 4P46B 1RZ8A 1HZLA 2UX6A 1PGRB 5DJ0B 1BD2E 2A7BA 1JPFA 3OPUA 2X4TA 1B9KA 5JYMA 4V2BA 5GS2H 4M5SA 2VAJA 3MC0A 3ZHFA 4Y4KD 2J44A 2I60H 1N2RA 1HEZA 4GRMB 1D5RA 1I1YA 4Q9QL 1Z5LA 3PWNB 3SE3A 1ZY9A 4W9DC 3F6LA 1OQXA 1D5IL 3KPOB 3Q2LA 3PNWB 4QR7A 3CZSA 5C0CE 2GY7B 2H32A 3DRQB 2F1EA 3N41F 5HHQA 2WWKO 2VMDA 3QJRB 5T3ZD 2Y1VA 1JZ6A 4JFDE 3DIFA 3LZRA 5F7EH 4GXFA 1SJVA 2BERA 5IKCB 1B0WA 2E7BA 3K72A 2D7TL 2E4FA 1TJMA 3QAZB 4XBEL 5CD5D 1RZ7H 3CVCA 4AQ1A 5K9JL 2R0ZL 2ADIA 2OJZL 1TVBA 4C59B 5CO1A 3V4VA 2WTRB 1OT1A 2I69A 3WHXA 4RZCA 3A0OA 1YN6A 1L9QA 5ELIA 1HDMA 5JXED 2XWCA 4UT9L 4YSCA 5IEHB 4K07A 2CLRB 3GJEA 1KYDA 5DZAA 5TH2B 1RUKL 4RQQA 1SXAA 3S34L 1DO6A 4ZMAT 1TETH 3SGDI 5FUCC 3ZZQA 2WBWB 3NABH 3NN8A 1PBYA 2K6WA 1AD0B 4FQXA 4JS7A 4G8FB 1SY6L 4OZFG 4NWTH 1JNJA 5DRWB 3RE0A 5FECB 1AQMA 3DOSB 4WFGE 5I1AB 3PWJA 3MVSA 3LZQA 5KVFE 3LVTA 1IX2A 2QVTA 2CJUL 1UOVA 2ADJB 3C60C 5CIPA 4GG6B 1N7MH 3BUPA 4ADIA 5DYOA 2AJYL 2BSCA 2IGTA 5I19L 2XG4B 2Y5TA 4PV8A 4KI1A 2ESVB 4QMEA 2JB6A 5L4JA 3HNSH 3EHBD 3CSYB 3VFNA 2BVOB 1QO3A 4M9PA 3WFDH 3FSAA 3CC5A 4IGBD 3G6JA 3RHWF 5IB1B 1E9OA 1KWKA 4LLWB 3RTQD 5JQ6L 3NIFE 3LQAL 2BSSB 1F6AA 2WNXA 1MVFA 3OLGA 4R2GD 1S7XB 3VFPA 3PXLA 3VXRB 3SYCA 1C1EH 5HHPB 1ECZA 5GS0H 1AO7D 2F54B 4KJYB 4YE4L 5CLZA 3DV6A 4JPIA 3CMOH 1I8MA 1WBZA 7PCYA 1SDAB 2IDUA 1OOAA 1W0WB 3CXDH 3RJOA 2G75B 1NCCL 4HQQL 5ID0A 1T6BX 1KB3A 4YZWA 5I6LA 3WFEL 5KVMC 1R9FA 4M93B 4LQFH 4OJAA 5T5FA 4K23H 3PWVA 3CDGB 1FAIL 1PNDA 1GYVA 3K5RA 4MAZA 1VSCA 4BK8A 1J48A 4FQJH 1EHLL 3FUMA 1OF0A 1WAEA 3ESVF 1ZJBA 1PD1A 4J3OD 5D8JL 5F70A 1P7QA 4JJOA 5IW1A 4XAKD 4ATWA 4X6BA 1H3PH 1QSEA 4PJBB 3GBNH 1OGTA 1YNKL 4LDOB 4Y4KA 4UQIM 1KT2A 1JWUA 3IRZA 4ORZC 4NHUB 4DAGH 3GK8H 1A14L 4PHZA 1OLLA 3L3HA 3JTBA 3VSTA 2Z0UA 1T4KB 2GQHA 4Y2DD 1NGWB 4TYUA 1VADB 2XZQH 4GXVH 1T03L 3K0YA 3N40F 4N6RB 3QQ4A 4FG2A 4OLUH 2YAOA 3BJ91 4KDTA 4LCUB 3QNXB 1JCVA 1PZSA 1XF4A 2IADA 5J13B 4K7PY 3QQXA 3GSNA 2C8NA 1GGYA 1QUNA 5FW6A 5IK3A 1NGZB 1BZDA 1TCRA 4XNBA 2EO1A 1WGOA 3ME0B 5B1JA 4C56E 1UWFA 4XO4A 4KI5F 3EDDA 4UM8A 3UCRA 2BVUA 4WHCA 2P9RA 2JKTM 3CU1A 3G5YA 5DZPA 3QEUA 4R96B 5DC0A 1ND0A 2FIRT 2V3EA 1X7QA 3MODL 4M03A 2F18A 2Q3AA 4MQTB 4PJCF 3X13B 2BW4A 5BNXD 2MTAA 3AQYA 3IDNB 4ZUUB 4XP4H 2ZWSA 4CU6A 1OCCB 5DFVD 1E5UI 3FT0A 4FXGA 5BVJB 5HDRA 2FT8A 1JZ3A 4NO5A 1KN4L 4L3EA 2JK5B 4Z7IA 4RGNC 4AQ8C 2YARA 4XP6H 4B53A 2RMNA 4HK0A 4Z7NF 4OIBA 1FZOB 4WUUA 2OXGB 4K8RL 2YJQA 2Y1AA 4KY1L 3ZZ1A 5I76B 5HD8D 1L6PA 4UIKL 4KVPA 3VXSD 3NBNA 4FULA 4JFHD 1K4DB 2P45B 3P30L 1XIWA 4K2UL 2AKRB 5EC1A 3VA2C 3DDFA 3HFML 3RWGA 3OKNB 2B1HL 4IGBA 5C09D 3MACL 3HE7B 4TNWF 1WLHA 4JFPB 3N06B 4YPGB 4XNDA 3BGAA 4JUSA 3QQDB 4KNSA 4WY7L 4XNXH 1ET5A 2FHFA 4D2NA 1A3RH 3GXTA 3UTZA 4Z5RB 3PWUA 5D1QB 1HXMB 3O11B 4PS4H 4ODXA 3MJ7B 1OF2B 1AO7A 4AJYV 1ZTXL 3HC3H 1UQSA 3ZE0F 4PGBA 1V7ML 2F74B 2RIKA 4Q74A 4OV6F 3P77B 2C3HA 3EJQA 3HHSB 4N28A 4PJDE 4Y5XB 4WRLA 1FIGH 4RA3A 3O4LE 2WQWA 2XPGA 4OF5A 4GKLA 3S35L 1XR9B 3WAJA 2HRPH 1EXUB 3M8OL 3QDHA 4Y9FA 4IS6A 4X0KA 2Q7NA 3S3DB 3TNNB 1CICB 5GZOC 1DUYB 1JWSB 1Q1PA 3P73B 5DO2D 2UV3A 3NDZE 4JHVA 3FCBA 3RWIB 4BXSV 4KZDH 1EVUA 1JN6B 4N20A 4UQEA 1SEQL 4FTVE 2VZ1A 5I5JA 2VDLL 2GIYA 1HINL 1YEGL 2BNQB 1U8PB 5J89A 1JYXA 9CGTA 1FV1A 2BY0A 1MREH 3LKSB 2B2XH 5ICYA 1XH0A 3V4PB 2W9DL 3HN5A 5E9DE 4ZNCD 4XP1L 3F58L 1T7XA 1WICA 1E5AA 2ITEA 3P3YA 5J9PB 1EJOH 3MREA 4K9EH 4LLQA 2N7BA 3DA0A 1RZGB 4U3SB 1YNLH 5GGSA 3MRQA 5J8OA 1IM9D 4M3JA 3MCLH 5J3HD 2AW2A 3P3RA 4GAJL 1DEEB 1OWWA 2BC4B 4PJXE 4WUKH 3UFIA 4QTHB 1OTSD 2X88A 3AUWB 4DGUA 4GW4A 5KBKA 1KACB 1XWVA 2N59A 5CJQL 1G94A 1MFEH 2MTPA 1HE7A 2H32H 1L9TA 2WIIA 3BWAB 3VG9C 4UNVA 4TV3A 5LDSA 3U9PH 3TBVA 3WHE0 3RWDB 2XUWA 2YZ8A 5E0QA 4UQCA 4U1LB 2XA3A 3QWRD 5B7FA 5E5UB 1EGJH 2VZVA 4GBXD 4UDUB 1AZVA 1J1PL 2ITFA 1T1ZB 1ULVA 3BUYA 3GGWB 5IOKA 1FFPA 2H6PB 3FB6A 3MV7B 1HOCA 1T6WA 3TEWA 1BQKA 4ZFZA 1SOQA 3P11L 5K59E 4ATTA 1LYQA 2F15A 4K7FA 3QIBA 4BQ6A 1J5OH 1MHEB 3FF7A 1ACXA 3FFCD 5C07B 4UOW1 4WTWA 3EOYG 4PLOB 2A83A 4G6ML 3V7AG 4MWFA 2JJUA 5E2JA 5C09A 2Y5QA 1IC5L 3TWYA 3OAYH 2NQDA 1N64H 1V7NL 1K8IA 4FI8A 1PX4A 4TUJB 4LSTH 5I6XC 4QJ3B 2ENSA 4KHTH 2Q20A 5HHXL 1RK0B 4Q89A 4KI5C 4JDZA 4NFBA 4N9GB 4X8GA 5HGDA 3MOAH 4IK7A 3A4AA 1GR7A 3MGOB 5BZDA 3ULVH 3W39B 4XMTA 3UTPD 1PKOA 1B2WH 1T1YB 2JKNA 3GSRB 5FGSA 3SDAB 1I31A 3VWKD 2R4SL 5E8EA 4C83A 3FTGA 1AP2B 2EE0A 3MRRA 4JFED 4AUJA 5C1MB 2V33A 3L8QA 1WAAF 4MMZA 4OCWL 2WINB 4PS3A 4Y1SA 3V6FA 4DGIH 5KVEH 1JPGA 2FL5B 2DQGH 4WI8A 2R39A 5I1CH 2QDVA 4WW1A 4I3SL 2JI2A 2YKLH 2YWZA 3DHPA 4MNQE 2GJ6A 1CURA 1U6AH 1QSFD 1UZ6E 4JY4B 3WNOA 2DEYX 4W6XB 3O3AA 3S5LG 1P5VB 1YN7B 4I4WA 1T04B 1U3HB 2D9CA 2OTWA 3KPPA 4GKSB 4NXKA 5GGVH 4DH2A 2AC0A 3WMSA 4N3UA 4FQ2L 4P2CG 1JRHL 5KG9B 3N0PB 9PCYA 5FYLD 4L9LA 3QG7H 5DZJA 3OBAA 3TV8A 4XPHH 4A2GA 4HZLA 2CIKB 3IF1B 3TH4T 3LEVL 3FUEA 4L8CA 2JCCB 3P0VH 2G5UA 1TZIA 5FYKU 5HI4D 1NCWL 2QADB 3Q3GB 4ZODA 5IW3A 4ZO9A 1JGLL 4GAYA 4F7PB 1E8ZA 4AITA 4B9YA 1AKPA 3CVIL 1RJZB 4AJ0A 4R90H 3F5WB 1F58H 5I75C 1EHAA 2B14A 4BWUA 1EMTH 4J4PA 3RI5F 1KXQE 3SPVA 4XH2B 4BD4A 3MOBH 3QUMA 2CPCA 3DO4A 4E41D 3NJVA 3AUVA 1NGPL 1HIML 3DXAB 5BCAA 5HI5D 2LU3A 5L0QC 3GSNH 4PBWD 4HEPG 4EIBA 1I8LA 3MHZA 5ABZA 3CVHL 1I7UA 3RY5A 2VUYA 2YAFA 4FG0A 4OLXL 2XZZA 2BK8A 3RB5A 3ZIMA 5EOCJ 5I18H 1XCTA 1HHIB 1ODUA 2WN2A 2YRZA 5E94A 5FGCB 3DJSA 4CC1A 3FUKA 4KKLD 3DMMC 4OD3H 4YHOL 3FFCA 3NPSC 1G9NC 4OZHA 1ZLSL 4MCZB 4J2XA 1D6EA 2EEXA 3CCHB 5E9AA 3I9IA 3CLFL 2VO8A 1A3LL 4EUPH 4RRPA 2VC2L 4GRLA 1GCFA 1YEJH 1YEKL 3N6YA 4M61B 5KSAD 4DN4H 2WGXA 1QABA 4JFWA 3B2MA 4DGYL 1MAKA 2E9GA 4CVUA 1PFCA 5EN2A 3ZVVA 3V4UL 5BXFB 5KS9A 1MFMA 3MSPA 3ZRSA 2Q7YA 3VWKA 1UA6H 4GRWE 4TXVB 4L3AA 1JZ5A 2V2TA 5DZ9A 3VW3H 4PVMA 1NMBL 3JVGC 2XWDA 5J6GB 2YN5A 3CFEA 2HRLA 4K71B 4YDVA 4XNYH 2JB6B 3QW9A 2GBUA 1A5FH 1F45A 4Y1AB 2APFA 4HAKA 5TD4A 4QYOA 5IFHL 1QSFA 3O6KL 2J21A 3L4VA 4OCRL 4CSTA 5CSZB 3PCYA 3FUFA 1F11A 1KCRH 2OKMA 3IWVA 4BFIB 2FQGA 3IDXH 1OAYL 1UZGA 4KXAA 5JR1L 4N2EA 1GZQA 1P1ZA 3QH3A 2AABH 2DLIA 2PCFA 4PRDB 2A0LC 3S4SB 2CO3A 3BRFA 2A6KA 3GRWH 2UYLB 4JPIB 5MHSD 3JQOB 1YJDC 1U33A 2PW2A 3KYNB 1PKQA 4M8UA 4JZJB 5FDYA 1P5UA 2AQ2A 2CWRA 2G9HA 2HKHH 1TDQA 1UCTA 3D4ZA 4LSQL 4W4NA 3GS0A 2FT6A 4NQSB 5SWSA 2V8LA 3WNLA 4EJ1C 5HI3D 4PH8A 2Z7ZA 3JT0A 5JYLA 1UCBL 5KSBF 3KL0A 5C8JB 5F9DC 3DX7A 4A38A 4WI3A 4HUWB 4CAGA 2VLKE 3EDJA 4Y19D 3FPXA 1RLWA 2VO5A 1HSAA 3GXDA 4Q58C 5LGKA 1X9RA 3NCWA 1JWUB 5T3XD 1JXGA 1H3WM 1CCZA 4PJHB 5CZVH 4JCWA 4KJPD 4H8UA 1SUJA 3CJJA 4AIEA 2CH8A 3AITA 4BFFA 2OMTA 2ZCHH 3DC0A 1JZ2A 4KFZC 1E4XL 3CX5K 2UVEA 5T33H 5AENA 4XX1E 2XNAB 3GS7A 4LNRB 2BRRH 2NX5E 2K78A 5LVEA 4V2CB 3SD5A 2DQHL 3MDJA 4EQ2A 1JSYA 4R3SA 3EH3B 4YSUA 4R4ND 3LMJL 1MOEA 1J05B 5F8QC 2FATL 3C8HA 4MKMA 1N68A 4NKDA 3WDJA 3GSNB 4Z7UF 1QUNB 5IK3B 1PMYA 1B4LA 2AFNA 2VJ0A 2F5BH 1FUNA 2CNZA 2R2HB 1J9CT 3ARGD 3D12B 4NEHB 5D1XA 4MZRA 1UVQA 4URTB 5ADOH 5ILTH 2ALAA 1CDUA 3ZHLA 2EACA 5D9SB 2KERA 4NOFA 5KSAA 4RA0C 4HWBA 3QJOA 5IMKA 5I0VA 4XMUA 3LKRA 3LN5B 4ENED 1NMCB 4Z3FA 4H44C 2QQNH 3C08H 4EUPB 1SDDA 1NL0H 1K3IA 3O6MH 2KZBA 2XCMC 2J73A 4HK0B 2ZAIA 1VGKA 1DJSA 4WUUB 3ABKB 4LLMA 4CDHA 5IMMA 1BIIA 4PVBA 2HYMA 1CE1H 1K5NB 2NY6D 4Z1PA 4IMLA 2DM2A 2VDNH 4AMKH 4DK3A 4ERSL 4GUOA 1DQDH 3V6OA 3OAUL 2IAMD 5DUMH 3ZGHA 4YDIH 2VN3A 4ZAKA 3PJLA 2VDOH 2WLYA 7TAAA 2PYEA 2RB8A 2ZWKA 1CXIA 4PJFB 4AMWA 3BGMA 1U3ZA 2VIRA 1G1OA 3LEYL 1UB6A 3WIAA 3BSHA 4UB0H 4UAOB 2GITB 1ITBB 1EFXD 1PZ2A 2K4WA 3P3TA 1YNTF 4WFEE 3T4AA 5DMKB 2DD8L 3IFPB 1CGXA 2P3YA 3L3DB 4P2RD 1SOXA 2DICA 5AVVB 3WXWL 3P3SA 5AVUB 4LPTA 4RFEB 3X3FH 2NXYC 4HUNB 2C3GA 1XGYH 2XPGB 3QYMA 3HRZB 3EBAA 4FFTA 1IQDA 3NCCB 3U9UA 3VYNA 4BDVB 2WCGA 5LN4A 2PXYA 3NJGA 1L3WA 2QR0A 3I2CH 4JJ5A 4LSRH 4TPRL 5DJXB 2C7UA 4Y19A 5GJSH 1GJUA 4LEOA 1AFVH 2F61A 3AWEA 3QEGL 3E6HA 5AZ2L 4KHXL 3RPIA 3X2QB 4ZPTA 5EDXA 1JI1A 2NLJB 2OYMA 3HB3B 3VXUA 2VDRH 3CXHJ 5IVZB 4LXFA 1PG7H 1ZLVH 2HFFA 1S78D 1R24B 3DX6B 4O51A 1F4XL 2FLMA 4KTYA 5SX5K 4LVHC 4H8WL 3K6IA 3PXJA 4OFDA 1KTBA 3MRJA 3IAPA 2CK0L 1N6UA 2YXFA 1U2YA 3UTSE 4QRUB 4UT6A 2NY4C 2VAAB 4TLSA 5ABAA 3ZDYF 2E74C 4ORGA 5E6UB 3SCMC 1KGCE 3KAAA 4F3FA 4N9OB 3RNKB 1U8JB 2VSMB 3WN6A 2WBJA 1NIEA 4KTEH 1WF5A 3QUMH 4U1GB 4CL7A 4K9JA 3ETBJ 4W9CC 1WFIA 2IMNA 1C5CH 3QARA 1OXYA 4N2HA 4ZMNA 1G7HB 4ZO8A 3NSXA 2M26A 5BQ7A 1IIKA 5I71C 3DURA 4NB7A 4X80L 5JW5A 1J9RA 5DA0B 3L4XA 5GSVA 5C6TL 4DCQA 1LWJA 3UPAA 2BIIA 4G43B 4OR1A 1HN1A 2IPUG 4HIHA 4XWOC 2IF7A 1SFHA 2X41A 3HG1D 2DWXA 2O5NA 4M56A 4PG2A 4P46D 1U8IA 4PJ9B 4QHNB 2FX9L 4LBEA 4GP4B 3PYCA 2J3SA 4L0ZA 2FO8A 3PWPE 1JD7A 4LMQE 5BO0D 2UXVA 4KC3B 1NEUA 1YY8A 2DTML 2X4SB 4DTGL 1PS3A 1JF6A 1F42A 1X5GA 3CSPA 4HISA 3TP4A 3V0HA 2IAMA 3BE1H 4JRXA 5TDNB 1SHMA 3STZB 4QRPB 5FM5M 5C0BB 3M17A 1MJ8H 4AE0A 1YPZA 2VDNB 5CD3A 5IW6A 4QXWA 1OSPL 4OFIA 1U0QA 1UKTA 2CM5A 2UZIH 2EIDA 3QJXA 5GRJH 1AACA 4J39A 3LV3A 2BO0A 1OPGH 2GPZA 3LH2H 2ZJSL 1DFBH 1A6UL 2VDOB 5CWSA 2XTSA 4WFFD 1D6VL 2VLRA 4X8JA 3VFMB 1HHHB 3H53A 3IXAB 3D69A 2ZOWA 4IKLA 5EZOH 4N0RA 4JGMA 3MRKB 3MRRB 4F9PC 4GMTL 4CVZA 1R0AH 2C3WA 2DJUA 4X42A 4KRLB 4XNZB 4AEHH 1EJFA 3JWNH 2AI0L 4QKTA 3SDYL 1YEEL 1A6ZA 4GG6E 3UIZA 1KCKA 3UTTB 3FTWA 3FUNA 1JK8B 1JD9A 4LPWA 4XX5A 4NC0B 1I1AB 2X3AA 1DLHA 3OKDA 3APNA 5DR5H 1KY6A 4F2EA 3O41B 1VACB 2VM9A 1A8JH 4NNXA 2VISA 2ZICA 3OXRA 3QFGA 4G6AD 1RULL 5MEQB 5HGHA 1CG9A 4OD1H 5CLTA 3KNBB 4L9LB 2ZF8A 2XZCH 1KJVA 3MTRA 4XXDA 1J86A 2F54E 3EUUA 4B3VA 3SE9H 3MLVL 2ENYA 3U0TB 2Y4SA 4XXCA 1TTFA 3BKJH 1VA9A 1IBGL 1RJLB 4HCRL 3SKJL 3ZGIA 2HMIC 1K5WA 2LABA 4L8CB 4G7SB 2A6JA 3R0MA 2HRHA 4HPOL 2A74A 3FT1A 4ODUB 2HJKA 1BBJB 1C16B 1FO0B 2DBLH 2ADGA 2VDRB 3O2DL 4M7ZB 1CE6B 5ESQA 1BPLB 3B7YA 3UOAB 1IVTA 5ENWA 3QNYA 1QQDB 1YA5A 2LQRA 3IDUA 2NUTB 4S1DC 3BW9A 5FF6B 4JHUA 4WHTB 4FKEA 1USZA 3VGHA 4NERA 4D0BA 3VXTA 1WT5C 2X1XR 5PCYA 5JPNA 3VXRD 4NHCL 2EABA 4PJBE 3RGVB 4ZOBA 1Q90A 3QDGE 3KM1A 2FWLB 4RFNC 1QD0A 3FTUA 2BLFA 3RVWD 1A1OB 3UBXI 4EZJA 1WYJA 2X1PA 2W07B 1IAOA 4BSWA 2V5YA 2NW2B 4BSVA 3VGAC 2EEDA 3BN9C 5EIQA 3GSQA 4KKRA 2COQA 1U8NA 3HG1A 3OHMB 4B9JA 3LD8B 2OJEB 2E9WA 2R9HC 4AH2B 4JDTL 4Q6YA 4FLRA 4I5BA 3MJGX 2IANB 3G08B 3HPLA 2BY3A 4KKAD 2XTLA 3VE0B 1DANU 2ZOLB 3D25A 5I15L 2BOBA 5H4YA 3Q0HA 5IQOA 2YLKA 5AOKA 1EDQA 1AMXA 1X5ZA 1E4WL 5I8CA 1OCRB 4FQPA 4M5YL 1I7RB 3BDYL 3DSFH 4JE4B 1FDLL 3R1GH 2OMZA 3D85D 1OB1A 3BAIA 4UI2A 1NGXB 2UXFA 2ZUTA 3K71A 2EP6A 2YA2A 5A2JH 1UWEL 4ZD3L 4WTZG 4B6ZA 2AXGA 5T1LD 3U1PA 2BFVH 5F3BB 1DEDA 1SEBB 2GT9A 3O9WD 3QFJD 4HJJH 3UO1L 1REIA 3DETC 4ZS7H 4EN3D 4S10A 2VZTA 1LD9B 2OK0H 2HG0A 3VSQA 4R7NA 3UAJD 4Y4HD 4FLHA 1BF2A 3RDTB 5E1QA 3JTSA 4M1DL 1UWGH 4PMFA 1QW8A 3BAKA 5JA8B 1CTOA 4UILL 4G9FD 5EBLA 4GJTB 1IGIL 3SE8H 2QMKA 1BM7A 4MHHI 2IPUK 2EIMB 1S7RB 4OV5B 2JXMB 1QR1B 3MOQA 1GYWA 4CMMB 2ZYHA 4D0CB 4P2OD 2F19H 5I1JH 3H42H 5JTWA 3L1EA 3C5SB 4X7SL 4LHQB 2EVIA 3F7VA 3VVWA 4ZFOA 3QCTH 3CFKA 4NM8L 2WLLA 1HNYA 1AKJB 1L9SA 3L3JA 5GRVK 2PW1A 2ADFL 3V0GA 2FX7L 5HHNA 4NQCB 2BNRD 3D4YA 1ERNA 1GGCL 3I3DA 1A7NL 1ZA6A 1JBJA 4W9GC 3U2SB 2PPFA 5GRWA 4IJ3B 4HXBL 1RUQL 3KJ6H 1KBGL 3HE6C 1QNZH 5K39B 1IFHH 3V5KB 3L16A 2EIBA 1DSFH 1MIML 2X10A 5B3JF 1ZHLA 2DQTL 4HC1A 4NRZA 4FABH 2J57A 1FZKB 5DMIL 4K7PH 2DI7A 1E4KC 1I3RA 1M6OB 3FU7B 3PL6A 3QI9B 5D1QD 2G4EA 2DWEB 2WY3B 4JRYA 2PR4L 3ES6A 1C5BL 2VQ1A 3Q8CA 5IEKB 5CLXA 4M4RB 3ZDXF 1SMAA 3US9A 3S36H 4J6RH 1U30A 2BNQE 3GBMH 3HBPA 3RURA 3VGBA 4UT6H 1MWAA 1MI5B 2APTA 2VERN 2WHVA 5AB1A 3R7RA 5L4MA 1NCOA 1U2CA 2W1NA 3GINA 1FGNH 4BFNA 5L88H 3SEPA 5FK9B 1VZHA 5H2BA 4WWKA 1QPPA 3DPBA 3ML8A 2BP5M 5EU3B 2BVPB 3JWDH 2Z6FA 4LSUH 2GG1A 1P4IH 1MIEH 1I85C 2Z92B 5ANME 3HLKA 1GW0A 1MHCA 3W0WA 5J06A 4CU7A 4AQZA 5DK2A 1BXVA 4ACPA 3DX1A 4TNGA 5D1XB 5DFAA 4OF7A 5TE6H 1NLBL 3K4DA 3MYJB 5TFSL 3D85A 5DHMC 3ATFA 1M2VB 4W6WB 3VB9A 3D2TA 2AEWA 1DDHA 3VFTA 2EDJA 3SQRA 5T1LA 4AKPA 1QI5A 4UOW0 4CADB 1OB0A 3O9WA 2YD5A 1OE2A 5T3ZL 4GH7B 3H1ZA 1S9VB 1UXLA 4OW6A 2PWGA 5LXGL 2MNJB 4G3YL 5D7KE 3U7YH 4EN3A 4NKOB 5I1IL 4IRSC 3UAJA 5CILH 4HXAH 1ZE3C 4QF1B 4Y4HA 1OP3H 1IC1A 5TPWL 5B4MC 5IMMB 3CV5A 3ZHKA 1T22B 2BFGA 3VWJC 2FTAA 1USQA 2P80A 1LE9B 4W4OC 4J27A 4YDKL 4FXKA 4P5TA 3LKOA 4D0DA 2MQCA 4MJIB 5C07E 3NESA 5GGQL 1MHHB 5K5YA 1B3JA 4HWZB 4LBAA 4HWEL 4P2OA 3WNKA 3F12B 4HLJA 1TQTA 4IU2A 2C9RA 3BIKA 1CXHA 1P7KB 4R26H 3ARBC 4U1MB 2NSQA 4XO8A 5FDWB 5HVFB 5L2JB 2ADYA 1I1RA 2E6JA 3A6BL 3OJVC 3GSXB 5DEZA 4UCFA 1U95A 4KXBA 4BKLB 3TXAA 3N50A 4HD5A 4HUCA 3NAAL 3MV7D 1GKOA 2BNRA 4MLSA 4OKVB 4PJ5E 1Q0XL 3VI3E 1H8NA 1NZRA 5E23A 1Z9LA 1ZWIA 1RL1A 2YRPA 5CEZH 5D70H 4FNLH 5IFAH 1BJ8A 4Q6IB 3QBTB 2JQMA 4PAZA 5HJDA 4JFEB 4MD0B 3FT3B 3G6DH 3RKDD 3ARFC 3WFCL 1J8HB 5B39A 5DFWH 1XTMA 4OIFA 4KQ4L 4ELMA 1IBZA 1WV7T 1R19A 4LEOB 5KBLA 3NCJL 3E7JA 5FKAB 1IGML 5E8PB 2VLMD 1YLBB 3L9RA 2BZCA 3Q9PA 4NC1C 3FQUA 4G7RB 2NNFA 1P1VA 2QGCA 4GS7B 1DVFB 1UURA 1IGJA 1IAII 1NCTA 2M1KA 3BH4A 5F3HA 2HFFB 4RAVA 1VCBC 1TTUA 4O51B 2J8UB 2YBRB 4QXVA 3RUGF 1QEWA 3MI6A 3MXVL 4BZ2L 5AW5B 4DO5A 3HS0A 2D0HA 5GISH 3QXUA 3C09C 4TSAH 4DEPB 4IEFB 2R1YB 1KGIA 4PV9A 4P4KB 2V17H 5CBAA 4YBLC 5CR8A 3UPRA 4MJ4A 4M1GL 3QIUC 2VDPH 4WSKA 1WS7A 4UQ3A 1WBYB 1F90H 3BQUD 2WBJB 3A24A 4H26A 5L7XH 2B1OA 3DSNA 3RAJH 3DTXB 3OJDB 1MNUH 1MCEA 1QLEH 3QZWG 5GJTL 5KANG 3VG0H 1XAUA 2R69A 1Q9OA 5LAPA 4LE8A 3WUZA 4X6CF 3O2WH 2PLTA 3PY9A 3W11C 2GBAA 5DRZA 4DW2H 2W94A 4WI0A 4FL4B 2OMWB 4KVNL 4WI9A 1DVXA 1R5IB 1XGTA 4NIYE 1DYZA 2YD9A 3DXAE 5F0JB 2MPAH 4K5PA 1H9DA 3NJXA 1J0HA 4NKQB 2WQSA 3EYVA 2AS5M 2RFXB 2CDEB 3WLBB 4NZRL 3G3LA 2QADD 2F53B 2G30A 4G5AA 4FCHA 3GXNA 1EQWA 3UACA 2AZAA 1FRGL 2WBKA 1LO5B 1UHVA 4Z7OE 4L2YA 5DQ9B 5FGCE 3P2TA 3LKPA 4NENB 5EMYA 2I7SA 1T0OA 4IQHA 2WQRA 4QRAA 3HKFA 1GMEA 1JPTH 5C0JB 2QHRH 5I1GL 1J1OL 3E8UL 2Q76A 3ISWA 5DD0L 4PRAB 2FNBA 2JIXB 4OGAC 5DD5H 3OSKA 3B9KB 1YPZB 1TU2B 2OI9C 3NFSH 1MH5B 2YRLA 3JSSA 4KKNA 2ITDA 3P9WB 4U0QB 1F4YL 4AYDC 3UDWA 3T6ZA 2CUAA 3UAFA 1LK3L 5E4AA 3IJYA 3RWJB 1UADC 1SJHB 2HT2D 5F1NB 2NY0C 1X7SA 1AR1C 5G5DA 1VCAA 2CUHA 2A9AA 4PI2A 4TN9A 2VMEA 4XVJL 1GHFL 5CZXD 4E9WA 3BFWA 5AD0A 1CIUA 3HJEA 3ULVE 1FNEA 5ICZB 1LK2B 2KMWA 4HULB 3IGAB 3OQ3B 4JREC 4LPCA 4Y1AE 3CLWA 3JZYA 3OKMA 3NZ8A 1HAWA 3ULUD 2W91A 1ZV2A 4GXUM 1BW8A 2WWNA 1N12A 2EJ1A 4ELDA 3TEXA 5HGHB 5E8OB 4AYFB 5KVEE 1KXTB 3IFNH 5IUCA 4XBGB 3SGJA 1L6ZA 3A6CH 5IB2B 4JMXA 1YMHB 4PR5B 2ED8A 4K94C 2WKOA 5IB3B 5F9WC 1UT2A 3KPTA 1GTNA 1LM8V 2WO4A 4WO4A 1XL6A 1BMZA 2GW5A 1CF8H 2CKNA 1JVLA 2GSMB 5IBTL 3MROB 2O1AA 3LDBC 3MNVA 3MXWH 2ADGB 2P7TA 2PNDA 2XVGA 1CDBA 4FFZL 5EUKA 3M88A 5CLWA 3S0PA 3SDXA 3C6SA 4PVNA 4QLWA 4GLRI 4N2CA 5HPMB 1KJ2A 1OZTG 2EH8L 1BVKA 4DERA 1W8EA 4WSJA 1QSEE 1U2HA 1YYMH 2J8OA 2X4QA 5IB5B 4RAUB 3H7BA 3JTTA 4Y5VC 1LNUB 3WIHL 5IROD 4PJHE 3HUJB 1IKNA 1OAQL 2UWEA 1PY4A 1IAOB 3CN4A 4YHZH 4OLVH 4M02A 1IQWL 5D1ZI 1CLOH 3X3GL 3DO7B 1BG1A 1QLEB 2E9BA 4KXZI 4S0HA 1GJWA 1UASA 2CU9A 2I9TA 4HWNA 3SGDH 4FFWC 1L0YA 2BOCA 2XY2A 3KYOA 2W88A 3LRLA 3UC0L 4IDJL 1HXYB 1S9WA 4JFZL 4JPKL 3VDAA 3QO0B 1CVSC 2OULB 3VXQB 1K2DB 3GHEH 5EU6D 4NRYA 2ZF9A 4XCNA 3HBGA 4BQ9A 2VUKA 3M6DA 3BWSA 1QRND 2XPYA 1NUGA 3ILQC 1G6VK 2BCKA 1JVOA 3EYFB 4PJGB 5JORB 1R3KA 3CZFB 3MNZA 5F7AA 3QJFB 1WWWX 5LGHH 4JFOB 5B38B 3GXFA 5DQDH 2EAEA 1Z9SA 1GGIL 1TOXA 1DJYA 3CN1A 5GRUL 4L3EE 15C8L 4DUWA 3KYKH 2XWJA 4FQCH 1YEIH 1IB5A 2BNUB 4NAMA 3C60B 2BSBA 4WUUE 4JVUA 1G0YR 1J87A 1FFRA 2OMBA 4M7KL 4GFTB 4XNQA 5AKVA 4AX3A 4D9LL 4PY7A 3FXIC 1NDMA 4I3RH 2IQAB 5FFOA 3A6OA 3CSFA 1G7IB 3X1FA 4BE6A 1FH5L 1SBBA 3TWCL 4MA7H 1UM6H 4HETA 3MX0B 2VDQH 2Q8AL 4DHLA 5EO1A 2YD2A 3F7VB 4PJFE 4U33A 3Q8AA 1HJBC 3DX4A 4RVBA 5AVTB 3MMEB 2VM4A 2G5BA 2H47C 3A47A 4K5LA 5HYSB 3IM1A 2B0SL 2PW1B 4GINA 2P47B 3MBXH 1M57B 2ZT9C 2DMHA 2MRYA 1AJ7H 1RQ5A 1ZSHA 4PJDF 1OGAB 4IRJD 4LCWD 5DHXB 3OKLA 4OH2A 2E27H 1WBXB 3G9AB 1TG8A 3EF7A 3C9NB 1QEXA 4OB5H 2YSSA 3IGLA 2I7OA 2P8LB 2VTFA 4L1SA 1U8OB 4PGZA 3T04D 5I0DA 2WKGA 2IQ9L 4EIGB 2GI0A 3EXJA 3GSWA 5LGJB 1C08B 4C58B 5D7LD 4CN4A 1SLXA 1DJHA 5MP6H 4JG0L 1KCVL 4XTRC 3EJUA 4LSVH 3IGKA 2MIZA 5I24A 4JRYB 4FFYH 4LZKA 2JSFA 1BQHB 1F1AA 5FYLL 2HJLA 2FGZA 1JTTA 2HT3C 1X5KA 5E8DL 3UG5A 5HJ3A 1X7TA 3U6RA 3X1BA 3GSVA 1CJYA 4ABVA 5B3SB 1QVOB 1VGEL 2UZPA 4G5ZL 5HY9A 1OKEA 2VZOA 2FJGB 5I66A 2WK2A 1RHFA 2YK1L 4CMHC 1MJUL 2XG5A 3FS9A 2VXVL 3MRHB 3VDBA 3W37A 5TF1L 3AB0C 1FFOA 4A7VA 1WG3A 2EQDA 3DK0A 2WNGA 3X14B 3N85L 1YMMB 4JY5H 3FO1A 4PJXF 4DJMA 5E6ID 4N2BA 5KYWB 3MLTA 5EU6A 3PPEA 3L6FA 3CN3A 3RDJA 1QRNA 1RUMH 1UD2A 4BH7A 4JVWA 4IMKA 4YSSA 3CDFA 5IJVB 3SQBB 4GOSA 1HE8A 2NY3C 1MFAH 3V6ZB 5ALCL 2FVNA 5ADPL 1UYWH 2APXA 3WTSA 1P2CA 1T1XA 5KOVC 1IGCL 4EI5D 4HJ0D 5DD3H 5E8NA 5D71L 5EV7A 2KPWA 1RIVH 3MV8A 4KZCA 4RGNB 1F86A 1AQDB 35C8H 4YSAA 5INCB 3UERA 3IDIB 3JV6A 5I1HL 4FC3E 4UIMA 2XWBB 4K3EH 4MB3A 1JGVL 5KVDL 5E00B 2AJVL 2VXSH 5EO0A 4BZ1A 5K59F 4OZIF 4EKXA 4LOUC 5C0AA 4PJEA 3RVXD 2J2ZA 3TCXA 2I07B 2QBWA 1PYWA 1TZOA 4A7SA 5DLML 1ZT4A 5IQLA 1VPOH 1Y18A 4LVOC 3VTAA 2VYRE 4PRNB 1Z32X 3PWLA 5ANHA 1CFQA 1B2YA 1KJMB 4J3OG 5IQ9B 1EAPB 2YS4A 4HWBL 1DJWA 4GMSH 1JUFA 3M1CA 1S5HB 4XOBA 2FCBA 3V79C 2DQ6A 3P9MA 1IGFH 2VZUA 1AIFA 3RVVC 2NNAB 4PJ9D 4AT6A 4KGJA 1N0LB 3NFNB 2OMXA 2VDQB 3BPOC 3Q6GH 4IRJA 3HCVB 1AD9B 3WS3A 4XPFH 2FO4A 4QT5B 4HK3J 4Z7VF 4KK5D 3CFBB 3PGCB 1CLYL 5KZCD 1CLCA 1OCWL 5B39B 4RX4A 3MRNA 3UTTE 5D7LA 5DJ2B 4QRPD 1F4WH 1KB5A 2NY1C 5C0BD 3A5VA 1FLRL 4L3FA 2GJ6E 1UZ6F 2YPKB 1OARL 4H0HB 3CZUB 5BQDA 3W9EB 1HAUA 2A1WH 4EKJA 2FYYB 3FB5B 1K8DA 4QOKB 3TJEH 5I0ZA 5LBSA 5JIDA 5TK4A 3WS6C 2Q2EB 3APMA 1F6FB 4XP5H 4XE0A 2FLRT 3EOAB 4UINH 5GRXG 4WTXA 5E2UL 1GS8A 2J4WH 3LHPL 4RAVB 1ROCA 4MA8H 1DJIA 4R5TA 3D7PA 4ES9A 2OCCB 5T1KB 3UYRL 4X4KA 1D9KC 2DIAA 2R1WB 3AWGA 3EO0B 5CGBA 3LEXA 1U8LA 5FOBA 3T6XA 1N9PA 3JYCA 3MU3A 2EINB 4JAMB 5MERB 4YQXH 5C0FB 1I1AD 5E6IA 1PDKA 5AW9B 2NCMA 2CBMA 4NJAL 3VG9B 3EYQD 2FBRA 2ZSVB 3FCTA 3P02A 3IDYC 1XGUB 5T3XL 3EFOB 3KW7A 2AJSL 2Y7MA 2DV6A 4AEIH 3W38A 1MRCL 1N3NB 4LNVA 2QKSA 2PCXA 1QLFA 3ZQ9A 3LKNB 2D7NA 1MAML 2LTQC 4MJJA 3JVFC 1RHHB 2BWDA 3EGSA 4Z0XA 4F1ZA 2WLIB 4KXDA 2AV1A 1SHSA 3LRHA 1G9NH 1NEZA 3MCKB 1K6QH 1SMDA 3INUL 1FVEB 3QRGL 1YCSA 4LLVB 3VD3A 3RA7H 1WZAA 2FJUB 4X4XB 1WIOA 4G1MA 5TDOA 5EBWB 4AQEA 2N0MA 3AG3B 1LJMA 4XVUC 3UG4A 2ITCB 1SPDA 1NC4B 1KCSH 1M3IA 1URLA 4WO0A 1JNHB 3V2AR 2CA3A 4IRZA 3Q2VA 4GQQA 3IFLL 1BM3L 4I48A 1A7BA 4GAGH 3S3PA 4P3WA 2OP4H 4FQHB 1FSKC 1ETZA 4XPGL 5I6XB 5LCVA 4QXGH 3PGFL 2H7WA 3ABZA 3MUGB 4B9GA 4I18A 2E59A 4PY8J 5DRXA 1RIUH 2R1XB 3TL5A 2VXTH 5BOPA 3D2UB 5DC9B 3S48A 4N68A 1JS4A 5JHLA 4FMVA 4S1RH 4GAAA 4QNPE 5KS9E 5JIQA 4IKIA 1PY9A 4L1BA 1HWHB 2ZUSA 4GRWF 4YHML 5JLZB 4FYQA 1WEJH 4KTDL 1UKSA 2ZX5A 1DQMH 2XV2A 5AW6B 4Z7NB 4FZ8L 5G4MA 4JM2F 4XVSL 4ZSOB 3QHFL 4LQ1A 3MRFB 1YJDH 2AQSA 4MDJB 5IMOA 4R7VA 4CNIA 2EDMA 3M7FB 3QISA 2J71A 1WP6A 3F8UB 3EYUL 3JWNE 3L13A 3U36B 2WZ0A 2Z8SA 3UJTL 1Z3GH 4QJ4B 1A6AA 1AY1H 3QZMA 5E4EC 3TIEB 1I3GH 1AZBA 1DBML 5I0WA 5HPOA 5KJ4A 5KN5A 3RDTD 1CGUA 5F88B 3VQ2C 1EZVY 2CO6B 4HLZG 4NQCE 4M3KB 2A99A 4GO6B 3VFOB 3ZE0B 2Y6SD 1IEAB 2FHCA 2Q9OA 1TUPA 4MQXC 2JJSA 3IE4A 4PB9H 5SWSE 1DN0A 5A16B 2F08A 3DECA 5L2KB 1UACH 4BQCA 4G6JH 4XI5C 1WT5A 3IN0A 4ZJ9A 4FJ6A 2YGPA 4CUCA 4E9LA 3MRDB 2OCJA 5DJZB 5I75B 4YAQA 4W9HC 4RRPG 3A67H 3H7BB 5DDHB 3G9VA 1AKJD 5FCUH 4ALAC 2X4NA 3SB3A 1A7RH 2VKXA 3AT8A 4P5KB 4HW6A 4NUJB 3HC2A 3OWRA 4CGTA 1Q9WA 1BSIA 5L0QB 3LNGA 4Z78A 4ZX3A 1RFDH 2I32A 5TE7H 4XPBL 4KVCL 4HGWB 5I0YA 3V5HA 2PABA 4HYTB 2R7EA 2GJRA 4ZQKA 3DMMB 4Q0XL 2YPVL 2D7MA 3EG9A 4HUUA 4XWGH 4LCCC 3NPSB 3B43A 4ODVL 4F58L 4YSQA 4PRPB 4NRYB 3V0VA 3NCBB 4RZKA 5FB8B 1W91A 3QORD 5ETUA 3CXHK 5AOMA 1ADQL 1U8KB 5D1XE 1FHGA 4ODSH 5IQNA 1UM4H 2NYYC 5G55A 1E5ZA 4LPUA 1MI5D 2JE8A 1NBCA 5SWZD 1HU8A 3HMXA 4KDVA 4X5WB 2AQNA 1XR8A 3NJNA 2Y7QB 4BZ1H 4X8CA 1BAFH 4XC3H 3ZO9A 3RWCA 5KYYA 5EIIG 4M6NL 1ZGLP 4NBYB 2WO2B 2ED6A 4O9HH 3QUGA 1CLVA 1D5XA 3D48R 4GKNA 4YLCA 1I9IL 2BS9A 2OR9H 3GT6A 4NNYA 5GGTA 5IVXA 5LUMA 1F2XK 3V9FA 2H2SC 1QZ1A 4I2XB 4XNQB 1CL7I 3RZWA 5D93C 1MCIA 1NKOA 3ARQA 4HX1B 4KO9A 4YL4A 3LX9A 5DJ6B 3WJJC 3WY1A 3IYLW 4ZMZA 1MKFA 1OQOA 2LAAA 4N8VG 1UOKA 4P9ML 4TSCL 2BY2A 2ZUVA 4M6OH 2R56L 4MJIE 5GXBB 4M4PA 1KYUA 1W72H 4POUB 4XVOA 4IBSA 5EH1A 3A22A 2PYEE 3RWEA 5EO1B 2NY2C 1IC4L 1FYHB 1WRFA 5F7LB 2PWFA 3SKUD 3PLYA 3STBA 4CVXA 1LO3L 2X44D 4XPTL 3P69A 4EDWL 5JO5A 1B0IA 4PJ7A 5I23A 3KCPB 2WAHA 3GQFA 3ZTJH 1INEL 4UDTB 4M43L 4HV8A 1KB5H 4TQEH 1QKZH 3IT8D 2OL3H 1KXVA 1CS6A 4TVUA 1WWBX 3DTDA 2YSSB 4TNFA 1KIQA 1KIRB 4ESKA 1Y7VA 4H1LB 1R46A 4D7BA 3UZEC 3UBXA 5LBSH 25C8L 1S7QA 4ZUVA 4WI4A 2DLGA 4HAFA 5HJBA 1J8HE 2FZ3B 5DS1A 3TT1H 1U8HB 1DBBH 2AERT 2L0DA 3HVDA 4BV1A 4MLIA 1P9MC 3SQOL 2CHZA 4JM2C 5CP3H 4NQVA 2F58H 4Q56A 1J1XL 3L3OC 5IWLA 1F5WA 1KTDA 5HJ3B 1RIHL 1ZLVK 4OCSH 1CI3M 2D2CC 1H5BA 4AG4H 4O58L 3VXUE 3LQZB 2K6YA 3RX8A 3Q01A 3PHOA 3N42F 5I66B 3NJKA 2GBTA 4L4VD 5I26A 5IJKA 4JRWA 1ZLWK 2ID5A 5IREA 4L5FL 2ZXQA 4V1DB 3GLZA 4XXWC 3QO1A 1IGTB 5CCGE 3FHEA 3GUFA 1CXLA 3ARRA 2WP3T 1Z2KA 1WZ1L 2XN9B 2FO1A 5JHAA 3AT9A 3WI9A 1FVDB 3JUZA 1PF3A 1MFDH 5DS2A 5F44A 3TA3A 3V5DB 2DB8A 1ZDSA 5HYJD 1JRHI 1AGBB 1DVUA 1M6UA 2Z65C 4CKQA 4H0GA 1BAGA 5LGYA 1TEGA 1WS8A 2WXGA 5SWZA 3N1MC 3COOA 1BCIA 4UQ2A 2MHAB 5J7CC 3TEYA 4BRVA 4HS3B 5CCKH 1O6TA 2R0KH 1HKLH 2WYZA 5E2WL 4F9LC 4JKMA 4YHKL 4K5MA 1PZ5A 3KWUA 4UIMB 4P3DA 2WKLA 3T65A 3FB7A 2BIHA 2CCVA 3SGEI 2F53E 3EJRA 3TX4A 5C0AB 3SKOB 4NRXB 3UJJH 3N1PC 3GDBA 3MRIA 5AW7B 3QHZL 1JGUH 3NJIA 2X89D 4JQIL 4JRXE 4YHIA 3T0VA 4H8PA 4PREB 2HVBA 4I0PD 1R3JA 1ID2A 3B7SA 4XMLL 4ZMLA 5FC9A 1T80A 1C8QA 1YPZE 5DTFA 3QEQD 2FH8A 4MAYC 3GRGA 1W72B 2JQZA 1XT5A 3QXVA 5SWQB 3MLPA 2G2PA 1AHWC 5TGBA 4H25B 2NXYB 2VLRE 3O3BA 4OZ4A 4E68A 5F7EL 4DZ8B 4LL1A 5I5MA 3MUJA 1CDIA 3LIZL 4MD4A 5ESAA 3MGTA 5MI0C 4GG6F 1TZHA 4UM9B 2ARJB 3TNMB 2JIXD 3PRZA 1KB5B 2EXYD 4DP7X 3LAFA 4MXQD 5AVQB 2OL3B 3CNKA 4E0RB 4QTIL 5CEZE 3HEIB 2CA4A 5LLIC 1Q9LA 2RA1A 3MA7A 3IXTB 4JG9A 3TPKA 1I1FA 3FH5A 3G6AA 3QZLA 3P2DA 2GUOB 3P9LA 1JZEA 5EU4A 4W9JC 4ISVA 4O4YL 1FORL 1G1YA 4FI6A 3WUWA 1E65A 3NABL 4QHUA 3MUZ1 3BSZA 3TVMC 2LU5A 4LVHB 4P2AA 2P5ED 2IFFH 4XZUA 2WMPA 5JZ7D 2DOCA 5D2NA 2NY4B 3SCMB 2VN4A 3ZE2E 2YXWA 4O02B 4Y9EA 3BFOA 3SDCC 3N5AA 3SSGA 4NO0D 1ZOXA 3AREC 3FOMA 3KHQA 5DSCA 5I5RA 1N7ML 7FABL 4AK2A 2CXGA 2FSEA 3F7QA 4JO8A 3HLAA 3V8OA 5I71B 2YD6A 3HNSL 4KRNA 1R47A 2EE2A 4CKVX 5HYJA 1U58B 3HC4H 1ONQA 5KSBB 1KB9J 1NC2B 1TJHH 4PJBF 4N2MA 2GCYB 3KLQA 4C4BA 3HUJE 1X6NA 1EBAA 1BX2B 4NZUL 1C1EL 2DWDA 3MCG1 3G5VB 4LHJB 3X1GA 4R83A 4EZKA 1F3JB 1SOSA 5GS1A 2GYSA 5INDB 3SBQA 2NSXA 5I8KL 5DRNB 1FFNA 3MO1A 2QELA 1KN2H 4PB0H 3TC9A 5B1AB 4AQEB 5D72H 3R4DA 3C5ZD 1BZ7B 2GAZA 4UU9A 3WJLA 3HMXH 1D2PA 1WAPA 4POZD 1JGDA 5ERWB 4BCYA 3NFPB 4XN4A 1LEKA 5BO1H 3HKZA 5EUOA 2DH2A 5HBBA 4Z7UB 3V4PL 4JCMA 1OEZW 4I0PA 1HYSC 1U41A 5D2LF 1E4XI 3GBNL 1PG7X 3O6FA 3QWOB 2XTJC 5FUCE 3V10A 4NZTH 1B4JH 3BUIA 2BMKA 4QRTA 3QEQA 4RMRA 4DAGL 4U6HB 1NJ9B 3GK8L 5FKPB 3ZOAA 1KIPA 4LP4A 4U1KB 4XC1H 1GZHA 3QA3A 2CRIA 2XN1A 3BP5A 3FQNA 2KDGA 4G80A 1GTFA 1NA8A 2EYSB 4LP5A 1CT8B 1M05A 2DY2A 4C57C 1JYVA 5D55A 4EZMA 1WA1X 4OLUL 4NQEB 3T5WA 2HT4C 1PW3A 3L9YA 4NX0A 3SPGA 1BWWA 5F9OH 2DWSA 4LGRB 5CGTA 3BQVA 4HDIA 2HTKC 5AWNH 1QW9A 3DUHA 5EG6C 2NT0A 2WLNA 1KTRL 3N0AA 3ZT6A 5IMOB 5IQ7H 5JW3L 1MNNA 1C5DA 4JGNA 2BSDA 5DZOA 4KJWD 4RDQF 3CUPA 4P48A 3UZQB 1AOZA 3CX2A 4PWFA 4XP4L 3LPOA 3RX9A 1JDAA 1E8WA 4FRWA 4JK0D 2P5EA 4F7MA 2EECA 3CFQA 3CHPA 3GMRB 4XBPA 4XOEA 1PAZA 1QR4A 1S9YB 1YNTB 4Z95H 1IBHA 1RZJH 1XBDA 1YEDA 1HHJA 4NO0A 2Q8BH 3QUZC 4XCYB 4DN3L 3KPNB 4NPYB 1UD5A 2CDGB 2ZONA 4ZDHA 2OMVA 2WSKA 5DS8B 3C6LC 1BYPA 2VR4A 3D8MA 3KLAB 5MEOB 3ZPDA 1EPFA 4KZEH 3BH8A 2G3XA 4QAWA 3OKEA 4RFNB 5LBVA 3BGFC 4Y5VA 2APSA 4JRYE 1S7SB 2X53A 3O8XC 3QIWC 4PRBA 2CQVA 1YY9D 2MCG1 1A3RL 3T0XA 3VGAB 1YDPA 1YEFH 5E1AA 4QHLB 1RP9A 4AENA 4X98B 3CPUA 2JI1A 3L2LA 4AV4A 4ZXBA 4ODHL 4ZS6D 3NK3A 3VH8A 4JQVA 4AIXA 1ZANH 1F4HA 4K3JH 5CS7A 2X12A 5KYXA 1IBDA 3FBKA 2B3IA 5BMFL 4OZFA 2DQCH 1FIGL 4HUVB 1V8HA 1JHLH 4OGXH 1UEYA 4X4MA 1YMME 3C5ZA 5KTEL 3KWWA 3HMWH 5M95B 2CGRH 3W0WE 1ZXKA 2BP3A 2HRPL 4ENZA 5C0EA 4IBWA 4AUYA 5IGXL 3HPJA 3O6LH 3EYSH 2YC1B 3L5WB 3W9DA 1XMWA 4N2GA 1NOAA 4KZDL 4W9EC 1IBBA 2VZ3A 3QJHA 4PI0A 5HYQA 2NTFA 1TJGH 4QY8B 1VDGA 3OZLA 5FPIA 4GI9A 3T2LA 5B8CA 4J8RB 4G82A 3BEVB 5KYYB 1MREL 1F4AA 2B2XL 4YOKA 3ECWA 1OP3K 4RGNE 2ZZUT 1OD7A 3IBOA 4F24A 4YHLL 4P5SA 1D5XB 2J43A 2HH0H 3EF4A 5HYEA 2RALA 4K9EL 2ZXGA 3TT3L 1QFUH 4EOWH 2OLDA 3DGGA 2D7OA 1P6AB 3CH1B 4X9YA 2D3JA 3DV4A 3MCLL 1AXTH 4FG6C 4PS8A 4JN2A 4F7EB 1O7DE 4WUKL 4Q52A 1FIEA 3BIBX 4B7IA 5CGMA 3PDOA 1RUPH 4XCFH 2EDNA 3QS2A 3LXAA 1M7IA 4MBRA 1MFEL 2V9UA 3P3UA 1OSZB 4JFQB 2VDMH 3WYRA 3U9PL 1BP3B 1QBML 2DQFB 3FUDA 4L3CA 2HX9A 1KGXA 5DYFA 5FX3A 4NZDA 3VD1A 2WGNB 1C12B 1EGJL 5JQHC 3IJ8A 1BMWA 2C3VA 3QYNA 4UAHA 4WHYG 4N5UA 5I1LA 1IKFL 4B9ZA 1AI1H 5E24E 2OV0A 3HE6B 1NMAL 5E2TH 5C08D 5BS0B 1YEHH 3UP6A 2EUXA 1NCBL 3UBXB 1UWYA 3ZUNC 4WWID 4ELKA 5D1ZA 3RVTC 4MYPA 1HQ4A 3FRPB 5E95B 2J5LC 3AY2A 4ELME 3QCVL 3BSZH 1IKOP 3PJSB 2F7QA 2NXZC 5EZJB 3FCUB 1A7PH 3VFSB 1H0DB 1FL6B 1ZEAL 4KHTL 1KNOB 4GYBA 3HRPA 4APQD 1GOFA 1UT9A 5IBUB 3RGBA 4NKMB 3R8BB 3GNML 2ZUQC 2NQ3A 3CFUA 5DHYB 3ULVL 2EDEA 3A21A 3RY6C 5TQ0L 1HC1A 1UA3A 3SY6A 1LP9B 4TRPH 5HHVL 5KANI 2H8PA 2KLSA 4WGWB 1Y1UA 4RAHA 4DGIL 2H2PC 1SNRA 5GRYA 5FYKH 1AQKL 3Q1EA 4NQTA 4XMPH 4CC4C 5I1CL 4E9TA 2YKLL 1Y6KR 4YDLC 4FERA 1R34A 1CZ8L 2Y7LA 4BELD 2EVGA 3REWA 5JPMA 1JVKA 3AACA 1G9ML 5IHUH 4ICWA 3WEOA 3A4DA 1UH2A 1FZJB 1QI4A 1ES0B 4B9PA 5I16A 4N2KA 3QDJB 4IKKA 5T1KD 4JZOA 5LWYH 3ESUF 4IRSB 1J5HA 3QG7L 2YQ2A 3VWJB 5AAWC 2HVJA 4OM1L 3W81A 2VE6B 4AL8C 2ZKMX 4G8GD 4JANB 4JKPH 1WCBB 3PP4H 3P54A 4Z7OF 3LZNA 3OKKB 1YQVH 3KDMB 1THCA 4MDIA 1OD9A 4K7PX 4W9KC 4E9VA 2AJ3A 2HX8A 5EORL 1BLNA 4LEEA 5IG7B 1ASPA 2YUZA 4UZSA 2OXHA 4O2EA 5EBMB 3H9ZA 2MPVA 3GI9L 4HALA 4YHIB 3GSOA 3S36X 5I17A 1NKGA 2P52A 2ZQKA 3ARBB 2N3JA 2JKXA 2UY7B 5IHWA 4YGVA 4U1NA 5A2CA 5BRPA 3BZFA 3I6LE 4HT1L 4R90L 3EDFA 1KELH 4KI5E 4ETQB 2ICWB 1BYNA 1U8MB 3PP3K 4Y1TA 2EXWC 2W65B 3MOBL 1IEHA 1Q72H 3GIVA 3HAEB 5LAXB 1TQCC 4G6FD 1WC7A 1O5PA 2C9UA 4MZ3A 1IAIH 1LO0H 2UZYB 5C08A 3IMRA 3FUIA 3ARFB 4HH8A 2W9EL 2Z8VC 2DTSA 1QSVA 2D9QB 4MD5A 5HGGS 4OAWA 4OD3L 4Z7NE 2ZOUA 1A6TA 2A9ML 1Y1DA 2P8PB 2DYPA 1ML0A 1Z66A 4KQ3H 2CM6A 1S3RA 1R3HA 1JHTB 3FK3A 3G6JF 1BVZA 1MFCL 1KPVA 1UB5A 2P8MB 3WS6A 3NIDB 3P9LB 2BSTA 3IU3B 3UEZA 4MMXC 3EZ8A 2VLME 2NNRA 3MNWB 2ZAHA 4YFEA 5E6SB 4APQA 3QPQC 4URKA 2BHZA 3SYQA 2P4AB 3JT2A 4JR9H 3L7FB 3CPLB 4X2UA 5F7DA 3C09B 2WMPB 3CFDA 1BQSA 4FEMA 2FGWL 2VXQL 4YBLB 1F0LA 3QIUB 4MB1A 1JGEB 3LZFL 2BZDA 1ORQA 3VW3L 3OR7A 2ATPA 4MAUH 3X12B 4R4BA 4MJ5A 2BX5A 5CCJA 2X5PA 3NZHH 4QHPA 3ALXA 3O4OC 4A2DA 4PRHB 5L2KE 3U4KA 1CFSB 5H35B 4OLEA 5FA4A 2JELH 3U4BH 2PCPB 4IIZA 1I4FA 1DP0A 3FH8A 3Q8EA 3RJDA 2FQFA 3L5HA 1AGCB 2R23A 3P4MA 4PJHF 1EEQA 1WHPA 4OZFH 1IFGA 2UWEE 3QUYC 5JOFA 3ECBB 2Y1ZA 3MLRL 2WTOA 1MQ8A 4YHNB 3UZVA 4JHZA 2E7LC 4LRNH 2Y36L 5CHNA 5D7SH 5IM7B 4LPXA 5E99L 4HIXH 1Z9MA 1T89A 1TCMA 5E1HB 2CZNA 2HKHL 1H3UA 2CCLA 2SEBA 3HNTL 1UM5H 4DP4X 1WK0A 1P4BL 4G71B 32C2B 5GZND 4CW1A 3ZHDA 4AIZA 1T7ZA 2W0FB 4U6XB 1DBAL 4N3TA 5ITFB 4YUEH 4Z7QF 3SJVD 4C4KO 3ZSTA 1BFVL 1LEKB 1OVZA 1FNSL 4FQ1H 5EN3A 3SDDA 3T8XA 2EIZB 4P5RA 2N0KA 2OMUA 1CIDA 2FECI 3MLSH 1XH3B 4P2QA 4Y0GA 2OI9B 3HW7A 2KI6A 1ILSA 2C1PA 5EHFA 5KBNC 1AGEA 3MUUA 3FTVA 4IBYA 2GK0B 1V27A 5CZVL 3IJEA 1F13A 3DROA 1ORSB 1T20B 3AAZA 4IM8A 1OOWA 2ZCHL 4N1EA 2ZOKA 1BV8A 4E36A 5HHMB 2IPTL 4G80B 4UT9A 2NY0B 4AW4A 1AR1B 1E2WA 2BRRL 4KQ0A 2HKFH 1U92A 1KFGA 3SE3C 4NP9A 4OLYH 1MXGA 3QVAA 4PRPD 2WB1A 4HFWA 4I2XE 4B9CA 4N24A 4L05A 1SY6A 1ZT7A 4JREB 3K2UH 3S98A 2FWOB 3IJHA 4UT7L 4X5XB 4YVUA 1GCYA 3FNKA 3ML9A 4AGOA 2F5BL 4K8RD 4JG1H 2ZUXA 3OLDA 4HG4J 2V8MA 1AS8A 4ZOEA 3U82B 1DVZA 4JHWH 4GLRH 2ED9A 5ILTL 4AQ1C 4WJ5B 4HLEA 4PJCA 4PJAB 4TNVK 4HIJA 5F9WB 2PPCA 1YC7A 2GK2A 1Z9PA 2OSLA 3FOLB 1PSKH 1RZFL 3WIFB 4U6TA 2ZKWA 1VJSA 4NQQA 2QQNL 3LDBB 2YAEA 1TQSA 2YD7A 5EPMB 1AAJA 3AJ7A 4KXZH 7PAZA 2B5IC 4IYKA 1AGFA 3QCUL 1A6VL 1HKFA 4HU2A 1BGXL 3B2VL 1CE1L 3GEFA 4FQXC 2JB5H 5HHOB 1DVTA 4ZDHB 1DBJL 1CK0H 2VDNL 2Y2YA 3HG3A 2A6DB 3CIAA 2OTUA 1WAAE 4F7CB 2YOAA 3BH8B 5KUKA 5DEGB 4J1UB 3BO8B 2E47A 1XGRA 2XX0A 1NCHA 4Y5VB 3LB6C 3ZQXA 2QSCL 3VFGH 1HQRB 1NTDA 2XJKA 4F33A 1EXGA 1JMZA 3MLUH 5CGYC 1RVFL 4MSWB 2NY5C 3ZBMA 3FAWA 1ZJAA 2CDFA 4P57B 4WJG3 5E7BA 2XWTB 1M9WA 1XEDA 4GG8A 4PP2A 4F5CA 4L48A 4Z77A 4CN6A 2BVEA 4PD4J 1CGSH 5JA9A 3OMNB 4X83A 2ZYSA 2XKSA 3NEOA 4K0OA 1LXMA 2MQGA 4FI7A 4YNYA 3RUGB 5LQBL 1DL7L 2ODHA 4TM9A 2W60B 4DNLA 3H8NA 1ESOA 1JZDC 4ZT1A 3FONB 5GZNA 2EUVA 1HZKA 5FR3A 2D3NA 4NUMA 3ZL4H 2WWMD 5EU6E 5CN3A 1N70A 1EHNA 2ZX6A 2LE9A 1NIDA 1E28B 1YUHB 1I53A 2H26A 1PL3A 1KZYA 1GS6X 3UGUA 5AZEL 3KPRB 3NYKA 1K72A 4MNHA 5GJSL 2BVQB 1BD2B 2WPGA 4KMTH 4XNMB 4KU1A 4XAWL 1IT9L 3F7PC 3LPPA 3CFMA 3SO5A 4X6CB 3KPSA 1FO0L 3U4AA 4X5PA 2VDRL 3MV8E 4V1DD 1NGYB 2UUDH 2ZNXA 5F7BA 5FM4A 5EC2B 4Y4KC 2GFBB 4UTAL 1NFIB 4ONGH 3QXAB 1KYOK 4QRRB 2AJZA 3KYMB 5C0RH 2PMZA 2EDRA 3FT2B 3ZKQD 3ISRA 3NSFA 3QQ3B 4HIIA 2MOGA 3N9GH 1JZ7A 4NO3A 5JHMA 3OMAB 3BD3A 5C0AE 3QG6B 4HJGB 3QZNA 2WCPA 2DLEA 1QSZA 4HA1A 4KKQA 4D3CH 5IT2L 4QPEA 4GW5A 2XXCB 4KDTC 4KTEL 1OSEA 3S96A 1I9JH 3JWOH 4PQXA 5FYJD 4TOYH 2Y6TE 3W2DH 1E27B 1QYGL 2P44B 1HT6A 1T7VA 3KBEA 4OU3A 4X6EA 5EZLA 4G42A 5JDSA 1MJJA 1O7VA 4PCKA 3GI8H 1A9BA 3TO4D 2CLZA 3VJ6A 3WDHA 5K1NA 4EI6B 5B1JC 3UTQB 4D9RD 3FZUC 5ES4B 2C3VB 4Y7OC 4KRPD 3W5MA 5GHWL 1ECYA 1UXWB 2V2WA 5BV7H 3Q2NA 2ZTBA 1JP5A 5CU9A 3ILEA 3SY0A 4S1SH 4NLAA 1RSYA 4QXTB 5AB9A 2XRAH 2VR3A 4P23A 1L7IH 1KG0B 4OT1H 3U9WA 1ZHKA 2MCPL 1KZQA 4FXGC 2OZNA 5CMAA 4RIRB 1TZAA 3ARYA 3WCYA 1DQLH 5AZUA 3UXFA 3TBTA 3OTTA 4OUUA 1IL1B 1BQLH 4LESA 2NUPB 4I0CC 3BE1L 4PTUB 2B1AH 3L3OA 3TO2A 1T21B 3NZUA 5KW9H 5IFJA 1T5WA 4DVRH 3UGEA 4UQAA 1PG7W 3EHBC 1QBLH 1XIWC 5IZ7A 4CMHB 4MXWL 4IGBC 3IFOB 2IH1B 1IM3A 1QFWI 2JJVA 4L1DA 5GRJL 5B1KA 4PW4A 2HPTA 2W38A 3AB0B 1BEYH 4Y5YC 1LE5B 3LH2L 4A66A 1XGQA 4HJ1A 4FYTA 4HS8L 4R2GC 5L6YH 1RPKA 2UY6A 5KWYC 1ZLDA 5EZOL 4Y7MA 4WF7A 2X6CA 3X11B 2KPNA 4AEHL 4Z7WA 5H94A 1NAMH 1KLUB 3BVNA 4LSPL 2Z93B 2ZOTA 1GPOH 3PHQB 3WEXA 1DQQB 1AGDA 2NY3B 5DR5L 5A3ID 3KPLB 5ID1A 3NJFA 5KYUA 3KDPB 3NA4A 3FO9B 2EIKB 4OD1L 2HUHA 2CHWA 3K6DA 1AQ8A 2QKIA 2CE6A 5J1AA 4W9ZA 2DEXX 1NBVL 2FAUA 4HU8A 2QSTA 5HDBB 1CYGA 2NY4D 3AG2B 3LSOA 2QMJA 3L95B 4HIQA 3SE9L 4ANWA 3DARA 1ETB1 1KIUA 4HWUA 3UABA 3VXOA 1KV7A 4E9QA 2CKBB 2PYFB 4QXUL 3UAAA 1CU4L 4D8PB 1LMKA 3HG2A 4MDIB 3CHRA 3LNEA 3HC0B 4XBEH 1P6WA 2DBLL 5K9JH 4LVOB 3E3QC 2OJZH 4JFTA 4WEBL 2AZUA 2Z7YA 3QULA 1SVZA 4XHJC 1INQB 4IOIA 3TCLB 4BH8A 4UT9H 1RJYA 5LN8A 3B2UD 4JFXB 1G7PA 1KGWA 3ESOA 4C56B 1RUKH 4GI8A 2BWIA 3WD5L 2VL5B 2OYLA 3S34H 4MAYA 1XF5B 3OM3B 4HHGA 3TO4A 2RBLA 4GIOA 4UV4H 4O2FB 3S6CA 1XH2A 2CLVB 3BPOB 3BPCA 4NKIH 1RKRA 4FZEH 4CU8A 1LVEA 2K9FB 1W9XA 4QNPF 4IW4C 4DOHE 5KS9F 3L3IB 1W80A 3TIDB 4PP1C 3T2QA 4TVPD 4LCVA 5DFVC 4Z76A 3V0AC 3QDMA 4NQEE 4A7TA 2CJUH 1CFTA 3D05A 2OMYB 3FSZA 1LTXA 2A6IA 2C9PA 3I50L 3KXFD 2AJYH 5I19H 5E5RB 1DQVA 2NY1B 2D03H 3T0ED 5BRQA 4ZMWA 3B9AA 1D5MA 1A1MA 1ZGLM 4I9XA 4DKFL 1TFHA 3ESMA 2HLFD 3EW3B 1S7VB 3CFIC 1N4XH 1BOGA 5JHDD 5JQ6H 5AB0A 3DSFL 3QIBC 1BVNP 3AU1A 2VLLB 4J3SA </