3IGFA

Crystal structure of the all4481 protein from nostoc sp. pcc 7120, northeast structural genomics consortium target nsr300
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
368
structure length
333
Chain Sequence
ALILTFLGKSGVARTKIAIAAAKLLASQGKRVLLAGLAEPVLPLLLEQTLTPDPQQIAPNLEVVQFQSSVLLERNWEEVKKLEAQYLRTPIIKEVYGQELVVLPGMDSALALNAIREYDASGKYDTIVYDGTGDAFTLRMLGLPESLSWYVRRFRQLFTNQVNNFLDKGKEALADPKRVAAFLVTTADPLEVVSVRYLWGSAQQIGLTIGGVIQVSSQTEGDLSAEFTPLSVTVVPDVTKGDWQPLIDALPNFVEQAEQAPKPITIDTHNRQVRLFLPGFDKKQVKLTQYGPEVTVEAGDQRRNIFLPPALSGRPITGAKFQNNYLIISFLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target NsR300
rcsb
source organism Nostoc sp.
molecule tags Atp binding protein
molecule keywords All4481 protein
total genus 101
structure length 333
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
A PF17886 ArsA_HSP20 HSP20-like domain found in ArsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3igfA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3igfA01
2EQBA 4BLPA 5HZHA 3OIUA 4Q47A 5E7IA 5FBRB 1F48A 2BHRA 3BC1A 3BAFA 4OHWA 1XTIA 1GSIA 2J1LA 5K8LA 1NMXA 2R44A 3TE6A 4L8GA 3WBJA 4I99A 1K8RA 1E9AA 1E9CA 1OIXA 2ERXA 3OEEA 2FA9A 4JT2A 5KPDA 3WNCA 3AF0A 2VBCA 3EA5A 5EP4A 1LS1A 2GILA 1IJFA 3SQWA 4U02A 2VP5A 1NY6A 1SVIA 2A2ZA 2OV2A 4C2TA 1B23P 4GSYA 2JA1A 1OH7A 1B0UA 1T8TA 1Z28A 2VHQA 4ERNA 3U3OA 4JZKA 5CDFE 4NL4H 1COWD 2NG1A 2J7KA 3DHWC 3AVWA 2NIPA 3A1UA 4M1YA 2JIZD 4BEBA 3Q3JB 4P4TA 1P7CA 3EAQA 5DN6D 4F4CA 1L2TA 2NO6A 2ZRBA 4JLJA 2CR0A 4LJ5A 3D8BA 4JMPA 4LJ9A 2AN9A 1T0JB 2PT5A 4IDQA 2CHGA 4FI3C 1ZD9A 2BKUA 1PZNA 2ZXUA 1P5ZB 1GL7A 4KXFB 3IGFA 4UXJA 5GJVC 3GUFA 2GESA 4CZ2A 1II8A 4EIWA 5C2JB 3QORA 1XXHA 1ZU4A 2QTVB 3THWB 5UKDA 3U60B 1KGDA 2G77B 2ZRLA 2WWYA 1YRAA 1MABA 2QGZA 3AEZA 3F0TA 1XBTA 2AKYA 3P32A 3ZZUA 3IPYA 4D4MA 2CBZA 1JNYA 3QORD 2X77A 1LF5A 2VHCA 2D7CA 3AF3A 4CGZA 4Q4AB 4ZKDA 5DN6A 1UDXA 1T9HA 1KI8A 2QRZA 5CIWA 3K0CC 2G1JA 3WHLA 4X8MA 1COWA 1O87A 3VQTA 4A0GA 1EFCA 3KQUA 1M6NA 3AVTA 2MSEB 3TJZA 1XJCA 2ZQ5A 2FF7A 3VX4A 2BJVA 4A2WA 4DLWA 4E5UA 2WMNB 3ZH9B 1T0HB 1VG1A 1YU9A 3C15C 3OIYA 2CVHA 4IOKA 2A5JA 5EZ5A 1DVRA 1DEKA 1JJ7A 1NF3A 2BBWA 4GDFA 4GNKA 1FUUA 1KHTA 1NNEA 1E1RA 2PEYA 1E0SA 2RGBA 2FFAA 4MUBA 3VKHA 2AHOA 4KFSA 4CW7A 2BDTA 1Z08A 4NKRA 4BZPA 4EQ6A 1NIPA 2A7QA 1MH1A 4AKGA 4PHHA 2R62A 1DO0A 2YOFA 3GJ5A 3ADCA 1OXUA 1DAGA 3EUDA 4B35A 3GMTA 3OEED 1G3RA 4PC1A 4DEXA 1NMZA 4ABYA 3QG5A 2AK3A 3PUVA 3IIJA 2C99A 2H8KA 1OH5A 4K81B 4OJQA 1E4VA 2WWFA 4GMXA 1EG7A 2IYUA 1U98A 1NP6A 4DT1B 5FBWB 4O25A 2QMOA 5G41A 2ZJAA 3KUDA 4JVMA 3AVPA 4UKDA 1N5IA 2GZHA 1F60A 4L9WA 3IIMA 2QE7A 3WY9A 4DCVA 5FOWA 2P6NA 4RZ2A 3CO5A 5M04A 2ZSDA 3C5HA 2QEQA 3GLAA 1RL1A 2IXEA 3P1JA 4W5HA 3AVUA 1TEXA 1UF9A 2G9NA 5FOSA 2MMGA 4ASUA 4LZZA 3I61A 2O8FB 1JR3A 1GFIA 1CTQA 3W8RA 2GJAA 1YE8A 2A5FA 3QY0A 3I5XA 3CH5A 4QGFA 3CUEF 3NHAA 3PQCA 4M22A 2RAPA 2HLDD 2I4IA 1F5NA 1Q0UA 5J4KA 4DT1A 1IHUA 3RS7A 2EFCB 2EYUA 2N0KA 1AM4D 1OE0A 4V0NA 2WAXA 1OH8A 3UMFA 5IHPA 3QEOA 3K0FA 2HT1A 1IM2A 4TMZA 4PC3A 3THXA 4HDCA 2FGJA 4AC9A 1ZIPA 2D3WA 1AS3A 1AN0A 5DI3A 5J5CA 5FOVA 2Z83A 3MJHA 4AI6A 4OI2A 3A4LA 1TMKA 1WE2A 3QF7A 3R20A 1UJ2A 4AYXA 4YMVA 2ZRHA 5AUNB 2IK8A 3ADDA 1NN1A 1G8HA 1MKYA 2XNDD 1UEIA 2NO7A 1FP7A 1N0VC 4PC7A 5JI2E 1XJQA 5JRZA 3QKRB 2NPIA 3U7FB 1Z63A 2V8OA 2C77A 2ZE7A 3AVYA 4R98A 1Q44A 1DAFA 3NBXX 5KSOA 5L3QA 5EP2A 3B8HA 2A5YB 1NIJA 2ZROA 3R9IA 1W36D 3TLXA 1FL9A 3BH7A 2V1XA 3CR7A 3ZVLA 3W5JA 1RYHA 3RS5A 2NGRA 1EK0A 2FFQA 3C5CA 4ACBA 2VSXA 1X6VA 2LCFA 1TU4A 4LBWA 1KZGB 2A30A 2YWEA 1X1SA 1Q1ZA 221PA 2GJSA 2KBFA 3DO6A 1KI9A 3EWAA 2IYVA 1NSFA 3FDIA 4KSCA 3T35A 1WCV1 1W44A 4CT4B 3FGNA 4LK2A 4F38A 1P72A 1E2JA 5L3SB 3MG9A 4JLMA 5KDLA 3T5DA 1G5TA 3H1TA 4GOKA 4KLNA 3SFVA 5F9FA 2VP0A 2OESA 4B3CA 4ZI2A 3ICQB 2ZVQX 1AJEA 4LBZA 1YQTA 1S0UA 2B7CA 1XB2A 3NTUA 5CLQA 5TARA 2WKRA 4ZV4A 4CIDA 4DWJA 4A2PA 1ZCBA 4R2IA 1F2TA 3VR5A 3H2YA 4ZCIA 2GBLA 2IW3A 3FKSD 2NO9A 2ODEA 4WAUA 1HT1E 1U81A 3MMPA 4MH0R 5B2ZA 2K8QA 2Z4RA 3BFXA 4HDOB 1P4SA 1ANKA 1ZBDA 3B9PA 4Q9HA 4DRZA 1Q3HA 3VNUA 1T5LA 4NH0A 3WP1B 1G7CA 4M4SA 1SULA 3QORB 5GADl 1KDTA 4OQMA 4UNNA 5CM9C 5AJWA 4Q7LA 3PXGA 4G1UC 4EPRA 4TSFA 1YR6A 2ZR0A 2ZRIA 2VLIA 1AKEA 3A1TA 3QJYA 5FPTA 1ZP6A 1E2EA 2GCNA 2H1LA 5L3RA 3K53A 3LFUA 1LW7A 3W3ZB 1XPOA 1SKYE 3GT6A 4RZUA 4PCKA 3A8TA 5BYKA 5JZVA 1PV4A 5HR5A 1GMEA 2GJ8A 2N3JA 1GAJA 5CYPA 1OKKD 4Q4HA 3RWMB 1A4RA 4KVAA 3KKQA 1OT3A 3CONA 4BLRA 3DZDA 3RLFA 4DSTA 2FEMA 3REGA 2J0VA 4GMDA 3SYKA 1VCIA 4RKFA 5G3ZA 2E1RA 2CE7A 1SVOA 3EZ7A 4D0LB 5JCZA 1OIVA 4Q9IA 3T1OA 4IOJA 2HV8A 5FUXA 4HSEA 4D4KA 3N3EA 2C9OA 2PLFA 3K1JA 4FCWA 3GLFB 2QSYA 2V55B 2H5EA 3UATA 2IBMA 3BE4A 3QXXA 4JLAA 4YC7A 4CRWB 4EJSA 1IN8A 5DO9A 4TLAA 1VCNA 2HXSA 2BOLA 3KQKA 2WJGA 821PA 1OW3B 1BKDR 2NZJA 2HDNB 1Z83A 2W2XA 4HUQB 1XTKA 2CLCX 3IUYA 4NCIA 5FH9A 1DE0A 1U0LA 3B6EA 3K8YA 3REFA 3QIAA 4BFVA 3SC3A 4TYPA 1F2UB 2VYFA 1UBGA 3KX2A 4NYMQ 3ZJYA 1Z0FA 1L4UA 1W47A 3U44A 4PSAA 3VNVA 3EZFA 1FPMA 2JLSA 4ACAA 4YMUA 5LD2B 2C95A 4EDHA 4ESHA 1KO5A 1DOAA 5AUOB 2R6AA 1JXOA 1KI3A 4O3MA 1YR8A 2EU8A 4FXPA 4ZKEA 5BN5A 3ZVRA 4YXWD 2JLYA 4Q4JA 3FHTA 2OG2A 1IONA 1QBKC 1SXJD 2ZPTX 3F8TA 3TVTA 5K8UA 1DO2A 1QG4A 2RGNC 2XNSA 3VR4A 2FV8A 2A5GA 1Z6YA 2Q6TA 3BD9A 4AKIA 2F3RA 3QF4B 1QHXA 3CRRA 2RHMA 4DUGD 3TMKA 2FFBA 1W0KA 4MGYR 1TPZA 2PMKA 4V0LA 4F91B 3IQXA 4DUGA 2BCJQ 4UJ5A 2J7PA 5HCNA 2SHKA 1GL6A 1ZNXA 2JLRA 4AYTA 4RVCA 1KZ7B 2WWWA 5CK5A 5TVKA 2CNWD 4MKHA 1Q3TA 3IEUA 1U9IC 2WICA 2BEKA 1OXSC 5JHHB 4H9GA 2D62A 3L1FA 1U2RA 3RANA 4ZIRB 4NYIQ 4DXAA 2WV9A 1KK0A 1X5MA 4A4DA 4BZXA 4II7A 4YMTA 3D3QA 3I1FA 1JAHA 1TF7A 1YJ5A 4LYJA 4RD1A 1LTQA 2CJWA 1YRBA 2MMCA 1OIWA 5LUMA 2XOKD 1NKSA 2QT0A 4JJKA 4WBSA 2Y1ZA 4HLQB 4D81A 2IXFA 2PT7A 1TQ6A 1W48A 4M0LA 2KMWA 4TMXA 3KUCA 3B7GA 2YWGA 2Q3HA 3KXIA 1YZUA 3EG5A 4TL9A 4BQSA 4A6XA 1ZM7A 4M1OA 3S1AA 1E2MA 2JJ8A 5DH9A 2XB2A 1TAGA 5J47A 2WJVA 3LW8A 4DC9A 3QG1A 1N5LA 3KKPA 4F4IA 1YHNA 2G83A 3U6KA 1KI2A 1ZNWA 3X1DA 1ODFA 3L82B 4G5RA 4HUQA 2PMDA 4PHGA 3I5YA 5SZKB 4D6PA 2W00A 4IRUB 1FW6A 3W3AA 1S3GA 4JLOA 2H17A 2F1IA 4PTLA 2Q9CA 3CB4A 4LJ8A 5IRCD 5H8WA 5KTYA 4QOSA 3VU9B 1Z6TA 4M1WA 5L8VA 4M1KA 4JL8A 3LLUA 1KNXA 2OLJA 2R6FA 3HU1A 4QHSA 5FL3A 2EFGA 3TGPA 2Y1YA 3L1GA 3BWDD 4OQNA 1VHTA 4DHEA 3AUYA 1IOZA 3CRQA 1J2JA 3MWJA 5LB2A 3TR5A 2ZREA 5L3SA 1RRCA 1Z6XA 1AS0A 2ZUDA 3D31A 2J5XA 4F7WA 2VEDA 3PEWA 1KI4A 2PEZA 3WXMA 2ATVA 4FMCF 4LV6A 1AGRA 3HWSA 3U44B 3C4JA 5DYIA 5K8IA 1A1VA 2WBLC 1EFUA 3JVVA 3K09A 2PH1A 3FFBA 3CF6R 3QPWA 3VAAA 1F2TB 4Z1MA 5JSZA 2F55A 1DAKA 1E79A 1H8ED 2BOVA 3L1EA 2GA8A 2JIZA 3K70B 4RD3A 2ZYTX 1Z0IA 3M0EA 2GAAA 3SBEA 1KDRA 4RD2A 2KI5A 1QHYA 2XXAB 1E2GA 5HKKA 4B44A 1XEWY 4ZDIA 1SXJE 1YZLA 4C0HA 3P26A 4V03A 5B57C 1AKYA 2KSQA 3LX5A 3OEHA 4MKFA 4NDZA 1K5GA 1DG3A 3M1IA 1YKSA 3NEJA 2TMKA 3B9QA 4B2IA 2XJ9A 3TSWA 1G4UR 3GLHB 1SVWA 4EFMA 4OYHA 5KNCA 4S35A 1BYUA 5J4HA 2ZRJA 2GVDC 3ICEA 1A7JA 2RMKA 5DSZA 2RH0A 4QNMA 3B1XA 1JQLB 5FTKA 4BGDA 2ZSBA 1E79D 1FMLA 1H8EA 1FQKA 2P6RA 1XZPA 4FMDF 2GCPA 4YDSA 4C0AC 5FTLA 4JYCA 4UJ3A 3BK7A 5KUTA 4NBSA 4QJ4A 1R0YA 2REXB 1CJMA 2R2AA 2RHDA 3T15A 1P2UA 3GJ7A 2O8DB 3MCAA 5LPNA 1NBME 2ZRAA 1E94E 1XD2B 3QVVA 3QBTA 1Q22A 4LJ7A 1QVRA 3TIFA 2JLXA 4YXWA 1R0XA 5KNBA 3H4MA 1ZM4A 4Z8XA 4IDOA 2WJJA 3AF4A 2XB4A 1DS6A 2JLWA 1FFHA 4V02A 2JKIS 2GEDA 1BIFA 3WYAA 1JI0A 2HEIA 1V43A 2WWIA 2ZITA 5DS1A 1OV4A 4D4LA 5JECA 3B2EA 2GXUA 1PVOA 1G8YA 3QENA 1N0UA 2HJGA 1OPXA 1RZ3A 4LYHA 4Y0AA 4B3FX 4CEIB 4OK3A 3H84A 1IXRC 4JVSB 4LRWA 4B76A 3OZXA 4TWZA 4PAMA 1AA9A 2CK3A 3NBYC 1Y3AA 3RRMA 2VPPA 5FPKA 1L7VC 2D2FA 4RFVA 3KFVA 1G3QA 2ZI3A 3GCGA 3LLMA 4IEIA 4M9SA 4B47A 2Z43A 5BXQC 5J4YA 5E95A 1PLJA 1N6NA 3OIWA 1TTTA 4GOJA 3UIEA 1XD9A 2ASEA 2AD1A 2JDIA 3GD7A 3QE0A 4KHZA 3ZLJA 1VDZA 1XF9A 4G5OA 3PITA 2I1QA 2XTZA 5TB5A 2H18A 1P60A 2ZS8A 3QKUA 4FW9A 4GZLA 4DDWA 2AXNA 1OSNA 2ONJA 4JLVA 3SYLA 1HH4A 4US1R 2AXPA 4TLEA 5EUMA 2YINC 3E70C 2WZQA 3LQQA 2J45A 4PZLA 4XTCS 5EZ6B 3I8SA 2XX3A 2BBSA 3BB1A 2F43A 4Q18A 3C7KA 1CU1A 2RH5A 3CWZA 1OYWA 5KDDA 1ZINA 4B74A 2J0QA 3M6AA 2QBYB 1JPNA 1ZNZA 2IYRA 4DJTA 2JATA 4XD7A 5DNYB 3BBPA 1JAIA 1XMSA 2ZE6A 4FN5A 1XEXB 2OBNA 1OLOA 3LVRE 4XWAA 1JBKA 2XZLA 4I1UA 2PL3A 5P21A 5J40A 4C2UA 2FN4A 2FX3A 1P2SA 1KDOA 1CR1A 4Q02A 2DB3A 3FKSA 4HZIA 4ITRC 5LD2C 4EQ6B 1XD8A 4NTZA 4OK5A 2PX0A 1X8KA 3MWLA 4Q19A 4X8LA 4XSGA 4DLXA 8OHMA 1E2HA 1OJLA 3EC1A 4M1MA 4KFUA 4FEIA 4S2EA 4UQOA 2VL7A 5KOYA 2QMEA 1CJUC 1ZAKA 4Q1DA 2F9LA 3BJIC 1H8HA 2BMJA 4NMMA 4QBIA 4A2QA 1Q21A 3K0AB 4B33A 4IEEA 1CR4A 2FFHA 1S1CA 5FTNA 2IF2A 5B30A 1N5JA 2LKCA 3K0EA 3RC3A 1SZPA 4DLZA 3U61B 1U9IA 2IEZA 4JLBA 5D3MB 3W6PA 2EYQA 2REBA 3LD9A 2RGGA 2BMEA 3BXZA 3KTAA 2FPKA 3H86A 5EUQB 3KB1A 1IY0A 1X8LA 4YMSA 4DSNA 4XVUA 3NBZC 1GTVA 4NU0A 1UAAA 3QKRA 4TLBA 5AJYA 1XMJA 2WJ5A 3AM1A 3SFZA 4DBLC 3THWA 1JR3E 3L8ZA 4Q9LA 5G3YA 2W6JA 2XSZD 1I2MA 4QJ5A 1QVAA 3OEHD 4C0JA 2I1VB 1DADA 1RYFA 2OBMA 3LH5A 4FWIB 4HI0E 3THXB 2WHXA 4N0EA 1ZJ6A 4PHTA 3GQBA 4IVPA 4W5WA 3CLVA 3NC0C 4LYAA 1F3OA 1GILA 2OFOA 4TZ0A 1C1YA 4BLOA 1W4AA 2OO7A 3PUXA 4QHYA 1BS1A 3KJGA 5D3MA 1GNRA 4KFRA 5EP1A 3IEVA 3KKOA 2O8CA 3CX6A 4LUCA 1VECA 4XWKA 3IQWA 3TQFA 2EWWA 1GL9B 3SN6A 3B1ZA 4MGZR 1VYVA 3F3YA 2J0SA 1WFIA 2CCGA 1GOTA 3NXSA 2X2EA 4RY2A 3QPUA 3QI2A 3TSZA 2C98A 1WDTA 4A6PA 1D5CA 2HT6A 4N0DA 4HLCA 3BFVA 1G18A 1P2VA 4I1VA 4PQFA 4L9SA 5L3VA 2YHSA 3DOEA 4J0QA 1RVDA 4F93B 1I4LD 1BO6A 1PUJA 1RFLA 4JSTA 3ADKA 1II8B 2Q3FA 4OKSA 721PA 3ZVMA 4Q1CA 5DGXA 4HLDA 2E87A 1AS2A 4U00A 2QL6A 3CPHA 5HE8A 1FUKA 2DWOA 1XJ0A 2J0UB 1DAIA 2EFHB 3RAPR 2IEYA 1HURA 1Z0AA 2BKEA 2WOOA 4B3GA 3CZQA 3NEYA 4KITB 1KAOA 2Q9AA 4US2R 3X2SA 4I1OA 3A1VA 2RGAA 4MA4A 4QFMA 1IY2A 5TMPA 5CJPA 1J7KA 1JR3D 1P9WA 1CULC 3FVQA 2A3RA 2QSZA 3ONWA 1E2DA 1R5BA 3TW4A 4AK9A 3K70D 1OB2A 4B3XA 1I4TD 1OHHD 1XCMA 2W2TA 3AP3A 3MSXA 2N1BA 2JJ1D 4C0LA 3PFIA 1NVVR 4YONB 5GVSA 1XU4A 4A8JC 1UBCA 3KJHA 4C7OB 2GZDA 4ILEA 1UKYA 3SHFA 1YZTA 3DDCA 1Z0KA 3NH9A 4HDQB 2F1HA 2V6IA 3ZD6A 1JPJA 4JBXA 1IN4A 3THYA 3EZ6A 3FKQA 4MKIA 1W49A 1P73A 3PUWA 1VG9B 4JBWA 3TRFA 2WSSA 3KL4A 5HCIA 3H0KA 1GUAA 3TNFA 3PIRA 4OI1A 4CT5A 1G291 1UM8A 2EVWX 1T91A 1KYIA 1XXHE 4IXMA 3A6PC 1XEWX 4RJLA 2DFTA 1FTNA 2HYDA 4JLPA 2WSSD 3CRW1 4GT1A 2ORVA 4Q4AA 2Y8EA 3Q85A 1ZC3A 2Z4SA 1XP8A 3V00A 3SQXA 5JLJA 3K70C 3Q5EA 1JEDA 2B21A 2GBLC 3GLHA 1HY3A 2ANCA 1PLLA 4BLSA 4KYUA 4FMBB 2ZYWX 3KXLA 3TAUA 3WP0A 4GOXA 2C03A 3VKGA 2OXRA 1DAMA 2W58A 3Q5DA 4AG5A 3Q8XB 2ZJ8A 1US8A 4FCTA 3RRYA 5EJEA 1DARA 2KJQA 3KKNA 4DLUA 4PAQA 5FOTA 3U3RA 2FG5A 1R6BX 3N2EA 3AB3A 3SYNA 4O2RA 1SKYB 4LBYA 2J7PD 6Q21A 1QDEA 2YVUA 4XVRA 2OAQ1 2QA5A 5BW8A 1T3HA 1Q20A 4RD6A 1CR0A 1N5KA 1U8ZA 1XTQA 3EIQA 3TSOA 4AD8A 2JLUA 2AKAB 3LA6A 1JALA 2VSOA 4PO1A 1AK2A 1CRPA 2CVFA 5F98A 2OCPA 4B3DA 4FCVA 4P31A 3SHWA 3JZMA 1QHNA 3SU8A 1NN5A 3GJ8A 1L4YA 1G6OA 1S9DA 5FBLB 4V0OA 2VP4A 2ZE8A 4A0FA 2GF9A 5FBQB 3W6NA 3I8XA 1FZQA 2GKSA 1XEXA 1G3MA 1N6LA 5E4FA 5C1BA 4Q7JB 4XOIA 2EW1A 4NCKA 3L0PA 2N42A 3M4YA 1G8PA 2GCOB 2W0SA 2XTMA 3NG1A 4LV5B 5EXPA 4OQXA 3AVVA 3B82A 4HUTA 4F92B 4PO9A 1J90A 3EARA 4A8JA 5SZJA 2J3EA 4P4SB 2HF9A 4ZDJA 3TW8B 2GXAA 3U3JA 4P33A 2GZAA 3NHBA 4NHOA 3TUZC 1OH6A 1G20E 4H1VA 5KO2A 3T5GA 2HCJB 2XZOA 3CX8A 2EFEB 3LXRA 4Q00A 1CEEA 1W0JD 1L8QA 4TQUS 3MLEA 4TL8A 1GRQA 1R10A 2MSDB 3ZS9A 4B6EA 1E2PA 3GLHE 1ZM2A 4BASA 1Q1QA 3EIHA 4K8OA 1CIPA 3Q7PA 2GEVA 1NBMA 2VP9A 1G4AE 2WMOB 3OAAD 5JWHA 4KV9A 4OI0A 5B64A 3AKCA 1AIPA 1NBMD 4DIDA 4EPTA 2QGNA 4DLRA 4BRWA 2FSIA 1N0WA 4IJMA 1G19A 3TH5A 2JGNA 4A92A 4BFTA 3FOZA 1GNQA 3I72A 3AVQA 4CEJA 1BMFD 3EWSA 2IYLD 5FPSA 1VCMA 1Z3IX 4NZYA 2ZRPA 3B60A 4ON9A 1ZW6A 5E7MA 2JJ1A 3PEYA 3IILA 1Z0JA 3TUIC 2OM2A 5JWOA 4Q5IA 3UG6A 1NJFA 4DDUA 2GK7A 1CJVC 3L8YA 3FMIA 2ZR7A 2OHFA 3CIOA 3LBHA 2QMHA 5KSPA 2G0TA 1Z22A 3KQLA 2IYXA 4ZIRA 1KKLA 1UKZA 1P2TA 3GEHA 3UMRA 3VU9A 2C9CA 3CPJB 3ASZA 3CZPA 2C96A 2VRWA 1BH2A 4HATA 4JKYA 5JS7A 4QM7A 4MJHA 1MT0A 3UWOA 4HZUA 2EWVA 2QM8A 5CYOA 3NIBA 3QF4A 1N3BA 1M34E 4PO8A 5A4JA 1N6PA 2W2VA 4G01B 1EWRA 4ASUD 1NN0A 3CRVA 1ESNA 5FI1B 5H1YA 4DIEA 4L4UA 4QGHA 5HZKA 5JJIA 2G88A 4DLTA 4NCHA 1UPTA 2QE7D 1KNQA 3ASYA 3KFXA 1LVGA 1X86B 1MRSA 4JSYA 3DM5A 2DWPA 4KBFA 2DFNA 1A82A 1JR6A 1E96A 1NMYA 4EPVA 1U8AA 3BS4A 4C3ZA 3BIFA 3SZRA 2R9VA 3OFND 2F7SA 3B85A 3K0CA 2W6ID 3CNOA 3K0FB 1QHGA 4R7ZA 3AABA 1X8JA 3EW9A 1TUIA 1Z47A 2X8AA 4IVRA 4JLKA 4BFXA 1LNZA 2V7QA 3PENA 4QL3A 3I3SR 2PZEA 2IUTA 3BORA 5EE5B 4HZUB 4AKEA 1VKJA 3T34A 1KKMA 4XIGS 3X1YA 4C0BA 2PBRA 4NYJQ 2J0UA 4UNQA 1CF4A 4XH9B 2XGJA 3B1VA 5EE0A 4MRRA 4PC2A 3SEAA 5LDDC 1RC8A 2CEAA 2Y22A 1WF3A 4XVQA 1HV8A 2P65A 4LJYA 4TMTA 5LBIA 3LQRA 3UPUA 2ERYA 2GAOA 5TXGA 3VTKA 3HP1A 3ND9A 2CLSA 5E3HA 1D2MA 4QBGB 2PJZA 2GJKA 4DSUA 2J9RA 2A78A 3LBNA 3Q7QA 5D3QA 5EXXA 3RVBA 3ZYCA 2G0NA 3FMFA 3ZGXA 4QGAA 1RKBA 1V5WA 1FQJA 1FP6A 2UVQA 3SE0A 3IO5A 1G3IA 2FE4A 4BFSA 1OF1A 3TKLA 3UANA 2ZJZA 3QKSB 3R9WA 3VHLB 4EJSB 2UZIR 1G5PA 4B6FA 3UXMA 2VIIA 3ZZ0A 4MRSA 2WOJA 1NL3A 1T5IA 4KI0A 1DG1G 3BH6A 4PHFA 1O3YA 3IHLA 5CITA 4YL9A 1I4DD 1XEFA 2DFKB 1ZD8A 4N1AA 4XD7D 3U4QA 3HPRA 3KXKA 4LBVA 2O8FA 3E1SA 2F1JA 5FI0B 4DLSA 5DIFA 5CB8A 1KSFX 3L2OB 1SHZA 4Q1AA 1CJTC 1XWIA 5FTJA 1M8PA 1KAGA 5F2EA 4B71A 1E2KA 5JEEA 2FMXA 5JMTA 5EXTA 2G3YA 2YNMA 3K9LA 1D6JA 4I4LA 1RRPA 2R6CA 5GVRA 3IPXA 1NVXQ 1XDBA 5JSZB 3KB2A 1E9EA 1M7GA 4JIMA 4PBDA 2WWGA 5FPHA 1NI3A 4QBFA 1M7HA 2NQ2C 2ZAOA 1WA5A 1Z8FA 3I32A 1GITA 4PX9A 2GK6A 1UFQA 4JS0A 3VR6A 2O8EA 4TYQA 4PQRA 3WMFA 2QENA 2O8BB 5KHOC 3GFPA 3V4FA 4IW3B 2FSFA 4BLTA 1NLFA 2ZJBA 4Q48A 4WXPA 1SXJB 1Y63A 3NBFA 2K5UA 5CK4A 3VFDA 2B8TA 3HYRA 1G17A 3QSYA 4Q03A 2J87A 4TL6A 2GEUA 3ZS8A 1OXVA 2YYZA 2FPLA 4GL2A 3UG7A 2KWIA 3KZ1E 4A8JB 4LHZA 2QTHA 2IS2A 1AQYA 3DPUA 2WPDA 4JUTA 3EXAA 1TQ4A 2FOLA 2ZI5A 3K9NA 4QNRA 3ZQ6A 1W4CA 2OXCA 1CKEA 2GXQA 3AGPA 1HE8B 2WJHA 3AQ4A 4PAOA 5KU1A 1N6IA 1TF2A 4GP7A 3FWYA 3CPEA 1RJ9A 3AGQA 1N6KA 4TZ6A 2O30A 5JFGA 4CEIA 3WBKA 2QM7A 4D25A 1X3SA 1GVNB 2GHIA 4OI4A 4DCSA 4V0ME 2RB4A 1A2KC 3SR0A 4A9AA 5JHGB 4I81A 1KY2A 3O47A 5H68A 2NO1A 4M5SA 4G5GA 2JAQA 4QGGA 2GF0A 3VKWA 3R7WB 1E0AA 1NKTA 2KLRA 2OCBA 2LKDA 2V54A 1W2GA 2Q9BA 3EZ2A 4DCNA 2QN6A 2XZPA 1VG8A 4LHWA 5JWRA 4KU4A 1NN3A 1GRRA 4CVNA 1XFAA 3R8FA 5BQ5A 4Q1EA 4A0HA 1DELA 4KSBA 3RWOA 3PCRB 2WJ7A 5J4VA 4GPTA 1E1QA 3J07A 4K46A 1OFHA 1NLYA 4EFNA 1KSGA 1TADA 2QI9C 1YR9A 3THOA 1VTKA 1SKQA 2ZJ5A 421PA 5AUPB 2IS6A 1E9RA 1WP9A 1E2LA 1SVMA 3S1AB 4EPXA 1KOFA 4WZ6A 1Z5ZA 3K09C 3A4NA 1E99A 1W46A 4TT3A 4M9XA 2IUSA 2OT3B 3O8BA 5EQTA 1YR7A 5L3QB 3CNNA 3BRWD 2ORWA 4TT3D 4Q21A 2ZSEA 5FL7A 3WRYC 1EWQA 4DZZA 2ZRKA 4W5JA 4W9MC 3GJ3A 3OFNA 3KDSE 2QBYA 3LY5A 2ZRNA 4YMWA 4MRNA 4URUR 1E9DA 2QT1A 1MRNA 3B13B 1P61B 4LHVA 5JJLA 2WIBA 4HAUA 2JJ2A 1TQDA 2R8RA 3WNBA 2ZJ2A 2JEOA 3W90A 1GKIA 3U6BA 1JQJC 1J8MF 5FR1A 3E2IA 3SDZA 2Q3MA 2AX4A 2ZI6A 2XNDA 3WYFA 3GEIA 1PJRA 4HB4A 1NRJB 2QAGB 4I88A 3A4MA 2VP2A 4BFWA 3GLIB 2QP9X 3TBKA 2ZUBA 4JVNA 1I2DA 4DDTA 1R8SA 5FBVB 2ZSAA 3QBVA 1OFIA 4X8HA 1XPUA 1G3UA 2AWNA 3O8DA 1MV5A 5J4LA 4PPFA 3ZIAA 1W0KD 1MO6A 5BYJA 2CHVA 4AY2A 2UZ3A 4M1SA 1TUEA 1ESMA 2FNAA 2IL1A 3B1YA 4PPNA 1E6CA 4IXNA 4DLYA 3SS8A 4M9QA 3GP8A 3VR2A 3QNUA 2O0HA 1G7RA 3HU3A 4TSFD 2H7VA 3NDPA 3QVUA 1XRJA 2D4HA 3VR1A 4D26A 3CNLA 4O2LA 1NSTA 1AQUA 2PLRA 4LHXA 1Z07A 1CBUA 1WQ1R 3SJAA 3MWYW 2CCJA 2ZYUX 4P32A 2FGKA 4BLQA 2XAUA 4LWZA 4RCZA 2JLZA 2VP6A 1XTJA 3GJ6A 4Z51A 1M74A 4BZQA 4N3NA 4Y0VA 5FR2A 3W5IA 3R9XA 5E7JA 4LCBA 1TEVA 5AJVB 4AWXA 3RABA 1CR2A 3CF0A 3CR8A 4FWTA 1FNNA 2KE5A 5FUVA 3A37A 1T4GA 3T1QA 1RW4A 2GDJA 3HJNA 3OE7A 2GNOA 1XCGB 4KCGA 2OILA 2WPDD 2RGCA 3U5ZB 1IAQA 3FHOA 4JVLA 1DPFA 1KI6B 1YZQA 2CL6X 2VQSA 2JLQA 4RFSB 2C2HA 4LC0A 1IXZA 1KO1A 4WXRA 2YKGA 1WBDA 3RSLA 2ZI4A 1EFRA 5FOUA 2RGNA 4YLGA 4BECA 1TX4B 4RZXA 2XITA 1KIMA 3EPJA 1FNMA 1KK3A 3K0AA 4EUNA 1KJWA 4US0R 3HU2A 2OCAA 4BFZA 3T1VA 4KVGA 2Z6VA 4KAXA 2V3CC 2HXYA 1R4AA 3RRZA 2DY1A 1Z2CA 2C78A 3AP2A 4MGIR 4D0GA 3RC8A 1QG2A 2I3BA 4LYFA 4UNPA 4E07A 4WW0A 3CWQA 4JKIA 2O52A 1R0ZA 1AZTA 3JVUA 3ZZTA 3K9GA 4G5SA 4DVGA 3RYTC 1R0WA 1IN6A 1ZD1A 2OUKA 1A2BA 1MO4A 4TL7A 3W34A 3ZDQA 2VHTA 1UADA 4NCJA 4JUSA 3QKSA 1ZCAA 1ZMXA 2FJUA 5B58C 3TUJC 1TQ2A 2D06A 3GLGE 5CLLA 2WSMA 1G6HA 4LPKA 3B78A 2AK2A 3AKYA 4EJSC 1HQCA 5EE9A 3EIEA 2H16A 1D8TA 1UEJA 5CDFA 1RRGA 4KO8A 5JI3E 3FPAA 1E9BA 1P3JA 4Q4LA 4A36A 4WZBE 3GLGB 4URXR 1K6MA 3MRSA 5KDOA 2O8DA 2F43B 1DAHA 3NC1C 3DEFA 3VQLA 3IBYA 4EFLA 3G0HA 3AACA 1CJKC 1Z6GA 2G1KA 1U99A 2DFLA 4ZI3A 2UKDA 4RCYA 2WM9B 3CKLA 4C7OA 4AIIA 3IBGA 5DYGA 5JBQA 3SI7A 1M7BA 1ZRHA 3CBQA 4D0NA 1NG9A 2MNWA 2ZVPX 3AKDA 3QOFA 4TMKA 5IT5A 3LV8A 1EFTA 4PPGA 5BN4A 3IKJA 2ZI9A 2C04A 3ECCA 2KBEA 3AF1A 1WXQA 5KNDA 4C30A 2JCSA 1P6XA 2CL7X 3PR1A 3R7WA 2GJ9A 4UNSA 4POAA 5DHAA 5HTKA 4EPYA 5FPYA 4PXAA 4URYR 1G8GA 2WJYA 2V7QD 2ZIAA 4DDVA 4B43A 2RGEA 5F3WB 4NYMR 5K8TA 1ELOA 1IJEA 1RJ9B 3RS4A 1KSJA 1HT2E 1VYUA 2V4ZA 3W6OA 4NCNA 1M1YE 2IT1A 2ZJOA 4YQFA 3WNDA 2P0EA 3DKVA 3DMDA 5JCPA 4KJZA 1G1MA 2CLDX 2WWHA 4A0RA 1W36B 1E1QD 1XTRA 1R2QA 2ZRDA 5H70A 2CNWA 2QUZA 1EJFA 1NY5A 1D9ZA 1PLKA 4BUJA 5IK2A 2WVJA 5TV2A 3TVDA 3MUFA 2ONKA 2QZ4A 1XCPA 1LS6A 3ZVNA 3DKPA 4Q4JB 2P5TB 4Q7MB 4AYWA 5KPJA 2BBTA 2FZ4A 2J41A 1D9XA 3FTQA 1FX0B 2GETA 1DTSA 1G64A 3VMFA 4BWYA 1KJYA 5BN3A 3I4LA 4OQFA 3D6TB 1BMFA 3HPQA 1HYQA 1EGAA 2P2LA 3RSOA 1LFDB 2PCLA 2R6DA 4YDHB 5DS2A 4P3YA 3K9HA 1N6OA 3ZQJA 4U7DA 3MGCA 1UBFA 5JEDA 3U7GA 3QPVA 1KK2A 1AGPA 3FFAA 3OIVA 3A36A 1QHIA 1HQYE 4PANA 5FTMA 4IKEA 1T3SA 4LPSA 2IWRA 1II0A 5FOXA 3T12A 1R7RA 621PA 1WH0A 2X1VA 4XTRA 4PR0A 4BE7B 4F4JA 2ZRMA 4TTRA 1RE0A 1CRQA 2QMUA 1G7TA 2ZUCA 1Z29A 3OF5A 5IDVA 2JLVA 1QHSA 3LWNA 2QNRA 5CIQA 4O0MA 4YLCA 4PQYA 4Q9JA 3T61A 4C0SA 3E5HA 2WAYA 4LOAA 2V6JA 4TYYA 1KI1A 5LB4A 2R65A 3D7MA 4JLDA 4DB2A 4D82A 5HKKD 3EX7C 2ZTSA 3U3KA 3DOFA 2IHYA 4Z1MD 2LWIA 3QQ5A 2VO1A 4QHTA 1SVLA 1KO7A 4Q1BA 4HB2A 4QRHA 4TLDA 5AJZA 1KI6A 1MO5A 2J59A 5EP3A 1CXZA 4XWOA 1E0JA 2IC5A 4URZR 4HAXA 4YDZA 1S4QA 1VYTA 1N6HA 1KMQA 2ZJYA 3AP1A 3CF2A 4QKQA 3JZAA 4U5XA 1W0JA 1F6BA 1E9FA 5JS8A 1US8B 3FMPB 3SOPA 4QC2A 3BERA 1E0KA 4JL5A 4LGMA 4QJ3A 1EXMA 3GJXC 3L0OA 4JLNA 4DSOA 2L0XA 1E9SA 1EFHA 2MSCB 4DCUA 5IK2D 2HJVA 3KKMA 3FE2A 4HAZA 1W1WA 2BBOA 1BYIA 1Z0DA 2OAP1 3O8CA 3FMOB 4I1SA 2FDCA 1P62B 2CL0X 4DB4A 5G40A 2QAJA 4PZYA 2X19A 3P4YA 4CF7A 2BJWA 5EXSA 3AF2A 4BPBA 3PEVA 1VIYA 2GRJA 1GRNA 3SJBA 1XX6A 3ND8A 4P0TA 1R8QA 1WB9A 2IF0A 3PUYA 4B32A 4WVFA 2ANBA 1HEIA 2E9SA 3RS3A 2OCYC 2NZ8A 4A1FA 1K5DA 2GXSA 4H1UA 2PX3A 2C8VA 1EX7A 4RSGA 2WIAA 3TK1A 4URWR 4AURA 2IA5A 2QTFA 2RGDA 2GVZC 1W5SA 2DCUA 4A82A 3I62A 4PSVA 1U90A 1IXSB 1NVWQ 1Q12A 1E3MA 3EPKA 2KB0A 3BB3A 2YWHA 1IY1A 2HF8A 2VA8A 1UDWA 3PVSA 3LBIA 2WJIA 1DBSA 3RS0A 2QP4A 1FMJA 2W6IA 4IHQA 4KBGA 3QXSA 1GZSA 3QORC 2NTYC 4LX0A 3EPLA 1RRFA 3SJCA 1OXXK 4EPWA 4ZDKA 4OHXA 3R8CA 3U3MA 5FL7D 2F1RA 1KY3A 4TQ9A 4RD4A 2XCMC 5DI3B 1E2NA 1EESA 2ODNA 2P3SA 4LC1A 4NP6A 4Z54A 2CG9X 2BVNA 2B8WA 2CMKA 2O0KA 3GEEA 5SZHB 4OBEA 3AVXA 2PCJA 3PEUA 4CYMA 4M5TA 3P27A 4PPQA 5DLQC 4TQAA 1QRAA 2OEPA 1N25A 2QQ0A 2WKQA 5A0FA 4V0MA 5SZIA 3Q9QA 2QORA 3BOSA 3NVAA 2G6BA 2IYTA 4Q66C 5ANRB 3V9PA 5C46F 1U0HC 2BC9A 2ZRGA 4TMWA 3QXCA 4ZCLA 3ADBA 2AFIE 3MFYA 2IX3A 1F2UA 4B75A 4QG7A 2ZE5A 3A1SA 1MR3F 2QU8A 2PZGA 2VF7A 3X1XA 1E69A 3GJ0A 3GLGA 2IYZA 1CS4C 3NWJA 1KI7A 2W0MA 2NOAA 1W2HA 2YOGA 4GRAA 1J8YF 2HLDA 4LV8B 3P20A 2QROA 2DR3A 3UK6A 4LI0A 5DI9A 2OFWA 3EZ9A 4M8NE 3WHKA 2OSBA 4TTPA 1W7AA 3VX3A 4IDNA 3NKVA 3Q72A 2FWRA 2YZ2A 1S9HA 2PJRA 5AK0A 2D2EA 4C0QC 1SHKA 4C9BA 2P6UA 5CJ2A 4ZPXA 1MO3A 1N6RA 2ODBA 5GJBA 3LRPA 1WMSA 2CDNA 2ATXA 3NDBB 5FUYA 3BGWA 4Q01A 2XTNA 4MITA 3IDQA 2VHJA 4MYTA 2H92A 3CH4B 3WRXC 2AFHE 3T06B 3BFKA 3PUZA 3A1WA 4OL0A 3C14C 2AL7A 4OHVA 2WWXA 4C4PA 4E03A 2IYWA 1VG0B 3HYTA 1VHLA 1GDDA 1YZKA 2DYKA 1JB1A 3L0IB 4Z8YA 4BFUA 3C8UA 2ZEJA 1VIAA 2IYQA 3FHCB 4ESVA 1UKEA 3AV0B 3QEJA 1S3SA 3Q9LA 1KO4A 2W6JD 2XSZA 2NPFA 4JBYA 2F9MA 4L15A 2CHQA 1G9XA 4MDFA 1BOFA 521PA 1S1MA 2ZU0C 3C41J 4WA7A 2ZR9A 2EFDB 1E1RD 1KTVA 3PJRA 2JASA 4OK6A 1KK1A 2O8CB 1SQ5A 4Q4HB 1S2MA 1G41A 1X1RA 4TYNA 1LF0A 1ZIOA 1XZQA 3K0SA 1R5NA 3ETLA 4V0KA 5AUQA 2QY9A 2D7DA 5BWMA 2YOHA 5ELXA 2O8BA 4URVR 1E2QA 3CW2A 3N2IA 4OJKA 1KSHA 4BEJA 3GLFA 4IOMA 3UWKA 1T8UA 4NPHA 4XJXA 5FFMA 2WTUA 3KTAB 4NONA 4LY6A 4YLBA 4LDJA 1IN5A 1Z06A 2QQEA 2ZAMA 3B5JA 3CX7A 1U8YA 1H8HD 3CRMA 4HYYA 1E2IA 3WYGA 3AH8A 4XSHA 1NJGA 1PUIA 4UXHA 4Q7KA 2YC2C 4G0NA 1WRBA 3BH0A 2CE2X 4GBMA 1Q57A 3GJ4A 5DHFA 5GJWC 3HR7A 3SJZA 1II9A 2OFXA 2HUPA 3SNHA 1VCOA 5JRJA 1P9NA 4PFSA 1VPLA 2IHBA 3EC2A 2AWOA 1TU3A 1LB1B 3MAAC 1Q1EA 4RD0A 4Q1FA 4X8OA 2NMVA 1Z2AA 2B7BA 4IFEA 2VHUA 2QPOA 3EASA 4IVQA 3LXXA 4MGKR 4B73A 4E22A 4RZ3A 1GM5A 2A5DA 3OHMA 1ZUIA 2R6GA 2AR7A 2Q21A 3HDTA 4GZMA 4A15A 3L0SA 2B92A 3GLFE 2HCBA 3X1WA 4HAYA 2QAGA 2QPAA 3RHFA 3WMGA 4GP6A 1EFRD 2JDID 4AG6A 3GFOA 4WIAA 1C4OA 1JECA 2JJ2D 1CLUA 2BM1A 1G16A 1S96A 3IHWA 4M53A 4KODA 5EE1A 3O8RA 1QZXA 4TMVA 4MYUA 5FUWA 3SBDA 4OHYA 2RKOA 4B3BA 4MQBA 2O5VA 2VSFA 4ARZB 2B6HA 4IDPA 1NG1A 1U0JA 2BEJA 5F9HA 2IXGA 3PG5A 5A5GA 4UXIA 4B48A 5JJKA 3N70A 4HB3A 2FH5B 4CEHB 2V9PA 4QXAA 1GWNA 3WMEA 4WZAE 4FD2A 3J81k 1OHHA 1EX6A 1J70A 3LX8A 5AR1A 1CP2A 2H57A 2DBYA 3MWKA 5IF9A 5C18A 1ZC4A 4LJ6A 2D74A 4KLZA 3RRNA 4P4UA 2OZEA 4PSKA 1KJZA 4TTQA 5TDHA 2ZRCA 3I92A 3MD0A 4FMDB 4HLUA 4CEJB 4TYWA 3HR8A 4FIDA 3X1ZA 5CB6A 2DWQA 1ZYUA 1U94A 2QPTA 2IUUA 1SXJA 4LJAA 3THYB 2IS4A 4ZCMA 1JEEA 3U7EB 4B2LA 1WBBA 3GPLA 2WKPA 2YJTD 4D2IA 1TL7C 2PZFA 3IO3A 4JT4A 4LJ4A 1XTSA 3QXHA 3LAWA 2X2FA 4G5QA 1MABB 2YV5A 3ZIAD 5AJXA 2QP3A 2DPXA 1IN7A 4ELDA 3W8NA 4E09A 2QG6A 1N2CE 4ZO4A 4HAWA 1KMHA 1TF5A 3RNLA 4M2LA 1P9RA 3AUXA 2ODWA 3RS2A 4DKXA 3DMNA 4QBHA 3LO5A 4JYBA 4B2PA 3AKEA 1HTWA 2C9YA 1G8FA 5EE3A 3MJRA 4UNRA 5KYKA 4JL6A 1OYYA 4AKHA 4M1TA 4MDEA 4W7SA 2GTPA 2Z5FA 2FEOA 4LHYA 1T6NA 1ZU5A 2QRNA 3IIKA 1E98A 1YZGA 5C4GB 3TR0A 4YE0A 2ZM5A 1SXJC 1XD2A 2AD5A 2Q0HA 1OFTA 3FB4A 1SVKA 2F6RA 3L43A 1UBEA 4HAVA 4ZDWA 3FYHA 3KQNA 4NE2A 4HLUC 4MKGA 1LY1A 5G53C 4D80A 3KQHA 1GG2A 2ZRFA 3OAAA 2IYYA 1XMIA 4RFSA 3W9YA 1M2OB 3OE7D 3TAHA 2ZS9A 3CM0A 1ZNYA 4TN1A 1WGVA 1JJVA 2ZYVX 2XXAA 1IQPA 2O8EB 1NVVQ 1XXHB 1ZUHA 5DISB 2BIFA 1E32A 2BM0A 3EPHA 2A9KA 3EA0A 1Q1BA 1KO8A 3N5CA 2FSGA 4KFTA 1OB5A 3G82C 3LNCA 5HPYB 2GWHA 4DEYA 5TY0A 1ETUA 1HA3A 3VHXA 1RPZA 1ZVQA 2BMFA 2YC4C 5HE9A 1OKKA 1YZNA 1W36C 2OLKA 1QF9A 4GI7A 4OHZA 1C9KA 1ZUNB 3G5UA 1IBRA 1D2NA 3P4XA 1VMAA 4M9ZA 4OQLA 2CCKA 4IOLA 5AWFC 2FPMA 1RIFA 4ZJ9A 2ZI7A 1KDPA 3NH6A 4MRVA 1W4RA 3BB4A 2YWFA 4EAQA 1GP2A 2BWJA 1GKYA 2QAGC 2ZETA 4FMCB 5GJCA 4B34A 3KJEA 4BRUA 3OESA 4JJZA 2C5LA 2OBLA 3U2QA 4FINA 1SVSA 2BCGY 4RZKA 1D2EA 3A58B 4RKEA 3GLIE 2O0JA 3I73A 2IWHA 4NYIR 1HUQA 5CM8B 4DLVA 1H65A 3F5FA 1HE1C 2W83A 3LDAA 4CDGA 2GCOA 1ONBA 3QKTA 5DE3A 2FU5C 2CJWB 3T1TA 1XNJA 3VR3A 4PZZA 3UKDA 1OFUX 4MUAA 3DL0A 2ORIA 4NYJR 1G5RA 3DZ8A 2IYSA 3DM9B 4L5BA 3C16C 3RDPA 1JXMA 1AZSC 2F3TA 4GFDA 4MYCA 1E4YA 1FTSA 1G7SA 4Q9KA 4M21A 4LSGA 4WOPA 4QM6A 2ZANA 1E2FA 3GFTA 2RCNA 2V1UA 2VTKA 4PC6A 4P4SA 2CK3D 2HYIC 4TLCA 1T3LA 1LV7A 1UKVY 1Z6AA 1KMHB 3W1ZA 2XOKA 5KSZA 4HEJA 1OXTA 1S8FA 2RGXA 2ZS7A 4BFYA 4DCTA 3Q9PA 4IFBA 1FOEB 3QXJA 3UMSA 3U4QB 1QHHB 3U7HB 4CEHA 1W5TA 1TNDA 4G3XA 4R2HA 4R71A 5KSYA 4MRPA 1SGWA 1G21E 1NLZA 3DVLA 2ECKA 1FX0A 2ZU6A 1W4BA 2NO0A 2P67A 1A5TA 3LVQE 2CXXA 3ZD7A 3QUSA 1SHSA 1XMVA 4R9UC 2REOA 3B1WA 4L16A 2FSHA 2J46A 2BMDA 2ZSFA 1J99A 3AVOA 4D4JA 1P75A 2DHRA 1DAEA 2Z0MA 1NVUQ 1R5OA 1ZM3A 121PA 3GLIA 2VH5R 4ARZA 3VQMA 3LW7A 4IDHA 4EKDA 5C4MA 2XEXA 3PV0A 2N46A 3V4RA 2VF8A 2XJ4A 2OE2A 2IS1A 2FZLA 3KJIA 1QHHA 4MYHA 1GKUB 1YVDA 2P5SA 4KYIB 4C0KA 2BV3A 4HB0A 1XPRA 1GIAA 3TQCA 1GNPA 1ZM9A 1MOZA
chains in the Genus database with same CATH superfamily
2Q3CA 2WKSA 1YJCA 3OIUA 3IPAA 1JGEA 2YQ4A 1PNDA 1ROCA 2HMSA 5CJ5A 2I6XA 2G60H 1SXQA 3KAJA 3I1IA 3DGFC 3NAMA 1QO0D 5K3DA 1II4E 1P33A 3MRGB 3RNQA 4LIPD 2OV2A 4C4BA 4B5ZA 3FYTA 1B23P 2FQDA 3ZUNC 2VHQA 4YQXH 5FF6A 3BYTA 1NAML 3AVWA 1ABFA 1MX5A 1INEL 4ZDHB 5BS0B 1GCFA 1FGVL 4UEQA 2VYRE 3GGDA 1HDRA 4G1CA 1RTKA 1T29A 2Q6WA 4MS3B 4UXJA 5H94A 2OZLA 3PU7A 4Y0GA 4ZAKB 3D85D 5UKDA 3H9YA 3AB0B 1K8QA 4EDWH 1FFRA 3F0TA 1S9VB 2NU9B 1CYDA 3GXPA 3BN9C 5FAAA 4XD2A 2GBVA 5C0DB 1C1HA 1UDXA 3P9KA 4RHFA 2SKDA 3DHMA 2WC1A 5ALWA 1V5FA 1TKWA 4RTLA 4JI0B 3TJZA 3MIZA 3RIFK 1P53A 4XH2A 1D5WA 5KKCA 2FXIA 2CVHA 1NF3A 2P1YA 4LF9B 2RGBA 3KPLA 2C2ZA 4KFSA 2JH8A 3TRKA 3U48A 1P0SE 3AM3A 5HD8D 1S9WA 4X7SH 1DVFA 1F0LA 3FSJX 3C3CA 1T2VA 1WDAA 4LZOA 1R74A 1B76A 1BAGA 2XIBA 3T0EA 4S24A 5K0TA 3ZNPA 5G41A 1NDMB 2X0KA 3KPRE 5CLWA 4GMSH 2Z34A 3GHBH 1S5HB 1SXGA 4HUVB 3C5HA 3LRSA 2ZWIA 4JC0A 4I46A 5FOSA 4LZZA 1KVRA 2DQEH 5EFZA 1JR3A 2DJ5A 4QNPE 1RAAA 5EIOA 4UMFA 4FYIA 1EE1A 3CUEF 2OX5A 3TXYA 3CZ4A 2I4IA 5F1OA 1R4ZA 1EHIA 2EFCB 1KIPB 2EYUA 2VQEB 3V7FA 5C0EB 3B1UA 4HGKC 4E30A 4MVBD 4DANA 1GQRA 4MXDA 3S34H 3W9BA 4NZRH 4ZMNA 4O59O 3QWFA 1ENOA 3KYAA 1YUBA 5ENDA 4FHZA 2ZRHA 4E88A 1N3LA 4Y1AE 4B6ZA 1J5DA 3NDRA 4OJAA 1SRQA 1A6ZB 4C55A 1UBHS 1A95A 1H6TA 3R9IA 1W36D 3H7BB 4MPDA 4OFIA 1IAIM 4WF7A 4DM3A 2GM4A 2NGRA 1X9HA 1XD0A 1QP7A 4JL2A 5AKRA 4ARSA 4GPBA 5ERXA 4C4RA 3O6KL 5JIDA 3QJRB 1ODCA 2JS7A 4BK5C 3ASNB 1NSFA 3AXSA 3L84A 4C6RA 1N8NA 3BAIA 3NRPA 4AX8A 1NP3A 4MFHA 3SDAD 4KWTA 1PZHA 3KKZA 4Z0PA 4XYLA 2JA2A 2NVOA 1KACB 4ZI2A 4JY4A 2EC8A 1N3IA 3PREA 4JDTL 5KVFE 3JQPA 5MERB 1G0XA 1DC4A 3H0TA 3SDDA 5EVCA 3FYSA 1S9YA 2F19L 4H3KB 2HQSA 3PICA 4LQ1A 1J2UA 1UA6H 1AD0B 2DJ4A 3MLTB 3AY4C 3NHYA 1J0AA 2W65B 1WY7A 3INRA 4M4SA 4QULA 4A26A 1HE7A 1SYSB 1MVFA 3P7MA 1NEZB 1MF7A 3FUKA 4QWWD 1AKEA 3SQLA 5L3RA 2CDFA 4FQCH 2V5UA 1XN4A 3D4LA 1RYYA 5BVHB 5HR5A 1Z6ZA 2PMCA 2C8KA 2WHPA 1GAJA 2X3FA 3U6RB 3DO8A 3UCFA 2A88A 1I1OA 3HNTH 4DC0A 4O2EA 3UPCA 5GZNC 3LT0A 4EKNB 4XGZB 4LDNA 2ZYHA 1OIVA 2HPVA 5FUXA 1APBA 4D4KA 4DO4A 1KJ2H 3BE4A 2TMGA 3LT5A 4ND5A 3ARTA 1NVFA 2IPTH 1PTKA 1V1RA 2BXZA 3ECVA 2WLHA 4HZLA 2VNIA 4K9NA 1UIRA 1MEXH 1UQTA 3GM8A 5ICGA 4GVLA 2D2CC 4I9NA 1U0LA 2JFXA 2QLVB 4CHTA 4UOQA 4HX1A 5EMNA 2Y2YA 4NYMQ 5AVTA 1JU4A 3KV3O 2E9GA 1OTTC 1IAKA 4DZ8B 1J9EA 3HB9A 4HN4B 3ZVRA 1EFKA 3RX8A 5IQOA 3NO4A 3K72A 2WIIA 1WPXA 3SG0A 2A6KA 3MA9L 2JQZA 4DA6A 4RU1A 1NCOA 2ERJC 5CH3A 5EHNA 2XDYA 4CCWA 1EBAA 1LO3H 1M7DA 1SJEA 2O2YA 2XRAL 3LKSA 2DQTL 3R7RA 5IVZB 4DN3H 1ZNXA 3NYRA 1A6TA 3GBDA 4MV4A 1NQAO 1KZ7B 4KK6C 5TQ0A 5HK8A 3E03A 5JXHA 3QW2A 1MQ9A 2IC2A 4CBVA 3B3FA 4WI0B 4XP6L 4I18A 4U6VH 2XOKD 3GMPA 3T04D 1NKSA 3DBIA 4YFVA 2N01B 2PT7A 2UX6A 5JOQA 3RVNA 1E3EA 3VHQA 3TECE 2B59B 1UBJS 5A0TA 4PTUA 2JJ8A 3OCCA 4JK0D 1AO0A 4D7BA 4E5KA 4KAFA 5EWMB 4LBAA 1TQTA 4UEJA 5B8CC 2DYPB 1WIWA 1ZT7A 5H2BA 4EB0A 3ES9A 4M93B 3VPBA 5T4FA 2RI6A 2WVTA 5DTFA 4BKTC 4XIYA 3ANMA 1ZPLA 1EIZA 1TETH 3VSVA 1GZVA 3O4VA 3ED1A 2ZLBA 3MACH 2V7VA 3O26A 4MUIA 1S8OA 3NKLA 1W52X 3HZKB 5HGGS 3D31A 3PEWA 2XZAH 5HMLA 1HESA 1EK2A 4EMTA 4OFKA 4AQ7A 3JVVA 1I1YA 1BU8A 3WL4A 1PZEA 2BOVA 5THQA 5CURA 3IUPA 2PO6D 2JIZA 1YNTB 1NGXA 4OI7A 1H2AS 3SBEA 2ZCHH 4HGYA 2JH2A 1OCZB 3SY0A 1FVEB 2B5VA 1XEWY 4W4TA 5T4HA 1SDYA 2AJ3A 3VXOA 3TZQA 5E8PB 4JWKA 4AK2A 4KFCA 5C0BE 1XXDC 3GLHB 4EFMA 2W2LA 1Z6JT 5EPMA 1B00A 3MR9B 1ZVJA 4PLNC 3QEBZ 5DQ9A 2RH0A 2QSJA 2FECL 2ZSBA 1E79D 5JSYA 1FQKA 5JXGA 4APXB 1B4RA 4JCCA 4C4KO 2VN4A 4R97B 4MA1B 1FBTA 5BW5A 4X8JB 5HJ5A 3I3DA 2GKOA 3NP7A 3BJMA 3RVSA 3MCTA 2WFLB 4AO8A 5JD6A 5JZOA 3FO0H 1RWMA 3QZBA 4WKBA 4YDVB 4IO1A 4D98A 4LJSA 4D8YA 1QJCA 1UXLA 1LILA 5CXUA 5DS1A 2NY0C 4H1TA 4EHDA 1Z2OX 5JHLA 2E7DA 3A1CA 5MGNA 1OD7A 4YNYA 4OK3A 1YQXA 3U25A 2AEJA 4C57C 2IV7A 2YASA 4LSVH 4H1HA 4MRMB 4ZBJA 2EL7A 4RTPA 2XUPA 2SKCA 1Z88A 4U1KA 2AD1A 2QL7A 3HEIB 3C24A 3ZL2A 4IKOA 4NOBA 1KNOB 2WAAA 2ZS8A 4CQMB 2AXNA 1KY7A 3AI3A 5CB4F 4MVWA 5JBIA 1XLTC 2X40A 3D2UB 4YRZA 3E70C 4PGBA 1S78D 3PK0A 3BB1A 3PTZA 5EOQL 1TO5A 2RH5A 3U9LA 4WGFA 2ZOKB 1QFUL 1FK8A 3G88A 1JAEA 5KMGB 1GOGA 4AITA 3GJZA 2DWSA 3VOBA 5DNYB 4KDRA 2Q7AA 4JFZH 4LPXA 4WE3A 4ZTZB 3T38A 4E1VA 1DFHA 1B0GB 1BAFH 3OWXA 4FZ8L 5ADHA 3CU5A 4X9IA 3DX8B 5F3FA 5GHWH 2OAAA 4GPD1 1XTZA 3VC1A 4NTZA 4Q19A 2CLKB 4GF5A 4I55A 1FDSA 1OILA 1I0ZA 3SCMD 3GUUA 2BMJA 4QRDA 4CBZA 4PYIA 1VFUA 2P2ZA 1F6FB 4I9WD 5B2FA 4JLBA 2V0AA 2EYQA 3DH0A 4YLYA 2ZKYA 3VFSB 2ZUFA 4L0ZA 3EC7A 1GTVA 3V8VA 1FFBA 5E8OA 4I55F 3PDOA 5IMSA 2H4FA 1YCFA 3WSVA 4YAGA 4JPIA 4LFHD 5C3TA 3LVBA 1GILA 2H1CA 5TF1H 2XCIA 3GPBA 4PYMA 1RZ8A 2DM3A 3NONA 3HFFA 2WG1A 5L95A 1USUA 2EWWA 3G1UA 4ORGB 1KPGA 4K2UL 1SVUA 3GLDA 5KUMA 4P3DB 4PRPE 1MB0A 2J0SA 3H55A 2APWA 5F1KC 3KMDA 1RFLA 2AJSL 3T8XB 3PFHA 4BNHA 4U00A 4OLJA 4COOA 4DNQA 4U3JA 4CTJA 1XJ0A 3TESA 3N58A 2EJCA 4FGLA 4B3GA 4E5MA 3AXTA 1Y0LA 3A1VA 3DB2A 5EU6A 1J7KA 4XC1H 5IB1A 2YRLA 1S7TB 4HQRA 2N1BA 1JEYA 4C1BA 3ZTJH 7FABL 1U5BA 3NEOA 4GKBA 4F96A 2EP5A 1KN2H 3IAXA 4S1SH 2I33A 3DEAA 1CL7L 3TNFA 1ZK3A 5IOPA 1QYGH 1ONPA 3G89A 3BH9B 2RCSH 1H0HA 4WBXC 2A3TA 1FE8L 3NI2A 5JLJA 3THML 1MU0A 3DLIA 5HI4C 1FSFA 3IMVA 4BLSA 3L02A 3QSKB 3OCYA 2QMJA 3A9UA 1KH1A 3PP4L 4MUKA 2DIAA 1RPJA 1HL8A 1H1DA 4DPRA 1EFVB 2X4IA 1JYNA 1R6BX 3HLAB 3JQGB 4HFWB 6Q21A 1CFMA 4QWWA 5KQLA 2HF2A 3RFZA 1HOTA 3K6SA 5L4SA 3POHA 4NO5A 2YJZA 3SHWA 1QUPA 4EGSA 2A6IA 4E9XA 3AFNA 2X0VA 3CG4A 1EDYA 2EABA 5C0CB 4TUYB 1B4JH 3RWBA 1KTBA 3B9RA 4LV5B 4OGKA 3AVVA 4G8DA 4J3OD 2AEPH 2GVYA 4DN4L 1D2HA 5EF1A 1JPGB 1RVFH 4MI6A 3NJKA 1VE3A 4N24A 2HCJB 2YVLA 4U05A 3ILEA 2O57A 1A9RA 3H2ZA 4F2WA 1OD9A 3W5MA 1FSKC 3EIHA 4HKJA 4OZHE 1G4AE 5KJEA 2X4OB 4OM8A 5D1HA 3AKCA 4EPTA 1NONA 3FOZA 2NY0D 1G1CA 1IZYA 4ZQTA 5I15L 2IAMB 5BRZA 3IDGA 3GYGA 5TT1A 1Z4MA 1T9CA 3W0WE 4G3YL 1UB5A 2IV9A 4YHPA 5IGXL 2K70A 3N2KA 4JM2D 1ZAYA 3S99A 4NQED 4JFZL 2XMDA 3T4AA 1AGNA 2G0TA 3DEHA 4XOUA 4H1LA 2W65A 5IQNA 1E4XL 2GPJA 2FCAA 4A2LA 2D5BA 4ZHQB 4HATA 1FO0B 4FHBD 4CADB 2EWVA 1H3PL 3MI6A 2YRFA 3NIBA 5ICFA 1RPTA 4UMSA 3UTSD 4K6GA 2BSAA 4RGNE 1UM4H 3FCBA 3ZHFA 1LO0H 1TUGA 3F7NA 4HLNA 2NYYC 2EKLA 1XZMA 3UOGA 1CZ8L 3OJWA 3CLUD 1YEEH 4M8RA 4DZ8A 1X86B 3ZLQC 3GGCA 4JX8A 3N55A 1ORQA 1BQ4A 4DMGA 1QRUA 3WK6A 4EEKA 3DZJA 3RNOA 4F9PA 1NFDA 3MRQA 4J91A 3D18A 3PENA 4E5DA 5EE5B 1D9KD 4FYWA 4C0BA 2XU9A 4H4DA 3RODA 4HIIB 4RIHA 1CD0A 2YVQA 4DP8X 2A57A 1I3KA 4MVCA 2Q4RA 1PGOA 2H2HA 4TVSa 2A0FA 2IALA 1OU4A 1IBMB 1SM3H 4HH1A 4BC0A 2W9DL 1E77A 2JKYA 5K8JB 1V5WA 1P80A 3UENA 4PLYA 5GMOA 3PCXA 3LP8A 3BZFA 5IPFA 5EEGA 4H0GA 3L7OA 3VG0L 1SC4A 2EKPA 2WZDA 4V33A 3N2LA 2BZGA 3LUKA 1N1MA 1PTZA 3DL7A 4AV0A 1FYEA 2XCUA 3OJOA 4KKLC 2RJMA 2XSKA 1JPSH 4DR3B 5FA3A 1ZCZA 1N3NA 4V11A 3CFDB 3U0PA 6AT1A 3O11A 1CZHA 2QTWB 4HJJL 2R2HB 4NICA 1MHEB 3ROXA 5SYMA 2HQRA 3MLRL 1RFDL 4QQKA 2A4ZA 4MTMA 5TGBA 3DPBB 5JIBA 1X5XA 1LPBB 3IHTA 2WSYB 2PXCA 3BDAA 1A9EB 1Z32X 3E4CA 3VFDA 2RG7A 4OP3A 3NT5A 4BS9A 1VFAA 3FW6A 3E9NA 4W1QA 3WMXA 1TQCB 3KXDA 4E94A 1M05B 4QNRA 3RQ3A 1G6KA 2PWYA 1N8OE 1CKEA 1R3HB 1IKNA 2GD0A 3RGVB 3BMOB 4F9EA 3UV3A 5EBWA 3TLKA 1PL6A 3IPRA 4DCSA 1HETA 1R19A 1NVKA 3SR0A 1TAQA 4L0PB 1U30A 1SKMA 3E3MA 1B0GA 1JMKC 3QFFA 3ESAA 3VFPA 3NUKA 4LHWA 3OM8A 5T1LA 3EGIA 4OFYA 4K7FB 1ZLXA 4QTTB 1JE0A 4OYRA 4ENEC 3LS4L 2WM3A 1P7VA 2PYIA 2EX0A 2A1TR 4CQMA 2ZJ5A 1J22A 1WP9A 3KKEA 1YQ2A 4LLUB 3K09C 3N0VA 5EZLB 1MQ8A 2XFXB 2XUFA 2GH1A 4TT3A 4HAOA 4K3GA 2YZ7A 4KQ1A 3KQTA 4FXGB 4JHZA 13PKA 3GJ3A 3BVNA 1QFHA 3LO8A 4YSUA 2ID7A 1NWOA 4JPIB 1TQDA 3ILQD 3TT1H 3W90A 1EM8B 4I77L 3CXDL 2AX4A 3LXAA 4RFOL 5B39B 3UCQA 4W8GA 3GLIB 4X1IB 2N1TE 4GSRA 1DLJA 4D7PA 2FMIA 1IE3A 1MB9A 2CHVA 4KK8D 4L2IA 2D8AA 4XP9L 1USQA 5EJ5A 1LL1A 4PPNA 4DEPC 3TO2A 5CGMA 2NW3B 4JXJA 1XKQA 4C4SA 3ZCTA 4LE2A 3T0XA 5BV2P 1CUCA 3UJNA 5DHVA 1TJYA 3U26A 5IC6A 1ADCA 3PS6A 3IM1A 2VPYA 2GEFA 4Y9FA 3R0ZA 1HNZB 4JNKA 3V3TA 4NGHL 4HU8A 1YUNA 4NK5A 4OKVA 1YQDA 1MI5B 3RABA 4J94A 1GS8A 1ML4A 1ZSYA 5KWYC 1X6LA 2VF2A 1Y3FE 4DA4A 2FHBA 2VQSA 2JLQA 2YKGA 3IKLA 1SCDA 2X3BA 3LEYL 5AW0B 1BU5A 1Y6QA 4JN1H 4NHEA 2UVDA 5AAMA 3AL3A 4PJAF 5EJGA 2RAUA 1PG2A 4J49A 4EI5C 2J88H 3VI3A 5IHXA 1D7AA 3T7DA 1F42A 3QFJD 5D4QA 5E7QA 2I78A 5IB3A 2VTFA 5EJMA 3C7AA 5F7KC 5PAZA 4YXKL 1UDAA 4PRNA 1PP4A 3GRAA 1E6OH 3D48R 3N1PC 2VK8A 1DCMA 4URTB 4Z7VE 1ZMXA 5B58C 5KEIA 1P5UC 5F5NA 3TYFB 1F1DA 3AESB 2PUWA 4G0MA 4CLOA 3IN2A 1EU1A 5I7RA 3AKYA 4TXNA 4EECA 1SO8A 4RJKA 5CDFA 1YRWA 1E9BA 6LDHA 4BNZA 1ZWIA 4Z7OF 3KPSB 3AACA 3J81A 1XL4A 1U99A 4DMRA 3GS7A 1YEKL 3RWIA 3SI7A 1ZRHA 1IGCL 4OV6F 3RU2A 2MNWA 3L5HA 1PR2A 3NR2A 1WB5A 1AOHA 3FNRA 4JC4A 4J23A 4ZTUB 1Q8MA 1AG0A 5HZGA 3FQ4A 4IJ5A 1EFLA 2PWEA 3ZLBA 2OQ2A 3PR1A 2D2OA 4AMKH 5L0QC 5D7JB 3LPLA 2C5AA 1ST3A 3FTVA 3DO3A 1P5UB 2AVFA 5F3WB 1IZ7A 2YA0A 3TLYA 2YYAA 3HB0A 1VYUA 2V4ZA 3ULUF 4R6UA 2AJYL 3UT0A 5JCJA 3A25A 1GIGH 1PY4A 1IC0A 3HN2A 1CT9A 3TTTA 4WWKD 3RVQA 4ZMQA 3H65A 1NY5A 3N1FC 2BHSA 5HHXH 3O2QB 1B2YA 4RQTA 3RGHA 1W80A 1HHKA 1IXYA 2NT3A 3BHBA 2FZ4A 5EPUA 5I0VA 5IN5A 3RADC 1EJBA 4UV4L 1CJBA 4OQFA 3RTBA 4OZFB 2JVUA 1NW3A 2IPAB 4UQBA 2RHJA 2FOIA 2R1ZA 5I9BA 4D8XA 1UBFA 4X91A 2CPUA 3DFZA 4Y1AD 2PYED 4R1UA 1YIDA 1MWAL 1KFGA 2CLFB 2R4UA 5JYBA 1Q0PA 4XTRA 5LNK1 4ND2A 5KBYA 1LVEA 5IDVA 2P45B 1ESZA 4TUJB 4C0SA 4HGWB 2R2EA 3DTXA 2ZCLL 1BFUA 1ED3A 5LVAA 1R3LA 1L9TA 2MCPH 3MJEA 4TYYA 4UZSA 5LJIA 1B16A 3H2SA 1BOOA 4X85A 3R41A 1N8ZB 1I30A 4WTXA 3U3KA 1QVVA 2IHYA 2LWIA 4PYQA 8AT1A 3LH2H 5I51A 1DVSA 1P7HL 1RULL 4XA8A 4DUVA 3U80A 4BFNA 3SSAA 1PEYA 4NCXA 1A9SA 3CN1A 1US8B 2ODAA 1JBJA 5EJ4A 4NQCE 1GEEA 5AW9A 2R4QA 3X11A 3GGGA 2BBOA 2B30A 2G0LA 1YECH 5AL8A 2C3VA 2I2XB 3IT3A 5AI6A 4OM7A 4NQZA 4IKNA 2VJOA 1E1KA 4NS4A 2HFKA 1KP2A 3ESMA 1YMHA 3PEVA 4GRLD 4ZFZB 1TT6A 3GIVA 3W5AA 4XP5H 2ZOLB 3FX2A 3A32A 2IF0A 3C60D 2W6QA 4RAHA 2BFWA 4OU3A 4GR9A 3UJTH 1PJCA 3EN0A 1N9PA 4IHKA 4XLLA 2HJFA 4FLRA 2YA2A 2EXSA 2Q86A 1I9EA 1ODJA 3WTSA 3REQA 2ZZNA 1IRAY 2DWYA 3PC6A 5DK4A 3WGMA 5EOCH 1G2IA 1ZDMA 2HC9A 2WYUA 1BJ8A 1PSKL 4QVKA 3CXHJ 3QEGL 3EPLA 2Y5TB 2CGRH 3VDNB 1MREH 4POZD 3IRZA 4LC1A 1WGOA 3MYJB 2XUJA 3N06B 1AKRA 1MIEH 5I73C 2Z5VA 5LCVL 3GGJA 4HCIA 4DJAA 2WKQA 1JZDC 3T5WA 1KXTB 2C7UA 4MJXA 5DM0A 1EFAA 1ET7A 4R9HA 3TBSA 2AFIE 1L7XA 4HR7A 2QU8A 3GLGA 4BP8A 4XO4A 2H5LA 2BIPA 4MKZA 4KTEH 5DK0B 1PNTA 4L08A 1J2RA 5CD9A 3X3GH 4M3KB 3KKLA 5KINB 3EZ9A 4OB7A 4G5AA 4ZMBA 4HYEA 4MJ4A 2RGWA 1QQDA 3EXG1 3QQPA 2Y5EA 4C9BA 4KPUB 4L74A 1DJGA 3RT7A 4BAUA 4P8RA 3DKHA 2XQYK 3T65A 1C29B 2FUCA 5F77A 5BUQA 4W4NA 4J3OH 3BFKA 3WWYA 4OJEH 3NHJA 3OC5A 2AL7A 4LMQE 2B14A 1ZIXA 4DGWC 3S2IA 2FPUA 4Z8YA 1L7IH 3ZE0B 4BFUA 4DA7A 2PUFA 2FBJH 2JKWA 2QKIC 3O9ZA 2B1OA 3WFDL 1CF9A 1ECYA 2ZU0C 3W2GA 2IZ1A 4KYVA 1T1JA 3ERXA 5KVEH 4RV9A 4ECEA 5AVWB 2HPOA 1WCBA 3ZHKA 4UEWA 4TYNA 1MPAH 1I10A 3RR2A 1L6XA 1ZS2A 5AW4B 3GQBB 4UU9B 1O97C 2Q8QA 3LZFL 3HFGA 4Y2DD 4QYXA 2DPMA 5FFMA 2L7UA 5TTRA 4ZI8A 1QSVA 4R9SA 4TUOB 1E2IA 1KH2A 1E8DA 3RIAK 2NNAB 4X9HA 1NXOA 2J9YB 6ADHA 2HREA 5DP1A 4M6ML 2IFGA 4ZFOA 5BUAA 4PO3X 1TT7A 5FLEX 4WEBL 3PP8A 1NCBH 5CTAA 4JENA 2XXCB 4EG8A 3IULA 4JRXD 3NBAA 1LD3A 5IC4A 3HPLA 2DFVA 3L0DA 3EG9B 5KEZA 3I1JA 4P4KD 2NNRA 4ZS6C 1RD6A 2ZYIA 3PLRA 4NQVA 1UKSA 2ZXDA 3EGOA 3MLUL 1G1YA 4DCQA 1GZDA 1ES0A 1XDDA 1HCVA 5F9HA 3FONA 3SY8A 3MGOA 5KAMA 4NQTA 1EANA 3LKBA 2MCFA 1CQYA 2V9PA 4I9UA 4NPYB 4ZVQA 3J81k 5G1OA 1AQKH 5K2MA 1C14A 5DIZA 2H57A 1TM1E 4BN5A 2BZCA 3MWKA 2CSUA 1WSDA 1YZYA 1KJZA 2BERA 1DC5A 2ZRCA 4TYWA 3HR8A 1UMBB 2P2CA 2R6HA 1FL3B 2EJWA 4O51A 1O8BA 3QOXA 3HB7A 2WKPA 1PF3A 2PZFA 5B39A 3QUQA 4LJ4A 2X2FA 4G5QA 1SHMA 3N75A 2O5ZL 4IXDA 3QQXA 2PANA 2XWTB 1N2CE 3TIVA 4YIHA 1P9RA 1UUNA 3FOFC 3Q3GE 5DHMC 1WEJH 3FFDB 2DLTA 1YIOA 1XTLA 1QPXA 1N70A 2YJLA 3VI3B 4HK0A 2D9QB 1ZU5A 2CFCA 2G30A 1PAUA 3HKDA 3ELQA 1E89A 2JK1A 4FUTA 3IIKA 3MOBH 4BUQA 4P36A 3S1SA 3QBDA 3MRKB 1M83A 4PV9B 2MSNA 4QY8B 3WS3A 2E4VA 3NYQA 3QLUC 1A6PA 5ECGC 1X7HA 4KZ0A 2ZS9A 3CM0A 4YP9A 3QA3A 3KWLA 4ODSL 1H6CA 2I85A 2Q8NA 4XFKA 4YT8A 4NP4L 2CXHA 2W9DH 3ELBA 5KSUB 3S44A 3G82C 1ZSVA 4MKRA 3X1KA 4ZCRA 5K09A 2D4FA 2I32A 4ETMA 4PRAB 3IAM6 1CUEA 4I5DA 2PWPA 2ZI7A 4CU7A 5EJAA 1F6DA 2NW3A 3IUQA 3TZKA 3KJEA 5AICA 2H2SC 1WG3A 1JWUA 1ZN2A 5A7EA 2ZT8A 4PPYA 1CYWA 2C5LA 2OBLA 3RO7A 5I5MA 2CDCA 2EYRA 4X6BB 2FU5C 3N87A 1IGJA 1QSFB 3VXPB 3QMWA 1XTBA 5I7SA 1OC4A 4Y2GA 4L5BA 5H3HA 1FJ1A 3VBCA 3LOWA 3JXAA 1A6WL 1AZUA 4QI3A 4ZQKA 3QIUB 1U28C 4I9GA 5MERA 5IVXB 1K7EB 4NE9A 4MV8A 4KVCH 2DKFA 5CBAB 4MUEA 3H87A 1Z6AA 2XOKA 5D7JA 1S8FA 4NBYB 1G9NL 3K5HA 3ZWCA 1KYXA 5JHLH 4L0MA 1EFXA 3HI6H 4N90D 1XD1A 4EJMA 1KDVA 5JW3L 4OL9A 1OBFO 3IKVA 4G3XA 1RK0B 2PKWA 5E08H 3R0NA 4J3VA 2ZU6A 2W4MA 1T7VA 4D9QD 1UCBH 1I85A 2UXCB 2V96A 5FIEA 1A4AA 5E9AA 2VH5R 2WIJA 4IBZA 5GIRB 3AESA 3MRXA 4CR6A 4CKYA 5K20A 1A3LH 2GI4A 2BE7A 1NGYB 4G9DA 3TM5A 43C9A 4G70B 4Z78B 1ZWIB 2W8CA 3NBQA 3O3MB 4JIMA 3JWNG 3OKEA 1ZRMA 5IVZA 3O2WH 4LRQA 2XA3A 5HPMB 5FBRB 4C5CA 3WEMA 2YIJA 1JJUA 2BHRA 3JXEA 4BX2A 1CVLA 1XTIA 1JDPA 4F2MB 5IU6A 5EU7C 5TX7A 1FF5A 3ZDXF 1T6VN 4BQFA 3W9EA 1OIXA 5DJ8B 2X5XA 4NM8H 5EP4A 2DFPA 3KFLA 4IS6B 3DVNA 3V8RA 1BXGB 1F51E 1AVAA 3IQIX 4GO8A 3JWJA 2F8TA 2IDFA 4BEBA 4P4TA 1EVLA 1T2AA 3Q3IA 2QDWA 2ZXGA 1CDDA 3C8HA 4P22A 3F7KA 2AN9A 5CJOL 1ZMTA 2FZ5A 3W1WA 2PAFA 1Q2XA 2ZXUA 4J4PC 3T3IA 3GUFA 2WTXA 4AQDA 3ZEIA 4EI6B 4NG5A 4XJVA 1FP4A 2DBVO 4LHJB 2M6LA 2BVPA 3L6UA 2CXPA 4S1RH 2PIDA 2B34A 3O4FA 3T8YA 4EVNA 4J6IA 2J5KA 2JIPA 4K5QA 1U0EA 4JKKA 1MY5A 1SUFA 1T25A 4Q39A 4Y2VA 4O4LF 1PKXA 4OT1H 4DLWA 1MAJA 3RVOA 5IBCA 1SHUX 4GNKA 1I7RB 3LPOA 4WV1C 3HWRA 2CGZA 3E58A 2BDTA 5JA9A 2AS5M 4XAWH 1XP5A 2XF2A 4FQLL 2YJNA 4DLPA 1PT5A 1KMIY 5MFZA 1IZ9A 4OATA 1XAIA 3DXXA 3GZNB 4EG0A 3ME0B 1UM9B 4L4JA 1W4LA 5ADWA 3P02A 4N5NA 1EUZA 5HVWA 1MLDA 3GUCA 4O9HL 4FB5A 3IIMA 1EHAA 4DCVA 4ZX5A 3DBOB 1T1SA 3GLQA 4F9TA 3NDJA 2Z8YA 2VXQL 2R83A 1H3GA 4Z76B 3SLGA 5AB0A 1CJYA 3K05A 4KGXA 2O8FB 1V55B 5E08L 1T5XA 4A6YB 2A0YA 4ZYXA 5FPIA 2LHAA 1FFXB 3L7CA 1TO6A 4KN6A 4KKQA 1A7OL 2X1WL 3V8QA 4DJDC 3Q6GL 4V0NA 2IHTA 4MCZA 5FWDA 1CI5A 3L9YA 4G7YH 4PJ9B 4OH1A 4AY5A 5FOVA 3WNQA 4OI2A 5MP6L 1UCFA 2DQ6A 4Y5YA 3EOTH 4M5ZH 5D1ZD 2ZUQB 1MKYA 3PP3H 4NQDD 2NPIA 3TF5A 1K0UA 1NP7A 3MLAA 5FA8A 5I1AA 2IOOA 1EGJH 1TOXA 4HVAA 2P91A 5LU9A 3I02B 3TLXA 3SGJA 1FUNA 1CJCA 1I3RB 1SC6A 3MINA 2VTBA 1EGQA 2KBFA 3OZUA 4W4OA 1KLUA 5HGDA 3BLBA 2IXDA 5T1DH 3VXME 3PWKA 5B12A 1VL8A 4KLNA 2JQMA 4WU5B 1NIFA 2UXTA 3N7AA 4OV5A 3MMNA 1QQAA 4BV1A 4JUCA 2C4HA 1YE5A 1S7XA 4EYQA 3LRLA 2QLLA 3VR5A 1F2TA 4AZ3A 2OSLB 4II3A 4G42B 1TM3E 3JUYA 4EHNA 3TEJA 4TKUA 4RENA 1MFEH 4Q9HA 4NP4H 1Y5NA 5ELIA 2QG9A 5AJWA 5GADl 4J07A 2DICA 3ZE6A 3L0YA 3A1TA 3QJYA 4YN3A 3N44F 3RL1A 3ETTA 5IP4A 1PNQA 5BYKA 1PV4A 2XBDA 5K3FB 2BSQA 3VG0H 3UKOA 5EZJB 2F2HA 5DMIH 4BBAA 2PXXA 4QHLA 4RKFA 2BT4A 4D0LB 4KY2A 2R69H 4AIZA 4L1LA 4IOJA 1OTUD 4N8PA 2O4UX 4FCWA 5FECA 3EQ6A 5B38G 2X9QA 3HA3A 4C4TA 1IC7L 3FNQA 5KYNA 4D9HA 2BOLA 2NWQA 2WJGA 5DTIA 2ZP8A 1T8SA 2NZJA 3HSYA 2WVVB 3OKDA 3COWA 4ANXA 4N2IA 2CLCX 3QIBA 1YY8A 2GO7A 2EZ4A 1JPST 3K8YA 4O2BF 3NAZA 3GXFA 5AJUA 3QH4A 1L4UA 4HTAA 4BELD 3HHSB 2P80A 5KN5A 1XRLA 1CI3M 3THSA 2NLJA 4OQTA 1JXOA 5CB4A 1TZKA 1KI3A 4KQGA 4O3MA 2HRDA 4FXPA 1PV1A 1EVUA 1E7YA 4YXWD 2JLYA 1VB9A 5C71A 3GN1A 3DLPX 3TVTA 2AK4B 2I26N 3F8TA 1O9ZA 1JKJB 2JPDA 3OZIA 2CXNA 3CVXA 5A3RA 4WUUD 1GZUA 2O7RA 4FFVA 4RV4A 1WS6A 3ZEAA 1Z2KA 3L3DA 2Z57A 5MP6H 4UJ5A 4DFHA 2VDQL 4C78A 1JQEA 2UZXB 2AW3A 1Q0YL 1GGKA 2CNWD 4AZ0B 3OGCB 5GS0D 1UYWH 5HVHB 4R0VA 1EBBA 3H5WA 4NYIQ 5LP6B 1KK0A 1XVIA 4KXLA 2E48A 1OAZL 2EKSA 2EDJA 5CZXD 2PR4L 1J5OH 3R5KA 3ARDD 5ANMA 3QXDA 1E58A 4TL9A 3G79A 1MA3A 1NKVA 1E1CB 4M1OA 2SCUB 5EC2A 3V2HA 1TAGA 2X89A 2KDYA 2IQ9H 3LW8A 4JBSA 4JAVC 5ESQA 3EDJA 3KKPA 1H8OA 4KO7A 1LO4L 1HHJB 4YGAB 3CU7A 1FUIA 5C09D 1YKFA 1AVTA 4L3WA 2X9LA 1RVFL 2IH5A 2HWWA 3GZJA 5K1JA 3QJTB 1JYEA 3D0VA 5CR9A 5SX4I 5FL3A 3V7MA 4QHSA 5CAEA 3L1GA 3MJ7B 4LGSB 5LQDA 4Z3IA 2NDFA 1MB3A 3GCDA 5HHOB 1RRCA 32C2B 1ZLDA 1ZLUH 4R31A 3WXMA 4LLWA 2XA8H 4LCIL 5K8IA 2WSPA 4P5DA 3KB8A 5AVOA 5B7EA 2VHYA 4PHXA 5DJCB 2ZDQA 5E6SB 3TRDA 4WBNB 3FLBA 4LFBB 1SY6L 4F3YA 5SWZD 2P40A 3R24A 3LYRA 3VD0A 2JI9A 3KR1A 1P1HA 4H40A 4NOKA 5JT1A 4NRZB 1XZNA 3LX5A 3OEHA 2CDBA 5IJWA 4CM9A 1CD1A 2CLZB 2J07A 1AD2A 4S35A 5LAXB 5J4HA 2I1WA 4YXLL 5I6OA 1U8NA 3QC5X 3B1XA 5G0SA 5AQEA 4C0AC 3ZXSA 4CF3A 3B7YA 4P2OB 5KUTA 1ORSA 1FYTD 4LO9A 4PRIE 4QJ4A 1SOAA 4YHZH 1E8NA 1ZHKB 1NBIA 2NLOA 3ZWQA 1QG0A 4AAYA 1Z8DA 3H5VA 1QVRA 2C26A 1IFRA 5JARA 4MW2A 1F0KA 3QEGH 3DD1A 3HEMA 2UVPB 2RB8A 3CSUA 1LWJA 1KTCA 3ARUA 4PZDA 4C8XA 2WJ6A 1G8YA 2Z5LA 2XZQH 3EYSL 3QZUA 3NBYC 3PWZA 1X0XA 4M3NA 4YRPA 2ZI3A 4P4KA 2C2BA 1A5BB 1Z7BA 2OMTB 4X42A 2INGX 2AJVH 1GGHA 3JU3A 5EBLB 4PJHF 1U5AA 5I9SA 5AW7B 1Y8ZA 2GBPA 5DCYA 3UYOD 2XTZA 2PKQP 3SBOA 4NSKA 4HXYA 4E9QA 2Y76A 1YD7A 2AXPA 1ZHNA 3W7VA 2J45A 3LHDA 4Z3TA 1NCUA 4M7KH 4LBEA 4MW0A 5HKLA 3MYYA 4HFNA 2EVJA 4TMFA 1CHNA 1MCSA 5I5IA 3BEWA 1PW3A 3LZDA 2JRLA 2Y4OA 1VSTA 3GF8A 3RYCA 4HDRB 5TPWB 1J1PH 3WLAA 1VKXA 5I2IA 1IBDA 2YV2A 2DQUL 2OBNA 1OLOA 5D7BA 3VR4H 2VK2A 3PX2A 1NGPL 1TKWB 1MRZA 2BRUC 4WFHD 4TKWA 4HZIA 4CNIB 4BVKA 1N77A 4OK5A 1N57A 1YOBA 1NVMB 1DBBL 1NCTA 5KOJA 4KXNA 5EKXA 5D5MA 2BM3A 1AOZA 3VXRD 4FFRA 3RG8A 2OMXA 2LKCA 2WLIB 2QAIA 3V4PH 4BJ5A 4TTDD 3I3EA 1X8LA 4YMSA 4N25A 1XMJA