3IGFA

Crystal structure of the all4481 protein from nostoc sp. pcc 7120, northeast structural genomics consortium target nsr300
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
368
structure length
333
Chain Sequence
ALILTFLGKSGVARTKIAIAAAKLLASQGKRVLLAGLAEPVLPLLLEQTLTPDPQQIAPNLEVVQFQSSVLLERNWEEVKKLEAQYLRTPIIKEVYGQELVVLPGMDSALALNAIREYDASGKYDTIVYDGTGDAFTLRMLGLPESLSWYVRRFRQLFTNQVNNFLDKGKEALADPKRVAAFLVTTADPLEVVSVRYLWGSAQQIGLTIGGVIQVSSQTEGDLSAEFTPLSVTVVPDVTKGDWQPLIDALPNFVEQAEQAPKPITIDTHNRQVRLFLPGFDKKQVKLTQYGPEVTVEAGDQRRNIFLPPALSGRPITGAKFQNNYLIISFLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords All4481 protein
publication title Northeast Structural Genomics Consortium Target NsR300
rcsb
source organism Nostoc sp.
molecule tags Atp binding protein
total genus 101
structure length 333
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
A PF17886 ArsA_HSP20 HSP20-like domain found in ArsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3igfA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3igfA01
2DFKB 3CBQA 3BH6A 4N1AA 2ZQ5A 1UBEA 2ZS7A 1WP9A 2CE2X 2YOFA 2CHVA 4GMDA 4HAUA 1CR2A 2JLRA 3TK1A 2FA9A 4N0EA 3DZ8A 2PZGA 4MRNA 1UJ2A 3PV0A 2VPPA 4CYMA 1XZPA 2QGZA 4WVFA 3RSLA 3QIAA 5CJ2A 4B3BA 4DT1B 3QORB 1N6RA 4FCVA 5EP2A 2ZJBA 3EPHA 2JLXA 3AP1A 2Y1YA 2WKRA 3QXHA 1HEIA 1IXSB 1M74A 1W0JD 2CLSA 1Z2CA 4RD1A 2W2TA 4OQNA 2EYQA 4Q7LA 1L8QA 2PJZA 4IDHA 4MJHA 1ESNA 3ZJYA 2BMJA 3GJ0A 1NN0A 2EWVA 3AKYA 1XTSA 4NYIR 1NJGA 3IBGA 3UANA 1N6NA 4IOJA 5E3HA 2Q3HA 1IJEA 4AY2A 4UNQA 2VIIA 3NBYC 2O8FA 2PZEA 1VCOA 4XD7D 1P9RA 1E94E 4BFWA 1DOAA 1F2TA 3CUEF 1L4UA 2FPMA 2JGNA 2CL0X 5JJKA 1G7RA 2NPFA 1Z0IA 1OE0A 4XJXA 3KQUA 1CRQA 4NE2A 4PPQA 3SJCA 2RHDA 3WRYC 1U0LA 3K8YA 4G01B 3GLIE 1U0JA 4F4CA 3GLIB 2ECKA 4HAVA 1KIMA 4M9SA 4EJSB 1QHIA 3D7MA 3KXIA 2JJ8A 3AM1A 1XEXB 3VR2A 3CF6R 4Z51A 2N46A 4PC6A 1N3BA 2MNWA 3ZVLA 1T9HA 2REXB 1DAFA 4C7OA 4A0FA 4BFVA 4Q00A 1TEVA 3BGWA 1CLUA 3NBZC 2LKDA 3GT6A 3SBDA 1W2GA 4QXAA 4NMMA 2NO7A 3UG6A 4QL3A 2BJVA 1AJEA 5FBRB 1XX6A 3KJGA 2IT1A 3GJ3A 4ZDKA 1KAGA 3BWDD 4QOSA 5JHHB 4HSEA 3V00A 4E07A 4CEHA 2VF8A 4F4IA 1RIFA 4QHYA 4HB3A 4YC7A 4C0BA 1YHNA 2ZRIA 1FTNA 1U98A 3BXZA 3ADBA 2WM9B 2X19A 1OIWA 4OJQA 2N1BA 2UKDA 2ZI9A 3TQCA 2ZE8A 2IXEA 4IFEA 1ZM3A 3CF0A 5FUXA 3VR6A 3U7GA 2OXRA 1TQ6A 2O8DB 1DS6A 2V7QA 2PX3A 5JJLA 3TQFA 2QT1A 2W0SA 3ZH9B 3EA0A 3NDPA 3HYRA 2ANBA 2GDJA 4LJ5A 1N6LA 2I4IA 1A2BA 5DYGA 2QT0A 2J9RA 4GBMA 4H9GA 2V6IA 2ZXUA 4MYCA 3QPWA 4PTLA 1AK2A 1NF3A 2JLWA 5FTLA 2BKUA 2YVUA 2FH5B 2QZ4A 4ABYA 4NBSA 3S1AA 2GJKA 4Q4LA 2GBLC 2V8OA 4LJ8A 4WW0A 4F92B 4BPBA 1NRJB 3TW8B 4IDPA 5CLLA 2JEOA 4D4KA 1ELOA 5FOSA 1TU4A 4Q9LA 1W5SA 2GXQA 2QAGB 2FWRA 2BMFA 3PQCA 4O2RA 4DLWA 1YZUA 2WJIA 6Q21A 1SXJA 3U4QB 1HY3A 1E79D 2PT7A 3A1SA 2FSHA 1JR3A 3CWZA 3IIJA 4XD7A 2AD1A 2O8CA 4P31A 3VKWA 1NKTA 5BN4A 4WBSA 2ZRDA 3RDPA 4DEYA 2NMVA 3U6KA 3QPVA 3E2IA 3B1XA 4BEBA 2D7DA 4PHTA 3TLXA 5JRJA 5TARA 3UMSA 1U9IA 3ZZTA 1U8AA 2XXAB 2YYZA 2P5SA 1D9ZA 1J2JA 3WYFA 2IBMA 3EXAA 1I4TD 1DBSA 2Z5FA 4PQRA 2XZPA 3AGPA 1OH6A 2A5YB 5DI3B 2KI5A 2GK7A 3HPRA 1WH0A 4X8OA 3MLEA 4PZZA 5DLQC 2IYUA 5CM9C 2IS1A 1VCMA 3B1YA 3CNLA 3O8BA 4FMCB 2WJGA 1JEDA 2IYXA 2Q9CA 2IHBA 3ZVMA 4YQFA 2F1IA 4G0NA 4DDTA 1KO5A 4M1TA 1WMSA 1KHTA 4HAYA 4RJLA 1CJVC 3Q5DA 1AA9A 2UVQA 4HAZA 2PMDA 2X8AA 3M6AA 5A4JA 1E1QD 1QDEA 5FI0B 2VP5A 2ZYVX 2PT5A 2IC5A 2V9PA 3D31A 4F38A 5J4LA 4GNKA 1YVDA 4HLCA 1TU3A 4D0NA 3TAHA 1VIYA 1E2MA 3FMFA 1US8A 4U5XA 1GM5A 1K8RA 1AGPA 4D0GA 4MITA 1Z22A 5FH9A 1Q3TA 5J4YA 2H92A 4L9SA 1E9DA 3DZDA 5TMPA 1E1RA 2JJ1D 1ZM7A 1BYIA 3EARA 4E5UA 1M7BA 1A5TA 2BV3A 3K09C 1Z63A 1FX0A 1LFDB 5TXGA 1ZMXA 2NQ2C 1UM8A 1XEFA 1R8SA 3HWSA 1R5NA 2AX4A 1OLOA 3UIEA 4R2IA 4ESHA 3OHMA 2VO1A 3SEAA 1JALA 3ZS9A 3ZLJA 1T4GA 3KDSE 4ESVA 5G40A 4CF7A 4PANA 5B57C 3ADDA 4A8JA 1EFUA 3LAWA 1CR1A 2XJ9A 1XTRA 4YMVA 3VMFA 4JVNA 4YMWA 5IDVA 4ZDIA 3FPAA 1W4AA 3LXXA 4RD0A 3NWJA 5A5GA 1RPZA 3KKPA 2KBEA 2ZRHA 2WWGA 3P4XA 1Z6XA 4H1UA 3RC3A 5JLJA 1Z28A 2QEQA 3REFA 3QXSA 5HCIA 1VYUA 4EPWA 3WYAA 1W36B 5G3YA 4KU4A 1E69A 2CL6X 4TWZA 1E3MA 3I5YA 4UXJA 1OHHD 1E79A 1UDWA 5C18A 1SVKA 4IDNA 1UKEA 3PEYA 4GOKA 2D62A 3KFVA 1G4UR 4XIGS 2W58A 2HYIC 1E9RA 3A37A 2CLCX 2R44A 2NPIA 4ZKEA 1KDPA 3QNUA 3RANA 2EU8A 4LDJA 4G3XA 4Q4JB 2HXSA 1P73A 1ZD1A 4HYYA 4OQLA 4UXIA 1ZM4A 3SN6A 4X8HA 1E2EA 2WWWA 2WKQA 4TL7A 4TMVA 4IXMA 1N5IA 1IM2A 1RL1A 1BYUA 4N0DA 4C4PA 5EXXA 4JBWA 4XVRA 4JIMA 4GPTA 4U02A 1N6PA 4UXHA 3CH5A 4QJ3A 5K8LA 3RRZA 4LPKA 1IHUA 2V3CC 1FOEB 3BK7A 2ZSEA 4QJ4A 1NN1A 5IT5A 3QKUA 4HUQA 5HTKA 4TYNA 2C9OA 2XJ4A 3NEYA 4IJMA 4EFMA 1HT1E 2F9LA 1YQTA 1OV4A 3ASZA 3UATA 4KXFB 2VH5R 3VNVA 4M9QA 1E0JA 1DAEA 3GJ4A 4F93B 3WMEA 4B35A 4POAA 4WXPA 1E2FA 3Q9PA 3X1DA 1VG0B 1BO6A 2B21A 2NIPA 3QXXA 1F48A 1GWNA 2RCNA 1XJQA 1YRAA 1Q57A 4UKDA 1IY2A 3RRYA 4HB0A 1SVSA 1KO1A 3GJ7A 2WJYA 3VR3A 1R0WA 4M1OA 3VTKA 4CDGA 1XD2B 1S1MA 5F9FA 3R20A 4IVRA 3W6OA 3LH5A 3U5ZB 1WA5A 2PMKA 4GZMA 5SZJA 1COWD 1UBFA 2B6HA 2Z4RA 4US1R 5L3SB 4GMXA 4MRSA 3CX7A 1E32A 3A4MA 1Q1EA 1IONA 3FTQA 3MFYA 2QTHA 3EZFA 1AKYA 3I8SA 1F5NA 3C5CA 3R8CA 3GD7A 3M0EA 1OIVA 3W6PA 3EZ6A 2DFNA 3A6PC 2G0NA 3FVQA 2ZJ8A 4WAUA 3AB3A 5L8VA 2XTZA 4YLGA 3SYNA 1YR7A 4C0JA 5FR1A 4OYHA 1W44A 1Q21A 1OF1A 3AVOA 1OHHA 1ZW6A 2G77B 2WSSA 2IS2A 1BMFA 1IN4A 3R7WB 4ZJ9A 2BEKA 4MUAA 2GVDC 4DBLC 3VR4A 2JIZD 4AYTA 4C7OB 4JLNA 1FUUA 1QHHA 3KQKA 1U8ZA 1WFIA 4FWIB 2WPDA 3QKSA 3THXB 2CNWD 3PEUA 3AVWA 4II7A 1KKLA 2YWFA 4Y0AA 3VU9A 3TIFA 4M4SA 4PSVA 3UMRA 3H84A 3ZD7A 1GRRA 3P32A 1R5OA 2FOLA 4PC2A 3H1TA 3GLGA 2E9SA 1AQYA 2HLDD 1R8QA 3KUCA 4V0OA 1P2VA 3E5HA 4FCTA 3T1VA 4JYCA 1P5ZB 4CEHB 4QBFA 2X1VA 1IQPA 2F1HA 5AJZA 2Y1ZA 1RJ9A 1G9XA 2RGAA 3RRNA 3C16C 5KPJA 4YL9A 4G5QA 1P61B 1PLKA 2OXCA 1IXRC 4KLZA 5DE3A 1IY0A 4MRVA 2IYQA 3HU2A 1QZXA 3K9HA 3B7GA 2A5GA 1J90A 1IXZA 3Q9QA 1QHXA 1LV7A 2IWHA 1E4YA 1VECA 3QBVA 4BLOA 1XEWX 3WY9A 1CJKC 2C8VA 2CBZA 4QBIA 2VP0A 3AF1A 1KY2A 5ELXA 1OFTA 1O3YA 3HR8A 2GXUA 3OZXA 3R9IA 2A3RA 3LX5A 2ZI5A 2A7QA 1LF5A 3DEFA 4AG5A 4OHWA 4LBWA 1ZVQA 2DWQA 2AN9A 5EJEA 5EP4A 2ZVQX 3F0TA 3S1AB 2QPTA 1UFQA 1Q0UA 5JS7A 4TLDA 1OW3B 1SXJC 4DUGD 3HPQA 3IO5A 4IKEA 4RZUA 2IF2A 1G41A 4JJZA 2G1KA 3C41J 1FZQA 2NGRA 4PSKA 1VPLA 1YZTA 2WICA 1XXHA 2R2AA 4LUCA 5KNCA 3FOZA 5HKKD 3RWOA 1Q12A 1GZSA 2D06A 2CHQA 1KYIA 3DOFA 2ZRKA 3MRSA 3BIFA 1G16A 1RRFA 3I4LA 5HE9A 2OG2A 2FF7A 3T1TA 2EFGA 1VTKA 2RGNA 4XTCS 2Q3MA 2VSXA 1GTVA 4G5RA 4LPSA 3W3AA 3UWOA 1GAJA 4LJ4A 1U2RA 3B5JA 4P4SB 1TAGA 5GJCA 1YR8A 2VHQA 1NI3A 1MABB 2OBMA 2YOHA 3A4NA 4MGKR 5AUPB 3DKVA 3LNCA 3LBHA 3KX2A 1NN5A 2G1JA 3F5FA 1KGDA 1OPXA 4PZYA 2CR0A 4DVGA 4HDOB 4P33A 2OFXA 2QMHA 4GZLA 3NIBA 4MA4A 2BWJA 3PENA 2ZETA 3T35A 4JL6A 1GL9B 1G3QA 2HF8A 2ZRJA 4M9XA 4RFSB 4M5SA 1GL7A 4WXRA 2ZYTX 1U90A 1CRPA 121PA 2GA8A 2J1LA 4OHXA 1CIPA 1NIJA 3GLHA 4NCNA 4N3NA 5K8UA 1KI4A 4EUNA 3IBYA 4BLRA 2ERXA 3OIYA 1MO6A 3UG7A 1KSFX 5CB6A 4LJAA 4D82A 1AN0A 2RH0A 3VQMA 2EFDB 2CJWA 2CEAA 3U3MA 2CCGA 3T5DA 2QM8A 2ZITA 2IYWA 4JLAA 2K5UA 3PVSA 3FB4A 3KB1A 4NU0A 4IXNA 1GDDA 2VP6A 4C0SA 4BUJA 4HB4A 1W48A 2BMDA 3CF2A 2OO7A 4YDZA 5IHPA 2QP4A 3DMDA 4A8JC 1Z0DA 2X2EA 3F3YA 3PUZA 3GLFE 1JNYA 3IO3A 1N6OA 2GESA 4EPYA 3LY5A 2IYSA 3U44A 2V55B 4KODA 3NC0C 1VDZA 4CZ2A 4PC3A 4EQ6A 1I4LD 4PAOA 1JB1A 4LYJA 3TBKA 4DUGA 5KSOA 4JL8A 3SOPA 5CDFE 3QVVA 2EFCB 2QQ0A 5B64A 4Q9KA 3WMFA 1GRNA 3DVLA 5KSPA 3C5HA 4JUSA 4BFTA 3B60A 4TTQA 2DPXA 4KFRA 4B2LA 1NKSA 4M2LA 1FP6A 2WJVA 3KTAA 1IY1A 1PUIA 1W7AA 1K5DA 1XEWY 2WOOA 3RHFA 3EWSA 4L4UA 1YZQA 4DLRA 2GKSA 4LJ7A 1TX4B 2PEYA 4UQOA 2VTKA 4A82A 2REBA 2GEDA 3K0AA 2ZI7A 4Q1DA 1ZC3A 1G19A 3A1VA 5KHOC 4NYJQ 4QBHA 5C4MA 4NCHA 3QEOA 2ZM5A 1PLJA 5K8IA 4TZ0A 4Q5IA 4DLYA 2W6JD 1ETUA 1W4CA 2KWIA 1UBCA 3SNHA 5L3QA 1RZ3A 4A6PA 2CLDX 2V4ZA 3CR7A 4OQMA 1DARA 2HCBA 2RB4A 3NTUA 1N2CE 4LGMA 4FINA 4WIAA 3REGA 3MWKA 3I5XA 2JLUA 3MAAC 4BRUA 2QPAA 2KSQA 2W6ID 1E2GA 3T06B 3WHLA 2DCUA 2QU8A 2A9KA 1TMKA 2W2XA 3IIMA 2F43A 1VYVA 3PIRA 1X86B 3LO5A 3LFUA 2C77A 5FPKA 5C2JB 3KZ1E 3TUZC 1FUKA 5HZHA 3G0HA 4W5HA 2YJTD 2ZIAA 2ZUCA 4XTRA 3ZIAA 3N2EA 3RS2A 5LPNA 5TB5A 2OLJA 1QRAA 3H2YA 1I2DA 2BDTA 1GVNB 5CB8A 1JAIA 2Q9AA 3D3QA 1U99A 4AKIA 3V4RA 3VHXA 3W34A 4IFBA 3CH4B 3NH6A 1XP8A 2Z83A 4LX0A 2NO9A 2AFIE 4Y0VA 821PA 3GJ5A 1CS4C 4PPNA 4B34A 3HYTA 3PCRB 4NTZA 3K9NA 4BQSA 1DE0A 2QRNA 4RD2A 3PEVA 1YE8A 2VLIA 3P27A 1IJFA 1KZ7B 2NO6A 2V7QD 4X8MA 3TJZA 1QVRA 2YWGA 5EUQB 2R6CA 2HEIA 1NG1A 3KQNA 5J4VA 1I4DD 2XITA 2HT1A 3BRWD 2RAPA 1F2UA 1YZKA 2GWHA 721PA 4NYIQ 1M34E 4L16A 4MUBA 1R5BA 3MMPA 4QG7A 3SC3A 3TNFA 1C4OA 1RFLA 3VU9B 1G3IA 4JVSB 1FW6A 4CEJA 2H16A 1D2EA 4NL4H 3CIOA 3QKRB 2BBOA 2VEDA 3JVVA 4W7SA 3A36A 1R0ZA 4TLBA 2AFHE 4B2IA 4IOMA 1JPJA 1B23P 1JR6A 3JZMA 4R98A 1SXJD 2ZJYA 4US0R 3KJEA 3FMIA 1KMHB 1JR3D 3QXCA 3LLMA 1II0A 1TADA 4LYFA 2W6JA 3SFZA 1QHSA 3AACA 1U8YA 3EC2A 4YDHB 2AXPA 4OL0A 3VHLB 4A2QA 5KNBA 4LHYA 1RE0A 1EFRA 5CLQA 1KZGB 1E0SA 1FTSA 3IQWA 4O3MA 1ZIOA 5J4KA 1D2NA 4BFSA 3RS4A 2ATXA 4ZV4A 1Z29A 2GILA 1AQUA 3DO6A 4F91B 3ZDQA 2QE7A 4LHVA 621PA 1RVDA 2WJ5A 4U00A 4K81B 2W6IA 4DLUA 1UDXA 4TZ6A 1M7HA 3BB3A 3AVPA 4JLBA 2PCLA 3EZ7A 3RLFA 5TDHA 1A1VA 1XMSA 2OCPA 3N3EA 3CRW1 3B85A 4QM7A 3RAPR 3LW8A 1E2DA 1SVLA 1RYFA 3BOSA 4TLEA 5IRCD 4KYUA 5FFMA 1NMXA 3QXJA 3MJRA 3ZQ6A 1NBME 3GUFA 2QBYA 2ZYWX 2GEVA 2ZE6A 3AUYA 1DELA 2NTYC 3K0CA 5GVRA 4MDFA 5TY0A 5LD2C 3IPXA 1S3SA 1XXHB 2BMEA 3QVUA 4KLNA 2RGNC 3CRQA 1D8TA 4Z1MA 2GTPA 2H18A 5JCZA 4PO1A 4P32A 1KNQA 4IEIA 2HDNB 1X3SA 1W4BA 3B1VA 4Q03A 1KI8A 5F2EA 2OFWA 3BERA 2O52A 4M22A 4G5OA 5LB2A 1DADA 1KJWA 1XPUA 2O8EB 1E1RD 4PC1A 2A2ZA 3TUJC 4MRRA 5JWOA 3FDIA 2AHOA 2ZRMA 1CR4A 4ZCLA 3EPLA 1VG1A 1E9AA 1TQDA 2FSGA 2J0UB 4DB2A 2O8BB 4KBGA 2Z6VA 3HU1A 4EAQA 1R6BX 1PJRA 4BECA 2BVNA 5B30A 3SS8A 4Q9IA 2QSYA 1N5JA 1SVIA 2C9YA 2PLFA 3DPUA 4I1SA 1DAMA 1G18A 4LHXA 4DRZA 3EX7C 4LK2A 4Q1FA 3RS5A 2BKEA 4B3CA 5EE1A 5JRZA 2QUZA 4PO9A 4AK9A 2ORIA 2OE2A 1H8EA 4HB2A 4QGAA 3GFPA 1ZCBA 3ICEA 2QENA 1MOZA 4KFUA 1FNMA 4QM6A 5JS8A 1KI3A 2H8KA 2CVHA 3GLHB 3K9GA 4DCVA 1EGAA 4KFSA 2JDID 2RHMA 2OFOA 3W90A 5B2ZA 3AKDA 1LTQA 1YRBA 2AR7A 2D2FA 2WWFA 2CE7A 1NY5A 4RCYA 4EIWA 1AZSC 1GKIA 4V0ME 1JAHA 2QORA 3DHWC 4GP7A 2K8QA 4PCKA 4OKSA 3SYLA 5JWHA 4M1MA 4I4LA 3SDZA 2GJAA 3X1YA 5DYIA 1G7TA 2R8RA 4DXAA 4D25A 1MRSA 3THWA 1Z47A 1ZM2A 2WWYA 2IHYA 4A0RA 1S8FA 2CDNA 4D4LA 3OIWA 3T12A 1S4QA 3Q7QA 4FCWA 1MO5A 4I1VA 3AGQA 1P72A 4HAXA 4B43A 4HAWA 4XVQA 3K0SA 3SU8A 5LDDC 3GEIA 1NMYA 1X5MA 1GKUB 2RGDA 5CK5A 5D3QA 3GPLA 2WAXA 3AH8A 2VYFA 2HJGA 4DLVA 2GAAA 4HI0E 4RZKA 2LKCA 2B7BA 2XSZD 3ICQB 1JQJC 8OHMA 4RFVA 1DAKA 4YDSA 2R9VA 3OEHD 1GSIA 2A5FA 4RCZA 3O8RA 4Q48A 2ZRAA 5DI9A 4YXWA 3FMPB 4MDEA 2IS6A 2VSOA 1P2UA 4HLDA 4Q47A 1E2QA 1UBGA 4MGIR 3DKPA 4OQFA 3KTAB 3L43A 4UJ3A 1E0KA 3VAAA 1PLLA 3CPHA 3SYKA 3IQXA 1C9KA 2GEUA 3CRVA 1G6OA 4PAQA 3X1WA 4TQ9A 1JJVA 3U3KA 2CG9X 4JSYA 1G1MA 4G1UC 1SKYB 2OHFA 4YMUA 2OT3B 1NNEA 3UPUA 3K0AB 5TVKA 1H65A 3KQHA 4QKQA 2N3JA 3LQRA 2XNDA 4PO8A 3RS3A 3TSZA 1GFIA 4MYTA 2J7PA 2OBLA 3T5GA 3NEJA 4Q01A 4V0LA 3TR5A 3QF7A 2RGBA 3KJHA 2QTVB 2I1QA 3Q7PA 2FU5C 2ZTSA 3U3RA 2OSBA 3WP1B 2ZI6A 2IYLD 3CX8A 3RRMA 3U2QA 1ZJ6A 3LVRE 2ZYUX 1E9SA 1AGRA 4QFMA 1G17A 1U0HC 3WP0A 1BKDR 2QMEA 4PAMA 2AK3A 5CITA 3KKNA 2ZJ5A 3AF2A 4GRAA 5JEDA 1Z07A 1HQCA 4HUTA 3ZVRA 2GCOA 521PA 2WSSD 4IRUB 3Q9LA 2N0KA 1BMFD 2JDIA 2YC2C 4HATA 1IAQA 2ZR0A 2ZJOA 2R65A 3CKLA 1GNQA 2FJUA 5G41A 3L82B 4B3XA 1OSNA 1NVVR 2XAUA 3NVAA 2FPKA 2ONJA 2WPDD 1II8A 2F3TA 1JBKA 4DCNA 4OHZA 1CJUC 5GVSA 1KTVA 4OBEA 3IUYA 2EQBA 2VHCA 3BB1A 2ZI4A 4TYPA 5CYOA 1ZNYA 5KSYA 4BE7B 1XF9A 2HYDA 3B8HA 2G3YA 1WGVA 2ZEJA 4ZCMA 2J3EA 1S96A 3EUDA 5AJYA 2I3BA 1NMZA 1UKVY 2OUKA 2QPOA 3O8CA 4HLQB 1O87A 3ADCA 5FL7A 2X2FA 3WYGA 5KOYA 3AP2A 1JPNA 5JSZB 3LBNA 4JLOA 3AVYA 4DLZA 2EFEB 1MKYA 4M0LA 1DAGA 4AKGA 2ZREA 3NC1C 4JLDA 2XSZA 2FFHA 4EPTA 1KI9A 3ETLA 1EX7A 3OEHA 3RYTC 3EAQA 4B75A 4Q7JB 1S9HA 1KY3A 4TL8A 5L3VA 1J99A 4FW9A 2I1VB 1UEJA 4HDQB 1NL3A 3BAFA 2Y22A 4DHEA 1L2TA 5UKDA 1GRQA 2IUTA 4I1UA 1OH7A 1F2UB 3Q85A 1KI6A 4J0QA 2J5XA 4R2HA 2ZRPA 4ITRC 3EPJA 4A36A 3Q3JB 5AJXA 1KDOA 4PR0A 3ASYA 1TQ2A 4Q18A 3U3JA 1D2MA 3TKLA 1E2NA 3A58B 3LXRA 1ZM9A 4B71A 1X1RA 1NVUQ 4Q4AA 4D4MA 3MD0A 4DSTA 1ZNZA 3LLUA 4A6XA 2GJ9A 4LI0A 4E03A 3DMNA 2QTFA 4JLPA 3FGNA 4FMDF 4LSGA 2E87A 3HDTA 5FTKA 1NY6A 1DO0A 5KNDA 4ZKDA 2JLVA 1DG1G 1NVWQ 1AM4D 1IN7A 1FNNA 3THYA 4PHGA 1GKYA 1WXQA 5HR5A 3L0PA 4E22A 2O8FB 4UNRA 5KUTA 1XU4A 1MR3F 1OH5A 1NIPA 5SZKB 1F2TB 3NXSA 3OF5A 2IF0A 3AVXA 3AF0A 2JATA 5AUNB 5DS1A 2ZAMA 4YLCA 1KI2A 3SJZA 1XFAA 1HQYE 1G8PA 5E4FA 1P62B 1E0AA 1X8LA 3IEUA 5GJBA 4PXAA 4ZDWA 2IYRA 2ZANA 1WBDA 1RW4A 3W6NA 4BWYA 1P9NA 4ILEA 4MRPA 4NONA 1W5TA 5EE9A 3SHFA 2XOKA 5AJWA 5IK2A 3K70C 1NLZA 2PH1A 4GL2A 3CO5A 2GNOA 4KSCA 5KPDA 2ODEA 2YWEA 2XNSA 4AKHA 1T6NA 2OAP1 4HZIA 1VHTA 3D8BA 4TLCA 3O47A 4O0MA 1LS6A 4MKFA 4UNPA 1N5KA 2BOLA 3BFXA 1XCGB 1XTIA 3K0CC 4QNRA 3T34A 4FI3C 5JECA 1R4AA 4MH0R 2D3WA 1TF5A 2GF9A 4LV6A 2EVWX 1EXMA 1SULA 2WMOB 2ODBA 3CRMA 5JWRA 4TQUS 1FMLA 1T0HB 2AWOA 4B6FA 4P4TA 3LV8A 3W1ZA 2XCMC 2QL6A 2VHTA 4CT5A 1CR0A 1G8YA 2AL7A 2IEZA 2OILA 4LOAA 4LYHA 4DT1A 1XDBA 3QORA 2H5EA 3GQBA 4D26A 5G53C 4DSOA 5EXTA 2JLSA 4IOKA 4PZLA 2QG6A 3OFNA 3EASA 5ANRB 2IXFA 4NYMR 2G0TA 1VMAA 4MGZR 3PXGA 4NP6A 3D6TB 3ZVNA 2ATVA 2P5TB 2ZSBA 3SBEA 4C30A 4BFZA 1A4RA 4B33A 3SQWA 1G3UA 4KI0A 3PUYA 4TMWA 3GMTA 4D81A 4RD3A 2AKAB 4L9WA 3CONA 3AVVA 1OT3A 1U81A 2IEYA 3TUIC 1I2MA 3FFAA 1DTSA 1AS0A 4BASA 1SHZA 4HLUA 4EPVA 5FUVA 1XTJA 1Y3AA 3GLAA 2KJQA 4Q9JA 3B78A 1BS1A 2OZEA 1Z3IX 2DY1A 5BYKA 1WDTA 1A2KC 3GLIA 4NCJA 4EJSA 3E1SA 2H7VA 1XEXA 4Q1AA 1J70A 1W0KA 1KSJA 4Q21A 4YONB 1GITA 5JZVA 4JKIA 1SXJE 1Q1QA 1SXJB 3QE0A 1HA3A 2VRWA 1OYYA 4JJKA 3THOA 2O8CB 3HP1A 3FFBA 1EJFA 4LC1A 4ERNA 1G3RA 1OKKA 1Z83A 2V1UA 4LYAA 2W2VA 3EC1A 4C9BA 4EPRA 3EIQA 1P2TA 1TEXA 1NBMA 2PCJA 1M7GA 1XNJA 3TVTA 2CXXA 1JXMA 4XH9B 1TL7C 1CXZA 4D2IA 4NCIA 3THWB 2LCFA 1QHYA 1W46A 2Z43A 4TTPA 4D6PA 4I1OA 1DVRA 1WE2A 5FTMA 1HURA 5EP1A 3QSYA 5CIQA 1G4AE 1KAOA 2TMKA 3RWMB 2IA5A 1E96A 1E2PA 1ZRHA 3TRFA 3AUXA 1DAIA 1OFIA 2FX3A 1RRGA 4A2WA 1G64A 1OB2A 4PHHA 5JI2E 1KJZA 3DM5A 4EFLA 4Q1CA 2WJ7A 1BH2A 1SGWA 3PJRA 2P67A 3ONWA 2BCJQ 2NO1A 1RYHA 2WJHA 4DDVA 2RKOA 1E6CA 3CPJB 2FN4A 5CK4A 3T1QA 1US8B 2J41A 2P3SA 3AVTA 3KKMA 2J59A 4P4UA 3B13B 1HTWA 3AABA 1R0XA 3ZIAD 3IEVA 2QAGA 2FSFA 4I81A 2YKGA 2F9MA 4BRWA 2J46A 4XSHA 2KLRA 4PPGA 1FX0B 3KJIA 4B47A 1E2KA 4D4JA 1UEIA 3B1ZA 3EA5A 2RGCA 3BJIC 4AKEA 1UADA 1W2HA 2PLRA 2WZQA 5HZKA 4NH0A 1EFHA 4UNNA 2FEMA 2ZE7A 5H70A 3ZZUA 1MO4A 4B76A 2JCSA 5FTJA 3IILA 1LB1B 1OXUA 4TQAA 5CYPA 3ZS8A 1X8JA 4A8JB 1KK0A 1K6MA 1GUAA 2CMKA 2QSZA 2IUUA 5FPTA 3U60B 1N6HA 4V0MA 1OJLA 2FGJA 2ZS8A 2F55A 1LNZA 2F3RA 2VP4A 3K0FA 4IDQA 4PPFA 3U6BA 2XXAA 4XSGA 1CJMA 2DWOA 1F3OA 3VX4A 2J0VA 4NKRA 3M1IA 3QY0A 4JLMA 3ZYCA 3P1JA 1TUIA 3GJXC 1X1SA 3EIEA 1NSFA 3OESA 1ESMA 2A30A 3LRPA 4L8GA 5DI3A 3GP8A 1R7RA 2WVJA 1R0YA 1HE8B 1E9EA 3T61A 4FIDA 4CT4B 4OJKA 3FKSA 3AP3A 2EYUA 4JL5A 1II8B 3IKJA 1QHNA 3QKTA 4RSGA 3RABA 1W1WA 3TR0A 2PZFA 4DCTA 2Y8EA 1G5RA 4PQYA 1ZNXA 2A5JA 4WZ6A 1N6KA 1MO3A 2CK3D 1R10A 4DLXA 1KO7A 5HCNA 1HH4A 1N25A 3C8UA 4IDOA 1TNDA 4ZI2A 2VA8A 2ZAOA 3MG9A 3PG5A 4FWTA 3NBFA 5JMTA 4KITB 4MYHA 3BB4A 3KUDA 3WNCA 1NJFA 2YOGA 4K8OA 2GXAA 1OXXK 2ZJZA 1L7VC 1EFRD 1ZU5A 3I73A 4HUQB 1QG2A 1TUEA 1DG3A 1NLYA 5CM8B 4B3FX 3ZQJA 2WBLC 1F6BA 2AK2A 4W5WA 2BBTA 4XWOA 3GEEA 3G5UA 5D3MA 5J4HA 1BOFA 3TGPA 1ZD8A 2QE7D 2VHJA 2ZSFA 3OAAA 2QI9C 1DEKA 5P21A 2WIAA 4AYWA 2IL1A 2VQSA 1TF7A 1CU1A 4LBZA 3SHWA 1PVOA 5FBQB 4URWR 3UWKA 2D2EA 1RRPA 4AG6A 3QI2A 3E70C 5FBLB 3FHTA 2ZU0C 2O5VA 1NLFA 4LBYA 3EZ9A 5DO9A 1Q20A 3CM0A 2FGKA 3FMOB 4NYJR 1X8KA 3BORA 3MJHA 4OHVA 1H8HD 4XOIA 3ZGXA 4DSNA 4E09A 5KU1A 3K70D 1EWQA 4BLQA 2OBNA 1K5GA 5AUQA 3NBXX 4Z8XA 1T5IA 5EXPA 2F1RA 5BN5A 2FMXA 2H17A 3BH0A 5GJVC 2G83A 4V02A 4DCSA 3EPKA 2J0QA 2DB3A 1AIPA 1ZCAA 2IK8A 2ONKA 3EZ2A 4WA7A 4Z1MD 2ZUDA 1JECA 2KB0A 5DN6A 2D4HA 1VCNA 3TMKA 5FR2A 5BXQC 5IF9A 1WBBA 1Z6GA 5FTNA 1HV8A 1XMVA 2J7KA 2PL3A 4TSFD 4ASUD 2WKPA 1XPRA 1T3SA 2ODWA 1ZUIA 4P3YA 4M1WA 4QGHA 1W4RA 4W9MC 3SFVA 4KV9A 3GEHA 4Q19A 2NZ8A 4RY2A 1BIFA 2YNMA 2OM2A 3W5IA 1ZIPA 1KJYA 4Q02A 1NP6A 2ASEA 3J81k 3LX8A 1XPOA 3B9PA 1KI1A 3L1FA 1JI0A 1QHHB 1TQ4A 1G20E 1R2QA 1KDRA 2MSDB 3ADKA 3QKSB 2QM7A 4HEJA 2C78A 4MKIA 4RZ2A 1ZU4A 3L2OB 2YC4C 5M04A 1Z6TA 4U7DA 3N2IA 3UK6A 2ORVA 2CK3A 1IN5A 1YZNA 3GFOA 1T8TA 3SE0A 2JAQA 3GCGA 5E7JA 3GLGE 1AZTA 1V43A 3KKOA 3GLGB 4RKFA 1H8ED 3TSWA 2ERYA 2W0MA 3KL4A 3QORC 5SZHB 1JXOA 2L0XA 2SHKA 1EFCA 1T3LA 3OE7D 5E7MA 4B44A 1RJ9B 2R6DA 1KO4A 2YHSA 1LS1A 1NG9A 3X1XA 2C03A 2C04A 2IS4A 1XD2A 3W8RA 3I62A 1KSHA 2VL7A 4YMTA 3T15A 5L3SA 3AEZA 1ZNWA 1GMEA 1E2LA 4AIIA 1KK2A 1CP2A 3AKCA 4KJZA 4BLSA 4HLUC 1N0UA 3U7FB 1G291 4EPXA 5TV2A 1G8HA 3KB2A 3TW4A 1OB5A 3EWAA 5DISB 3H4MA 3NG1A 4S35A 4A9AA 1TTTA 4EJSC 4A15A 2C96A 1H8HA 4JBYA 1WB9A 3EG5A 1P7CA 3SQXA 1KK3A 1FFHA 5SZIA 4F7WA 2XZOA 1CBUA 4A1FA 3P26A 4WOPA 3VR1A 4D80A 4BLTA 3SR0A 2YWHA 1XXHE 4YXWD 3R7WA 1WQ1R 2JA1A 2W00A 2IYZA 2CCKA 5EE0A 2XEXA 3I92A 4DEXA 5JI3E 1YR6A 1S0UA 2JASA 1Q1BA 3THXA 2CCJA 5LD2B 4JKYA 1HT2E 5JBQA 1GOTA 2F7SA 3UXMA 1ZBDA 4PHFA 2O0HA 1OXSC 4TSFA 4A2PA 4ASUA 4R71A 3B6EA 2QMUA 4ZPXA 2FFBA 2QRZA 3B2EA 3L1EA 2FV8A 1EK0A 1E2HA 1M1YE 2P6UA 4GOJA 4O25A 1MRNA 2IUSA 4P0TA 4ZIRA 4FN5A 2ZRNA 4FD2A 2XNDD 4ARZA 1EFTA 1Z8FA 1SKQA 4IVQA 2J7PD 2ZR9A 4QRHA 4RVCA 3NH9A 2HCJB 5FOUA 3L0IB 3FWYA 4G5GA 4DKXA 4JLKA 4JVLA 2Q6TA 1KSGA 3CB4A 4ZCIA 2EFHB 3RNLA 3VKGA 2D74A 1YZGA 1YKSA 2Q0HA 1UAAA 2NG1A 4JSTA 5B58C 4AD8A 1TF2A 1D5CA 4WZAE 1QF9A 4DLSA 4S2EA 3WNDA 2AWNA 3DM9B 3DOEA 2BBSA 3GLHE 4AYXA 4QJ5A 3OE7A 3TSOA 3ND9A 2ZI3A 2MMCA 3CPEA 4DIEA 2B7CA 2C99A 1E2JA 4B6EA 3KXKA 1EG7A 3P4YA 3VX3A 1W0JA 4C2UA 2ZRBA 4B2PA 4JT4A 2Q21A 2QAGC 3HJNA 4Q1EA 3WBJA 1IBRA 2BCGY 2CJWB 5FPHA 4CEIA 1VHLA 1EX6A 4B48A 4WZBE 2IWRA 1Y63A 2JLYA 1LW7A 1E9CA 3GJ6A 2XTNA 4OK5A 1DPFA 4CIDA 3U3OA 4BFYA 4C2TA 4AC9A 2HV8A 1QG4A 5FL7D 4OI0A 2PEZA 4XWAA 3QPUA 3I32A 1AS2A 4MGYR 2HF9A 1N0VC 3U44B 2DR3A 4JLJA 1SVMA 3W9YA 3CWQA 3ND8A 4KCGA 3AVUA 4EQ6B 2NO0A 4QC2A 4PBDA 4CRWB 2OESA 3K0FB 2H57A 1SQ5A 4P4SA 3BE4A 4DC9A 3TVDA 4LWZA 1E4VA 2FZLA 2AKYA 2WWHA 1MABA 3W8NA 5JEEA 1ONBA 3K0EA 3VQTA 2ZR7A 5DGXA 4AURA 1Z08A 4LJYA 4H1VA 5HE8A 1SVWA 4RKEA 4YE0A 3FKQA 4V0NA 2DFTA 5KDDA 5H1YA 2WIBA 3FE2A 4TMZA 2DBYA 4LHWA 1P2SA 3CZPA 3PUXA 4KAXA 2ZJ2A 1QBKC 4Q66C 3J07A 4BEJA 2ANCA 3I3SR 3MSXA 4LZZA 4W5JA 2X77A 3UKDA 3V4FA 4NCKA 3PEWA 1X6VA 4TL9A 3RC8A 4BLPA 3IIKA 4JVMA 5LUMA 1FL9A 1SKYE 1W49A 3BBPA 4RFSA 3V9PA 2BHRA 5DSZA 2BM1A 2BOVA 4M1KA 2CVFA 3AF3A 1VKJA 2VHUA 2XGJA 2QQEA 4KO8A 2A5DA 4KYIB 2QGNA 2O30A 5EZ6B 1G6HA 2W83A 4FMDB 2DHRA 2NZJA 4TN1A 2WWIA 3Q72A 5L3QB 2G9NA 5FBVB 5KYKA 2JLQA 2GXSA 3MWLA 4QHSA 5KDLA 4OI2A 4QGFA 1NVVQ 1T5LA 3H0KA 3P20A 3U7HB 2HUPA 3DDCA 421PA 5D3MB 3F8TA 4EFNA 2P65A 5HPYB 2WMNB 1KK1A 1S3GA 1WRBA 1ZC4A 1P75A 5DH9A 4LY6A 1M8PA 3CLVA 1J8YF 2OCAA 4AWXA 3GLFA 1HE1C 1A82A 3NHAA 3QENA 4Q4HA 4ELDA 1XWIA 3JZAA 2XOKD 1PZNA 2F43B 2ZRLA 4KVAA 3TH5A 2KE5A 5IK2D 1V5WA 1G8GA 1E9FA 4BZQA 3HR7A 2J0SA 1G3MA 2XB4A 3RVBA 1W36C 1WF3A 5H68A 4GOXA 3I72A 4QNMA 1ZP6A 5JHGB 1U94A 5DHAA 4LBVA 1CJTC 2N42A 2DYKA 2KBFA 5FOVA 4C0QC 4IOLA 5A0FA 5CDFA 1E98A 1KOFA 5EZ5A 3MWYW 1FMJA 5E7IA 2GJSA 3KFXA 4QBGB 2MSCB 1YU9A 2PX0A 4JZKA 2HT6A 1NSTA 2BIFA 3OIVA 2FE4A 1KO8A 2B8WA 4JBXA 2AD5A 1RKBA 1OIXA 2ZRGA 5E95A 2Z0MA 5FBWB 3QORD 4URZR 1G7SA 3QF4A 4Q7MB 2B8TA 1XRJA 5FOWA 1OFHA 4UNSA 4C3ZA 4MYUA 221PA 4MQBA 5AK0A 3X1ZA 3OFND 2FDCA 1SZPA 3AF4A 4KSBA 4M9ZA 3C14C 3MCAA 4X8LA 4DDUA 4ACBA 4JYBA 4ZO4A 4PSAA 2OCYC 2HXYA 4LJ9A 3IDQA 4NZYA 4BZPA 4ZI3A 4NHOA 5EE3A 3LD9A 4FMCF 2Q9BA 4LV5B 4Q9HA 1CULC 3TE6A 5FI1B 3KQLA 1CF4A 2FNAA 3L8YA 3AVQA 3EIHA 4GT1A 4CVNA 3WMGA 4YLBA 4M1SA 3A4LA 3HU3A 4KVGA 4JUTA 1OXTA 3SJAA 2HJVA 2YZ2A 5GJWC 4CEJB 5LB4A 4LV8B 4HDCA 3QOFA 4YMSA 1GIAA 3MGCA 2FSIA 1XTKA 2DWPA 4CGZA 1VYTA 1W0KD 1AS3A 2XX3A 5L3RA 1E1QA 1CEEA 3LA6A 5EQTA 2J45A 2IXGA 3ZD6A 2XB2A 3U7EB 1Z2AA 2JKIS 3QQ5A 1CTQA 3ZZ0A 4RD4A 2C9CA 3I61A 3BD9A 2KMWA 2FFQA 5FUYA 4M5TA 4Q7KA 4GI7A 4A0HA 1ANKA 1YR9A 2ZSAA 4TLAA 4PFSA 4A0GA 1OKKD 2CHGA 2JJ1A 3EW9A 2GHIA 1PV4A 4DWJA 2QNRA 2QP3A 3H86A 5BYJA 3TAUA 1UPTA 1NBMD 3VFDA 3W5JA 1RRCA 3IHWA 2E1RA 5BN3A 4R9UC 1LF0A 1FQKA 2WAYA 3FHCB 4BZXA 1UKZA 1DAHA 3MWJA 4HZUA 3NKVA 3CNOA 5EP3A 1G8FA 3CX6A 1N5LA 3KKQA 4LC0A 1XCPA 2V6JA 1LVGA 3SI7A 4OQXA 2ZUBA 1DO2A 2WWXA 3K70B 5CIWA 5JJIA 4NPHA 1KKMA 3LWNA 1GNRA 4L5BA 1TPZA 1ZD9A 3OIUA 4TT3D 4OI1A 3WNBA 2QBYB 3GFTA 1N0WA 3BFKA 5FOTA 1XMJA 4GSYA 4TYYA 4A4DA 3K1JA 4NYMQ 3C7KA 4IVPA 2IYTA 2GJ8A 3LVQE 3QUSA 3DL0A 2F1JA 4PQFA 3WRXC 4MKHA 2RMKA 1MT0A 5KSZA 1XJCA 1OYWA 4XWKA 5C46F 4IEEA 2ZSDA 5GADl 2WOJA 4RZXA 1RC8A 1XTQA 3BH7A 4UJ5A 3C15C 4JT2A 3QKRA 4DDWA 2B92A 1IN6A 3PFIA 1Z5ZA 1AKEA 4ZIRB 1JQLB 5FL3A 4BFUA 1KMHA 4ZDJA 3AQ4A 1FQJA 2ZU6A 4ARZB 2G88A 1HUQA 4D0LB 2R6AA 1EWRA 1T91A 2YINC 5BQ5A 1JJ7A 3AKEA 2BEJA 2ZJAA 4K46A 1HYQA 4KBFA 4LRWA 2ZROA 3VKHA 1KDTA 3PITA 1P9WA 3U61B 3JVUA 3FHOA 1Z0KA 3SJBA 4OK3A 3R9WA 2GZHA 3MUFA 3LW7A 1Z6AA 2GVZC 1G5TA 3K53A 3L8ZA 5C4GB 1S1CA 1GG2A 5FPYA 2WTUA 2UZ3A 2GF0A 1JR3E 5JFGA 1ZUNB 2P6NA 1Z6YA 3B82A 3PR1A 3G82C 1P6XA 2G6BA 4KFTA 3FKSD 4TMTA 2IYVA 1Z0FA 4DLTA 1GL6A 4ACAA 2ZRCA 2GZAA 4FMBB 4CEIB 3WHKA 2VP9A 4I99A 3T1OA 2WSMA 1S9DA 4NDZA 2JLZA 2VF7A 1P60A 1YJ5A 1COWA 1F60A 4C0HA 5DHFA 4B3GA 2F6RA 2FPLA 4DZZA 4JLVA 5KTYA 2MSEB 1XD8A 1QHGA 4LCBA 2P0EA 5AWFC 1J8MF 1XJ0A 5J47A 2RGGA 5K8TA 2GAOA 1G5PA 4EDHA 1U9IC 3SZRA 2JJ2D 2WJJA 4B73A 1ZINA 3LDAA 1VCIA 3QG1A 4PC7A 2ZVPX 5JCPA 2O8EA 5DNYB 4Z8YA 3WBKA 1JEEA 2O8DA 1T0JB 4FXPA 3IHLA 4TT3A 3QBTA 1GILA 5EXSA 3A1UA 4OK6A 3OAAD 1IOZA 2J0UA 1UKYA 1XB2A 4M1YA 4M53A 4OHYA 2O8BA 4IHQA 5DIFA 4L15A 4V03A 2JIZA 4F4JA 5AUOB 2GRJA 1NN3A 2EW1A 2CNWA 2H1LA 2C98A 1L4YA 2PBRA 4B32A 5DS2A 2A78A 5C1BA 3I1FA 1KMQA 4GP6A 2RH5A 1T3HA 2UZIR 4DB4A 3B1WA 1WCV1 2QA5A 4C0LA 3KXLA 3AV0B 4OI4A 3PUVA 2FFAA 4TYQA 1T8UA 2NOAA 5F98A 1W47A 3RSOA 3GJ8A 2BBWA 1Q44A 2HLDA 2QP9X 1FP7A 2GBLA 2QROA 1W36D 3BS4A 3LBIA 2Z4SA 3U4QA 1Z0AA 1S2MA 2VBCA 3RS7A 3VNUA 2QMOA 4DIDA 1ODFA 3Q8XB 4TTRA 1XZQA 2P6RA 1UF9A 2OEPA 3IGFA 5DN6D 1KI7A 3CNNA 3NDBB 5G3ZA 2QY9A 3I8XA 4BGDA 1KNXA 1Z0JA 3OEED 4BFXA 2FG5A 3L0OA 1XCMA 2ZE5A 1Q22A 4GFDA 4A92A 2BC9A 3A8TA 1C1YA 4RZ3A 3X2SA 1XD9A 2CL7X 1VG8A 5J40A 4DSUA 3C4JA 4FEIA 1OXVA 2AXNA 2GCOB 2ZRFA 3L1GA 4JMPA 4R7ZA 2ODNA 1CKEA 3GLFB 2BM0A 4Q4HB 1SHKA 2IW3A 2R6FA 1M2OB 1QVAA 2FZ4A 3CZQA 2QAJA 5KDOA 1MV5A 3R8FA 3WXMA 1A7JA 4QGGA 1Q1ZA 2D7CA 4M8NE 3QJYA 4TMXA 1P3JA 4V0KA 1E99A 5CJPA 4B74A 3A1WA 1II9A 2MMGA 5HKKA 2EWWA 5AR1A 2GCPA 4C0KA 4DCUA 4TL6A 5EE5B 4GDFA 2VSFA 4PX9A 1VG9B 2IX3A 1NVXQ 1P4SA 2QN6A 2DFLA 4B3DA 2PJRA 1SHSA 1OH8A 3QF4B 3ECCA 2JJ2A 2WV9A 4DJTA 4MKGA 2R6GA 4I88A 4Z54A 4JS0A 4ON9A 1EESA 2LWIA 2YV5A 2XZLA 1OFUX 4O2LA 2RGEA 1B0UA 2V1XA 1XMIA 3UMFA 4IW3B 5F9HA 3Q5EA 3BC1A 2P2LA 3QEJA 5BW8A 4URUR 5KO2A 2R62A 2OCBA 3PUWA 2J87A 3M4YA 3K09A 2BJWA 1G21E 1ZUHA 3VQLA 1FPMA 4LHZA 1KI6B 1D6JA 1Q3HA 2IYYA 5F3WB 4EKDA 5EUMA 1ZYUA 1IN8A 4M21A 3VR5A 2OAQ1 2GZDA 1N6IA 5FUWA 1GNPA 1VIAA 3QG5A 4Q4AB 5LBIA 2GK6A 3CR8A 2WHXA 3LQQA 1J7KA 4URYR 3FYHA 2Q3FA 3CW2A 4TMKA 2C95A 4LJ6A 1LY1A 3R9XA 4URVR 1G7CA 2O0KA 2O0JA 3CRRA 3THYB 3B9QA 5H8WA 2XTMA 1YZLA 3K9LA 3N5CA 2FEOA 3NHBA 1ZAKA 4Q4JA 1XBTA 2OLKA 2C2HA 3L0SA 2OV2A 3IPYA 4AI6A 1MH1A 4XVUA 4US2R 3OEEA 2C5LA 2ZPTX 5J5CA 3O8DA 5FOXA 2VP2A 1Z06A 4Q1BA 5AJVB 1SVOA 4KHZA 1M6NA 1D9XA 4RD6A 2REOA 3RS0A 5BWMA 3W3ZB 4QHTA 1GP2A 5FPSA 4URXR 1PUJA 2ORWA 2RGXA 3BFVA 4C0AC 2ZS9A 4HZUB 5JSZA 1E9BA 4TYWA 2GCNA 3A1TA 4CW7A 2V54A 1E2IA 3N70A 2GETA 4G5SA
chains in the Genus database with same CATH superfamily
3C70A 5EHFA 5GM2A 2O5CA 3B6ZA 5FOBA 2J3QA 3WC4A 3ZMEA 2DWTA 1XZPA 3RSLA 5DVNA 3KR3H 1BDJA 3GT7A 2ZJBA 5IW1A 3HFFA 1R6AA 3K1AB 1PT5A 4NPAA 4E15A 2PJZA 4EAEA 4YE4H 1G9TA 2HJFA 4F2EA 3KQYA 2PR4H 5FGCE 3ZJYA 4X9XA 2VXVH 5FJJA 1KMNA 3MMSA 4KQFA 1OU0A 1T1JA 3K6IA 2PZEA 2F68X 3I2GA 4QRRD 5FXMA 1G7RA 2JD2A 4Y6OA 1QVOA 3WRYC 5MEPA 3ZTCC 2NY7H 1M1XB 2XI9A 4JJ4A 3GLIB 5J2TF 1GZHA 3D7MA 3EGDB 2K9UA 3GK8H 2GX6A 4LZJA 4N9GB 5CBPB 1HH9A 4YK7A 3UHAA 4JQOA 1TKRA 1P4RA 5DDHA 1EFDN 4ZRMA 4Y9TA 4GD3Q 2D31B 2XVMA 3VGDA 5FM4A 1B6DA 5CGYD 4RXMA 1NGZB 4K94C 1C3JA 1ACCA 1ONNA 1MT3A 4J23A 2LABA 5HVHB 3RWIA 2ZRIA 1A1MA 3OKKB 1ZJZA 4O8ZA 1GYWA 1SAYA 3O03A 3TE7A 3MOGA 3MTBA 4I1YA 3JQ8A 1QYGL 5HI5D 5BQ7A 2MPVA 3VR6A 3S2UA 2FLVA 1A4CA 1L5ZA 3UCEA 4UPDA 1Y5MA 5D7BA 3RK4A 3DDUA 4TTTS 3X3FH 1JLSA 4KVNH 2ORBH 4WO4B 3M8OH 4LXTA 1J39A 2HVKB 2X2OA 4CG1A 1UMDA 4Q4LA 3SQOA 3A11A 1Y6QA 4TKUA 2WXKA 4E5KA 1IC7L 1Q4NX 3ETBJ 3ICCA 1HWWA 1KQ3A 2IDZA 1RXEA 4AMZA 2BYTA 3QCUH 1F56A 1I7PA 5EG5A 2XUJA 4ALLA 2FIRT 4GC9A 3R7FA 4BPRA 4KMQA 1U8OB 3LS5H 1MC1A 1YAHA 4JYAB 2OD2A 4X8OA 4Z7QF 5DJCA 3MWFA 1RIVL 5IEKB 3Q06A 4PJAA 5I73B 2FPSA 5IH7A 3E7XA 1OT1A 4FXGA 1F9AA 4XODA 1AMOA 4LXUA 1CJVC 1Y6GA 3LF1A 2VUOA 4PB0H 4PYGA 4LLDB 4PR5B 1QIEA 4F38A 3CWCA 2MIZA 4RESB 2QV7A 1YVDA 3AM5A 3OE5A 4ZYXA 3LPCA 1E2MA 4P5TA 5DUPL 3L49A 5FH9A 4TYUA 4G43A 1PP4A 1KU6A 5H3CA 1BYIA 1IM3B 5I7VA 3CX4A 4EG1A 5FPQA 1I1AA 4DV4B 2E8ZA 4XP6H 3IJ9A 3QIBC 4F9TA 1Z8DA 4RDHA 1WAMA 3VM6A 1OXKB 3NHRA 3IT1A 4PANA 1Z2EA 4Q3EA 1X1EA 3AIMA 5HQTA 3FPAA 2P7TA 1NCBH 1TCBA 1TYBE 4RD0A 2GN9A 2VYVD 5DI8A 1P17A 1Y1QA 1WOMA 5INCB 4YEFA 2VR1A 1MEJA 3SYOA 1OGPA 1IKNA 2V7HA 2FZEA 1KB3A 4GOKA 2HUNA 3KFVA 3ZWQA 4JFFB 2PV0A 5F3BA 1BQRA 3GJFB 2WWWA 1E60A 4UAGA 3MXOA 4KE7A 4XVRA 5IC5A 4JHLA 4B3SB 2QADB 4YBLC 2HA7A 2JI3A 1XH3A 2JJUA 3RRZA 3NACL 4N8VG 2ROYA 2ZSEA 4KAFA 4QJ4A 3RUGF 2L17A 3L05A 3ISWA 1LDSA 3UATA 3S3JA 1LC3A 4G8GE 4IZHA 2I76A 3GXOA 4B35A 1SJHA 3BHJA 3BZBA 2AQ2A 2FY8A 3QXXA 3B89A 1H69A 1AHMA 1IY2A 2OOSA 3JWDH 1K5WA 2WJYA 4KK9D 1EJ2A 3BP6A 5AWNH 2OHVA 1ACXA 3TBBA 3LYRA 3HFML 3RT7A 1FSKC 2H0QA 3EXG1 2DM4A 1RXSA 5JW3H 4XBGA 3LLSA 2J33A 4L0ZA 2ZJ8A 3OOJA 4AJEA 3QVWA 1F6AA 2NVBA 4IGIA 5IVDA 4L5FL 4WGFA 2JKSA 3BC9A 1R8JA 3ZYIA 5T3UA 3HA5A 2NYRA 3KKKA 4F33A 1RWKA 4XRCA 4D74A 3VU9A 3UMRA 1VAHA 2YN4A 3MUNA 3I52A 2YICA 4PC2A 4U1IA 2A9VA 3GLGA 4UOQA 4HPOH 1CB0A 1AQYA 5F7EH 1H0DA 3KCNA 4CEHB 2F1HA 4U2FA 2AUMA 1UA3A 4R97C 1O97C 2J9FB 3MI6A 3ZVVA 1BZOA 5T6BA 3K9HA 5I76A 4PBSA 5HDQA 2UWEF 3QEAZ 3EGVA 2Y06L 1CC1S 1E4YA 2B14A 2K7PA 2A9RA 4Q24A 3DC2A 2WJ3A 3TO4C 3IQZA 1G7HA 3D5QA 3UH0A 2CO4A 1XNGA 5EHZA 5DASA 3AWDA 2QDWA 3BZFB 1RZPA 4IGBD 2V03A 3CLHA 4LBWA 4I46A 4MXQD 4GIAA 1RWBA 3PRZA 1NANI 4HXBL 1MQKH 3LHPH 4XOEA 1NUUA 3TT3H 4GUPA 5AB9A 2AHRA 1XF4A 2NGRA 1VPLA 4RVFA 1LDEA 2BMAA 5F89A 1RRFA 5I45A 2FF7A 1SQ0A 4LF3B 5AOBA 1GPOL 5HHPA 2VSXA 5ERWB 1GTVA 3HZ3A 5K45A 3T9EA 3SDDA 5KBKA 1NSNL 3DNKA 1CUFA 5G0WA 5IHUL 1HZHL 3LNTA 4LVNC 2G9VA 2FZ5A 4NENB 3PUIA 5HJ5A 3HNTL 3S81A 1R4MB 2IOMA 1AZZC 1N9GA 3E3LA 1G3QA 5EMYA 1P0SE 3ZI7A 1UWYA 1TJYA 4INPA 4EUNA 2UXBB 3K5SA 3LC1O 2P7HA 4D5GA 4ZJUA 1DUYA 5DRZB 5LBSA 3K71B 3L7BA 2WT4A 4MV6A 2YBRB 1RQLA 3KB1A 1XAUA 2X2UA 4YZFF 3QJTB 3O2WL 2PGIA 3BEWA 5HUQA 2X2EA 5I8OL 4NWUL 2HKFL 1FY2A 3U25A 2XHZA 1VDZA 1RMTA 1YE3A 4HDIA 4F5YA 3CFEA 3TBKA 1CE6B 4Z53A 5DUBA 5DJYA 1QQAA 2PSSA 3DVLA 4BFGA 4JPWL 5A06A 1MZPA 2X70A 1NKSA 3ZHXA 4ZYKA 1AKNA 3D3KA 1F0KA 4NO2B 3RHFA 1EAOA 1JTOA 2PEYA 3MA0A 4ECNA 2NV6A 2ZI7A 4P48A 1G19A 2EP5A 3A1VA 3ML9A 5B5SA 1JGDA 1XCJA 2C3WA 4RGOH 4IQ0A 1PLJA 2EJCA 4RA9B 4PJAF 4P9HH 2W6JD 2KWIA 5I3CA 5KNBD 3SNHA 4K6FA 1E1CB 2AYXA 3HMKA 1YAJA 4LGMA 1XXLA 3VR2D 3RBGA 3A1CA 3EQ8A 1BFOA 4WWKB 1KWKA 2WCSA 2DCUA 3QX3A 2F43A 5IJ0A 4GL4A 3OV6A 3F5WA 3C8MA 2YD6A 2XOEA 5D1ZC 2BHTA 2AJXL 4WXMA 3ZIAA 4XO4A 5TB5A 3H2YA 1I1CA 2XNAB 4D97A 1XZNA 1JAIA 5BV7B 1KMGA 5EPUA 3A6JA 3IM1A 1ODSA 1XP8A 3NH6A 1VGKB 4WFQA 4FFYA 4M8IA 2NQ3A 3D09A 4NM4H 4MDRA 3OFVA 5HGGS 4LCUA 2NO6A 1JXQA 4HG4K 2A5LA 2GOYA 2ZJ1A 3OZTA 3CSUA 3Q43A 2EDNA 4KK8D 2VC2H 3BSWA 5TE4H 3INUL 5CJOL 3SS9X 4WHMA 1M34E 1Z12A 1MHHB 1RZRA 2GYUA 4J0DA 4U0RB 3K81A 2W93A 4MMZB 1Q16A 1JW9B 2LR4A 5E7QA 3TN0C 5JO5A 3FSEA 1JDZA 1R0ZA 2AFHE 4MW2A 1XGTB 1GA6A 2BC4A 4B6GA 1TO5A 5AZUA 1RI1A 4JGJA 3DHPA 3VB8A 1ZLVK 4OIAA 3LL4A 3SFZA 1SMKA 5LWYL 1GVHA 1F2DA 3MRHB 2C4TA 4OHBA 4HUVA 3JV4B 5A4DA 3W4IA 3ZVKA 1AD9B 1SHLA 621PA 1RVDA 2WJ5A 4K5MA 1HSBA 3S5UA 4PZDA 3AVPA 1BZ7B 4QNPF 5CWSA 3N75A 2BKXA 1MAVA 1G1OA 3CRW1 3TS8A 5F33A 4RWZA 4XWTA 3OTHA 2OGZA 4YHHB 3VXOB 3V5KB 3L01A 3M6DA 4WKCA 2AC0A 5EGNA 4DAGH 4C6HA 3ABSB 1ISRA 2RGNC 3KVNA 2XCTB 3FR7A 5CG2A 4H8HA 3EMBA 4HT3B 3QUXD 2EX0A 5LU8A 3B1VA 5EC8A 1I4OA 1QZ3A 3R2JA 1XPUA 4EW6A 1WSBA 2O8EB 5CW2A 3TUJC 3PQYD 4L3CB 3FWZA 4TZTA 1IL1A 3CHSA 2ZCLL 1KELL 4ZYZA 1NKVA 2FSGA 1EGMB 5JLAA 3GEBA 2X88A 1QCYA 4DSZA 4FFBA 2G7MC 5G4KA 4AVIA 4KDTA 4X0NA 1C14A 3NIDB 1M6UA 2OPBA 4DNOA 2Q86B 1DAMA 2P2DA 4ZI7A 4JZJA 1JD7A 1FLAA 5I4IA 1H8EA 3GFPA 5M3BA 4G8CA 3CNQS 3QUHA 3K15A 1QBML 4LF7B 3C3WA 4DCVA 1UK9A 3C5JA 1DT3A 5AI0A 3W90A 1K2VN 2NAPA 4LJSA 3SZKC 1HDCA 1F97A 1NCCL 2VM3A 1AH1A 2OW6A 1GKIA 3QRBA 1QK3A 4G6JL 3OOHA 2H65A 3GIDA 1RK1B 4JFDD 1JAYA 1FVXA 5E6IA 2ADFA 3M07A 4A0RA 4QT4A 5LQKA 4S1SH 3IKLA 2EZTA 1FC1A 3FU8A 2AG5A 4UNTA 4C7JA 5IFJB 3FQUA 5CVUA 2B3IA 2VYFA 4IXWA 3O9WD 5KEZA 1KTDA 1VADA 3RWJA 3RHSA 4BUZA 8OHMA 4GXRA 3STHA 4JY5H 1JOIA 1VPTA 4YXWA 1EGQA 3HBMA 1THTA 2OI9B 3LKZA 4O4LF 3DEAA 4MGIR 3LHKA 2C4MA 3BN9C 4NH4A 4KOBA 5BS0D 3GCZA 1MAKA 5F6IB 2GIYA 2FJHB 3KQHA 3N43B 1HJBC 2ZWSA 1NW6A 1PX0A 5CDTA 1FYTB 2ENUA 4XC1H 1D5XB 1YS6A 4NUMA 4OXQA 3Q05A 4HFNA 4C4AA 4I4NA 5EG6C 3FQTA 3VM7A 4WFHD 3D4BA 4KKRA 2Z09A 1UPFA 4EHAA 5JAPA 4QFMA 2GI7A 3T6VA 5I4BA 1GR1A 4FMVA 3EULA 1HKUA 3B9BA 3UTCA 1HOXA 1M9SA 2QD3A 1DSWA 3G5XA 1V5JA 4JFEE 3U2IA 1VMKA 2XAUA 1MBZA 2D0PB 4MRAA 5F7UA 1M72A 4HIXL 3BMCA 2CRIA 2R69L 2HD4A 3AY0A 1WGVA 4QRQA 1Q1NA 3L1OL 4DOMA 1G0YR 2VW7A 3TZLA 1BIIB 1FYDA 2PMBA 4ZOLB 4OT1H 5A1JA 5C2UB 3MCYA 4JLDA 2VRCD 2G9QA 3DT8A 1KI9A 4P46A 1WJGA 3ESQA 2R6HA 1NUDA 3BE1L 3LYLA 4X99B 2FPPB 3BAFA 4ZCRA 5E1AB 1JDVA 4DP9X 3ANLA 4CDNA 1P3Y1 3KMDA 3J80A 3GGJA 5EZQA 2E18A 4PR0A 3U3JA 4DNPA 1JHDA 4AN4A 3KZ8A 2H1VA 3VV3A 5J6GA 2GJ9A 2I34A 3QEQD 2BNUB 4C5BA 3MROB 1ODIA 3OZIA 4L2LA 2J8OA 5J13C 4AJ0A 4WFGE 4UNRA 4F3FB 2VYNA 3T7KA 3IFPB 3CS3A 1TQBB 4NRXB 3UMTA 1OA0A 2ZAMA 3ZLVA 5IFHH 4AY5A 3Q0TA 3ES6A 1TCMA 5FA8A 1SYSB 3ZJAA 2EDMA 4I9WE 1SJXA 4PEEA 4KI5C 1PI3A 1X8LA 4RIGA 1F58L 3RUHA 4R68A 4W9EC 1OK0A 4Y6LA 5IK2A 4TUKL 4N20A 2D2VA 4WLEA 3NGBC 3KT3A 2AUTA 1JI3A 4P57A 3K0CC 3C8DA 1Z4IA 5JECA 1BXVA 3D39B 5ALDA 4B6FA 5HRUA 2XZCL 4F2MA 3V0VB 3ILEA 1DC6A 2EIMB 5EOVA 2GRAA 5EZYA 2JJSA 4GQAA 4Z7VA 2JLSA 4Q3OA 3SZUA 3ZVNA 3HE6A 3NOIA 1JU3A 4PVLA 2J72A 4G86A 5EZOH 4Y6GB 3KHQA 2W6QA 1SOVA 4YROA 1U81A 5DZOA 3IBSA 3QMMA 5AVKA 3WSQH 1EJ8A 1H85A 1AS7A 1R6XA 1SHZA 3TZEA 4ZK8A 1UH3A 5JQGA 3U9PH 4DN3H 1UWVA 4W1SA 3GSRA 3WNQA 3V4PB 2BI8A 2BR5A 4ESOA 3RFRA 3VFGH 2FH8A 3G5YA 3WNPA 4KXZI 1BC5A 1NINA 4L6CA 4LGRB 5D96B 1F1JA 3I9JA 3I3EA 3JYOA 5FB3A 3ARVA 2D5AA 4PJIA 4CKEB 4NP9A 3EC1A 2D4DA 1M7GA 1XNJA 3L7LA 2HGSA 2FK8A 3T6QC 4QY8A 1T1SA 2AF4C 4AZVA 5T5FA 3TRFA 2FR1A 1JYEA 3QXAB 1BF5A 4X6FA 3MMXA 4N9QA 1Z3GH 1XLTA 5B7GA 1F42A 2IW1A 1OBHA 2EEXA 1G64A 2AJSH 2WYVA 3SSOA 2DIJA 5D4QA 2Q3BA 4BTEA 1SGWA 3L4XA 2NO1A 1VZHA 4YQXH 2A6KB 2FE0A 5HYSG 1FNBA 1NPTO 2VZVA 3IGKA 3A1NA 2OBYA 3DTVD 2OPCA 2J46A 4HDMB 5HDBF 2LLLA 1BW9B 3DMPA 1CD8A 4LARL 5I1GL 2WAQA 2MQ3A 1W2HA 1ZWLA 2ZE7A 4PCUA 1CT9A 2XXMB 4EATA 4A8JB 4WCVA 1ZS2A 1H2HA 3K0YA 4WNIA 4JR2A 1D9KA 3IB6A 4F2GA 3ZCPA 2XXAA 5B7NA 2RBEA 5C07D 4R54A 4I1NB 3QY0A 3UA3A 3DHJA 1X1SA 2XY1A 4N0CD 1BCSB 2JCWA 2WVJA 4IKKA 2Q3LA 1CIJA 1AT1A 4NUPA 1QHNA 1G0XA 7MDHA 3LRXA 3UBTA 2A5JA 2DWUA 4M0EA 3N05A 3VJRA 3G9ZA 5HCNA 3A67H 4IDOA 4PJ7B 4UU0A 3OLYA 3MRCB 2XA9A 1Z7GA 3NBFA 2BFBA 4CMKA 5JMTA 1J5OH 2AQTA 3S36X 2VQ1B 3PHOB 1XGRB 1E30A 4KH2A 5CJQL 1E7SA 1CFQB 2WBLC 4Q97A 1F3JA 1DVZA 5I7FA 5D3MA 1UXSB 1ZD8A 1HYEA 1K5NA 4JFXB 4G65A 2EP6A 3G2QA 2VQSA 1P6WA 3AQDA 1G21B 3UTSD 1H0HA 3UWKA 2CUMA 2HKFH 4GEIA 5H4ZA 1OHZA 4L8SB 4PR3A 2YAFA 5JIPA 1TIBA 4ZFOB 2CSXA 1XQ6A 1JG2A 1Q92A 4GSLA 3HK2A 4TWJA 1WMEA 2G83A 2J0QA 2ZSVB 4PINA 3QQ3A 2W8ZA 2IU3A 2ZOSA 1VCNA 1E8MA 3FZQA 5BXQC 2CD7A 1QCCA 4EGJA 4TQHA 2Y1LA 4HN9A 3WXBA 4DYHA 3LD8B 1SNYA 2IANE 2YMTA 1D6NA 1J0IA 1ADCA 1P5UC 4Q3BA 2NZ8A 2B4CH 4GIPD 1UZ8A 4GPVA 4MCAA 3QI9A 1J88A 2BEVB 5SY9A 5JLZA 2C78A 3LGAA 4MKIA 4XT1C 3V6OA 1JWBB 1M3IA 5DZLA 3HCBA 1A14H 2HJHA 3OHXC 5KVEE 1ONPA 2JAQA 2CE6A 3UK0A 4XIJA 2W0MA 2PBZA 3QORC 4M0PA 4DFIA 2K7QA 5AW6B 4RAVB 2E7HA 4Q6BA 3TBYB 1R5IB 3NX4A 3JQAB 1LEIA 2UYLB 1E4XI 3LKPA 1BOGB 5DRNA 3PNPA 4YSCA 3MO1B 4KPYA 1NJ9B 1IVNA 3GIVA 2YHUA 4EG8A 4BFBD 3SQRA 3ZO0A 1G291 3E9ZA 4AW9A 1H22A 2UX7A 1OB5A 3TJPA 3ULVC 2AQHA 2HFTA 1M2VA 1N3NA 5E9DB 4J3UA 2ZATA 2VLRD 1KB5H 3VR1A 4I9XA 1PQ4A 4XFKA 4L4TE 2M6LA 2H3NB 1LPBB 2PUCA 4CL2A 3KOYA 3V8OA 2F64A 4N25A 4MX7A 4O08A 1GOTA 3WRXA 4COOA 2H5UA 3WS6A 5ADUS 2Q5LA 3R0QA 2QMUA 1DL7L 1O6SB 4HGQA 1A9EB 4M1ZA 2IZ0A 1E2HA 2P6UA 2FO8A 1NLBL 3DL4A 4K3EL 1R1DA 4BO0A 1NEPA 4GKZA 1MIOB 3CJQA 5CUQA 5DBFA 1GNTA 1R3LA 4KKZA 2ZR9A 4QRHA 3NH9A 3ULSB 3SDXB 3WV5A 4JVLA 2H5JA 1KSGA 5FC9A 1FVDA 3LZCA 4OGLA 2SKCA 4K8RB 3VKGA 3EUEA 1OGTB 4GHWA 2A7BA 3C9NB 3ZSSA 3QUYB 3QTLA 3VZPA 3H5LA 2VWPA 1FLTX 3A26A 4KKXB 1SQ6A 4RV9A 3VTAA 3I01A 4G1CA 4L7VA 1D2RA 1PZ5A 2AGJL 2PY6A 1UJCA 3ZDXE 2B7CA 2BNRD 3SKOA 1AG6A 1P4BL 3EGWA 1TZHB 3ZKNC 1Q0YH 2GTZB 1BEEA 3BOVA 5F6HI 1E9CA 4YCDA 3GJ6A 1CF2O 4OK5A 2O54A 3G68A 1BEYL 4YQEA 1W59A 4QYOB 5KVGH 2QR5A 1LK7A 1NE7A 1W0YT 2CSPA 4UDTA 1OWOA 4QQNA 5C6PB 3HBJA 5KTKA 1JK8B 1U8JB 5G4MA 5JQGF 1EQ2A 4KQ3L 4OM1H 2M32A 3FCYA 2NXYD 5CVTA 4JDTH 4GWLA 5B3SB 2VDOB 3KYOB 4RV4A 2Z1NA 3VG9C 4WSKA 4PBDA 3MBEA 4J1QA 1U3FA 5ICGA 3DVNB 3VQTA 1XF3B 2GFHA 4DJFC 1WXWA 1LPNA 5KDDA 1A4XA 4PJIF 5F96H 1JGVL 4RAUB 2ZZUT 5BVHA 3CDYA 4KAXA 3WLPA 3K8MA 3MSXA 3QJHA 2C3OA 4HDRA 1DDHA 1UOEA 1MQSA 3E6FB 4YN3A 1K3UB 4M1KA 3AF3A 1VKJA 3UY4A 4NYLB 1JF1A 2OMKA 2R7EA 4KY1H 1V95A 1HFKA 1DQIA 2F54B 3D0QA 1NVVQ 3W0WB 2ADJA 1Z7BA 4LCJA 4MKZA 4D9LL 5CFPA 5A9SA 2P5YA 4YSEA 4LRUA 1LEKB 4MHOA 1O95C 5J3JA 4MDJB 2KE5A 1LD9B 3MPCA 4N26A 3LDBC 3VE0B 2J3LA 4DNFA 3I72A 2J73A 4M3NA 5JHGB 1CY2A 2OYSA 3KLAA 1E98A 2WBJB 1L9PA 1JZDC 3ZGIA 4AYEC 1E18A 3O4HA 3AU0A 1HI6A 3NOOA 2VNHA 1PG7W 2XR1A 3CFKB 5EIQA 5FW8A 4N0UE 2LE9A 4J3FA 3MJEA 1H6CA 5J2UA 4MYUA 3O4OC 3HNVH 3K80A 1WPQA 1AHKA 4EKXA 2F62A 5F0LB 4X8JA 4MV5A 1FBIL 5BUSA 4I8DA 2C26A 4EELA 3BL5A 2VAJA 3Q0EA 4Q9HA 4E41D 3J8F7 3RY6A 1AXEA 4NKOB 5KUKA 5AM2A 3QWFA 4GYWA 3HU3A 3U9SA 4BE5A 2PX8A 4MARA 1PJCA 3H9SE 1VKXB 1E1QA 3VRLF 4XPTH 3F3KA 2P3LA 1CZHA 3RBAA 2N59A 3QHZL 1FORL 2DJUA 1V4BA 4RD4A 3SVLA 4HWZB 5C92A 2IQ9L 2WZDA 4A6YA 4Q7KA 4GMFA 1EWHA 3BJMA 5E9NA 1AXSA 2BSSB 2GHIA 2PKYX 4P4NA 2JF1A 5REQA 1UPTA 4QTXA 1KR5A 2I5PO 1XKLA 2UZ1A 2YFOA 4LCCA 2E1RA 1KBPA 4GKSA 3K5RA 4IRJC 3Q41A 5AVQB 1RMFH 1ANUA 5LDSA 1PZFA 5C0CD 1GL3A 3H6KA 2FZCA 4CA4A 1OLSA 3EMKA 3LWNA 1DL5A 2AEPL 1GNRA 5C09E 4OI1A 4FULA 5ED4A 3BDXA 4PJEB 2IYTA 3QUSA 4MJ7A 3BKXA 4M61A 4PAWA 3NVMB 5ARCA 5GADl 1MAML 4O4JB 4OLWH 1YGPA 3R7SA 5CIPH 4BE6A 2NY4B 4YMLA 4P4GA 1JMXA 2FX7H 4D4GA 3DEYX 3BDYH 3DLIA 4K7PX 3P9QA 4NOKA 3W9DA 1KFBB 4HULB 4J3OF 4BHTA 2JLCA 4LO9A 5D5ME 2OOKA 1SDAB 1DVTA 4PJ5E 5AVOA 1C30A 4YK4C 4H0NA 5C4GB 5EUOA 3J81A 3IVAA 1EVIA 4KO6A 4EGCB 3ARFD 3BWUC 3NABH 2GM5A 1OZTG 1XYYA 4RS3A 1I6MA 4PYMA 1F02I 4HS3A 2PRJA 4Z9YA 4RK1A 4A23A 4K0OA 4TTIA 1MCQA 3FFTA 4YPFA 3MV8A 3G0DA 4X92A 1E8WA 3P96A 3FCBA 4TVPL 4J75A 5EZIL 5F1OA 2FEEL 3VW3H 2QV2A 4QYAA 3I45A 1JT9A 1M1YA 4HQKA 4IHJB 1YE5A 1VHQA 4R05A 4L4JA 4OSEA 4OZGE 1NN3A 1D5MB 3QUCA 3BKCH 5TJHA 1S7TA 1U7TA 4YSOA 2R0ZH 4QICA 2NZXA 1WZAA 4HH3C 2P2SA 2PKRA 3R6LA 5FYLL 2DI9A 1DKUA 2NOAA 4PHCA 3I04A 2HLDA 3CIAA 3MBXH 3GAFA 3RU2A 3BVNA 5KBDA 5HI5C 2HRGA 4I13B 3U1TA 5HJDA 3W1VA 3BKYH 1CUOA 3MIIA 3K1ZA 3O38A 1MJ8H 3SO3C 1DMSA 3PJGA 3ZRSA 1VG8A 2ZRFA 2P4QA 2Z92B 4RF5A 2ODNA 1PZUB 3EFBA 1O6TA 2FZ4A 1YF3A 3C6BA 4DE5A 5JNRA 3QQ4B 1KJVB 1NF9A 3OZ9H 1U9CA 4LGVA 2PMFA 1LRLA 2XB9A 3I0NA 3A1WA 4YRDA 2P5EA 1HDMB 1TYZA 1JNHA 4FQCH 2HF2A 3QEGH 4PY7A 3ECCA 4GKOA 4DJTA 5IFAL 5BMFL 4IXTA 3UMFA 5CR9A 4ZMAT 2EYTB 4PREB 4S0SD 1FFSA 4BKLB 3GD5A 3KYBA 1ZYUA 3L07A 1KLGB 3SYMA 3S1SA 2AK4E 1SPDA 2Q1TA 1YN6A 3OB0K 3K6SB 4DCJA 1M6EX 2ZT6A 2H52A 1W6WA 1L5QA 1RHJA 2ZFUA 3DV4B 3KS0J 3MMEA 1CBVL 1TTCA 2Q8BL 4LJ6A 3OR7A 4YZWA 2NUAA 3THYB 4M0KA 3WR5A 4B0MM 1U5CA 3NV7A 5D5HA 1PE0A 4AYBA 1EUYA 4LG1A 3QVTA 1V96A 4OXYA 1LWOA 1FFNB 1GGIL 2R0LH 5B7PA 1WXFA 4OXXA 3TIGA 2P6PA 3RS0A 4BXOB 1ZI9A 2TECE 1BQ4A 5DM1A 2GCNA 3JVGA 3RWBA 3HG2A 2LGJA 3ZT7A 4DKTA 2JHPA 3JV0A 5AVTB 1MVYA 5DHTA 4GMDA 4WHYG 1EBBA 4U6QA 3DRTA 1PX8A 4MRNA 4EGSA 3HG1B 2WVHA 3BEOA 1YMUA 2MJWA 5E2BA 4Y1AA 3JYLA 5JQWA 5J2UF 5CJ2A 1XPJA 4B3EA 3GHBL 4LHQB 3IR5A 1HESA 1OUMA 4DPMA 4ODVL 1GTSA 4NM8H 5C3LD 2L04A 3EOBA 3QEUB 2IGFL 2WLZA 1A9PA 5E3HA 5IWLC 2PQ0A 4EKYA 3HR5A 5KINB 3P9CA 5DNCA 2D6FA 5DGHA 3R4CA 3ND6A 2VITA 1QNLA 3QDME 1L4UA 3K8OE 2MHAB 3O75A 1I85A 3KQUA 3DJRA 1C0PA 1HLPA 3MREB 2Q7XA 2ZCKL 3VXUE 3A6ZA 4LKXB 2N46A 3FPJA 1J12A 5C6TH 2REXB 1OM3L 1BOOA 1SN0A 4JPQA 5JBIA 4JM2B 3RRFA 3SBDA 4DWVA 3EZYA 3WE1A 1EJOL 4PLOB 3WZMA 3TIVA 1CFVL 1J0BA 3IDNA 3K6NA 2IAMD 1Z5GA 3R6TA 4ISBA 4OGWA 1ZRSA 4AL8L 4OPMA 3ZIMA 1KXQE 4NE7A 1NOKA 2G67A 4YR6A 3NSJA 1UKCA 1FTNA 1UPCA 3FNRA 1EHLH 4P0DA 1ZGBA 1WO2A 4UUNA 3LHIA 3NIFF 2XTJE 4MAAA 4FHBD 3LGXA 4BNLA 4N48A 4UFOA 2PX3A 1U93B 3ZH9B 1NLMA 2UY7A 3OSZA 3ONFA 1KOAA 3P94A 3MAGA 3U40A 2P2ZA 2PMWB 4ALJA 1JHLH 4XO8A 1F13A 2V6IA 2D8MA 5ESQA 1U6IA 3F7PC 1HHGA 2X7LB 3OP4A 4L4RA 3PWLA 5F73A 3X44A 4FYXA 1MW8X 3A1SA 1W30A 4R1MA 4TVSa 3ECWA 4C57C 2ZRDA 3RDPA 4OLYH 4ARUA 3R5FA 4KUCD 4L3ED 3V0WL 5JRJA 1DL7H 1U9IA 1ZUWA 2VZUA 4XPHL 4YHNA 2IBMA 1Z7WA 1YJDL 2Y92A 2MTPA 3PAZA 5EUOF 4MA7L 5KSVA 1NOJA 3TGXA 3T3PF 4IGBC 1K8XB 3C43A 4OZIB 4MXQC 4PZZA 3S35X 3S99A 2VYCA 3B7TA 1VSTA 4WQOA 4U6XB 4FMCB 4ETQA 4CVXB 4DDTA 4G6FD 5C0ND 1A9XB 3VSUA 2NPOA 4KXVA 5GONA 2AS5M 5BPPA 3N28A 4KK5D 4Y2JA 6REQA 5D7JA 3KPRA 5AVRA 4AWJC 1QH8A 4QRUB 4PSDA 1VIYA 2WM2A 4QOKA 4JWKA 4NQCA 5IEHA 4NQRA 4PJXE 3NRJA 1NC2D 4QDGA 5IROA 4Q34A 5IMSA 3P9KA 2DBVO 4FQIH 4FGZA 3N0AA 5T8KA 1LFDB 2RI1A 3IN0A 4BX8A 5DK3A 1RTTA 1UBHS 4C8XA 3HUJB 5DTIA 2BWDA 3BWBA 4PG9B 5AVWB 4UI2A 1Z75A 3PDOA 1J22A 2JRLA 1P4IL 4ZUTA 1AXTL 3BRQA 1ULSA 5E1HB 4LSSH 1OD9A 1HR0B 1Z28A 2R1WA 1I3GH 4OLBA 1Z73A 3I5YA 3QJZA 1OHHD 3QFTA 3KVYA 4GMTL 4HC4A 1XL1A 3JUYA 4BAUA 2H1PH 2W58A 2J3JA 4U2EA 1FE8L 1JGVH 2HH0H 3WYRA 4MAMA 2QVCA 3DEIA 3ODPA 4LDJA 2O4CA 3DCNA 1B9ZA 2YPLD 1H2YA 4UVDA 3B3IB 5KTSA 3RYMA 4NCC2 3ECVA 1SIWA 4D8TA 1W8OA 1RL1A 2Y2YA 4JBWA 4P58A 1XGUA 2C58A 1VJTA 1VXRA 1GPWB 1YKGA 4B3JA 3LLVA 3DO7B 3DMTA 5D7SL 4LIPD 4LPKA 1SHMA 1AF7A 4IV0A 3QDJA 3FK3A 3UZVB 1EGVB 3QR2A 3FXAA 2W65B 3PR3A 1H2FA 1DAEA 4D9GA 1BE1A 3BZEB 3NCCB 3Q98A 4LVEA 4DAEA 4DKJA 4LQFL 2VJOA 1A9QA 3FWPA 4HWEL 5BZDB 3GN2A 2FUEA 2A6IB 1OZ0A 4ODWB 5L3SB 2PUQT 5FYJE 5BRNA 4M1CD 3MACL 1GOFA 3FUCA 3TVMB 3M0EA 2G0NA 1XDWA 4KO5A 15C8L 1QRSA 2CLVA 1L6IA 3A6GA 4KZKA 3BXOA 1LI4A 3DE0X 1ZIDA 1VXOA 4F4FA 3EO9H 1OF1A 3P0VH 1Q21A 1W5AA 2ID8A 5EORL 2XHEA 3MA7A 4K1LA 4DBLC 4PCAA 2WJZB 4AYTA 3TSYA 4JFYB 4EARA 4KE8A 4L8CA 1G20A 3QCTL 3NGXA 3PWPB 3R23A 3KP1A 5AAMC 2OTCA 4DIFA 2QTRA 1DQRA 3RVMA 1KBWA 2ZIZA 2R0KL 2YTZA 2PSJA 4RMQA 1L5YA 3SC4A 1FORH 1AFVH 4N90E 4H60A 5C1OA 3B7GA 1F4YH 1QHXA 4KUEA 4KK8C 5EIEA 1BQHA 1VJ5A 4PGCB 2YVAA 1UOOA 1DQQA 1D1TA 3WRYA 4FABH 2WZ6A 2QL5A 2A3RA 4HRXA 4NQZA 2ZI5A 3UBGA 3QMPA 1NIFA 2WB7A 1RVV1 4B6JA 2IPUG 3IETA 3QBDA 5EP4A 5T5QA 2PR2A 1G41A 3KNBA 3EXEA 3L9YA 1SPXA 2ADOA 3SY0A 2N7BA 4HKJB 4EHIA 1ZK3A 1NCAH 4C4OA 3APNA 3ESBA 1IGYB 3V2HA 5JHMA 5C5IA 3OHSX 2IQ5A 2X6MA 3DGEC 3D85D 2X9NA 3B5JA 3R06B 2VHQA 4MRMB 5MENE 5HKAA 4UQEA 4MGKR 4DIMA 3KX2A 1XCQA 4WNSA 1TKAA 5JH7A 1ORVA 4HXFB 3E0XA 4UT6H 3T35A 4AYGA 4KQMA 1PEAA 2LVBA 2J1LA 3R6GA 3QUXC 5FA3A 4OHXA 1HYSC 4FEYA 4MB3A 1KI4A 1XZIA 5TTRA 1E9OB 4Y2HA 5ITZB 1X5AA 5F7DA 2W90A 4TMFA 3B1UA 4IPTA 1MHPH 2E6KA 1UZGA 2RH0A 2CJWA 4OP2A 2W6OA 4KMOA 2CCGA 4HF7A 4HXGA 2NYZA 1J1PL 2P30A 2Y71A 3K35A 3PVSA 3ER9A 4H27A 3ORSA 4BUJA 2Y7MA 1XHEA 1EX9A 3ETSA 1Z9OA 3DPDA 1L8OA 2H59A 3O9MA 5TGTA 3K2KA 3E3QE 1AOZA 3QPDA 3GQFA 3KT0A 1I4LD 5L7YA 2NXZB 2FJGB 4WU7A 1QO0D 3Q2LA 2EXWC 1MI5B 3MNDA 4EFDA 4NSNA 3B60A 5AW4B 1TM7E 2V6HA 3KTDA 1J2UA 1GAEO 5HYVA 2CA4A 3SEPA 2N47A 4P53A 5A9RA 1QLHA 1UM6L 1PVHA 4HHEA 1CF8H 1NGPL 4MVWA 1KXHA 1A88A 2OJEA 4TZ0A 3O9WC 2BEUA 4Q5IA 5CEZE 4YJ2A 2F1OA 1SLVA 3QIBA 4YJGB 4RZSA 1MFCH 4RS4A 1DKNA 1EX0A 4MJ2A 4N39A 1IKOP 3FB6A 5GONF 4Q6IC 2ED7A 2FECI 5AVZB 2ARKA 1JKXA 1Y6FA 1I7UB 1FIGH 3T06B 2Y7QA 2EDCA 1EBUA 4PW9A 5DN9A 1PDVA 3PIRA 3IFLL 4CFYA 4DP5X 1E9VA 3EOTH 5BSFA 2Q6OA 2H7WA 3G9UA 3CFIC 2ZIAA 1BF8A 2BX5A 3Q3GA 3RS2A 2X0FA 2OK8A 5C0AB 3EQ6A 4F7KA 4OQTH 1B8NA 3UFXA 3D3QA 2WYWA 4KXAA 2Z83A 4I50A 4KXWA 2NO9A 2ISCA 3O31A 5CFAA 4CHTA 4HQ0A 3L3DA 2UZ0A 3WMQA 3IAS1 2WEKA 3BF8A 4YUWA 3VXMB 2WMPA 1N7GA 5EU4B 3MT7A 4BNZA 3CH1A 3ATEA 4D46A 5CT6A 4PN6A 4FJ2A 1SLXA 4XKJA 4XYBA