3IGFA

Crystal structure of the all4481 protein from nostoc sp. pcc 7120, northeast structural genomics consortium target nsr300
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
368
structure length
333
Chain Sequence
ALILTFLGKSGVARTKIAIAAAKLLASQGKRVLLAGLAEPVLPLLLEQTLTPDPQQIAPNLEVVQFQSSVLLERNWEEVKKLEAQYLRTPIIKEVYGQELVVLPGMDSALALNAIREYDASGKYDTIVYDGTGDAFTLRMLGLPESLSWYVRRFRQLFTNQVNNFLDKGKEALADPKRVAAFLVTTADPLEVVSVRYLWGSAQQIGLTIGGVIQVSSQTEGDLSAEFTPLSVTVVPDVTKGDWQPLIDALPNFVEQAEQAPKPITIDTHNRQVRLFLPGFDKKQVKLTQYGPEVTVEAGDQRRNIFLPPALSGRPITGAKFQNNYLIISFLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target NsR300
rcsb
source organism Nostoc sp.
molecule tags Atp binding protein
molecule keywords All4481 protein
total genus 101
structure length 333
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
A PF17886 ArsA_HSP20 HSP20-like domain found in ArsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3igfA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3igfA01
3EASA 1SGWA 4HI0E 1EWQA 4MKFA 2WWIA 3P20A 4KSBA 1T91A 1PUIA 1VG9B 1EXMA 2W58A 4RZ2A 2EU8A 2GETA 4X8MA 2O8FA 3PUXA 2IS2A 4XD7D 3IHLA 3LWNA 4UXJA 1XWIA 1KO5A 2EFDB 3KJEA 1RPZA 3W9YA 1T4GA 1ZC3A 2H5EA 2OFWA 4B74A 5JRJA 2JLXA 3ZQ6A 1DS6A 3FHTA 1AK2A 3J07A 2QEQA 1W49A 3QPUA 4MUBA 3IO5A 4EFNA 5JSZB 1OIXA 1W0JA 3N2EA 5EE3A 3CF6R 1QHSA 5FR2A 5FOTA 4A0FA 3GLIA 3AM1A 2FMXA 4EJSA 2R2AA 4RFSA 4BLPA 2O0KA 2PJRA 3RSOA 4QHTA 1TQ2A 5GVSA 2L0XA 4DKXA 3W34A 1U98A 4YE0A 4NE2A 4IXMA 2XTMA 3W1ZA 2ODWA 1IN8A 3NIBA 2OO7A 1UKYA 4XVRA 3KKQA 1NIJA 2ZUDA 3GJ4A 2I4IA 1YZTA 4WXPA 3ZD6A 2NG1A 5FPYA 5EP3A 4JLMA 3AVUA 2GJ9A 3CX8A 3CX7A 3HPRA 5JJKA 1N25A 4JL8A 3U7EB 1EX6A 4DSOA 4ZV4A 2GF0A 2C98A 4RD2A 1U8ZA 2FPMA 1GKIA 3SNHA 4QHSA 4PC6A 4A9AA 2O0JA 4B76A 1DAMA 2Q3MA 1K5DA 5F9HA 2VIIA 2JASA 2VHCA 2VP2A 2WIBA 4ARZB 2BHRA 2ZPTX 3VNVA 4DHEA 1Z3IX 2IYRA 2FSGA 2IHBA 1NSTA 3EZ7A 1W7AA 2EQBA 1COWD 2BKEA 1VCIA 1M7GA 1YR7A 2QGZA 3L1EA 4M0LA 2CL7X 4U5XA 2WM9B 4I1SA 2IHYA 4QJ3A 1GFIA 5EQTA 1AM4D 5CITA 1E96A 2IS1A 1IN4A 3UATA 5BYJA 4G01B 2AK2A 3EA0A 2NZJA 1HUQA 3GUFA 2VEDA 1WQ1R 1NN3A 2HV8A 2NO7A 3DKVA 2WPDA 4OI4A 5DNYB 2DYKA 2B7BA 2OXCA 3AVWA 1P60A 2AXPA 1KSHA 1E4YA 2O5VA 3C5HA 3RANA 5CDFE 1E94E 1RE0A 1VYVA 3KXLA 3B7GA 4C7OB 3EUDA 1QBKC 1TEVA 2OESA 1R10A 5H8WA 4EUNA 3HWSA 1TQ4A 3AGQA 3WNCA 4YLCA 3OFNA 2DFNA 4Q01A 3D6TB 1S8FA 2P5TB 4JIMA 4KVGA 1XD9A 4HZIA 3LH5A 5IK2A 3LQRA 2VSFA 2W6ID 5FOWA 1QHHA 2V1UA 3GJXC 2VF8A 4DVGA 4C2TA 2V7QD 4IOMA 2QL6A 1NVXQ 2HT6A 4F4CA 3I8XA 3BH6A 4LYFA 4WZ6A 4TLBA 5C46F 1WFIA 2P3SA 3CR7A 2RH0A 4GBMA 1OXXK 1G5RA 4JYBA 2XGJA 5FL7A 4ZKDA 4URUR 2G6BA 2R6CA 2BCJQ 2K5UA 3I32A 2RB4A 1RKBA 2NQ2C 1MH1A 1D8TA 3NG1A 4NCNA 1W0KD 1U8YA 2ZRFA 4FN5A 4PO8A 3I1FA 5SZHB 2ZRDA 3A1VA 5KO2A 2CHGA 1ZD9A 2P2LA 2QENA 5EXSA 3X1XA 1II9A 5GJBA 4TYQA 1E2IA 2ZSAA 4RD4A 1SQ5A 1U9IC 2JIZD 2OBNA 1ZC4A 3FMPB 1R5OA 3O8CA 1CTQA 3O8RA 5FI1B 3TJZA 1MV5A 1E2MA 3X2SA 4CT5A 1QRAA 2QRZA 3E5HA 3RRMA 4BRWA 4W7SA 3AF1A 3QVUA 5G53C 2NO6A 2XNSA 1H8HA 1OKKD 2V3CC 2PBRA 3DMDA 5FPSA 4BEBA 3I72A 2WHXA 4QJ4A 4XWOA 5LDDC 4LHWA 2O8DA 3HYRA 1TX4B 2MSCB 1QHIA 2RGNA 4IXNA 621PA 2ORIA 5G3YA 3VR3A 2ZSFA 3DZDA 4OYHA 2ONKA 2ZE6A 3MJRA 3D31A 3PENA 3BS4A 1CS4C 3LV8A 3RS7A 4TYWA 1VKJA 4GDFA 4C0LA 1G8GA 4GT1A 4BEJA 2A78A 3JVUA 1D6JA 2MNWA 2W6IA 3QKRA 4BFWA 3UK6A 3RC8A 3QF4B 3KDSE 4G1UC 2ZRBA 2GXQA 1UFQA 2VTKA 5J4KA 4WW0A 4I1UA 2XSZA 3HR7A 1XP8A 2XNDD 3VX3A 4HAXA 4RFVA 4ZKEA 5UKDA 1MRSA 2WJJA 1SXJC 2ZREA 4KYIB 4ERNA 2ODBA 2NO9A 2CK3D 4RKFA 4WBSA 1W5SA 1K8RA 2FPLA 4JSYA 3SQWA 3BH0A 4MYUA 2YYZA 1FMJA 3TMKA 4A92A 5KOYA 3WYAA 2EW1A 3RS0A 4TL9A 1RRPA 2A5DA 1W48A 2ZSDA 4YC7A 5DLQC 5JJIA 2KWIA 2RMKA 2ZJAA 1G8PA 3A4NA 3H0KA 4FCTA 4JLAA 4UNNA 1ZCBA 4TLDA 5E7JA 6Q21A 2FZ4A 4R98A 1KKMA 1Q1BA 3F5FA 2AD5A 3IO3A 5E3HA 1H8HD 2J59A 1OKKA 4CT4B 4XD7A 2OLJA 2KBEA 1XJQA 3LBNA 4YQFA 4LDJA 1CBUA 2H7VA 2TMKA 1GNRA 2IYWA 1KHTA 1QVAA 4LX0A 3REFA 3H84A 3MFYA 1S1CA 2BBOA 1KI7A 1YKSA 2GTPA 2JLZA 3LVRE 3U7GA 2RGDA 1AS0A 5K8UA 4ELDA 3R7WB 3ASZA 1BOFA 3WRYC 2QE7A 2ZJBA 1DADA 1H65A 2OM2A 1G5TA 2OFOA 1ZNXA 2F1RA 4HDCA 4J0QA 4PQFA 3WP0A 4Q00A 3AKDA 3EZ2A 4A1FA 3KQHA 1U90A 1UKZA 3KFXA 1VTKA 3O8DA 3N70A 3TKLA 2FDCA 2IYQA 2QROA 3QI2A 5FBWB 1NP6A 2J1LA 3ETLA 1E32A 4I4LA 4KAXA 4LJ8A 3U3OA 5LD2B 1E2KA 3UG6A 4OBEA 2VYFA 3VNUA 1X8KA 5JECA 1KMHB 2CK3A 1XZPA 2PZEA 5CYOA 3TAHA 4GZLA 2BJVA 4TLEA 4D26A 1MR3F 4A8JA 1JR3E 1Z83A 2YOGA 2X2EA 2I1QA 3QPWA 4RZUA 1SXJE 1DO0A 5DISB 3RS4A 3EC1A 5TARA 3TBKA 3UWOA 4DLTA 4RFSB 3U5ZB 3DEFA 1XEXA 4MYTA 2XCMC 1OH7A 1I2DA 1DTSA 4M2LA 2NPFA 1VYTA 4IKEA 4UJ5A 1L7VC 1KNXA 4PC2A 5GADl 3QBVA 1F2TB 2ZQ5A 3N3EA 4AY2A 2VP9A 2VPPA 4JKYA 3A6PC 2V7QA 4FD2A 5DS1A 1EWRA 3MWLA 2FSIA 3VQMA 2QPTA 5EP1A 3QXJA 3Q9QA 4LJ6A 2OILA 2B7CA 3ONWA 3B1ZA 3LD9A 3SFZA 4DRZA 2H18A 4UNQA 2AWNA 2C8VA 4FW9A 3AVYA 1ZD8A 5HPYB 3DHWC 3Q8XB 2A7QA 4CEJA 1FQKA 2GZHA 2H1LA 2ZRKA 3B9PA 4P0TA 2QPAA 5J47A 2F3RA 2FZLA 4NYMQ 1KNQA 4ZO4A 4XWAA 4UNSA 2QQEA 3P27A 4PAQA 4Q4LA 4M1WA 1OE0A 2OAP1 2X1VA 3B8HA 3K0AB 2HXYA 3LO5A 4PFSA 3NH6A 2AXNA 3VQLA 4LBZA 3B1VA 1K6MA 5JI3E 2ZI7A 1R2QA 4A15A 4Q7KA 1Q1EA 4NL4H 3MCAA 1WP9A 2PLRA 2CJWA 1AKYA 1VG0B 3DDCA 4PR0A 4XJXA 1MO6A 1F6BA 1OW3B 4FWTA 2XTZA 1NF3A 2GEDA 1YQTA 3GFPA 3VU9B 3PUYA 1XMJA 2WJ5A 3KUCA 2A30A 4BLOA 5LPNA 4OHVA 4HLDA 4Z1MA 1KZGB 2K8QA 1Z06A 4V0MA 4V02A 4OL0A 3VU9A 4P3YA 2GJKA 4L5BA 4JT2A 3AUXA 1ESNA 2WKPA 3K09A 2QPOA 1SKYE 2EYUA 4FCWA 4FWIB 2RCNA 3C14C 1VCOA 3H1TA 4HB4A 1DAFA 4WVFA 1Q3HA 3EARA 4DEXA 2WVJA 2O8BA 2IF2A 1EG7A 1Q12A 1ZJ6A 4DDVA 5JHHB 2CCGA 1OXSC 3IILA 2ZRIA 4H9GA 4M1YA 2OLKA 2YV5A 2V9PA 1GL9B 1XPUA 1QHYA 1TQDA 2WOJA 1COWA 3W3AA 4F91B 2C04A 3M0EA 1NMZA 1AS3A 4LJ7A 2X2FA 5KDOA 1YVDA 2ZM5A 3PJRA 4KV9A 1UF9A 1G6HA 3O8BA 2EWWA 1XMSA 2VBCA 1TTTA 1S96A 3SI7A 3TQFA 1IJEA 2ZRHA 2QQ0A 3FGNA 1OFTA 3SHWA 4EFMA 3E70C 4NHOA 2E87A 5BN3A 1FP6A 2GILA 4LPSA 4GZMA 3K9LA 4W9MC 1GZSA 1N5IA 1FNMA 1DE0A 3K0FA 4C30A 4LHXA 4FMDF 4A2PA 1XPRA 2HF8A 1C1YA 1PZNA 4KITB 4LI0A 5TY0A 4HUTA 3MJHA 2YWFA 3Q5EA 1Z6GA 2WJ7A 3L0OA 3CIOA 2FF7A 3C15C 4MA4A 1Q21A 4WZBE 2VF7A 1CJTC 2XXAA 1Z5ZA 1E9SA 1IQPA 5FBVB 3LXXA 4EPTA 1KI6A 2XB4A 3NC1C 5BWMA 1FL9A 2QU8A 4DBLC 3EPKA 4E5UA 3Q3JB 2HLDA 1F2UA 3SYLA 1G20E 2SHKA 2KJQA 4HUQA 1M34E 1RFLA 2WWYA 3CLVA 4NCKA 4MKHA 3K70C 2ZRPA 1TNDA 1Q57A 3FYHA 4NBSA 2ODEA 1KJYA 2GWHA 2N1BA 2REBA 3CO5A 1KOFA 1R8QA 3W8NA 2QI9C 4BFXA 3PUWA 3TW4A 1FZQA 2F3TA 4PO1A 1P2TA 4A8JB 1KJZA 1E69A 4IOLA 4TZ6A 4M9QA 4IDQA 4HB2A 2Q0HA 1W46A 4NYMR 3UMSA 2VHJA 1P9NA 1WRBA 3IHWA 2GEUA 1Z8FA 2GBLC 2WAYA 1D5CA 1JPJA 4ILEA 4YMWA 1VDZA 1G9XA 3H2YA 2ZR9A 2PT7A 3GLHA 4QGHA 3U3MA 5K8IA 3ZGXA 1BO6A 3GMTA 1XEWY 5SZKB 3T1OA 1MRNA 2GDJA 1E79A 2CCKA 1UBGA 1DAKA 3PIRA 5B2ZA 2O30A 4FMDB 1CP2A 2Q6TA 1ZU5A 3ECCA 1KI1A 4YXWD 2GZDA 1EFUA 4P4UA 2IEZA 3GJ5A 3FMIA 1GNQA 3NC0C 5FL7D 1SVWA 2WSSA 2Y8EA 3BGWA 3L2OB 4MKGA 4C4PA 4JT4A 3LX8A 4URXR 4CEHA 3GEHA 3CPJB 4MRPA 2FFAA 1E0KA 1XTQA 2QT0A 2ZAOA 4CEHB 4TN1A 3SFVA 1ZMXA 4HDQB 2HUPA 4K46A 4PHGA 4D4JA 4P4TA 3T61A 4V03A 1NJFA 1NBME 4HLCA 4AD8A 3AP2A 1RW4A 3AVQA 4LHZA 1F5NA 4QJ5A 5JMTA 3X1DA 1RJ9B 2ZAMA 2G9NA 4MRSA 4TL7A 5B30A 3IDQA 4DLSA 4Z1MD 1U99A 3GJ3A 1W47A 4ZDWA 1OYYA 2ZS8A 5CM9C 5TDHA 4EPWA 1Y63A 2A2ZA 3QSYA 2OZEA 4S35A 4QNMA 5JCPA 2J46A 1EFRA 1NI3A 1ODFA 2ZYTX 4B71A 1A1VA 3W6OA 1Z2AA 4PX9A 2ERXA 2QMEA 3NEYA 2CLSA 4LV8B 2WZQA 3FVQA 1KIMA 3LLUA 4MYCA 5IRCD 3P1JA 1N5KA 2J3EA 3AF2A 2YC2C 5FR1A 2CL6X 1SVKA 3RAPR 2WJIA 1KAGA 1P6XA 3W6NA 3AVXA 1SKQA 1H8ED 1XNJA 5DYIA 2D7CA 3R8CA 4UQOA 4NONA 1LW7A 2ZRCA 4R71A 1P61B 1LV7A 1WF3A 2G0TA 4PPNA 1TUIA 2IX3A 3GJ6A 4URVR 5FPKA 1II8B 1KK2A 4GL2A 4PSAA 5KSOA 3GLIE 2QTFA 5M04A 4R2IA 3EXAA 1KI4A 5EP4A 4ASUA 3VKGA 4P31A 2GZAA 1ZYUA 1GMEA 1F2TA 4XVQA 4US1R 2GCOB 3U3KA 8OHMA 4KODA 4QM6A 3GLGA 2N46A 2OFXA 4ZCMA 3K70D 1TQ6A 5CLLA 4L16A 5FBRB 1ZCAA 1VG1A 2ZJ2A 3IEUA 4GP6A 2EVWX 2QSZA 4Q1CA 4HDOB 3VKHA 4RD6A 1VYUA 1P2VA 4TSFA 1W44A 1ZUHA 4HZUB 1JALA 1YRBA 1OFIA 3MSXA 2VLIA 2D4HA 1G64A 1T0JB 3BERA 4RY2A 4A6PA 2ZR0A 4DZZA 4EQ6B 4P33A 3R9XA 1FX0B 2GXSA 3K0FB 2MSDB 3TQCA 4YMVA 3GP8A 2IEYA 2PT5A 2DR3A 3HU1A 3D7MA 3BORA 3WP1B 5C18A 5LBIA 4O25A 1N6KA 5AJVB 2WWFA 4CVNA 3T34A 3VAAA 3GJ7A 2CNWA 1S9HA 3DMNA 2G83A 4KO8A 3AVPA 2D06A 2O8DB 3I3SR 3NTUA 4DB2A 2ZSEA 3SYNA 2J0QA 1QDEA 4JBWA 1M8PA 4RJLA 3GPLA 1Z47A 3IPYA 4IEEA 3NDBB 1G291 1KO8A 1RZ3A 1X1RA 3KKOA 4MYHA 3QORA 4TZ0A 2HJGA 4YDZA 3L0IB 1QHXA 1Q1QA 4W5WA 1RL1A 3IPXA 4OHXA 4G5OA 4DCSA 1XMVA 4LV6A 1E99A 1DEKA 3QENA 1FNNA 1HE8B 2DCUA 4B3BA 2FH5B 1OH6A 3FPAA 5EUQB 3HP1A 2FGKA 3BE4A 4MGIR 1N3BA 2F9MA 2G77B 2IYSA 2WKQA 1S3SA 4M53A 5FOVA 2HCJB 3OESA 4OHWA 1XRJA 4ON9A 4N0EA 3TSZA 1JAIA 2Z4SA 1FTNA 3QBTA 3P4YA 3ZZUA 1HY3A 1KDPA 1A2KC 3K9HA 1BIFA 2O8BB 5L3QB 4Q1AA 2GK6A 3MWYW 2AR7A 1E2QA 4DSTA 1GSIA 3QKRB 2ANBA 4Q9KA 1VCMA 2ONJA 4B44A 5KNDA 5KPDA 3GLFA 4IVQA 5DE3A 2FE4A 5BXQC 3AUYA 1IJFA 4MJHA 2NZ8A 4K81B 3DO6A 2XJ4A 4JMPA 1D9XA 4MGYR 1VPLA 1N6RA 3NEJA 1XXHA 2DBYA 5HKKD 5EXTA 2Q9BA 2IYVA 4RSGA 3C4JA 1P72A 4H1VA 4OJKA 5B64A 4GMDA 3CR8A 4EKDA 1N6IA 3REGA 2N0KA 1E98A 1IY0A 4DXAA 4F4IA 3QIAA 5C4MA 1AS2A 4Q1DA 4RD1A 1EFCA 2GCNA 5FBLB 5BYKA 3FTQA 1HV8A 1G8HA 1UEJA 4A0RA 1GUAA 1M2OB 3K1JA 4HZUA 5KU1A 2XZPA 3I61A 3K0EA 1DARA 3THWB 5BN5A 2CR0A 4PPFA 4FCVA 4LCBA 5JWHA 3SBEA 2G0NA 2PZGA 3RLFA 5HR5A 1CEEA 3P26A 1LY1A 2OAQ1 3CBQA 2WTUA 2CVHA 2IC5A 4KBFA 5FOUA 2Q3HA 1E1RD 2P5SA 3SE0A 1OSNA 3S1AB 4PC3A 1NVVQ 2PCLA 1P75A 1DPFA 3FKQA 2P67A 1Z0KA 2ZI6A 2IXEA 2GHIA 2ZJ8A 3Q72A 4I81A 3K70B 1N6NA 1G5PA 2FJUA 1TU3A 3T1TA 1CKEA 4OQFA 4II7A 3M4YA 2OE2A 2ZI5A 4X8HA 5K8LA 2EFEB 3GEIA 5D3QA 3NWJA 1KI8A 4L8GA 3QXXA 3WHLA 4DSUA 2ZROA 4NU0A 4TLAA 4LZZA 3BAFA 3ZH9B 2ZUBA 2ZEJA 3GLFE 4XVUA 4JS0A 5FOSA 3NH9A 3A1WA 2IUSA 4DLRA 1E9CA 4EAQA 2P6NA 4TMZA 1E1QA 1FMLA 3BXZA 4G5RA 5H68A 5FUXA 3O47A 4PC7A 4A0GA 1Z0AA 4LC0A 4ZCIA 1ZD1A 4BRUA 2PLFA 2V54A 3X1WA 2ECKA 4M9ZA 3AP1A 4B48A 2AD1A 4TQUS 1NLYA 4TMXA 1LB1B 2FFQA 1EX7A 1FUKA 1UEIA 3VR1A 1KSJA 1ZAKA 1YZLA 3CF2A 2IS4A 4RZXA 1DAIA 1J90A 1NBMD 2BVNA 2WJYA 3L0SA 4NYIQ 3FDIA 2J0UA 2VHTA 3T1VA 3FB4A 4PPGA 1LVGA 4R7ZA 4TL6A 1E2FA 4M1TA 5AJXA 2FEMA 5J4HA 5C2JB 1DG3A 2ERYA 3EWSA 4E03A 4PQRA 2C9OA 1T5LA 1ZM7A 521PA 2KE5A 1E9BA 4CEJB 3CRMA 4DUGA 4QGFA 3NHAA 2AL7A 3OIUA 3KQNA 2HJVA 1HYQA 1VECA 2GJSA 3LBHA 5ANRB 1N5LA 2Q3FA 4Q7LA 2D2EA 1M1YE 4Q21A 1JXOA 2KI5A 3CRW1 2ATVA 3LVQE 1G4AE 4RZKA 4KBGA 2QMOA 3U60B 1G18A 1BH2A 2YHSA 1WGVA 3OHMA 4M22A 1JR3D 3WNBA 1TL7C 3RSLA 421PA 3BD9A 3ZVRA 2QBYB 3PFIA 2O8CB 2VSOA 3MAAC 2FPKA 2AN9A 2F1HA 1E9DA 2YWGA 4IVRA 3U4QA 4DJTA 1FUUA 2GXAA 1DAEA 5JZVA 3RDPA 1EFRD 1PV4A 2HDNB 4ABYA 4AKHA 5JWOA 2A5JA 5KSYA 1VHLA 1CR1A 4WZAE 5B57C 2JLRA 1II8A 1ZUNB 4K8OA 4MUAA 1SHKA 2BMJA 3U2QA 3OIYA 2V55B 1LNZA 2R9VA 5F3WB 2KMWA 3KKMA 5E95A 3QG5A 3FHOA 2MMCA 3U3JA 3GLGE 2EFGA 5AR1A 1NVVR 2C77A 4HLUC 2Q9CA 1KSFX 1X86B 1DBSA 3DM5A 1NNEA 5IF9A 3THXA 3T12A 4N0DA 4B73A 4XWKA 1A7JA 1I4LD 4CGZA 2R65A 3MUFA 4GRAA 5AJYA 4DB4A 1SXJA 3KXKA 4IJMA 2BJWA 4EPXA 1JQJC 5FOXA 2V4ZA 1ZM9A 3FHCB 4UXHA 2CHVA 3IGFA 3Q85A 1N2CE 4OKSA 2ZRAA 1T8UA 1XF9A 2JGNA 4RCZA 3RS3A 3X1YA 3WYFA 4OJQA 4LJ4A 1AZTA 3ZD7A 1G3IA 2AX4A 2LKDA 3BK7A 4A8JC 4EQ6A 5AK0A 1W4CA 4X8LA 1GKUB 3TUZC 3CUEF 2ZJOA 3BC1A 1G3UA 5EUMA 3CONA 4Q9LA 1E4VA 1ZP6A 1KI6B 3LAWA 4IDHA 4D81A 3LW8A 3EIEA 1E2GA 4B75A 4OI2A 4QKQA 2ZYVX 4B6EA 3WYGA 1TF2A 1IXRC 3BFXA 2XOKD 1GAJA 3CB4A 5CB8A 5LUMA 4LGMA 3W8RA 1UPTA 1W36D 3LX5A 3ZQJA 2I3BA 1AGPA 1DAHA 4NMMA 1WDTA 4NYIR 1QHGA 1TU4A 1W4BA 3CPEA 2VRWA 1RRGA 3WY9A 3EZ9A 3T35A 4URZR 4DDWA 2YWHA 3CWQA 4NCIA 4MQBA 1MOZA 3MG9A 5CJ2A 5DI9A 5JS8A 5G41A 1L4YA 1BMFA 2RGNC 3NVAA 4YMSA 3TLXA 2IXFA 3KTAA 4FIDA 3GLAA 3B1XA 5AUOB 2CBZA 3C8UA 3I73A 3C16C 4JUTA 4RCYA 4LC1A 1US8A 4NYJQ 2RHDA 2V8OA 3QVVA 2ZXUA 4PAMA 3N5CA 4V0OA 3GLFB 4FMCB 4GFDA 1U8AA 3PVSA 1DELA 2C03A 2QSYA 3T5GA 1M74A 3SJAA 5DI3B 2BKUA 3G82C 3WRXC 1N0WA 2GA8A 4R9UC 3D8BA 5DI3A 4G5SA 3ZS9A 4BWYA 5CIQA 1KO1A 4QG7A 2PEZA 1OJLA 3CZQA 3SDZA 4HAYA 4MRRA 3KJIA 3RRNA 3BB1A 4GSYA 1JQLB 2OCPA 5CJPA 4EPVA 2HYIC 4IHQA 2QTHA 5DHFA 2IBMA 4A36A 4Q4JA 1OH8A 4MGKR 5KTYA 4ZI3A 4Z8YA 1Z28A 1T0HB 2XAUA 5FPTA 2OEPA 2QGNA 1G21E 2GAOA 2OCYC 1KMHA 3C7KA 1EJFA 4KFTA 3EZFA 2Z83A 4MKIA 4AG6A 1Z6TA 1WA5A 3AVVA 2FSHA 3THYA 4KSCA 4KYUA 4AYWA 1MKYA 1NN0A 4BFTA 2IYXA 4Z8XA 2IWHA 4QGAA 4TMVA 1KDTA 4XIGS 1G17A 1CU1A 3EA5A 1GKYA 3VHLB 3ZVLA 3ZLJA 1NVWQ 5JHGB 5JJLA 2FNAA 4M1MA 1XTJA 4LUCA 2NO0A 4RVCA 5B58C 5JFGA 5D3MA 3ZZTA 1G7RA 1J70A 1MO3A 2FSFA 1Q3TA 3B13B 1XEFA 4H1UA 5SZJA 5A4JA 1YR8A 721PA 2XTNA 1QF9A 4BLTA 2YOHA 1W4RA 1NKTA 1IN7A 3VR2A 1TMKA 2F55A 1KO7A 1YZUA 1E0AA 3TR5A 1HURA 4QHYA 2R6FA 4P32A 1KK3A 1US8B 1N6HA 3HJNA 2A5FA 3TW8B 2A9KA 5JWRA 3VFDA 1E1QD 3C41J 3KQLA 5BQ5A 2PH1A 5CB6A 5HZHA 2WV9A 1P2UA 3HPQA 1WE2A 4P4SB 1KDRA 1OHHA 1XJCA 5EZ6B 2VP5A 5CLQA 4LBWA 2CLCX 4TL8A 1JI0A 5H1YA 2H57A 1XEXB 1RYHA 3KKNA 4M5SA 1IOZA 1IAQA 4YMUA 4JLPA 1XU4A 4CIDA 1E2EA 3RS5A 4B34A 2G1KA 2NTYC 1Z0FA 3QOFA 1KDOA 3U61B 2JJ1D 4DDUA 2NMVA 4JVMA 3FOZA 2DFTA 2W0SA 1IM2A 2C2HA 2J87A 3PV0A 3TVDA 2JJ8A 4OQLA 4U00A 1VMAA 4B43A 2IYUA 1CLUA 2BBTA 3A58B 3GCGA 1E2JA 5J4YA 1KMQA 2F43B 4DC9A 3KB2A 1GDDA 2W0MA 1TAGA 2J0UB 5EE9A 3AKCA 2QE7D 3ZIAA 1CR0A 2KBFA 5L3VA 2AFIE 2BOLA 4B47A 1ZM4A 1IXSB 2REOA 4IOKA 1CRQA 4M8NE 2F1IA 1IHUA 2F6RA 3BFKA 4UNPA 2BM0A 1UAAA 3AVTA 3EW9A 1DVRA 1YR9A 4AKIA 3KJHA 4A2QA 3SEAA 1T3LA 1N6PA 4JLBA 5DH9A 5J5CA 3UMFA 4CZ2A 1NIPA 1QVRA 2ZYWX 3SJZA 3I5YA 1BKDR 5JCZA 1IN6A 1P4SA 4EDHA 5KNBA 2ZSBA 3K53A 4B33A 2KSQA 3ADKA 4JVLA 2C9YA 3GJ0A 1SHZA 2YVUA 1XTSA 1LF0A 4AC9A 4OHYA 4QNRA 1IONA 4XTCS 1R7RA 3CNOA 5FL3A 1ZM2A 2ZS7A 3OF5A 2JLWA 3ND9A 2DWOA 1IY2A 1R8SA 4B3FX 4I88A 2OSBA 1OIVA 4A82A 2E9SA 4ZCLA 2GVZC 4BE7B 1V5WA 3LDAA 2BDTA 2QRNA 3U4QB 4FEIA 3TIFA 2DB3A 3AGPA 5AJWA 2B21A 1R6BX 4MDEA 2VH5R 3K9GA 2ZJ5A 4N3NA 2RAPA 4U7DA 2J0VA 2HT1A 4AI6A 2DFLA 1ZUIA 2RGGA 4QRHA 4BLRA 4LJ5A 1U9IA 3J81k 3SU8A 3MLEA 1VHTA 3TE6A 2PX0A 3QNUA 4C0SA 2FFBA 1T6NA 1R5NA 1SXJD 1XXHB 1GRNA 2IYLD 2RH5A 1F2UB 1RRCA 1GRRA 3PEUA 3IUYA 3Q9PA 2JEOA 2QM8A 2X77A 3GLHB 5TXGA 3B6EA 3U44B 1N6OA 3KXIA 2GJAA 1PLJA 1G4UR 2F43A 5FUVA 4EJSC 4QGGA 4PZLA 4DCTA 4NTZA 3NHBA 3RNLA 4KJZA 5CDFA 1ONBA 4DLYA 3PR1A 2R6DA 1SZPA 2AFHE 1TPZA 3A1UA 1CR4A 4JZKA 4B2LA 3BFVA 2ZRJA 3TSOA 4Q48A 3CF0A 2AKYA 3WMFA 5AJZA 3B9QA 1E9EA 2JLQA 2R44A 1OIWA 2VL7A 3ICEA 4JLVA 2W2VA 1MO5A 1B0UA 3VR4A 3OAAD 3EPHA 2RGXA 4ZDKA 1XFAA 4DCNA 4Q66C 3GEEA 2FOLA 2JLSA 4OK3A 2ZE7A 4OQNA 5FTNA 1GTVA 1R0XA 4QBFA 1S1MA 1Q0UA 1WCV1 5IHPA 5C1BA 4WXRA 2X8AA 3QF7A 5TV2A 3T06B 4OQMA 4DT1B 2G88A 1J7KA 1JNYA 2YOFA 2QP4A 4MRNA 4TYYA 1HH4A 1O87A 2ZRGA 1AQUA 3LW7A 4WOPA 4B3XA 2XOKA 3B2EA 3AKYA 2JLUA 3VHXA 3QE0A 2C78A 2BMEA 3L82B 4W5JA 2ZVPX 3CNNA 1KI9A 1NN5A 3AH8A 1U81A 2QUZA 2ZYUX 3AABA 4DDTA 1NL3A 4D0GA 1U0LA 2F1JA 1HQYE 4BZQA 1G16A 5DN6D 4D0NA 1E3MA 5L8VA 2CLDX 3A1TA 4PCKA 3LLMA 1KGDA 3SYKA 2CG9X 4NYJR 5E7IA 4ESVA 4EPYA 1QHHB 3I62A 2C5LA 4FXPA 4GOJA 5DGXA 3VR5A 4O2LA 3ICQB 3ADDA 4QFMA 4QXAA 5GJCA 3ADCA 1OF1A 5DN6A 1W2GA 1NJGA 4Q4AB 3PG5A 2W2XA 5ELXA 2O8FB 2FU5C 1L8QA 1WMSA 2PZFA 4JLDA 4LY6A 2ASEA 1XD8A 2G3YA 2XB2A 2BMFA 3ZZ0A 2GCPA 3DVLA 1SHSA 1Q22A 3KKPA 5BW8A 2R8RA 4JLKA 4AURA 5FUWA 1OH5A 2GCOA 1DG1G 3FKSA 4B6FA 1XXHE 4BZXA 1QG4A 3SN6A 2OBLA 1E9AA 2ORWA 2FGJA 4NP6A 1R0WA 3QORD 4Q9JA 2HLDD 5HZKA 1IN5A 3V4RA 4QOSA 4XSHA 2P0EA 4G3XA 4ACBA 5FH9A 3NBXX 2QAGC 2VHQA 2WBLC 4OK6A 1YE8A 2YNMA 1N0UA 3OE7D 2MSEB 4KLZA 4PHHA 4PZZA 1ZM3A 4B3DA 2CNWD 2WOOA 1HA3A 2IL1A 4BZPA 3TSWA 3EIQA 3Q9LA 5GVRA 4OHZA 3UMRA 4D4MA 2YJTD 1VIAA 1FOEB 1Z29A 2IS6A 1G3RA 4Q4HA 4A4DA 2XXAB 2ZITA 1NY5A 2O0HA 2NO1A 1Z0DA 1GG2A 3C5CA 4BLSA 3TH5A 4M1KA 1ZNYA 3RS2A 3V4FA 4CF7A 2BC9A 2R6GA 2FA9A 1OT3A 1Q1ZA 3TK1A 4BFZA 1X6VA 4V0ME 1DO2A 1LF5A 4LBVA 5FTLA 5KSPA 2O8CA 4L9SA 5KPJA 4OI1A 5KDLA 1FQJA 2ORVA 3CH5A 1X1SA 5JEEA 4G5QA 1ZIPA 5A5GA 4ZDJA 3UPUA 2OBMA 1G6OA 4G5GA 5FTJA 4RZ3A 5H70A 4FINA 4B2IA 4TSFD 1CRPA 1XD2A 4URYR 4F7WA 1ESMA 3R8FA 3IBGA 4GI7A 1Z6YA 1ZNZA 2OHFA 3L8YA 2HXSA 1NLFA 2JKIS 2W6JA 3B85A 2REXB 4JUSA 3K8YA 4CW7A 5KUTA 1NMYA 1YRAA 1A5TA 4B32A 1OYWA 2IF0A 4BQSA 4UNRA 4URWR 1F60A 2O52A 2W2TA 1IXZA 3BOSA 3NDPA 4Q19A 3GLIB 4CRWB 5BN4A 4MDFA 2BOVA 4PBDA 3A4MA 2C96A 4TYPA 1G41A 1SVLA 2VHUA 2W6JD 4GOKA 3HU2A 3H4MA 4D2IA 2XEXA 1P62B 1GL6A 3AB3A 2FFHA 4C7OA 4IDNA 2D3WA 3CM0A 3IIKA 4M5TA 1FX0A 4PXAA 5EP2A 3B78A 4HSEA 3U7HB 5F9FA 1NY6A 2B6HA 1ETUA 1P3JA 2YINC 3QXCA 4QBHA 4DUGD 5LD2C 4HB3A 4PHFA 3U7FB 1I4TD 2VP0A 1TADA 3OEEA 3SR0A 3KZ1E 3TUJC 2ZI3A 1YZQA 4DLWA 4R2HA 2P6UA 3UXMA 1OPXA 4WAUA 1N0VC 4I1VA 4LYHA 4LV5B 3FFBA 2P6RA 4Y0VA 3QXHA 4W5HA 4IFEA 4DLVA 1G7TA 5AWFC 4JSTA 2UZIR 2BM1A 3MWKA 4PSKA 1W1WA 1JEEA 5TMPA 3OE7A 2QBYA 4Q9IA 1L2TA 4ARZA 1S9DA 4UXIA 5HE9A 4JLNA 2OXRA 3B5JA 3H86A 3KTAB 1CJMA 4F92B 3L1FA 2OUKA 4KFSA 3GJ8A 1II0A 2WSSD 3QXSA 2JCSA 3UANA 4AWXA 2QM7A 1U0HC 3IQXA 1RIFA 1NLZA 4KFRA 5K8TA 1DOAA 1J99A 1XX6A 2FEOA 2IWRA 4ZDIA 2WSMA 1PJRA 4P4SA 3AEZA 1E6CA 1NBMA 4CYMA 3CKLA 3MGCA 2OT3B 4RKEA 4BASA 3V9PA 4IDPA 1U2RA 2FV8A 3RABA 4PO9A 2QMUA 2WIAA 2BCGY 1AIPA 1ZNWA 1WB9A 1ZW6A 3A4LA 4Q47A 4D0LB 2B8TA 1XTIA 1EFTA 3ASYA 1WBDA 821PA 5JS7A 2UVQA 1KYIA 4MGZR 2A3RA 1TF7A 2QAGA 4M21A 1BS1A 1CJUC 3ADBA 4AG5A 4Y0AA 3U3RA 3WNDA 1QHNA 5EE1A 1IBRA 1XCMA 2X19A 3LFUA 2VP6A 2PEYA 4IOJA 2B8WA 5G40A 5HTKA 1SXJB 3VQTA 4BECA 5F98A 121PA 2JDIA 5L3RA 2WJGA 3SZRA 1VIYA 4DLZA 2W83A 3L1GA 3GFOA 1SKYB 3VTKA 1ZBDA 3B82A 1Z2CA 4LJYA 2PL3A 1WBBA 4KFUA 1ZIOA 4M9XA 3Q7QA 3SJCA 5AUPB 1W36B 1HT1E 1GOTA 2QA5A 4EJSB 3OEHD 3EC2A 4FMBB 2Z43A 5IT5A 1KSGA 4QC2A 3TRFA 5KSZA 2ZU6A 1G8YA 3DPUA 4LOAA 1RVDA 3CX6A 1T9HA 2XZOA 4YDHB 1CJVC 2QMHA 4YLBA 4WIAA 2GAAA 2IYZA 3CNLA 4JLJA 4M1OA 3ND8A 3AVOA 2O8EA 3QG1A 1G1MA 2QZ4A 2ZJZA 3UKDA 3HYTA 1GP2A 2V6JA 3A37A 2ZE5A 5HCNA 1E2LA 1AKEA 1U94A 1DAGA 3U6KA 1NVUQ 3BH7A 3Q5DA 2D2FA 4HAZA 2CJWB 3DOEA 1FFHA 4TQ9A 1FPMA 5IK2D 1A4RA 4PSVA 2HF9A 4LRWA 3E1SA 3EZ6A 3EX7C 1XDBA 3CW2A 4TLCA 2GEVA 3OZXA 1S4QA 5EJEA 3PEVA 2PX3A 1Z6XA 3MRSA 1BMFD 3R20A 4KVAA 4M9SA 2F9LA 5HE8A 5FTMA 1PLLA 3RHFA 1VG8A 1BYIA 2JAQA 2GVDC 4PANA 1LTQA 4NKRA 3R9WA 3TGPA 3KL4A 1G7SA 4DLUA 4D80A 2YZ2A 3L0PA 4BFVA 4BFSA 1OXVA 1OFUX 4LYJA 4XTRA 1YR6A 3W5IA 2RGBA 3GT6A 5FBQB 4FMCF 4KHZA 4ZIRB 4TMKA 3EAQA 1GILA 3PUZA 3LNCA 3QKSB 3CWZA 4I99A 4DCUA 2GRJA 2DWQA 4BGDA 4JL5A 3FWYA 1EESA 1NKSA 4ACAA 1I2MA 2NPIA 1Z07A 3NBZC 4OQXA 2WICA 5C4GB 4HB0A 4D4KA 4HAWA 4JLOA 4PQYA 4JYCA 1GRQA 4GMXA 4D6PA 1S0UA 1O3YA 2R62A 1F3OA 3HU3A 2J7PA 4C3ZA 1A82A 3IBYA 1EFHA 3BIFA 1S3GA 5JLJA 1F48A 1M7HA 3CRQA 3RWOA 4AKGA 1ZRHA 3PXGA 1Z63A 3LA6A 2ZRNA 2CCJA 2JDID 4XOIA 3CH4B 1UBEA 5FPHA 3W3ZB 2ZI9A 5P21A 4QM7A 4F38A 1AA9A 1HTWA 2Q9AA 3T5DA 2ZETA 1CF4A 1T8TA 3NXSA 3AKEA 3OAAA 1XZQA 2DPXA 5JI2E 5CIWA 1P73A 2WJHA 4LK2A 4NCHA 3PQCA 5L3SA 1E2DA 2IA5A 1N5JA 2V6IA 2CMKA 2NIPA 1NRJB 4L15A 4RD0A 1LS1A 3X1ZA 3TAUA 1T3SA 1JXMA 2C99A 4V0NA 3WHKA 4JJZA 1PVOA 2ZU0C 1W0KA 1CIPA 3FMFA 1C4OA 4IEIA 1A2BA 1P9WA 1JR6A 4YLGA 2AK3A 2HEIA 4B3CA 3BWDD 3QJYA 1GNPA 1NN1A 3GQBA 3MD0A 3SHFA 4DSNA 2XSZD 2BBSA 2E1RA 3ZVMA 5FTKA 3F8TA 1L4UA 1HQCA 1J8MF 3JZAA 1OXTA 3RC3A 2KB0A 2D74A 4AYTA 2ZANA 4QBIA 3VKWA 4TT3A 4ZI2A 3G5UA 5AUNB 3QEOA 4Q03A 3IIJA 4LHVA 1KJWA 4BFYA 4BPBA 1M6NA 2BIFA 3Q7PA 1ZU4A 1V43A 3DL0A 3DM9B 4IRUB 5DO9A 1JBKA 3U44A 1XD2B 2RKOA 3ZS8A 4ZIRA 1JECA 2N42A 3CPHA 4C0HA 1EK0A 1K5GA 1XBTA 1JJVA 2VSXA 2GK7A 5CK4A 1FW6A 2EYQA 2CE7A 1GWNA 2FG5A 4G0NA 4EIWA 2ZRMA 4F93B 2G1JA 3GD7A 4D4LA 1ZINA 3G0HA 1T5IA 5JSZA 3RRZA 4M1SA 3M6AA 5TVKA 4IW3B 2JLYA 3TUIC 3I5XA 1MO4A 2RGAA 4LJAA 2NOAA 4Q1FA 4GPTA 1OV4A 3PCRB 3OEED 3OIVA 4Z54A 1E1RA 2YWEA 1SVSA 3QY0A 4GP7A 3K0CC 1SVOA 3SS8A 3MWJA 2GXUA 1MT0A 4V0LA 2GBLA 3GFTA 3VMFA 5EXPA 5IDVA 2OCAA 4YDSA 3K0AA 3R9IA 3ZYCA 4Q7MB 3DZ8A 1PLKA 4YXWA 3IEVA 2PMDA 2D7DA 2WWHA 3BRWD 4US2R 4DT1A 4N1AA 1E9FA 1KY3A 4S2EA 2Z4RA 1UADA 3B60A 3LY5A 3IKJA 4BFUA 1B23P 4O3MA 1KI2A 3N2IA 3NKVA 5FI0B 4GNKA 1HT2E 3I4LA 4PHTA 5HCIA 3P32A 2FN4A 1Y3AA 1YJ5A 2IUTA 4JKIA 4O0MA 3CRRA 4A6XA 2QY9A 3AF0A 1NG9A 1YZKA 2JA1A 5KNCA 4I1OA 1AN0A 4U02A 1NG1A 4E22A 4LSGA 2JIZA 4Q1BA 3WMGA 4HAVA 1VCNA 2VA8A 3DKPA 2BV3A 4Q9HA 3RYTC 5GJWC 3KB1A 3JVVA 2QN6A 5EE0A 3TNFA 4PTLA 3A8TA 4YONB 3KJGA 1HE1C 3FE2A 1Z0IA 1UBFA 1ELOA 1Z22A 3HDTA 4NZYA 4KXFB 4IFBA 3ZVNA 1OHHD 3THOA 4DWJA 1XB2A 1SULA 3IIMA 3L8ZA 1BYUA 1Z08A 2A5GA 4JBYA 4NCJA 1KTVA 1KKLA 3FFAA 3M1IA 3KQUA 1Z0JA 3JZMA 4NH0A 4B35A 5G3ZA 1EGAA 1D2EA 4JBXA 3QORB 2WPDD 1AZSC 4KLNA 1G8FA 2EFCB 4TT3D 4DIDA 1G3QA 1R5BA 3ZDQA 2JJ1A 2LWIA 1JR3A 3D3QA 3QPVA 2Z6VA 4PAOA 4PPQA 3K0SA 1OXUA 1RRFA 1J2JA 4OI0A 1X5MA 4Q4AA 4TMTA 4QL3A 3A36A 4NPHA 2N3JA 1UM8A 2AKAB 2P65A 3FKSD 3HR8A 5EXXA 4AIIA 3U6BA 1J8YF 1KY2A 3UG7A 4KCGA 1R4AA 4F4JA 4B2PA 3A1SA 4ZPXA 5DHAA 4JL6A 3NBFA 4L4UA 4LPKA 1KAOA 4A2WA 3AP3A 1W36C 1H8EA 2PJZA 5AUQA 4TYNA 2A5YB 3EPJA 5LB4A 2DWPA 2H17A 1X8JA 5DYGA 1OLOA 4HAUA 1QZXA 4TTPA 3SBDA 3PEYA 2Y1YA 221PA 1E0SA 1GVNB 2VP4A 3WXMA 1NSFA 4L9WA 3TVTA 4QBGB 3V00A 3DOFA 2JLVA 4Q4HB 1P7CA 1W0JD 3BB4A 5DSZA 4DCVA 4HLQB 2WWXA 2RHMA 1E2HA 3EPLA 3AQ4A 4CEIB 2I1VB 4JVNA 4C0BA 2YKGA 1E2PA 4HUQB 1P2SA 1CXZA 5E7MA 2O8EB 2J5XA 2BEKA 1KO4A 1JB1A 1I4DD 1MABB 3FMOB 4MITA 3B1WA 1KK0A 2IT1A 1CR2A 3IQWA 3L43A 2WMNB 1X3SA 1MABA 1LFDB 5LB2A 1TEXA 2IUUA 1AJEA 4OK5A 5KHOC 1SVIA 2ZR7A 5CM8B 3SC3A 2ZVQX 3BBPA 2Q21A 3B1YA 2DHRA 3I92A 3QUSA 2FX3A 3W5JA 4ASUD 4KU4A 2Z5FA 3CRVA 3QORC 3PEWA 1XJ0A 1TUEA 4Q02A 1XPOA 2LCFA 2QAGB 4JJKA 4HATA 3KQKA 1KI3A 5DS2A 4LBYA 4V0KA 4ESHA 2XJ9A 5F2EA 1E0JA 4C0AC 1JAHA 1QG2A 2IXGA 2ZUCA 4LYAA 4ITRC 4UKDA 3TR0A 3F0TA 2EWVA 4E09A 2IW3A 3AACA 1UDXA 2Z0MA 5J40A 1G7CA 2MMGA 2GNOA 1U0JA 2V1XA 5KYKA 1JJ7A 1S2MA 3QQ5A 5DIFA 4CDGA 2CEAA 2ZE8A 5TB5A 4E07A 2XZLA 4GOXA 4A0HA 1FP7A 4IDOA 3KX2A 2H92A 3PUVA 2HCBA 3T1QA 3MMPA 3LXRA 1YU9A 3OFND 4C0QC 3QF4A 2IYTA 1ANKA 1P5ZB 1R0ZA 3PITA 1G3MA 2QNRA 1G19A 2GF9A 2QAJA 4Q5IA 3ZIAD 3THWA 1XTKA 1XEWX 4POAA 5EE5B 2J45A 4X8OA 5SZIA 1RJ9A 4IVPA 4C0JA 5L3QA 1P9RA 3E2IA 4DIEA 3THYB 1Q44A 2EFHB 4CEIA 2C9CA 2WWGA 3BB3A 3RWMB 1Q20A 5J4VA 1YZNA 2J0SA 5CYPA 2J9RA 2XITA 5JEDA 4TMWA 1IY1A 4D25A 4AK9A 2RGCA 1XTRA 4NDZA 2JJ2D 1CULC 2ATXA 1WH0A 2ZI4A 2GKSA 2Y22A 1LS6A 4Q4JB 3KUDA 1RYFA 1SVMA 2QT1A 3W90A 3AF4A 3K9NA 2CVFA 5L3SB 2ODNA 2XNDA 2IK8A 4MRVA 4PC1A 5A0FA 2DY1A 2KLRA 2JJ2A 2CXXA 4AYXA 4BUJA 1E2NA 1W5TA 2ANCA 1XCGB 4US0R 3NBYC 4UJ3A 2OCBA 2F7SA 3S1AA 2WKRA 2ZJYA 4LHYA 2QORA 2QG6A 3EIHA 2QP9X 3AV0B 4TTQA 3UIEA 4C9BA 4XH9B 4Z51A 5FUYA 1R0YA 1KZ7B 2R6AA 3RRYA 4D82A 2ZRLA 1CJKC 1Z6AA 3KFVA 4Q18A 2CE2X 3QKTA 2FWRA 1W4AA 3QKSA 4DLXA 4YMTA 1OB2A 3SOPA 4KI0A 2HYDA 3LQQA 1W2HA 3OEHA 2GESA 4WA7A 2ZS9A 5GJVC 1AQYA 4LJ9A 2LKCA 4ZJ9A 3ZJYA 1UKVY 2J7KA 2BMDA 2C95A 2H16A 4MH0R 5CK5A 3WBKA 1OFHA 5EZ5A 2WMOB 5KDDA 2NGRA 4JVSB 2OV2A 3T15A 2B92A 2QP3A 1UBCA 2AHOA 3GLHE 4EPRA 4LWZA 4Q7JB 2YC4C 1FTSA 3CZPA 2QTVB 3I8SA 1X8LA 1E9RA 2BEJA 3OIWA 4PZYA 2ZTSA 2Y1ZA 4TWZA 3QKUA 4XSGA 3WBJA 3EWAA 3WMEA 2H8KA 3EG5A 5E4FA 1RC8A 1YZGA 1PUJA 3QEJA 1KK1A 1AGRA 2CHQA 4TTRA 5J4LA 1YHNA 3GLGB 2RGEA 1NMXA 3VX4A 1ZVQA 1E79D 3K0CA 5JRZA 3SQXA 2AWOA 2J41A 2XX3A 1OB5A 1UDWA 5D3MB 1T3HA 3LRPA 2DFKB 3BJIC 3K09C 2BWJA 1TF5A 3P4XA 3VR6A 3THXB 1XMIA 2GJ8A 3W6PA 1JEDA 2D62A 2VO1A 1UJ2A 2JATA 4O2RA 2WJVA 1C9KA 4HYYA 3RVBA 2BBWA 5HKKA 1N6LA 4C2UA 2PCJA 4RD3A 1XCPA 1D2NA 2IYYA 4B3GA 2WWWA 1UKEA 4C0KA 5JBQA 1GL7A 4BLQA 2OG2A 3SJBA 4HEJA 2ZIAA 4YL9A 1M7BA 2W00A 3F3YA 4TQAA 4EFLA 4Q1EA 2WAXA 1JPNA 1GITA 3AF3A 5FFMA 1D9ZA 2CL0X 1WXQA 1GIAA 4HLUA 1D2MA 2UZ3A 3LBIA 4M4SA 3UWKA 2CDNA 4FI3C 4AKEA 4DEYA 1GM5A 2UKDA 2PMKA 1HEIA 2J7PD 3R7WA 2VQSA
chains in the Genus database with same CATH superfamily
1L8AA 1URZA 4QRQA 2RKBA 5CCJA 4KSBA 2EC8A 5IOPB 1MFAL 2I60H 1Z74A 1JZHA 1EXMA 4DR6B 4RZ2A 1PJSA 4X8MA 1NXVA 3NM6B 1LO0H 3ZU8A 4DBVO 3LKPA 3MCKB 3QHZH 1WZCA 4Z7UB 3LWNA 1TPXB 4ZXBD 1JXAA 2PXYC 1A6TA 3ZQ6A 3VSEA 1I53A 3KVOA 1LU9A 4CKWA 3RYIB 1QHSA 5FR2A 2ERJC 2AP2A 4Z86A 5FO1A 4ZZ2A 2EXWC 1RJLB 4ENED 3ZZSA 2EKSB 2Y25A 3T1YB 3GUYA 1BW9B 1PLGL 5TVGA 4QREA 2W9DH 3O31A 3H5TA 5AK6A 3O2WL 1YASA 5D5MF 4JEHA 2GCYB 4LRNH 4BB5A 5JYLA 4CNBA 2WQSA 5ANMB 3TQIA 1KOJA 2I85A 4RMTA 1JDBC 2E4FA 1DBAH 1LWJA 4N90E 5M3BA 2VP2A 3VNVA 1A9YA 4DHEA 4W9ZA 1Z3IX 2JEYA 3S55A 5DYWA 5HCUA 5G02A 2EQBA 2YQZA 2YAHA 3MXWH 4Q3NA 4KE9A 4YSRA 3ESMA 5FUCE 2CNKA 4I1SA 1DVSA 5D93C 4BO0A 4ZK8A 5CN1A 5BYJA 1YZZA 3QULB 1LDPL 3U4AA 4ARSA 1EEXB 4HV8A 5DRYA 4MR7B 2OXCA 3IMFA 1ETZA 3VU1A 2XH8A 4DTGH 3M5WA 1NDGB 5IROA 3A10A 4U6NA 4C7OB 1H3FA 3TW8A 2HU2A 2R1TB 2ZJFA 4AQEA 3HWSA 1MIOB 3V0IA 1TQ4A 1WSDA 3M1AA 4GYYA 3CU7A 1RIUH 2B7DT 4AP5A 1MRZA 3DMRA 2BVPB 5KBMA 5F9OL 1NYLA 4Y6OA 2WXGA 3M4ZA 1Z2EA 4F20A 4LRTB 1OTSD 1FFSA 3PLYA 5JT1A 3MYYA 2VDKB 1G5RA 3HE7B 4ZQCB 2Z31A 3I9IA 2BCJQ 1I1FB 5AG9A 5ADWA 1YCDA 2WNSA 4IW4C 1P2CA 2GPAA 2X70A 2VEOA 3R5JA 4PG8A 2CLLB 4IDJH 5JOQA 4YR9A 1A8UA 3X2SA 1GL3A 5ICXA 3F7KA 2QRZA 4NZ9A 3RRMA 4A63A 5CFRA 3KXDA 4WVRA 3V6BR 4H7DA 5IC6A 5C0EA 1GGBL 1I8LA 4HJ0C 4BQRA 3HG1B 1GQSA 3STBA 3PAUA 1QEWA 3V4UL 2RGNA 4OA5A 5FLYA 2VQDA 4D9QE 2JH9A 3GMSA 4OYHA 4XPIB 4H4NA 4MQ5A 1IGCL 1UCTA 1RPTA 5IKMA 3FQUB 4P2RE 2DM6A 3KVDD 1UP4A 1Z75A 3B7SA 1RZVA 4Q39A 5HDQL 2MNWA 4UM9D 1CY6A 3FNEA 4CN1A 7CGTA 4LP8A 4XWGH 4DR4B 1I7SB 1WA2X 1XP8A 1W75A 5JW5A 5LQCA 3U1VA 1E4EB 2ZREA 2NO9A 2CK3D 1J4AA 3ONVA 4OCYH 1UXWA 3VZQA 1TO4A 2LVCA 4PMEA 1JG9A 5DQ9B 4QUDA 1NVGA 2KPWA 2WTAA 2RDMA 3CZAA 3QIUD 3OMZA 2NR6D 3T7AA 1OBHA 1LVEA 2ZSDA 4FCTA 1E2UA 4X7TB 1CGUA 4EKIA 3SPCA 2OUIA 1OKKA 1R5VB 3N9GL 3O8XA 2KBEA 4XNUL 1NMQA 1NUHA 1SYSB 4LDJA 4PRID 1X0XA 5HUHA 3U30B 4JL1A 1KHTA 2BPBA 4Z99A 3FT4B 1Z2NX 2D2CC 3S5LG 1CLYH 1L5WA 4N1CA 3P40A 4E12A 4H40A 3ZHQA 2WK2A 5FA3A 4ABUA 3BCUA 4ZT6A 2OFOA 5TDPB 3GAMA 3EXG2 3MLUH 3ZIUA 1UUNA 1KPUA 2W80C 1VE9A 1LPBB 5KC8A 1YB7A 3BZ4A 4B31A 3TTVA 2CK3A 1NCUA 3H7BB 3LP8A 1W87A 3SICE 1NUAA 1XKTA 2R1XB 5ALZA 1DO0A 1ABBA 1PEWA 4P2RD 3X11B 4YCAA 1QDUA 4H26A 4A8TA 3LT4A 4HOMA 1VYTA 3PVCA 5ELIA 1SBTA 4PCLA 3HE7A 3P0YH 3TIVA 2IUYA 2D3VA 4MW1A 3EXHC 3VYSB 3HM2A 2QPTA 2OSXA 4ZQKB 1G2IA 1A76A 3DNMA 2MCMA 1TEHA 4XYMA 5DLLA 5FYKH 2ZRKA 2QPAA 4AZ8B 3HG1A 4C78A 3HVDA 2X1VA 1CLYL 4UOZA 1C0PA 4PFSA 3IIEA 1V3KA 4QEGA 3ZWKA 5JD3A 4BFIA 2ZI7A 4OZ4A 2EDYA 1R2QA 2JLAA 4A15A 4EZLA 2BZ7A 1NPJA 1FFQA 1KC5L 1O94D 5KBDA 5FNVA 1AKYA 4FWTA 1CQYA 4BRSA 2PGNA 2JKTM 4NPCA 4XNMA 4PLYA 3KM2A 4BS9A 5JROA 3PDDA 2J3HA 3QQ4A 2O05A 4V0MA 4QAJA 1FCJA 1G7JB 3G7SA 2WUCH 3K8QA 4XXWC 4FCWA 3TG2A 3H9JA 1E7QA 3HFSA 3FGOA 4TLSA 2A2QT 2ZT9C 1EG7A 4F57L 3VGAC 1J5EB 2FMTA 2YV5A 4PXYA 4NZUH 3HBLA 2CJSA 3KPSA 4WH0A 3UOGA 1KAHA 5IDQA 2JANA 4PRZA 2ZF8A 1JEOA 1IDN1 3T1NA 1NGYB 3KALA 4Z7OE 1LX7A 4PCSA 4EG3A 5CP3A 1JXKA 3BH9A 3DEHA 2VUTA 4C22A 5HEKA 5FGCB 5FDFA 1JSLA 4WWHA 4LHXA 2VHEA 3SHSA 1NEZB 1M5RA 1I82A 4QFDA 4DJDC 1A6AA 1E9SA 3FPHA 3WWDA 1RAGA 3E61A 4HD9A 4MVJG 4WQMA 1B6TA 2ZWNA 5HP4A 1BQ5A 4NX2A 2RBGA 3KOMA 1IN1A 1Y3FE 3NGLA 4K3JH 2E4VA 4EMUA 5G55A 2GK3A 5IQ9A 5DM4A 1KB5A 1KPVB 2IWGA 1HZHH 4X61A 1KJYA 2IOIA 3WIEA 3HCEA 2A9DA 1LBQA 1NIEA 1FZQA 4OLAA 1JVOA 2R1YB 1EZUA 4E3WA 2G30A 3MM4A 3NHWA 2A9QA 4WUTA 3LC2O 4ILEA 3QU9A 2YD1A 3GRWL 4QT4A 5JALA 1LTXA 3PIRA 3ZBQA 1DZBA 1HHHB 4HUJA 3L17A 1G4HA 5ANMA 1KI1A 1HWGB 1ZTMA 2EAUA 4FR2A 3FZGA 3F73A 4UI2A 1DXYA 3BGWA 4CMIB 3EYSH 4WO4B 1JK9B 3FO1B 1HWYA 4EKJA 2IZOA 3JQAD 3BWBA 2X12A 3H17A 3V33A 1P8AA 4HV4A 5H4HA 4IS3A 3NZSA 3AVQA 3DETD 4ZX3A 4OUDA 1T2JA 1LWHA 3KLSA 3L1OL 3SB3A 5D1ZI 1VB9A 2JFXA 4ZDWA 3X2FA 2DUUA 4OLVL 3RU8H 1C7RA 3KPQB 3TN0D 3PXUA 2A2ZA 3MJ9H 3QLUC 1LDNA 3W2EA 4BNFA 4QRUB 5EWJA 4MDJB 3HYNA 3QFJD 4ZS7L 4LE0A 1CPUA 4I9GA 3NIDE 1JN6A 1C1EL 1KAGA 1P6XA 4P7KA 2PQ6A 3MWDA 1P4UA 1I8IA 1FU4A 3HHSA 4DFIA 1Y6ZA 2WF5A 4URVR 4P5RA 3OURA 3B5EA 3UAWA 3WENA 4FQCH 5IGXH 3WS7A 1JMVA 1MI5B 3SYCA 5T3ZE 1KI4A 1I1AD 3LKRB 4YSSA 5EUCA 2R0ZH 1BD2D 5A3QA 4PRBB 5L88H 1AHPA 4QM6A 3EYOB 3O9WB 5HOQA 1ES0A 1PDKB 2FB4H 4Y2NA 4ZAKD 5JOFA 5KSAC 1W44A 2RACA 1QNZL 1ILWA 4UPEA 5LQBL 1G64A 4DZZA 3QVOA 1MCJA 4AJIA 3K0FB 1RZ7L 3FFCA 1FG2A 4OQ1A 4Y4HA 3ARRA 5BRJA 2JFGA 1JYNA 3T34A 3W5NA 1A9XA 4AUKA 4L0MA 2CW5A 3GJ7A 1QSEE 1UBSB 3QVKA 2PT9A 5HSFA 3SKOB 2HB6A 4FS3A 5C2BL 3GLDA 4NAQA 4PR5B 1Z47A 3U62A 4N0FB 2C3VB 1RZ3A 3DX8B 3CH1B 2GERA 1Z68A 5G5DB 4TZ0A 3B9KB 4MXWH 2HJSA 3MJ8B 4PLWA 3US0A 4KUGA 3HHRB 1E99A 5I8CA 3TP4A 1CFNB 5IMOA 4MNGB 4M9CA 1QYIA 4ACPA 1JQ5A 1YFKA 3DUUB 1KOGA 3JZFA 3BH8A 3WSQH 4J6FA 5MERB 3MLRL 3NOOA 2ONJA 3HE3A 4NNPL 2R1UA 3I6BA 4B44A 4QTHB 4HEPA 1IJFA 3ICWA 2QGCA 3UJIL 4Y5XC 3CMCO 4L2LA 4K9NA 3DFUA 4Z7WF 3JV4B 2JEZA 1DEHA 4MI6A 1FU7A 3DBRB 2XCIA 4L29B 3BA1A 1N6IA 1TCMA 3K1KC 4WEUD 5IW1A 1NPUA 4NC1E 4Q1DA 3RFFA 1EFCA 4QT0A 3FO9B 3GEDA 4JFOB 3WTXA 3V4PA 4X98A 2WCSA 2I8AA 4U0JA 3SHVA 1DP4A 1XX9C 4AC4A 2DG2A 4OKNA 4ZVVA 3TVMC 1ZJJA 3N3BC 3GSXB 4B8WA 2VCEA 1C1XA 2YMXH 2YMMA 3U7QB 2XT6A 3IAPA 3VH8A 1NVVQ 1P75A 3MX0B 1RMTA 1Z0KA 1TNMA 2VRNA 1SEQL 1TU3A 4G8GD 4LF3B 2HT3D 4FDWA 4B7UA 1LK2B 4OQFA 2C2KA 3M4YA 8AT1A 4PJIE 2H2AA 5D3QA 2DWEA 3W0WB 2ZROA 3TTTA 4EG4A 3WN5C 1FFBA 4Q0XL 3WUWB 1TQCC 3E03A 1KTLB 1T5HX 4JANB 4BCYA 1OFGA 2RHEA 3SVZA 5FUXA 3O47A 1BECA 3NV9A 1KCSH 5F35A 4KI5D 2PLFA 5HIAA 1VDMA 1RK7A 4TMXA 4B09A 2APTA 3VR1A 2X0VA 1R33A 1QWSA 2AYYA 2IDUA 3BMCB 3H2BA 3A6GA 1NBMD 2IBTA 5AVVB 3RY5A 4LYGA 4MJ2A 3TJEH 2I6QA 3K35A 5BN3B 5LQRA 2AZAA 3VPBA 2G9ZA 5FBHA 4EO7A 2WT8A 3AINA 5CP7B 1KUMA 2HRPH 2NXYC 4NCXA 3AHIA 3OTHA 2QAIA 3U25A 2AL7A 2ROQA 2CDFA 3EO1B 1GC1H 5LGKA 5TFSL 4X4YA 5IVZB 4ZXFA 4F06A 5KJ6A 4WFED 4RZKA 2QMOA 4YXLL 3DWEX 2VS1A 3H9GA 3QGVA 3I64A 1JR3D 2ZWZA 5DO2C 1FS6A 2OGSA 4XO5A 3B3JA 3AETB 2J0EA 2VQ6A 1FFTB 3JWNE 4NCBA 4HS9A 3DUFA 2NP7A 2HZ7A 3QZWG 1KGCD 1T1ZB 3MLRH 3FQ2A 3QUXD 3TNMB 1Z0UA 5LIRA 5I2IA 3VDQA 1QH0A 1B3JA 2H0PA 1T9GR 1VFOA 1DCLA 1SIWA 1GCAA 4WKZB 1CE8B 3VNYA 1SHKA 1VLJA 4EIBA 2XT0A 3QQ4B 1HQ4B 1F3JA 2F0CA 5T3ZD 3F12A 2XCLA 1NVVR 2YEZB 2Q9CA 4YP5A 2Q6VA 1MRCL 3D5EA 4GO6B 4JEGB 2J30A 3JWOC 4N2NA 1OAAA 1BKYA 5I7SA 3OPQA 4XWKA 4ZOEA 4HQ6A 2FUKA 3OLQA 2EIMB 3I9LA 4B0MB 3VU0A 2P7HA 2AKEA 2D7TH 1E40A 2PLNA 3ZW7A 2FJGB 2B59B 4DRXA 3P45A 1B0AA 5CDYA 2LP4Y 4NZUL 1ESCA 2P8PA 3IEPA 2VUSA 3KYKL 5J6HB 4B6EA 3WELA 2PWZA 3N04A 4HOXA 4OQZA 4JFYA 4OGKA 2P8MB 1EEZB 3GUTB 4P99A 1W9HA 3GBVA 2KMLA 4UQPA 4BDTA 4A7GF 1IAKA 4EI6A 1ZKMA 4NFYA 5H2BA 5AUOB 5SYMA 4FIDA 5DZNA 3CEHA 5LCXA 1E3QA 2W9XA 1MRFL 1XQYA 1PCXA 4EG8A 4KBPA 1NQAO 3BEOA 2DLNA 2QJRA 1RXWA 3ZV4A 3ORRA 4F8YA 1T4WA 3RL2B 4C8XA 5MENE 4YN3A 2P5EB 3SBXA 5ISZA 1F2QA 2QTHA 3NVMB 4M03A 1RFDL 2BGNA 2B5IC 2EKZA 1KDIA 1FSKC 4M60A 1EJFA 5DOVA 1WBXB 4M8RA 3WIIH 4LYYA 1YKGA 3GMLB 2B1RA 1MKYA 4KJYA 5ADOL 1GQYA 2G07A 1ODUA 1EXNA 4TXMA 4XIGS 5FXMA 3OQHA 1GKYA 2WYZA 3GUVA 5CFHA 2IP2A 2Y0BA 2P9CA 1LX6A 2BYTA 4JFAA 4TWBA 1KN2L 2LR4A 1O96B 1J70A 3P69A 1Q94A 3H11B 4DJMA 4P0QB 3S3TA 3TQTA 5D70L 3JVIA 3NOXA 4I9XA 1SCAA 2PHZA 1Q6ZA 3C8ZA 2IGBA 1FFNB 1R4MB 3N28A 1C9YA 3P7MA 5DEFB 2JFQA 4TQ8A 2MJLA 2OXGB 3T8XB 3SFTA 4DSZA 3TEJA 1XJCA 1RLOA 5DBGA 3GGJA 3GOQA 4CW1A 3KKEA 2FUNB 1IAQA 5KS2A 4K88A 1TSHA 2G1KA 4BCXA 4C4KT 3OZBA 4O9HL 1K3FA 4RJIA 4JGIA 5T1JA 3AFMA 3LD8C 4XQCA 2GTIA 3GSNA 1HT0A 2XKAA 2RHGB 2IYUA 1CLUA 1HFWA 1NNLA 2BWIA 2XCUA 4TTIA 1X5FA 3CEMA 4HQRA 4IXTA 4JP2A 3ZX1A 3CURA 4OB6A 5BN5B 2IWEA 5L3VA 5BSEA 2FJHB 4IOKA 4P7GA 4H1LB 3DVNA 3DTVA 2G4GA 2HFJA 2ERCA 1UAAA 1UTDA 2DBLH 3OJXA 2J73A 1U3YA 5H80A 3C08L 3MX0A 2ZYWX 3ZLQC 3AXTA 4FZVA 5KVEH 3DTXB 3ENWA 3NACL 2O9JA 5JVDA 5AVSB 1ORHA 5CDHA 1PK8A 3CCHB 3HI1A 3EEIA 4H7KA 1TYCA 1HRKA 3N1QC 1ZHHA 1JILA 1L7OA 4IDEA 4XC1H 2HQBA 4M61B 3RAJL 1M1YB 2H41A 4A82A 5EA2A 5HYSB 3JYQA 1ZHBA 1ZHNA 4MNQB 1CSEE 2YA2A 5C0CE 2J0VA 4U7DA 3QBTB 1DKLA 3ZPXA 3VXRB 3MWEB 3G79A 3JV4A 5EJ9A 4PSRA 1N5RA 2FEAA 3G6JA 1FFXB 4GJTB 3A05A 4FP8L 3NYWA 1NLMA 2DUJA 3U44B 4URKA 2RG1A 3C6YA 1PLJA 2WLMA 4Z5RB 1TFHA 4XRRA 4IOSA 4HN9A 4DCTA 5GS2H 1GPOH 3EIOA 1ENOA 5B1EA 2IPTH 2OBGA 3ALXA 3CLSC 1B88A 1P6WA 1FUIA 4P23C 4MLZA 3CF0A 3VD3A 1CYWA 3WMFA 4J0GA 1NTDA 5F7HA 3WE6B 4KHPB 3HPJB 4KX5A 4DCNA 1MWOA 2F7OA 5CBEA 2FOLA 1CDIA 1YMQA 1Q0UA 4QXUH 3CSDA 1Z1WA 4W9HC 2XKKA 4DZTA 3I9V1 3DPSA 1AQUA 1XXFC 4YGVB 1BN7A 1WC7B 2ZVPX 4OGYH 3PHIA 1NN5A 3IESA 2X38A 1X38A 1M2GA 3EVDA 3F6LA 3G0DA 5H2BB 3RFVA 5BS0A 4JFTA 1JLRA 4PJIB 2C1OA 1AKJB 1O9WA 3WGYA 4LIPD 1UFKA 1DQIA 3MYZA 4AEHL 1PR2A 3VMOA 3I5AA 3PG5A 2NXJA 1MJ5A 3TIEA 4NHCL 3T0EE 3BULA 4HS4A 1GC1C 3VYOA 5A3SA 4P5TA 1SHSA 2WIGA 4E2XA 4K87A 1FO0L 5BSKA 3K31A 3ZQKA 1YGPA 5U4QA 4E13A 4CLXA 1QYXA 1O57A 4A7SA 2FGJA 4MDIB 2ED8A 4LT7A 4G5HA 5I24A 4L9LB 1JFFB 4XIJA 4U2FA 5CCHE 2FVNA 5J1TB 1GPJA 3FYEB 4PZZA 1ISJA 3RT1A 2WOOA 3WNLA 1DEOA 2DQSA 3ZGOA 4X42A 5H3CA 1WQVT 4AQ8C 4BFCA 2IIVA 1ZEJA 1CY2A 1GGNA 1G3RA 4UZUA 3B4NA 3ETBJ 4JKNA 3ILPA 2HJRA 2HTKD 1NPYA 3A3KA 4OU5A 3AUWB 3WLNA 1PJ8A 3RTAA 4M1KA 5J63A 3GHEH 4QXWA 3U2SB 1RBQA 4AQOA 4PBSA 4Y2JA 1J2EA 2FJ0A 2XDQA 3L1JA 1PKOA 1RQ2A 2FEXA 1NVEA 2XKUA 1TKWA 3BD4A 3ZWNA 2CPCA 1U8KA 4A68A 2H26A 1OU0A 4TSFD 3S8MA 1VPWA 2QPEB 2EDEA 3F6JA 1Z6YA 1H6UA 2X4LA 4URWR 1Q90A 4MAUH 3CFJB 3D81A 1AQLA 5LVAA 1D7AA 1MH9A 3GRRA 2NY4D 4PBDA 1KMMA 3D54D 5IWAB 2IQAB 3C6BA 2XEXA 3S2EA 3ZW9A 2FFHA 3DEZA 4II2A 4PJHB 4DV3B 3JRNA 2FR0A 32C2A 3RU9A 4FUQA 3QXCA 2PMBA 4RX1A 4DUGD 5LD2C 1IUOA 4M8KA 3QIBA 3VD2A 3TUJC 1JZQA 2G67A 3LEVH 4NO0D 4NUJB 5H82A 4KQCA 3SHTA 2WQXA 2PX8A 3FFBA 3K8OE 4MUGA 3NDJA 3AR3A 2Q2VA 2ZAHA 2XX0A 4PX3A 1BW8A 1JF6A 5DM1A 5JXEA 1S7GA 4I0PA 1K7FB 5K0ZA 3HRZC 1F90H 5D96C 3VXRE 2JVKA 4HIHB 1KIQB 1TXKA 2GPYA 5AVOA 4YIQA 4OL9A 5IDXA 2QMUA 4P4KB 2K7FA 1ESZA 3WWOA 4GOLD 4OGLA 4M21A 4PRHD 1W16A 1QYGL 1SXJB 2YHIB 3Q2IA 4R1OA 4EN3C 4J90A 2OCFD 3T0IA 2B34A 5IAOA 4IDLA 3NJXA 3BMNB 3BWAB 4IJTA 4D6YA 5G4OA 5AUPB 4I4WA 3R4VA 2J8OA 1A1OA 4N2BA 2HJFB 4ACTA 3UB3A 3ASNB 3EC2A 1RI2A 4DLAA 1TO6A 3TRFA 3O82A 4P0PB 4NLHA 2EJVA 3PQFA 5DHQA 4U7FA 5AZUA 3R3VA 2IYZA 3AVOA 3GFBA 4P2BA 5D2NB 2ZE5A 5AENA 2FF5A 3LPAA 1CGVA 4N2DA 4PLPA 3ZTNL 2PBLA 1AHWB 2X7HA 4J3UA 2JCCA 4X8CA 1J0JA 2VK2A 1RAEA 1XDBA 5D1ZC 4YASA 3WLJA 4IIGA 3IDYC 1BZ7B 5E4YA 5CZVH 4QY8A 3Q01A 2GVDC 2DB8A 1DN2A 1P7QB 1ZWIA 2PR4L 1KDZA 4BFVA 3FTVA 2PU7A 4WOBA 4BFSA 4OKVB 5A71A 5K9QG 4QQ8A 3W5IA 1TW2A 4ZIRB 3MODL 3DX8A 4DCUA 1YGYA 3CWZA 2C1OB 3P9MB 3ARDC 2R9HD 2EXXA 4UQ2A 5AB1A 2OP1A 3PJLA 3BL5A 1F48A 3CRQA 2OPCA 1E2BA 3BL6A 1SWVA 1I85C 1DL5A 4P9HH 2OMUA 3DPIA 2J5WA 1I3MA 4PW9A 2J8HA 3ZY2A 3OLXA 4BXSV 4DVBA 3PQCA 5H83A 1N5JA 4PWZA 2R6ZA 4M43H 3AROA 4OV5B 2XMCA 3CCCA 1F4LA 1CIPA 4IEIA 4L8SB 2ZXFA 5CIYA 5G4KB 1JR6A 4DP9X 4K0RA 1INEL 2OBFA 2C83A 3PGFH 1UQSA 3GPDG 1HQCA 1KBBA 1ZI9A 3JQ8A 3UBHA 1RM0A 4W70A 1TZAA 1YCFA 2XWTA 2PKYX 2F4VB 3ROFA 2EICA 4TVPH 3L08A 4JO2L 4JN6B 3B2XA 1JFLA 2JAXA 4G6AD 5DS8A 4RMBA 1JZTA 3OHSX 2ECOA 5FOBB 2ZRMA 1V5GA 4BNLA 1PZ3A 5BNZA 2XTJD 1GU7A 4I6JA 2ZCHH 5JIQA 1EVKA 4EDWL 2IPXA 1UYWH 3FU5A 2AK4D 4XP4L 1TIBA 3PDOA 2O8VA 1OV4A 5B3KA 3WZLA 4Y2TA 1NGPH 3NKLA 1GYCA 1R1DA 2NYUA 3HI6A 2P9FA 1IL1A 3U4BL 2WB2A 1ZVHA 5ALPA 1MT0A 1ECPA 1UMBA 1ORSA 1E9PB 1IHXA 2IANE 1F45A 3R9IA 4HHAA 2BR5A 4YXWA 4HNQA 3ES9A 1HHKB 2R4UA 4US2R 2ASVA 3B60A 3HRPA 3IKJA 3RSGA 3HN2A 3B3GA 3NC4A 3UAJC 5AHXA 1XVSA 3P32A 3SOZA 1UWEL 5CFQA 1TVBB 2YCBA 4XPFH 1VCNA 1P2CB 3DKPA 1OTHA 1R5VA 5EE0A 5L7XH 2APWA 2B1HH 3KVRA 3RD5A 1EX9A 2JKWA 4WIQA 4I4IA 5BUZA 1XB2A 3MJCA 1EDDA 2CXPA 3KPWA 4I5FA 3CKYA 4Z23A 4F71A 1EFPA 1MFBH 4YI3A 1CT9A 1OCWL 5IAAA 4CVXA 2JJ1A 4HJGB 4AITA 4KNQA 3DTVD 4OAWA 4GEGA 3D4NA 4BLWA 1KCUH 2WLJA 2VKQA 4NPHA 3RIXA 3FKSD 1GAQA 3IM1A 2R1TA 4WGVB 5E2IA 1GAWA 2KKQA 2FK8A 4ID9A 4DQKA 3CZSA 4RBPK 2ADMA 1AY1H 3SBDA 5KJFA 4AMGA 2XVLA 3UZEC 3V00A 2L04A 1KB9K 3EYFB 4KXNA 4B85A 3P0GB 4JRFA 4ZUTB 3UMBA 2EE6A 3T99A 1YMHA 2I1VB 1WZ1H 4N49A 1QAWA 4Y1AE 4NRXB 2K9FB 3R3WA 1HL9A 3CXHK 4WKOA 3FMOB 3FRIA 1X3SA 4RVSA 1WHOA 4YHLL 5GZOC 4YXHH 2P9QA 3CKMA 5KVDL 3SPIA 4P9MH 4ZEXA 5K9QI 3V42A 1PDWA 3N0AA 4YJHA 1U8XX 4X6DB 2FIRT 3SDXB 2WZ6A 2H7YA 5BW7C 3KQKA 1CYEA 2FJFA 5DS2A 4V0KA 4ESHA 1RURL 2WE8A 3BE1L 3BG5A 1T2QL 1YECH 3CVWA 2G5PA 1UDXA 4R8RA 4M46A 4H0LC 1IX2A 3UAAA 2V1XA 2GWRA 4F1JA 3CQQA 4ZYXA 2RA1A 5DIFA 3WLBA 3T5PA 2WP8J 3F58L 2QJOA 1LDGA 1UK9A 4CF5A 4N5MA 4P2GA 1C12B 3BO8B 1TC1A 3FPLA 4MR8A 2CMRL 3AK4A 2V5YA 2BIIA 1V3JA 2EIDA 2XRMA 2FCAA 4H25B 4N28A 1ISMA 2V3VA 1EGHA 1IGJA 2HY7A 4WSGA 3QUYD 3S8EA 4P0DA 5LYJA 2H08A 5FI5A 3L95A 4DKAA 4H7FA 1RYFA 2QFPA 4WZ9A 5C3LD 4DAGH 2XZZA 4PC1A 5EYPB 2NXZB 1UATA 5EIOA 1J8VA 1B0ZA 1S9YA 5DHYB 1L8LA 3LI2A 4NEHB 1DC8A 4A0SA 4LLQA 4X8JB 1SYSA 1AKVA 3AV0B 1A04A 2C7GA 5C32A 3LPDA 4B9PA 4RETA 4KAQL 1XELA 4OJNA 3HKEB 4Q18A 1V7MH 4B6RA 4X5XA 3FMVA 3VVMA 4XEHA 3I9JA 2HYDA 5FBZA 4PHZA 3ZRSA 1JVLA 3F3KA 4KO2S 3ULUE 2QVKA 2Y1CA 1MFEH 4LVHC 1B2WL 2FWNA 1N75A 1H6BA 1MENA 3A06A 2R0LL 1QZ3A 2X1QA 1IGML 3PRZA 5JMOA 2AF3C 2OO5A 4EPRA 3MGKA 2YC4C 3T6XA 1X8LA 4JCLA 3VH3A 4C01A 3K72B 1FFPB 4ZGWA 3FI9A 2CHQA 3EYOA 4ZW6A 4NPYB 1EK3A 3D1VA 3N1GC 3V0VB 2PS1A 3ANXA 5KAPA 3THXB 5TF1H 1INQB 4RH3A 2JATA 2PSDA 3HG7A 1GA1A 1YEEH 4W63A 2D1RA 2BISA 2GNAA 4J0HA 4X6CA 2IYYA 4GUAA 4S0HA 1UKEA 3UPRB 4A1RA 1V1MB 4HEJA 1R9JA 3DT8A 4RZCA 1KMCA 2BRRH 2WAXA 4MW5A 3LQZB 3A5VA 3AF3A 2OJZL 2CL0X 5L8KB 5HM8A 3PLAE 4JDTL 4EBBA 4JENA 4UE3S 1QX3A 5DYOB 2A6IA 1B3RA 1NR7A 2F1AA 4RJTA 4XOUA 2NUAA 3HCRA 5L8LB 5C1MB 3NRQA 3ZU2A 3KPQA 3II3A 2DU8A 1CIUA 1RWKA 4OZ4B 3T1FB 5CLFA 1DTWA 2MQ3A 3BMQA 1RPZA 2EDCA 1T4GA 2OFWA 2VDVE 1KYFA 1DS6A 3J07A 4XPGL 4MS1A 2N1TE 3MRKA 3AS1A 5CBKA 5ERWB 4P23B 3GZJA 1RJZA 3O11B 4OUUA 1RWQA 4FFSA 1D1QA 4MQ4A 3DRTA 3L4YA 3NIBA 1AGBA 2OO7A 1YI1A 3P30H 2A9CA 2F53B 1X7HA 3CLSD 1QIJA 3FS9A 3PL6D 3MB5A 4ZV4A 1MNUL 1SMAA 4RKYA 5CD5C 2YHAA 1X70A 1GKIA 4GEKA 4WKBA 3DHNA 4CQJA 3MAWA 1JK9A 3FO1A 2ESVD 3UBGA 1DAMA 3AX6A 1C5CH 4QRPD 5JW3L 4ESEA 3VFVA 2BHRA 2CJYA 3VR3D 4M8QB 5HYJB 4FFLA 4QHUA 4J94A 1WZKA 2WBXA 2ZSWA 1K63A 3DOUA 3NZHH 3PWVA 1MB9A 2NW2A 2JNWA 3EA0A 2E3JA 1NONA 3IKKA 1GVIA 4NBWA 5IJXA 3PGXA 3D39D 1E43A 5E9DA 3AVWA 4JQXC 1VLXA 5EY5B 5K8CA 3S48A 2FE0A 2AGJH 5IQ9B 3BCDA 1CFNA 3SC2A 1VKOA 2P5ED 4MWEA 2F68X 3ESPA 1E77A 2EKSA 3RIFF 4BMDA 2Z3FA 4PB9H 1YJ8A 3C48A 4YK4B 5FOWA 2ICWJ 3D51A 3VHRA 4MZ3A 3FUDA 5BYAA 2CWRA 2GCYA 1VGEL 4O02L 4FL4C 2H2IA 3R3UA 2Y3NA 2PR2A 3R6DA 4Z0PA 2OZ4L 1I9JL 1AZRA 1I0IA 4OFYD 1S4MA 1CVRA 1ZJ5A 1JKJB 3P2BA 4P92A 4FN5A 1ZT4B 4E42B 3L7YA 2ZB4A 2CHGA 2P2LA 1QTQA 4KKBD 3KYDB 4JN1L 2YA1A 1IZZA 4WINA 3T7SA 1NFIB 1N2RB 2XB8A 4DQLA 2OTUB 5LZ7A 3Q12A 1ZSHA 5L6YL 1DKUA 2HTFA 4EGCB 1M3SA 3I72A 4OLJA 3AUJB 4IXNA 1AK9A 2AK4A 4M7JL 1I0LA 4LARH 3PENA 1CS4C 2Z1DA 2B4AA 3QS2A 3H3KA 5AP9A 3O3UN 5T1LD 4OOEA 2P45B 3LN5A 1KFJB 3A7EA 4LC9A 4ECAA 3CGWA 4J0KA 2DI8A 2C7BA 4PB9L 4E9RA 4GOOD 3WFIA 5EU5A 4NQEE 3MJTA 1O6TA 3GHEL 5KYGA 1X80B 2JI7A 2FPLA 5K2OA 1M7IA 2Z31B 1QPGA 2I9PA 4KZKA 4BY9E 3NHZA 4KFMA 3SG0A 2PUAA 1EK6A 3QHFL 4KGVA 5HJEA 1EKXA 4JUCA 3A4NA 3F2IA 4KVNH 4YDKH 3HHMA 3Q6FB 3F5FA 4MHHI 1K4DB 5LN8A 4RTOA 1JGVL 3DJYA 3VFPA 4X45A 3E35A 3U7AA 1JP7A 1CBUA 3A6CH 3NBQA 4OZFH 2VJOA 5IULC 4C83A 3KBHE 4IRSB 4B7ZA 3QFJA 1QVVA 2HAEA 3VXSB 3EXEB 4R16A 5CHNB 4CPDA 1BOFA 2XN1A 4C4UA 2QE7A 2ZJBA 2R1ZA 1A9BA 5EUBA 3LDFA 3UY4A 5FUZH 2QU7A 4GO9A 4XAQA 1H3PL 5CEZL 5FBWB 3OVUB 1F4VA 2QJDA 4DUYB 2M2DA 4FYXA 1XZPA 3OH8A 2Q8BL 3SLKA 2X4SB 1E5CA 4RF2A 2HMID 4A8JA 5BRNA 2FPXA 4BSVB 3SF0A 2NWQA 2IUEA 1UZNA 1XDSA 3REQB 3UC9A 4MYTA 3RX5A 1GPYA 4PIMA 5J5EA 1E4EA 1SFDA 1ASQA 2COKA 1N2CA 4LSRL 5I51A 2VTDA 3CHPA 3EADA 4W99A 2WZ0A 1TCAA 2VZUA 1W8EA 1TFPA 4LDPA 1KIRA 4GPBA 4MTLA 4F6RB 4DRZA 2C2YA 3IPRA 2AWNA 3RVXD 3VZRA 2P5YA 4DN4H 3O3OB 2SBTA 4Q7EA 4ZO4A 4X2UA 1T2FA 4IV0A 3K0AB 1YOVA 4W5OA 2BRQA 3DWFA 3NH6A 2Y9PB 1M76A 4HWOA 1P69B 1YJDH 1UMCA 5JLZB 3DS8A 4AKTA 1PVVA 2VQFB 4R90L 1NF9A 3CFMA 2GEDA 2X6UA 1BGWA 3SCMA 5HWSA 2A30A 4HD8A 1Z36A 3ZHCA 3NG5A 3BHMA 4QRIA 3IAEA 1W85A 4L5BA 2C1EA 5JHDA 3ZX4A 3AEUB 2ZK7A 3D6AA 1JB9A 1I3NA 4LZLA 1ZK3A 2IF2A 2V3CC 2PR4H 4PJCF 1OXSC 3C60A 1RI5A 4EJ0A 5EUOA 1ND6A 1UADC 3GUUA 3COVA 1GL9B 5MENB 4KLCA 4R7VA 3M0EA 1X39A 1YVDA 3MGGA 2MKLC 3DV9A 4LJRA 3VAYA 3MGOB 1X6NA 2PANA 5ULLA 5C0AD 2GSWA 1VB3A 3TCLB 1K4DA 2EJUA 4TRPH 4OEHA 1FC1A 5BN3A 2HGSA 2JCXA 1N5IA 3S3JA 4CC4C 2AW2A 2QDWA 1C1YA 3NP4A 5KJ1A 3T2OA 2WJ7A 2QFRA 2GMWA 4BNMA 1GZVA 5TQJA 3DZGA 1KI6A 2OTUA 4RAVB 3PFCA 2YN5A 3R7SA 3FN4A 2A6IB 4QRBA 4QX6A 2GUOA 4M0DA 1W0WB 1JEYB 4GBGA 5I82A 4V1DA 1EZVX 1FP1D 2FMIA 4ALIA 4R1QA 4TS9A 5L4FA 3IDMA 3D09A 4OM8A 3PJNA 1LCIA 3HQ4O 4IOLA 2E37A 4HB2A 1E90A 2ZIUB 2IHKA 3EWIA 1U92A 5BO5A 2KX7A 4JJIA 1O6VA 3FSRA 5K8IA 3NJ8A 2AJSH 4DA7A 4CW1B 1MRNA 3O95A 5D70H 1FAKT 4UQIM 1E50A 2BC4A 5B7GA 3QO0A 4YXWD 1CZHA 1K88A 1EFUA 3LP5A 2PYEB 1TZBA 4URXR 3CPJB 1DC5A 1MOSA 4M8SA 4BP8A 3HYLA 2HTLD 2RI1A 1FE8L 4IWYA 2HUPA 3CSYB 1X92A 1EHLH 1MG2C 3L1OH 4OG2A 3KM1A 3BCSA 5KVDH 2DERA 3FOMB 4UM7A 2ZAMA 3E0GA 4RHYA 5ENZA 2ZXAA 2JAWA 1U99A 1Q14A 4G0WA 3DGFC 5TDPA 4HADA 4KHTH 4RSMA 1PG7L 1WEKA 4WOKA 3T5TA 5F9AC 4HNAB 3FVQA 3R0VA 4MGHA 4IIJF 1S9YB 4JOQA 1CFMA 3D50A 4PTZA