4HF5H

Crystal structure of fab 8f8 in complex a h2n2 influenza virus hemagglutinin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
195
structure length
153
Chain Sequence
EVQLVESGGGVVQPGRSLRLSCAASGFMFSSYVMHWVRQPPGKGLEWVAVIWYDGSKTYFADSMRGRLTVSRDNSKNALYLQMNRLRAEDTAVYYCARQQDSGYSGPEVSYYSHYGMDVWGQGTMVTVSSASTLVKDYFPEPAVLQSSGLYSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin HA1
publication title A recurring motif for antibody recognition of the receptor-binding site of influenza hemagglutinin.
pubmed doi rcsb
source organism Influenza a virus
total genus 28
structure length 153
sequence length 195
ec nomenclature
pdb deposition date 2012-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hf5H01
5IM7A 1W0WA 1Z0MA 4XH2B 1U3HC 2AXFB 4P99A 5IEHA 5DMKB 3HZYA 4R7NA 3FN0H 1NEZG 3PWJB 4JPKH 4GLRH 2IFGA 25C8H 3OXSB 4P5TD 3TM6A 5I6XC 1XIWC 2XNAA 4QY8A 4XCNB 4YXHH 5CJXA 1NAMA 5F1IB 3ARED 1S5IL 4NN5C 4NNXB 1KULA 3OAUL 1U8IA 1MWAL 4YH6A 1EAPA 4S2SB 1AY1L 3LN9A 4QTIL 4KPHH 4JZOA 1NBQA 5DVMA 5T3XD 1XF3A 2GJJA 3MRQB 1R5WB 5DR5L 1AP2A 3P0VH 3DV4B 4KMTH 3U9PH 1ACZA 4X6CE 1T03L 1EEZB 4C59B 3QWQB 4YDKL 1JWUA 4FZEH 1U8QA 3DHJA 4L5FL 1YJDH 1J05B 3NCYS 4JY6B 4RAUA 5HI5D 1KN2L 3BD5A 1SJEA 3ESVF 1NGZA 4HIIA 4XMPH 3P11H 4F15C 2NY1B 3QXDB 4M93C 3H9SD 3IDMB 4LGRB 4PP1D 5MERB 4TN9A 3RIAK 3LIZL 1ZLSL 5MEPA 2PO6A 3ULSB 1Z2KA 3H7LA 3IDIA 3D39D 3OKLB 4I4WB 1NL0L 4X6FA 1H3WM 1R3LA 1P84J 1Q0YL 1IAOA 2J6EA 2NY4C 5E2WH 1B0WA 4XAWL 1ZHBA 3MOQA 2NW3B 3DX7B 3CXDL 5HGGS 1FNLA 1QOKA 4RRPA 2NYYD 2C3VA 4ZUWB 5SWZB 1AH1A 2A6KB 4GRMA 3DURA 1IC4H 5E8EA 2J8UB 4L4VA 4R2GD 3NIFE 5C86A 2VE6A 1TQCC 2X4SA 3WXVH 3IS0X 4XNUL 1N5AB 2B5IB 3QZWB 1QSFE 4GRLA 4LK4A 5IHBA 1J0YA 3MRLB 4CMMA 5KSBB 5GPRA 3RWHA 2OTPA 2FLBT 3UBXG 1A6ZB 4X4ME 3DOSA 5F9JA 5HI4C 4MDJB 3QXTA 4PGCB 2CD0A 1FLTX 5IVOA 4NKMA 1T89C 3ROOB 4NPYA 2GSGB 2JB5H 3GMLA 2VLRB 4OCLC 1OTUC 4OFIA 4LOUD 1HYRC 5IG7B 4MXQC 3OKKA 1INDH 1FLRL 5T1MA 3TBVA 4U49A 3HR6A 2QEJA 1XGTA 2CIIB 5DQDH 1FP5A 4UOW1 4FXGB 4ZS7H 2ARJB 3EUUA 1CDJA 5IB2A 4YR6A 5F89B 4U0QB 4LU5H 2HJFB 4OZHA 3UTSE 2R9HC 1XT5A 4DN3L 3MROB 2QR0A 2A9MH 2BNUA 3L3GA 4PJ7F 5DQ9A 4TOYL 4U1LB 4LLQA 3RUGF 4QEGA 2VKXA 1TTUA 5DRWB 5EOTA 1I1RA 1ZXQA 2DLIA 3D9AH 2EDHA 4CMHC 1N6QH 4EVNA 5C2BL 3WNMA 2XWTA 2ICWI 1YN7A 4Z76A 1A7OH 2Y36H 2YK1H 2MJWA 4HJ0D 4MD5B 1B88A 4ELMF 5DI8B 4BH8A 1BM3H 2P43B 4HUVA 4TUKH 2AQ1A 2HJKA 3WJLC 1LO0H 1OD9A 3OV6A 3CH1A 4PTTA 4PRAB 5LAXB 4N8CL 4YBHA 3VXNA 1TJHH 4Y2OA 5E9DE 2UVEA 5ENWB 4JREC 4N5ED 4K9EL 4HSQA 5F1SA 4JFFE 3C5SA 1F2XK 1G7QA 1VENA 2L7JA 4PY8J 1OQXA 4WUUA 5ISZB 1G6VK 1AXIB 1W0VA 3LQZB 5DJYB 1QPPA 4M7KH 1MREH 2GITA 3QQ3B 1BD2B 5AD0B 2DD8H 2ZSWB 3KPNB 3T0WA 3PNWA 1A3LL 5MP6H 4TULL 5DJDA 1I1CA 3TBTA 1T3FA 4P9HC 3ARZA 4GT7A 4MSWB 4XP9L 4X7TB 1I3RB 4NM8L 1WT5C 2VDRH 3PWNB 2BSSB 2FX7H 1MCLA 3QEGH 4Z7VB 1DDHB 1TCRB 2NY0D 4AIZA 1DLHA 4PJIB 4QKXB 2IADB 4O58L 4XC1H 3T4YA 3NH7L 4PJ7A 3SDDC 3RUGA 4NO0D 4KJQD 5EU5B 4OFYA 5EBLA 5CMAB 1WGOA 1GAFH 1Q0XH 3I6KB 2GYSA 4U1SB 2F19L 2QHRL 2YPKA 4P2QB 5TH2A 2VQUA 2BY2A 4ELMA 5JW4M 2DQHL 3D25A 3QYCA 3ARBB 4HAGA 3DIFA 1QFWH 3L95B 2OL3H 3LZFH 3OKOA 3JWDC 1S7QB 1DQDH 2Y7QA 3WNOA 3GO1H 5LQBH 1S7XA 5DVKA 4ZMAT 2H32B 4LVNC 4NKOA 3K8MA 4M8QA 1JWSA 1V3LA 4WGWB 3QDGD 5DJCA 4LSQH 4OB5H 4G9FE 3MREA 4AYFA 1Q9OB 3TJEH 5C7XH 4L3EB 4HKBB 3KPMA 5F9AC 2ATPB 4DN4L 1VHPA 4LEOA 1CVSC 2YPVL 2IPKA 1EXUA 3IFNL 3AY4C 1RMFL 4MXVF 1OARL 4YFLI 4JFPB 5HYJD 4O5LH 1P7QD 4KKBD 2AJYH 3QUZC 1TZIB 1UENA 4KQ3H 3SOBL 4HUXA 4ZFFB 3MJ9A 3O41B 1K85A 2HT4D 4NUGH 2Q3ZA 4B5EA 3X11B 4YBLC 1VSCA 2NY2B 5DD0H 1D5BA 1CR9H 3EDKA 3RX8A 1X7QA 3G5VA 1RUAH 1ZHKB 3MUY1 4U3CA 3RAJH 4CAGA 2EZ0C 2YPLD 4Z95L 4OQ1A 5I1DB 4EXPX 3LN4B 3OJMB 4YHLH 2PTTB 4N8VB 5JUEH 3NFSH 5FF6A 2DLFH 5EOCJ 3O3DA 1LEKB 1C5CL 1UKSA 5DFVD 2PXYC 3C6LD 3TNMB 3LN5A 4KQ4L 4R0LA 2AKRB 1QTYT 3ETBF 1LE5B 5FYLD 1UB5B 5CP7A 2NXZD 3F62A 1UJTA 2BSTA 5TQ0H 4HT1L 1UB6B 1QD0A 5HD8C 2AV7B 2DM2A 4WWID 4KV5E 1T1YA 1ONQB 1T4KB 1CDGA 4P23D 1H5BC 3RTQB 2FD6L 3WO4B 4JN2A 4NBZB 4FN0A 2GAZB 4G6ML 4U6VL 4RFEA 2P24A 2XZCL 3ARFA 4O2FA 1INQB 4YDIL 5DURB 1IGJB 2RQ8A 3VXQA 3CMOL 1ZS8B 3RDTC 1UXWA 2ED9A 3P9LA 3QIBB 5EA0H 3BHBA 5I73B 1DFBL 4X9FA 3IVKB 4JRYE 3E2HC 5CFHA 1U8LB 3R1GL 1NGPH 3WS6C 4M48L 5DEFB 1N26A 1UZ6F 3A6CH 3JWOH 5BVPH 1ROWA 2Z8RA 2QSQA 1WTGT 3NCBB 5D7LB 4NFCA 5C09D 2CLZB 1MF2L 2F53D 1CU4H 4PJBF 5D96B 5HDQH 3PQYE 1LNUB 2DM4A 1QBML 2W0LA 5C07A 3CFDB 4JFHD 1DEDA 3QDJB 3CSYA 1L4IA 3TFKC 1YEJH 1HYSD 4NQXB 5KSAB 2RCSH 4LQFH 4AENB 5HHNA 3AXLA 4PYGA 1YY9D 4L4TD 4H1LA 3TGXA 3U2SA 4LHUB 3NIGF 1JV5B 1JPGB 2LQRA 3W0WE 3CDCA 4UT7H 4YGVB 3FN0L 2MSPA 5KSVA 1A4KA 2G9HB 1OT1A 2X89D 3DLQR 3ARXA 4NHUA 25C8L 4LCCC 3QUKA 1H8OA 4YXHL 4QHLB 2ICWA 1V5JA 4MWFB 5CP3H 3TCLB 3SKMB 2WUCH 4JDZA 1IEAA 4PBWD 4G8GD 4DW2L 1JNHA 3NGBB 2BOBA 3MGAA 1OF2A 4G6FD 1BECA 1TENA 4QRQA 4KPHL 4ZUSA 5HYSB 2W9DL 2R1XA 4LPTA 4HS3B 1VGEH 3VWKD 3CCHA 3QDMD 3ULUC 5KOVC 5T3XH 3P0VL 4KMTL 1FYTD 1INEH 1Q9LA 12E8H 4L9LC 3U9PL 4QHKJ 4KRPD 4LCWB 1FVDA 4DKAA 3GSNA 4X6EB 5GQBA 2VZUA 2EO1A 3EO1A 4FZEL 2DLTA 3QFJA 4ODUB 1YJDL 2O5YH 3IJHB 4KDWA 3GJEA 2DQCH 4OZGE 1UA6L 2F54D 4XMPL 1V3MA 3P11L 3UX9B 2D9CA 4PJBA 1AQKH 3G5ZA 4ZAKD 5E00B 3SN6N 4ZSOE 5DK2A 4MNHB 5A16A 2NPLX 4NP4H 3I84A 1I7UA 3PHQA 4DVBB 3CSGA 3UTOA 2BY0A 1LO4L 5LCVH 3KLHD 3VA2C 1JGEB 4L8DB 5DDHB 1YQVH 5AG9A 5L88H 5E2WL 3VXRE 5I1KH 3TZVB 4MNQD 3QCUH 5C8JB 3QG6A 1YNLH 5C0CB 2YMXH 3MRRA 1JNJA 3BD3A 3DECA 1IC4L 1YPZF 3FQWB 1UH2A 3OR7A 5JR1H 3NOIA 3V6ZA 3WXVL 1C16B 4H20L 4PUBH 1FPTH 4WFFD 4WWKB 3F7VA 3FB8B 4M1CC 3LMJH 5C0AE 4FQ1H 3DX8A 2QSTA 4TPRH 5I8OH 1A6VH 3L3IB 2ADGA 3MUGA 1KGCD 4JFXA 5INCA 1FFQA 3P73A 3V79C 4G43B 4ODWB 4PRID 4YPGB 2EC9U 3GNML 5E5RB 3WN5A 3FONA 1YDPA 4LHQB 5F7EH 1INDL 1V7MH 2ZSVB 5BCAA 1WBYB 4J3XA 4O2EA 3STZA 5DQDL 5D7SH 4ZS7L 5BQ7A 5JOPD 3KPRA 4LU5L 3SO3C 3AS1A 2A9ML 1EGJH 3C6SB 5F1KC 1RZIA 5DVLA 1EBPA 3D9AL 1QR1A 4JM4H 1N6QL 3O6FA 1D5ZA 4XTRD 1ZGLB 5LXGL 1NDGB 4NN6C 4QF1B 1A7OL 2B1AH 2BOCA 4W4NA 3FN3A 2EIZA 3GBLA 3IKCA 1BM3L 4PJGF 3WIHL 1MCQA 4TUKL 1CL7H 2CRZA 3VXMD 4KI1A 1OGAD 1QFWM 1LO0L 1HILB 1IAMA 3BD4A 1XGQA 4LLWB 4I1NB 1TJHL 1YPZA 4WW2B 3TN0C 4X4ZA 4MB4A 1JF1A 4WFHE 5BVJA 5DUBA 4JO1H 4WEMB 3HRZB 3GKZA 3EDFA 3U83A 5HVHC 5LBSH 3MV8A 4ZFOB 1JE6A 5IHLB 5DLMH 1J87A 3QIUB 2K9UA 1D6EA 4GFTB 2YN3A 3K3QA 6FABL 4P46D 2ZCHH 3MCKA 2W59A 1MHEB 1MPAH 1P9MC 43CAB 1Q1JH 3Q48A 4M7KL 1MHHA 5FUOL 1MREL 4XPTH 3RGVC 3S3JA 3RVVC 5FGBA 1P2CA 5D1ZC 1K2DB 2Q20A 3MV7E 2VH5H 3EOYG 3FQRB 3QNYA 3F7YB 3ARTA 4PRNA 1I1FA 2EDLA 5MP6L 1YYLL 4JM2D 5D72L 1DP0A 5I8KH 1RUPH 3X13A 2VDRL 3Q6FB 3O3UN 3QEGL 4JRXD 2B20A 4EXKA 3DRQB 4V1DB 4QRSB 3QFDA 2LU4A 5JO5A 4XC1L 4LNVA 5LG1A 4RNRB 3G08A 1KBGH 2C3HA 3B9KB 3I75B 3HPLB 1UEMA 2J7LA 4WIQA 5K9QG 1GAFL 1MH5A 1Q0XL 3MJGX 3SDCD 4JLRA 3FQUA 1K8IB 3AS0A 2FRGP 5HHPB 5JDSB 4PJFF 1FNHA 2BNQA 3GMMB 4PJGA 3P4MA 1A6UH 4YHZL 1QFWL 3MJ7A 3PGCB 4HG4K 1LDPH 1P4IH 2OL3L 3LZFL 2OJZH 5ADOL 3CU1A 3OTTA 4JFYB 1K8DB 3H9SE 4XAKD 3SGDI 1DQDL 2VDQH 3GO1L 3MRCA 5LQBL 5TDOB 3NA4A 1C08B 3H0TB 4HIXH 2VDPH 1L7IH 3JV6A 4ZD3H 3DI2B 3O3AB 4LSQL 3MRHA 1OY3B 4BZYA 1XH3A 2VNCA 3BP6A 1BOYA 2GT9B 1X5FA 3MLRH 3TJEL 5C7XL 1I8MB 3S5LA 1SJHB 1TZHA 3QP3A 3QR2A 5D2LF 5GGVH 2CO7B 4XNXH 1GHFH 3DSNA 5C0GB 3O11B 4Q9QH 2ITCB 4FQXD 4K07A 1AE6H 2X9XA 4FFYL 2V2TB 1TXKA 2CKBH 3V7AE 4OIIH 1IQWH 4KK6D 2AJYL 4KQ3L 1JJUA 1HHHB 2JB6B 1CE6A 3TJHC 1MAJA 4NUGL 5SWQB 4U6YA 2YEZA 5C71A 3LSOA 1BQHB 1Y6KR 1A1OB 5DD0L 3SGKA 2A6DB 1CR9L 4MQXC 1I9IH 3MOAH 1HH9A 5D7JC 1RUAL 3BZEB 4U1HA 1S9WA 5EU6E 3RAJL 3UYOD 5GZNC 3SDXE 1HN1A 2YD8A 4U1GB 4XWOD 1CWVA 5KVFH 1T22A 3B5TA 5ID1B 1R0AH 4YHLL 5E70A 4DKDC 5GGTA 1RPQA 3KPSD 5JUEL 4NC1C 1MFNA 2DLFL 1RIUH 1CCZA 3VFUB 1T1WB 3RRQA 4I18B 2DWDB 3IXTB 3ZDYE 5CIPB 3OGOE 4EUPH 4RAVB 3WFBH 3VXUD 4DZ8B 3KXFA 2BVEA 4KMQA 2VLMD 1S7SB 2ZP0T 4H26B 3FRPG 3D85D 5DD3H 4HKZA 5TQ0L 5FYLH 1M71A 1SBSL 5IMOB 1SYSA 1PEZA 4JO2H 2CMRH 2P8MA 4YJZL 3SDAB 4JN1H 1S78D 2D7QA 2X4QA 3IFPB 4MB3A 4P4KC 1G9MH 5CSGA 1HWGB 3BKJH 1XF5A 3SDYH 4HGKC 3ZKXB 1ES0A 1U3JA 5D2LA 1GPOL 3FOMB 5GIRB 1JK8A 2FEDC 5EA0L 3LKRA 5DSCB 3PL6C 3CC5B 1B0GA 1OAQL 1NGPL 1CFBA 4LDEB 5ANMA 3A6CL 3JWOL 3JVGA 1JPTH 5BVPL 3D3VD 1T2QH 4WO4D 4R6UA 4EN3D 5IM7B 1W0WB 3ZDXE 3PGDA 1ZANH 3EOAB 4WUKH 4Y2DA 3CIQA 1CU4L 3HZYB 4R7NB 5HDQL 4MGXA 3U30C 4IOFC 4OCNC 4OZIF 4NQVB 15C8L 3T77A 3SE4A 4PGJA 4JFDA 5K9JH 1I1AD 2WK2A 5GRUH 1AGBA 2XNAB 1ZVSA 4QY8B 1YEJL 3MUHL 3CLFL 2RCSL 4LQFL 1F6AA 3T0EB 1J0JA 2OI9C 3T0BA 2LU7A 3MUJA 1XCQB 4BH7A 1LMKA 1EAPB 2XT1B 1MCHA 1QLRA 4JZOB 1EZVX 4UT7L 5D6CB 3ESUF 5T1LD 4JJHA 1TLKA 5IBTH 1NMBH 1HQ4B 3U4AA 4UAOB 1JWUB 4OTXH 4QRPA 4KVNH 1U8NA 4RAUB 2WUCL 3OB0K 5CGYC 2A6IA 1AGEA 5M94B 1RJZA 3DXAD 2KQNA 4LPVA 4X9HA 4DFHA 2IAMB 3EFFA 1EV2E 2J8UE 1VGEL 3EW3B 3I6GA 2VXTH 3VDAA 5T3XL 1KJ2L 2OMNA 12E8L 4NRXA 1DLFL 5MEPB 3UEZA 2PO6B 5KSBE 1T1XA 3DGGB 3LY6A 2O5YL 2YS4A 3VE0A 4X6FB 2ZOLA 1R3LB 2DQCL 2HFFA 4OLZH 3VRIA 3IDYB 1GOFA 2CO6B 1Q94B 2AV1B 3HFMH 1ZHBB 2JJWA 3FTGB 2IAND 1S9YB 2FYYA 1NH6A 1RJLA 1AQKL 2G5RA 4XXCA 4YQXL 4MA1C 4PJDE 4BQBA 3BJLA 2C3VB 4Z77A 3LKOA 2VUYA 5GJSH 5DYOA 3DURB 3HNSH 5E8EB 4APQA 3W82A 3I6LD 4ZOCA 2X4SB 1G1CA 2ZG3A 2H2SD 1F00I 3OB0H 3UZQA 5LCVL 1P7KB 3OJDA 4XNMB 4HEPG 1X5HA 4AEIH 3GGWA 1YQVL 3HE7D 3OKMA 5L88L 5GGUB 5F9JB 2LTQC 4GQPH 3PUCA 4P5MB 5I1KL 3MFFB 4WHTA 4MZ3A 1PKOA 3QCUL 2QADD 1AD9A 1EJOH 1NCAH 2GK0A 2AEQH 4NPYB 4NSKB 1WZ1L 2X40A 4J3TA 2NY6B 5EU3A 5JOEA 4NQED 2EE9A 3GMLB 1CS6A 1E4WH 1CLZH 3MNWA 4PUBL 1FPTL 3OKKB 4U3XA 3VFVA 5T1MB 1CFQA 3LMJL 4ZFGH 1XGTB 1LEIA 4D0CB 4FQ1L 3N1PC 4TPRL 5I8OL 1A6VL 2VDMH 3BQUD 3GIZH 4I2XA 5IB2B 3CLEH 2APBA 3L3GB 2KZ1B 3PIQA 4LLQB 3MBED 1FHGA 5EO9B 3V0VA 3BW9B 5EOTB 5F7EL 1DVFA 2JKXA 1ZWIB 5JHLH 3H3BC 1EHLH 1V7ML 2WWKT 3V4VH 3HB3D 4EVNB 5ISZE 4NWTH 5E8DH 1CTOA 1MAKA 1YN7B 4Z76B 4MQ7A 3L3DA 5D7SL 2X4RA 4BH8B 1C1EH 1JYWA 1BD2E 4HUVB 1FNEA 2W9LA 3TNNA 2HJKB 3LD8C 3CH1B 4PTTB 4NKIH 4WU5A 4Y4HC 3VXNB 2FJHB 1EGJL 2A38A 1R3JB 2A1WH 3L7FA 5BW7A 4JM4L 2FJGA 1DEEA 3C5SB 3KPQA 1G7QB 4KK9C 4PJIE 3ZYIA 3VI4F 1KB9J 2PYEA 5CSZA 5DZNA 2B1AL 4WUUB 4GKNA 4PRDA 1MY5A 1W0VB 4M7ZB 1CL7L 4M9PA 1OSPH 3HE6A 2GITB 1VFOA 2X4PA 4UILH 4JKPL 3V0AC 2P45B 3PNWB 4OCXH 2WBJD 2NX5B 3BDXA 4JFHE 2IPTH 5CZXC 4P2QE 5DJDB 4JO1L 5KS9E 5GGVY 3K4ZA 1YZZA 5LBSL 1ORSA 3BEWB 2ZCHL 3TA3D 3JSSA 1WF5A 1MPAL 4QLRA 4S11A 1DLHB 1G6RA 2PW1A 4N1HB 1Q1JL 4PJXF 4XPTL 3T4YB 1MCCA 2F74A 1KTRL 3I02A 4PJ7B 4D8PB 3RUGB 4XVJH 2EDEA 5EBLB 2VH5L 2Y9RT 1YC7A 5EZJA 3ARYA 5I8KL 2HTKD 3NZHH 4L3EE 1X5YA 2YPKB 1YY8B 2YSSB 3KYMA 1RK0B 5TE4H 4XCCL 3MRGA 4L4VD 4X98B 4ELMB 2ICWJ 3WMSA 1MWAA 5FXCH 5GISH 4K8RC 1YN6A 2C9AA 1H8SA 3OKOB 4TSAH 4WCYH 3WDHA 1VEMA 1IGTA 2Y7QB 1KBGL 2O26U 2OCFD 3QDME 4PR5A 4NKOB 3RZCB 4M8QB 3ARDD 1JWSB 1YMMD 5IWLA 2ICCA 1L0YA 2QQQA 1BBDH 2R1WA 2WP3T 5IROC 3T3MF 1OSZA 2XZQH 3CVIH 1A6UL 4HQQH 2F54E 3KPMB 3ARVA 1P4IL 3U1SH 5E5UB 2OJZL 2BXYA 2IPKB 1EXUB 1ZA3A 1G9NH 2VDQL 4LKXA 3V8CA 4FTVB 4OZFA 4RA0C 2VDPL 1L7IL 2NZ9C 3IAGC 4ZD3L 3QDHA 3HCVA 1S9KC 4HUXB 4I0PB 2X41A 3MXVH 4N0UA 4MX7A 1QBAA 3MLRL 3H9YA 3PGFL 3VXSD 1FJ1A 3DV6A 4W4OC 2VLLB 1F4XH 1D5BB 4PJXA 1MCPL 1X7QB 3G5VB 1GHFL 4NO3B 2VDKH 4Q9QL 4HEME 3AAZA 3IJSA 1AE6L 4MNGE 5I71C 4XNZB 1N8ZB 3TEUA 4XMLH 4OIIL 1AHWA 1IQWL 3QEQA 4HDIA 5ABDE 3O3DB 3C5ZC 2NY3B 4HUWA 3LN5B 1YYMH 1WBZA 4EI6A 4I8DA 4ZO6A 5DJ2A 2CR3A 2GSIA 1HHIA 5CP7B 1I9IL 3MOAL 2DBJA 4F7CA 4H8WC 2BSTB 3S98A 1IGIL 4HJJH 1WICA 2IF7A 3BUYA 1CT8A 3VGFA 5KVFL 3HMWH 4PRIE 5HDBE 3SGJC 2V5YA 4Q58C 3L7EA 4K7PX 5FECA 1DBKH 1RIUL 5DXWA 5EZIH 5HHMB 1H3GA 2EICA 3HI1A 5I15H 1FN4A 5EO1A 2P24B 3ARFB 4O2FB 3QQ4A 4WVRA 3VXQB 3HI5H 3WFBL 4IS6A 3QDJE 3IJYA 1UXWB 5DD3L 5C0IB 3WNPA 1CBVL 1BVLB 5L8JB 3F6IA 1CICD 5FYLL 2YXFA 3O45A 1VESA 2YUVA 1TJIH 1K4CA 4O00A 4JO2L 2CMRL 4OD2A 3WNLA 4UIMA 4GLRI 4JN1L 2J2ZA 1R6VA 1G9ML 1KTKE 2RIKA 3BKJL 4OFYD 3BIBX 3QUYC 3TIDA 3A0OA 2DIJA 2GFBA 3BN9D 2XQYG 5C07B 5GRWA 3JV0A 2HFEA 3CSYB 1JWMA 1DANU 5JA9A 3HG1B 1QO3A 2HT3C 4ISVB 3AXLB 3DO7A 2H1PH 4X6CF 4H1LB 3S96B 5I8CA 3T1FB 1IKNA 5F97E 3V7MA 1JPTL 1T2QL 1A0QH 4NN5B 3QA3B 5DD1H 5E6IC 4R7DA 4EIZC 1ZANL 4WUKL 2VOTA 3C60A 3BKCH 2HFGH 4RMTA 1A4KB 1IBGH 3OX8A 4BQ9A 1MRFH 1MJ8H 2DQTH 2PUQT 1ZLWK 3BPLB 5K9JL 3NFNA 5T1KA 2BNRA 4KROD 3QUKB 5GRUL 2SEBA 3RQ3A 3DYOA 3EOTH 4OD1H 2O61B 5A2JH 2Q7YA 5HVFB 3GMRA 4IRJC 3RNQB 4JDZB 1IEAB 1D9KD 1JNHB 1XZ0A 1CGWA 4TUOB 1M05A 3QEUA 1ZT4B 4ZUSB 5D71L 5JNYA 2R1XB 5IVXE 4JRXE 4OD3H 4WHDA 3WIFB 3CCHB 1KCVH 4PRPD 5IBTL 3PWPA 1NMBL 3TO4A 1Q9LB 1MCFA 5I66A 1FVDB 2HLAA 2DQGH 4OTXL 2WIMA 3GSNB 4RDQF 3CDGA 5JXEC 5DHVA 4C54A 3QFJB 4KVNL 4UOJA 4OKDA 3OG6B 1K4DA 3NIFF 5E94A 1KLGA 4JZNA 4QRRE 4HLZG 5CD5D 2YXMA 5L9DL 2VQ1A 1BREA 4Z7QE 4PJBB 5I76A 3G5ZB 3OSKA 4HPOH 3SKOA 2VXTL 2VSCA 1FFPB 1ZLWH 5AZ2H 2H9GA 1CIDA 1X5XA 2Y6SD 3WLWC 2W1NA 1I7UB 3BAEH 3OKNA 4G8EB 3P77B 1A7QH 4X6CA 5BRZA 4U1JA 3HAEH 4X7SH 2AXGA 5IB5A 4OLZL 3OF6A 3QDAA 5DUMH 4M43H 3HFML 5C9JA 2FB4H 1HSBB 3ARWA 2RR3A 1UM4H 2EXYC 5ICXA 1PY4A 5GJSL 2EYRA 2BERA 3HNSL 4C58B 4WI2A 3GMPA 4JHBA 3OR7B 4Y4FA 3V6ZB 3FO2B 2X42A 3EIFA 5IV2A 2BVPA 2QQLH 2WAHA 3FZUD 4AEIL 1JFQH 4NFDA 3B43A 4GG6A 1ZTXH 3L3KB 4LVOB 5F3BA 2ADGB 1NUNB 3MUGB 4OFKA 4JFXB 5INCB 3P73B 2QLVB 1EJOL 1NCAL 2B7DT 4WENB 5L7XH 4ZOBA 3X12A 3FONB 3ZL4H 5HVGB 1E4WL 1RULH 4F9LA 1YDPB 1CLZL 2Y5TA 2EE2A 5IW6B 2WWMD 4ZFGL 2A77L 5ERWB 4CMHB 1N4XL 3STZB 2Z31A 3WFHA 5SWZD 4NJAH 2VDML 3GIZL 5FM5M 5SX5K 2GTWA 2VDLH 5BV7H 3IDUA 2AK1H 3MRNA 3CLEL 4AIOA 3KPRB 1U58A 2YD2A 3LRHA 3FCTA 2XRAH 5GS0C 1KXVC 2Q1EA 1EZVY 3W11D 1FZJA 1F5WA 1RZIB 2P44B 4OGAD 5JHLL 1F97A 1EHLL 1D5ZB 4K7PH 4M7LL 4GAGH 3V4VL 4JREB 4R4NC 2EH7H 4NWTL 5E8DL 3UO1H 2EDDA 2BOCB 4DGVH 5KSUB 3IKCB 1C1EL 3LHPH 5F9WB 4FABL 1BWMA 3O8XC 1IC7H 5KVDH 4D9QD 1TFHA 3VFPB 2VZTA 1XGQB 2AI0H 4NHCH 1YPZB 1NAMH 2R0KH 2E7LA 2UY7A 3MV8B 4U7SA 1KLFA 3VRJA 3FFCB 1D6EB 2VXSH 1D5XA 3BMVA 4V1DE 3MCKB 4GW5A 4CDHA 1GGTA 1QNZH 4JO3L 4Y16D 5CAYB 1U95A 2B8OT 5IMLA 3IYLW 1QRNA 1OSPL 1G1YA 2DM7A 1KB5H 4UILL 1P2CB 2ENSA 4QHMA 3WEXA 2EEAA 1C5BH 1KPUB 1WFTA 3QNYB 4OCXL 1I1FB 3N1GC 5FA4A 2KUTA 1JVKA 1QFWI 3SDDB 1CK0H 1F8TH 3X13B 3LS4H 1H9VA 3BO8A 1TNMA 2FATH 3VGDA 5L2KA 4Z7WF 4KKCD 3I50L 1EFXA 4HMCA 1V8HA 3ZKNC 1NGWB 4DWHA 3TLRA 3ZT5A 3RWIA 4GBXA 1A7RH 4XVJL 1JHTA 3MLZH 1RFDH 3LVEA 4ZXBB 4ZPVA 4BSJA 2YZ8A 1B90A 1I7RB 4JLRB 3FQUB 3NZHL 4G8IA 5TE4L 3CUPA 5HY9B 2BNQB 4JR9H 5HBBA 5HHOD 4PJGB 3P4MB 3EYOA 5GISL 1B0RA 5A40E 2FHBA 4KJPC 1MHPH 4WCYL 1MRCH 3MRBB 3OKEA 2DQEH 1HQRB 3RIAF 1J8HD 4N90D 1N5YH 4IIQA 3JV6B 4TSCH 4PIRF 3C9NA 3KPPB 4PLKD 3VI3E 2LVEA 2D2OA 1XH3B 1QZ1A 3BP6B 4TUJA 4BELD 4DCQB 1BBDL 1N2RA 1MCJA 2XZQL 3CVIL 3S5LB 1TZHB 5KZCD 4MJID 3U1SL 1OAZH 2R2EA 4PJ8D 1BMGA 4Y5VA 1G9NL 1G0XA 1CFTA 2ARWA 1OTTC 5F21B 1Q9KB 5H37G 4F7TA 3BZDA 1XR8A 3I6LE 4RCAA 4FQLH 4Q6IA 2XWBA 5D7IF 4KUCD 3MXVL 1CE6B 3QJHA 2ATKB 5HI5C 4Z7WA 4TNVK 4U6YB 2YEZB 5FO7A 3LSOB 5DRZA 3RL2A 4Z0BL 4OJFH 4ZO7A 3QAZC 1F4XL 4N0CD 3O6FD 1LK2A 1HH9B 4XPFH 4U1HB 1S9WB 2VDKL 4GG8A 2QBWA 4NQCB 4PP1C 3MRJA 3T08A 5J12B 5E2TH 4L29A 4XMLL 2XN9B 1WIPA 4BM7A 4POYA 2VL4A 4PJFB 1UM6L 2ZG1A 2VDOH 1H5BB 1LK3H 2L4OA 2RHEA 1QSED 4MB5A 3LKNB 3KXFB 2X1PA 3HA0A 1XGRB 1CN4A 3QCTH 5EUOA 5D1XC 4KRMB 5F1OB 4HKZB 5F88B 1U2CA 3RDTB 4HJJL 1G9EA 3HMWL 1M71B 4LPXA 5JIPA 1J11A 5SWSA 2P8MB 3HS0A 3GJFK 5F7HA 1DBKL 3TBWB 4O4YH 2DLEA 5EZIL 4DQOH 5I15L 5MEQA 4UBDD 1J0HA 4YHYB 5IQ7H 4LRNH 5J0BA 4HUNB 4ZO9A 1ES0B 2E9WA 1F90H 4NO2A 4UUJA 5D2LB 5FO8A 1C7TA 3UTQB 4HFWA 1JK8B 3C8HA 3LKRB 4X0KB 3SEPA 1ND0B 4LHJB 3UJJH 2PTUA 1TJIL 2P5WB 3NIDF 1OD7A 5AUMB 5ANMB 5D7IA 1CDCA 1FH5H 2BVTA 2R23A 3K1DA 1LE9B 3VFMA 1MEXH 4P2RD 3GBMH 3T77B 4JFDB 3WIIH 1RHFA 3WDIA 2IGFH 1AGBB 1ZVSB 3O6LH 1WFOA 2M26A 1NQBA 1EO8H 2MFNA 3IDNA 3EOBB 4LCCB 2H1PL 1BZ7B 1X5ZA 3EYUL 4ACPA 4IMLA 4BH7B 4XX1G 3QI9A 1A0QL 3DX6B 5DD1L 1GVIA 3JTTB 4HF5H 5E2VH 1SM3H 2YHGA 2HFGL 3BKCL 3QNZB 4WHYH 1A6WH 1MRFL 1MJ8L 2DQTL 5DJ6A 3DSFH 3D18B 4MCYB 5CWSA 4CU8A 4FZ8H 2VMFA 4QRPB 3EOTL 4L9DA 4OD1L 5AYQA 3ECBA 1LD9A 1U8NB 2A6IB 5E56A 3FB7B 4ZQKA 3DBXB 3EFFB 2W65A 5K9KA 4L4VE 2WBWB 1BFSA 4ZUTB 1TVHA 3VGBA 3AM8A 3VGHA 4NRXB 1A47A 2DQGL 5EU4A 2VLJD 3NZ8A 1SMAA 1T1XB 1CDUA 3MJ9H 5EULV 4BYHA 1PG7X 3KR3L 3QPXH 2D0HA 3VE0B 4RBPK 2NY1C 4YK4B 1MCOH 3ILPA 4K7PY 1Y18B 3BUTA 4OZIB 1NGXA 1X5JA 3BSZH 4WEUD 4HPOL 1PKQB 4Z77B 3LKOB 4HIHA 4QWWC 5AZ2L 4KKAD 3UYPA 1WCBA 2YOCA 2KBGA 4RMRA 1ZLUK 5CJOL 4N9GB 3S88H 4KJQC 1A7QL 4MHHG 4X7SL 3OJDB 1T20A 1F13A 2A9NH 3GGWB 4LLDA 5BS0A 3CNKA 5DUML 4OZHE 4M43L 4CJ1A 2FB4L 4LGSB 2H3NA 2OR9H 3UC0H 3UTTA 5JORB 1UM4L 1KENH 4WHTB 4LCWD 1AD9B 4O9HH 2GK0B 1FL6B 4XBGA 2B5IC 3T2NH 3NAAH 2IQAA 5T5NG 4J4PD 4JDVA 1KCUH 2G5BA 4RBPH 3VFVB 1CFQB 2CIKA 3VFWB 1IJ9A 2QQLL 3K74B 5DMGC 1JFQL 1LEIB 2KKQA 4KFZC 4FQIH 2JJSC 1RV6X 1GH7A 4A2MA 4H25B 2EDBA 5E8OA 4MAUH 3PIQB 5L7XL 2E7CA 1ZLUH 1C5DB 3SO3B 3V0VB 5ESAA 1RULL 1KIQB 4PBXA 4S0TD 4Y2DD 1DVFB 2P8PB 1CL7I 4WUUE 4KUZH 1KTDA 5GZOD 4FG6C 4EI5A 4OAWA 4KKBC 4OUOA 4MQ7B 2CH8A 4NJAL 2X4RB 3RWGA 1N0LA 4RGMB 4X83A 1FNEB 2VDLL 5BV7L 2AK1L 5DEGA 4F9PA 2HT4C 3U4BH 4LKCA 3TNNB 2EDNA 5TDNA 4WU5B 2XRAL 2DI9A 1FL3A 1F2QA 3T4AB 3E6FA 1N0XL 3H9HB 2HVKA 3P30H 3GRWH 1CXHA 3D48R 3L7FB 1DEEB 4FP8H 3H3KA 4K7PL 1F6LL 4GAGL 2DB8A 2EH7L 1HXYA 4JQXC 3UO1L 3MCG1 2PYEB 1BFTA 4GKNB 3KLAA 4PRDB 4DGVL 1E6OH 4PJ7E 3LHPL 3F5WA 4XB7A 5HGHA 3RUGE 1S7VB 1FL5B 3MJ8A 4PGEA 3ULVE 1S7RA 3HE6B 5KVDL 1IC7L 4F80A 1S7UA 2APTA 2AI0L 4NHCL 1NAML 2R0KL 1HINH 3RWJB 5BJTB 3QCVH 3TCXA 5D1ZB 1MCWM 2XY2A 2DF3A 4ELME 5J13B 2GJ6D 5DVOA 1ORSB 4K94H 1B3JA 1NGYA 2VXSL 3MV9B 3N0PB 3F7PC 1A4JB 1SEQL 2PW1B 4ODTH 4UT6H 1U6AH 1QYGH 2B4CH 2F74B 8CGTA 3OKDA 3OB8A 3VFRA 1HNFA 1KB5L 5I74C 5JIKA 1C5BL 4RISH 4UB0H 4FFWD 3KYOA 3KHOA 4IRSC 5IVNA 1XGUA 5EZJB 5FV1L 2XOTA 4PRBA 1CK0L 3C08H 1F8TL 5SX4H 3LS4L 3CFKB 3ZE0F 3FQTA 3KYMB 2FATL 1JN6A 4APQD 3MRGB 3IDGA 4P49A 2J3SA 4J6RH 2P46B 1MWAB 4W6WB 1KCRH 4ZUVA 1NC2A 1HHGA 1YN6B 4OGYL 3TP4A 3WFCH 3KNBA 4PRHA 1T5WA 4Z7UF 1A7RL 1IGTB 3UJIH 1OTSD 1RFDL 2R1YA 3MLZL 1K9TA 4I3RL 4X5XA 3L5WB 1JZ3A 2IFFL 3CD4A 2IPUK 3H42L 3OAZK 1A1MB 4CVXA 5CEZH 3ARBC 4H5SB 5CP3A 4P5TA 2R1WB 4JR9L 1LO2H 3VH8A 3AREA 3TT1H 1KSRA 5DZOA 1J5OH 1MHPL 4W6YB 1MRCL 2DQEL 2N4IA 2ERJB 3MRFA 4OZFB 1UFUA 5F9OL 2BCKA 1N5YL 3RBGA 5IMMA 1T7XA 4PJAF 3HCVB 5I1LB 1PG7H 4N0UB 5C0NC 3SJVD 4HUUA 1KJVA 4N9OB 2IALA 3DV6B 4CN6A 3JUZA 4PJXB 4Y5YA 3ZDYF 5FGSA 1OAZL 5IBLD 5D1QD 2YBRB 3AAZB 2V7NA 4Z5RA 5DHYA 2ITDA 1KXQE 2F8VA 3OAZH 3O9WD 4UDTB 2WM0A 3QEQB 4HDIB 3GM8A 4HUWB 2NY2C 1WBZB 2YZ1A 3U0PA 3SCMD 5DJ2B 4PB9H 4KHTH 3D39A 4MXVE 4YHOH 1HHIB 3K7UA 1S3KH 3DO3A 4JANB 2UVFA 4Z7UA 1CLOH 3SGEI 4AK1A 1F4WH 4XPFL 2XWJA 4F7CB 1LP9F 1CT8B 5D70L 5KW9H 2Z35A 5FECB 5E2TL 5TF1H 4L9LA 4RGND 5EO1B 1UT9A 1BZQK 1QG3A 3QQ4B 1DUYA 1F6FB 5C07E 5LGJA 4GSDL 5IQ9A 3K2UH 1LO3H 3WD5H 4NQSA 3QCTL 5E95B 4LRIC 4WI6A 3ZDXF 4NZTH 3SBWA 3RTQC 3O45B 3BPOC 3GIVA 3R0MA 5HGBB 4PJAA 4OD2B 4O4YL 2H26B 4I48A 4DQOL 5FB8A 2Z9TA 5IQ7L 4LRNL 2V2XA 3VWJD 4QXWA 3QIBC 3MZGB 3P9WB 5ALBL 1F90L 3TIDB 4LDOB 3MV01 2GFBB 4QOKD 3KWWB 2XTJD 3GSOA 2HFEB 3OAYK 1JWMB 1KUMA 2EDJA 1MFBH 4QCIB 4Z8FH 1QO3B 1O0VA 3QXWA 3UJJL 1EGJA 3ILQD 4HV8A 3QHZH 3DO7B 1U36A 3KJ6H 3GBNH 3TIEA 2NMSA 4G3YH 5D96C 1FH5L 3GDBA 4R7DB 3UTZA 2DYPB 3BPCA 3K4AA 1MEXL 3C60B 3MCLH 2DKMA 4LLMA 2H2PD 3OX8B 3ULVL 5KSAC 4L8CA 3QFJE 3SE3C 1LP9A 3WIIL 2BNRB 2E7MA 4D0BB 4GUPA 2IGFL 3VMPA 3O6LL 4X7EC 1TPXB 3MGTA 2DQFA 4G6KH 2Q7YB 4QXTA 3GMRB 2ED8A 4PJBE 1XZ0B 2AK4D 5DTFA 5J6GA 3G04A 5DO2D 3QEUB 3QUXD 3DETC 4G7YH 3GSQA 3VXTA 5JNYB 5E2VL 1SM3L 3OAYH 1A6WL 4XP6L 3DSFL 1MCBA 3TO4B 2DMKA 3O0RH 4HIJA 4FZ8L 5EUKB 5I66B 4XXDA 4PJDF 4TNWK 3LOWA 3NIGE 1U42A 4LSSH 1QFHA 5DHVB 1N6VA 5D93C 4WNQA 5BMFH 3K0WA 1K4DB 5CEZE 2WUBH 2BVOB 3WYRA 1KLGB 4JZNB 2CDGA 3G5XA 5D2NA 1J88A 1F3JA 5KG9B 2VQ1B 4KI5D 3LQAH 4P46C 3UDWC 5C6WH 2QHLA 5B39A 4CW1A 3RBSA 3NCCB 3D2UB 5DFWH 2H9GB 5GRXG 3OKNB 4HIEA 4ODXA 4WHCA 3MJ9L 4X6CB 5BRZB 4U1JB 3QPXL 1YEGL 4U3HA 5E7FA 1PEWA 2AXGB 2YR3A 2DM3A 4NO0A 4M62H 3WHXB 4RMUA 4LPYA 3PABA 5C9JB 1MCOL 1OLLA 2OP4L 4MMXC 5I18H 1GCFA 5ICZA 4KJYA 5ICXB 2LVCA 1XGPA 1GGBH 4E41D 5B4MD 4OLVH 2EYRB 4Y4KA 4DTGH 2D7TH 3GMPB 3QZWG 2EYTA 4M6MH 4PJEA 1DSFH 1P9MA 2ZUVA 5E8NA 5KANI 3S88L 5IV2B 2BVPB 4U1MB 5I9QC 3QSKB 3PF2A 1RUML 5FFLA 2A9NL 3TZVC 3KPRE 4JVUA 3EJJX 4PLJD 3I85A 2QQNH 3B2UD 2OR9L 3UC0L 1RZJH 4W68A 1KENL 3QDGA 4KTEH 1NAKH 5GSVB 1QQDA 2X5PA 1T83C 4O9HL 1IFHH 4NDMA 1G9NC 5CUSH 3T2NL 1HE7A 3LB6C 4U1IB 1CFVH 4OI9A 5CGTA 3V6OA 1H0DA 1I8LA 4LVHB 4DKFH 2HJLA 1KCUL 2E3VA 5CZKA 2Y5TB 4EOWH 1JIBA 4LLVA 1G7IA 3BZ4B 2CKBA 4GKSB 3FQNA 3WFHB 3T2QA 1MCEA 1GL4B 3P9MA 4PV8A 4FQIL 3RI5K 2GTWB 5HYJA 3KDMB 4HC1H 2DIBA 1P7QA 1YPZE 4LIQE 4LSVH 4GMSH 5TE7H 3MV8E 3REVA 4YHNA 3LPWA 1X6LA 4OLEA 1FZJB 4P59H 2WNGA 4JKWA 4TTDC 1SEBA 1UVQA 2HWZL 2IC2A 5CJQH 3A6OA 4KUZL 3LS5H 2YPLA 5KS9F 3Q3GA 5T1KD 2Y5EA 1VCAA 1I3UA 3BZFA 3P4NA 4JHWH 5E1AA 3U4BL 3H6JA 2HT2D 1KELH 4EUPA 5HYEA 1ADQA 2VYRE 1BX2A 3C6LA 5KOMC 3T1WA 3O4LD 1R5IA 5TGBA 1TTFA 2F9BT 1FE8H 3P30L 3GRWL 3MRDA 4FP8L 3KJ4C 1B9ZA 2I9TA 4GW5B 4EIGB 4ONGH 3RIFK 1E6OL 3VA6A 2EXWD 5I75C 4GS7B 1HKFA 4WW2C 1QRNB 5I1HL 3MA7A 4WRLA 1BF8A 4C83B 2HVJA 4HKXB 1CD0A 1BBJA 3QIUC 1HINL 5FA4B 3QCVL 3UYRH 2OZ4H 4LLYA 2BNQE 3GKWH 5GS3A 2G2RA 5I19L 4PJHF 4O2CA 4PJGE 1KC5H 4K94L 3ARGB 1T7YA 2JJTC 2ADIA 1S78C 4JFFB 4WW1A 4ODTL 4UT6L 5F7NC 1NLBH 3AMLA 3RWIB 1U6AL 1QYGL 2A73A 2B4CL 3HZVA 1JHTB 2X7LA 4OV5A 5C09A 4UB0L 2F53A 4ZPVB 1EERB 1SY6H 1I8KA 3C08L 3EYQC 1CZ8H 4G8IB 4JGMA 4MAYD 1WZKA 4ODHH 4Y4FD 4J6RL 1X5GA 3B8SA 1JPST 1KCRL 3EYOB 5JW4N 1B0RB 4L4TA 5DMJB 2NX5D 5ITFA 2LAGB 2NZIA 3WFCL 2LAAA 3RJQB 5MEOA 1QLEH 3OKEB 2NXYB 2Z93A 4XBPB 3UJIL 2PW2A 5IR1A 4X9IA 1CXLA 2VB5A 4IIQB 4PJ9D 3C9NB 5CEZL 3I3DA 2EH8H 5GS2D 1T2JA 2X89A 5IF0A 4I9WE 4P3DA 4TUJB 1FZOA 4G6JH 4NKDA 1JGDA 4KK5C 3UMTA 1ZSDA 4OFDA 2Q6WA 1LO2L 3TT1L 4IOIA 1FZKA 1J5OL 4QYOB 4G8GA 4HWZB 1Z3GH 4OIAA 2ZCKH 4L4JA 5CLTA 4OBSA 4Y5VB 2X44D 1XF4A 4G6AD 2Z31D 1CFTB 2VC2H 5F9DC 3WXWL 5T33L 2ZUQC 1AO7D 2VKWA 3VWKA 2PF6A 2UV3A 4PJHA 2C3GA 4Q6IB 1PG7L 2VZVA 1FYTA 5HDBF 3SGDH 2DTSA 4Z7WB 4G9DB 4GAYA 5FO7B 1GZPA 5DRZB 3MNVB 3U0WH 3HUJA 4R97B 3RZCD 4KMLB 3BH8A 4ZNEA 1WIOA 5IIEB 2GUOA 4N8VG 3MRJB 2RAMA 4L29B 2YA1A 2R0LH 3QISA 4HWNA 2Y06H 1ZK9A 5FDYA 1QACA 1CFNA 1E4KC 3STLA 4PB9L 4YBQC 4KHTL 4BFIA 4YHOL 1S3KL 4FTVD 4OI7A 1CLOL 1F4WL 3MA9H 4L8BA 3VXPB 5ANME 4MNQA 4ORGA 5KW9L 3QQ9D 5SWSB 4I18C 3HS0B 3RJDA 5TF1L 4MNGA 3DMMD 5MEQB 1T0MA 1QFOA 4OF5A 2W91A 5EPMA 4JFDE 4NO2B 3K2UL 1LO3L 3FRUA 4UUJB 4MQTB 3WD5L 2DL9A 5FO8B 3B4NA 1S9XA 3QUYB 4HFWB 4AIXA 4NZTL 5K9OA 5EC1A 1CLYL 5L2KD 3NN8A 1FFRA 3W39A 3SDAC 4WY7H 1T7WA 3S6CA 3CZFA 3QB7C 3ZLQC 3G9VA 2VL5A 2X4TA 3HR5A 4HPYH 5D7IB 4GBXD 3ZKXC 3B3IB 4NZJA 1P5VA 1NDMA 1G6RH 3UZVB 5IKCB 2EECA 3BKYH 3VFMB 5F7FA 4URTB 3PWLA 5IT2H 1AR1D 3E6HA 4OCWH 3AU1A 5IVXF 1MFBL 4LHUG 3CAFA 1UJ3A 2CRYA 2BRQA 3DTXA 4Y1AD 3IDNB 3QHZL 3VD3A 3KJ6L 3GBNL 4IMLB 4JRYB 4L3CB 3DNKA 4UTBH 4G3YL 5HJ3A 3QIWD 3QI9B 2DKSA 4TQEH 1CGSH 4YAQA 3MCLL 4JKMA 1RZFH 4AT6A 5DJ6B 5C0FA 5CJXC 3BDYH 1HXMA 4FRWA 3HMXA 3KAAA 1WUNT 4Y5XB 4FA8A 4F2MB 4MCZB 4ALAH 5EFIA 3ECBB 4G6KL 3VXMA 1LD9B 5TPWH 1OGAA 1U92A 5HGDA 2AVGA 2E7HA 3O81A 1MLBA 1RU9H 5HYSG 4ZQKB 3SQOH 1ERNA 4KJWC 4OFPA 1U3HD 3BVNA 1CI5A 5DF0A 1NSNH 4G7YL 5K9KB 4E5XA 4UAOC 1TVHB 4R8WH 4KK8C 2XKNA 3O0RL 2HKFH 1XIWD 2VQTA 3CVHH 3NZ8B 3QBTB 2O93L 4LSSL 5BMFL 2WUBL 5KVMC 1NC4A 4J3UA 1IZKA 5C3LD 2RGSA 4OLUH 4U6TA 5TJWK 3RKPA 5IHZA 1FSKB 3C2AH 3VFGH 3ILPB 4N68A 4JM2A 1JGLH 3LQAL 3ZMRA 6CGTA 1M7DA 2NY5H 1NGXB 3U79A 1J86A 1IMHC 1UC6A 2PO6C 4HIHB 3FT4A 3ARSA 4OIBA 2OL3B 1DQMH 3N1QC 2ARJQ 4Z18A 3IDYC 5DK0A 2VXUH 1CE1H 4N0FB 1T20B 4I2XE 1KEMH 1T0NA 4PG2A 4LLDB 5BS0B 2CLRB 4L8SA 4M62L 2VWEE 1YNKH 2ZNXA 4X4YA 3DUUB 3UTTB 2H3NB 4YO0A 1DBAH 5I18L 4WGVB 3G5YA 1I85A 1GGBL 4PJ5D 5AWNH 1MCRA 4UT9L 5FKPA 4OLVL 1RZ8B 1LDSA 4DTGL 2D7TL 4XBGB 1DR9A 1PG7W 4GRLC 4M6ML 5MHSD 2JJVA 4JDVB 2CDFA 2GHWB 3H7BA 4JQVA 2CIKB 5IFAH 2NY4D 3OBAA 2QQNL 3GZKA 1RZJL 1CXEA 4R4FH 2NY6C 3BN3B 3V2AR 1NAKL 3AS3A 5E8OB 4BQ8A 1IFHL 3VXRB 1RZKC 5CUSL 3RPIB 1CFVL 5ESAB 1QSVA 4DKFL 2ZJSL 3HLAA 1X6NA 2EKSA 2PYEE 4EOWL 1PYWA 5FKAA 1T6VN 4EI5B 1CLCA 4FQXA 1IAII 1P5UA 5T3ZD 5J8OA 3RWGB 1N59A 4JZJA 5C0AB 4HC1L 5DEGB 1A1NA 1KLUA 1DQQA 4LSVL 4GMSL 1C8PA 1FNAA 1RSFA 5LGHH 3CSPA 3VFSA 4LCYA 1OTUD 4NC2B 3E6FB 4P59L 2HVKB 1EPFA 3MLUH 1MUJB 2X70A 3QT2A 4MXQD 3U7YH 1HNGA 5CJQL 1T2XA 5MI0B 3KYNA 3LS5L 1U8OA 1RJYA 4WFEE 1YEFL 3KLAB 5J4MA 3F5WB 1BFVH 3BT2L 2VO5A 3KPSA 4PGEB 4MA7L 4JHWL 1QBLH 1KELL 1S7UB 3D0LB 1NBVH 1HK6A 4NQDA 2AJZB 1Z9SA 1EMTL 5FIEA 3IDJA 3VXUA 3B9EA 4OZ4B 1FE8L 1EX0A 3D85A 1MI5D 1OWRM 1NGYB 4PGBA 4M7ZC 3FMGH 5HHVH 3W81A 5HYQB 4ONGL 3OR6A 4ZUUA 1T66C 3IF1A 4WDIA 2C1OB 3OKDB 4OF0A 3VFRB 3GSVB 2X6MA 4DK3A 1K5NA 3U9UA 2I60H 4X5WB 1OB1A 3X14A 2MOVA 1XGUB 3UYRL 3S37X 4PRBB 3VI4E 1PQZB 2OZ4L 4CDGC 3GKWL 3VFNA 1KC5L 4V2BA 3FQTB 1NKRA 1JN6B 5FHBH 4EBQH 3UXFA 3EJZC 3IDGB 4FQPA 1V3KA 3TVMA 2AK4E 1VB9A 5IBUB 4ZUVB 3ULVC 1NLBL 1NFKA 1KV3A 3KNBB 4PRHB 1T5WB 3TYFA 1QHPA 3D3VA 4EN3A 4WO4A 5A2KH 2O5ZH 3RZWA 2N7AA 4N0UE 2XTLA 1SY6L 4X5XB 3PHSA 1IM9D 4CVXB 3RWCB 1CZ8L 1I1AA 4HCRH 4P5TB 4CBPA 5IW1B 4PJXE 2VITA 1WTLA 1I1YA 3CX2A 1GC1C 3VH8B 1KACB 1I9RH 4KI5E 5IUSA 4PYHA 1QLEL 2B1HH 4UINH 3MRFB 1AQDB 1E4XI 1DQJA 4PLOB 1KJ2B 2K7PA 4YIQA 2A83A 2FSEA 5IMMB 1VPOH 2EH8L 3RGHA 4N0YH 3CX5J 3PXJA 4OUUA 4I5BB 1KJVB 3B6SA 3LRSA 4G6JL 3VMNA 2C7UA 1FNGB 4ZTPL 3DJ9A 4MD4A 1X3DA 4Y5YB 2H8PB 1Z3GL 5DJ8B 2ZCKL 2Y07H 5DS8B 5EN2A 3DXAA 4MJ5B 4E41E 2RFXA 4PB0L 1JHLH 1OW0A 1C7SA 4Z5RB 5I1JH 5DHYB 2VC2L 4I0PC 3H9SB 1EFQA 3ZE2E 4MLSA 2MMXA 3T3ME 4TVPD 2P47B 4NN7B 1YEIH 3HAEA 1FAKT 3U0PB 4LQ1A 4XI5C 3HTLX 3U0WL 4PY7A 3D39B 3ZKSD 3BMWA 4Z7UB 1H3XA 3GI8H 3VG9B 4LCIH 1XF2A 2FEEI 3BIAX 3JV4A 2XPGA 4MJ6A 5I30H 1AKJD 5B8CA 4ZDHA 2IANA 3F8UB 5HPOA 4QRUA 2NY3C 4N1EA 1D7FA 2R0LL 4R0LC 5BZWA 3QUZD 2IBZX 3PXHA 2HG5A 2Y25A 1I8IA 3LKSB 1NCWH 4R2GB 2Y06L 4J1UA 5ECJE 4HX1B 4YXLH 4LAQH 1DUYB 5JPMA 4CRPA 3N9GH 3L3OA 5DHXB 5LGJB 4NQTA 3RX5A 5IQ9B 4NQSB 4Z78A 1QFPA 5JZ7D 2EDOA 5J06A 1TETH 2Q8BH 3MA9L 2EZ0D 3HE7A 5CD3B 1SBBA 4KY1H 2Y1VA 4XWGL 1KXTB 5EU6B 4PJAB 3ARFC 2DTMH 5FOBA 4NRYB 4XGZA 3T65A 5I1GH 5IK3A 4I48B 2FIRT 5FB8B 3BP4A 1ZT1B 2PXYD 1XMWA 4NQEA 3VXOB 4YNYA 5ID0A 2V2XB 5B3NA 3IU3B 2R2HA 1HZHH 4NQCD 2J8OA 5A2IH 1T04A 1AXTH 3BQUA 5HD8D 5ICYB 1G7LA 4WY7L 1OP5K 3BH9A 4IEFB 5JOFA 3MYZA 4HPYL 5F7UA 4NM4H 4ZOAA 1F45A 2ZUTA 3TIEB 3K81A 1G6RL 3MBEA 1K6QH 3BKYL 3Q5TA 3PWPE 4XHJC 4GXUN 3UTZB 3BPCB 5D7KD 5IT2L 2V2WB 4LLMB 1X5KA 1GGYA 5FAAA 4L8CB 4OCWL 1LP9B 1JTPA 3L9RB 4GUPB 3BPNB 1DBJH 4Q9CA 2DQFB 2A6JA 2Z8WC 1RD6A 4OGAC 1CXKA 5DTFB 5J6GB 4UTBL 2ICES 4TQEL 3VXTB 1CGSL 3BESR 3BPLC 3MUZ1 5TE6L 3S36X 1RZFL 3K8KA 2D9QB 4D3CH 3BDYL 4HIJB 5BRZE 4XXDB 3TFKD 3LQMA 2N7BA 1KB5A 4UQ3B 1OP5H 2EDXA 2XG5A 3ARPA 4S1QH 5TPWL 2E8YA 3HPJA 3S37H 3VDBA 1RU9L 1MJJA 2ZG2A 4P2OA 3SE9H 3SQOL 2CDGB 2BRRH 2WBJA 5D2NB 1F3JB 1S7WA 1NSNL 4HFUH 4QXGH 3VD7A 4C56D 1FDLH 4RMQA 2JCCA 4OZHF 5B39B 4POZC 4CW1B 5ADPH 2WV3A 1ZAGA 5DJZB 3TA3A 2HKFL 2NY0B 1RZ7H 4XT1C 3CVHL 4XPHL 4HIEB 1NKOA 3Q1SH 4ODXB 5IMKA 3O8XA 3NFPA 4QTHA 2UWEA 4GG6E 3T04D 4NO0B 4OLUL 4HXBL 4LF3A 3R8QA 3C2AL 3UTPD 3VFGL 3BOVA 2VR5A 4KJYB 2XZZA 2NY5L 4KKCC 3LEXA 5CEYB 3TBYA 3ULUD 1OP3K 3RWDA 4D94A 3THMH 4GW1A 3ALWA 3ZDZF 3RA7L 1DQML 2AERT 2NR6C 4YUEL 3TBSA 5E8NB 1FO0A 5T5FH 2VXUL 2BHZA 1CE1L 5ESQA 2ESVD 1DE4A 5CGMA 4F37F 4P57A 1YNKL 5J1AA 2APFA 5FA3A 2DWEA 1L9NA 2ILLA 1Z9LA 3ARDA 1DBAL 1IL1A 3VGAB 4YZFF 2DQDH 1YMMA 3QDGB 5D9SB 1QQDB 5AWNL 2OTWA 5FYKD 3F65A 4DJMA 3P40A 4PJDB 2FL5A 1H0DB 1ETZA 4Y19D 2HJLB 1ZT7A 4S1SH 4LLVB 4LVOC 2J5LB 1G7IB 5IFAL 2CKBB 4JFED 2JELH 1GGCH 3FQNB 3P9MB 1DZBA 1HSAB 1P4BH 5HYJB 4R4FL 4GQ9H 4XCEA 1P7QB 3GMOA 5CBAA 3AVEA 3MLWH 1IGYA 1KNOA 2GTZA 3MQIA 2NW2A 2VLKD 3REVB 4YHNB 3ULVF 3G9AB 3VXSA 4QHNA 1EEYA 4YHPA 2QTEA 2EDRA 1SEBB 4XC3H 4M1CD 1Z0NA 2JTDA 2YPLB 4K3DH 5GS1A 3ET9F 1QRNE 4X6DF 3H3PH 1NCDH 1SMOA 3PDDA 1A6AA 3BZFB 4YHIA 3VW3L 2FZ3A 5E1AB 1MCNA 5T3ZH 4EUPB 3DARA 1WEJH 2WBKA 5MEND 2VZOA 2OQJA 1BX2B 3C6LB 4AL8H 1I7ZA 2FECI 5EBWA 5LGHL 1R5IB 1WK0A 1FV1A 3IDXH 5TGBB 5IFHH 3BP7A 3NCFB 1NLDH 5IGXH 2QSCH 1MJ7H 5L2KE 3MLUL 3U7YL 3MRDB 2NXZB 2IEPA 2PCPA 4Z6AT 1QSZA 3L5JA 5F9WC 3G6AB 3INUL 2OJEA 2VISA 3ME0A 5E24E 1FZMB 3QRGH 3V6BR 4P23B 2ZUWA 4YHKH 5SX4I 1QBLL 4NGHL 1H3PH 1J9CT 2J1KA 3ELAT 3MA7B 4CU7A 3BKMH 3RVXC 1P4LA 2HVJB 4JY4B 2N56A 1IGCL 4U1KA 3Q2CA 5C0BD 4A2LA 3QH3A 2CUIA 5I74B 4LLYB 4QT5B 5KVEH 5J3HC 2G2RB 4J3SA 4O2CB 2I25N 4IRSB 4GXVH 1CTNA 1CICA 4LMQI 1P6FA 3V0WH 4FQCH 5HHVL 4F58H 4WW1B 2NLJA 1Z9MA 5FGBC 4N1CA 5A3IC 4QRTA 2A73B 4GOSA 3CXHK 4BQCA 2X7LB 3TN0D 5C09B 2I60L 3NCJH 2EDKA 2MCG1 1MQKH 2F53B 3BWAB 4LASH 1EJ6A 5E5MA 3HC4H 4D9RE 3L1OH 2VXVH 3GJFA 2C4FT 5KS9B 4Y4KD 4X6DA 4EBQL 5FHBL 4WI5A 1YEKH 1H8NA 4L4TB 3FAWA 1DJSA 5MEOB 3RGVD 4ZXBC 3TV3H 3RVVD 3S36H 2XYCA 2Z93B 2O5ZL 1YQ2A 2PW2B 3FN9A 4ZOEA 2V9TA 4F3FB 3MV9D 2BC4A 4FMFA 1FVCA 4Z7WE 3PHOB 3TESA 1Z5LA 5IOPB 1CF8H 4CJ0A 3BYTA 1TIUA 4P9HH 4HCRL 2FIKB 2UZIH 1AFVH 4U1NA 1FZOB 1Z6JT 4JG0H 2Z92B 1UGNA 4NKDB 2Q6WB 4F57H 5EZOH 1FZKB 5ITBH 1D9KA 1NGQH 4G8GB 1R3HA 2AGJH 2B1HL 4UINL 2EYSA 2OLDA 1XF4B 5J9PB 4LDLB 5EOQH 4UV4H 4XB8A 5EG6C 1PSKL 1WAAF 3QDMB 4PJHB 4PRPA 3VG0H 1JHKH 3FFDB 1FYTB 4UV7H 3LKQB 5EUOE 1DQLH 4YFDB 2P49B 4NNPH 1QLFA 1GZPB 3U7WH 4LFHG 2Y07L 3QRFM 5SWSE 3BH8B 2F54B 2GUOB 2AP2A 3RKDC 1JHLL 5I1JL 3JWDH 1NFIB 4XCYA 1VFAA 3OXSA 4ZAKB 1NUDA 1O5DT 4P2YA 3X3FH 3S7GA 4MD0A 4KVCH 1N7MH 3AB0B 1YEIL 3SGKC 2W07A 5JXAH 3STLB 4KRNA 4TVPH 4JPIA 4CADA 2E27H 4CVZA 4BFIB 4LSDA 3CFJA 3UPRA 3GI8L 5JW3H 4LCIL 3KG5A 2V9RA 5J12C 1MSPA 4L8BB 5DUPH 4FXKA 5I30L 5D7IE 4MNQB 1MIEH 1EEZA 5IJVA 5GJTL 2P5ED 4BFBD 1VADB 3BPOB 4MNGB 1J05A 1NCWL 3GM0A 3TPKA 1T0MB 2ED7A 3AC0A 4LAQL 3N9GL 2GQHA 3ARRA 5EPMB 3FRUB 3G6DH 4MQXD 1TETL 1S9XB 5D7JD 5DA4A 5GZND 3PJSB 5K9OB 5EC1B 1U8MB 3NN8B 5F8RC 3W39B 4YHYC 1WAAA 3Q5YA 2XQBH 2WANA 2X4TB 2VL5B 4PRIB 1FC1A 3HR5B 3WS3A 5IJKA 1NDMB 4NO5B 3OKLA 4WI9A 1GGIH 5HHQA 1V3JA 4HD9A 4PLNC 1HZHL 4DKEL 4QXUL 4JG1H 1IZJA 1AXTL 4J8RA 4ZUWA 4H1LG 5SWZA 1IC1A 5DWUH 3O3BA 3JVGC 3DTXB 2C3WA 4KWUA 5INDB 4Z7OE 1CGVA 5FDWA 5IFJA 3ISWA 5F6HI 3JZ7A 4NM4L 3BGMA 4P4KD 3GRWA 5HJ3B 4U7KA 1K6QL 3MRLA 2JLLA 4B7LA 4HGWA 5LGKA 4YAQB 3SE4C 5KTEH 2D7MA 1P6AB 4MDJA 4AT6B 4JPKL 5C0FB 3NIDE 4LPUA 2FEDD 5AZEH 1EVUA 1HXMB 3S35X 2GSGA 2DJUA 3PL6D 5EFIB 3VXMB 2VLRA 3EFDH 1OGAB 3RY6A 5EU7E 1U92B 5HGDB 5I17B 2JJUA 2MCPH 5D93B 4KKLC 2R8SH 2UZYB 1LO5A 3HNTH 3HZMA 2OTUB 3BVNB 1BVKA 1LGVA 4JGJA 4IOFD 3HNVH 5LVEA 4LVEA 4NFBA 2XKNB 1AGDA 4D3CL 4P46B 4X9GA 3L5IA 4Y16A 3LKPB 4U1LA 1A6TA 5BS0E 4S1QL 3QHFH 3S37L 5BOPA 2EDQA 3UTTE 3QEHA 3UAJC 2DYPD 3SE9L 1NBZA 5IHZB 2BRRL 3ZTJG 4DUXA 4LSPH 1JP5A 1KN4H 4HFUL 4QXGL 1M7DB 3CFCH 1FDLL 1WCQA 1UQSA 2IBZY 1F4YH 5DI8A 2EIBA 4KUCF 4YFLF 5ADPL 3FT4B 5IVXB 2FX8H 4JRXB 4YPJA 3RHWF 5LAXA 5IEKA 4YWGH 3OHXA 3Q1SL 5DK0B 3PP4H 4YK4C 5CJ5A 3DWTA 5CGYD 5CINH 4XXCC 4HJGA 1BFOB 4L8SB 1A8JH 1XR9B 1CXFA 4X4YB 2GEEA 5I9QB 4YO0B 5I0DA 1QA9A 3SDCB 3G5YB 4QRRB 5IVZA 3RY4A 1B2WH 3LQZA 1I9EA 3OG4B 4P0DA 5DJYA 5DJ0A 5EH1A 3THML 1ZE3C 5HHOA 2MHAB 3ULUH 5AD0A 5T5FL 2CDFB 5DRNA 1MJUH 2ZUYA 4RZCA 5GGQH 3WJJC 2X4NA 2DI7A 4MSWA 1HH6A 4X7TA 1J8HA 4F8QA 2BSSA 2BVQB 2LV4A 3WSQH 5GGRY 4Z7VA 5C3TA 2DQDL 3K4DA 3EDDA 3BRDA 4FOMA 1JRHH 1J0KA 2IADA 2JB5L 2V5SA 1R3IH 1GSMA 3R06B 4G80A 5FYKH 5EU5A 4S1SL 5GRVK 3HLAB 2EKSB 4MJIA 3GMQA 5FKAB 4PJ8A 2JELL 4FQXB 1GGCL 2VWEC 3N85H 3WFEH 1P4BL 2BDNH 3ZYOA 3MTRA 4GQ9L 1A1NB 1UH3A 3MLWL 3K8LA 1EHXA 2GI7A 1DQQB 5HDLA 1DVFC 5E4IA 1YEHH 3VFSB 5F6IB 2VRAA 1M6OB 4HKJA 2WINB 2FGZA 1OM3H 4X80H 4XC3L 5ACLA 4F33B 2P1YA 3KYNB 5F93C 4RGMC 1U8OB 4K3DL 1RJYB 5ALCH 3H3PL 1NCDL 2Y36L 2AW2A 2YK1L 3WLBB 1Q9OA 3KJ4B 1A9EA 4Y7MA 3KPSB 3DI3B 2FBJH 3MZTA 2IBBA 5F44A 5T3ZL 1EO5A 1WEJL 4ODSH 5I75B 3CX5K 5BW7C 2XXMB 3IDXL 1QSEA 3IDJB 3VXUB 5IFHL 1NLDL 5IGXL 2QSCL 1MJ7L 1QSFD 3D85B 1Y0LA 1AD0A 2V17H 4PGBB 1TZIA 2XV6B 3HE6C 1FGVH 4ZFFA 4PRHE 3QRGL 5JIHA 2A74A 3OR6B 4MS8C 4ZUUB 4YHKL 4HLJA 1H3PL 1NC4D 4Y4HD 3BKML 1U8HB 2DD8L 1K5NB 5FOJA 1A9BA 3X14B 5J13C 5I1DA 4GAFB 3U6RA 3LN4A 5KVEL 1NCBH 1WC7B 2AJ3A 5K33A 2W0PA 3VFNB 2PTTA 3RL1A 2OMBA 4GXVL 2FX7L 4KK9D 4N8VA 1G7PB 3V0WL 4FQCL 1LEKA 4F58L 3TNMA 1NBYA 2LU3A 2QKIA 3LEVH 3UTSD 3TYFB 5T3XE 1LE5A 1YA5A 3D3VB 4EN3B 4WO4B 2BHUA 5CZXD 1HCVA 4LASL 4TNWF 3S35H 1KEGH 1URLA 3RVUC 3HC4L 4OCMC 4WJ5A 3L1OL 4P2RA 2VXVL 3L5XH 2P42B 2ZCLH 3ILQC 1I1AB 1T4KA 4NOFA 1I3VA 1YEKL 1MIMH 1TQBB 2F58H 4HH9B 3TV3L 1ZS8A 4HUKB 3TC9A 3GSUA 1DQJB 5E9DD 3SKJH 3ZE0E 3QXAA 4YIQB 2A83B 2FSEB 5T1LB 2HTLC 7CGTA 3ZE1F 4OB5L 1CF8L 3S5LG 2V7HA 3F58H 2ZUQB 3D39E 2UZIL 4OUUB 1AFVL 3MGOA 4Z7UE 3LRSB 2DJ4A 3L3JB 4JG0L 5F7DA 4E0RB 4F57L 3H9ZA 1LWRA 2PR4H 4K8RD 2ERJC 5EZOL 4MD4B 1NGQL 5TDPA 1QR4A 5EN2B 2JF1A 2AGJL 1LNUA 1S5HA 2BVUA 3DXAB 4PFEA 2DKUA 3GUTA 4HS6B 1J1OH 1CGXA 3CFDA 4NYLA 4UV4L 1FIGH 4AMKH 4O5LL 3VG0L 1JHKL 4AENA 3FB5A 1SYVB 3HAEB 3MFGB 1DQLL 2VLJA 3CDYA 2BK8A 4NNPL 3U7WL 4PY7B 1IC5H 3R4DA 1JPGA 4QTIH 5EO0A 3QUMH 4KI5C 5HPMA 1XF2B 4PJAE 4YC2B 5I2IA 5KJRH 2YD5A 3JV4B 4MJ6B 1AHWC 3MMEB 3DGCR 5B8CB 3JWDL 2IANB 4ZDHB 4XRCA 4QRUB 2NZ9D 1R3KA 3EZ8A 2JIXB 4J12A 1ZGLP 1VFBB 4M61A 5BZWB 3NFSL 5JHDD 3B9DA 4KVCL 3TCLA 1N7ML 1I8IB 4F7MB 4ZPTA 4J1UB 2CXKA 4NQDD 1YEDA 5JPMB 3WE6B 4C57C 3L3OB 2W0KA 4X6BA 5JXAL 3KYKH 1ADQH 4OCYH 1G7MA 3GB7A 2E27L 4Z78B 4ORZC 3RVWD 3KHQA 1FCCA 5JW3L 3HE7B 1ZHNA 2H41A 5DUPL 4DGYH 4HUMB 1BQUA 3LIZH 4LSTH 2IH1A 1MIEL 4LCWA 1UEYA 2QADB 4X6EA 5FOBB 3T65B 4MA8H 3EHBC 5IK3B 3C5ZD 4ODUA 4G9FD 3SGEH 3BP4B 4KDVA 5F7KC 3IAQA 4OF8A 4YNYB 5ID0B 4RWHA 5EIVA 2VZSA 2AJVH 4J4PA 2R2HB 1LP9E 5F1NA 4RFNB 1T04B 3CXDH 4HC1A 5BV7B 2KL6A 5E00A 5C6PB 1GZQA 3BQUB 1KF9B 1U8KA 1G7LB 1N64H 2JK5B 3TVMD 1NJ9A 2CLVB 2Y72A 3N06B 2ICEA 2XQBL 2K1MA 5JOFB 3VCLA 2XI9A 3MBEB 1GGIL 4TTGA 1OAXH 4L8DA 4GXUM 5IEHB 3I3EA 2F15A 4R4BA 4JG1L 4RA3A 2DOCA 5C0CA 4UU9A 4JHZA 4FS0A 2HLFC 1IKNC 3TO2A 4K9EC 2X1XR 3FQWA 2A6JB 2OR7A 1NAMB 2XQYK 5F70A 2E9JA 5D2NE 3ZYJA 5T1DH 3TWCH 4WWKA 3S4SA 1U8IB 3C60C 3FB8A 2R2BA 4UIKH 4HWBA 3QO0A 1XF3B 5KTEL 2VTFA 3L3IA 1TPXC 4Q9BA 1AP2B 5TF0A 4D9LH 1XCTA 5AZEL 1WSST 2HT3D 1KB5B 4B50A 1U8QB 3EFDL 3PWVA 3HPJB 2PYFA 1SJEB 1FFNA 1MJJB 1QP1A 4U05A 2OZ4A 1NGZB 3MO1A 4HIIB 1W2KT 5AAWA 2WBJB 3HNTL 5E6ID 4K2UH 1A21A 1S7WB 3TO4C 1AR2A 3CFBA 4PJEE 2GJ6A 4A6YH 1MCIA 2X1OA 5E08H 1INEL 4EZMA 2H6PA 3TA3B 3ZZ1A 3MRMA 3B2VH 2CUMA 3L6FA 2FWOA 3IDIB 3NFPB 4IRJD 3QHFL 4NQUA 1SY6A 2D7NA 2X2YA 3E3QE 4WV1A 4JVWA 3WUWA 5DD5H 3QDGE 1IAOB 4UI2A 4LF3B 1A3RH 1NDGA 4PJCE 1U0QA 1RAMA 1OLZA 4LSPL 3SKNA 1KIRA 4PREA 1KN4L 4MVBC 5C08D 3PQYD 3LEXB 1F4YL 3V6OE 5GRYA 4GRMB 2FX8L 4L4VB 4NP4L 3TBSB 2DICA 2VE6B 5JXED 4GKZA 4LLWA 3IFLH 4YWGL 2X9WA 4MA3A 3PP4L 4U7MA 4GRLB 5ESQB 5CINL 4CMMB 2FCBA 3RWHB 5HYJE 4ZFOA 5J1AB 4ZO8A 1YECH 5FA3B 2E6QA 3W0WD 3ZT6A 3MODH 1IL1B 4IMKA 1YMMB 4NKMB 1MHEA 1LEGA 1QHOA 4OT1H 1B2WL 1YNLL 2OTWB 43CAA 2YMXL 1WZMA 4BUHA 4O58H 3WLWD 4NWUH 3NH7H 5JR1L 1DN2A 2FL5B 1E28A 1MCSA 1ETZB 2YPLE 5L6YH 3M1BA 5GGQL 4MXWH 5E2JA 1KTLA 3TBVB 3PP3K 2C26A 2OBGA 3Q6FA 3WSQL 2EXYD 4YR6B 3GMOB 4HLZH 5CBAB 1KNOB 2GTZB 4OZHB 2CSPA 4LVHC 4XP5H 4F9LC 5FYLE 2QR0B 5DQ9B 2BNUB 4K3JH 3SJVA 3V4PH 3VXSB 4QHNB 1R3IL 2CUHA 1EEYB 8FABA 4YHPB 5FYKL 3UBXI 5L8KB 3B9KA 1FGNH 4S1DD 1PLGH 2XWTB 5D1QA 4WTZA 5GS1B 5B38A 5F8QC 5CEXA 3GSRA 3N85L 3WFEL 1KCLA 1TDQA 3O9WA 5C0DA 2GK2A 4R26H 1A6AB 2FZ3B 1MFEH 4PS4H 4IJ3B 3U36A 3PGCA 1YEHL 3SCMA 1FV1B 4JFYA 1GYAA 1K8DA 3BP7B 1XGYH 5TDOA 1C08A 2DQUH 4X80L 3PP3H 3H0TA 2PCPB 3T0DA 5TQ2H 4X9BA 1MFCH 5ALCL 2OJEB 2VISB 4R9HA 5DZLA 3GHEH 4AJ0A 4I0CC 5HI3C 2GT9A 2FBJL 2VZ1A 5C09E 2BHYA 3HMXH 2F53E 1SJHA 2E7LC 4ODSL 2DLGA 2Q86A 5GS0D 4Q74A 4P2OD 4U1KB 1F42A 3TBTB 1T3FB 1BAFH 5D6DA 1JYNA 5ACMA 5DLML 4R4ND 5C0AD 4GS7C 2V17L 4L4TE 4FQ2H 5DMIH 1FGVL 1WFNA 5JW4R 1C5CH 4AIZB 2YA2A 3PDOA 1HCFX 3RPKA 1J0IA 3O8XD 1L7TH 5SWQA 4QRTB 3T09A 1IE5A 35C8H 4X7FC 1BQHA 3QQNA 1A1OA 1X4XA 3JV5A 2IBGA 2A6DA 1MY7A 1JGVH 5ELIA 3VWJA 3RVTC 4W6XB 3JXAA 4KI5F 4M00A 1UM5H 5E5MB 3ARGC 2AJSH 1RUPL 5C0RH 4QOKA 2NTFA 2D7OA 5TH2B 1GOGA 4HK3N 1KCSH 4X6DB 2XZAH 3VFUA 4G8GE 2A0LC 4ZS6C 4DEPB 4G6MH 3D25B 2DWDA 3DIFB 3BEVA 1AC6A 3BGFC 3IXTA 5CIPA 2OM5A 4RAVA 4ZODA 5DGRA 4XZUA 2EDYA 1S7XB 5L0QB 3P2TA 4PJHE 1II4E 1FYTE 4LP5A 1CG9A 3S35L 2GW5A 1KEGL 1FVCB 2DQJH 2HRPH 5DJCB 5HDOA 1Z5LB 4ONHA 3L5XL 3MREB 2ZCLL 3HUJE 4KROB 3UZEA 4U1NB 3ZE2F 5EBMA 3ZKND 1MIML 4ZNEE 2H45A 1NCCH 2NXYC 2F58L 3ZT7A 5E6ZA 3GK8H 1D9KB 1KFAH 1LDPL 1R3HB 4OZFG 4LEOB 2AK4A 4IIQC 1IEHA 3QUXA 2FO1A 4WFHD 3SKJL 2BSED 2YUWA 5KN5A 3IFOA 1A7PH 1VGKA 1YJDC 4HIXL 1EH9A 1IM3A 3CVHA 4PRPB 1NMCB 3F58L 3O2DA 4ENED 3OGCA 1QLFB 2ADFH 1CFSA 2PR4L 4Y5VC 4KJPD 5JMRA 3EOAA 3O4OB 2Y23A 5GGVL 4MNQE 4XNXL 1R24A 1WVZA 4IOSD 4K8RH 4NQVA 3QPQC 3MV7D 2E9IA 4Q6IC 1J1OL 4OSUH 4XCYB 2HMIC 1VFAB 2QV2A 4OKVA 4RMVA 1NEZA 1FIGL 2CKBL 4AMKL 4F7PA 2Z91A 2COQA 5FF6B 4MD0B 1MVFA 3QWOA 4K55A 4WFFE 3T0EA 4R97C 1XCQA 4R0LB 4DW2H 1HOCA 4JPIB 4CADB 4CVZB 1IC5L 2W9DH 3QUML 3CFJB 3UPRB 5D6CA 1KGCE 4U31A 5KJRL 4FXKB 1M1SA 1HQ4A 1OTTD 1R0AL 2PTVA 3WDJA 5IJVB 5FYKU 1T1YB 4E41A 3WNNA 4JN2B 2R0ZH 1CQKA 4IDJH 4RFEB 4JJ5A 3C5JA 1ODAA 5FK9A 4HXAH 3GEWB 1UA6H 3BISA 3KYKL 1ADQL 4MJ4A 1WISA 4OCYL 4UZGA 5C0EA 4PD4K 2IAMA 4IHOA 3P9LB 5JOPE 2HFTA 3BHBB 1Q72H 4DGYL 2P48B 4LSTL 1X5AA 1OAYH 4MA8L 3DGGA 3WS3B 5H37H 1LO4H 5HHQB 4XNYH 3V5DA 2AJVL 2L0DA 3SDYL 1Q94A 4XVUC 1U93A 1TMCB 2AV1A 1V7NH 5D1XD 3FTGA 1S9YA 3VXME 4J8RB 1OGAE 3CU7A 1T7ZA 1N64L 3O3BB 4H8WH 5FCUH 5HHNB 5FDWB 1UWGH 5IFJB 3U2SB 4X8JA 4H20H 1QVOA 3BGMB 1P7KA 4XNMA 1OAXL 4HGWB 5JIIA 5GGUA 4P5MA 5KSVB 3MFFA 4JFZH 5EU6D 3UBXA 1DUZA 1JPSH 4NHUB 2VIRA 4KDTA 5I8EA 4NSKA 3GNMH 2ICWB 4OLWH 4LSUH 3QI9C 4HMDA 1JZ4A 5T1DL 3TWCL 2BOBB 3O4LA 1OF2B 4UIKL 1LO5B 1IILE 3HZMB 4QRQB 4RX4D 4GG6F 1BVKB 4D0CA 3WV0A 2WW8A 1AGCA 4Y5XC 3OWEA 3FB6A 4OM1H 3BRGC 5BO1H 1AGDB 4D9LL 2G75A 2P4AB 4Y16B 1A6TB 3EO1B 3BI9X 5JMOC 3TH2T 3GJEB 5EO9A 3BW9A 3IRZA 1ZV5A 3QEHB 2V5TA 4N0RA 1G7JA 1MQ8A 1ZWIA 1NBZB 4K3EH 1CGYA 5LXGH 2XA3A 4K2UL 2M8XA 3NABH 3AM8C 4K3HA 1N6UA 1UQSB 1OP9A 4A6YL 5DK2B 3WIHH 5A16B 5E08L 1BZ9A 3LH2H 5J11B 4XAKE 1GXEA 3B2VL 2FJHA 3PHQB 5IEKB 3OHXB 5L8LB 1R3JA 1NCNA 1FSKC 1YNTA 5EU7C 4LEXH 4XPGH 5IESH 5D5MF 5F6HJ 5DD5L 4HJGB 1A3RL 1CQYA 5FGRA 4F7EA 4HCRA 6FABH 1QA9B 1B6DA 5IVZB 1QUNA 1W72H 2B0SH 3O2VH 3QG6B 3MRRB 5DJ0B 4G8FA 4MAYA 5FUOH 1ACYH 2L7UA 5HHOB 1OGTA 1JZ7A 5E7BA 3IFLL 4BZ2H 3F7VB 4X99A 2NX5A 5DRNB 3BE1H 4RZCB 3EO0A 2X4NB 1YYLH 4G5ZH 2NY1D 5D72H 1HH6B 1A7BA 1K3ZA 3DX8B 1J8HB 1YECL 3BEWA 4PJ9A 3MODL 4RDQG 4OT1L 3MSPA 4QWWD 2AEQL 3GI9H 3DUHA 4NT6A 3WN5B 4NWUL 3WKNA 4D8PA 3OXRA 4G80B 3EGSA 5KZCB 5L6YL 4MJIB 3KS0J 3GMQB 4MQSB 4MXWL 4PJ8B 1A02N 2QL1A 3KPSE 5JHDE 4O2EB 3V5HA 4LAJH 1YY8A 2YSSA 5BQ7B 1AO7A 1RK0A 4JFOA 4NQDE 4BK4A 4X98A 3ZSSA 4XP1H 2ZKHH 3VXUE 4YHZH 4XP5L 2VLME 3JUYA 3B9VA 4K3JL 2EE6A 3V4PL 5ADOH 2F5BH 5IW3A 4QHUA 4HKJB 2WLZA 1QR1B 4EI5C 3FO1A 3O6FB 1FGNL 3RZCA 1PLGL 5D5MA 5EIIA 5DMGD 2HP4A 4JAMA 2Q3AA 4F9PC 5CBEA 4Y8AA 3NPSB 1X9QA 3ARUA 2EIZB 5FUZH 1A9EB 4R26L 4UNTA 1MFEL 2VLRD 4HZLA 4PS4L 4NKIL 3SPVA 2R69H 1IAIH 1QSEB 1JF1B 5MI0C 5BVJB 5DUBB 1XGYL 2A1WL 3S34H 2DIAA 4FFYH 2DQUL 4FTVA 4RWYH 2YD1A 2FNBA 4LLUA 5BXFA 1Y0LB 4FG6D 1AD0B 5TQ2L 2P7TA 4YXKH 1JZ8A 1MFCL 2YC1A 5SX5H 4I0PA 3MLPA 3GHEL 3WKMH 1JUFA 2A74B 1NPUA 3D3VE 3D5OF 1AGFA 1KOAA 4J3OC 1MHHB 4RMSA 2YD7A 3HMXL 3WFDH 3DMMA 2VLLA 1CGTA 1GIGH 4LNRA 5JZ7C 1A9BB 4NO3A 2LFGA 4PRNB 2IPTL 5GS0H 3U6RB 1BAFL 2AJ3B 3JWOC 4O51A 3RL1B 4HWEH 1N8ZA 3AS2A 1OQOA 4FQ2L 1KJMA 5DMIL 3TT3H 1OT2A 2FBOJ 1MFAH 4WTWA 1BJMA 1NBYB 3QFDB 1L7TL 2QKIB 5JO5B 3AMKA 2QJDA 3O3EA 35C8L 3BP5A 3NBNA 3G08B 3QJFA 2D31A 1JGVL 1UM5L 2AJSL 1MH5B 3M07A 1SBSH 4WJ5B 4P2RB 5C0RL 4NOBA 4YHMH 5ISZD 1H15A 1IRAY 1KCSL 2XZAL 5M95B 1I4FA 1BF2A 4Y1AA 5TFSH 1BD2D 2DS4A 3DXAE 2E7BA 3MJ7B 5EUOF 4TSAL 1KYOK 3MNZA 4M4PA 4M9OA 3QIWA 5AYUH 1FO0H 1GPOH 3GSUB 3MRCB 2MKLC 5C0IA 3T3PF 1BVLA 3VJ6A 4IRSD 3QXAB 4J7RA 3WCYA 4P5TC 2DQJL 3F7QA 1IVLA 1PVHA 2HRPL 1RK1A 2FO4A 4JRWA 1OAQH 2A2QT 3MRHB 2V7HB 3AREC 3MGOB 4LLAA 1OAUH 3IRPX 4XCFH 3O6MH 4XX1E 5F7DB 2O5XH 4XPAH 1T5XA 1NCCL 4HQQL 4R3SA 4D0DA 3GK8L 5TDPB 1KFAL 2IANE 5C08E 2Q87A 5K9QI 1S5HB 4FNLH 1U3HA 15C8H 3GUTB 3KPOA 5E8PA 4NYLB 4P2QD 1A7PL 2X10A 3HG1A 2AEWA 3RWEA 3DRTA 3IETA 3CLFH 4ISVA 4JCMA 3ARBD 3FB5B 2V5MA 1XIWA 3S96A 1E4XH 4Y5YC 2VLJB 3T1FA 3CK0H 4OGXH 2ADFL 3QA3A 5EO0B 1GJIA 5HPMB 4NZUH 5I2IB 4K8RL 4CL7A 5CLWA 1T22B 3FQXA 4OSUL 4S0SD 4XRCB 4QGTA 1R3KB 4NQEE 4NN7C 4M61B 4L3ED