3IGFA

Crystal structure of the all4481 protein from nostoc sp. pcc 7120, northeast structural genomics consortium target nsr300
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
368
structure length
333
Chain Sequence
ALILTFLGKSGVARTKIAIAAAKLLASQGKRVLLAGLAEPVLPLLLEQTLTPDPQQIAPNLEVVQFQSSVLLERNWEEVKKLEAQYLRTPIIKEVYGQELVVLPGMDSALALNAIREYDASGKYDTIVYDGTGDAFTLRMLGLPESLSWYVRRFRQLFTNQVNNFLDKGKEALADPKRVAAFLVTTADPLEVVSVRYLWGSAQQIGLTIGGVIQVSSQTEGDLSAEFTPLSVTVVPDVTKGDWQPLIDALPNFVEQAEQAPKPITIDTHNRQVRLFLPGFDKKQVKLTQYGPEVTVEAGDQRRNIFLPPALSGRPITGAKFQNNYLIISFLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Atp binding protein
molecule keywords All4481 protein
publication title Northeast Structural Genomics Consortium Target NsR300
rcsb
source organism Nostoc sp.
total genus 101
structure length 333
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
A PF17886 ArsA_HSP20 HSP20-like domain found in ArsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3igfA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3igfA01
3K0AB 4TTQA 1TQDA 2F9MA 4NDZA 3ZS8A 4B43A 3LD9A 1X3SA 1HT1E 2OFWA 1UPTA 3RS2A 2B7BA 1GOTA 1TU4A 3CRMA 1H8EA 1SXJB 1VECA 3TR5A 3EPLA 3GLIA 1XMIA 2Z6VA 3LBIA 3A36A 4BLOA 1FP7A 1Q1QA 1GL9B 4G5OA 4DBLC 1CJVC 1GP2A 4BZQA 2V55B 1S3SA 2GNOA 2CG9X 1G4AE 1R6BX 4M1KA 1U0LA 2IWHA 2WTUA 1G5PA 1RYFA 2CJWB 1Z2CA 2ZR9A 4Q7LA 4YMUA 1T91A 2P6UA 1CR0A 4JYBA 4AC9A 1VYTA 3ICEA 5K8TA 5KDLA 5IHPA 2ZSAA 2D62A 3GEIA 3NH6A 4ASUA 2ZRMA 2ZROA 3K9NA 3X1XA 5FBVB 4OHXA 3X1DA 1LY1A 3HYRA 1F5NA 3OEED 3SR0A 4PAOA 821PA 5TXGA 4E03A 2HJVA 3HR8A 3BXZA 2QEQA 3SYKA 2VRWA 2W6IA 3VQTA 2RGNA 2CHVA 5FFMA 2TMKA 2OFOA 1I2MA 4MYCA 3T15A 4RZUA 5L3SB 2JLYA 2BKUA 1NNEA 6Q21A 4MGKR 2EVWX 4Z1MD 3VMFA 4NONA 2VA8A 3GJ3A 4Q21A 1UKEA 4MYUA 4EJSC 3C5CA 2WWXA 5KSPA 3RS0A 5CYPA 3SYNA 3KJEA 1KIMA 2IS4A 4JLDA 2NG1A 2QU8A 4BFXA 4P33A 4LV8B 3RS5A 2C95A 2E1RA 2Z4RA 5HCNA 2OBMA 2FZ4A 4LHYA 5FPKA 1TAGA 1B23P 2ZQ5A 4IDHA 3GFOA 2MSDB 1WA5A 3J81k 4QL3A 4ITRC 5EJEA 5DO9A 1S9HA 3WBKA 3ZQJA 2O5VA 4NYMQ 2HDNB 1EX7A 3HWSA 2DFLA 3FVQA 2O8FB 1W4BA 2MMCA 3B82A 2IYWA 4AURA 1CF4A 3F3YA 2P6NA 4P4TA 4DKXA 5EUQB 4M1TA 1AZTA 4UNRA 3IEUA 1WB9A 2G9NA 4YONB 3AM1A 3QKUA 3PUWA 1HH4A 3DKVA 2O8EA 2JCSA 1VIAA 2OFXA 4C30A 2MSEB 4Q00A 1Z06A 2V9PA 1IY1A 2R44A 3L8YA 1VG1A 4B6EA 5E7MA 1OFTA 2KBEA 2HV8A 1IY0A 1G6HA 1S2MA 4I1UA 2GA8A 5H70A 2ZRIA 5CITA 5CDFE 1MRSA 4RKEA 1ETUA 2C03A 3U3RA 3VQLA 4FMDB 1NVVR 4C0KA 1EESA 2GVDC 4TL7A 3R9IA 5IK2D 3AF2A 2F7SA 3RS3A 4U5XA 1MABB 3PEVA 4KFRA 4PZZA 2FFBA 3QORB 2NQ2C 3NIBA 5F9HA 5DS2A 1YZLA 4IFEA 4A0FA 5H1YA 4R7ZA 2ZR0A 5HCIA 4C9BA 5AUPB 4TQUS 2RGNC 2GXUA 2JASA 2ZSFA 2JAQA 2R9VA 4D2IA 4YMSA 3IDQA 3QBVA 3TSZA 1A4RA 3FMFA 5LD2B 4Q47A 5JRJA 4O2RA 4OK5A 1PVOA 4I88A 2LKDA 2XJ9A 3CW2A 4AYWA 3AKYA 2Y22A 4G5RA 4Q01A 3SBEA 3DVLA 3TMKA 5SZJA 4M1WA 3OE7D 1M1YE 4TSFA 4AWXA 2J0UA 4CT5A 5F3WB 4A92A 4MKFA 4DRZA 2OG2A 4WBSA 5JEDA 2F1RA 3BB3A 2EFHB 4FXPA 2HUPA 3KJIA 4YE0A 1E2MA 4EDHA 3KTAA 3W8RA 4HAUA 4OQNA 5EP4A 5A0FA 1RKBA 1G19A 3U3MA 2WIAA 2PL3A 4B3XA 3UMSA 3AVWA 4IEEA 4TLEA 1M74A 5JI2E 4PO1A 3RC8A 1G3UA 1QRAA 4YLGA 4PSAA 4Q4AA 2PCLA 4QBFA 1R7RA 1SVSA 4IOMA 4BASA 4Q9LA 2PMKA 4WW0A 2ZJ2A 3LVRE 1Q12A 3N70A 3AKEA 3IBGA 2VF7A 1KI6A 1BS1A 4URXR 2GXQA 2A5YB 2G6BA 3C14C 2KI5A 3GCGA 4PHTA 3D8BA 3TSOA 3K0FB 4DT1A 4PFSA 3BFXA 4OHZA 4DLYA 2FE4A 1UDWA 2OBNA 4C7OA 4MRRA 2Y1ZA 2GVZC 2NPFA 1G8YA 4LWZA 4M0LA 4B2LA 1D2EA 4B32A 4DIEA 4GOXA 3K09A 3DPUA 4E5UA 1E0SA 4HUTA 1XD2A 1M7GA 2ZE6A 3HR7A 1W36D 3CKLA 1J90A 5FUXA 4E09A 4M9SA 1I4DD 2ZYWX 2RGGA 2R2AA 2HCJB 2KBFA 4BLPA 1ZNXA 2ZI7A 4Q4HB 4URYR 3BB4A 4JUSA 5CLLA 3GP8A 3KQUA 5DH9A 4Q1BA 4IVRA 1OB2A 2ZRNA 1FQKA 1ZIPA 1KMHB 2ZRJA 1XTJA 2JDIA 4MDEA 4B3GA 4LYFA 4NPHA 3KKOA 3DMDA 4G5GA 3QPVA 2WJJA 2AR7A 2ZE5A 4ZCLA 5KYKA 2N0KA 1DADA 1P3JA 1X86B 2XJ4A 4QGGA 5FOSA 521PA 5KU1A 1SVWA 1Q0UA 3K0SA 2JLZA 2JJ2A 1GG2A 1K8RA 2YWFA 4DSOA 1N6PA 1OH8A 3M4YA 4IDNA 1F2UA 5LDDC 3KB1A 5JJLA 2J9RA 4FMCB 4PC2A 1L7VC 3IEVA 5FTKA 2JLRA 3DKPA 1S8FA 3TR0A 1U8YA 3C7KA 2YINC 3OEHA 2XSZA 3UIEA 4NZYA 4DDUA 1KO5A 4RZKA 5L3RA 4C2UA 1VHTA 2PZGA 4A8JB 2QRZA 4LCBA 1FPMA 5L3QB 2WJIA 621PA 1JJ7A 3IQXA 1W46A 5AJXA 4JKIA 4H1VA 1M8PA 2ZSBA 4LBWA 2QM8A 4PANA 1JQJC 4DUGA 5HE9A 1U0HC 2XNDD 3TRFA 3IUYA 3OAAD 4OBEA 2CNWA 1G3IA 3GJ0A 3KXKA 5EP2A 1VCMA 3TW8B 4F92B 2VHQA 1AM4D 4QM7A 5J4VA 3RDPA 3QF7A 4TLAA 3TQCA 2QSZA 1YR7A 2QMHA 2G1KA 5DHFA 1TF5A 3K70C 1XCGB 1XXHE 2G3YA 2XB4A 1KY3A 5A5GA 3AVPA 2AD1A 2YOHA 2OV2A 2QGNA 2WJGA 3VR2A 3I4LA 4LX0A 4LC1A 1U81A 2A7QA 5DISB 2AL7A 2ODBA 3W90A 1RIFA 2NO1A 3THYA 5H8WA 2PX3A 2QNRA 5J40A 1NN3A 1CRQA 4WIAA 3LA6A 4B44A 2Q6TA 2XZLA 1W44A 4R2IA 1ZUHA 1N25A 4LBVA 2FFHA 3EUDA 5HR5A 3TLXA 4LJ6A 4GP7A 1P2VA 5JWOA 2FF7A 3V4RA 1WMSA 3QF4A 2H16A 4PC7A 3GD7A 5E4FA 3S1AB 3BAFA 3E1SA 3DM5A 3OEEA 1U8AA 4HDCA 4GZLA 5EZ5A 4KYIB 1NG1A 1VG0B 5LPNA 4DLSA 2BHRA 4P4SB 1NRJB 4WAUA 1OXTA 1TNDA 4DSUA 4CRWB 2LKCA 1U8ZA 1WF3A 5KPJA 4N3NA 5SZKB 2O0HA 2BDTA 4DLRA 3U7HB 5J4YA 2Y1YA 3VKGA 3AVUA 1IXZA 4Z1MA 1XXHB 2ONKA 2HF8A 1NL3A 4RFSA 1FNNA 4JVSB 2YHSA 2WWYA 2VP0A 1SZPA 2ZRKA 1N0UA 1E79D 2OCBA 2EYUA 2EFDB 4B3BA 2FFQA 2ZI6A 1SVKA 4RFVA 4A0RA 5EP1A 3TGPA 1UFQA 2WKPA 5KO2A 1LW7A 2VHJA 2ORIA 3I72A 2D4HA 1ZJ6A 2QZ4A 4BUJA 2PEZA 1J70A 2QT1A 1SXJD 3NVAA 1LFDB 4QBGB 1PUIA 4KO8A 2V54A 4UNPA 2A78A 4L15A 3A1UA 3P20A 3J07A 2Q9AA 4US2R 1Q1ZA 1AA9A 4BZXA 1W0JD 1JEDA 3JZMA 2QORA 3LNCA 1A2KC 2Q0HA 4TMKA 1IAQA 4C0LA 1WBBA 3N3EA 4UQOA 1WQ1R 1NG9A 2OUKA 1R0WA 2CLSA 3AUYA 4FD2A 4PTLA 5AJVB 3VFDA 4A4DA 5BYKA 3MG9A 4ARZB 2ANCA 2D3WA 5JJKA 4JT4A 4NL4H 1CULC 1W48A 3ADDA 1OH7A 4URUR 3L0PA 1WRBA 1L4UA 2OLJA 4ZI2A 1F48A 2FSFA 2QA5A 1Z6TA 2J0VA 2V7QD 3FWYA 1Q22A 2QROA 1DTSA 3CR8A 4LY6A 1X8JA 1E1RD 1KAOA 1Z6YA 5IK2A 1ODFA 4QHSA 3KKNA 2FGJA 2IX3A 4TMXA 3T61A 1VHLA 2OM2A 1XD9A 5H68A 3U3JA 3LW8A 1OHHD 5FUYA 2IF2A 3I1FA 4OQXA 3PIRA 1KK0A 4IJMA 4M1OA 1NN0A 2ONJA 3I8SA 5AUQA 4HB3A 3CONA 2OCYC 2W00A 1D6JA 3FPAA 4FWIB 2O8CA 1VYUA 1FMJA 4JLMA 3QXJA 1B0UA 4JL6A 5JSZB 1AK2A 2GBLA 3BORA 5JLJA 2OEPA 1ZIOA 3OE7A 4K8OA 1DG3A 4LC0A 1AGPA 4QJ3A 2AKAB 2QP4A 3QKRB 4JBYA 4XIGS 3CF0A 4O2LA 4C0JA 1KO4A 3LDAA 1KI3A 3QKTA 3QKSB 4XTCS 3BWDD 4B2IA 2GCOB 4DVGA 1CTQA 1T6NA 2YKGA 2P5SA 3SI7A 2KMWA 2WJVA 1FTNA 2C04A 2F43B 1ZMXA 2FV8A 2OCPA 3TE6A 2XEXA 3UG7A 3H2YA 1FUUA 1HT2E 3HJNA 4KU4A 1L2TA 4OL0A 2IYRA 1OXVA 2ODWA 5KTYA 5CB8A 1DPFA 5FOVA 1YZGA 5F2EA 3BFKA 3EA5A 1UJ2A 2JATA 1P61B 2GCPA 2FU5C 3TUZC 3MJHA 4LOAA 2X2EA 1YQTA 3WBJA 4TMWA 4KVGA 2OILA 4TYNA 2XITA 4FN5A 1FX0A 5DI3B 3ASZA 5EZ6B 3QG1A 4MKGA 2VP2A 2RGAA 1DVRA 3RNLA 2V1UA 1DAHA 2IYLD 1VG9B 2OBLA 2GXAA 3QORD 4EPVA 2OLKA 2ZJOA 1EK0A 5D3MB 3OHMA 3UMFA 3TUJC 2WWWA 1COWD 2H7VA 4XD7D 4BWYA 2VTKA 2CMKA 3HYTA 4TTPA 5BWMA 4FIDA 2OHFA 4IXMA 2WAYA 3BJIC 4PC3A 4DXAA 3PQCA 4EPTA 4DDWA 4F4IA 4UJ5A 2B8WA 3HDTA 1FUKA 2EYQA 1GRQA 5BW8A 2ZYVX 2CHGA 1UBGA 3RRYA 2JLVA 2D7DA 4AKEA 4C2TA 2C9CA 3ZS9A 2VSFA 3ND9A 4II7A 5FUWA 4ZV4A 3KQNA 1UKYA 4GFDA 4BEJA 1FQJA 5FOXA 4DEYA 1N5KA 1QHHA 4DDTA 1RC8A 1PZNA 2YNMA 3E70C 1XCPA 1F6BA 1YE8A 3NBZC 5TV2A 5FOWA 5G40A 4CZ2A 3IO5A 1N5JA 2GBLC 4HB2A 3BERA 1RL1A 2WSMA 4ZIRB 1HE1C 2KB0A 1P60A 1NF3A 4ZCIA 4WZ6A 1XMVA 1T0HB 5JFGA 1P73A 2VSXA 1ZNZA 1TQ6A 1R8QA 2ATXA 1J8YF 4GDFA 3FKQA 4XOIA 2J87A 1JJVA 4HLDA 2IUUA 3UK6A 1AS2A 2REXB 2YYZA 2PJRA 3TAUA 5KNBA 2ZRAA 1BOFA 4BFZA 1E9FA 3AQ4A 3K9LA 4FW9A 3EZFA 3B1VA 1E96A 2NIPA 1E3MA 1OW3B 2P6RA 1SVIA 1E2GA 1IN6A 2QI9C 2CCGA 1GRNA 3P27A 4MUBA 4PAMA 1JI0A 3X2SA 1EFUA 3WHLA 1NSFA 4EJSB 3QXSA 1SXJE 1A5TA 1G8HA 1EX6A 2OESA 1S96A 3Q7QA 2ANBA 5FPTA 1EFTA 1OPXA 1YRAA 4Q4JB 2XNDA 5CK5A 3CRQA 4LJ7A 3U61B 3OAAA 2PLRA 2A2ZA 4ON9A 3TNFA 1X8LA 2HXYA 3NH9A 1NLZA 2VQSA 3SZRA 4D4JA 1QHXA 3AVYA 4CEHB 4HZUA 1G4UR 1Z6XA 4XWOA 1NMZA 1G3QA 5FTLA 2UKDA 3L0IB 4UJ3A 5HE8A 721PA 4JL5A 1WP9A 2ERXA 4DLVA 1GIAA 2WKQA 2WMOB 4R2HA 2IYVA 2R6GA 4ZJ9A 4EFMA 3AP3A 2ZI4A 4LSGA 3M0EA 1TMKA 4WZBE 4FI3C 5E95A 1W36C 2ZAMA 4CEJB 2DR3A 5DN6D 1GNRA 3KJGA 3RRNA 1GM5A 5JEEA 1E2IA 2WJ5A 3QVVA 2G83A 4J0QA 4PPNA 2ZITA 4M1MA 4IDOA 3LVQE 5EUMA 4C0BA 2A9KA 1ZM2A 4MYTA 2W2XA 1SKYB 1ZM3A 1Z0FA 1TEXA 2VH5R 3FHOA 4JJKA 4KLNA 4BFTA 1YZUA 4DCTA 2GAAA 1RFLA 2V8OA 1LV7A 2Q21A 2QN6A 2W58A 2OZEA 2WBLC 3SYLA 3ZZTA 4D80A 2BEKA 2JLSA 3I32A 2J7KA 1M34E 3B78A 4TTRA 1N6OA 1YHNA 2E9SA 1IM2A 1A82A 2RGXA 3TAHA 3ADKA 1U9IC 4JL8A 2K8QA 4IVPA 1XRJA 4US0R 3Q5DA 3LAWA 4QC2A 4DZZA 3WNDA 1G7SA 1XB2A 4XVRA 3I92A 5JCZA 4M5SA 1X1SA 3T1QA 3K0EA 2FEMA 5KNCA 2W0MA 2A5JA 1HQCA 3WMGA 4QJ5A 2QTFA 2HF9A 4RD4A 1Z0JA 2GHIA 1HE8B 3ZZ0A 4QM6A 2QG6A 3BH7A 4NP6A 1G7RA 2HJGA 3V9PA 3B6EA 3NHAA 2ZS8A 4ACBA 3K53A 5FL7D 1E79A 2CCKA 4LZZA 1NVUQ 4IOJA 3SE0A 3LH5A 3K0AA 2YVUA 1KDTA 4LI0A 5BN3A 2HEIA 4D81A 1CEEA 1E0AA 4M1SA 5BXQC 3ADCA 2ZU6A 4QFMA 3SOPA 2PEYA 3VNVA 1N6HA 4MRPA 4KITB 1SXJA 4ABYA 4CT4B 3DHWC 4C4PA 3MWKA 2FDCA 1MKYA 4Q1AA 2BM0A 3GEEA 1VYVA 3A1VA 4TLDA 5IT5A 2EWVA 1KO7A 4RD2A 1G5TA 3L0OA 1E99A 4A6XA 2A5FA 4P4UA 1XD8A 2FEOA 1W0JA 4D25A 2QTHA 4Q4LA 4NH0A 3W6NA 2CJWA 4X8HA 1Z08A 2C98A 3B1XA 3NDPA 2RMKA 1KTVA 4RY2A 3QPUA 3LBNA 3MSXA 3MFYA 3B2EA 3W6OA 5JCPA 2BMJA 3IHWA 1AN0A 4US1R 3GMTA 3AB3A 3CR7A 3P32A 3ZZUA 2ZRPA 4H1UA 4M9ZA 1DAIA 5B2ZA 4I1VA 1KKLA 1ZD1A 2O8EB 4MKIA 1BYIA 2WKRA 1U90A 2V7QA 2ZI9A 1PV4A 1UAAA 4AYXA 4Y0AA 1M7BA 1A1VA 1N6KA 2ZUDA 2ORWA 2WOJA 2VF8A 1E1RA 1E9CA 1NKTA 1E2JA 1XZQA 3M1IA 4CVNA 3AEZA 2ZM5A 5L3SA 1JQLB 2GK6A 2YOGA 3FKSD 3NEYA 2ZE8A 4HI0E 1QHNA 1XNJA 3RSLA 1W7AA 1OHHA 1OV4A 2IXGA 3MGCA 4W5JA 2CL0X 221PA 4LGMA 2VHUA 4DLXA 4EQ6B 4HATA 4E22A 3QUSA 2P3SA 5DSZA 4LBZA 4ERNA 3EARA 3C4JA 4PZYA 3ZIAD 3L1EA 3ND8A 4MITA 1XFAA 1X8KA 4FMDF 2EFGA 4MGIR 1GILA 4ZDJA 5E7IA 4DJTA 1KMQA 1II8B 3KXIA 2RH0A 2VHTA 2XTMA 2QGZA 1SHZA 1S3GA 1WCV1 2CCJA 4D4LA 4Q48A 4AI6A 4QKQA 2REOA 4F4JA 2AXPA 2O8FA 1SGWA 5J5CA 1ANKA 1GVNB 4HLUA 5GJBA 1H65A 2C9YA 4HAXA 4JVMA 4E07A 5KUTA 1NY6A 1R5BA 3L82B 2RKOA 4B73A 4RCYA 1XTSA 1FFHA 1VPLA 1AS3A 3AACA 1QDEA 1ZNWA 2ZEJA 1KI8A 4HAZA 2AK3A 3AH8A 3AUXA 4TLCA 5JS7A 4LHWA 2HCBA 2G1JA 4Q4AB 2GAOA 4Q5IA 2WOOA 4A2WA 1VKJA 1ZVQA 4LBYA 3THXA 1XF9A 2Q3FA 1G17A 4ACAA 4JBXA 3RS7A 3SS8A 1NLFA 1P2SA 5TB5A 1ZP6A 2MSCB 3NBXX 1RZ3A 3PXGA 3WNBA 5LB4A 3CX8A 1Q3TA 3EZ7A 4KI0A 2IYUA 3FYHA 3NBFA 4TT3D 2LWIA 3TVTA 3PEYA 3SFZA 1D5CA 3GLHB 4NBSA 3F0TA 1F60A 1SHSA 4PXAA 3KZ1E 3CWQA 1KDRA 1MABA 5FTNA 1VCIA 5D3QA 3NC1C 4C7OB 3QORA 2QL6A 2IYSA 4MRNA 3K70B 4B2PA 3K0CA 1YR6A 1F2TB 4PQYA 2R6FA 1COWA 2SHKA 1EG7A 4XD7A 3QE0A 2J46A 2XOKD 2B6HA 1FNMA 5FBRB 1E9BA 1VMAA 2QT0A 1GNQA 2R65A 2W6JD 1MOZA 1CR1A 5FBQB 3L0SA 1G8FA 3QEJA 4BFWA 2KLRA 2CL7X 4KBGA 2CE7A 2FSHA 1AZSC 1HA3A 2CHQA 3ZVNA 3KFXA 3QSYA 2IC5A 2BBSA 2JLWA 1JAHA 1H8HD 1SVLA 3UWOA 3CH4B 4TYQA 3W5JA 4ZI3A 2FN4A 5IF9A 2ZRDA 3R7WB 4D4MA 1W2GA 5F98A 1EFRD 1W47A 5SZHB 1GFIA 5EXPA 3U5ZB 3BH0A 5LB2A 1Z0DA 4KFUA 2ASEA 3K8YA 2W83A 2ZI5A 3CRVA 1Z83A 3SU8A 1Q21A 4N1AA 5CJPA 2VHCA 4IXNA 5CDFA 3VU9B 5L8VA 2J0QA 1Q57A 4I99A 1OKKD 1PLLA 2BBOA 2OXRA 4LV6A 3EG5A 3P26A 2QMEA 5TARA 2NMVA 4BE7B 4B74A 4HLUC 4NCIA 2IBMA 4TN1A 4V0KA 1MO4A 4OJKA 4BGDA 3U4QB 3K0FA 3JVUA 2GDJA 3GLGE 2FJUA 2CVFA 1FP6A 4AD8A 3Q5EA 1C9KA 5FI0B 2ZREA 1VCNA 1Q44A 4FMCF 4LDJA 1OH6A 1ZYUA 5G41A 3RRMA 1QG4A 2F1HA 3U3OA 2XXAB 4NKRA 3AP2A 2A3RA 4BFVA 4KLZA 2HT1A 4L9WA 1J2JA 1G291 4HDOB 8OHMA 4ZKEA 5GJVC 1R0XA 4BLSA 4TMTA 4AIIA 2H92A 1NN1A 1WE2A 2BKEA 1G3MA 1HEIA 3KB2A 3QXXA 3U7FB 3K9HA 1ZU4A 5AJYA 4A82A 4WOPA 4CF7A 4Q4HA 2NGRA 1G5RA 3U2QA 5TVKA 3EW9A 3RABA 2RHDA 4ZDIA 1OJLA 1ZRHA 3GUFA 1KMHA 4FINA 3Q8XB 4UXHA 2FZLA 1RJ9B 1WBDA 3B85A 2PH1A 4JYCA 1KJZA 4CEIB 1OYYA 2QPOA 5DN6A 4BECA 3FMOB 4DCSA 2FPLA 1YR8A 5FL3A 4LRWA 1NSTA 3PJRA 5AJZA 2JLXA 4XSHA 3KL4A 5KOYA 1E2PA 5GADl 3W3AA 3U44B 2IF0A 3W34A 3H86A 2N3JA 1RW4A 1CRPA 1EFHA 3GLFB 3EPJA 2GESA 4KVAA 4JLNA 2V4ZA 1GL7A 1JBKA 2BM1A 1OFUX 5C46F 3K09C 3LX5A 1PLKA 2V6JA 3GLGB 1E32A 4ESHA 1XTRA 3GLAA 4RCZA 5TDHA 2O8DB 2JJ8A 2R62A 2WM9B 2YC2C 3QNUA 3R20A 4A8JA 3QY0A 2Q3MA 2IA5A 3BH6A 4W7SA 5GJCA 5L3QA 2G0TA 3THOA 1G6OA 1E4VA 4AKIA 4B75A 2ZIAA 5JS8A 3QQ5A 5LUMA 1GTVA 4XSGA 1EWRA 1NP6A 121PA 1XMSA 2BV3A 3CRW1 1XDBA 3KUCA 3MMPA 3WYGA 4JLPA 3ETLA 2Y8EA 1J99A 2D2FA 3LFUA 2V6IA 1UF9A 1ZAKA 3T5GA 1TF2A 5HZKA 4RSGA 1CLUA 1J7KA 4RKFA 5FL7A 4PC1A 4HUQB 3NC0C 4OHYA 4O0MA 1KI7A 4OI2A 5C18A 4PQFA 1QHGA 3MWJA 2B92A 4YL9A 1N6NA 3IIMA 1N5IA 3B1WA 1VTKA 2NO6A 2YC4C 3DEFA 3B13B 3GQBA 4B3CA 4S35A 1TEVA 2VP6A 2W2TA 4RD3A 1O87A 1XEXB 1R8SA 1W5SA 2ZS7A 2BVNA 4Q1EA 5AJWA 5FTJA 5DS1A 4JLKA 2O8BB 1TUIA 1YZNA 2EWWA 2Q9BA 5FBWB 3I5YA 1OIWA 4JKYA 1R10A 1X1RA 2BMDA 4QHTA 2F6RA 2QAGB 2ZXUA 3EZ2A 1XEWX 1R4AA 1E2HA 3O8DA 1NMYA 4Q1FA 2GZHA 1HY3A 5K8IA 3O47A 4GPTA 1ZM9A 1GWNA 2Z5FA 4K46A 2R6CA 4Q18A 1IN5A 4TL6A 5CYOA 3CF2A 3S1AA 1DAEA 4DSTA 2ZRLA 1IN8A 1BMFD 5J47A 4M22A 1E0KA 1A7JA 4WZAE 4ILEA 1EWQA 4QGFA 2B7CA 3EIQA 3EZ9A 4P4SA 2ZRGA 3KX2A 3LW7A 1E6CA 5KNDA 5G53C 1QBKC 1M6NA 3IIKA 3LLUA 3FKSA 4QBIA 1PJRA 2NOAA 2JKIS 1ZC4A 5FH9A 2FSGA 3QG5A 5FOTA 3NEJA 2BJWA 1KI4A 2WSSD 1XXHA 1HURA 3LLMA 3CPEA 3KKMA 1AS0A 2CEAA 2OXCA 1C1YA 1DELA 1RRPA 4EIWA 4LPSA 2CLCX 4Q9IA 3V00A 4AY2A 4CGZA 3EX7C 4KSBA 3ZIAA 3A1WA 2PZFA 4G5SA 2AWOA 1T3SA 1W5TA 3WP0A 4RZ3A 2BWJA 4ZPXA 4BQSA 4PO9A 1P4SA 3D3QA 4B71A 3QVUA 5JBQA 3RVBA 1FTSA 1Z0KA 4JSTA 1BKDR 2ZSDA 1E4YA 1MRNA 4ZO4A 3CWZA 2BEJA 1NN5A 4KCGA 1ZCBA 1E9EA 4GZMA 3CRRA 4MUAA 2GF0A 4WXRA 1GNPA 3RAPR 3UXMA 2C77A 3EPKA 3OIUA 3Q7PA 1U94A 2VBCA 1JXOA 4D0NA 1P9NA 4Z8YA 1CIPA 1JEEA 1XEWY 2WJHA 2ZPTX 4OYHA 2UVQA 1ESNA 1Z22A 3UANA 4ARZA 3MRSA 1D9ZA 2HLDD 1US8B 3B9QA 1QVAA 5HKKD 1SVMA 5FBLB 3TW4A 2B8TA 4C0SA 1KK3A 5BN5A 4LJAA 1OIVA 2YOFA 1KZGB 2IEYA 2MNWA 3X1YA 1RRCA 4TT3A 1RYHA 3CNOA 3H1TA 3RSOA 1W4AA 2CXXA 4V0ME 2BC9A 3B1ZA 3GFTA 3C41J 4BLQA 4M4SA 5HZHA 2PCJA 1QF9A 3LXXA 3RRZA 5KSZA 1XPUA 3L1GA 2BIFA 4D26A 4HSEA 4HB0A 4YMWA 3EPHA 3BOSA 4RD1A 2OO7A 1NJFA 4JSYA 1P6XA 2XOKA 4GMXA 4MRVA 1E2LA 4YXWD 3R9XA 1SHKA 2W6JA 2IK8A 2H8KA 5EXXA 2QP9X 3T12A 4CDGA 1E1QD 4XVQA 3DL0A 5FR1A 5JSZA 4FEIA 3REGA 3X1ZA 1DG1G 4Q1DA 4A1FA 2J1LA 1T8TA 2IUSA 2OAQ1 4TQAA 3KJHA 5JZVA 4DB4A 2FFAA 2DWQA 3Q9QA 5DE3A 3QKRA 3K9GA 1H8HA 4PHFA 2GEVA 3MCAA 3QKSA 3BBPA 2GCOA 2WZQA 4JT2A 5FOUA 1EFRA 2OAP1 4UNSA 4NMMA 4B6FA 1MT0A 2QUZA 4JBWA 2OT3B 4MA4A 2F43A 2QBYB 4LHXA 1JPJA 1E2KA 4BRWA 5DGXA 2GTPA 3CNLA 1KYIA 4IHQA 2WWGA 2NZJA 2R8RA 1XTKA 2GZDA 2XTZA 4HAVA 4H9GA 4Q9HA 2FH5B 1OKKA 2WPDD 1OH5A 2KWIA 3EC1A 2GILA 1Z8FA 4MDFA 4EFNA 3HP1A 4EPYA 1FMLA 3I61A 4AK9A 3ZLJA 1E9SA 2GXSA 3L43A 4FWTA 1YJ5A 5F9FA 2N1BA 2J41A 3JVVA 3FFBA 5KPDA 4JVNA 1OF1A 3CZPA 3PENA 1ZBDA 4JLVA 5DI3A 3FB4A 4MKHA 1R0YA 2RAPA 3B1YA 4Q7MB 1DOAA 2RB4A 2VP4A 4UKDA 3D7MA 4X8MA 3X1WA 2H5EA 2DFNA 3GLIE 4C0HA 1FL9A 1OXUA 2VIIA 3K70D 1WGVA 1Z3IX 2IXEA 3OZXA 1GKIA 1UKZA 3KXLA 4Q7JB 5D3MA 4G01B 1SKYE 2ZAOA 2CK3D 2QAJA 3VAAA 1P2TA 1YRBA 2IYYA 1D2NA 1HTWA 2KJQA 3BIFA 3GT6A 3I73A 2RGBA 1UADA 3FGNA 1VDZA 1V5WA 4CYMA 5JHHB 1X6VA 1BO6A 5GJWC 3RC3A 1UDXA 2P2LA 4A15A 4AKGA 5EXSA 5E3HA 4M1YA 2D74A 1CJUC 3KKPA 1CXZA 4XVUA 4P3YA 3CX6A 1VG8A 2F3TA 4LJ5A 4WXPA 4HB4A 4NYIR 1MO5A 1XBTA 1M7HA 1W0KD 1JNYA 3CF6R 5KHOC 1Z5ZA 3OIVA 2C96A 3IBYA 2FMXA 4M53A 1N3BA 3CPJB 3I8XA 2WWFA 5HPYB 3VKHA 2FWRA 1R0ZA 1W1WA 1ZD8A 3SJAA 3TSWA 3TK1A 2VP9A 2XZPA 3VR5A 4N0EA 4EAQA 4ZIRA 3THWB 1DO2A 3MUFA 4Q02A 3EA0A 4Q19A 3E2IA 3SQXA 1MR3F 2ZTSA 3QOFA 1JR3D 1TX4B 5B58C 4MGYR 4NCHA 3W6PA 4LV5B 5GVRA 3LXRA 3OFND 1E0JA 4X8OA 3BS4A 1S0UA 3AF1A 1KDPA 3FMIA 1G64A 2XGJA 1T3LA 2C5LA 3UPUA 2DCUA 4G3XA 5C4GB 3GLIB 2WICA 2ZRFA 4DDVA 4YC7A 4YDHB 2W2VA 5UKDA 2IHBA 4ZCMA 1BIFA 3MJRA 2XCMC 2F9LA 5ELXA 4MYHA 2FPKA 4QBHA 2JIZD 2O0KA 2GWHA 4EJSA 1GUAA 4GSYA 1IN4A 1XJQA 3ECCA 4D0LB 2R6AA 4LPKA 3T1TA 2EFEB 2AN9A 4PR0A 2EQBA 4LJYA 3ZD6A 4PPGA 2D2EA 3A1SA 3A8TA 4D4KA 2WV9A 4D6PA 1Q20A 3A4NA 2F55A 2P0EA 1IXSB 1NI3A 3B5JA 4CEHA 4GT1A 1W49A 4X8LA 1KSGA 4JMPA 1DAMA 2PT7A 4BRUA 1BH2A 3T5DA 1NLYA 3SN6A 1ELOA 4L8GA 1D8TA 2BOVA 1EFCA 3REFA 2QE7D 4I4LA 1RRGA 4IDPA 4LK2A 1RE0A 2DPXA 2FPMA 2ODEA 1Q3HA 1XU4A 4OQMA 4KODA 5CIQA 3SJCA 2QPAA 3CM0A 3PEWA 3LX8A 2GEDA 1KSJA 3ZVMA 1IJEA 2ZJAA 4A9AA 3N5CA 4CEJA 3KKQA 1SQ5A 4YDZA 5EE0A 2DFTA 1Y63A 1CR2A 3HU3A 1W2HA 3ZYCA 3MAAC 2IL1A 4C0QC 1ZCAA 4WA7A 4URZR 5KDDA 1QHYA 2OE2A 1DO0A 4GL2A 3DOEA 1LNZA 3BB1A 3N2IA 1UBCA 421PA 2QQ0A 4GBMA 4RZ2A 3PUZA 1WFIA 2F1IA 4PHHA 1JAIA 1KZ7B 4XWKA 4I81A 3SDZA 4Q66C 4OK6A 1BMFA 1Z07A 3VHLB 3FFAA 2C78A 2IYZA 3AVVA 1P9WA 3ZDQA 4B47A 4POAA 1RRFA 4IW3B 3W1ZA 3GEHA 3WRYC 1Z47A 3OESA 3IILA 4NYJR 4ZDWA 3A4LA 3NBYC 3PITA 4RZXA 2WIBA 3EIEA 2UZIR 1SKQA 3NXSA 1XEFA 1YZTA 3WY9A 2EU8A 1CJMA 2DYKA 4MH0R 4LYJA 2JJ1D 3SJBA 2KE5A 3PUXA 4DIDA 5K8LA 3B60A 2WSSA 2V3CC 4Q9JA 2BBTA 5EE5B 4CIDA 3VTKA 2ZUCA 4HDQB 1IBRA 3CZQA 1ZM4A 1ZU5A 4JLBA 2ZJ5A 1OIXA 3DZDA 3IHLA 1LVGA 3IIJA 2QENA 3LV8A 1KSFX 2R6DA 2BBWA 4UNQA 4LHZA 3SHFA 3QJYA 1IY2A 2ATVA 1RPZA 3AGPA 4PO8A 1Z0AA 1CKEA 2AFIE 2AD5A 1ZNYA 2QM7A 4YLBA 2X77A 2UZ3A 3V4FA 1D9XA 1YZQA 4NCNA 5CJ2A 3IO3A 1T5IA 3EWAA 3LO5A 3GLHE 1S4QA 1QG2A 2VPPA 3LRPA 1JR6A 2RGCA 4PBDA 3DM9B 4KXFB 3T1VA 3NG1A 1G7TA 5C2JB 2YV5A 4M5TA 1GKUB 4LJ4A 5DLQC 5G3ZA 3T35A 4D0GA 5FI1B 4DLZA 2ZR7A 3TIFA 4JUTA 3QPWA 2HLDA 2JGNA 1E2NA 1AGRA 1T0JB 1XTQA 2VSOA 1G9XA 1OFHA 3GFPA 5FTMA 4GRAA 3WP1B 5HKKA 1NIJA 4A2PA 1ZINA 4QGHA 5J4KA 4Z8XA 4Z54A 5KDOA 1IHUA 4G5QA 3THXB 2J0UB 4PC6A 2J45A 3EC2A 1IONA 1KI1A 5BN4A 2FOLA 2IEZA 2J59A 1CBUA 3AVTA 4EPXA 2AKYA 1Q1BA 2OSBA 4YMTA 4KBFA 4DCVA 2ZJBA 3KTAB 1ZC3A 2JA1A 3OIYA 2BCGY 4XWAA 3ZJYA 3SHWA 4DEXA 4A0GA 5FUVA 2GRJA 1SXJC 2GJAA 4JLJA 1P75A 3WRXC 2J0SA 2WJYA 1NKSA 2F1JA 5J4LA 3NTUA 2ZJZA 1II0A 3EXAA 4FCWA 4TLBA 4EFLA 1XPRA 2CVHA 2IS2A 1X5MA 2Q3HA 5JJIA 5J4HA 3SQWA 5EE3A 3AF0A 1VCOA 5G3YA 3VQMA 4YXWA 4EQ6A 2A5DA 2BMEA 3IGFA 4KFSA 3NWJA 2DWPA 1JR3E 1KI6B 1E1QA 4MJHA 3VHXA 1NY5A 5DNYB 3ZVLA 1BYUA 4DT1B 3A37A 2N46A 4EPRA 2ZRCA 4Q03A 1LB1B 4Q9KA 1II8A 1T4GA 3QBTA 3SJZA 1R2QA 1E2QA 1YZKA 3I62A 1TTTA 2VLIA 2ERYA 3DOFA 2CL6X 4NYIQ 4QXAA 3BD9A 2NO7A 5FPYA 1E2EA 3IPYA 4MQBA 4TWZA 4TMVA 1XCMA 1XD2B 3P4YA 2HT6A 4V0NA 3PV0A 1RVDA 1HUQA 2GJ9A 5IDVA 5HTKA 4JVLA 3WHKA 4A2QA 1S9DA 3QI2A 5FR2A 5DYIA 3ZGXA 1GKYA 4LUCA 1IJFA 1OYWA 1U99A 5AK0A 1AJEA 4JJZA 2WPDA 2I3BA 2GF9A 4IDQA 2NPIA 2I1VB 2ZRHA 3QEOA 2X19A 1KGDA 4YQFA 1KO8A 1WDTA 2J3EA 3LQQA 1E9DA 1G8PA 1N0VC 3RYTC 5CK4A 2ZS9A 1KO1A 3VNUA 1YVDA 5JWRA 5EP3A 2DWOA 4XTRA 2RHMA 1T3HA 1O3YA 1ZUIA 3QXHA 3U3KA 1KK2A 1P7CA 1NBMD 2DBYA 2XNSA 4QNMA 5EQTA 2ZI3A 4HLCA 1A2BA 3GLHA 3KFVA 4URWR 1TQ4A 3BK7A 1F2UB 3TBKA 3B9PA 5EXTA 3VX3A 3OIWA 2VP5A 2ZYTX 4B76A 2A5GA 4DWJA 4RD6A 2AWNA 1F2TA 3FOZA 2CK3A 4WVFA 2WWIA 3T34A 3AV0B 3GJ4A 2X8AA 3GLFE 2B21A 4A6PA 1NVWQ 2VEDA 4NHOA 1ZW6A 5CLQA 4JIMA 4OHWA 1N0WA 4JLOA 3W3ZB 3JZAA 5DHAA 3DMNA 4TQ9A 2DB3A 2ZE7A 3VX4A 3NHBA 4LYAA 3HU2A 3PEUA 4B3DA 4LJ8A 1TF7A 1W0KA 3DO6A 1UBEA 5AR1A 1CJTC 4DLTA 2VO1A 1GITA 4IKEA 1IOZA 1OFIA 4Q7KA 4PSKA 3R7WA 2C9OA 2PLFA 1GRRA 3BE4A 3LQRA 4G1UC 5M04A 2CE2X 1ONBA 2QP3A 2VYFA 5C4MA 4TYWA 1SULA 3AKCA 2FG5A 2IYXA 3ASYA 3C16C 4U7DA 3SFVA 3G5UA 1JR3A 3QORC 3CNNA 3LY5A 3VU9A 1G7CA 3OFNA 4LJ9A 3K0CC 5CIWA 4OI0A 5EE1A 2Z83A 2QPTA 4TZ0A 1DARA 1G21E 2GJKA 2QQEA 4DHEA 5JRZA 2YWHA 5LD2C 1S1CA 2ZJ8A 3KUDA 5L3VA 2XX3A 1U2RA 4I1OA 3U4QA 4KHZA 3E5HA 3THYB 2JIZA 3DZ8A 3ZH9B 4V02A 1LF0A 2G0NA 1T5LA 4KYUA 1R5OA 3UG6A 3AABA 3CB4A 2IYQA 4OHVA 4NYJQ 2FX3A 3KQHA 4L9SA 1DS6A 2ZSEA 3PVSA 5CB6A 1DBSA 3CPHA 3QXCA 2XXAA 4I1SA 4HLQB 1GMEA 4BEBA 3FTQA 3ZQ6A 4DCNA 2JLUA 4IVQA 2NTYC 4GI7A 3W8NA 3QF4B 2P65A 4IOLA 1MH1A 5P21A 2XAUA 2EFCB 4C3ZA 4F93B 3UWKA 2WHXA 4U02A 2QY9A 5C1BA 2ZVQX 4G0NA 2ZANA 2QE7A 3AP1A 3W5IA 2G77B 5CM8B 3RWMB 2QTVB 2XTNA 2Z4SA 2PX0A 1LF5A 5DI9A 4UXIA 4M21A 4F7WA 1SVOA 2H18A 3RHFA 5EE9A 3PUYA 1Z2AA 3A58B 1G41A 1RJ9A 4HAWA 1LS1A 4BFSA 2O52A 4CEIA 4OQFA 4AG6A 4A36A 1IXRC 4DLUA 3NDBB 4RFSB 4DCUA 3U44A 1V43A 3GJ5A 1TADA 2J7PD 2C8VA 5JWHA 5KSYA 2HYIC 2IW3A 4AKHA 2CLDX 1CP2A 3CBQA 3GLFA 3CUEF 1PLJA 4UXJA 3IQWA 3PG5A 3KQLA 3ICQB 4O3MA 3FHTA 4PCKA 3GJ7A 4B35A 3EWSA 3GLGA 1N6IA 3HPQA 4NTZA 4M2LA 1U0JA 2O30A 4TZ6A 1UEJA 2O8DA 4DSNA 2HYDA 5FPSA 1G3RA 1H8ED 1KI2A 2IT1A 1E9AA 2RH5A 2H17A 3VR3A 3A6PC 4GNKA 2C2HA 1XJCA 4R9UC 2GEUA 3RLFA 5DYGA 1KKMA 1E2FA 2AXNA 2BJVA 2X1VA 1EJFA 3P4XA 3Q9PA 1XJ0A 3A4MA 4PX9A 1L8QA 1T9HA 1UM8A 3SNHA 1XTIA 3VR1A 2IUTA 3U7GA 2WMNB 2JJ1A 1D2MA 1XWIA 3R9WA 3RS4A 3WYAA 1NVVQ 1VIYA 2IHYA 3TJZA 4ASUD 4GP6A 5KSOA 4HUQA 1OXXK 4AYTA 1TUEA 1KSHA 1W4CA 1KHTA 4K81B 4NCKA 2O0JA 1JPNA 4O25A 5B64A 4PZLA 5LBIA 3C15C 1FOEB 3TUIC 4NCJA 2J5XA 1Q1EA 2W0SA 3ADBA 1L4YA 4LYHA 1EGAA 2CBZA 2QRNA 2JLQA 3UMRA 2W6ID 2A30A 3F5FA 4P0TA 3QIAA 4IFBA 4OKSA 3AKDA 1KOFA 1XEXA 2YZ2A 1OT3A 1HV8A 4PSVA 2O8BA 3ZVRA 2D06A 4A8JC 4URVR 3B8HA 2C99A 1M2OB 1T8UA 1NBME 3AVQA 2NZ8A 3F8TA 4GOJA 3EZ6A 2QAGA 3G0HA 2REBA 3AF3A 2BOLA 4NE2A 5JECA 4FCTA 1ESMA 3Q9LA 4QNRA 3FMPB 1OLOA 3LWNA 2O8CB 1KJWA 4QJ4A 4PQRA 3VKWA 1HYQA 4P32A 1G18A 3TVDA 3MWYW 2HXSA 4F4CA 1WXQA 2QMUA 4V03A 4Y0VA 4QRHA 1E94E 1Z6GA 4NU0A 1AQUA 1GL6A 2WAXA 4LHVA 4KSCA 3AGQA 4GMDA 5AUOB 2MMGA 4GOKA 1Z0IA 2WVJA 4B48A 3RANA 2GKSA 3U60B 4M9QA 5E7JA 1AKYA 2QSYA 5AWFC 1UBFA 1P72A 2DFKB 2P5TB 4QHYA 1XMJA 4YMVA 4EUNA 1QVRA 3T1OA 3EASA 1XP8A 4PHGA 3RWOA 2H1LA 3UKDA 4L16A 2FA9A 3MLEA 2AFHE 2GZAA 2BMFA 5CM9C 4ZKDA 1OSNA 2GCNA 2PBRA 1Z28A 3VR4A 5FPHA 4HEJA 1IQPA 3CO5A 3W9YA 2IXFA 1CJKC 1J8MF 1FW6A 2I1QA 4P31A 4HAYA 4FMBB 4RJLA 3NKVA 3AVXA 1JXMA 2ZYUX 2ZU0C 1KNQA 1Z29A 2Q9CA 4ELDA 4U00A 1MO6A 2KSQA 4IRUB 4QG7A 2GJ8A 4C0AC 3G82C 1P9RA 1FX0B 4OI1A 1PUJA 3BFVA 5JMTA 3P1JA 2DHRA 2YJTD 3SEAA 1U98A 2PMDA 3O8CA 4KAXA 2ORVA 2FSIA 4V0LA 4EPWA 3EAQA 1W36B 3ZD7A 1G20E 2RGEA 4CW7A 3KQKA 4MRSA 4W9MC 3VR6A 2FGKA 3WXMA 4XH9B 2E87A 4PAQA 3O8BA 2EW1A 3AF4A 1Y3AA 4BLTA 1AIPA 3FHCB 3HPRA 3L8ZA 4B34A 4Q1CA 4L5BA 3WMFA 1GDDA 1DEKA 2GJSA 1US8A 4D82A 1LS6A 2IYTA 4MGZR 1KK1A 4NYMR 4W5WA 1E98A 4TSFD 3H84A 2QAGC 3CLVA 2RCNA 3GJ6A 1DE0A 1DAGA 3TQFA 3H0KA 5K8UA 5TMPA 1QHHB 1KAGA 3SBDA 4ESVA 4W5HA 3U7EB 4DC9A 2ZJYA 1NBMA 1KY2A 1QZXA 1NIPA 2F3RA 3MD0A 3QENA 3K1JA 1P5ZB 3T06B 5A4JA 1CS4C 1GSIA 1S1MA 1ZUNB 4OQLA 3Q3JB 4BPBA 1Z63A 1ZM7A 3C8UA 2Z0MA 1TU3A 5B57C 1NJGA 1XPOA 1DAFA 4AG5A 2ZRBA 2ZETA 3R8CA 1TQ2A 1TPZA 1MO3A 4TL8A 1K5DA 1N5LA 1G16A 2N42A 3GPLA 2XB2A 5IRCD 5B30A 3CIOA 1I4LD 2XZOA 4YDSA 2NO9A 5JHGB 3M6AA 4Z51A 2QMOA 2NO0A 3BRWD 4QOSA 1YKSA 4S2EA 4FCVA 2WJ7A 1Z6AA 2JEOA 1W4RA 3CX7A 1C4OA 4OK3A 1XZPA 3Q72A 1K5GA 2RGDA 1R5NA 4OI4A 4KFTA 3L2OB 1DAKA 4ZDKA 3GJ8A 4YLCA 2ECKA 4KV9A 4R98A 5SZIA 2PT5A 3MWLA 2YWEA 1QHIA 2AK2A 3BGWA 3N2EA 3ONWA 2X2FA 4JLAA 1G1MA 4BFYA 3R8FA 1UEIA 4DB2A 4HZUB 3L1FA 1NMXA 1U9IA 2QBYA 1F3OA 1GZSA 1E69A 2WWHA 4TYYA 2VL7A 2V1XA 1LTQA 1YU9A 1TL7C 3CH5A 3WYFA 3TKLA 1YR9A 4R71A 2ODNA 2ZUBA 1CU1A 1N6RA 4QGAA 2IWRA 3FDIA 2PJZA 2AX4A 4V0MA 5DIFA 1K6MA 4F91B 5ANRB 1QHSA 1CR4A 2JDID 3WNCA 3O8RA 4BFUA 1AQYA 4RVCA 4KJZA 3U6BA 3I5XA 1FZQA 2D7CA 1IN7A 1JALA 2CDNA 3KDSE 2GETA 4JZKA 4RD0A 4B3FX 5JI3E 4B33A 3HU1A 1AKEA 1KI9A 2JJ2D 4F38A 4TMZA 4UNNA 1I4TD 1HQYE 3C5HA 1OE0A 2FNAA 3H4MA 3LBHA 3PFIA 5BYJA 3I3SR 2G88A 3D6TB 4DLWA 5GVSA 3OEHD 2XSZD 3PR1A 5BQ5A 4HZIA 1JB1A 1E2DA 4TL9A 4XJXA 3SC3A 1N6LA 3Q85A 1N2CE 4PPQA 4A0HA 4N0DA 4IOKA 1XX6A 1OB5A 1JECA 2BCJQ 2IS1A 3TH5A 1WH0A 2Z43A 3A1TA 4M8NE 4L4UA 1KJYA 1ZD9A 3FE2A 3BC1A 1OXSC 4JS0A 2AHOA 3WMEA 2K5UA 4BZPA 1GAJA 1E9RA 1NVXQ 3AVOA 1G8GA 2L0XA 3D31A 2ZVPX 4Q4JA 4TYPA 2OCAA 4EKDA 3EIHA 3PUVA 1MV5A 5AUNB 4IEIA 4BLRA 1II9A 4M9XA 4DUGD 2IS6A 3IKJA 5TY0A 1KDOA 2YWGA 2H57A 3IPXA 4PPFA 3DDCA 1I2DA 1P2UA 1KNXA 3U6KA 2CNWD 2J7PA 4V0OA 3OF5A 4OJQA 2DY1A 2CR0A 2LCFA 1EXMA 1P62B 3B7GA 4HYYA 2I4IA 2P67A 2PZEA 3UATA 3PCRB 2GK7A 3GJXC 3THWA 1UKVY
chains in the Genus database with same CATH superfamily
2IHTA 3BLPX 2E37A 3TB6A 4RAHA 4UUQA 3UJ7A 4DGQA 3K6SA 3KCNA 1KXJA 3IUMA 4JZNB 4GYYA 1I8IA 4FGUA 2OGTA 1Q91A 1CY1A 4J9UE 1AZVA 2FXIA 2UWEF 1Q8MA 1B90A 5K3BA 3VVBA 1K9TA 1QH8A 1G5PA 4BFKA 4JFQA 1KAMA 4GECA 4JYBA 1JHXA 1BDHA 4KN5A 2ZROA 4GOMD 5E4JA 2WSIA 3EVNA 3PS6A 3F90A 5HI5C 2QEQA 5CXXA 3V1MA 2WKOF 1TZGL 5CG2A 1OBCA 4HDSB 3LVBA 4MYCA 3FT3A 5L3SB 2JLYA 3V1KA 2BKUA 2YWZA 1NR5A 3C60C 4ZSOE 6ADHA 4AX8A 4Z1MD 4B7AA 4G8GE 3VUAA 3Q98A 4Q21A 5B22A 3GU3A 3WY2A 4RHYA 2GFQA 4BV3A 1N6QL 4FABH 4XX0B 2AV1A 2Z4RA 3TN0C 3I9KA 2MSLA 4K6CA 1BA3A 3ATDA 1WS7A 5TLSA 1TTUA 1MX5A 3PZRA 5HQ3B 1R47A 5ANMA 3GMOA 2EYSB 3ZU2A 4R3UC 4FR0A 4QTUB 3SPJA 2VMCA 4P4TA 3BN9C 1DFIA 4Z4EA 3KGTA 4PGEA 4M1TA 3S8MA 5GP1A 3DAHA 1WUTA 2VJBA 1DSFH 4QRFA 2HSWA 2B16A 1WB9A 1A9EB 3WNKA 5I7EA 1F3JA 3OR7A 1JIIA 4UQ2A 3D4CA 3PJEA 2O8EA 3VFOB 1SD5A 2MTAA 3ZHOA 3BKMH 4QRPA 4LGYA 2OYKA 3RB7A 4X66B 3LXCA 4QARA 3REWB 4NJAH 2DS4A 2PCPB 1LW6E 1I3NA 4M8SA 1M42A 1J9SA 5GV7A 4M6AA 2IWEA 3QLJA 5HPMB 2DDQH 1L6IA 1EGVB 4O4HB 4IFEA 5C1OA 2YASA 2QTZA 1QFWL 5BS0B 2NR6D 2RGNC 2Z1KA 2JASA 2ZSFA 3W6UA 2Q1UA 4Q47A 5IAJA 3RYIB 2XJ9A 5IDWA 4EE2A 4X6LA 1EZSA 1DKRA 4P53A 3AU0A 4IBWA 2YMMA 4KQ4H 3DIVA 4E0RA 3S68A 5IPFA 4DJFC 4FXPA 4F9LA 1UBSB 3KTAA 3ZY7A 1JN6A 3IJ8A 3A1EA 1OGIA 1GS6X 1MFDH 1D5ZB 4NZTH 4ZPVB 2WWMC 1Z5LA 2P77A 3EDCA 4F9FA 4JYPA 5L2KA 2DSTA 3N04A 2A5LA 4BZYA 3BSSA 1AGNA 5T1JA 3FUHA 4ZX6A 1SJHB 1XZCA 4DT1A 1YHPA 3BFXA 2VL5A 3UXEA 4RPLA 3KL5A 3OHXC 4ZAKA 4DPCX 1MN4A 4TUUA 5TDOA 1R3HA 4WK0B 1V45E 2Y1XA 5SY9A 2VIRB 4C56A 4HUTA 5HGXA 5F6IC 3T7CA 3FH8A 4LLDB 4RSVA 3K4ZA 1U2CA 2XVZA 2CGRL 2BX5A 3L3GB 4UIKL 3BB4A 3VJLA 1VIMA 4UMFA 4GXVH 4FFWD 4DLKA 4RL4A 4G6JL 9PCYA 4PJBE 1NC3A 3J7AC 2JGDA 4J2QA 5K2OA 1CLVA 4MV6A 4O02A 2JLZA 5FI3A 3P9MB 4ZFZB 3ROLA 4Y2YA 4YIQB 5FYKE 4MA7H 2QNBA 2H29A 5B1EA 4GIPD 1G9TA 3E5RA 3SD2A 1QUNB 3T0XA 4U3HA 3OEHA 2RK6A 1GA1A 4JDUA 5ALRA 2Q9OA 1SWVA 3EOAA 3BYTA 2PZGA 4WU7B 4DGUA 3KTOA 5CEJA 3KB8A 1GRCA 1RLTA 4LBWA 4XQEA 2QVFB 2APXA 4XAQA 3HWX1 4LNUB 2WYVA 4MS3A 3JV4B 3ZLBA 3WTWA 2OMUA 3T04D 5EIXA 4QGYA 1I7UA 1C3VA 3HAEH 5H4GA 4MIKA 1CGSL 4P23A 2WAMA 5TS3A 2CRZA 3QZMA 4L29B 5TR9A 2VRCD 1V95A 2OUIA 3GI9H 4LC1A 2FW6A 2NO1A 1RPTA 1DC3A 1EDEA 3K6FA 2PKDA 2Y2WA 2KMLA 3DUFA 4N76A 4ZOLA 3FNGA 5I8ZA 3KKZA 2IUYA 2YBEA 3ZWYA 3OZCA 4HCGA 1Z7WA 2X4PB 4PC7A 3KEHA 3R24A 4L0YA 3AW9A 1MJUL 5BORA 3NSFA 3STWA 3Q3GA 2BGRA 4HDKA 2PQMA 1NOLA 4OLEA 5KNCD 4IHJA 5KYYA 4CLOA 2HW8A 3TO4B 1TU2A 2QQFA 1NVKA 3N76A 5CX4A 4LHUG 3AU9A 3M89A 1JYNA 1X0XA 4L4VE 3GFBA 3RFXA 1O97D 1GGCH 1ZJ6A 1TYCA 1UPFA 3AI7A 2QT1A 1SXJD 3NVAA 4QE3A 4F33B 4ENRA 2BCEA 4QI3A 3RTQD 1P7KA 4JR9L 2P40A 3W9DB 3C74A 4TMKA 4ZMRA 3M6VA 4C0LA 3AUSA 5EHQA 3M1OA 4UQOA 5KTPA 3L3BA 4XARA 4XM1A 5JPNA 3S7TA 4CADA 5JIPA 4NL4H 2BIMA 3P45A 3MBWB 4MJ7A 1MI5E 3H6AA 2WSPA 1TMYA 5DDHB 3O93A 2QIPA 1A9BB 1TO5A 3CSYB 1E1RD 5KZCD 4D0CA 4CDHA 2ECOA 1WT5C 4FDAA 3GZ4A 2GBVA 5DZNA 4BYMA 2A9ML 5B6JA 5D1QE 3ZE0E 1BGXL 2YFNA 2W00A 2V7XA 1VYUA 1TZJA 3L6FA 3RCBA 2GBLA 4LDNA 1KEZA 1HHIA 1KIUB 4P05A 3G2JA 1UC9A 2ZCJA 5MERB 2ZQKA 1W2KT 2KMWA 3INUH 2C04A 4M5YH 4AMXA 3MBEC 5EU5B 4HEHA 2J12B 1YNLL 5AK6A 4QUBA 1L3IA 4RQQA 2KH2B 5CN2A 4CRPA 3ABKB 4BX2A 4YR6A 5TE7L 2DYPB 3KSMA 3EA5A 3TYXA 5ITBL 1TITA 4QNPE 2ARJA 3VU2A 2DQUL 3ESZA 4KTTE 1YJDC 1AAJA 2CO4A 3U4KA 1Z9BA 3C6LC 4TYNA 2ZD0A 3KPRB 4KLAA 2VXQA 3BBLA 1TG8A 3PFHA 1SHJA 3B9VA 1YRHA 4YCMA 1U6KA 1DZ0A 3IHKA 5B1BB 5A3JA 3KPPA 3KOOA 3V3KA 1OMOA 1AGEB 5ERWB 5DM0A 4W9HC 5I1LB 2WAYA 1FTWA 3OVUB 2IXTA 3NJIA 2B8WA 2APVA 1R33A 3KYBA 2EYQA 2HFGL 1GRQA 2FPGA 4S2SB 1Z45A 1R24A 1I7RA 4LGRB 4II7A 4ZFOL 3KGUA 2HAEA 5C07D 2C9VA 2CLIB 3FWPA 5DWQA 5DF0A 5CEZH 4X65B 3UK6A 3CX3A 4AY3A 4JKPL 4DCCA 3S0JA 2GK3A 1YUHA 4BFZA 5I18L 3NRFA 3A6LA 1E2GA 4FNQA 3II1A 4NS1A 2F3SA 1NCDH 4MSWA 5EZOH 4DV5B 1MZZA 4GXQA 3DI3B 3A32A 1RD6A 4M7LL 5DLEA 3TNFA 4EARA 1IYZA 4KFCA 4DLVA 4BCYA 5YASA 1F58H 1NC4A 3BCUA 1UOPA 3IDUA 2R87A 3AP3A 4GFTB 3EAKA 3GT4A 1W36C 1LDPL 2W60B 1NBAA 1MPAL 2YPLE 1L9TA 5LXTF 2GEBA 3LVQE 4RHTA 3T3HA 3OBIA 2VH5R 4R1PA 1RFLA 2X6UA 3OKKB 4NQUA 2YAMA 4XO5A 3SYLA 5DRWA 3HCEA 2WLIB 1J48A 1EK2A 3TBBA 2VJYA 5FOJA 4XUEA 1E40A 4YC2C 2E9SA 1FXWA 5DXJA 4FADA 5JQGB 5JT1A 1NT4A 1VZ2A 1PLBA 4ZYVA 3K6DA 4Q24A 1LTHR 1SD1A 1AS8A 2QSCH 2A5JA 1CDYA 3NCFB 4MJID 2ZCKH 4OQPA 3O2SB 5D1ZA 1ULSA 5GIPE 3CLUD 5AVWA 1X8XA 4Y5YA 1RE1A 1CICA 4IOJA 4UZFA 3PFBA 3SE0A 5A2CA 1TVKA 4JI7B 4PG9A 1ZG3A 2MYNA 2YRLA 2A4CA 3MNDA 3ADCA 3WG7B 4QFMA 3MCYA 3PQ4A 5F7MC 3MTXA 1VYVA 1KDJA 3MK31 2B1AL 2OR3A 3QDJA 4MYWB 1XD8A 2WW8A 1LO0H 2ZQZA 5KSAB 4Q4LA 1KJVA 5AAMA 3KJQA 2JAHA 1OK0A 4MJJA 5D7HA 3CZFA 2C34A 1RQGA 1MO2A 2BZCA 5J6HB 1CETA 4IIYA 3P32A 2GBTA 1P5VA 3M8OL 2VSYA 5DQDL 1YR2A 3UK0A 1DEOA 4CLRB 1SCUB 3P77A 3O7WA 4DPKA 1FSFA 1M57B 4NDMA 2ZUDA 1RUQL 3OJDB 3FKSD 2X4NA 1KEEB 1LHZA 4RADA 3S8GB 5DTFA 1M2EA 1JT2A 4WEQA 3D0AA 4F1KA 1NXWA 4OZHB 4QWWC 2MWMA 4OT1H 3TEMA 3JVFC 2DQDH 5CGTA 2NXYC 2Y9MB 5BV8A 3HRZA 4WEBL 3DO4A 1VCHA 2QGZA 1PTZA 3NZUA 4P82A 2QW1A 3RV4A 1IX2A 5BW7A 4J0FA 4B46A 4HCRH 3W8FA 5ECDA 2VDKB 1XQXA 1Z5HA 4AS3A 1RZRD 3NORA 4X54A 4GHWA 1ECJA 3VC3A 3PGDA 3O3MB 2DPHA 2UUBB 1BOOA 1RLOA 1LSJA 3LCRA 2PP9A 1J22A 5LGYA 4LOJA 1KCWA 2QLTA 2Q3FA 2H9AA 4ZSOA 2CGYA 4I6EA 1ZP6A 1XZEA 5AD0B 4G8GA 5EBWB 5F0PB 1O6SB 1QRSA 1TT7A 1Q0HA 4F7PA 3KYAA 3CKMA 4X1YA 4OD1H 2PGNA 4C0WA 4FXGB 4GMFA 2HLHA 3EBLA 3DTDA 2YZNA 5C0NC 4X61A 4M3HA 5BVPH 4ZO8A 4XD7A 3A06A 3E22A 4Q9DA 1M10A 1GNQA 1GEGA 3SHVA 4V1CI 3KLQA 2CE7A 3ZMNA 1HQKA 4JJOA 4EUPG 3RWEA 2C5BA 1P33A 3TZVA 5JHDB 4X1OA 2IFFL 4B4DA 4OM1L 4DC1A 5IB1B 4LASL 3KWUA 1XDGA 1VPOH 1HRKA 4Y2SA 2WD7B 2DWEA 2JGEA 4ZFOA 1UT6A 1E20A 1DX6A 3BP4B 1CQXA 1Z0DA 3GSUB 5LQMA 4PS0A 3Q88A 1MEXL 2GKGA 5B3AA 4DPAX 1BDIA 1QQBA 3H2JA 1TKCA 1MO4A 3L46A 4AK1A 3AHCA 1E1LA 4HK0A 4AO8A 2C82A 4LPCA 4Q3LA 3RRMA 1ILEA 3LZOA 1ULBA 2WCGA 2WLLB 4JZJC 4CU6A 3AP2A 2FP3A 3CO0S 4KLZA 2HT1A 2WQZA 3CVXA 1KC3A 5FWQA 4MEAA 4PS4L 4TMTA 4XNMA 5JAIA 5HZGA 3A21A 3QXXA 1FJGB 5JMPA 3O9ZA 2D7TH 2GM5A 2NUAA 1JYVA 1KN4L 1ORHA 2ZIFA 3N3AC 4CEIB 5JLZB 1D1QA 3I5MA 4N2BA 3VE0A 3HG5A 3SJVB 3B1KA 5KINB 1QHQA 4F9PC 2HLFC 2G5PA 1FDTA 5IN5A 2BKLA 2W2KA 3VR5D 3QDGD 3GK3A 3MRBB 3QR1A 4IBVA 5DHSA 4FFZL 4HD5A 3UBTA 3GLGB 5F1YA 2ZBEA 1T80A 5ALKA 5AM1A 4Q3NA 1JUFA 3KBOA 3D39B 5CP3A 4K3GA 2YC2C 3QNUA 1H3FA 1Z5VA 4RFNB 2IBZY 4W7SA 5GJCA 4I3SH 4TUKL 1JGUH 4IV8A 1RVFH 121PA 3FNHA 4UTXA 4FS3A 3WYGA 3MV9A 4Z3EA 1NINA 5B2FA 1FYTD 3CFDA 2V5YA 3BQMB 4L4TB 1QTQA 4L4SA 2FRDA 2IPTL 3GD1C 5DK2A 1ULTA 1KI7A 5C18A 5F3HB 2D1YA 2PUQT 2YAHA 4MVJG 4YSRA 3HIZA 1NWCA 3L5IA 1Z0ZA 3IIMA 2EDKA 4OHUA 1Q0YL 3ENWA 1RZKH 5IHUL 3KZVA 4KUCF 3U4EA 2C94A 4KMMA 5F52A 4OLXH 4WGWB 1TQ8A 1C9SA 3OLVA 3WI7A 2UUDH 1B6RA 1ZGGA 5FBWB 3X11A 4U1KA 2DQZA 4UUJA 1X1RA 4LFHD 5CEFA 1XEWX 3SKMB 1D4AA 1TFUA 3MRHA 4L8SB 2Z5FA 3FYSA 1PEKE 4Z7VE 3KYJB 4DRXA 3I0MA 4HF7A 3C70A 4FQXD 4P59H 2XYHA 1N2IA 2ZRGA 2UY6A 4MAMA 4BSVA 5FHBL 1CY7A 5U9CA 1QGDA 1RKRA 2QSJA 1HOXA 2PL1A 2FLBT 3OAZH 4AY5A 4LCVA 2G1UA 4XNZC 4HH3C 3HE6D 4U1LA 4YO7A 1TCCA 3FO9A 4MDJA 1P31A 3FUNA 2XNCA 1ZVYA 2R0WL 5B1CA 4LCEA 3P0EA 4B71A 1KXZA 3WKNA 5CFNA 4W68A 4XMWA 4XT1C 5EI5A 3S3BB 4PYKA 4MJ5A 1GNPA 5EY5B 4HIHB 3SE3C 1XXFC 3ZWOA 2WBWB 2PX8A 1JHQA 4WGFA 1D9ZA 1US8B 4XI9A 5EG5A 1E9OA 2JH3A 2R1TB 1TTBA 3EIOA 3APMA 5IM5A 4QTXA 1TYAE 3FOCA 1RYHA 4F8PA 1NF8A 3L3IB 5JMOC 1WVZA 4L4VA 4IYRA 4ODVH 4TKZA 2CXUA 5CPFA 3G9VA 4RD1A 2LUOA 4MRVA 2E6QA 4YJZL 1X1AA 1XAKA 2NU8B 1QIEA 3MRQB 3LSOA 4XNYH 4BNKA 2QR2A 1Y8RB 5I8KL 3G2PA 3G0OA 5F12A 4NBKA 1KU0A 4MA4A 1REQB 4F3RA 3TQTA 3AB0B 1MI5A 3R0IA 4XCEB 2JI3A 5IF0B 4KI5E 2FXVA 4H9GA 4OQTH 1OKKA 2F3QA 3EK2A 4YRQA 4Z77A 5E2WH 3OEYA 3PC7A 1SRQA 1YJ5A 1MB3A 2P2YA 2J4WL 3EZJB 5D1QA 3AR6A 4JJ4A 1R0YA 4HFWA 1MFAH 3HUTA 1N0LA 1WV0A 1Z9NA 4C07A 3G88A 1FL9A 3MREA 4EHLA 1GKIA 1PZHA 3UV3A 3QS2A 2BDNL 4WLCA 3JD4A 2VLLA 3GYBA 4QHUB 2E7LA 1K8DB 4JQXA 5B53A 4K9MA 1Z12A 2VDOB 1V39A 5HI4C 2RG7A 2Q5HA 3N8GA 1P9MA 5KNBH 4Q2ZA 1MO5A 4LCJA 3DFKA 2XMGA 5KHOC 4NERA 2RDMA 3K6JA 1O54A 4IKKA 4RIGA 2BUAA 2E7BA 2JI1A 3VVCA 5C3IA 5GVRA 3O2DL 3P0YH 3ZW7A 1KDPA 4RMUA 4GMSH 3T0VA 3ZQXA 2W0FB 4G3XA 4FFZA 3I83A 1GU7A 3AR5A 3NDYE 2R2CA 1UWGL 4QEZA 1AP2B 3GSQB 5C92A 1HDMB 3P0GB 3RGHA 3NPSB 2AN9A 3MRFB 5GINE 4HJTA 3UMMA 1S5HB 2CZGA 1OXYA 1XMWA 3HZVA 2TMGA 1X9HA 1EO8H 5JCJA 4C59B 3AREB 1NBYB 3TVMC 3QK7A 2GQ0A 1X4XA 1BVUA 1ZJYA 5CIQA 4LDRA 4LXHA 3NCWA 4JM2C 4UINL 1XWFA 1Y4ZA 5JH7B 4FYMA 3ARBA 4GIAA 2G17A 4LXQA 4CEJA 2DLHA 2F58H 3IE1A 3JWDL 3TBVB 1RJDA 5TDNA 4BKSC 1XCJA 3MAAC 2LU4A 2IL1A 2SECE 3ZHSA 4BKLB 1LO3L 5I2IA 5ALVA 3TOZA 1DO0A 3N2IA 3TQIA 4YHNA 5E51A 1KJMB 2WVVA 1P5UC 3HNSL 2PRIA 3UDWC 4A7TA 2G36A 5AVUB 4BPRA 3AVVA 1PYOA 3H99A 4D9IA 5ESVB 2C5AA 4NKMB 3HOGA 1ID8A 4J3OD 4EZLA 3ZKWB 4G8BA 5DMIH 2WSSA 5BXFA 3IT3A 1QR2A 2AW5A 3B6IA 5IU6A 1EVZA 1N5AB 2PR4L 2WABA 3LZPA 4N01A 1ZVNA 3H7AA 2I6QA 2HA0A 3HP7A 5JXAH 3JWNH 3QIBB 5CCJA 3AGPA 1RQNA 2AFIE 1MJJA 4WTXA 3KWWB 4NRDA 2AE2A 4ZTOH 2C0PA 5CJ2A 3KSAC 2YYYA 3L7AA 1D6EA 1WIWA 4NI6A 3NN8B 1H15B 4C4SA 4V0SA 4XB6B 5JAOA 1GADO 5G3ZA 1QRND 4JUTA 2JGNA 4IMRA 2IDZA 1SUDA 1E4KA 4GRAA 1DQJB 3U9LA 3EBOA 2H1RA 5F21A 4CMAA 1IHUA 4KFZC 4M0FA 3VXPA 4PO3X 2FP4B 2V37A 2V0NA 5BN4A 1CK0H 2HMSA 2MPAH 2JA1A 1BVOA 1R5IA 1Y81A 2AZAA 1BWRA 2XYQA 3MTAA 3ZXAC 1T66D 3MGTA 3DVFA 3BIXA 1QDLB 1OAZH 1IEBB 1O4VA 5LXGL 3D3VE 2ONYA 2O1XA 4PW4A 4MR9A 3A37A 3GUYA 25C8L 2P6MA 1LB1B 2Q1XA 2Z2JA 1MF7A 1QFSA 4II2A 3PIQA 5LBVA 2PMEA 3MBOA 4OGAD 4D41A 1NFFA 4KIUA 3VXTB 3BK1A 1G9MH 2M1ZA 4MNHA 1BQUA 5JO5B 3JSAA 1U31A 4M0MA 4ODHL 1FRZA 4BNUA 2GSGB 3QI2A 5DYIA 4QHMB 1N64H 1CSEE 2WPDA 2NPIA 2RALA 2HYMA 4MS1A 4OGLA 4P22A 4LZJA 2ZRHA 3Q9UA 4D8VA 4YHBA 2X19A 2AS5M 2EGUA 2JJSA 3UTOA 3DHYA 4U7MA 4MDIA 5EP3A 2DWOA 2EEDA 5BP7A 4IX1A 4N18A 1W52X 3AWDA 2Q27A 1YYLL 2XNSA 4M1DH 2AJUH 4HLCA 1UDAA 5KTNA 4NCDA 3EQ6A 1M2VB 1DBBL 1HHGB 3WJJC 1WEJH 3JVGC 4HRVA 4MNTA 4XR4A 3OF3A 3Q15C 1Y18A 2I6XA 5DHAA 3MRJB 2AE1A 3HU2A 4KB5A 1UJ3A 4HKBB 2VA9A 1FL3A 4ZTBA 1YNKH 1A6ZB 5M04A 1JXDA 3C98A 2SKEA 4MD0A 2OXGA 3PGMA 5AOVA 3H4HA 3DBVO 1DJPA 2R7LA 4FK8A 2QVIA 2PSEA 4N3TA 1V16A 3FT1A 4YECA 2Z91B 3PSAA 5JVDF 4KH9A 1I6KA 3M7FB 1FDSA 2R8XA 4TZ0A 4JIGA 3MDJA 1QQAA 4DHEA 3O2DA 1SDDB 1MW0A 3U4QA 2A1WL 3VZRA 1T5LA 1T7XA 1VE3A 3NHYA 1QRUA 1QF7A 5CB6A 4QHKJ 3C5JB 3UC0H 4HLQB 3GMLA 13PKA 2PMWB 1N26A 4JT9A 4OM7A 1SKAA 3EH4B 2EFCB 4QVIA 2Z3ZA 5DK0B 3VO1A 3MF4A 2XTNA 1QCCA 2BWQA 2XOXA 1DJHA 3UH8A 5GGSB 4AG6A 2B94A 4Y4KC 1EZ1A 3IDAA 4AQDA 3A10A 1NNUA 3BGDA 3FQYA 2DWDA 2VQTA 3Q3CA 5D1XE 5G0WA 2EE9A 3JTSB 3LQZB 3FHTA 5FV4A 1VADB 1WUKS 3S6CA 35C8H 4DSNA 2AANA 1G3RA 1E9AA 3VR3A 1QZTA 4EG1A 4GNKA 2GEUA 1ZPLA 3D7PA 4FQLH 3G6DL 3TEJA 1E9PB 2AVGA 2R0KH 4EM6A 1T9HA 3GZJA 4EYSA 1U9KA 3WEXA 3PDOA 1J56A 3N8KA 4E08A 4LCIL 1NPUA 4PP2B 4MQFB 3CDZA 4RFLA 3IC5A 2OKCA 5CSBA 3MROB 2FUG6 2C2WA 4EY8A 5IVKA 4COOA 1RC0A 4IH4A 2GJZB 1FYHB 1ZI8A 3H5NA 2W6ID 4K9EL 3T4UA 2HZ7A 2AF3C 1PGRB 4OCXH 4OKSA 4V1DE 3CUPA 4EATA 5K3DA 1U9CA 2ZICA 2C99A 1T8UA 1E3EA 3AVQA 1HT6A 3L7CA 2AMUA 1A97A 1XTUA 5GPRA 1JI3A 1YDHA 3E1ZA 1AC5A 4V03A 3HB3B 5E7QA 1ZI6A 4JJAA 4OZIA 3WOVA 3U60B 1Q50A 5E7JA 1PQWA 1DUYA 1NASA 3ZTJH 4GI8A 1Q94A 4E7PA 5AOMA 2YC1A 5GPBA 4RGQA 4GEJA 3I6YA 2JK0A 2G75B 5CDTA 4NDNE 1JWUB 4LFAB 4AX3A 1IQPA 1KKUA 3GIWA 2XQBH 3NKVA 5BNTA 1F41A 4RMIA 1JXMA 3MS2A 2PSSA 3I6SA 3MEQA 4KQ6A 4D9LH 5JCOC 3IMCA 4QLBA 3V0GA 5TC4A 5GZND 1UZ8B 2RHWA 1KP9A 1RJEA 2YJTD 1KLGB 1B0GA 5IASA 1NP3A 2X2YA 3WGNA 1PP4A 4JJ6A 4ZRDA 4YPGB 2PJDA 4Y4HB 1WM1A 4LMBA 2WZCA 3GO4A 3CZAA 1U8HA 5SYNA 4OG2A 2E87A 5ENVA 1S7SA 4XAKD 3KOZA 4HNAA 3WIUA 5ESDA 3FSEA 3I12A 2BC4B 1QKIA 2QAGC 1UM5H 2FH6A 2H11A 4OCYH 4KDFA 1GCOA 4C4ZA 4WLUA 1QHHB 2I7OA 2HJFB 4GQ9H 2CKMA 2CFIA 2WE7A 3IMFA 1XVVA 1L9MA 4HHWA 2ARKA 4OQLA 1N77A 1Z63A 2C7VA 4WPGA 5I1JL 1IM5A 1XXLA 2FE0A 1QH9A 2CXNA 2ZUUA 4C22A 1MP0A 4U9IS 3QVLA 1JLRA 2WJ7A 1W4RA 1SEQH 3RASA 1K5GA 4AJ1A 5FXMA 3BXGA 3GX1A 3CJTA 4NKQB 4R98A 4JRYD 2Q7NA 1T5SA 3F58L 4HXBL 1G1MA 3R8FA 4C20A 3JPWA 4N8PA 4NHCL 4NWUH 1EQAA 4BUCA 1ZS9A 4JELA 4WCFB 3PHQB 4TX1A 4IU3A 3PK0A 3CH5A 2WEKA 4POZC 2ZUBA 1KS9A 3MV01 4Y16D 2C5GA 5KQMA 3FCUB 1U91B 3Q1SL 1BM3L 3FF4A 3KPUA 1WFUA 3HFML 2W2NA 2XVGA 2JFOA 3ZHRA 3RUCA 3ZJ5A 2K6WA 1WIPA 5JI3E 2PD6A 3LX6A 2DQHH 1JG7A 1X7XB 2JJ2D 5DZJA 3VFMA 4KTGA 3R9KA 1U58B 4G8CA 4OHOA 1EGJL 4MQ7A 4DGYL 3RAJA 2H0QA 4W8GA 4XSVA 1V71A 3D6TB 3NDIA 1TAUA 3PR1A 4G5AA 5GGRB 1QSEE 5HHNB 4X83A 5CYGA 3O6LH 3BL6A 5EZYB 3IDMB 4AS2A 1C2TA 3K35A 3HLYA 2NNLD 3A1TA 1CE6B 1BD2E 4W4NA 2AHOA 2VTDA 1N67A 4DW2H 4EKDA 2ZVPX 1OP3H 3ZWQA 3PUVA 4LFBB 3PD7A 4HX1B 3EYUL 1BE0A 1KYXA 1UK7A 4JVUA 5ALBH 1UOKA 2WVSA 3INNA 1KEKA 1N3IA 3TN7A 2ZUXA 1MQKH 4L7QA 2QVYX 2GK7A 5BRQA 3IVKB 4YWGH 1IM9A 4TL5A 1ZLVH 5C0EB 2IQIA 4S1RL 1TAHA 2XUQA 5B8CC 2H2AA 1WBZA 3LBIA 3D2BA 4C03A 3PAUA 4DBLC 4IJQA 3CXHJ 3FMGH 4YAGA 2GNOA 4X4MA 1MFMA 3DOHA 4A7SA 4LSPL 2G06A 3TLRA 1GQQA 3ZNQA 1EZVX 4KY2A 2J5LB 3OG4B 3MCLH 5ADHA 3D69B 3VWKB 4NNPH 3A9TA 1OD7A 1KEMH 3H8WA 2COQA 5BSFA 3IETB 3S98A 1F3DJ 4E03A 4WZBB 3ZMEA 3GARA 4ZYZA 2R23A 1FYXA 2J5KA 1R88A 3JTTB 4FERA 2WYOA 5T41A 1R3LB 2NY0D 1JTPA 4P2QD 1S46A 3T8MA 1S9VB 2Y2VA 2BEUA 2PKXA 1W1IA 4KWCA 4LV8B 3TESA 5DIZA 4F2PA 2IEPA 5AW2A 4ODBD 2XTJB 3WBKA 4JRXD 5C0AE 4L50A 1X39A 1XF2B 3QVWA 1LJ8A 1C1XB 1JI1A 3DXYA 3NI2A 3S2SA 3F3YA 1MREH 3TL6A 4B4WA 3TA3C 1CTMA 4KRGA 2ODHA 1WYJA 1A1NB 4KR9A 4ODXB 4GVXA 2B7DT 1NXPA 1VIAA 3AY4C 3GLSA 3TW6A 3PNYA 2FW9A 5K8VA 2UZ0A 2O26U 4ZYKA 3O4LD 1GZHA 1O7DE 3RS3A 2X1OA 1GZ5A 2FFBA 2IPOA 2Q6VA 5EC1B 3T1WA 4G42B 1FZMB 4JBLA 1ODSA 1UINA 3NNNA 3TRDA 1T0NB 1TJHH 2EW8A 2JAQA 3DJRA 3HCWA 4AJPA 3CC5A 3CW2A 3UHFA 5IQOA 4Q01A 3B1UA 4KVCL 3PUCA 1L1QA 3WG9A 5JISA 3KELA 4LAQL 5L9AA 2XWXA 4MPPA 1G7QB 4I4TB 1SMDA 3W39A 1NMEA 2JVJA 4E2OA 2OWDA 3KETA 3DVIA 4IRXA 2JFNA 4DFIA 4DDKA 1YCGA 4HAUA 4JV5B 1MFEH 1RKBA 2LIVA 3PGXA 4AZ0A 2F3PA 4FLQA 1Z5PA 1JGVL 5MI0C 2CUMA 1J5OL 3T9EA 1E7WA 2OHHA 4KWHA 2AK4B 2AFIA 4X97A 1KJIA 4MYDA 4E41D 2C7UA 5HXMA 4F9EA 1A22B 4K6KA 1AMUA 1ZSDA 5KC8A 4R7XA 4RMWA 1M05A 4D7PA 3W2DH 2NCMA 1A7QL 3D7NA 4ALMA 1A2YB 4J8QA 4UEQA 4Z9FA 2Q41A 1XD2A 3FUVA 2RB8A 2QLLA 3F3MA 1H0KA 2PD4A 2BERA 2QQNL 4AZSA 4JFZH 3TOCA 3DX3A 4ENVA 2NY1D 3I9AA 5C6TL 4L9LA 4JUSA 4JUDX 5BRZE 1HCZA 3LGAA 2ZRJA 3EOBA 2O3JA 2AR7A 2ZE5A 1D3CA 5CBAB 2GI4A 4XO4A 3HH8A 3IXMA 1Q0UA 2X15A 4X20B 4C88A 1EB9A 3R3WA 4WNCA 4YDRA 4ZVPA 2FKNA 1SUEA 1J87A 2WM8A 1UWYA 2A6JB 1AS7A 2IGTA 4R96B 4WI4A 1EGJA 1IZ9A 3EYVB 3PNWA 2BVPA 1FPMA 4PGBB 3A6BH 1JJ7A 4CTJA 3KWVA 5DD3H 4QY8B 2DQFA 3KAPA 1ZIAA 2V2WB 3QFJE 4ZW8A 3D8MA 3U80A 1JPST 1A7OH 4HOYA 2VHQA 2Z7YA 3II3A 4KOEC 3ZY4A 3RDPA 2NY2D 3EDFA 3QLEA 4BQ8A 2YMXH 1JL3A 3S34L 2PW2A 5JHLA 1XL0A 4YDVA 4BN4A 3S81A 5ER9A 4IJ5A 2YOHA 2DIBA 4UAHA 4APQB 3ZG6A 4C08A 3I4LA 1JLLA 1GU1A 4OGXH 2CKBH 5E1AB 5HM8A 3T9AA 3LYRA 1A7RH 3RT7A 3WKDA 4D9BA 3LA6A 1D5MB 4N7BA 4AQ8C 2LP4Y 5ALIA 4O2CB 3LYHA 4KAQL 3TLXA 3RU2A 4P86A 4ZQKB 1HG0A 4QYMA 3W04A 1IHYA 3C2SA 5KQRA 3BICA 4WAUA 1OXTA 4B9IA 3QDMA 2GSWA 2I1LA 5F6HI 1Z33A 1J20A 2O3SA 3B4NA 2RHJA 3R3HA 3VFVA 4P5MA 5FLKA 2EO9A 2EZ4A 3MN8A 1IXZA 5DBHX 1FNNA 4E6EA 4ENZA 1Y3IA 4UMDA 2BEVA 3FK3A 5HJDA 4KRPD 1TGYA 1T5OA 1UFQA 2I99A 4KAJA 5C2UB 4MVJI 4LPWA 5AK4A 5FV2A 4HRYA 5EOQL 1OOAA 3ZL1A 3RL2B 5KHLB 3VFNA 4UNPA 4IR7A 1PVHA 3CFEA 5FXCH 3WEBA 2BP0B 3KYMB 4C4YA 1G6RL 3E6FA 4L37B 2XWJA 1U4SA 2G4GA 3GMDA 3ICVA 2VWHA 4ZX5A 4YJ3A 4XNXL 2AABH 3HC7A 3ALWA 1Q0TA 2B9AA 1OH7A 1F1GA 5JA9A 1SBSH 1KFAL 1G94A 1YJDH 3CEJA 5SY6A 1KZ1A 1ZSYA 1KL7A 5CA0F 5DJ6A 3NWEA 4REQA 4IDDA 4OKDA 5IK2A 4QGBA 5D1XA 4BY9E 2OM2A 3O3CA 1XD9A 5ADWA 1VL5A 1OHHD 3I1FA 1GLGA 3EFOB 4DPBX 2ZSIA 3CONA 3GAFA 3O8QA 1Y4UA 2UUPA 2YEQA 5GGSY 4NI3A 1R37A 4YRNA 1RXCA 2O5RA 1P6AB 3F2LA 3C09C 5I1HH 4EBQH 2QKIB 5J2UB 1ACLA 2G5CA 1OPOA 4XTCS 1HEZA 2BRRL 3LZ6A 4E4YA 2HK6A 1HSAB 2V6MA 1IXKA 3PFCA 4P4LA 2P1ZA 2WNHA 3MLSH 5FOBB 3II2A 5HHMD 1D07A 4EPSA 2JGAA 4V1DA 1GD1O 2CJTA 3NBAA 5EINA 4FJ1A 4RA3A 5K9QG 4BRVA 2EXTA 3RNOA 4Z0HO 1DC7A 5DURB 1UOVA 4N12A 2HTKD 3P9CA 1XVIA 4HULB 3K4QA 3QORD 1DVXA 2HTFA 2ZOUA 3U39A 5CUSH 1W9HA 3BMNB 5I1KH 3U4BH 5I19L 1BQSA 3V6ZB 1YI8A 4UJ5A 3FQWA 1F6WA 2OXHB 3UHOA 1E4OA 3LS2A 2N01B 1NMAL 2YMPA 5CHNA 4BMZA 4RVGA 4GM1A 1C12B 3D9AL 5FOXA 3K46A 4AYFA 1JQBA 1PZNA 1YKFA 4LDQA 5DM70 2ZVJA 5CLYA 1J8QA 4HB2A 3UYPB 1JFQH 2Z35A 1GMIA 3CFUA 3PLRA 1P73A 3U26A 4CG2A 2GTZB 2PJRA 2B2XH 3K9LA 1NJ2A 1TJYA 5D00A 4YFEA 2XWZA 4OSPA 2X4UA 3DAFA 2VMFA 1XKXA 3CMMA 4XFJA 1H19A 3VFUB 1KYTA 3OSUA 2CO6B 4Q4JB 3UENA 3QJGA 3UAZA 1T9BA 2PLRA 3PVZA 4G0PA 4HIEB 2W4QA 5K45A 2AR0A 5IHHA 3RX7A 1GCGA 5D87A 4EI8A 3MD9A 2JIQA 3KR0A 2WMOB 1J97A 2IYVA 2R6GA 4EFMA 3OKOB 3DETC 5H94A 1S8DA 4ZXPA 5DN6D 2RFXB 3DDOA 1GM5A 3WL3A 1QORA 2BRUA 1BLNA 1ZM3A 1TEXA 3E1F1 1T6BY 4K94L 4D9RE 4DEWA 2C2KA 2YARA 5EKXA 2EL7A 1RRKA 3H6GA 3LEXA 3LLVA 4R97B 5LNK1 1E4XI 1G7PB 3OE4A 1XRJA 5JUEL 4FHFA 5KVVA 4DT2A 5JCZA 1QYGL 1AR2A 1NAKL 2HF9A 2C4UA 3ZV3A 1G63A 4FL4C 5BNWA 1XMQB 4JWKA 2ZWLT 4MSUA 5FL7D 1JFHA 2UWEB 5BSRA 5C5EA 4RMHA 2KQNA 4GI9A 3O21A 4D81A 2UXCB 3RDTB 2V3DA 3MR9A 4C4PA 1JU9A 3BE5A 4TLDA 1L0BA 1SA0B 3RX9A 4JFXA 1K06A 1K8XB 2QV4A 4FKEA 1CP3A 1H6UA 3G2QA 4JFSA 4EYGA 1XUOA 4UMGA 3A6HA 2RMKA 1G6RA 1ZHNB 4HG4J