3IGFA

Crystal structure of the all4481 protein from nostoc sp. pcc 7120, northeast structural genomics consortium target nsr300
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
368
structure length
333
Chain Sequence
b'ALILTFLGKSGVARTKIAIAAAKLLASQGKRVLLAGLAEPVLPLLLEQTLTPDPQQIAPNLEVVQFQSSVLLERNWEEVKKLEAQYLRTPIIKEVYGQELVVLPGMDSALALNAIREYDASGKYDTIVYDGTGDAFTLRMLGLPESLSWYVRRFRQLFTNQVNNFLDKGKEALADPKRVAAFLVTTADPLEVVSVRYLWGSAQQIGLTIGGVIQVSSQTEGDLSAEFTPLSVTVVPDVTKGDWQPLIDALPNFVEQAEQAPKPITIDTHNRQVRLFLPGFDKKQVKLTQYGPEVTVEAGDQRRNIFLPPALSGRPITGAKFQNNYLIISFLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords All4481 protein
publication title Northeast Structural Genomics Consortium Target NsR300
rcsb
source organism Nostoc sp.
molecule tags Atp binding protein
total genus 101
structure length 333
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
A PF17886 ArsA_HSP20 HSP20-like domain found in ArsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3igfA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3igfA01
4C30A 1FX0B 1NKSA 5KU1A 1E0KA 1FTSA 4B75A 3QUSA 2Z4SA 2PT7A 3OEHA 1PV4A 1Z06A 3NBZC 3QQ5A 1J2JA 4KFSA 5IDVA 3SHWA 1WE2A 4C0LA 1XD9A 3AF0A 1VIAA 5AK0A 3VR5A 1TEXA 3WY9A 3T15A 5BN5A 3BERA 2VO1A 3EIHA 4C3ZA 2OE2A 1XJ0A 3TH5A 4XOIA 4TLEA 3TW4A 3A36A 1J99A 1KI6B 2OILA 2QQEA 4OJQA 5DYGA 4B43A 4P3YA 2X19A 2G6BA 3GJ5A 3KUCA 3T1QA 2BEKA 5JSZB 2X1VA 4TQAA 1P3JA 2RGNC 4D0GA 5L3SB 1QDEA 1UBCA 3QORC 4HLUC 2W6ID 5FOWA 2VLIA 1M8PA 1KSFX 2QP9X 1KSJA 5EXXA 4Q47A 3U3MA 4LJYA 4YC7A 2ZUDA 2BMDA 3DMDA 1X6VA 2ATXA 1E99A 3RWOA 4ZI3A 1C4OA 2VQSA 2WBLC 4RZXA 3QVVA 2A30A 5F98A 3QKUA 4JVNA 1NMYA 3GLIE 2V7QA 1NLYA 3A58B 1W1WA 1G18A 4ELDA 2XAUA 5G41A 4Z1MD 4M8NE 2XNSA 3WBKA 3IDQA 1MR3F 4NONA 3CX7A 4DIEA 4Q1AA 4OYHA 1TF2A 5BYKA 5AUOB 3WMFA 3SE0A 3KZ1E 5DIFA 3TUJC 4XD7D 4YMTA 4BWYA 3U7HB 2PLFA 4BZQA 1UKVY 1E6CA 4QBFA 5CJ2A 3GFOA 1M34E 2QG6A 3QBTA 1N25A 1Z47A 3EPHA 2PX0A 3BD9A 3D31A 3S1AA 2A5YB 2BBOA 2O5VA 1VG1A 2ZRLA 2FGJA 3LAWA 1RYHA 3A1UA 1O87A 4AKHA 1GFIA 4OHVA 3P4XA 2NO9A 1E4YA 1Y3AA 1BH2A 2HUPA 3QXHA 2C77A 1UBEA 1G3IA 3P32A 1XFAA 2GF9A 2I4IA 2H1LA 3V00A 2CL7X 4GNKA 2RHDA 1N6HA 4C2UA 4AKGA 1OXUA 4JL6A 3LW8A 1KI3A 1E2GA 3AF4A 1ZD1A 4YONB 3UKDA 3AVXA 1Z6AA 1U81A 2O0HA 4W9MC 1SVIA 3D8BA 3KFXA 4KFUA 3H2YA 3W8NA 3FHCB 1XRJA 1DE0A 1NMZA 1QHHA 3NC0C 3PR1A 3Q7PA 4QRHA 4B34A 3LRPA 3THXB 1R0YA 5LPNA 3T06B 4MYCA 2YZ2A 3D6TB 1Q1QA 2NPFA 4B35A 4PC1A 1R0ZA 4DSOA 1NBMD 5DLQC 1HUQA 3WHLA 5JHGB 1H8HD 3HU3A 2WIAA 4GOXA 1AGPA 4RY2A 3CRMA 2ORVA 3A4MA 1W48A 3P26A 3L1FA 1HV8A 2OAQ1 4NZYA 4DUGD 4QHYA 4GI7A 5FOTA 4W5WA 2XGJA 3MSXA 1N5JA 4RKFA 3QXJA 4EPVA 1FNNA 1S0UA 5CB8A 2GXQA 1EFCA 4TMKA 1IN4A 1YR7A 2A7QA 2ZAOA 4B3CA 3NEYA 5CIQA 3FDIA 2ZPTX 4Q00A 2ZIAA 3B8HA 5K8TA 4A0RA 2QE7D 5L3RA 1GAJA 1UKEA 2RGBA 5AJZA 1PJRA 3MFYA 4W7SA 1XEFA 4KFRA 1DAGA 2HCJB 4I99A 5JS8A 1YVDA 3NC1C 3G0HA 2OHFA 3FMIA 5AUNB 3HPQA 2IS2A 2YWEA 2H8KA 3EZ6A 2PZFA 2ZREA 3PEWA 4MKGA 3HWSA 3BFKA 5JLJA 2H92A 2VPPA 3LXXA 3VR3A 2ZRMA 4D4KA 2A5JA 4Q7KA 3B85A 4F91B 1R2QA 5AJYA 2RCNA 5DS1A 2IUTA 3GJ4A 3Q8XB 1G8YA 3B1WA 3GQBA 4PAMA 3SFZA 1XMSA 3WNDA 4B33A 3FKSD 4HLCA 2ATVA 4N3NA 1G6HA 1E9AA 1TQ6A 3M4YA 2GK6A 3VKWA 4CYMA 1NVUQ 1E9DA 3SBEA 2VBCA 2ZR0A 4W5HA 2FA9A 3AV0B 4GT1A 3SFVA 1IY0A 4UXIA 4F7WA 1GOTA 2L0XA 2ZVPX 3AVYA 2MSCB 4OL0A 1IN6A 5F9FA 1J90A 1NIPA 1R6BX 2ERXA 1E2HA 1YR8A 3KQHA 3K09C 5C18A 3KQUA 3DL0A 1G5TA 4U7DA 3VTKA 2ODEA 4Q01A 1TEVA 3ZZTA 3NDPA 3S1AB 1ZD8A 1FMJA 4PPGA 3KXIA 1EFRA 1KI7A 4YDZA 1Z28A 3TVTA 3U44A 1FW6A 2ZJ2A 3JVVA 1U0HC 2GCNA 4E09A 4Z54A 1S2MA 3FFAA 4S2EA 2PCLA 3GEHA 3HPRA 4D0NA 3E1SA 1MKYA 3TSOA 5E7MA 3M6AA 4G01B 1Q12A 1OH8A 1W36D 2RMKA 2CL6X 3PUWA 5SZJA 3QEOA 4FXPA 1KDRA 3NH6A 2PL3A 2WWHA 2J0SA 1QHHB 3MGCA 3B1ZA 1VCNA 4PQYA 4IDPA 1DEKA 3QPVA 4FWTA 4B3DA 4DDUA 1AK2A 2RH5A 5DI9A 4NMMA 1Z63A 3T5DA 3IIJA 3AVQA 4L15A 2JJ2A 1W7AA 2J59A 3U7FB 3PEUA 1TX4B 2IEZA 3CO5A 2RH0A 4RFSA 1G7TA 5JI3E 1TAGA 4Q9KA 1ZU4A 4TZ0A 2ZR7A 1ODFA 3VNVA 5DH9A 4JUTA 2VHTA 1EFTA 2WPDD 1GIAA 4ZKDA 3LA6A 2Q9CA 1J8MF 1XTKA 2JIZA 3LX5A 3TE6A 3WYFA 3SQWA 4WAUA 3VKHA 3GJ6A 4Q1EA 4AYTA 3DVLA 2N3JA 2E87A 3M1IA 2BJWA 2OCBA 4GOJA 1I4LD 1WXQA 3BIFA 2WJIA 4ZKEA 5KNBA 3VQLA 1G64A 1E2KA 4JKYA 3T61A 3PFIA 1XCGB 3MCAA 1KDOA 4D6PA 1OKKA 4IJMA 1DBSA 3OFNA 4P4TA 4YMUA 4PPQA 1KSGA 3IQXA 1SKYE 5CM9C 2D2EA 4BUJA 4WVFA 4TT3D 4TMXA 2QL6A 2GZAA 4PQRA 1P61B 4CDGA 3B78A 3AKYA 3AM1A 2QPTA 4UKDA 4PO1A 3PXGA 4A2WA 4C4PA 4CGZA 4GRAA 3A6PC 4DCNA 3RVBA 1RJ9A 1YHNA 1YR9A 2VH5R 4IDQA 4ZDKA 1UEJA 5CK5A 5KHOC 1GTVA 1VIYA 3O8BA 4JIMA 1COWA 2FJUA 2VSOA 4DDTA 3U61B 3P4YA 4B6EA 3LBHA 1OH6A 4PQFA 4ESHA 3H1TA 2RGEA 4GMXA 1RIFA 1OXXK 1FP6A 4V0LA 2ZRGA 2G1JA 4YLGA 2FH5B 5KSOA 1XMIA 3KTAA 1JB1A 3IHLA 3TR5A 3AKEA 4TTPA 1VHTA 2AN9A 5CK4A 4O2LA 2DFLA 3RABA 5EXSA 3IKJA 5F3WB 4URZR 2IHBA 3QKTA 4LY6A 1G9XA 5FPKA 1GUAA 1JEEA 1E32A 3U44B 2ZTSA 2AKAB 3R9IA 3KXKA 1XWIA 2GNOA 3CB4A 1TQ2A 3CR8A 2ZYTX 3LNCA 3SBDA 2IYUA 1KNXA 1G21E 2WWGA 4IKEA 1N6LA 1NBME 2B7CA 2EU8A 2QMUA 2ZVQX 4P31A 4D82A 3H84A 3FKQA 3U3JA 2CK3A 3J81k 4QM6A 2F1IA 1S9DA 1XD2A 2P6NA 2VIIA 1AN0A 4QL3A 3F8TA 4G5RA 2Y8EA 1D6JA 5EP3A 3H4MA 3DEFA 1RFLA 3HR8A 1ZM9A 1T3LA 2C2HA 4ZDWA 3W5IA 5KPJA 4QM7A 1W0JD 3C16C 3RWMB 3FE2A 3NEJA 4RFSB 4IOMA 1ZVQA 4LZZA 3QKRA 2IA5A 2B21A 3GT6A 5CM8B 4TL7A 3U3RA 2QU8A 2HV8A 4MRSA 1E2DA 1Z0FA 5JCZA 2ZANA 4HAWA 2AKYA 5BN4A 2HEIA 3C15C 1KK0A 3ND8A 3MUFA 1NN3A 5A5GA 3TW8B 3PEVA 1NLZA 1W47A 5HCNA 1XD8A 5KOYA 2BOVA 4IXNA 3SOPA 1VG0B 1RRFA 4JT2A 1HURA 2CE7A 1MO6A 1NMXA 2Q3MA 2WOJA 1WMSA 2G83A 1XTRA 1W4AA 3DOFA 4V0NA 3WYAA 4DDWA 2GKSA 5H68A 5K8LA 4G5QA 2EWWA 2IHYA 4MRNA 3LH5A 2XXAA 4BFXA 1GNPA 1RJ9B 1EFHA 1XMVA 3HDTA 4JVMA 4NYMR 3RC3A 4D4LA 2NO7A 4V0MA 3KJGA 4BLSA 4PC7A 2ZSBA 4DLRA 4TYWA 4NHOA 2DHRA 1E9CA 2IYLD 1YZGA 3PUVA 4EQ6A 1HQYE 1NN5A 1LF0A 3VQMA 3AVOA 5G3YA 5J4VA 4JBXA 3K9GA 2GTPA 2AL7A 4EPXA 3R20A 2CDNA 4DWJA 4LJ8A 2OBMA 4DLTA 1OT3A 3MRSA 3KTAB 4M9XA 3QI2A 2ZRJA 4Q03A 3ZIAA 2FPLA 2OBNA 4URWR 2IYZA 1KKLA 1U9IA 4TSFD 2XJ4A 2JEOA 4AURA 1KI1A 4W5JA 2GCPA 4PHHA 5SZKB 4GBMA 1AA9A 2QAGA 3LW7A 4GOKA 1T6NA 1Q1BA 1P75A 5ANRB 1FQKA 3TIFA 2QTVB 3JZAA 4G5GA 4CEIA 1XTQA 5C1BA 1CR0A 2R6CA 2R8RA 1OIVA 4BQSA 1KK2A 1KO4A 1XD2B 2BKUA 1XXHA 3I8SA 4WBSA 1YJ5A 2XNDA 4TMZA 3K0FA 5IK2A 5H8WA 3U6BA 3MLEA 4LJ5A 1FP7A 5EP2A 2WKRA 1G3UA 3FOZA 4ACAA 1GZSA 1VTKA 4QG7A 4A92A 4CT5A 2F43A 2BKEA 4OK3A 4TQUS 5JEEA 1N6IA 2BDTA 3GLGA 3C4JA 2OCYC 2Q21A 3SU8A 5L3VA 1QF9A 5LUMA 3QKRB 3THOA 5C2JB 4KLNA 1GRQA 3X1ZA 1Z0IA 4BFVA 2GEUA 1TQDA 1LVGA 1Q21A 4QJ5A 1TUIA 4E07A 3OE7A 1YZKA 1AS3A 3K0EA 1T8UA 2ZRPA 3KDSE 4GP6A 4JZKA 3ADKA 4G0NA 1ZYUA 1TMKA 1MRSA 3R8CA 2DFKB 1T4GA 4FCTA 3PJRA 3R9WA 2OSBA 1FOEB 1KJYA 4NU0A 3Q5DA 1EESA 2PT5A 3QNUA 1U8ZA 2DYKA 4Q7MB 2IC5A 3QG1A 2W0MA 1GL9B 2ZSEA 3TR0A 2HYDA 2O8BA 1E98A 1UADA 3UG7A 1G7RA 1Y63A 5TV2A 4OI4A 2CHVA 1Q3TA 4OKSA 5DHFA 2C8VA 2ZJAA 2GBLA 2H17A 3NWJA 5KSZA 4XJXA 2HF9A 3FB4A 1NY5A 3GEEA 3L2OB 1NIJA 4GP7A 1CXZA 1JAHA 2LCFA 2HCBA 2VHCA 2OUKA 4HAVA 1P9WA 3W6OA 2R6FA 2BM1A 2FU5C 3K70C 3EWAA 1U0LA 2QZ4A 1XZQA 3ASYA 1X8LA 2FZ4A 4GZLA 2XXAB 1P73A 3IPYA 1Q44A 2YYZA 3QJYA 2W6IA 1N0UA 2NZJA 2JDID 1JXOA 2LKDA 5J4KA 1EGAA 1AKEA 2ZQ5A 4UXJA 2PEZA 2AFHE 1OJLA 4HSEA 4Q9JA 1QHIA 5IHPA 2X8AA 4ILEA 2BHRA 1XF9A 4HAYA 4EQ6B 3IBYA 3I4LA 3KJHA 2DWPA 3BB1A 3LLMA 2FZLA 2EYQA 2ZRCA 4WXPA 2HJVA 4DC9A 1GILA 4KV9A 2QRZA 5JWRA 1Q1EA 1XEXA 4C2TA 1ZNXA 2IYTA 1D9ZA 1OSNA 1X1SA 3ZVLA 1P60A 2Y1YA 5LBIA 1PLJA 4Z1MA 3TK1A 2CLDX 2W2TA 4KI0A 3NDBB 3Q7QA 4V02A 2R44A 3TMKA 3L1EA 4HATA 4LSGA 3DZ8A 3GLFE 1M2OB 1KHTA 1K5GA 1UBGA 2VP5A 3L8ZA 4XVRA 5TY0A 4BLPA 5J4YA 4LC1A 3NHAA 3EUDA 2OBLA 1E94E 2QAGB 1Z0DA 4IFBA 4XD7A 5GJCA 2JJ1A 2JLUA 3BH6A 2O8CA 1OYWA 1ZIPA 3EARA 3P20A 1R5OA 4CEIB 3GEIA 1TTTA 4RD1A 4P33A 2VF8A 3TJZA 4ASUA 4OI2A 5DE3A 2H18A 2ZROA 1XXHB 5FR2A 2C9YA 3ND9A 4TMTA 4IVRA 4LYHA 3K0FB 3DMNA 1MO3A 3AACA 1DADA 2CNWD 3CF2A 4KVGA 1G19A 3LBIA 4KYUA 4PFSA 2F43B 2Q9AA 2R6DA 3GLGB 4M5TA 3GFPA 3ASZA 3DDCA 4CEJA 1E9RA 2WKQA 3UATA 4MRPA 1IN5A 2KBFA 3WXMA 1IQPA 2YVUA 4DLVA 2JKIS 4JVSB 1IAQA 3ADBA 1CULC 1PLKA 4AKEA 1VCIA 1HEIA 1CJTC 4JLJA 2YINC 1HT2E 2NOAA 2GWHA 3FFBA 1NBMA 4F4JA 1S3GA 4LC0A 1ZCBA 5AR1A 3SYLA 5DYIA 2GETA 3AVUA 2VYFA 4HLQB 4I88A 4IVPA 2YOHA 3RRMA 2RGNA 3H86A 2PLRA 5DI3A 5FTNA 2D7CA 1H65A 1EFUA 1N3BA 3QORA 4HLUA 1IJFA 2R9VA 3N5CA 2QMEA 2O8BB 3B7GA 2KE5A 1CTQA 2EWVA 5EE0A 4YMVA 1JPJA 1S96A 1D2NA 3B9QA 5CDFE 1U8AA 1XTSA 4DEYA 4LBWA 2W6JD 4UNRA 1TQ4A 3LV8A 5B58C 2A9KA 1KDTA 4BLQA 5DNYB 4L9SA 3B1XA 2V6JA 3P27A 1W5SA 5JI2E 2CG9X 2IS4A 1FMLA 2ZS9A 2IT1A 3V4RA 1UAAA 4C0BA 5CIWA 2R6GA 4YL9A 3AB3A 5FOVA 1AZSC 1U2RA 4BPBA 1IY1A 4RSGA 1DTSA 1E1QA 5IF9A 3ZVMA 1KO7A 1N6RA 4TLDA 5FFMA 1EJFA 4L4UA 1IBRA 1S4QA 5JZVA 4B3XA 2YWGA 4A15A 2AHOA 1XEXB 1FUUA 1TL7C 5FL7A 1CKEA 3KKPA 2HJGA 5DN6D 3CNOA 3KUDA 2WSSD 4MYTA 2VTKA 1KK1A 1O3YA 3KB1A 3AF2A 2GILA 1N0WA 2VA8A 4IOJA 4K46A 3VAAA 5FPYA 2ZE5A 1VKJA 1LY1A 1WFIA 2ORWA 3WNBA 3O47A 3BORA 4RD6A 4FMCF 5J47A 2RKOA 1NN0A 4LJ9A 1AS2A 3UMRA 4DDVA 1BO6A 1E2LA 2IX3A 1G5RA 2NPIA 2NZ8A 5KNDA 4MITA 2O8CB 1NVWQ 2P0EA 5EJEA 4D26A 1A2KC 2CMKA 2WJVA 1PUJA 2PBRA 2QEQA 2WSMA 1CBUA 5HKKA 2J1LA 4Q4JA 6Q21A 2KLRA 2ZM5A 1CR1A 1G3QA 1ZUHA 4HAZA 4OQLA 3W3ZB 1G17A 2F3TA 1F48A 3ETLA 4CEJB 2QNRA 2WTUA 3W3AA 2R62A 3RRYA 1T8TA 4EFLA 2P2LA 4OQNA 1TF7A 4DSTA 1WH0A 1G8GA 4YXWA 2V55B 2WAXA 4ZV4A 3X1WA 3BAFA 1P72A 1WA5A 2JGNA 2RGGA 5FL3A 4FIDA 5EE3A 1SVWA 2V1XA 2FSFA 1SXJC 1R4AA 1KAOA 5DI3B 4US2R 3J07A 1XP8A 2F1HA 3QORB 2KB0A 1WF3A 2J46A 3RSOA 4QNMA 1ZINA 5CLLA 3SZRA 2EVWX 3O8CA 3ADCA 2XB2A 3C7KA 3TSZA 5JRJA 3BFVA 2GAAA 4UJ5A 1E79D 2WMNB 2QRNA 3HP1A 4YDHB 1UF9A 2CVHA 3CRW1 3CKLA 1W0KD 1WP9A 3K53A 1BYUA 3ZZ0A 3TLXA 3BGWA 4YLBA 2OM2A 3JZMA 3WRYC 1DARA 2J0VA 3CIOA 1XJQA 2IXGA 2XOKD 1ONBA 3CZPA 4MYHA 4JS0A 1W2HA 4ACBA 5FBWB 2QN6A 1R0XA 3T1VA 4OJKA 3K09A 1TNDA 1YQTA 2FFQA 1VCOA 3Q72A 1OLOA 2NIPA 3WP1B 4A0HA 5G53C 1KJWA 4OHYA 2GJ8A 2AR7A 1K8RA 1OYYA 1W36C 4DEXA 4N0EA 3A8TA 4LYFA 1OH5A 2G0TA 3L0SA 2C96A 2C95A 2O8FA 3ONWA 2ANBA 1XBTA 3ICEA 1ZC4A 1OHHD 1FQJA 3CNLA 3NG1A 4IRUB 4Q1BA 4GDFA 4D4JA 4NYJR 1DAKA 1YR6A 2XEXA 4QBGB 4KVAA 2CXXA 2PCJA 1G4UR 4WIAA 3I73A 3RDPA 2E1RA 5UKDA 2GJKA 2R2AA 4B3BA 5AJXA 1HA3A 1FNMA 2OCPA 3VR4A 2XZLA 4F93B 3R8FA 2CJWA 2PZGA 3DPUA 3VU9A 4LDJA 1SXJD 4Q4JB 3CPEA 3OEEA 2CHQA 4NTZA 5ELXA 3TRFA 1F60A 1EXMA 2W58A 3B1YA 1P7CA 3W34A 4AKIA 1VECA 1US8A 4DSUA 4Q7JB 3I1FA 2NG1A 5E95A 3RNLA 2N46A 3GLFA 1W36B 5EUQB 2IYWA 3QXXA 3GLHE 1Q0UA 5K8UA 3MMPA 4CRWB 4HB3A 2QM8A 3RC8A 3GD7A 2P3SA 2WAYA 1L7VC 2BBSA 1IXSB 1N5IA 2NQ2C 3REGA 2V1UA 1G41A 1BS1A 2IYYA 4PSAA 2WJ7A 2BEJA 3Q85A 2F7SA 2FEMA 3QSYA 3OEHD 2REOA 2ZS7A 4URVR 3QXCA 4OI1A 2J45A 1NN1A 1W0JA 3FHTA 4LYJA 2AFIE 2AX4A 4XTCS 2JLZA 4WZAE 1XEWX 1DAMA 4A36A 3RSLA 2OCAA 3CRVA 4TYYA 3I3SR 3SR0A 1OXVA 1JEDA 3W9YA 1X86B 1FTNA 4IDNA 2PMDA 4JLAA 4BEJA 4LOAA 4HDQB 4B32A 1AZTA 3T34A 1ZD9A 1G7CA 3AUYA 2G88A 3RRNA 4AG6A 3U3OA 2GJ9A 3AVWA 1QHYA 3UK6A 3SJCA 3RHFA 2CCKA 4LUCA 3OHMA 4LI0A 2ZI5A 1G3MA 1NF3A 1OFHA 3W1ZA 1F2UA 5AJVB 3SN6A 2QPAA 2OV2A 4A6PA 1E1RD 1NRJB 1QHXA 3FWYA 1YZTA 2KWIA 1A7JA 3FMFA 5FUXA 4DCVA 5JJKA 4JLBA 1XJCA 4Q5IA 5EXTA 1JI0A 2X2EA 4A6XA 2BBWA 5C4MA 3L0IB 3SJBA 4ZCMA 2RGDA 4F4CA 1WQ1R 1U8YA 3AGPA 4URUR 3K9NA 4IFEA 4A9AA 2H16A 4ERNA 4QKQA 3W5JA 4H1VA 2K5UA 3GMTA 1P2TA 4B3FX 1RRCA 4PC6A 1KY3A 2Y22A 1XCPA 5FPHA 5CITA 1QG4A 4HUQA 1JJVA 1Z6TA 5E7JA 3L1GA 5JWHA 4JJKA 1E9BA 2O8FB 5JJLA 1SVLA 4HB4A 3IUYA 3KX2A 2ZRBA 1E2MA 4V0OA 2OXRA 5H1YA 1HE8B 3SEAA 721PA 4ABYA 1Z2AA 3OAAD 3RS2A 1Z2CA 2OEPA 2XITA 4DZZA 3MWLA 1CRPA 1OV4A 1T3SA 1VYTA 1XPOA 2ZE7A 2VP0A 4H9GA 4PZZA 2ZITA 3IHWA 1Z5ZA 4POAA 3NBFA 2XTZA 3A1TA 3CPHA 4DXAA 5JHHB 3I5YA 4NCKA 4KBFA 4PAOA 4TSFA 2CJWB 2WWFA 2JJ8A 4LHXA 5GJVC 3C8UA 4ZIRA 3BJIC 3VU9B 2IXFA 4EIWA 2DWOA 3A1SA 5KDLA 1T91A 4PBDA 4KYIB 3FYHA 3LX8A 2XSZA 4CEHA 4Q4HA 1K6MA 1HE1C 3ZZUA 1BMFA 1US8B 4B44A 3GJ3A 5L3QA 2BMFA 2ZETA 4AYXA 3GLFB 3VX3A 1CJMA 1CIPA 2QT0A 1KDPA 2WOOA 1P2UA 2OZEA 4RCYA 3ZS8A 2GZHA 3GP8A 1RZ3A 1R0WA 1T5LA 1YE8A 3VHLB 4R71A 2E9SA 1GNRA 3W6NA 4H1UA 3GFTA 2XCMC 1WGVA 4X8LA 5HZKA 4I1OA 4ZO4A 1U99A 4ARZA 2BCGY 1AKYA 4JYBA 3VMFA 4AIIA 3B2EA 5FOXA 1GL6A 4N0DA 3O8RA 3FMOB 3Q5EA 2C03A 3TUIC 1GNQA 4TLBA 3UANA 4C0KA 4URYR 3QOFA 2WJ5A 3LDAA 2MSEB 4BEBA 1G8HA 4KODA 5AUQA 3GLIA 2VHUA 2IUSA 4M1SA 5FPSA 4HDOB 3T35A 2B7BA 3BBPA 1CS4C 3IILA 4NYJQ 2NGRA 5FPTA 3WMEA 1T3HA 1ZC3A 2ZYUX 4D81A 2JA1A 4S35A 3RS4A 3U4QA 2N1BA 5EZ5A 2EFCB 2WIBA 2GHIA 2D3WA 1F2UB 3WP0A 3HR7A 4MGKR 1Z8FA 3B82A 3EZFA 1KAGA 3IEUA 1RRPA 4RFVA 4B2PA 1S1CA 2Q9BA 1ZM7A 2JATA 1OXTA 1PZNA 1SZPA 2LWIA 2FOLA 2WVJA 3M0EA 5EXPA 4F4IA 2GAOA 4TTRA 3SYKA 4IOLA 5JS7A 1E9EA 2OFOA 3ZDQA 4JYCA 2C9CA 4L8GA 2J9RA 4LBYA 2FE4A 4EPYA 3VHXA 1P9RA 2A5FA 3D3QA 3AVTA 4HUQB 4RD2A 5TDHA 3A1WA 1W49A 1ZM3A 4QJ3A 3C5CA 4TLAA 1D5CA 2P67A 4DHEA 2WJJA 4PCKA 2KI5A 2IYRA 1RRGA 1ZUNB 4DCTA 4EJSC 5HZHA 1SXJE 5CB6A 3EPJA 4LPSA 1M7BA 5LB2A 1QHNA 2K8QA 2B92A 4GFDA 4P4UA 5BW8A 2WM9B 2EFDB 1EK0A 1ZBDA 4O2RA 2FGKA 4UJ3A 5B30A 5AWFC 1EFRD 3CZQA 3IGFA 1DAEA 1GM5A 1JR3D 2BVNA 1E4VA 1W4CA 3I5XA 5FTJA 4EFNA 2C78A 3KQLA 4ZDIA 4ZIRB 4MKHA 4KO8A 4XIGS 3PVSA 2JLQA 3KFVA 1N6KA 4ZCIA 2PH1A 4Z51A 3CW2A 2FEOA 3QF4A 3RANA 2ZI7A 2WICA 5DHAA 3SS8A 4CEHB 4Q4HB 4OQFA 4B71A 5GADl 4MJHA 4OHWA 3I92A 1N2CE 4JL5A 4D4MA 5L3QB 5LD2C 3DKVA 1D2EA 4QOSA 3V4FA 4PX9A 1OH7A 3EG5A 2TMKA 1I2MA 3GJXC 4JJZA 3KL4A 5KTYA 5JFGA 2JJ2D 4M1WA 2J5XA 1YZLA 2CNWA 2V4ZA 2B8TA 2YV5A 4AK9A 4Q48A 1IXZA 4RZUA 4ARZB 4MH0R 4MRVA 3KJIA 2IF2A 3L43A 4FN5A 1SHKA 2ZAMA 4PC2A 4JLMA 1E2PA 4QGFA 1R8SA 4Q02A 1KI4A 5E7IA 3A37A 4NYIR 3G82C 3TSWA 4XTRA 2HT1A 2IBMA 5FBVB 2C99A 1P62B 1NG1A 1JJ7A 3PG5A 4QHTA 2XJ9A 1Q57A 3GLIB 4LJ4A 2ZR9A 4KU4A 2NO1A 5K8IA 5BYJA 3NBXX 1JR6A 1KKMA 3TQFA 1RW4A 2DFNA 4DLZA 2BBTA 3U4QB 3K9LA 2WJGA 3OFND 2H7VA 4JLDA 2FFHA 2VHJA 5P21A 2J7PA 2FFBA 2F9LA 4AWXA 2XX3A 1L4UA 2F1JA 4TL8A 1WCV1 3F0TA 1R5NA 1Z0AA 3BB4A 3U3KA 3SQXA 2W6JA 1OW3B 4DJTA 1P9NA 3MG9A 4LHZA 1WDTA 2VP9A 3A1VA 4AD8A 4QBHA 1E2EA 1XCMA 2HLDD 3A4NA 1EX6A 4ON9A 4PTLA 3TQCA 1VHLA 1Q22A 4XWKA 3K9HA 4U02A 2Z5FA 2PJZA 4KAXA 4PAQA 1XTIA 5GVSA 3ECCA 1EWRA 1Z07A 1COWD 1M1YE 1H8EA 1P2SA 1MO5A 3N2IA 4HB2A 5FOUA 1DG1G 4E5UA 1YZNA 3DM5A 2ZI9A 1ANKA 1VG9B 2FNAA 4QJ4A 1BKDR 1DAIA 2QTHA 3AGQA 1JNYA 1KGDA 4PHFA 4WZ6A 2Q3FA 3EXAA 5FUWA 5M04A 1SVSA 3LQQA 3RS5A 3MWKA 4LYAA 4Z8YA 4EPTA 2PMKA 5FTLA 3SC3A 2OLJA 1FZQA 1ZJ6A 4MKFA 4ZPXA 2DBYA 4QC2A 1YZQA 1FPMA 4US1R 3UWKA 1R8QA 5TVKA 3BXZA 3N3EA 2V8OA 5J40A 3SJAA 1BIFA 4BFZA 3TUZC 1VPLA 3AKDA 3SYNA 3L0OA 2I1QA 3B6EA 1KZGB 2P6UA 5FR1A 2C9OA 2CK3D 3QF4B 2GCOA 2RHMA 4CW7A 4LBVA 5FH9A 4QGHA 4A2PA 2WWXA 2VF7A 4B76A 8OHMA 4BZXA 2D62A 1IXRC 2MMGA 2YHSA 1CRQA 2ZJOA 3LXRA 4AY2A 3L82B 4Q9HA 3VX4A 4DIDA 1ZM4A 4Y0AA 3UMFA 3FGNA 2A5DA 1YZUA 1N5LA 4TYNA 2P5TB 3SNHA 3DO6A 3VFDA 1NL3A 4OQMA 3BB3A 4WXRA 3UMSA 5L8VA 2OESA 4IDHA 3PUYA 4IHQA 4GMDA 2AWNA 2OLKA 4X8MA 1N6PA 3R7WA 4PR0A 2FG5A 2F1RA 2Q0HA 3K70B 1GKUB 4KCGA 2OAP1 1LV7A 1CJUC 4NCJA 2WWYA 1RKBA 3PUZA 2AD5A 1CLUA 1XX6A 2OXCA 4NCHA 4YQFA 3SJZA 2VEDA 1K5DA 1MH1A 2IUUA 2BV3A 1P6XA 1OF1A 1GP2A 3EZ7A 5BQ5A 4F38A 2ZUCA 2GXAA 3KKNA 1W2GA 5EE9A 1AS0A 1E79A 1JQJC 3V9PA 5J5CA 2UKDA 1W0KA 1LS6A 4LHWA 3ZVRA 2XZPA 1ELOA 2J3EA 5FBQB 4R2HA 1KIMA 3IIKA 4M1YA 5JWOA 1II0A 2RAPA 4NYMQ 1E2JA 1LS1A 1GKIA 4IDOA 4CF7A 4ESVA 4LRWA 4ZJ9A 2FV8A 2WV9A 5DISB 1KJZA 1H8HA 2KJQA 2ZJBA 4M53A 2H5EA 1N0VC 1JR3E 4OK6A 3KB2A 4X8OA 821PA 1DELA 1E2IA 3HJNA 4JT4A 4OHZA 4DUGA 1E96A 2ONKA 2GZDA 5FBLB 5J4LA 1UPTA 2VL7A 3KXLA 3OZXA 3X1XA 2OT3B 4FD2A 3GCGA 1KMQA 2FPKA 4R9UC 1G6OA 2REBA 4UQOA 1JALA 2CLCX 4B3GA 2C5LA 3EIQA 3X1YA 4PHTA 3CX8A 5KNCA 1OFIA 4RD0A 1OPXA 1OHHA 2QE7A 1EX7A 4ZCLA 3CM0A 2JAQA 4Q19A 4HDCA 2JCSA 1ZIOA 1XPUA 3UWOA 3RRZA 2GCOB 2CE2X 5FOSA 5BN3A 2AWOA 3WYGA 2XZOA 1ZAKA 3PCRB 3FHOA 3CWZA 4PO8A 4WA7A 3TAUA 4NDZA 2AXNA 1E0SA 1LTQA 1Z6YA 1OE0A 4CZ2A 4MGZR 3LWNA 2QUZA 3BRWD 5G3ZA 4LV8B 1SXJA 2F6RA 3AP1A 4M4SA 4M9ZA 5C4GB 2V3CC 2ZRHA 3FKSA 2GJAA 5KYKA 4KSBA 3P1JA 1RC8A 4TL6A 4Q21A 5EZ6B 1LNZA 1SKYB 2W2VA 4JKIA 1QRAA 1S1MA 2BMJA 1QZXA 1Z08A 3PENA 4QNRA 5DSZA 5CLQA 4HZIA 2QI9C 2I1VB 2P65A 2PZEA 2ZI4A 2ZRDA 1GMEA 1IN8A 3R7WB 2ZEJA 1NJFA 1W5TA 1NG9A 2KBEA 2A3RA 1ZP6A 1TU3A 1W44A 1Z3IX 2PJRA 4PZLA 3ZJYA 1ZNYA 5TARA 2FSIA 2QT1A 2V9PA 4OI0A 4BECA 2ZSAA 2JLVA 2Q3HA 1KOFA 3AP2A 4EUNA 4IW3B 2BWJA 2FX3A 2RB4A 1UEIA 3BWDD 3EASA 2DWQA 3QIAA 3ADDA 3HU1A 3AUXA 4P0TA 3NH9A 4RZ2A 3TGPA 1UDWA 4HZUA 4O25A 4MUBA 4FW9A 4C0SA 2FDCA 4OK5A 3VNUA 4Q18A 3OIWA 2WZQA 521PA 1KI8A 4XVUA 4Q1FA 2FMXA 4DCUA 2KMWA 2DFTA 4BFYA 1FUKA 1JXMA 3ZQ6A 1GRNA 2EYUA 4I1VA 4JLKA 4HLDA 2F3RA 4M2LA 3WRXC 1E2NA 4A0FA 3AF1A 4M22A 2DB3A 2CCJA 4Q66C 3B9PA 1X8JA 2ZSFA 2IYSA 1E1RA 3ICQB 2C04A 2GEVA 4UNNA 1XPRA 1GG2A 4RCZA 5GJBA 1E2QA 4TYPA 4II7A 2O0KA 3TAHA 4M1KA 5JJIA 5AJWA 2J87A 4AYWA 2G77B 2QBYA 1CU1A 2W83A 1B0UA 1WBDA 4BE7B 5HE8A 3U7GA 2J7KA 1VCMA 2ODNA 2QORA 3BFXA 3EC2A 4DCSA 1UBFA 2QM7A 1E0JA 2WPDA 3SI7A 1KY2A 1UKZA 3KJEA 5EP1A 5JEDA 4EDHA 3RS7A 2WWWA 4KFTA 2YC2C 4Z8XA 3SHFA 2G9NA 4DSNA 1SQ5A 1KMHA 5HTKA 2JJ1D 5C46F 2YNMA 1C9KA 4TMVA 4JUSA 1IONA 3DOEA 3OAAA 2ORIA 3R9XA 3F3YA 2QP4A 1PUIA 3BH7A 3FVQA 2JASA 3PQCA 2RGCA 2W0SA 2IWHA 4ASUD 2C98A 3EPLA 2CL0X 2XTMA 2ZRKA 4KBGA 4BLOA 4B73A 1KO5A 4TT3A 1Z6XA 3I8XA 1SKQA 3HYTA 4M1MA 4XWOA 3D7MA 4EPRA 4B2LA 1JBKA 1SVMA 2HYIC 2GA8A 4BRUA 1SXJB 5BXQC 4WZBE 5F9HA 3B13B 1DS6A 3FTQA 5TMPA 3PEYA 1RPZA 4R2IA 3NIBA 2GXUA 4HEJA 3B60A 3LD9A 4C9BA 2CBZA 3ZD7A 3KKMA 4K8OA 2GESA 5JRZA 4M0LA 3W8RA 3QKSA 1T5IA 3REFA 1ZNWA 1XU4A 1GL7A 2FSGA 4B6FA 1KO8A 2YOGA 2FN4A 1XNJA 4P32A 1NY6A 1DOAA 3RS0A 5FI0B 3AVVA 3QORD 1QHSA 2P5SA 4BZPA 2VP4A 1OFUX 5FTKA 4HI0E 2X77A 1XDBA 5E3HA 3TVDA 1GRRA 5E4FA 4DRZA 1FL9A 3Q9QA 4LK2A 3U60B 4D0LB 1DAFA 2UZ3A 4V0ME 2A2ZA 3EA0A 3JVUA 1Z29A 1OB2A 5DS2A 3PIRA 5KDDA 4BGDA 3CONA 4HZUB 4XSGA 5KSPA 421PA 5B64A 3L0PA 2HDNB 3LVQE 1E3MA 2IF0A 1RL1A 1CP2A 1W4RA 1F3OA 1Q20A 1GKYA 2ANCA 4V03A 2JLXA 1DVRA 3NTUA 2IYVA 3NKVA 1X1RA 3VR1A 4GPTA 4A0GA 1S8FA 4XVQA 3UIEA 2R65A 3K0SA 5EQTA 4UNPA 2IWRA 4LJ6A 1E1QD 2QMHA 4TWZA 4PSKA 1A1VA 3LY5A 4FINA 4QHSA 3QBVA 5HCIA 3A4LA 1MT0A 1G8PA 4FWIB 4BFWA 4IXMA 4PPNA 1IY2A 4FMCB 3I62A 5FL7D 2QBYB 4MRRA 4NKRA 1G3RA 1AIPA 1WRBA 3QENA 621PA 4I1UA 1VYUA 2I3BA 2VHQA 1XMJA 3CLVA 4A4DA 4G5OA 4YLCA 3U2QA 4CVNA 4NE2A 2EQBA 1XXHE 2GF0A 2GVZC 1JAIA 3GLAA 1SVOA 3LVRE 4RZKA 5CYOA 1V5WA 3ZGXA 3CNNA 3WMGA 5LB4A 1KMHB 3ZQJA 1IHUA 1F2TA 2CR0A 2OFWA 1VDZA 4LHVA 3GLGE 4FCVA 4TTQA 2DR3A 5FUYA 3MWJA 4CT4B 2YKGA 5DO9A 2ZE8A 4OBEA 2GK7A 2O0JA 3RLFA 5HKKD 4QBIA 1JR3A 2QROA 2RGAA 3T5GA 4TZ6A 1AQUA 4A8JA 1ZW6A 2YWFA 3CUEF 4FMBB 4TYQA 4A82A 4MYUA 1GVNB 4DB4A 2EFEB 2ECKA 4MGIR 2V7QD 4LV5B 3WBJA 1DG3A 2DY1A 4NP6A 1IN7A 4JSYA 3LO5A 2MMCA 2PEYA 4M9QA 4PC3A 2ONJA 1CJKC 5CDFA 2ZJZA 3DHWC 3W6PA 4EPWA 2ZXUA 1WBBA 3ZLJA 3VR2A 4HAXA 2VSXA 3CR7A 4C0QC 1E2FA 3BOSA 1BYIA 1N6OA 3AH8A 4YXWD 4L9WA 4IEIA 4E03A 3QKSB 1XZPA 1NVVR 2A5GA 3GJ8A 1YKSA 1ESNA 2IEYA 2ZU6A 5HPYB 4KHZA 1A4RA 1IOZA 2VRWA 2G1KA 1X3SA 1CJVC 2NO0A 1ZNZA 3DKPA 3UPUA 2J0QA 4PO9A 3QY0A 3GJ7A 2MSDB 4N1AA 1IM2A 4UNSA 1GDDA 2V6IA 4JLVA 1Z0KA 3G5UA 3IIMA 3OIVA 2F9MA 1A82A 4QFMA 3MWYW 2A78A 4HAUA 4L16A 1FFHA 2CEAA 2RGXA 4M21A 3MJHA 1TUEA 1QHGA 4BFUA 4DLXA 4UNQA 4PANA 1WB9A 1VG8A 4I81A 2N42A 1J8YF 1MRNA 1LB1B 3T12A 4JLOA 4FMDF 2R6AA 5EUMA 1X5MA 3IQWA 1DO0A 4NPHA 1LFDB 2D4HA 1XEWY 4JBWA 1NSFA 1AM4D 3IEVA 3AABA 1I4DD 3LFUA 3Q9LA 4A8JC 1S9HA 4EJSA 4E22A 3VR6A 1SGWA 3HYRA 3H0KA 4QGAA 2QY9A 1KTVA 5LDDC 2HLDA 1G1MA 4MQBA 5KSYA 1Z83A 4FI3C 1DAHA 2AXPA 1E9SA 4EFMA 2REXB 2IS6A 1HYQA 3FMPB 4RD3A 1OB5A 4C0HA 2FPMA 3EIEA 4PXAA 2EFHB 5EP4A 4RD4A 5JMTA 1NKTA 1D9XA 2QP3A 3ZS9A 2X2FA 4TLCA 1ZU5A 1CR2A 1A2BA 2IW3A 4JMPA 3NBYC 4M1OA 2Z4RA 3CH4B 3TKLA 3QF7A 1F2TB 1MO4A 2ZE6A 3TBKA 2D7DA 4RJLA 1QVAA 4JBYA 4B47A 2IK8A 1L8QA 3MAAC 4PPFA 1YU9A 3OESA 1UM8A 221PA 3MD0A 1B23P 3K0AA 1G20E 1ZMXA 3E5HA 4BFSA 2GJSA 3RAPR 3IO5A 2IXEA 1M74A 2SHKA 3OEED 4A8JB 3THWA 1CF4A 5JBQA 4Q1DA 1NVXQ 4YMWA 2Y1ZA 4Q9IA 2VP6A 4BLRA 3HU2A 1KNQA 4R7ZA 2ZRFA 1P2VA 1J7KA 2HF8A 4Q4LA 2JLWA 2JDIA 4DLUA 5B57C 3VQTA 3GUFA 3QPWA 4D25A 4DB2A 3AF3A 3CWQA 2ZJ5A 2CVFA 3C14C 2GEDA 3DM9B 1G291 2O8EA 3AQ4A 1QVRA 3IPXA 4M9SA 4O0MA 2NO6A 1NLFA 2XB4A 1RE0A 3B5JA 1KO1A 3QEJA 1R10A 1RYFA 4UXHA 3Q9PA 1G5PA 4BFTA 4NH0A 3U6KA 1T0HB 2HXYA 3EW9A 4Q4AA 1UKYA 2IYXA 1HY3A 1UFQA 2ZJ8A 1P4SA 1KZ7B 4JL8A 2YJTD 2CHGA 1GWNA 2Z83A 3Q3JB 4GZMA 4P4SA 5IT5A 1ZM2A 5J4HA 3CF6R 4RKEA 2N0KA 4RVCA 1A5TA 5BWMA 3T1OA 1YRBA 3AP3A 1M7GA 3B1VA 1CEEA 2WHXA 1NI3A 2DPXA 2OFXA 2QSYA 2ZYWX 1DPFA 4DLSA 4LHYA 5A4JA 2QTFA 1Q1ZA 3X1DA 2CLSA 1YRAA 4D2IA 3K1JA 3NVAA 5HE9A 1X8KA 2QGZA 2PX3A 2VP2A 4EJSB 4JLNA 2KSQA 5KPDA 4XSHA 3U5ZB 4URXR 5SZHB 2BM0A 1G7SA 4O3MA 4M1TA 3QXSA 3DZDA 1KSHA 1P5ZB 4IOKA 5CYPA 2QA5A 3AKCA 1NNEA 1NSTA 2JIZD 4LV6A 1D8TA 2EW1A 2Z43A 5KDOA 2H57A 4R98A 1T9HA 2QMOA 2ZU0C 3MJRA 4YMSA 1KK3A 1NVVQ 2ZRAA 4K81B 1N5KA 2CCGA 4LBZA 4G5SA 1L4YA 3U7EB 4TN1A 3IBGA 1QBKC 4AI6A 2FSHA 5D3MA 3GLHA 4U5XA 4NCNA 3NXSA 1GSIA 1OKKD 2WJHA 3GPLA 3EX7C 2D2FA 5F2EA 4EAQA 5LD2B 2ZS8A 3AEZA 1QG2A 2D74A 4GSYA 3N2EA 3RS3A 2BC9A 1KI2A 4PZYA 4KITB 3I61A 4BLTA 3K0AB 4TMWA 1HH4A 3PUXA 2QENA 4FMDB 1TPZA 2ZJYA 3GJ0A 3THWB 3FPAA 1AJEA 2XSZD 1II8A 3WHKA 1BMFD 3THYA 1AGRA 3WNCA 1M6NA 121PA 1U90A 2HXSA 5FUVA 3IO3A 3KQNA 5D3QA 2LKCA 3CPJB 4C7OA 2BOLA 2AD1A 3ZVNA 2ZUBA 1LW7A 1TU4A 1OXSC 2YC4C 1G4AE 2UVQA 2G0NA 4MA4A 2WWIA 2O8EB 2GRJA 1U98A 4U00A 3VKGA 2O52A 4DLYA 4XWAA 1TADA 4QGGA 1D2MA 1I4TD 3E2IA 2ZI6A 3KKOA 5B2ZA 5DN6A 5TB5A 3UXMA 2WSSA 4DLWA 4ZI2A 2QSZA 4Q4AB 3NHBA 2BJVA 2Z0MA 5SZIA 1Z22A 2O8DA 4TQ9A 3LBNA 1SULA 3CX6A 1GITA 4X8HA 2XTNA 2ZRNA 3ZD6A 4P4SB 4KXFB 2NMVA 2J0UA 2F55A 3PV0A 1U0JA 4G1UC 1PVOA 2QPOA 1UJ2A 4DT1A 1CR4A 1NJGA 2ZRIA 3N70A 4US0R 1XB2A 3F5FA 2IYQA 4EKDA 5IRCD 3BS4A 3W90A 1MABA 1V43A 2WJYA 1G8FA 5FBRB 4WW0A 3CRRA 4QXAA 4TL9A 2ERYA 5AUPB 2FFAA 1U9IC 3LLUA 1SVKA 4BASA 2IL1A 3EPKA 5DGXA 4HUTA 3I72A 3QVUA 2QAGC 1EWQA 5FI1B 4RZ3A 1Q3HA 3EAQA 4KLZA 5EE5B 1BOFA 5CJPA 4A1FA 2YOFA 1KI9A 4LGMA 3CRQA 2QQ0A 3EC1A 4B74A 1HTWA 4B2IA 2QAJA 2IS1A 4Q1CA 1ZRHA 4CIDA 1XTJA 1Z0JA 1N6NA 5JECA 2JLRA 1NP6A 2W2XA 1L2TA 3QG5A 2O30A 1IJEA 1FX0A 3CF0A 4IVQA 4MGYR 3KKQA 3OF5A 1II9A 1SHSA 4L5BA 4LX0A 5H70A 1Z6GA 4G3XA 3BK7A 3KQKA 5D3MB 4BRWA 1ZCAA 3GLHB 3BE4A 4KJZA 5TXGA 2NTYC 1E0AA 2FF7A 2AK2A 5A0FA 3LQRA 4M5SA 1JECA 1W46A 2YWHA 4YDSA 3X2SA 5KO2A 1KYIA 1OIWA 1ZUIA 4MDFA 3EZ2A 4FCWA 2DCUA 4I1SA 4Q7LA 4V0KA 3BC1A 4DVGA 2BMEA 4LCBA 3I32A 1KI6A 3CH5A 1AQYA 2QGNA 3K0CA 4MUAA 2V54A 5JSZA 2GVDC 1J70A 2ODBA 1TF5A 5L3SA 4OHXA 1II8B 1R7RA 4YE0A 2G3YA 3THYB 2B6HA 1OIXA 3EA5A 3K8YA 4C0JA 1ETUA 1EG7A 1SHZA 2ZI3A 3E70C 2XOKA 3C41J 1LF5A 4Q9LA 3BH0A 1W4BA 2OG2A 4KSCA 2W00A 2GDJA 5GJWC 5HR5A 4C7OB 2GBLC 4JSTA 1F6BA 1VYVA 4A2QA 4B48A 1I2DA 1JPNA 5FTMA 2WKPA 1MOZA 1MV5A 3ZIAD 2ZYVX 3QE0A 4PSVA 1M7HA 4GL2A 4ITRC 2EFGA 2Z6VA 3QPUA 4NCIA 2P6RA 2GXSA 4WOPA 4MDEA 1U94A 5G40A 3RYTC 1VMAA 1HT1E 4NL4H 2D06A 2O8DB 2B8WA 4NYIQ 3OIUA 4AC9A 1T0JB 4LJ7A 4IEEA 3L8YA 4DKXA 1PLLA 2HT6A 2JLYA 3K70D 1R5BA 3ZH9B 2JLSA 3O8DA 4Y0VA 2J0UB 1G16A 4PHGA 5EE1A 4C0AC 1OFTA 2OO7A 2UZIR 4DT1B 2J41A 3T1TA 1DO2A 1MABB 2J7PD 2XNDD 1E69A 2BCJQ 2ODWA 1RVDA 5JCPA 5IK2D 2BIFA 3TNFA 3C5HA 1UDXA 3AVPA 2Q6TA 2VSFA 4J0QA 1C1YA 1ESMA 4NBSA 2FWRA 3ZYCA 4DBLC 3K0CC 2AK3A 4HYYA 3SDZA 4D80A 2ASEA 3PITA 3CBQA 5KUTA 4I4LA 3OIYA 1S3SA 2WMOB 4FEIA 4OQXA 2ZSDA 4AG5A 1F5NA 1JQLB 4MKIA 3THXA 4LWZA 3EWSA 5GVRA 1E9FA 3EZ9A 4JVLA 4LJAA 4XH9B 1HQCA 4F92B 1H8ED 2MNWA 4ZDJA 3UG6A 4LPKA 3OE7D 4HB0A 4JLPA
chains in the Genus database with same CATH superfamily
3OXSA 1O9VA 3OZCA 2OMVB 1G66A 2DWXA 4ZVQA 3FVRA 1EJBA 3N3BC 3WO4B 4KKLC 5JHMA 3AF0A 2VDQB 7MDHA 5FOJA 3GPCA 1OGAE 4DJAA 4E3WA 3DX2A 3MS2A 4W8OA 1F6AA 5IC5A 1OGPA 4DRYA 5T57A 5CX4A 2OULB 2HPAA 4UU7A 3P9IA 3NRJA 2PWBA 1NA5A 1RT9A 2KZ1B 3TA3C 4PRHA 4YC7A 2BRUA 2AJTA 2CJUL 1DU4A 1UP4A 3RWOA 5I6DA 1J48A 4AM0B 1PT7A 2A6IB 4BQBA 4AL8H 1UEXC 2MSWA 1CPUA 3ND5A 4KQIA 5BRNA 3ZDWA 4B31A 1AGYA 1EHLH 2R7KA 3ENEA 1VE9A 3LRXA 4M8LA 1S78C 4ZZ1A 2I2XB 4CA4A 1KCLA 2BISA 4RSVA 4FHZA 3ZMEA 1KTIA 4KX5A 1E27A 5J2UA 4FP9A 1UWXH 1TEZA 5KSBE 3K92A 4Z76B 1WCBA 1SFRA 3IKTA 4AKHA 3BVUA 2O5ZH 2EDMA 3AERB 2CL5A 1Y8AA 4GNKA 3LW8A 2PUHA 4YRMA 1IILE 2AJ3B 2C9XA 4JDTL 5HOEA 3W8NA 1U8OA 1NMZA 1XCQB 4LASL 1TMQA 2YZ2A 3LOQA 4K3HA 4F7DA 1ASOA 4XOAA 4CLEA 4LSMA 1HUQA 2QJOA 3CO0S 2BY4A 4D2NA 4NQEE 1LTKA 4I4WA 4DUGD 4MNGA 4G2NA 3PNWB 3FCGA 2KHZA 3L4ZA 5BVJB 4RACA 2C4VA 4EDXA 2D2IA 5KX5A 1C5BH 5HMMA 4FQQB 3BDBA 1M72A 1T0MB 3L8HA 2NNAA 4QHMB 3C8MA 1EDYA 5CX1A 4E2WA 2J4DA 1BEYL 1WFMA 3W7AA 2QR0B 5EEUA 4YLYA 1K9TA 4QO1B 1BLNA 3WL5A 3II3A 3FT3A 5T1DH 2VBCA 3KH4A 4CMJA 4HD8A 3SGEI 5I1AB 1IUOA 5I16B 1XROA 5HJBA 4ZI5A 4JFHD 3MU3A 2Z6FA 4JANA 3H2ZA 3VFVA 4MMZB 1FIGL 1LA2A 1IUPA 4P4GA 1JGLL 1SZJG 2P1ZA 4F5YA 3HH8A 3HCNA 3ENZA 4W1RA 1QTNA 4EUEA 4TV8F 2VMEA 1EFLA 3D4GA 1R5WB 3C0KA 2J0SA 1QHHB 3B1ZA 1D2CA 5B4UA 3VB8A 1ISPA 2IH3B 3QPVA 4B3DA 4KDTC 1E5YA 1XGKA 4NYLB 4ND2A 2DTMH 2M6RA 4GXVH 3UXHA 1R19A 3IVRA 5FTWA 2OHIA 1I3GL 3CO5A 1N10A 1P5UB 1G7TA 1EUTA 2C20A 1QE3A 2ZR7A 2JVKA 5TQ0A 3N42B 5DH9A 5CJQL 3WEXB 4JQSA 4BCYA 4BKRA 6FABL 4JO8A 4TWJA 2VZEA 2Q50A 4NQTA 3PJDA 4Q1EA 5LLDA 1Z7GA 4KMTH 4U1JA 1FNBA 3H5AA 5DHYA 5IJKA 2RBKA 3VQLA 2EATA 2B1GA 4BMPB 3I9NA 2BTQA 4IJMA 1DHKA 5A3VA 5C0JA 4PPQA 3OJFA 2Z98A 1EE1A 1UUNA 1SKYE 4FA7B 4DMUB 4K3JH 4X71A 1OPGH 2QL6A 2YQ5A 4FF9A 2QPTA 5MN6A 1R3JB 3B3AA 3GQBB 4JKNA 4FFZA 2Y5TB 1OCWH 4ZAKC 2FIKB 3E7XA 1XVVA 5IBQA 3MWEB 5D1ZD 3JALA 4LLUB 1OWLA 1TM2A 1VIYA 3O8BA 3U61B 3JU3A 2CGRH 1ISHA 1M0TA 1IL0A 1UENA 2YAHA 5LXGH 4V11A 1ZHKA 1U8LB 2D4AA 3KTAA 4TKZA 2IC2A 2CJTA 5BO1L 4HS8H 5CK4A 3GI9H 1PYGA 5BRAA 3QDMB 3RAGA 5E23A 2XA3A 1AURA 4I0KA 1MC8A 1NUFA 4L1SA 2F8LA 5JT1A 2ROXA 3SBDA 1XGUB 1KNXA 4AU1A 5C0AE 2QTVA 1HIML 4GG8B 5TD4A 2ZSWA 3H84A 1A5ZA 3LQ4A 3RGGA 4K5OA 2R4RH 1XD2A 3SBRA 3QJQB 5DLMH 1F5WA 1B3RA 1TETH 5LGJB 4RE6A 4JI3B 2WY3B 5C71A 5KSBA 4FZ8L 4O2FB 3T9FA 4IOMA 3OZTA 3IJHA 1NFRA 4RV9A 4O4JF 2G80A 4Y2GA 2HWKA 3NP7A 3TOZA 4OCSL 2IQ5A 2BFFB 5JCZA 1EH9A 2JGFA 2WRZA 1DVFB 3GA0A 3V7YA 5CNMA 2QKSA 1CETA 4EL0A 4OLUH 4AF6A 4ISCA 4K9EC 1DSYA 1RRFA 6REQA 1BJRE 4Q05A 4PRLA 3CISA 4RF5A 2Q8AL 4UINL 4KI1A 3P0JA 1NZFA 1M7IB 4E12A 3IQDB 1UXIA 1ZVMA 2LNDA 4FGZA 1LQSR 3TO4A 1YJDL 3HDTA 1QV9A 3RGVC 2HU5A 2NSQA 1E7QA 5JBIA 2JNZA 1NOLA 2P8JA 2C3HA 2W9DL 4M8QB 3DNMA 3D4NA 3CEHA 1MO2A 3H2GA 1MAJA 4QCIA 4OATA 2D7TH 3H13A 4OVKA 4O8CA 1HDRA 3ETDA 1B9ZA 3L3OC 1E6WA 1RQ2A 2IYZA 5BSGA 3L49A 4RGNB 1KGCE 3MOQA 3ZYZA 3D3JA 4K6GA 2GSIA 4ZS6C 3QVGB 4PGBB 4Q0XL 4WU7A 1NKVA 1ONQB 2PU5A 2MOKA 2Y9PB 4UUPA 3AY2A 3F7PC 2VSNA 5C4IA 4KUZH 4X0EA 3SOBL 3Q13A 2NTNA 4W9NA 4NRZA 3SDYH 5IAEA 3EHBD 4UU8A 2E18A 3H2SA 1ENYA 1V4BA 1ZHOA 2RQEA 5HHQA 3V6ZB 4GH5A 1KQPA 4HLZH 4BDVB 2ZUXA 1F06A 4MA7L 1UOWA 2EILB 2ECQA 3SDDD 3RI3A 1T6ZA 2YJ3A 3F7OA 1NDHA 1Z0IA 4DBZA 1WUYA 3KKLA 1TQDA 2HMID 3HJ0A 3R1GH 4MA3A 4ZVNA 2HA5A 4UF7C 3OE7A 3VX1A 3U6XA 1YZKA 1YNLL 4HNTA 4OFQA 4H31A 1BVUA 5AKTA 1HU8A 1AQKH 2YZ1A 4QUKA 3R9WA 3EAFA 5IJBC 1SOVA 1I85C 3RL2B 1U8ZA 4BQNA 2DV6A 2ZSEA 4KQFA 1UADA 1S01A 2CLFB 1YEKH 2VXUL 4CMMB 3PIQA 2R0ZH 2HF7A 4OH7A 2R6FA 3AZOA 5AVRA 1KJ9A 3DBXA 2B5IB 4U1HA 4N49A 1Q44A 1Q90A 4ZCPA 4O4JB 3S81A 2AFHE 2Q5IA 4MNTA 4Q9JA 4JW3A 2H2PC 4X5QA 1XDZA 1TFRA 1URLA 3LC1O 5GINE 1D9ZA 3TN0C 1G2QA 1VA9A 1K8YB 3INTA 4DQOL 3AQZA 1EUDA 1K5GA 3L54A 1J20A 5INDA 3NKFA 3NFPA 4P3DB 4YBQD 1DQYA 2A8YA 4FU0A 4NGHL 1Z8DA 1TTGA 2O8CA 1LDPH 3FTEA 4RD1A 1HCZA 1MHPL 5FW7A 2I3AA 3TJZA 3ULKA 1OLXA 2GRUA 3O3DA 3K0FB 1AS6A 5SX4H 5HD8C 1AT1A 10MHA 2Q9AA 2EGHA 3WA7A 3PP4H 4LAFA 5LO7A 5JYLA 3CFJB 2ZWIA 2VLKA 1Z4MA 3F7NA 2WUCH 4JLJA 2YINC 2ADIA 4TQIA 5C0AA 1Y4DE 3UPRA 3VAEA 5AZEH 1SD5A 4QFCA 3QVSA 2YOHA 4IVPA 3RRMA 1NXOA 4K9KA 4TMFA 3B7RL 4GVLA 1IAIH 3UAVA 3N2NA 4W5TA 4PUBH 3MRJA 2JHAA 1Z5HA 1IE3A 4JJOA 3V7UA 3R7QA 1KMCA 1N2BA 4PLTA 2NDFA 4JL2A 1EV2E 2QSQA 1I1OA 1W5SA 5JI2E 1CGUA 1LLUA 2VUTA 4EF6A 1OX4A 1LEKB 4YHIA 1AZSC 5C8JB 1JJAA 3HE3A 4NSNA 5LP6F 1U1FA 2CVOA 2J5LC 3KPOB 4WI4A 5FO8B 4PWGA 1EZVX 4AQYB 3QYAA 1HZHH 2C4KA 3I2IA 3NFYA 2AHOA 4IJQA 1ZLWK 2XYQA 2RAVA 5CVTA 2G8NA 4CKZA 1Q9WA 5ESXA 1VKJA 4N8CH 43C9A 1ZESA 4ARCA 5KMGA 3RIXA 3SHQA 4MJXA 1AZRA 2NZIA 5EJGA 4EZIA 2CLLB 5IT2L 1BO6A 2I2AA 3W5BA 3P4NB 2UV8A 1KN2H 1E50A 3MIIA 2HRRA 4GM1A 1XF3B 4HQOA 4IHJF 3GSOB 3NAAL 4QQRA 1F8TH 4IU3B 1ZUHA 4IBYA 4ERSL 5BV0A 2MHAB 1JNHA 5BR8B 4L3AA 3N76A 4UASA 1A7AA 3PXEA 2XUHA 4TKLA 3MS7A 3FTNA 4OD0A 2WTBA 5L8LB 3DOUA 3EZLA 1UIMA 2I9TB 3U7RA 4DERA 4LIQL 3V0JA 3X1WA 1RHHA 3BAFA 5DYYA 3QXGA 2FI1A 2DFVA 4AMUA 4F46A 3PHLA 1JA1A 3RV4A 4NSKB 5EE3A 1SVWA 4OU5A 4BCDA 2V1XA 1KYDA 3QZPA 4L9AA 3US9A 4US2R 3J07A 3T38A 3SZRA 1NBEA 2H1IA 3OM3B 5I0ZA 2R7NA 5JRJA 3AWIA 3CDYA 1UK7A 2WMNB 3M46A 3IVCA 1YH3A 2CNDA 4J16A 2EKQA 2H2SD 3SPGA 2CBXA 3MVEA 1WP6A 2OMUB 3VXNB 3EQ9A 4G4JA 4H88H 4PQXA 2CKBL 3PUJA 5EINA 2GPYA 3P77B 2BFNA 1VEOA 3MBED 1TNDA 1OLOA 4A0HA 3T9DA 1KJWA 4JQYA 3VKFA 3D7LA 3GMIA 2B3TA 2ZCHL 1OYYA 5IAOA 4N0EA 5K39A 5CFRA 2I7TA 3ITDA 2CD7A 1CFTB 3TURA 2XRMA 1GZ7A 1LI4A 1LILA 4Q1BA 5ILGA 2A0KA 3QQDB 3DC7A 5E8DL 2E1RA 3EH3B 3O95A 3EOBA 5AJXA 3ZY3A 2XXCB 4JY6A 2QGCA 3TI7A 1Y6GA 1H1LA 3G0BA 1RH8A 1U6JA 1I7DA 4IV8A 2F74B 4XOCA 3S7TA 4U6XB 5LP6B 1GZHB 1RHRA 3W9EB 1WBJB 4BU0A 2AI0H 2BBSA 1YZFA 1WXWA 3ZXUB 1BS1A 1JTPA 1K85A 1XOIA 3NSFA 5CD3B 5JPMB 3KLMX 2PX6A 5BOSA 1XEWX 4ZGBA 1TFPA 5U4XA 4GS7B 1UODA 4AGOA 1JEDA 5DA0B 2PMDA 3O4IA 2OTPA 2B9BA 3TZCA 1RHKA 3CFQA 4PWJA 1GEEA 3WJAA 4DMRA 4A2GA 2XUJA 5DCYA 3U0WL 5JROA 3L1UA 2OYMA 1BVZA 3W1ZA 1JL8A 1VSCA 4NP9A 2FX2A 4WO0A 1OM9A 3F96A 4PY7B 4C4SA 2PN5A 1HHJB 5EYPB 5F7KC 3BUSA 5DKFA 1SN7A 3FRUA 4A9AA 3GF8A 2K5UA 3KGSA 5JATA 3T7AA 2O7VA 5JWHA 4I1NB 2O0LA 3Q6IA 4E68A 5E1AA 3TXYA 3OMZA 5F3FA 1XHFA 1E5DA 4KI5C 4PYGA 2OEPA 1B26A 3WN5B 1OW0A 5G4MA 3GJFH 1P4IL 3WK4A 3IHWA 3CPHA 3QIUD 3NABH 4NAQA 5GGTH 5E99H 3CQQA 3WHPA 5IW1A 2XJKA 3BSWA 4XVJH 2FAXA 2R8OA 4FKMA 3NBKA 1EAOA 4KGDA 3U0TA 3HZVA 1IT9H 5KYGA 2JFNA 3P9SA 1FVFA 1SCUB 4KR0A 4ZEOA 1YE8A 3O6FC 2ZYIA 1DQDL 3IT2A 3G8YA 4ARZA 4TXJA 3TTSA 4JYBA 4U2GA 3MCKB 1KEGL 5FOXA 3C8KA 4BH7B 4MUMA 1AXIB 3FMOB 3IDFA 4GQPH 4F2MA 3AR6A 5KZMB 5CF3A 2IZZA 3UANA 4BFOA 2QTLA 4MCZB 2B34A 2GJZB 3GTNA 3WAJA 1C5DA 3UAFA 4A7VA 1R6DA 4EA6A 2BLNA 3K5RA 3DO4A 3O2VH 3WY1A 2PVPA 4MUXA 2ZUVA 2JA1A 3U4QA 5EG6C 1AHWA 4NB7A 2C5BA 5CVUA 5D9SB 3VR3D 4JN6B 3QH3B 4GC5A 1H15B 5T8IA 3D87B 2AHRA 4L6CA 4WOJA 3GQFA 3ABMB 3GZOA 4V1CI 3PLYA 3GJRA 2P27A 4XR9A 2IAMA 1KV7A 3I3EA 2UZ1A 4E9WA 4EPYA 1BA3A 3VHXA 2WTMA 3ZLTA 1OTSC 2AP2A 3GSUB 2PXXA 4M6OH 4N2DA 2W2MA 3MV7D 4TLAA 8GPBA 2V97A 3EQ7A 4AXXA 2Y66A 1HHGB 1WDAA 3DZGA 1SXJE 1JHLH 3EPJA 1DQLH 3SBPA 4I0PD 4J0FA 2D3JA 4BX2A 2EFDB 2PCXA 2CMGA 3QMWA 3U30B 2GN9A 4MTLA 1ZLYA 4QTUB 5DHAA 4ZUSA 3K6SA 4Q4HB 3IJEA 1TA4A 1YEJH 2CPUA 1T26A 5CVVA 3LKZA 5KHLB 3TYGH 4R1OA 5K2MA 3ASVA 4NLAA 3L2LA 2BWQA 3UH0A 3NBUA 5JLZA 4TM7A 2YV5A 4ZK8A 2W43A 2VTDA 2AEQL 1PNRA 3HNOA 4M0MA 3KU4A 4E41D 1WG8A 1QTYT 4MK4A 4BBJA 3QSGA 4TQEL 4NYIR 1H2EA 3QWOA 3QVAA 2AOTB 1DJWA 1YN7B 3I2CL 1N2HA 3HZKA 3GLIB 1JERA 5F7YC 2ZR9A 4RM3A 4GLBA 4Y9DA 1LK7A 3NDJA 1JR6A 4MPRA 1RW4A 4JJ5A 1CE1L 3ASWA 4OD2A 4OM1H 2ZX5A 4DL9A 2PUDA 3Q87B 2HFGL 1T0IA 2J7PA 3IJSB 3RY4A 4TL8A 1WCV1 4L5IA 3R7AA 3CRNA 4DJTA 1AZNA 2J1XA 4O2EB 4L3WA 3LUJA 1AKUA 1E2EA 4YR6A 2UVEA 1JEJA 1QGDA 4EPSA 2WTNA 1EGHA 3KJ4C 1CTNA 1Q9OA 1ANKA 4UDUB 1KGDA 2I03A 5HDRA 4FS0A 3NGBC 3R8XA 1OM3L 3RVXD 3PIIA 3VSBA 3NB0A 4L18A 2BGIA 2DBYA 2JFQA 2Q62A 3FF1A 1W88B 1FL3A 4JFTA 4Y5XA 3N3EA 3LNDA 5I8OL 3ICCA 1SKMA 3OTIA 1AUPA 2FHFA 1N9KA 1M2EA 5FR1A 1JR4A 3CFEA 3VFMA 4JM2C 4LWPA 5B4TA 4ZPVA 2NU8A 1BZOA 1C9YA 1IXRC 4D0BA 2ZJOA 1INEL 4TTDD 1U0OC 3FRPA 2IZOA 2YUWA 5THQA 3VTMA 1C0EA 4DKFH 2FJGA 3DAOA 4OQMA 3QR1A 3L8EA 1E7YA 1Q0HA 3HFGA 2BFMA 4ZBJA 2Q6IA 2XPGB 1PX8A 1SCNE 1JXGA 2IXDA 1DQJB 1T6XA 1CJUC 2ZKHL 3PUZA 1XX6A 3G5ZA 3PE6A 3SJZA 1MW1A 1U92A 1KGXA 4IKKA 2ZYSA 1P6XA 4JQXC 2BRRL 5BQ5A 5EU3A 4NE9A 3BKMH 5B1DA 3QS3A 3FW1A 1PFCA 4ELMA 4G70B 1XGPB 1U8XX 5E0FA 3HBLA 4X6LA 1Q94A 1CK0H 4WASA 4MNQD 4B0MB 3O3CA 5B3JA 4B95C 5EFZA 1T4CA 4EDFA 2WNWA 3KPRB 3MTIA 2XOEA 4FS8A 3BEWB 4TOYH 3LYUA 4IMIB 3F2IA 1DE4A 3MUJA 4F8OA 3OZXA 1ES9A 3VI3B 3QX8A 2RONA 1G6OA 5C80A 1G7LB 3VXTA 1B8NA 1QWSA 1OFIA 5F3HA 3FK3A 1ZIOA 4GG6B 4PJEF 5GGXA 3RRZA 5BN3A 3KZVA 3ZOZA 3OKAA 3U36B 3MRFA 2NXZB 4IDEA 5G3ZA 4FOSA 4LQCA 3ESYA 1SXJA 2F6RA 3QHPA 4NZPA 4KZDL 4DV3B 1VE3A 1NCAL 1W1UA 3QOXA 2CRMA 5AVYA 3FOLB 3F6LA 4L8DA 3VWJD 4ZFOA 1CVRA 5DJ2B 1A3QA 4KHPB 2OHXA 3EY4A 5EWLA 4AE1A 4Z53A 2KBEA 3FCSA 1VJ1A 3VM7A 4V2BA 5IROC 1EA9C 1ADCA 4BU1A 1AHKA 2IDUA 2CY0A 2F9FA 1H23A 3JQRA 1ACJA 4GX0A 4IBQA 1UC6A 3CSDA 4AB1A 3QIAA 1WWAX 2XV1A 3TGPA 4ROTA 4UOJA 3HABA 5J11C 3MRRB 2DPYA 3LVTA 1FL6A 4DGIH 3KYCB 1CNFA 1RRKA 3RWCA 1A14H 4I1VA 4X7RA 1H5QA 4L0DA 1LLDA 4NKIL 1E2NA 3TZVC 3QHFL 2DB3A 5DFAA 3DSFL 1UD5A 5HIAA 2F19H 2VTEA 3ZJUA 3C6LB 4S1RL 1E2QA 4OLBA 1W6RA 2CLHB 4JEGB 1X3LA 1B0UA 5HHOE 4TRPL 3U1TA 3D6VA 2QM7A 2WUGA 3GO4A 3SI7A 4H6XA 1Q1NA 1B4LA 2YPKB 1UOQA 1AKTA 2VJOA 4LEXL 5KANG 4G9FB 4IY1A 2CU9A 4EDWL 4KRNA 5TS2A 2BVUA 3D3WB 3R9XA 2P48B 5FPIA 4Z77B 4B7UA 1RHUA 1IN1A 5FHQA 2HJHA 2JS7A 4B2LA 1I9JH 2HYIC 4G0PA 5JIBA 3H8JA 3PEYA 3GB7B 4RHTA 1SF5A 3H9EO 4DM3A 4HEJA 2FSEB 5DTQA 4CQNA 1BRTA 3P9RA 3BT0A 3HN7A 1E4XI 2H41A 3WZLA 1RMFH 2BRUC 4E5DA 1N4XL 2MSPA 3FM9A 5CDGA 1TJGL 3LPDA 2HNKA 1IG0A 2X77A 4N2LA 3B3QA 1QGUA 2VM4A 3D8MA 4H44C 3BYYA 2FEJA 5LGYA 1JPFA 3RYFB 2I0FA 1AMOA 2R6JA 4WACA 4X4YA 4V3BA 1U0GA 5IMSA 4HZUB 2HV9A 1ROWA 421PA 2X4PA 1P0FA 3KWXA 2WIGA 2EXYD 5D7JD 4TVKA 2VITA 1ISIA 1SQMA 4UTAA 4X6EB 4V03A 2WZCA 5E1QA 2FETA 2ID8A 4NG4A 3ULVD 1ZGLA 2WU1A 3BH4A 2R25B 3CVIL 2J5KA 3AJ8A 4X3PA 1JJUA 3DGGA 3KPSA 3ETSA 3RTLA 5FXCH 1T1YA 4MW4A 4NBYB 4FMCB 1FNDA 2G36A 3UK7A 3FO2A 1AIPA 3S9DB 1N7HA 1F51E 2XWPA 4APQD 3N50A 5H9WA 2GF0A 3O03A 4QELA 1MDAA 5LB4A 2H4ZA 1F2TA 5T1JA 4ZJYA 1YMVA 4Z6KA 3NCCB 1N75A 1GPAA 2GK7A 1VSTA 1ZHLA 5TE4H 2NN3C 1TEGA 5CRIA 3IOMA 4R97C 2XA9A 1ZW6A 2YWFA 3D2UD 3LDHA 1YB6A 4FMBB 4JI5B 4YS4A 5CWSB 4H16A 1V8OA 2NY5C 2QJRA 4FXKC 1I7QB 4HAXA 3IFNH 2XPCA 3CR7A 4N6NA 3RSQA 5CVEA 1GT6A 5D2CA 3W1EA 4GF5A 3DJRA 5CAEA 1PLBA 1BLIA 2CXPA 3H7AA 4TPKA 1JHRA 1P7KB 4XB1A 4KZCA 2AZXA 5B1YA 2P47B 1I7NA 2A0WA 2JCBA 4IMPA 1IM2A 3HN5A 4ARUA 1S9VB 4XM2A 4CNIB 4EA8A 2BCEA 5LG6A 3PGLA 3ZV3A 1KB3A 2ZUQB 2Q2OA 1IL1B 3MCWA 3HB4X 4RISL 2PXHA 3R6WA 5INTA 2ZAYA 3VU8A 3NCJL 4DLXA 1U6KA 2IOMA 4WWNA 1MRNA 2DUJA 1XRQA 5ALVA 1A9SA 5ISZD 3IU3B 1MZZA 1UYWH 3A6CH 3FYTA 3CZEA 4YALA 2AXPA 3LHIA 1XQVA 2LW3A 3WGKA 5EP4A 3ABSB 4FVTA 5HHXH 1ZJ5A 4LQLA 1FFSA 3ZS9A 2FT7A 1NNSA 4HEPG 5E9DB 1QANA 4M98A 2MCMA 1SQ0A 2XXJA 1JXKA 1MO4A 4CODB 5HDQA 3DURB 5K0FA 4B47A 5ICCA 3UEQA 2Z4QB 4ZUVB 3A27A 4KGXA 3F7YB 2C5FA 3DBHB 4LSUL 4P2OD 4EUFA 1Q0SA 1JH9A 1CD0A 4P4KD 1NE7A 1CF4A 1CYWA 1T7YA 1LH0A 2WYOA 4Q9IA 1AOZA 4BLRA 4YHLH 5JDJA 1N2ZA 1TQUA 3OL2A 4MZIA 3MTDA 1NDUA 5ED4A 4UT6L 2WO3B 2GO7A 3ZL2A 3GJFB 3KFLA 3OPQA 2MMXA 1F17A 4EGFA 3U6KA 1GZ4A 4H1LH 3GA7A 4X64B 3Q40A 5DD1L 1XZBA 2DECA 2V2WB 1TQTA 2FKAA 4O02A 4C59B 4YZFE 2NCEA 2X7JA 3ISWA 4DIOA 2R69L 2X1QA 1EBAA 1QPXA 2WWKO 4KK4A 1MJ5A 1RIUH 1NQ5A 4XYMA 4DM4A 1J07A 5JYMA 3P2YA 4JO3H 4LOEA 5FEUA 4G6FB 3SPVB 3VTAA 1LTXA 1PKQB 5AW9A 1QLRB 4WK4B 3NCMA 4XSHA 1CGWA 1XKLA 3BIAX 2XF2A 2I6UA 3G0DA 3PS9A 1VYHA 3QNXB 1U8HA 2UXCB 4LARL 5I8EB 2X0KA 5AJHA 1WQ4A 1Y3FE 2YFNA 2HA6A 5AW3A 5T1LB 4LRNL 3FI9A 4JASB 1PJQA 1ND0A 5I6XB 4L5FE 3CE9A 2GBTA 1TUBA 1JE0A 3FAWA 5GS0L 4L23A 2JJMA 3H0CA 3T3OA 1ZEAH 2XCSB 1SUCA 4KRGA 1OTTC 1HH6A 4RA3A 1HL4A 3K0BA 1TQHA 4IV0A 2YHGA 4LLWB 2ONYA 4P86A 2HZHA 2Z7YA 3OHPA 3V55A 3TO4C 4RL6A 1WDKA 2XF8A 3KKOA 4WN9B 5C0BB 1SQSA 2O8DA 2OHOA 2O61B 2F55A 3PV0A 3CZUB 1KU0A 4HN2A 2Y1CA 4LSPL 4L75A 4J0IA 4US0R 3MJ9H 3GUUA 4UQCA 1XTPA 3NOXA 1K6JA 2WKSA 4JAMA 5AVWB 5T1KB 3BP5A 3FA2A 5C7YA 2FFAA 4CL3A 1SFHA 1D2PA 2X7LB 2Q4RA 4DZ8B 1ONSA 4CLXA 3F6JA 5DFVC 4J3FA 2WFAA 3U7AA 1N2RB 1PSKH 3HY6A 4W9NC 2N9UA 3R76A 4BB5A 4IOSD 5CGYC 4KKQA 3E82A 4BXOA 2ZT7A 1SHSA 5D3MB 3DZHA 5DYOB 3A6JA 5DWUL 4CBPA 1OT1A 5C0EB 4AG4L 5LFAA 4DY4A 1GOHA 5IJVB 4LCBA 4CKWB 1QPZA 5JSZA 1C9EA 1BH6A 4UOQA 3CPUA 3FXIC 3L95B 2H0PA 1X9GA 1ZONA 4IDAA 1QFPA 1EG7A 1UADC 4IXTA 1NIBA 5MEOB 4PJHA 4YGYA 2G3ZA 2K7QA 1CJBA 3KPVA 4YGAB 3MTEA 3IXLA 3TAXA 1SK8A 3NWPA 1RU9H 4NCIA 1W87A 1HT1E 4YVNA 3WK7A 5A43C 3V4VL 3UOAB 2P80D 5FGCB 4TNWK 2JLYA 3U3DA 3DOSA 1MZPA 2OO7A 3PWVA 1JWUA 5CEZD 2BELA 4OQZA 2RQ8A 2R2EB 2BE7A 2ZKYA 2E3VA 2L7EA 3T1TA 3I9V6 4ZVPA 1NQWA 3NNSA 4LLMA 2YVQA 2BIFA 4PN7A 3FT9A 2IEDA 4NV0A 4MW2A 4XWYA 4W9RA 2VR4A 3FZYA 3ZL4H 1R9GA 1JLLB 3PL5A 2A9DA 4NJEA 4MCJA 1ABFA 5IMOA 1YR2A 3CQPA 5BURA 4ZOLA 1H8ED 1LDNA 2G4VA 4HB0A 4E5PA 3K6IA 4YYEA 1QG3A 1KPIA 3QUQA 1XL1A 4JEHA 1J2JA 4ZXFA 3HNVH 5DVKA 3VXMD 4HY3A 2HAEA 1TEXA 5BN5A 1ZSYA 1JG3A 5KVEH 4M9CA 3D3KA 5HI5D 1JA9A 4L02A 4LISA 2OILA 4OJQA 2GSWA 3OIFA 4UV7L 3A31A 3KUCA 1FRVA 5I1IL 2W6ID 3WGUA 1VEMA 4LLVB 5I7RA 1FDVA 1MWAA 1AFVH 2VQ1A 3DE1X 2ATXA 1Z5VA 3QULA 2OZ4A 2EC9U 1EM6A 1AGDB 3EGOA 2EG9A 3VXPA 4UM7A 4HG4K 3DQQA 2WZPA 3DLBA 4FNLH 4C2BA 2X8WA 4KO5A 1UBLS 5AUOB 1FTGA 3WMFA 1X80A 3WS6A 5JD4A 3RE1A 5LDUA 4X94A 1YCSA 2FE0A 4E36A 3EPHA 1QWNA 3K8MA 1PFGA 3RKRA 2GDZA 4FWBA 4PYOA 3C5XA 4L4VB 2GF9A 1M8JA 3KOUA 1XCWA 1RHQA 2ES4A 2EUZA 3I8OA 3G6AA 4P57B 4I9WD 2I7XA 2O0HA 4KFUA 1HLFA 2IXQB 2O50A 4BDTA 4OLHA 4KDRA 3ORYA 4AECA 2ZJFA 2P1RA 1W48A 2BKLA 2EP8A 1FF5A 4BK4A 1RJLA 5KSVB 4RKFA 1PNCA 1XF2A 2C3VB 2Q5LA 5CIQA 2Q46A 3PRZA 1E5LA 4FZEL 5TE7L 3QDJD 1OQOA 1ZXBA 3HS0A 2WLJA 2FDXA 4OM8A 1USIA 5FYLL 1SVNA 3WIBA 3GJ4A 4J16C 1H3UA 1XMSA 1UK6A 2F7PA 1PFOA 1GYCA 4YCDA 3W8FA 5B36A 3VKWA 2GK6A 3DHVA 1VADA 4RZCB 4BYHA 2C7UB 1UFOA 4GRLA 2F9BT 4JOBA 4PTZA 4E5XA 3JD3A 4DUYB 4M7JH 4HSGA 2X87A 3PC6A 3O1IC 4H8UA 3S1AB 1Q0PA 4PPGA 1DIGA 5C5DA 1KZ4A 2GCNA 1ZN8A 3HPRA 3TSOA 3G2HA 4L4ZA 4WF7A 1WF5A 1S8AA 2H3NB 5AVTB 1WHPA 2R6ZA 2RC6A 5EO0A 3PUWA 3S1SA 4E1BA 1KARA 1TYBE 3P45A 3UCFA 1DEKA 3TIDB 2AK4A 4PB9H 3H4TA 1Q15A 1GTMA 1BZ8A 3CZJA 4U1GB 2V6FA 3PXBA 3ETEA 2ILTA 1GA6A 4PJ5B 1JGDA 3EYSH 4ZTZB 4X99A 3DTDA 5H2BA 5FBKA 1TZOA 2V7GA 4U4IA 1KBQA 2QUHA 4DKEL 3S37L 4AIEA 3T6QC 2CDGA 2QW1A 3P96A 3BIFA 1A6VL 4RNCA 4OL9A 1XCGB 2X6BA 1YEDA 1Z39A 3M88A 3JQAA 3VXQA 4P4TA 4XGNA 3SQRA 3ZU5A 1Z0UA 1YS6A 1ID5I 4Y19A 3L8CA 3HZYA 2DQCH 3X11A 1DVZA 4HUWA 3P3TA 4WKZB 4F33B 2GAZA 4PO1A 3GQVA 3TWCH 1JFVA 1CGVA 4IDQA 2WW8A 1LE5B 3RLSA 4C4TA 4F1WA 3RASA 4PQFA 1U41A 2G1UA 2LE0A 2ITCA 4A8HA 5IF0A 2ZRGA 1JEYA 1HWYA 2A73B 5TRTA 2JJTA 2VDPB 1Q7CA 3IHLA 4AZ0A 4IJKA 3V9CA 2ZZUT 3AKEA 3GDHA 4FHFA 5IQLA 3RVUD 5KTPA 1P9LA 2H1OA 3QHQA 4P7JA 3NBNA 1G9XA 1GH7A 4OLYH 2LCQA 7CGTA 4QJBA 5JAMA 2YXLA 3E15A 5IW6B 3WFHB 2OI9B 3E3AA 3KXKA 2CF6A 1YXMA 2IYUA 3I0MA 3W9SA 1W76A 3MTJA 4ZT2A 3L3JA 2XDQB 3UPTA 4LVEA 2VZ1A 4X6DA 2P6NA 3SKVA 4DSZA 1OW0C 2CV1A 1J33A 1NJ9A 4BIKA 1UGNA 3AWFA 1MDFA 3KJ6L 2AG6A 1JPSH 5CBEB 1V39A 1QFWL 3I30X 1D7OA 3WIHH 3ZSTA 3L7LA 2R9HC 3RFZB 2ADYA 5JY1A 4QRTA 1G2IA 3FJOA 3NFNA 2R1VA 4LNAA 2HRGA 4XGZA 5JNUA 1BWMA 3TW8B 3E18A 1XCBA 2VR1A 4J3JA 5E3IA 1QC5B 1V10A 3CLSD 2GB4A 1XTRA 4JNCA 4WHYH 4PGHA 3FIJA 2DF8A 5LNDA 4JS7A 3NNDA 4DDWA 2P7TA 4ESEA 5JR3A 4PIBA 1B6TA 2AT1A 1U8CA 3UUGA 1RJ9B 2Y93A 1NGYA 3PQ3A 3W5UA 1AHWC 4NHOA 4F57H 2BGJA 3NN8A 3N9IA 1LF0A 1IGIL 5G3YA 4K88A 3WYNA 2IV7A 4WDRA 2OBMA 4DLTA 4MUYA 4LPCA 1SBYA 1JMZA 1MD9A 2FPLA 2IAMC 5DV9A 1DEEB 1HKLH 1M2OA 4FONA 2P8PA 5AM3A 3P54A 3IPAA 3FH8A 1JIXA 2V03A 1P75A 4RQUA 1C08A 1I7RA 7PCYA 1R9FA 4BQSA 4O33A 3GBVA 3QIWA 4TMZA 4C6TA 1H6TA 4WTZA 1D0VA 3UACA 1Y42X 5JYCA 4H1LB 4ZVTA 4NCAA 1WR8A 2JKTM 4OK3A 1IQDA 4JZJA 4MFHA 5HGAA 5LUMA 5FV1L 3P9XA 2GD0A 5C8YB 2IUFA 2JB5H 4AMWA 1W72L 2TRHA 3LDUA 5ALTA 4QJ5A 4DV2B 5D1QD 1GTNA 2HHJA 4YMLA 4U6HB 4HIJA 4BFCA 5GZOA 2DFKB 3ICPA 4FCTA 1T2JA 1YUHB 3QNYB 2PT5A 1S7SA 4ND4A 4KL8S 3PJSB 3TEZA 2W0MA 1EVUA 3TR0A 2XD9A 1BN6A 2BP7A 3VR0A 2XWBA 1DMSA 3RVJA 1H3TA 2C8VA 4DCJA 3OSZA 4GP7A 4P53A 5A04A 3R6LA 4PJCF 2VYVD 3MXVH 4WO4A 2L19A 2AJSH 3QJYA 3FT4A 1T9KA 3LKVA 4TXLA 4Y9TA 2CO7A 4UXJA 2WBJA 1T0PB 2XHZA 1N8NA 4PRKA 1E3TA 4AK1A 2Y6SC 3COZA 2X6VA 2ZJ3A 3IEAA 1IGFL 3I9JA 4QD2E 3WNKA 2WMDA 3HJFA 4Y1RB 1QLFA 3FU7A 4XVRA 3ERXA 4Z4CA 1XZWA 1HMYA 3NHAA 4A8PA 3B2VL 5E9JA 4FYWA 2A9QA 3F73A 4ODBD 1BX2B 1MEXL 2YA1A 1K4YA 2ED8A 3DEAA 3GGGA 5FUBA 5C7XL 2E27L 1BVRA 5A4FS 5JZMA 3LN4B 2G9QA 5FBHA 2F3PA 3AACA 4Y5XC 4QUOA 2CNWD 5CYFA 5F9DC 4DEPC 1G4MA 3DDCA 3QUZA 2DKNA 3OTQA 3QEQA 3DMYA 1JHKL 1IN5A 4P81A 3NT2A 2JKIS 4UQLA 5BZZA 2P24A 1TJHH 1QIJA 3GMRA 5E24E 2GWHA 1UC5B 4KN9S 1A8JH 5FFLA 1KQ3A 4J9UE 3VAZA 3H86A 3TBSB 5I5JA 4JFDD 4DA8A 4ZAGA 1IEXA 4UQ2A 4D92A 3SSMA 4K3UA 1TQBC 2O8BB 3UCEA 4EBQH 4ETIA 1D2NA 4FDAA 5MEPA 4Y2RA 4GS5A 4JVWA 4TMPA 4UDTB 2YKKA 5KBMA 2F59A 5BMVA 2KPWA 3LYRA 2ZS9A 5D1XD