4RA3A

Crystal structure of dimeric s33c beta-2 microglobulin mutant in complex with thioflavin (tht) at 2.8 angstrom resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPCDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Beta-2-microglobulin
publication title A covalent homodimer probing early oligomers along amyloid aggregation.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 100
sequence length 100
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ra3A00
2O26U 5LGHL 2AKRA 1NCTA 4XCYB 1SJEB 1YEHH 3QUZD 4NQEB 4OLYH 4WEBL 2HT2D 3QEQA 2ZPKL 5ESAA 5JMOC 4YK4B 2VIRA 4Y1AA 4YHNA 4ELMA 2X05A 3FT3B 1QVOA 5EUOB 3V2AR 1BWWA 5FO9B 4N5EC 2PW1A 4M03A 2XG4A 5L2KA 2AV7B 2WWMC 4YE4H 4B0MM 3K2MC 4CADA 2X89D 5ICYA 5I1AB 5D1QD 4G43B 4PG2C 1YYLH 4S10A 1XR8B 3PWLA 4NRZA 5D7IE 4HDIB 3RBSA 3TWCL 1GAFH 1TPXC 4N5UA 4FOMA 1MCKA 3I85A 1R3KA 4X9IA 2RIKA 3OJDA 3T04D 3T0WA 3X3FH 4YR6A 4HPOL 3BRFA 1M1SA 2HP4A 1BQUA 4GT7A 4HIXL 3O6LL 3IKKA 4GQ9H 1UWEH 2FD6L 3BGFC 2WINA 4OAWB 1CG9B 3H9SD 4DN3L 4ZNCD 1A1OB 4JB9H 5CEZL 4KUZL 3PQYB 5EA0H 1KCKA 1NAML 2A9MH 2AEQH 1PQZA 1UJ3C 3WHE1 1A3RH 3MBEC 1CDHA 4Q2ZA 3ZDYF 2O5ZL 4LHJB 2A6DB 3HNSH 3TBVB 2YK1L 3MNWB 1KPRB 4MVBC 3TO4C 2DYPB 4TSAL 4BH8A 3QUXC 2ZUWA 2VLLB 3KYNB 3UX9B 1ZGLM 5C0EB 4OM0H 1U2CA 1YA5A 3HLAB 4N8VB 1R3LA 3VXSA 1QLFB 2GIYA 3V0WH 1GGCL 4PRDB 2BNQD 2FL5A 1I8IA 5GS0D 3Q0HA 5CHNA 4HEPG 2OX5A 2AK4B 1CE1H 3DHMA 4APQA 4JFFE 4M9PA 3QAZC 4JY6A 3CDCA 4P4RB 1U95B 1E4WL 4JCLA 1MJJA 1F4HA 2FLRT 2CPCA 4M48H 4JN2B 3VW3L 3GI8H 3MV9B 4LVEA 3BWAA 5FF6A 2G2RB 3O2VL 3TIEA 5E6IC 1FNLA 2B4CC 4LCCB 2OTWB 1C1EH 1N5AA 3FT4B 2JCCE 4PRNA 3TV3L 4XPHL 2WBJC 3WFBL 5I73C 4ZUWB 4BZ2H 3UTPD 2HJKB 4OLZH 1TZIB 2CLRB 1EGJA 1QSED 2XXMB 4DVRH 3QIUC 5GJTH 4PJIE 1T0NB 2W9EL 3B43A 4XCCH 1DCLA 3CFIC 1IGTA 4ONFH 5L2JB 1IRAY 1ROWA 4QHMA 4M7KH 4J8RA 4PJAF 3BHBB 1SMAA 1UM4H 5EO0A 2M8XA 3SKJL 3FQNA 2JJSC 1MQKH 3CFBA 1BBJA 3DMMD 5CIPA 1G7PB 5FUOH 2X44D 1R0AH 1A7RL 4JDTL 4U0QB 1KUMA 1NBVH 1S7XA 3LKPA 4ENEC 1JZ3A 3WN5A 4YDKL 4YHYB 4MXWH 1JHKH 1XGPA 4LLYA 4ZUUA 4QHNB 3AGVA 1IL1A 2OJZH 2X1QA 5FYLE 2V17L 2ICWI 4D0CB 5IB1A 1M7XA 3BIAX 3MFFA 4X6CE 1YNKH 5I66A 3AY4A 5BQ7B 2WK2A 3T8XA 1OAZL 3PWUB 1F4WL 2OS7A 3SDYL 4C56B 1DL7H 4E42A 1ZSDB 1S5IH 3UJTH 3O0RH 3RWFA 3D48R 1EZVX 4CNIB 3FQTA 5F7UA 4PJBB 2PTTB 3MQIA 4K94H 5BVJB 2AXGA 5MENA 3PL6D 3NIDF 4Q7DA 2IAMC 2Y07L 1RFDH 2OTUA 3WSQH 3E3QC 3GIZL 3CFJB 1F8TH 5JORA 3RVUD 5CEYB 1MWAH 4JG0L 5ITFB 1CZ8H 1EO5A 3SKUD 4Z0XA 3MR9A 1AQDA 4OI8A 1IC4H 1CL7I 4JFDE 4I1NB 5C07A 2XNAB 3SO3B 3D5OF 4HKJA 4R4BA 3VXTB 4JO2H 4C4KT 1RMFH 1PYWA 4JFHE 4LRNH 3ARGC 3HZKA 4RMSA 3I3DA 2VDQL 4NGHL 5I1GL 3H7BB 5IV2A 1A64A 1LK2A 3V6ZB 3DBXB 4LKXA 3DX9A 4C4KO 2XTLA 3FOMA 4L3AA 2UYLA 4DVBB 1HE7A 1CICD 3SQBA 3NACH 3LKRA 1HHKA 1H5BC 1HDMB 5L0QB 4CN4A 1T20B 4X5WA 1Z3GL 1OD9A 3MLZH 3ZKNC 1TITA 2J7LA 5DRZA 5E2UH 3G6AA 1WISA 3O3BA 4OZFA 3AU1A 4F9PC 4RA3A 2EYRB 4ONHB 3SE8L 2A1WL 2WBWB 4WO4B 5A3IC 4XZUA 4BQBA 3C09B 4N90E 3SGJA 5IROA 2DBLH 5IJVA 3TFKD 2Q3ZA 3QUYB 1ZK9A 4GFTB 2A6KA 3HZMA 4K2UL 4P5MB 1KLGB 1TZHA 2WSKA 43CAA 4XRCA 4S1QH 1NSNL 4YIQA 1JK8B 2X4QA 2F5BH 2Y7QB 2ILLA 1YEKL 5DD5L 5IOPB 4XMLL 4KDTA 1T5WB 4JPVH 4FP8L 4XAKD 1IBGH 1M4KA 4W4OA 2DM3A 5D1XB 4K8RC 5AZEH 3RWJA 5BV7L 1IJ9A 5E0QA 4KTDH 5DI8B 2A77L 1FIGL 4K3DH 3T0XA 1AHWC 2VUYA 3Q5TA 4PJHF 3P30H 3U2SA 4HF5H 4AYFA 2XPGA 2X09A 3GMOB 3HB3C 1MJ7L 3GB7B 4F37K 5MEOA 3L5WA 4H20L 5FDWB 5C92A 5K9QG 5GJSL 1OM3L 2AXFB 1H15A 1A7OH 2GAZB 1YPZE 4Z77B 5C0DB 3GSRB 3QUZC 2WWKT 4YNYA 2N7BA 2OSLB 4JHAH 1FZJB 1UCTA 5DURB 1FLRL 3W9EA 3PJSA 3T09A 3IXTA 1MCJA 1EAPB 4WV1C 3RGHA 5EU6D 3MRPA 3GMNA 2WWKO 4GRLD 4HSQA 5FKAA 3ARZA 1NGYA 2AJSL 2DQHL 4YHIA 3HC0A 4WW2B 2EIEA 2VLJE 4CMMA 5L9DL 1UH2A 5D1QC 2QQNL 5D2NC 1OAQL 3U6RA 3O2DL 4RZCA 5JO5A 5DHVA 1D5BA 2YPLA 3EDKA 4PB0L 3RY6A 4CAGA 4I77H 2F8XC 4M1CC 4KQ4L 4HWEH 2HFEB 4WFHE 1D5MA 5HDBE 3RPIB 1WEJH 1XGTB 2J8HA 5T1MA 4FQIH 3GJFH 4GAYB 3V5DB 2E7MA 4LLDA 3Q2CA 3R8BB 4HV8B 1Q94B 1WSST 1YY8A 4AG4L 2YOCA 2F19H 3MLSH 2E3VA 1LEGB 4R26H 5HD8D 2OMNA 4LLVB 3IDNA 5I1IH 1HIMH 1MAML 1ZT7A 4ODXA 5EC2A 3VXRE 5BVPL 3S37L 3WJJC 3RI5F 1T89A 3GSNL 4RQQB 2ESVA 5D7SL 3D9AL 4NWTL 3VXQB 1A4JB 1EFQA 5IMKB 4KKBC 3BQUB 2AABH 4OFPA 4UB0H 4CU6A 4NQTA 3IF1A 4ZSOE 5I18H 5JOFA 4PRPD 1N2RA 3HR5B 1SEQL 3UZVB 2D31A 2FWOB 1INDH 1KG0B 2VSCA 1HQ4B 1KCVL 4U1KB 1B90A 5GS0C 5GS3A 3NIGE 4IRSA 3RDTA 3FO9B 1CT8A 3QXDA 3HNTL 2CKBH 3ZYZA 1EXUA 3ZKQD 4WY7L 3N1GC 4GW1A 4RMQA 5DK2A 3ZTNL 1JVKA 5J11C 3O6ML 4HQQH 4JN1L 4I18A 3STLB 5EC1A 4QOKA 4YHPB 5HGBA 1Q38A 3HPLA 1QACA 5KSVA 4OQTA 3F5WA 4XCNA 1X5JA 4XVJL 1MQ8A 3MNVB 2ZP0T 4OZIE 3VD3A 4Z7WE 1KENH 1B4RA 3O9WC 3CGTA 2YXMA 5FIEA 1RZ8B 1HILB 5KVDL 4D8PB 1JGUH 2LU7A 4M61B 5LGKA 2DF3A 5FFLA 5IFAL 5EO9B 2VLMD 5EN2B 4LVOB 3MA7A 3WKML 3C5ZB 3CVHL 3VMNA 2JJTC 1AGBB 1IARB 4P2OD 2Y5TB 2GCYB 2PYEB 2X4OA 5JOPD 1AKJD 4CN6A 3BAEH 1WBYB 2HT3D 4QLRA 4M00A 6FABH 1ACZA 1I1FB 4OZGE 1HHHB 5GGVL 5CBEA 2QKIB 4H0IA 3MV11 4DOHB 1TJHH 4RGOL 2XZQH 1EERB 3OAUL 3ALWA 3DMMC 4GKSB 5I74B 2NCMA 2QR0A 1MHHB 3C2AL 4O2EB 3HI6L 4WFGD 2ZCLH 7FABL 2WLZA 3RX5A 3T0ED 1FN4A 3WNKA 2L7JA 3X14A 1I9RL 4L4TB 2DQJL 2XTJD 4U1IA 2XWBA 4NN5B 4LF3A 3SKNB 2Q7YB 5ETUB 4PJ5D 3TPUB 32C2B 5JZ7D 1JV5B 1KIPB 4POYA 5LBSL 4LPYA 4F3FA 15C8H 4S1RH 3O4LD 5FKPB 5FYKH 2LQRA 5EOQL 2BFVL 5EBLA 5DJ2A 1U8PA 5C0IA 1IAOA 4HHAB 3VRIB 1OARH 1XH3A 2OXHA 5FOBB 2E9WA 3E6FA 3GMLA 1U3HB 3PWNA 5DSCA 4A6YL 5B38B 4FTVB 3KJ4C 4M3JA 5F7FA 3GK8L 1BVLB 4XP6L 1Y0LA 4DGIL 3KPMB 5E2VL 3MJ7B 4N0FA 4NYLA 4ZFGL 3PL6C 5DWUH 3R0NA 3VXMB 4G8EB 3ZE0E 4P57B 1MCHA 4HG4K 3L7FA 1JPGB 5ALBL 1LDPL 1C7SA 3F12A 3GHEL 3Q6FB 2I07A 4GW4B 1A3QA 3D39D 1FVCA 4DTGL 1A0QL 1YC8A 2JIXB 4XP9L 3PHOB 5CP7A 1U8JB 2E9JA 3G6DL 1VFAB 4IRZL 5GGSA 1NEZB 1L6ZA 5I71C 3C8DA 4FXKA 3K2UH 4PREA 5TJWK 3H42H 3BEVA 3OXRB 3IJHB 5C8JA 1G7MA 3JUZA 4AH2B 1N4XH 5TDNB 2D03L 2W60A 4WEBH 1CICC 2BVTA 2L7UA 5ESQB 5H37H 1UA6L 2ZPKH 3NZ8A 5E1HB 5DDHA 3H7LA 3CXDH 2NX5B 5I16B 5AAWA 1OY3B 4XXDA 3A6CL 3VI3E 4X98B 4C54A 1G1CA 2IFFL 1VGEL 2H1PL 2BVOB 1BJ8A 4YDJA 4XPBL 4P59H 4H26A 1HCVA 3M17B 3DECA 3IDGB 3TFKC 3U7YH 5CJXA 4MQ7B 4PJDF 1D5XB 1G9NL 3CFEA 4MJ2A 1IQDA 2QSQA 1MUJB 2CUIA 3B3IB 3IJSB 1W72B 1MPAL 3RP1A 3U4EB 1RIHL 2P7TB 4ZUSA 1IC5L 1G9MH 3E3QE 3RU8L 4HPOH 5T5NF 2M26A 3ARBB 4KK6D 4RGND 4HIXH 4O2FB 1ED3A 5CJ5A 4ZO7A 2VL4A 4I4WA 2FD6H 4NQUA 2FX9L 5H35A 1NAMH 4U05A 2FO4B 1RZJH 2XWJA 4ESKA 1A6UH 3RWHB 3TNNA 1BQLL 1L7TL 1Q9LA 2C4FU 3RJDA 3IVKA 1I8KA 4BJLA 1KJVB 3THML 2EDKA 4MNHA 4UDTA 4U6TA 2PYFB 5EZLB 3MV7E 3SY0B 3IRPX 1HSAA 1NMBH 1XR9B 2GTZB 4WWKB 4X7FC 4UQ3A 1FH5H 2F5AH 3TF7C 2IQAB 1GGCH 1W2KT 4Y19A 3DV6A 3TO2B 3UYRL 3ZYJA 1RU9L 1FZOB 3DETC 5JIKA 4GRLC 2PW2A 3QDJD 3LY6A 1ZANH 1ZWIB 5J1AA 1OTUD 3KYMA 1IKNA 5EZOH 5H2BA 2VC2H 1FSKB 5FK9B 4ODSL 4LNRB 1JHTB 3VW3H 2APXA 2Z92A 4TVPH 2O61B 2EH7L 2MCPL 1ZVYA 4NWUL 1E4XH 5KVFL 1F3RB 5F7YC 3SDXB 1EFXB 5TQ0L 3KYOA 4I0PD 3WUWA 1NCWL 1XCQB 1S7RB 1KTRL 1DQJB 2D7QA 2YC1B 3TV3H 2R8SL 2V5SA 3WFBH 1NFDE 3BDXA 1ZE3C 3MROA 1FFNA 2CK0H 5HD8C 1PGRB 1MREH 1WZLA 2VR4A 2LE9A 2HWZL 3BD5A 4RFOH 1JYNA 5EUKB 4LLQA 5FDYA 3KPLB 1S9XB 3ARDD 2DD8L 5EU4A 1I3RB 4Q9RL 5E8OB 3NFNA 1ZGLA 2QQLH 1DBJH 3FOLB 4OCNC 3MRBB 3EFFB 3FHQA 3K4ZA 3SKJH 4K3GA 1YUHB 3BZ4B 3RZWA 4I0CC 3ULUD 4NN7C 1A7RH 1LNUB 4G8IA 5K9OB 4Y4FD 5IFHL 3TYGH 4NO2A 5JLZB 4JZJC 2IH1B 2KUTA 4QHLA 1KSRA 3TT3H 4Z78B 5TE6H 1QQDB 4JREC 1HK6A 5D6DA 5D2NE 1U8LB 3H9HB 5DTFB 4N8CH 3HE7B 3F65A 5KOVC 3G5VB 5DMIH 1A6TA 4OD2A 3R1GH 1YDPA 4JKPH 2JE8A 5DFWH 2ITCB 3OKKB 4TNVF 1NGQH 3MX0A 1TCRA 1QFWL 1IAMA 4WJ5B 3OKOA 3PDOB 1DVFA 4PJ9A 3H9SE 1WIOA 3ZL4L 4XGZB 1CTNA 2V2WA 3X17A 4HS6A 5F88B 5CWSB 1MWAA 4CU8A 4UI2A 3PWPA 5B4MC 3CPLB 1VCAA 4PJAE 1ITCA 3LKSA 4M8QA 4X6BB 2I9LB 3F7YB 5DQDL 3TYFA 1FC2D 3I6KB 1GL4B 2HT3C 1N6QL 4XI5D 5IFJA 4JQIL 2DQCL 2H6PB 2VDQH 4NQXB 4HS3A 4YC2B 4X7EC 5SV4A 2VZSA 5ENWA 1QD0A 1RPQA 1E4KC 2BNQE 3MLPA 2VLRA 5HDQH 3QBTB 3QEGH 3T0EC 5C0GA 1NC2A 3BP7B 5J8OA 4FQ2L 4HFWB 2XTJC 4RRPG 3BO8B 3QI9B 4J7RA 5I8OH 3GSQA 2WANA 5KVEH 1JPSL 1T83C 3QZWG 4KY1H 4X8XA 3TCXA 4PRIB 1HHJB 2R23A 2HFGL 2V2XB 1NUGA 3TVMD 4WFED 1PX4A 5FYJD 4MWFB 5J12C 3T77A 5JTWA 5KZCD 2Z31A 1I7TB 4K2UH 4PRHA 5J9PB 5ID0B 5L8KB 3D1MC 5B21A 3NGBB 3E6HA 3CFDB 3UTPE 2HKFL 3FTGA 1T6VN 4R97C 3ALPA 5IEKB 3MRNA 4X80H 1P4LB 1NAKH 1VFMA 4BM7A 2IANA 5I1HL 1CDIA 1C16B 4J3OC 1EHNA 2W59A 4PG9A 1SVCP 2BSTB 2NY2B 4CVZB 5BV7H 3OG4B 4Q9QL 3VFTA 2A77H 1FIGH 2X4SA 3AVEA 3TIDB 1JN6A 2AI0H 5I6XB 5BOZG 5HVHC 3MJ9A 3ZE1F 3ILPA 5FM5O 4XB8A 3V5HA 4Z9KB 5C0CA 4FNLL 3RNKB 4Y2DB 4H20H 5T1LD 2UWEA 4NDMB 4GG6B 2YN5A 3BEWB 5FO7A 2I26N 2VXUH 4IMKA 5GJSH 4P46B 5F97E 1VEMA 1C5DB 5SWSD 1S78D 1FV1B 2RR3A 2DQDH 3M45A 1XCTB 2AQ1A 3VFOB 5D5MF 3NOIA 3GI9H 1MCOH 4P5TC 1M6OA 3KPQB 1F5WA 3OZ9L 4X4YB 2F54E 2IG2H 4AL8H 1HI6B 4R2GC 1MAJA 3HRPA 43C9B 5J6GA 4MJID 4EDWL 4ZXBB 3SKOA 4TUOB 4PS4H 2AJSH 4AK1A 2OM5A 1FC1A 2HTLD 5L9DH 2FEDC 5BS0A 2QQNH 3W11D 1FL3B 1LVEA 4HWBA 1AC0A 2ENYA 4JFYB 3ARVA 1CD1B 4C83B 5D7IB 3TCLB 2XWTB 3GJFK 5E8DL 4PYHA 4J3SA 3UTSB 3RQ3A 3QUKB 2YD5A 2J8UF 4BSWB 3LQAH 4J3WA 5HHNA 2W0LA 4E41B 4KK6C 4RGNC 4AG4H 4RBPH 5DRNA 4M1DH 1KT2B 4XNQA 3HCVB 1U0QA 1J10A 5FECB 1I3GL 4KAQL 2VXQL 2Z93A 5L8JB 1KEGL 4KVNL 3SDDD 3HI5L 1WCBA 5IB5B 4IIQC 3NN8A 1WBXB 4IDJL 4OTXH 4J12A 1G9EA 4KU1A 3M1BA 3D9AH 2QADD 1AR1D 4JHWL 5DQJB 3VXNA 3ZKSD 1MF2L 2D7NA 5F6IB 5I2IA 1EUTA 3S3JA 2GJ6D 1X6LA 4LSQH 2NY4D 3V52H 3WIIL 4ZNEE 5IW1B 4LVNC 3RY5A 4MQXC 5JPNB 3E2HC 1BZ7A 2BXYA 2C9AA 5FOJA 3P2TA 4NKQB 2VDKH 4OIIL 4U7SA 5BZWB 4R4FH 1FP5A 3PHQB 3QWRA 4PJDB 4PJ8A 2EIBA 4K71C 1M7DB 4LU5L 3R4DA 3HNTH 4HUNB 4K9EL 3WO4B 1OTUC 1JHLL 4TQEH 2IMMA 4K7PH 5E1AA 4ZFFA 4IRJA 4PV9B 2H26B 3TESA 3KYKL 4F7PB 2MQ3A 4JN1H 4XBGA 4QCIB 4PD4K 4EI5C 5KVMC 5IT2H 3MRMB 4XVJH 4XAKE 1IKFL 4BFBD 3PDGA 4I0PC 1A9BB 4PRBA 5BMFL 3UJJH 2NW3B 2BSRB 2Y9RT 3L5IA 5E70A 4MDIA 3WKMH 5JPMB 4KI5C 3CVHH 1ETZB 1BFSA 5F9JB 2JF1A 1GSMA 4P2QA 3SPVA 1G6RL 1LP9F 12E8H 3L1OL 1QG3A 4PJIB 3HG1E 4DQOH 1VKXB 4F57L 3S5LG 3ARDC 1R5IB 5DJ8A 1NCNA 2C4FT 2D0GA 4KC3B 4MB5A 5IHBA 3HC4L 2F74B 4G6JL 3EOYG 5DVMA 4ELKB 5TDPA 3C2AH 3ULUC 4Y4FC 6CGTA 4EN3D 5IF0A 2ZNWA 1EJOH 3DUSA 3BPOC 1FG2A 1CXIA 4XPGH 1INQB 1QSVA 1JUFB 4P5KB 1DN0A 2WUBL 3T2NH 3DO7B 1NC4A 5LBSH 3CSYB 2G75B 2ADIB 4X6CB 2G9HA 4LDLB 1DBBH 2DIAA 1NJ9A 2GW5A 3S9DB 3VXUD 1JNHA 1G7LB 4PGJA 5DJXA 1B88A 2OZ4L 4JFED 1JF6A 3VRJB 1TFHA 3MRLB 3QFDB 4DGYL 2BJML 4G80B 2NY3D 4WCYH 1P7KB 4BH7B 4E5XB 4LVHB 3D85A 4K7PY 4ZFGH 2BY0A 2CIIB 4XCFL 4MNGA 1V7ML 2OI9C 3DVFA 4FFZH 3OJMB 4P23B 1SJVA 4I5BA 4R9HA 2X42A 2HFFB 5ALBH 1J05B 3QISA 5CJQH 3BYYA 4DZ8B 5EZJA 3W0WB 1WUNT 4KRPB 3BSZL 1NDMA 4YO0A 5EPMB 4DTGH 1A0QH 1NGPL 1WTGT 4U2ZA 3GSUA 1EEUA 3O6FC 4JFDB 1PEZA 4TNWK 4PJCF 2CXKA 1NL0L 5IMMB 2Z8VC 2CO7B 2OJEA 1HWHB 5MI0C 2C5DC 2VYRE 1BQHG 3U0PB 3DI2B 1UA6H 3OXSA 5B8CC 2E7HA 3G04B 1YNLL 3BE1L 1UZ6F 4XNMA 3MRCA 4Y5YC 5ICZB 2FATH 3A6CH 4YPJA 5T3ZH 1KELL 2NY0D 4OZHB 1J7VR 3DSFL 1YNTA 5E56A 4R7DA 1JNLL 1TTFA 1A6AB 3WXWL 3MNZB 1WV7T 1J5OH 5C6PB 3QEQD 1FCCA 4ALAL 4CVXB 3TVMC 2AK1H 5DEGA 4Y1AD 1EAJA 2QHRL 3QP3A 4NPYB 1EK3A 4WGWB 2R1YA 4U1NB 2DTML 1BHGA 1YMHA 2VLME 1RIHH 5L2KD 1E28B 3G6JA 3QNZB 2VSDA 2YD9A 4P2YA 1VA9A 4MD5A 4LQFL 4X99A 3V5KB 1NAMA 1XT5A 3EYSH 1IGYA 5CD5D 3CFKA 3HUJA 3MUGB 3P4NB 4J1UA 5JOPE 1OGAA 3D69B 4R0LA 1LILA 4QY8B 2GITB 4JM2A 4K7FA 2IH3A 3T3MF 3FQRA 2BSED 2RHEA 1NDGB 4UU9B 5IVXF 3ZT5A 2C3VB 3OGCA 4O5LH 1ITBB 5DEZA 2SEBB 1BX2A 3KVQA 2VKWA 1BQLH 3QJFA 3PGDB 3VXOA 3R0MA 4WFGE 2DWDB 3T0EE 1EVUA 2DM7A 3BKYH 1I7UB 2XTJE 4TSCH 1S78C 5AD0A 1RULL 1YPZB 4YFDB 5C0FB 4YBLB 1MHPL 3O3UN 4PJ5E 3MGTB 1NCDL 3RVVD 1WBZA 3TBSA 1RUQL 2E9BA 3O4LE 2C1OA 2QQKL 2R2CA 5GGQL 3BESR 3UYRH 5C09A 4C59B 2A38A 3P77A 1KB9K 1RU9H 4NQEA 3RPKA 5F9DC 3ARFC 3DJ9A 3LKNB 3FCTB 2HTLC 2VLJB 3ARXA 3FT3A 3W11C 2EH8H 1H3XA 3VXSD 5FO9A 4RISH 4GJTB 4ZTOL 3F7VB 1JFQL 5HYJE 2MTPA 3QIBB 4KI1A 1FL6A 2B2XL 4ELMF 4OBSA 1DANT 3SGDI 1NCWH 2VDRH 4OIAA 4APQD 5CILH 2C3WA 4KXZH 2E8YA 1RJYB 1YEDA 1FG9C 4A2MA 2X9YA 2WIMA 3MRQB 2AXHA 3LH2L 4OF7A 1I1AA 2NXYD 1GGIL 1HZHL 4HLJA 1P7HL 4LPTA 5C70A 5J3HC 3EOAA 3SDDC 4LSDA 3VXRB 2FBJH 2EC8A 2XG5A 4ZMAT 4LLWA 2OYPA 4PJ7A 5LXGL 1W72H 2LTQB 4OAWA 1A1OA 4Q9RH 4QKXB 5LJYH 3QDMA 2QADC 5CUSH 1AR1C 1MJUL 1XGYL 3L7EA 5D71L 5I8EB 1T5XA 3OR6A 2P4AB 1Q9OA 2NY4C 3BZFA 4G7YL 1IGCH 1VSCA 4ZSOB 1WZ1L 5SWZA 4HD9A 3DGGB 1MJ8L 5C1MB 3RZCA 1ZGLP 1KPRA 2ZKHH 3F6LA 1A1MA 3SGEH 1FDLL 3HPJB 4K7PX 2BMKB 3VFWB 5E9DD 3HLAA 1BD2A 3CH1A 1QLFA 2OR8A 1KCSL 4M6OH 3I6GA 5DYOA 1A9EB 3N50A 1TPXB 1EO8H 5I1LB 5HGAB 5C08A 2DLGA 2GSGA 3IFNH 1QFWH 4RGNE 1Q9WA 1JIBA 1RZ7H 5DZLA 1DQMH 4OZIB 3BGFB 5CINL 2EZ0C 4Z7WB 2B1AL 4Q0XL 4X5LA 3DPBA 4UNTA 2FYYB 1UJ3B 1QBML 2OTWA 3GBNL 4MJ4A 2MJWA 2X9WA 3FT4A 3GMPA 3MBEB 5DQDH 3D25A 3VD5A 4WI6A 2KZ1B 4L4VD 2AEIT 4ZUWA 5AWNH 3TO4B 1FNFA 5FB8B 5MEND 3GBML 3QUXB 3WKNA 4JQIH 4OZGB 1T0NA 2ARWA 2EO1A 1NMAL 2BCKA 4H1LG 3SKMB 3P9MA 2IQ9L 5IEHB 3TZVA 4YBQD 5BJTB 4ETYA 2YWZA 3L3IB 2M2DA 4KQ3H 2C1PB 5L2JA 2DICA 2X1XR 1DR9A 4DFIA 4KHTL 3FB7B 5C07D 4ODBD 2NY7L 3QDJE 4P3DA 1A6WL 4FQ2H 1MRFL 1JJUA 1KBGL 1G7PA 1FORH 1JPSH 3C5JB 5HHQA 4G42A 2DBJA 4WEUD 4TRPH 5HBBA 1B2WL 1VFOA 2HFGH 4YUEL 3VG0H 1T0MB 1G0DA 3ES6B 3MLUL 3FFCE 4J3UA 1HH6A 4OD1H 2W65A 5AG8A 3ILQD 3OKDB 5T3XD 4P4KC 4PJGE 2CDGB 1RHHB 5BQ7A 3BPCA 1S7TB 1N6UA 4KI5E 1Q0YL 1YN7B 2E7LA 5I73B 1CL7L 2HKFH 3PG2A 5CP3H 1OSZA 1CD9B 3RA7H 1CDYA 4M7LH 2AJ3B 3QIUB 2NW2B 1LO0L 2ORBL 3K74B 4DJMA 1C7TA 2YD1A 5DUBA 3EO9L 4OD3L 3VWJA 3C6LD 3RKPA 3VI4F 1CS6A 1CU4H 4KDWA 3MV8A 1X5HA 1P5VA 1U8MB 4FNLH 3ULUE 3V4VL 1UM5L 5C2BL 1IEAA 2XQBH 2ATKA 3FN0L 3ME0A 3IFLL 1IMHC 4MJ5B 2DRUA 3ESUF 4NKMB 5AZ2H 1Y6NR 1RD6A 3LRSA 1A8JH 5KJRL 1AGFA 3RVWC 4PGCB 3OZ9H 2R1XA 3V6ZA 1MCWW 5D96C 4OZ4A 4WI8A 1M7IA 4ZO9A 3O2DA 3KPPB 4DVBA 1V8HA 1KIQA 2I9TB 4RWYL 1OOAA 2NY0C 4KTYA 4XBPA 2H32B 1FYTA 4TUKL 1FE8L 2ZUYA 1VACB 5E8NA 1T20A 1A5FL 2Q8BL 4LIQE 3EAKA 2EYRA 1Q9KB 5CD3B 2IAMB 1WITA 4RSVA 1MVFA 4Z7VE 1CDBA 4JPKH 4C57C 1IAIH 3QUYA 4RBPK 4F9LA 5JW4R 3A67H 3QUMB 5HY9B 4FZ8L 3GEWB 4M1GH 3AS3A 2YPLD 3W39A 5KG9A 5KAQG 3FRPG 3GSNA 1JK8A 3ROLB 3QZWB 1I3GH 3N1QC 4KAQH 2VXQH 1KEGH 5I17B 2CLVA 4MCYA 4KVNH 4PJCB 5IOPA 4L29B 3ARGB 4JLRB 2PETA 3DRQA 1G7JB 1KC5H 1XF5A 2VXTH 3ZDZF 3GMQA 1EX0A 3CUPB 4DZBB 5D1XA 4MNQA 1MEXH 2R9HD 5DI8A 2FJHB 3OPZL 2D7MA 1MF2H 4RMTA 2XRAL 3EGSB 3IFPB 3QRGL 4HK0B 1H5BB 1XZ0A 5F44A 4MB4A 1LO2H 3GMOA 3GB7A 4IHOA 5F1IA 1NCCL 4PJXA 2X9XA 3WBDA 1JGDA 3RVVC 1PVHA 2ESVD 3V7MA 4X8JB 3L9RB 3S4SG 1JWSB 4X6DA 1F11B 1QKZH 1UKTA 1V3MA 3SJVE 1T1WB 2GAZA 3L95B 5C0DA 4Z77A 1KTLB 1NGWA 2VXSL 2CLZB 4WFEE 5FYJE 4D94A 4LU5H 5I0ZA 4K9EH 3JV5A 4CKVX 1OVZA 1R3HA 1JHLH 1I4FB 4LBEB 3D2UA 1B0GA 1DBAH 3DYMA 1ZLUK 1K8IA 1S9VA 5FCSH 1K6QH 1QRNA 3BKCL 5TDOB 4DK6A 2GUOB 4DKFL 5C7XH 3CVHA 4L3EA 3RDTD 5LQBH 3UTQA 1IKFH 1W0WB 2NTSP 4APQC 3HNVL 3UO1H 5BMFH 2X4UB 5DC9B 4HPYL 4Q6IA 2HH0H 1J8HA 4MZ3A 1AHWB 1NFDB 5EFIB 4QRQB 2NXYC 3V5DA 4QOKD 3NCEB 3INUL 4HIHA 4CRPA 4PLNC 1X5FA 1NUFA 1TTUA 1UEMA 2W91A 2ZWLT 1DFBH 4RNRB 4BUGA 5J1SC 1TXKA 4LAQH 1ORSB 4RGMC 4LLVA 1SYVA 3EBAA 3QUZB 4P3CL 3WEXA 2E5EA 4U1GB 3MJ6A 1IGFL 4NSKB 3GGWA 3ESVF 1I1YA 1OP3H 4ZS6D 4RQQA 5IMLA 5DD3L 3N9GH 1F42A 4RA0C 4YDLB 4CVWA 1YJDL 1DQQB 3V0AC 4WV1B 1A4JA 4XC3L 4AEFA 4MJIE 3KYAA 2NLJA 3GMMA 4ACPA 4OKVB 1A6VL 1D6VL 3C08L 4NQSB 5D2NB 2WUBH 4GKNA 4ONOA 4A6YA 2G5BB 3X3GL 1YMMD 2FWOA 1X9QA 3NCYP 1FFOB 2HRPL 3U9PH 2H8PB 1NMCC 1HQRB 4TTDD 4U1KA 3WN5C 1EHLL 4ZODA 1WVZA 4PBWD 3JV4B 4RIRA 2NZ9D 2BJMH 2ARJA 2I5YL 1WC7B 2VDMH 2YPKB 4YDIH 5LAXA 3BVNB 5HYQB 2ZJSH 1SM3H 3H9SB 3AY4C 5HYSG 4LSVL 1QBLH 4KV5F 1V7MH 5DD6B 2DI7A 3GKWL 3MNVA 1KCRL 2JB6A 5D6CA 4JY4B 4HUXB 4JJ5A 4LARL 4Z7OF 3P4OA 3P3YA 2OMBA 3NTCL 3QJHA 2VE6B 4HC1H 3IFOB 4LSTL 2ICEA 3BSZH 3HS0A 3WIHH 1NGPH 3C5ZA 2EDNA 2GJ6E 4MLIA 1AGBA 1KULA 1OL0A 5ISZA 1X3DA 4JANB 5A40E 1WBYA 5MEQB 5IHUH 4Z7UF 1JCKA 4YBQC 1TJIL 5I1JL 1ZT1B 1WWBX 2BNQB 1HHHA 3MLVL 3NA9H 2QKIA 3NCMA 5C0AB 3WD5H 3U0TB 2W0PA 4KJYA 3SDAA 3BRGC 1J0KA 4YGVA 3NIFF 3BE1H 4GKSA 3VFVB 1IC1A 5DMYA 1U58B 2DQGL 35C8L 1KELH 1WAAA 3RWGB 4U1LB 2V6HA 2VABB 5IQ7L 3S5LB 4NQDA 3WXWH 3UBXG 5FO8B 1ZA3B 3SKNA 1QPPA 3OWEA 3MRKA 3S96B 1FBIL 1UCBH 2X89A 4M4PA 4UOW1 2QHRH 4ORGB 5IESL 3O9WB 1WFOA 1R6VA 5FKPA 3MGOA 3ILQC 2NZIA 4GUPA 4EBQH 4KJPC 1MHCB 5BXFA 3VRIA 1QR1B 4LQFH 2CR6A 2EDRA 3DIFB 1V3JA 4FTVA 3SGJC 1G0XA 5IROC 1BVLA 1EO7A 3RHWK 1EEZB 1ZHKA 3KPMA 5GIRA 5IQ9B 2WIIA 2CO6B 2QBWA 3Q6GH 4HH9B 4ZFZA 3VXMA 1BBDL 1HXMA 3X11B 4TPRL 4D3CH 1DQLL 5F3BB 3DMMB 5I8CB 2HMID 4KDTC 3VFMB 1IT9H 2ZSWA 1IFHL 1PDKA 4W4OC 4HXBL 3RWDB 4JO4L 1AIFB 2X1PA 3OX8A 1MLCB 4UT6L 1MFEL 2NTFB 4HWZB 1WIPA 2MOVA 1MCEA 5D7LE 2X1OA 4PJEE 3DX7B 4ONGL 4LLMA 1E4XI 2QQKH 3IJHA 3VD9A 1BM3H 2F54B 3BGMA 1I3VA 2DKSA 5TDNA 5T1DL 1XF1A 1SMOA 3KS0J 4H88L 4JFEE 5ICXA 4DEPC 5HYFA 1HINL 5CGTA 4PR5B 3K0WA 1AJ7L 5I16A 1KN2L 2MSPA 4MCZB 1FVEA 4X98A 4Y19D 2HJFA 2KZWA 5DS8B 1EBPA 1NBZB 2VLKA 5F7EL 5J13B 3T3ME 4WNQA 3OHXA 3AROA 3WNMA 5J0BA 3OJVC 1BQHB 3VFSA 2BSSB 4NHUB 2B1HL 1JRHH 4NM8L 3DROA 3LH2H 3VDAA 3RY6C 4G6FB 3VFUB 5DHYB 1HZHH 1WTLA 3EYUL 3OKNA 1B9ZA 1BWMA 4G9FE 4O2FA 5I71B 3QHFL 1QA9B 4OUUB 3L5JA 1QSEA 1C12A 5F9AC 3AMKA 2AVGA 5IG7B 1DLHA 3QH3B 4ZFOB 1MJUH 4AM0B 5HVWA 3JV6A 4DKDC 1CICB 2DMBA 5L88L 1Z9LA 5M95B 4G7YH 1QFUH 4NP4L 3RWHA 3JWOL 4XMPH 4UV4H 4I0KA 1WZ1H 5DA0B 4L4JA 2EIZB 1T89C 1PZ5B 5A2IH 4DFHA 4MDJB 4O00A 1KOAA 3FO0L 3QEQE 4NO5B 3WFEH 1JYVA 2UZIL 3DVGB 2GTZA 4Y1AE 4JDVB 1EGJL 1ZTXH 1A2YA 1J12A 4MHHI 2EICA 1GIGL 3QDGE 4RDQF 4ZDHB 2RQ8A 1T22A 3RL2B 1EJ6A 5L2KE 1FZOA 2A6IB 3BZEB 1K3IA 5C6TH 3F7PC 4PJFF 1BEYL 5LGJB 5DR5L 4NRYA 5HDOA 1CLOH 3I50L 2R2BB 1CXFA 1CFTA 1KPVA 4IRSC 4ODVL 4HX1A 3BKJH 5KSBE 5FK9A 3LS4L 3T3PE 1D5IL 1F4YL 4OGXH 4P9HC 5DK3A 4LNRA 3O45B 2O61A 3NZHL 5F71A 4U7MA 1QBMH 4XNYH 4I18C 1EFXA 3FO2A 3GBNH 2GTWB 1XCQA 2AJYH 2R4RL 3P9LA 4PJ9D 3HG1B 3IDXL 5CLWA 2GKIA 4PJHA 2IC2A 3QQ4A 5C9JA 3BYTA 3IRZA 3MXVL 3GBMH 1M05A 3UTZB 5HTSA 3PWPD 4JPIB 3D0LB 1MH5B 4P9ML 3KPLA 2IQ9H 5DUPH 2DQFB 4G6KH 4LCIL 3ROOB 5I1EH 4KHTH 4Y88A 3FOLA 3QNYB 1GGYA 4XPFH 2NY7H 4XHJC 1YUHA 3BZ4A 1JZ5A 3P0GB 3E8UH 1FZMB 1E6JL 1LNUA 4KKAD 3V8OA 1T03L 1T1ZB 3KNBB 3VXSE 2CMRH 4EIGB 4CDGC 5JLZA 2L4OA 1B2WH 4LGPB 2IH1A 2DLHA 2ZUUA 5F21B 2VLRD 1RURH 5TE7L 1E0OB 2FX7H 4TTDC 3S36X 1NC2D 3MLUH 4WEMB 3R06A 3H9HA 1XF4B 1N3NB 4O51B 1PZUB 3U83A 3B5TA 4I13B 3QWOB 3QG6B 2NZ9C 3TBWB 3LEYL 1U3ZA 1I85A 3VA2C 4GW5A 4WUUD 1CL7H 4QT5B 2ITCA 2W9DL 1AE6L 1PG7X 1P4BH 4WJ5A 5C0JA 4Y4KA 2Z31D 4PRHD 1ZVSA 1A7BA 3EO9H 1XIWA 2PR4H 4OD3H 5F88A 1YEJL 3T2PA 1MCCA 3CK0L 5CMAB 5JHDD 5GRUL 2BOBB 5HHOD 4HUVB 2JELH 1I7RA 2VERN 5CKGA 3IJYB 3C9NA 1UM5H 5C2BH 4NN7B 2IAND 1U8NB 2I9LA 3F7YA 4FFWD 4AY0A 3FN0H 5TQ2L 4JZJB 2Y36L 1HHIA 2L0DA 4JREB 3EFDL 4GKZA 3BDYL 2IPTL 3RWIB 5C0CD 3HAEG 5IGXL 1IE5A 2CSPA 4PY7A 3O11B 3DVNB 3FONB 1DSFH 3QPXL 2BVYA 4QNPF 4U1HB 1DTUA 3CLEH 4N0YH 3I84A 4Z18A 4TUKH 1FE8H 4B7LA 4D9QD 1LE9A 1U6AL 1FO0B 3QI9A 4L5FL 4IS6B 5EBWB 3G5ZB 4MXVF 4D0DA 4H1LB 4QF1B 2C3XA 2VISB 4XP5H 4XVSH 5DJ0B 3B2VL 4ODUB 5E7BA 2UZXB 3MRFB 4Z76B 1I7TA 4IMLA 2O93L 1KCLA 4S1SH 5DMKB 1UT9A 1PKQA 4LCYB 3CFDA 3S3SA 5MENE 2B4CH 4FZEL 3CVIH 4I3RH 1NLBL 2A9NH 2CKNA 1K4CA 2QQQA 1YN6A 2H45A 3JWDC 3EYQC 4NKDB 3LCYA 4JGUA 2HMIC 4FQXC 3RGVC 3T08A 2NY5L 3AUVA 2ZOKB 4NJ9L 4WHDA 2XRAH 1OAKH 3T0EB 5C07E 2X4TA 5DJ6A 3O4OC 5F8QC 3MCLH 1IAKB 4XVTL 2P42B 2XTJB 3O3DA 3HI1A 4OCSH 3RNKA 4Y2DA 5F96H 4KZEH 3S35X 4GG6A 5DD1L 3BEWA 1JPFA 1S7WB 3DUHA 3G08B 4G8GB 2C26A 3MTRA 3O4LB 2DWEB 1I7ZA 1PLGL 4F33B 4PRPA 2VXSH 1MSPA 5GISL 5J12B 3KPQA 3P4LA 4O02L 3EOTH 2CDEA 5T3XE 5H94A 3WXVL 4YZFE 1HI6A 3LQZB 4KK9D 3FN3A 3BKCH 5I9QC 4R97B 2FGWL 3S3PA 5HYJB 4LSUL 4Q6YA 5EOTB 1FAIL 4NN6C 4PJ8D 3EYVB 5J6HA 3ZDXE 4NBYB 2AERT 4MGXA 1G6RA 2XY1A 3CDGB 1FGNL 3HNVH 3WHE0 5E6ZA 1CD1A 2H32H 3UAJD 4XWGL 3OKYA 4IRJD 4I3SH 2ID5A 5HVHB 3UTSA 4MYWB 3V95A 4JO1H 1Q72H 3EOBA 1NLDL 4E41A 1BIIB 4HS8L 4WHTA 5INDB 1KT2A 3O8XD 1FFPA 4B50A 4P2OA 5IBUG 4ZPVA 4WWID 4M7JL 3UJIH 1AKJA 3ETBF 4EQ2A 1C08B 2N7AA 4OT1H 5IJKA 4UOJA 3QUMH 1FNSL 2APFA 1OP3K 1IGFH 2MHAB 4MB3A 5E7FA 4HG4J 3N0PB 4P2QD 4P5TB 3D3VB 5GGUB 1GZQA 5DT1L 3ARSA 1GXEA 1YJDH 2C3HA 2Q76B 3VE0B 4WW1B 4XC3H 4JQXC 1CE6B 2BP3A 4R2GB 2BC4A 2ZG1A 5DQJA 1EDQA 4O58L 1ERNA 4NZRL 1A6VH 3C08H 4KROB 1PG7W 1U8KB 5IW1A 1ZKAA 2OZ4A 1L6XA 1WICA 1K8DB 3MRRB 1DUZA 3MLTB 2WBKA 3HMXH 1S8DB 4H0GA 3X3GH 3BT2L 2I24N 2HRPH 1VB9A 2FR4A 2EYTB 5FYKD 4P2CG 4PJDA 1M7DA 5D6DC 5GZND 5C0RH 1AC6A 3KLSA 5A16B 2F53B 3CX5K 2YPLE 3TJEL 4AEHH 1WK0A 4PV9A 5IW6A 1RIUL 4QHKI 4HC1A 4S2SA 3VCLA 1K2DA 3S4SB 4IIQB 3QIWA 3MRMA 5MERA 1KCRH 3H0TA 3ZO0A 3GZKA 3REVA 1BJMA 1AGCB 3U48A 4NM4L 1DVFC 1XGRA 4PJ9C 1S9WA 4R7NA 1ETZA 1RZGB 4HUUB 3D85D 1VGKB 4JVWA 4BUHA 3D39A 4GBXD 5T33H 5KTEH 4LVNB 1AD0A 3MMEA 4CBPA 1QZ1A 3E2HB 2ESVE 3MRIB 4PTUA 5EO1A 3DXAE 3BIKB 5I1JH 1B0WA 1P7QA 3OMZA 2VZ1A 1CLYL 2EDWA 1VADB 4F58L 5DUML 5SX5H 3ULVC 3ULSA 4K71B 4KTEL 3QDJB 3EYOB 5GRJH 2VXVL 1AI1L 1NCAL 4WU5B 1AH1A 3VD4A 2BNRE 4KKAC 1G7IB 1X5XA 5CZXC 1I9IH 3GRWH 3CCHA 4LGRB 4JKLA 1MFAH 2EXYD 2P8MA 4EI5B 1GC1C 1JUFA 1FBIH 1YEHL 3DO7A 2ZZUT 3FFCB 4KVCL 1IC7H 1J1XL 4LK4A 4I0PB 4OLYL 2DN7A 2G75A 3RUGB 5IESH 1WLHA 5EU3B 4D9RE 3LOWA 4PJGB 1HEZB 1XF3B 3GM0A 2MNUA 3MCKA 3S6CA 2EDEA 5FA3B 3AS1A 3VRJA 3EJYC 3MRLA 4XH2A 1D5ZB 1HKLH 5ID1B 2Z31C 3ARDB 3QHTC 1MFDH 4R4NC 4ZOBA 4E5XA 3L3DB 2GSIB 2E27H 1YYLL 2NNAA 5HI3D 1Z0MA 3NCYS 2B0SH 4TPRH 3WFDH 4OLEA 1A1NB 1J05A 2YEZB 3NIFE 1OGAD 4NFDA 4GRMB 4DZ8A 2XICA 2WZPD 3W0WA 4FFWC 5EPMA 2N1KA 4HXBH 4ZUVB 4JM2D 4JO4H 5ERWB 3GIVA 5E03A 4WI7A 3BPOB 4XCEA 4GQ9L 1UWEL 4JRXA 1RIVL 1MFCH 4AJ0A 4JB9L 5DRXA 1BGXH 5EA0L 3Q3GA 4TNWF 5IMMA 2A9ML 2AEQL 5ADPH 4CUCA 25C8H 1U8IB 1BAFH 1HNGA 1F13A 4CMHC 1A3RL 3BP4B 4IMKC 2HN7B 4KXZI 3U0PA 3VFRB 1P9MC 1K5NA 2PCPB 3HNSL 4LCUB 2VN7A 4RMWA 4Z5RB 4LP4A 1KN2H 2F15A 2V7HA 4MAYA 5AUMA 4OZHA 1S5HA 5C09D 4OM0L 4K3EH 4NQED 1FL5B 4EI6B 2EEAA 3BP5B 3QR2A 4L8SA 2OI9B 5I1DA 3V0WL 1F4XL 5JIPA 3S88L 4JRYA 4M6AA 1RJLB 1BVKA 3S37X 4NPYA 3GHBH 4U1NA 4N0CD 1IQWL 3GSWA 4TUJA 5I76A 3QCUH 2UUDH 3O6FB 3PWVB 3QNZA 1WFUA 3V5KA 2KL6A 5FM5M 5JOEA 2DMCA 3GI8L 3QHFH 1X5GA 3UBXB 5HI4C 3TN0B 2HVJA 4QY8A 4HBCH 4X4MA 4NT6A 3SGEI 5MI0B 5ACZB 3G6JF 1T80A 1C1EL 2PTVA 4Q58C 3GSVB 3HZYA 5B8CB 5L88H 2FH6A 2H9GB 2J88L 4QWWD 2HLAB 3PGDA 1YECH 2DDQH 4Y5YB 2DWDA 2GJZB 5GJTL 4XCCL 1I7UA 2IBZY 3FO0H 3QDMD 3OKMA 2X4PA 4ONFL 5CLTA 5F9OH 3SJVB 5KN5A 1YPZA 5C0FA 4FQPA 4N9OB 1FGVL 5E6YA 3TVMB 4EDXB 2P43B 5JW5A 3GO1H 4M7KL 3MJ8B 4L8DB 5F7DA 4N68A 5SWZD 4PFEA 2NY1B 4QRSA 3U4BL 1MQKL 4EIZC 4M9OA 3CU1A 4KK9C 5FUOL 1R0AL 4MSWA 2J5LC 5F7HA 5KBNC 5DR5H 3LKNA 3MV01 1NBVL 1YQ2A 4D2NA 3I50H 5SWQB 1CDCA 5DEFB 4MXWL 1BOGB 2BVQB 5E94A 4NKIH 2IADB 1D5IH 1F4YH 4RMRA 2OJZL 2HLFD 1J1PH 3F7VA 4POZD 4U0RC 1U8OB 4IRJC 5C08D 1UH4A 4LCWA 1Z9OA 2E6PA 5EUOF 1SYSB 1IM9B 3KJ6H 2ICWA 3MA9L 1RJYA 3NCJH 5ACLA 3IDXH 1U93B 3IDMB 4PGBB 1DN2A 2C7UA 1DL7L 1S5IL 3UJTL 3MV9D 2FIKB 5KVGH 5FEBA 4F2MB 4L9DA 3MLXH 2DM2A 3X13B 4F7EA 4P9MH 4K94L 3SCMC 5E24E 2ZUQC 4KK5D 4LCIH 3C8KA 1UXSB 3IAQA 1RFDL 4JFXB 4MS8D 2AW2A 1XGQB 3WSQL 5D5MA 1VDGA 2B5IC 3K1KC 4R6UA 4MJIB 1F8TL 5JDJA 1ZHLB 5JW4M 1MWAL 3ARFB 1CZ8L 1T66D 1IC4L 2NY6D 1E6JH 4OIBA 5M94B 1EEYB 2ED8A 3L3OB 3FB5A 4LRNL 1O7VA 4Y19E 5BZDB 1U36A 1Q1JH 1RUKL 4JQVA 1RVFH 3HPJA 2COQA 1WZKA 2BMKA 2EDLA 4BA8A 1BF8A 3NACL 5GZNC 4XVUD 3BH8B 3HTLX 4OFVA 4EJ1C 1CFSB 1OTTD 1F58H 4JCMA 3C8HA 2DKUA 2X1WL 1A9EA 3AREA 4GXVL 2J8UA 5JA8B 2W9DH 1JZ2A 1T21B 1AE6H 1WFNA 3MLZL 4Y0GA 3SDDB 1B6UA 2ZOLB 1EEQA 4OI9A 1MFNA 3VWKA 1KEML 4HFUH 5CGMA 2KDGA 4G8FB 2GT9A 4Z7WA 4H8WL 4HWUA 1YEJH 2DBLL 1NGZB 3CK0H 1AGDB 3BD3A 1RZKL 4S0TD 4HIEB 4BFIA 2IPKB 1N8ZB 4S1QL 3LKOB 5DO2D 2NY4B 5J06A 2YWYA 2V9TA 1BFTA 2F5BL 5E5UB 2GJJA 2VDNH 5TQ2H 3NABH 3B9EA 3MUY1 4JZOA 3RVTD 1DUYA 3VWJD 5FB8A 5T1LA 4UTBH 1IBGL 2QTEA 3EFDH 4PTTA 3VFGL 3QHZH 3MV8D 3RWCB 5AZEL 4ODWA 5DK0B 3BPNC 5H8DA 3SKMA 1CQKA 2OP4H 3O3EB 4KTDL 3HRZB 5BJTA 3L3IA 4GAGH 4LHUG 4L3CA 4MAUH 4DW2L 5HPMB 1FZKA 1CDGA 2C1PA 3P30L 1KJMB 4HF5L 1M71A 2AV1B 1IAII 3EYFB 4UDUA 1JGEA 3FB7A 1L9NA 1C5BH 2EXYC 5I75C 1P4IL 2P5WE 3U30C 1A7OL 5DRWA 5FM4A 4MXQC 1HHGB 3LN5B 1XEDA 3V6OA 2PNDA 3GMRA 3HC3H 4JHAL 4M7ZC 5FA4B 1DZBA 4QRUA 3LV3A 1HH9B 5GGRB 1T1YB 1MLBB 4HEME 1T0MA 5IR1A 2XZAH 3B2UD 3ES6A 1FYTD 1IEBA 2X70B 3EDDA 5I1KL 3OKDA 3VGHA 3L3JA 3BISA 3DX6B 3B9DA 1W8OA 4FZEH 4PD4J 4IOIB 4JO3H 4BZ1H 1LP9A 3PWPE 2IALB 2AJZB 5HI3C 2IBZX 4I77L 4HWEL 4LEXH 4LMQI 3QUYD 2F9BT 3QEHB 4LLUA 5KANG 1PY4A 5DQ9B 2NY5H 4M7LT 5CGYD 5L7XH 2BERA 4FQIL 4ORZC 4R0LC 5K9KB 3G9AB 4U2YA 3D0VB 4XBEH 2ZCHL 4Y5VA 4JM2C 4QNPE 4U1MA 4MA3A 1CFVL 1T04B 4AT6A 1U8MA 4CJ1A 3ZSTA 3MLSL 4OF3A 5KS9F 1MHEB 2V7NB 4R26L 4BKLB 5DD1H 1T4KB 4PJBF 5D7LB 2R39A 5D1XD 5K9JH 1ADQL 1KACB 4MNQD 4PJEB 2VLRE 4MJ5A 2BVUA 4L8BB 1AP2B 3O41B 1T2QH 5GISH 2WAHA 1CGXA 4ZYKB 4HW6A 5FHAH 4M02A 4P4KB 2AABL 3STBA 4DN4L 4UB0L 1LEKA 1NUNB 3DV4B 3KPPA 2I9TA 1UZ8B 1S7VB 3MPCA 5I18L 2H32A 1X4ZA 4U6XB 2FGWH 3U9UA 3JV0A 5DFTA 4LSUH 5J4MA 2FDBP 1INDL 4FQHA 4IM8A 4PRHE 3LMJH 4EXPX 3D2UD 1JMXA 3HAEB 1CIDA 4N0CC 2CKBL 1Q9KA 2GFBB 3U7WL 3CU7A 5CD3A 3JTTA 4KWUA 1NKOA 1CLZL 4R3SB 2IANE 4H1LH 4L3ED 4HQQL 4HS8H 4MD0B 4G9FB 3GDBA 1YEIH 3EO0A 1QUNA 5JIHA 2DOCA 3VDCA 1LWRA 4M7JH 1OB1A 2EECA 4Y8AA 5DXWA 1J8HD 1L7IH 1SEBB 4PJCA 3L3HB 2FSEA 4L29A 3WJLA 2MKWA 1I1AC 1FNSH 1KB5B 1UB6A 3ARGA 4NNYA 5ADOL 5C0CE 1JGUL 1G7JA 1ZLVH 3QULB 2UWEE 4DZBA 1G84A 5DT1H 4QWWC 5D96B 2Q6WB 4HIIB 2FJHA 3ZKXC 1BPVA 3EGSA 3HMXA 4HK0A 4YFLI 4D9QE 1NFIA 2A74A 3QEQB 4FQ1L 3QXAA 2XN9E 5ESAB 1VHPA 3WMSA 2VIRB 4Y1AB 4YHNB 4E9LA 1QVOB 3L9RA 1OTSD 1JWSA 1QLRA 3BT2H 3QDGB 4WU7B 3RZCC 2PW1B 3BQUD 1KTLA 4K55A 5L2KB 2XYCA 2CLZA 2EE6A 5BS0E 1A3LH 2ZCLL 5K9QI 3FB8A 4ERSL 5HYEA 5EU7C 3VXUA 3AAZA 3I3BA 5D2LE 1OAYL 5C0BA 5D70H 5DJZA 3KLAA 2CIKA 5KSBB 3BP6A 1UB5B 3PWLB 3MACH 2HLFC 1TETL 5TDOA 5SX4H 3MGAA 15C8L 4QTHA 4S1RL 1R3KB 3OJDB 3IU4L 4K3JH 4YR6B 4NQCB 1W0WA 5F72S 2JTDA 3FQXA 3H9ZA 5GRZA 5IVXA 1CF8L 2WINB 2FEEI 4HKZA 4WW2F 1YEGL 1QO3A 1G7HA 1ZOXA 4I3GA 1PQZB 2NR6D 1F3JA 3VU2A 3KDMA 3MYJB 2ATPA 4KK5C 4RNRA 5DWUL 5GXBB 2BRQA 2Q8AL 1CLYH 2P8PB 3C5ZD 3GRWA 4F58H 1GZPA 2YD3A 4KPHH 5DUMH 1GPOH 4NSKA 4KTEH 4U6HB 1T66C 3GUTA 1LQSR 5FM8A 1NCAH 1H3PH 4LDEB 1JNJA 1XFPA 2NY6C 2Q86B 1A02N 4WV1A 3TZVC 2VO5A 5IHZA 3VXSB 1R3LB 3QNXA 2AQ2A 2YD8A 2FL5B 3K2UL 5IBUB 5T3ZD 1I8IB 4J6RL 3BUYA 3H42L 4YHKH 5CHNB 3SDAD 4J3TA 5HJ3B 2G60L 1MELA 2DB8A 4KVCH 1J1XH 1N4XL 4NUJA 4APQB 3TPKA 2AQ3A 2G5BA 4JY6B 1KB9J 4KUCF 1FFOA 1OTTC 3ZYIA 3CXDL 2NXYB 4NQDD 3QA3A 3MRJB 5JDSA 2YHGA 3JV4A 5FF6B 3TIEB 4D0BB 1WC7A 4WHCA 1U42A 3WNPA 1N5AB 5E00A 5TF1L 4PRNB 4P59L 1OW0A 3U7YL 4BYHA 2E7LC 4X9BA 5BV7C 1ES0B 4P2QE 1QEWA 1KNOB 4YX2L 1U3HD 5DO2C 2OQJA 3VXPB 4FTVD 1G9ML 2VE6A 3IFOA 1S9KC 1IGTB 1AGEB 4WIQA 2BNUA 1HYRC 3SDCB 4GRWE 1W0YT 1BQSA 3VWJC 4QHMB 1RIVH 1S7SA 3VXMD 4KMQA 1X5IA 5MEQA 4XXCA 1BBJB 4BK4A 1RZJL 3LAFA 4HJ0D 1DE4A 4RFNB 1ZT1A 4KKCD 3QSKB 1A6UL 1NMCB 1S7XB 2JIXD 4P0DA 4QXWA 5FYKE 5C0AA 4YAQB 3WN5B 1JRHI 4ZUUB 1XGPB 4LLYB 4F7CA 1IL1B 2PXYB 3AXLB 2A73B 3Q1SH 4JG1H 3EW3B 5IB1B 2ICES 3MFFB 2O5XH 5I66B 1NMBL 3S5LA 3EJZD 3K8LA 4GG8A 3EDEA 1FH5L 2EKJA 5JW3H 2F5AL 5FO8A 3T8XB 1ZA3A 3BMWA 1F4XH 3S88H 5B39A 4ORGA 2VITB 4E42B 5MHSD 1WAAF 1HYSC 2UUDK 3OB0H 1IQWH 3RWFB 1ZANL 4X4ZA 3OF6A 3FQTB 3NCFB 1MHCA 3L6FA 1MCPH 4FRWA 5T5FL 3FMGH 5EZOL 2VLKD 4MNGE 2AXGB 5MENB 1QR1A 2VC2L 5TGBA 3V4UH 2OCFD 4OSUH 5L6YL 3MFGB 2OTUB 3RKDD 4TVPL 3UZQA 4F9LC 2W0FB 1E4XL 4XTRD 1EEZA 3QXUA 4L9LC 4NNPH 3DTXA 5IK3B 3O2WH 3S97C 3RHWF 1JI2A 4Z0XB 1AQDB 5JNYA 1DJSA 1S7QA 5ESVA 4QRRA 4O2CB 3X11A 5C07B 1FIEA 1ZHBA 2MMXA 4HKJB 4R4BB 1CYGA 4OJFH 1PYWB 2J88H 4FQCH 3VRLE 2Z0BA 3HZKB 2CK0L 5F1SA 1LK2B 1MREL 4LOUD 4RFOL 3WDIA 3RWDA 5D1XC 1OAXL 3W81A 4EUPA 4LKXB 3DX9B 1TIUA 3K4AA 2UV3A 3FOMB 3LN4A 1LO3H 2UYLB 1LGVA 4ZO6A 1YEEL 5ILTL 4HWZA 1FGVH 5DGQA 3LKRB 1HHKB 1OP9A 4J3XA 3SGDH 1R3JB 2QQLL 5KSAA 1DBJL 5FCUH 3MLWH 3BD4A 3U0WH 1LD9B 3QFJA 3DHJA 4HKBA 5DRZB 4Y89A 3U4BH 3O3BB 2Y72A 3GNML 1F6AA 3AU1B 5E9DA 4IOFD 3TYGL 4P99A 5HSFA 1KJ3H 2VAAB 4RAVA 3TT3L 2P1YA 4WWKD 2WQ8A 5TE6L 1GGUA 5FHBH 5A2LH 5A2FA 2A6KB 2YUWA 3HZMB 43CAB 4XRCB 3QQ3A 5DS8A 2APTA 1X44A 1YYMH 4N8CL 1L0XA 5CEZE 3G6JE 4YIQB 1QTYT 3RIFF 1FRGL 5DMIL 4LDOB 2K3TA 4XPTL 5FUZH 3HUJE 3KPSA 3R1GL 4NHUA 2DJSA 4JKPL 1OGAE 4LIQH 3MA9H 3CSGA 3SQOH 1RSFA 1NGQL 3LPGA 1QLEH 4OM1L 4M6MH 3RWJB 3RNQB 5KS9B 4Q6IC 1ORQA 4L4VA 3UPCA 3IKCB 1EFXD 3U2SB 2W1NA 4PLJC 4Z7NF 3NFSH 2XPGB 4OUUA 3OAYH 4YEFA 5MEOB 3L5WB 4HMCA 4ODTH 5IG7A 3QH3A 3GM8A 4AM0A 5EZIH 1MY5A 1HXYA 4DEPB 1SHMA 1H15B 1V3KA 1A6ZA 2YBRA 4M5ZH 5DMGC 4WI9A 1RJZA 2EIZA 1ZS8B 2VDPH 3W9EB 3NMEA 5C09E 3TJHD 1OTSC 4NQEE 3IXTB 1RUKH 4NO5A 4W4NA 5IBTH 1NGYB 1BFVH 4YHIB 1CFNA 1X4XA 5HDQL 4CMMB 3QEGL 2V2TA 1OF2A 4JR9H 4ZPTB 3MJGX 4X7TB 5TE4H 3U6RB 4RZCB 5JO5B 1PX3A 3RL2A 5DHVB 1D5BB 2YPLB 4GXVH 3ORJA 3BZEA 5I8OL 3BXNB 3VGGA 5KVEL 4KY1L 1D5MB 5FYJH 2ZSVA 5B3NA 1UACH 5T1MB 3MSPA 4K07A 4PPTA 2R2BA 3CZJA 3ARYA 1S7UB 1KEMH 4LLDB 3WS3A 2FZ3A 2FJFA 4H8WH 2P49B 3CFCL 5FGSA 2DQIL 5I15L 3MO1A 1TJGL 1RZKH 1DLFL 5HGHA 3HKFA 3JBG7 3NAAH 4R96B 3C6LA 5EC2B 4ODXB 1ZT7B 2ERJC 2NR6C 4PJ7E 4HXAH 4Y4KD 4XWOD 4DUWA 1J18A 1TVDA 5HHVL 1XIWD 4X80L 1NUDA 2ESVB 1NAKL 5D7JA 3QO0A 3QDME 1CGYA 1MCRA 4PV8B 3DXAB 3SDXF 3VFGH 1QYGH 1QSFB 1VENA 1Z2KA 3D0LA 3C87A 3WYRA 3IF1B 2HJLB 2DQFA 1MI5A 2AI0L 2XV6B 3P0VL 5SWZE 3I75A 3ROOA 4DW2H 2DLEA 3WE6A 5JOFB 5D9SB 3T0DA 1CK0H 2BNRB 1N2RB 4XC1L 4FG6D 2CJUH 2D31B 2NMSA 5EU7E 1P4IH 2VXUL 5IBLD 1A4KA 1FZMA 4FQLH 5BW7A 4IRSB 3SDAC 1T1ZA 5GRWA 5E95B 2NQCA 1INEH 1J0ZA 3ZZ1A 1BD2E 1CT8B 3QXDB 1MRDL 2DQDL 3JXAA 1EXUB 1X7QB 5I74C 3QXWA 2GYSA 2HT2C 3GI9L 1MCOL 5JIIA 4GW1B 2EDFA 5C08E 5DK2B 3RIAK 1G9NC 4R8WH 1KPUB 2IG2L 4AL8L 4I18B 1N3NA 5HGBB 5I1KH 2WUCH 1ZT4B 1OQOA 3QI9D 3HPLB 2H3NB 1EH9A 2FJGA 5KSVB 3QWOA 4XCNB 4KK8D 3QG6A 1MVUA 4PS4L 2ICCA 2UY6A 4U1SB 1RK1B 3UPRB 4UAOC 3MA7B 3P11H 2XKSA 1MCFA 2YS4A 1JMZA 3DURA 1FVDA 1MCQA 2X4OB 4LFHG 5E5MA 1URLA 3LQAL 2ZCHH 4F8QA 4QRPB 5AAMA 5GS2D 4ISVB 5GS1A 1EIBA 4M1DL 1CFVH 3IJYA 3B9KA 5CBEB 3BKMH 3ARUA 3ZTJG 3J8F7 4GAFB 2NY2D 3HFML 1ADQH 3B83A 4JZJA 3OR7A 2QR0B 5FV1L 3VJ6B 4Y16A 4HJ0C 4OTXL 9CGTA 4KKCC 1ONQA 1FN4B 3X14B 4U1IB 4LF3B 4Y2DD 3FONA 4DN4H 4LSQL 1U8QB 4F3FB 4LSSL 3V52L 4P46D 1VPOL 4U1HA 3T4AB 3EJZC 3H9YA 4UBDD 1JPTH 5EWIL 5HXMA 5EBLB 5DJ2B 1U8PB 4QHUA 5C0IB 1IAOB 4QEGA 4IS6A 4K3HA 3E6FB 4YBHA 3G5ZA 3K4DA 3GMLB 1Z6JT 4HUWB 2Z35A 3PWNB 2VDKL 4R4FL 1D3CA 3FFDA 3KAAA 4JEGB 4H5SB 1J9CT 3SE3C 3I02A 1FLTX 1P1ZA 3U7WH 4LHUB 1F00I 1Y0LB 5F89A 5DJ0A 4ODUA 1UKQA 4Z76A 4TQEL 4BSVA 4NYLB 2Y23A 1CLZH 1MIEH 4K7PL 1V5JA 1JGLH 4WRLA 4LAJH 3H6JA 5DMKA 3RKDC 5FAAA 2CD0A 5DC4B 3F12B 4LCYA 4OBRA 5IT2L 1FVCB 3MV8E 3UTSD 1BZ9A 1ZLVK 5ADOH 5CJOH 4Z7UA 3UJJL 3H3BC 5FGCE 4HAGA 4OCRH 5GGSB 4NKDA 4E41D 3H3KA 2ZOKA 4PREB 1Q0XH 4LOUC 3BEVB 1FJ1A 1FFQA 12E8L 2MQCA 4DQOL 1ACYH 5HHPA 4QHKJ 2E9IA 3BOVA 1G7MB 3F7QA 3RAJH 1OP5H 2ZCKH 1RAMA 5HHME 4FQ1H 5DLMH 3IETA 4MD4A 4XHQA 1CD8A 3G08A 4G8GA 3TGXA 4HH8A 5EOCH 4XXDB 1VERA 1WWWX 4PB9L 3ZT6A 1K85A 1FYTE 1TVBB 3GSXA 4IOFC 1YMMA 4ERSH 4GG6F 1JTOA 1UXWB 4YDJB 1EJOL 4Q9CA 4H26B 4KRNA 1OAYH 1H3GA 2X7LA 4PGZA 4XPGL 3FZUD 1TETH 3WIFA 1IQDB 3T2NL 1AXTH 4KMTH 3PIQA 4WTXA 4ZUSB 3C6SA 3IU4H 1GHFH 3PWJA 3EYVA 3F8UB 2R56L 1DBBL 4FQXB 3RGVB 1ED3B 1FNAA 1CF8H 4UT9H 5H35B 1YEGH 4F7TB 3CC5A 3O4OB 1CGSH 4HIJB 4WCYL 2ADJB 3QIWD 1O5DT 2XWJB 4UINH 4P2RA 3HAEH 5INDA 1AXSA 1CIUA 1RJCA 2BOCA 5LWYH 1HSBA 3RTQA 3TNNB 4MNQE 1U3JA 5D7IF 4FFZL 1FNEB 1CFBA 1I8KB 2XXCB 2EEBA 4FQJL 4MNHB 4UDTB 2Q8AH 3IVKB 5GGRY 1T3FA 5D72L 5CJQL 1C5CH 2MHAA 3RVUC 1EVTC 4KKLD 1OT1A 5B3JE 4PJXE 3D3VA 5GGUA 3WFCL 2PO6B 3U1SL 2VN4A 4UQ3B 3VE0A 2R2HA 4X6DE 1R5WA 1KB5H 1P7QD 4ZQKA 4Y19B 5I9QB 2HRLA 4KGJA 4J6RH 4LPWA 2VQ1A 2Z8RA 1RQ5A 1U8KA 2VJXA 4NN6B 2G60H 2PW2B 3KYMB 4XP1L 2F8OA 4FHBD 3NPSC 1QRNE 3HZVB 3EO1A 1N0XL 2Z92B 4OLXH 2XA8H 3KPNB 1JF1A 2FATL 5T3ZL 2A6JA 4L3EE 2FNBA 4XNZB 1RZIB 2F53A 3VH8A 3W9DA 3MODL 5HI5D 4YFLF 4F80A 3FQUB 1J5OL 2PUQT 1UKSA 5TF1H 2DQUL 1J8HE 2A0LD 2AK1L 3LB6D 3DUUA 5F1KC 3UEZA 3IYLW 2K7QA 3FN9A 3LIZL 4YX2H 4M3KB 3V79C 3STZA 1AGCA 4LLQB 2WP3T 4Y4KC 1KV3A 2Q87A 5EU4B 3EYSL 2YMXH 1XIWC 1VGKA 4AENA 3C5SB 3NFNB 5A2KH 1ZGLB 2R2EA 1D6EB 3CAFA 1KYOK 1C8PA 4KH2A 4EOWH 4NO3A 1S3KH 4G8IB 4O5LL 4AEIL 3W0WD 1DP0A 3QCVH 4HKXA 1K4DA 2BHUA 2Z9TA 4S11A 4QHLB 3BDBA 2FX8L 4JAMA 4JRXD 4PJIF 5F6HI 3BKYL 2P8LA 2P5WB 2R0KL 1DEEB 2D0HA 4TSCL 4NCDA 3NFPB 4PJFA 4Z8FH 1TZGL 1A6TB 4OD2B 2GHWB 2J4WH 3UROR 1TCRB 3DRTA 2KQMA 1MRCH 3OB0K 3RUGA 5CBAA 4MAYD 1EHAA 1DVFB 1HEZA 4PJ9B 1KLUA 3VFNB 5T5FH 5GSRB 2V2WB 1ZMYA 4HS6B 4LPUA 4I48A 4U3XA 4U6YA 2EH8L 5LCVH 2VDOL 5D7KE 1SJXA 4RISL 1UWGH 5CKAA 1RI8A 4JRYD 5L6YH 2JLLA 4X6CF 5ANMA 3ARRA 3LKSB 5LG1A 3TYFB 1Y18A 2GSIA 4XP4L 2Q20A 2VDRL 3QYCA 5CILL 4ETQB 5IFJB 3ZDYE 5ISZE 3HE6B 2YEZA 4WHYH 4GRMA 1YQVL 4HS3B 4V1DA 1EMTH 3KPRA 1OAXH 1UM6H 2I60H 4J23A 5AYUL 2FBJL 2FIRT 4W6YB 2VLRB 5T3ZE 1I8MA 1W72L 1YEEH 3OJ2C 5ILTH 4DOHE 1V7NH 4Q74A 5FGBA 5HYSA 5C0GB 1NC2B 5CUSL 2Y6SD 4M43H 4OLWH 1U8IA 2XOTA 5IVZA 1WAAE 3GNMH 3MRGB 4K9EC 3BP4A 1IGCL 1T2XA 3ISWA 4NQDE 2R23B 3VFRA 2PCPA 4UBDC 2ZKHL 3T77B 3IAPA 5AG9A 1B6DA 1IILE 2Z31B 4PRHB 1JWUB 4PY8I 2UZYB 2H2PD 1FL5A 3BP5A 1GGTA 2BRRL 1FRGH 2Y06L 3FTGB 1FNGA 3MOAL 4M6OL 3BJLA 4XPTH 3EUUA 2H2SD 4FTVE 3EZJB 1EO8L 3MXWH 2IANB 4OZHF 3IFNL 4OM1H 4PG9B 3KXFB 2JJUA 1RZ7L 4FMFA 1DQML 3P73B 3VXME 4RMVA 1JN6B 4LCWD 3OAYK 3VGDA 4NRXA 3TN0A 5C0CB 3V5HB 1F3DH 2UWEB 5DJYB 4NZDA 5ALCH 3SHSA 5FO7B 2H41A 4P2OC 2ITDA 2H9GA 5IJKC 5AWNL 3T1FB 2QV2A 1M6OB 4YXKL 1T1XB 2XN9B 2FHCA 5JA9A 1BFOA 2EC9U 5JW4N 3K7UA 3SJVA 5J6GB 5SV3A 4X0KA 3SKOB 4KQ3L 4YPGB 1MCSA 2OK0H 4PUBH 1U41A 5BS0B 1G0YR 3MJ8A 1HN1A 5MHSE 1SQ2N 5D2LB 5ABDE 1FORL 4N0UB 2VLKE 3FZUC 1YPZF 1DBKH 4MA7H 5JZ7C 4JFPA 5D1ZB 1N5YL 4TRPL 4WUUA 5EBMA 2MKLC 4W70A 3TA3B 4Z7NE 3NIDE 3VG0L 3CFCH 2DQIH 4M5YH 5I15H 1W0VA 1TJGH 4OD1L 3ARED 1DLFH 2VL5A 4TULH 2Z93B 5IB3A 1IM9A 4DAGL 4OQ1A 1VFBA 3QIWC 5JHDA 3NN8B 5HHOA 3M07A 3VWKD 1QSEE 5HHVH 3RA7L 4M7LL 4F15C 3IDMA 4A2LA 3LKQB 2FB4L 3M1BB 4RFEA 3K3QA 1QHPA 3TBYA 1XGUA 1MCWM 4F2MA 5I2IB 3FT2A 3X13A 4OCXL 5C3LD 3MBED 1CU4L 3P0VH 5F1NB 1UXSA 5GQBA 4D9LH 1XGQA 4MVBD 3TO4D 4XC1H 3FB6A 2J5LB 2X4RA 2XQBL 5I30H 3ARFA 1J11A 3GSOA 3L3GA 1EEYA 5CSGA 4UV7H 1N64L 1NQBA 1MRDH 5AZ2L 3O3AA 1E6OL 1SJHA 4U0RB 4ZFFB 3I2CH 3TNMA 2R1WA 3PHSA 2XKNA 4L8CA 4C55A 5A2JH 5HI5C 2GEEA 1RK0B 3L3KB 2YZ1A 4PBVC 3GJFA 3LB6C 3NIGF 4PP2B 3SCMB 3SPVB 2ZUQB 5B22A 3FAXA 4ZAKB 3IAGC 2DM4A 2OBGA 4JPKL 1NGZA 4PJHE 1IAIL 1YC7A 2B5IB 3A67L 1ADQA 4GRWB 2X4NA 4M1GL 5DJ8B 4OZIF 4FN0A 4Z7WF 2P45B 5IMOB 4NZUL 3HFMH 5MP6H 5E8PA 5I1CH 3PABA 4Y5XC 4UOW0 2ZUXA 1KC5L 2VXTL 1DBMH 1T7ZA 4QRTB 4CDHA 5D8JH 3RWCA 5IF0B 1FG2B 2A2QT 1MEXL 3HRZA 2EYSA 2BZDA 2DLTA 1ZVHA 1DN0B 3D18A 4U6VH 4AIZB 1NC4B 1RUAH 1U92B 5DD0H 3T0AA 4LSSH 5C71A 1LO2L 3EYFA 4LPVA 1VPOH 1X5AA 2ZUTA 4I2XA 3HR6A 4Y4HA 4OZGF 1GYAA 5EWIH 4UIKL 1NJ9B 2CKBA 2DLFH 2V5TA 2HFTA 3QEUA 1JNHB 1QKZL 2WLYA 2CDFA 3LN5A 2R0WH 4GOSA 4MAYC 1J0HA 3WL9A 3EIFA 2XIDA 4JFFB 2HA1A 4JZNA 2HG5B 5IVNA 4MNGB 1DBAL 3CMGA 3MREB 4L8SC 3P40A 1IM3A 4P9HH 1K6QL 3CX5J 1TVHA 1II4E 1KIUA 3DX6A 4LKCA 2NXZD 2WW8A 5C7XL 5LQBL 2LVCA 3BH9A 4X5XA 1RZFH 4YO0B 3X12A 1NDMB 5BRZA 3O8XA 5TH2B 2IALA 1AO7A 2AJZA 3GSUB 3T2OA 2P5EA 3ECBB 3UO1L 1HOCA 3H8NA 4ZUTA 2JCCB 3BPNB 4KZDL 3RL1A 1QOKA 2HH0L 1X5ZA 1A7QH 1P2CA 4OFDA 4HZAA 5DFVD 2OJEB 3PV6A 3FO1A 3UTTA 3KHOA 1OP5K 3AB0B 3RBGA 1T04A 3D6GA 1DFBL 3ARGD 5I75B 3KPOA 3ZE0F 5CZKA 5MEPA 4XPAL 2JK5A 3U30B 3WFHA 5CSBA 3BW9B 4LAQL 3OXSB 1NCBH 2M1KA 2Y1VA 3G5XA 5D7LA 5SX4I 3FL7A 2Y6SC 4XNMB 1REIA 4M7ZB 4PB9H 4RCAA 3N9GL 4L8BA 4NHCH 1I9JH 1YNTB 4R7DB 4OV5A 5EU6E 1IGJA 1KIRB 1U2HA 3F58L 3T0VA 5HHXL 5IP4A 1JTTA 1WT5A 4JE4B 1UZ8A 2DJ4A 1S7VA 4OF6A 2R1YB 4HWNA 3U46A 5J1TC 1YMHB 2VWEC 3ZKMD 4MD5B 2R56H 3U9PL 1Y6MR 3MBXL 1J1OH 5C3TA 1IGYB 2X40A 3HUJB 4J1UB 3JSSA 1OGAB 1A7NL 3QQ9D 1B3JA 2BVPA 1B0RA 4R0LB 5C0BD 3VI3F 2VDLL 1PKQE 4LSPH 5FYJU 5DMJB 5EIIB 2IH3B 3FQRB 3S36L 2JB5L 2VDML 4YDIL 2Y25A 3IU3A 2ZJSL 1R5VA 1SM3L 3OGCB 1QBLL 2IGFH 4POUB 2YSSA 1BMGA 4GBXA 3B4NA 3QJFB 3VXOB 4FQJH 4X7DC 5TFSH 1CFQB 1LE5B 3K1DA 5D72H 2V5MA 3L3HA 4NC2B 1OWRM 1KB5A 1PG7L 3WIHL 2D0FA 4HC1L 5AD0B 2KKQA 2VQUA 3QULA 4NC0B 1J88A 4MX7B 4F7MB 1FFRA 3ET9F 3WFCH 3C60B 4M4RA 4XI5C 3U1SH 1WBZB 1QNZL 3T2QA 2Q6WA 2LTQC 4HGWA 2C1OB 3S34H 5C09B 3P77B 4PRPE 1WZMA 2APVA 5DA4A 2AGJL 5IHUL 3EDJA 4JFQA 4NNXA 5IM7A 2GY7B 4J4PA 4M93C 5INCA 4QO1A 5DJCB 1EBAA 5GHWH 3NA9L 4XP1H 3WD5L 4OGYH 3QDGA 4WU7A 2Z91A 2FEEL 1Z5LA 1N0XH 3QXTA 3RWEB 5IHLB 4JQVC 1ZLSH 2RCSL 1FL6B 1P84K 3IDJB 1KTDA 1SBSL 2HKHH 3MODH 4OB5L 4QXGL 5KSBA 4M1CD 1UB5A 1YEDB 2DQUH 3WHXB 1UCBL 1WJ3A 3DLQR 3UTSE 3AREC 2RJMA 3LQMA 1I1AB 3LIZH 3PGFH 1D9KA 4EBQL 4E41E 1YEFH 3EOAB 1GVIA 4NQCA 5FUCC 2J1KA 5FYLL 1HWGB 4LLWB 4B41A 4PJ7B 3VWKC 3P4MA 3T65B 3VFPB 3JWNC 4NBZB 3ZKXB 3KWWA 3JWDH 3QDMB 3JTSA 3L7EB 3SOBH 1T5XB 3OR6B 1Q9OB 3BZFB 3Q6GL 3MYJA 4AEIH 3LD8B 4MJ6B 5SWZB 4D3CL 1NFDF 2BX5A 3RZCB 2P8PA 4KKBD 2ADGA 4K23H 4TYUA 2FX8H 1VEPA 1A1MB 1IT9L 1OCWL 3BGAA 4U6HA 1CN4A 2R0KH 2EC9T 2Q86A 2FCBA 1BD2B 3CH1B 1TZGH 2Q7NA 1DDHA 3I6GB 5DYOB 2DMKA 5C0AD 5IIEB 5C08B 2GSGB 4PJDE 4XCYA 1BM3L 1SJEA 5HJ3A 3JVGA 5GGSY 5L8LB 4WI4A 3S35L 3VGBA 2GI7A 1Q9WB 1ZEAH 5AEAA 1QHOA 3V8CA 5EUOA 1NKRA 3V6OC 3OL2A 2VDOH 4LGSB 3MRJA 2J6EH 2AV7A 3HMWL 1QFWM 4D0BA 1CD0A 5CFHA 5I1AA 3O9WD 3GMPB 4G43A 3D25B 4XP4H 1UG9A 3OF6D 2GK0B 1CWVA 4CGTA 1XR8A 1ES0A 1KCUH 1JRHL 2VMFA 3D39E 4HDIA 1KNOA 3IXAB 3VXPA 1YQVH 1UYWL 2BCKB 1B4JH 2NY6B 5EIVA 3P9MB 1KLFA 3TZVB 1AGEA 3SDCA 5AYUH 2LFGA 3PF2A 2ICWJ 2APWA 1HKFA 4Y5VC 1CG9A 4QRRD 4WUKL 3PQYA 4P3DB 3UMTA 2DKMA 1N0LA 4G6MH 2AEPL 5HHQB 4G42B 3U4AA 4KJQD 4HJGB 1QFUL 4HZLB 4YAQA 4XMPL 3AS0A 4UV4L 4GAJL 3MCG1 2A6DA 4J3VA 3TBVA 3MNWA 4OCWH 1JGVL 2DYPA 2ENSA 3VMOA 2R0ZH 1J87A 2PXYA 2A73A 3AXLA 1HH6B 5KSAD 1FPTH 2W65B 2VLLA 1H8NA 3KYNA 3WFEL 5C0EA 3QFJD 2F54D 3BPCB 1ZTXL 2IBBA 4N8VA 2AJXL 2BRRH 2Y06H 5BV7B 3MOAH 1OSZB 4PRDA 1ZV5A 3NPZB 3KR3L 5C6TL 2VITA 3I9GH 2AK4A 3UBXI 1CLOL 5HVGB 5DUBB 2NXZC 4P4RA 1U95A 3VWJB 3BKJL 1CVRA 5A43C 3MV8B 4OGXL 4LNVA 4JN2A 4X83A 4N8PA 3KPSD 2YA1A 3MV9A 1UGNA 4HT1H 5FGCB 2W0FA 2G2RA 5T1KB 2XZCH 3W0WE 1IEAB 1F90H 4LCCA 4XNYL 5IK3A 2ATKB 4G6FD 5DFVC 2AJYL 1SY6L 4O2CA 4JRXE 1YJDC 5BCAA 1NH6A 1JBJA 5D93C 1RUML 4AZ8A 3WJLC 1KXQE 3B8SA 2HJKA 3LRSB 4QXUH 1TZIA 2CLRA 5JHLL 1U8HB 1AGFB 2CGRL 5HHMB 4YXKH 2R1XB 3UZEA 1KXVC 2E7BA 4URTB 3ULVH 4OZ4B 4GO6B 4G5ZL 1ZLWH 1M7IB 5DUPL 4KRMB 1KIQB 4G6KL 5JUEL 3QT2A 4XBPB 1FYTB 5I1EL 1R3JA 2DTSA 4X9GA 1UADC 4GMTH 3BHBA 5E8NB 4EN3C 1NFKA 4NO0B 4XPFL 3E0GA 1LD9A 5EH1A 1ZHNB 2UVFA 1E4JA 4G6AD 4OZHE 5FV2A 1GC1H 3QAZB 5KW9H 3E8UL 1IGIL 4WTZA 1N5YH 2CMRL 4Z6AT 3S8WA 3AM8A 4E0RB 2VAAA 4JRYE 5DVNA 5I19L 4CU7A 3ZKMC 4QHNA 1RURL 3CX2A 4NJAH 2BDNH 2FX7L 3B9AA 5E6IB 4L9LB 2UVEA 3QQ9C 4D0CA 3W39B 5KG9B 3GSNB 2WMPA 4G7VH 4ZOAA 2CLVB 4MCYB 3T1WA 3VA6A 1AY1L 2NY3C 2WBJB 4DAGH 5IWLA 1IAIM 2CR3A 3PWUA 4N9GB 4W81A 3DRQB 1XF5B 4X4ME 2EXWD 3GMQB 3CDFA 1OD7A 1P4BL 2FB4H 2ARJQ 4C56A 1KN4L 1ZSDA 4MNQB 4NUGH 5F3HB 4YHML 1CDJA 3RNQA 4OUOA 5KS9A 1BIHA 4CNIA 3IKCA 2PR4L 3U82B 4PJBA 2PTTA 4JY5H 5BVJA 4OCXH 1V05A 1XZ0B 2D2OA 4IHOB 1TENA 5F1IB 4UILH 4PJXB 2JELL 4UIMB 1JGDB 3HG1D 1S9YB 5T5NG 3OV6A 5D7JD 3CFJA 4FABH 4X6DB 2J8OA 3MJ9H 5CEYA 5ITFA 4DGVH 3LZFL 5BO1H 3PNWB 1RY7B 1KFAL 1NGWB 2P44B 4OF5A 2QSTA 4U1GC 4GS7C 3DI3B 2XNAA 1N64H 3V4PH 2O5YL 1MI5D 3VXTA 1ZS8A 1R3HB 4YDLC 3D2UB 1B0GB 2B7DT 1E6OH 2VWEE 3H7BA 1ULVA 5I0DA 1K8IB 1S9VB 3DETD 1DQDH 3DBXA 1QRNB 1DSFL 1BZQK 1OT2A 3OAZH 5DGRA 3CVHB 4L3EB 3CLEL 4ZPTA 4N0YL 3UTQB 4YQXL 4X7TA 1HDMA 4FFYH 3BXNA 1I8LA 4I9WD 4O9HH 4Q6IB 1J8HB 2V5YA 5EB9A 1IEHA 4LCWE 4FXGB 2MPAH 2CRIA 4HWBH 4ONHA 5EDXA 3LRHA 4HIHB 4WO4A 4ZD3L 1S7UA 4XAWL 2EDXA 4XP5L 4XVSL 3OBAA 5E08H 3EHBD 3ZE1E 2ED9A 2J2ZA 4WGVB 5JQ6L 5CD5C 4P5MA 1KLGA 4S1SL 1OW0C 4R96A 1SYVB 1F97A 3WEXB 4HUKB 2B4CL 2Y7QA 4KHXH 4YHLL 3CVIL 4GQPH 3GGWB 4NZUH 1I1YB 5IMLB 1T5WA 4XB7A 4I3RL 2A9NL 4PV8A 3DXAA 5D5ME 5CZVH 1QSFA 2PTUA 2Z4QB 2NLJB 3GMMB 4O4YH 4X6FB 3B9KD 2PF6A 2HJLA 1OAKL 3MV7B 3FRUB 4OI7A 5D9SA 4XXCC 2BNRA 4GKNB 1EUUA 3CNKA 3MCLL 2UY7A 2RGSA 4Y16D 4A6YB 4OCSL 3WNOA 4KZEL 5F96L 2Y4SA 4UIKH