3IGFA

Crystal structure of the all4481 protein from nostoc sp. pcc 7120, northeast structural genomics consortium target nsr300
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
368
structure length
333
Chain Sequence
ALILTFLGKSGVARTKIAIAAAKLLASQGKRVLLAGLAEPVLPLLLEQTLTPDPQQIAPNLEVVQFQSSVLLERNWEEVKKLEAQYLRTPIIKEVYGQELVVLPGMDSALALNAIREYDASGKYDTIVYDGTGDAFTLRMLGLPESLSWYVRRFRQLFTNQVNNFLDKGKEALADPKRVAAFLVTTADPLEVVSVRYLWGSAQQIGLTIGGVIQVSSQTEGDLSAEFTPLSVTVVPDVTKGDWQPLIDALPNFVEQAEQAPKPITIDTHNRQVRLFLPGFDKKQVKLTQYGPEVTVEAGDQRRNIFLPPALSGRPITGAKFQNNYLIISFLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target NsR300
rcsb
source organism Nostoc sp.
molecule tags Atp binding protein
molecule keywords All4481 protein
total genus 101
structure length 333
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
A PF17886 ArsA_HSP20 HSP20-like domain found in ArsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3igfA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3igfA01
1J2JA 1F60A 4JUSA 4PZLA 4A8JC 1MR3F 2J7PA 2G3YA 4RCYA 5DN6A 3GLGB 1S96A 1R5BA 1XD2A 1XEWX 3X1XA 1LNZA 4B3CA 1A2KC 1ZU4A 1IQPA 2BKUA 3PVSA 4X8OA 2ZRJA 4M1MA 4E07A 1QHYA 4A8JA 4DSTA 5FI0B 1C4OA 3B8HA 3AP1A 2R8RA 1BMFD 4F4JA 2HLDA 1FQKA 3KFVA 2CL7X 2PJZA 4DWJA 2QSZA 4G5QA 3QF4B 5SZHB 2ZQ5A 1KHTA 3RC3A 4DSUA 1IHUA 1RKBA 4MUBA 3DM5A 3H84A 3MWKA 4Q1CA 4TL7A 2VO1A 3ZH9B 3GLAA 1YZTA 2V6IA 1ZMXA 1CEEA 1OFTA 4HZIA 3W3ZB 4LC0A 2XJ4A 3GFTA 4UNQA 3VTKA 3SYLA 3PFIA 4LY6A 3IO5A 2WAXA 4CEJA 5KSZA 5AUOB 3THYB 3IILA 5G53C 1M7GA 5J40A 3EPJA 2FF7A 1JEEA 1HYQA 5KOYA 5FPHA 2JKIS 2Q0HA 3ICQB 3AVWA 4RD4A 1CXZA 1FMLA 2QG6A 1E0SA 2HLDD 4CVNA 1WDTA 2W6IA 4EPWA 1KI1A 2R9VA 3CH5A 3ADDA 1JBKA 2F3RA 2ECKA 1Z29A 4NCKA 4HZUB 2Z83A 2O8BA 1KZGB 1FX0B 4KLZA 4UNPA 4LJ8A 4PPNA 2C03A 3DPUA 2V6JA 2GCOA 1BOFA 3FWYA 3B7GA 4GSYA 1UDWA 3VQMA 5HKKD 2OUKA 5LD2B 2QMEA 2O8DA 4PSVA 3GJ6A 4OHVA 5L3SB 1XDBA 4Z54A 1UEIA 3P26A 4TMKA 2O52A 1PVOA 1KIMA 1OKKA 2ZI7A 2VP5A 1YU9A 2WKQA 1XTRA 5DSZA 2Z5FA 3O8DA 4OQLA 2B92A 4NTZA 4LWZA 4C0JA 3GJ8A 2EYUA 3M1IA 3AGQA 5G40A 1PUIA 2DR3A 2VP6A 2BJWA 2IUSA 1VPLA 1Z6YA 5CITA 1ZU5A 2F1HA 3RSOA 2QPAA 3T35A 4KU4A 3ASYA 3GJXC 4BZPA 3LBHA 1N3BA 2WJIA 2F9MA 1GIAA 4HAVA 2ZJBA 3CNNA 1L7VC 2I3BA 1E1QD 3BB1A 4DIDA 1E94E 4C0AC 3M4YA 3FB4A 2OO7A 4JKYA 1JPNA 1KZ7B 2F6RA 2NO6A 5GJWC 2RGXA 4A9AA 5HZHA 1XTQA 3Q9LA 1NG9A 2QAJA 2QQ0A 2BDTA 3PUVA 4NYIQ 1XP8A 3P32A 3VU9A 2BVNA 1GRRA 4LOAA 2IBMA 3VKGA 4A6PA 3SJZA 4NCNA 5DS1A 2Y22A 1VCMA 2PEYA 4W7SA 4PAMA 1ZAKA 4MJHA 1G7SA 1JR3A 2WAYA 3A1TA 3CM0A 1G17A 1XB2A 4LDJA 4PQYA 2QUZA 4LJ9A 4JBYA 4LK2A 5FH9A 3MWJA 2YKGA 1EJFA 1J70A 2WSSA 3AKDA 3QF7A 1G5TA 3KXLA 4GFDA 3IGFA 2WHXA 2A5GA 4C0LA 2F1RA 3SI7A 1KO7A 4UXIA 3QXHA 4HAYA 4HZUA 2VRWA 4EJSC 5JLJA 3R8FA 3K09C 1E9FA 1FX0A 4IOMA 3BERA 1XJ0A 3K9GA 1VG8A 3THXB 2QY9A 2O8CB 2AWOA 1SXJD 1N6IA 1OIWA 3AF2A 4ON9A 4CIDA 5B57C 3K9HA 2BCJQ 3W5JA 1SXJC 5GJBA 4LYHA 3RS4A 5K8LA 1LF0A 4Q9LA 4TTQA 2ORIA 3SJBA 4B2PA 5JBQA 4MUAA 4P4UA 2QP4A 1G7CA 3AKCA 4BZQA 5HPYB 1WB9A 2E87A 5C46F 2V54A 4MKIA 1L2TA 4E22A 3PIRA 4HYYA 2GHIA 1N6PA 3K0AB 1GL6A 4R2IA 5JECA 2ZRAA 2OILA 4A92A 3VFDA 4QL3A 1E6CA 2FX3A 1KO5A 4DEXA 4LHWA 3NC0C 2G1JA 4G01B 5KNDA 5HR5A 1KO8A 5DO9A 1T8UA 4URUR 4GZLA 3QXXA 2QP3A 4O0MA 4D81A 3LD9A 2BJVA 4PTLA 1G8FA 4IFEA 1RRPA 5JSZB 1G64A 1E9SA 4D4LA 4LZZA 3AF0A 5KPJA 3CRW1 3HPQA 3QG5A 3GEEA 4TMWA 3D31A 3CNLA 2O0HA 4HB3A 3A4LA 5KSOA 2EWWA 3AP3A 4PR0A 3ZIAA 2GCPA 3GLFE 3RNLA 4AG6A 1TQDA 5BN3A 5JFGA 4A2QA 3BS4A 4GDFA 4QHYA 4URYR 3BH7A 2XGJA 3B2EA 2JJ2A 1VIAA 4WVFA 4LGMA 5JI2E 5KDOA 4AKEA 1Z6AA 5JS8A 2QP9X 3FMPB 2O30A 3HYTA 4GRAA 1E2QA 4RZKA 2VIIA 4DLTA 3KZ1E 2JLQA 3C7KA 1IONA 4TYYA 2BCGY 1N25A 3AUXA 2ZM5A 1XF9A 4Z1MA 4AY2A 5CB6A 5AJWA 3U3KA 2JGNA 4ITRC 1YR8A 4Q4JA 4A82A 4CYMA 2EFDB 4JLDA 2OV2A 4UNRA 4LHXA 1KI7A 2E9SA 1EWRA 1K5DA 1XX6A 3X1DA 1ZUNB 2XJ9A 1L4UA 3E70C 2E1RA 1JB1A 2FFHA 4ZPXA 4B32A 1C9KA 3AUYA 2YWGA 3IIKA 2AN9A 2FPKA 1U8AA 3GLIE 2VP9A 1XPRA 2UVQA 2W0MA 3KKMA 4R7ZA 1UKYA 1SXJE 1UM8A 3B5JA 3ZZTA 2P6UA 1OIXA 2WIAA 3HU1A 2O8FB 3SYNA 1TQ2A 1II9A 1MKYA 1XEFA 3KQNA 2F43B 3AACA 4P4SB 2ZI4A 2P5TB 4JS0A 2V9PA 4KVGA 2DY1A 3K0CA 5JWOA 3RS0A 2F1JA 3I92A 3A1VA 1GITA 4XVUA 2CL0X 3QI2A 4I1OA 2FE4A 1F48A 3TSWA 3OEED 1W5SA 4LPSA 2AK2A 2PT5A 3AB3A 2XZLA 3BXZA 2EYQA 2YWEA 4PC1A 4RZXA 3VR2A 1GTVA 1XZQA 4OI2A 5G3ZA 4B33A 3LO5A 3K70C 3PEYA 2A3RA 2B8WA 4I1UA 1JNYA 4JLAA 2ZU6A 4DDTA 3RABA 1HURA 1MO5A 2AKYA 4BZXA 4UJ3A 4AK9A 1EFTA 3Q9QA 4GOXA 2ZJZA 1HQCA 1ZD1A 1VIYA 1DBSA 3SU8A 2P0EA 2XOKD 3EPKA 3WMGA 3GEHA 3EARA 3ZQ6A 4RSGA 1Z6TA 4NONA 5FBLB 1MRSA 4QBGB 5E7IA 2ZRKA 3DDCA 4RZ2A 1DADA 4JL5A 3G5UA 1SHSA 3QSYA 5EJEA 4BLTA 1NVWQ 1NMYA 5P21A 3R8CA 1AZTA 5C2JB 1P6XA 1E79A 3NH9A 1WFIA 1M7HA 2VBCA 3B13B 2YHSA 2BBSA 3BBPA 3V00A 5EXPA 1T9HA 1T3LA 3QE0A 5HE8A 2BV3A 1X1SA 4JIMA 5KSYA 2HXYA 3FGNA 4BWYA 3GLHB 2YNMA 3GCGA 1RIFA 3HDTA 3I5YA 3LY5A 4QGHA 2ZAOA 3IHWA 1XEXA 2ZI9A 3CX7A 1LVGA 4QC2A 3S1AB 2L0XA 4IEIA 4CEIA 4D25A 3AVQA 3N70A 3WMFA 5KPDA 4BFZA 1TPZA 2AWNA 1ZM2A 1SQ5A 5HCIA 1ZM9A 3RRZA 2W2XA 5CB8A 4F91B 4GZMA 1FNNA 5JWRA 1KMHB 1KSFX 2JJ1D 5FTNA 3NBFA 4WIAA 3OAAA 3TBKA 2REBA 2JLYA 4OK6A 1G41A 1ZD9A 4YMWA 5AJYA 2F43A 1J7KA 5D3QA 4DSOA 3NBYC 4C0KA 4D82A 1DAMA 5G3YA 5SZKB 3W6OA 4M1OA 4ZIRA 1S4QA 2B8TA 4FCVA 2WKRA 1UKEA 4ASUD 3GPLA 1G291 2CBZA 3AF1A 3KJHA 1CBUA 1FFHA 2GEUA 4M1SA 4RFVA 4PAQA 1FL9A 5F98A 1ZUHA 3HJNA 2XEXA 3UG6A 2JLXA 1W0KD 1EXMA 1VKJA 1ESNA 1RJ9B 4JYBA 4MYTA 4NKRA 1XCPA 4EKDA 3BE4A 1JJVA 2GBLA 3MRSA 3L2OB 1TTTA 2C8VA 1XXHB 4PC7A 3CF6R 1S1MA 3N5CA 1SHZA 3D3QA 4H9GA 2XSZA 4A0RA 3K53A 4AURA 2C5LA 4WBSA 4IKEA 1JEDA 1G6OA 2ZJ8A 1AKYA 3VQTA 4KSBA 4NZYA 3FFAA 4G5OA 2G0TA 4M22A 4A0HA 2IS4A 1LW7A 1HE1C 1XTKA 2C96A 4RD0A 2OBNA 5EUMA 3RWOA 5KHOC 4B35A 1KI9A 1RC8A 1E0JA 3EIQA 3KTAB 4OK5A 5C18A 2C9YA 1P75A 5IT5A 1OT3A 1OW3B 4A36A 4LJAA 4KI0A 2YJTD 2QBYA 2Q3MA 1G3RA 2KJQA 2RHDA 3DZDA 4MYHA 4D4JA 1NN1A 3K0FA 1QDEA 4HLUC 1Z0AA 4N1AA 2IUUA 1W0KA 1Q21A 4URVR 1G8YA 3OIVA 5K8IA 2CNWD 4IHQA 4B76A 4OQXA 3OIWA 5BWMA 4HAUA 1NLFA 1R0XA 1W4CA 1XMIA 1GZSA 4D80A 3VR1A 3TGPA 3TR0A 3B6EA 4ZV4A 1JQLB 2H7VA 3LQQA 4Q4AB 1VCIA 4JSTA 1P9WA 4UXJA 3IEVA 4PO9A 3A1SA 3GLFB 4IEEA 3I61A 2XXAB 4G5RA 2D74A 1DG1G 2G6BA 4J0QA 1UF9A 2PT7A 4XJXA 2O5VA 4M2LA 1BKDR 2JJ1A 4Q47A 3DEFA 5DS2A 3SS8A 4BFVA 1DAGA 5CLLA 4YLBA 2X8AA 2YINC 4EFMA 2O8EB 2JATA 3B1ZA 1I4LD 3BGWA 1UADA 4Q4LA 3FOZA 5F3WB 2ZRCA 2AXPA 4QHSA 1YKSA 2J5XA 2QSYA 1NLZA 4YE0A 2BEKA 2D4HA 1KI6B 2RGBA 4RD2A 1GWNA 3QUSA 3GFOA 4BFUA 3J07A 3NTUA 3Q85A 2OAP1 1G7RA 1QRAA 1RFLA 5ANRB 2FDCA 1TMKA 4TN1A 2GA8A 4Q7JB 3U3JA 3VR5A 1D2NA 2MMGA 3L1FA 3VR3A 1VTKA 4YMVA 4WA7A 2XZOA 2JAQA 5JWHA 3GJ0A 2A5YB 1QHIA 3AVVA 1CJTC 1U0JA 3MWLA 3LRPA 5FUVA 3AEZA 3PXGA 4ESVA 4JLVA 4DT1B 4LHVA 1GRNA 5CLQA 2IXFA 2Q9AA 4II7A 2UZIR 3G82C 2VF7A 5KSPA 1Z0DA 1P7CA 1P62B 4FINA 4B44A 3TKLA 2CL6X 3I72A 3WNCA 3BRWD 4PPQA 2H57A 1NSTA 1E2JA 1ZW6A 1KI2A 4R71A 3PV0A 2MSEB 4XTRA 3NHBA 1Z0IA 2ZE7A 2NQ2C 5CIQA 1R7RA 2F9LA 1BIFA 4URZR 1SULA 4HLDA 1W46A 4ARZA 1JR3E 5KUTA 1F2UA 4DUGD 4AKIA 2VSXA 3ICEA 3KB2A 1OXXK 4DLZA 4TMTA 1YR9A 2VSOA 3U44A 3CPHA 1P2TA 1HT1E 1TUIA 4FWIB 2UKDA 1EWQA 4XIGS 3SE0A 1Q1EA 2C95A 4LBYA 2WJYA 1G9XA 1XJQA 1NIPA 5FOVA 4G3XA 1XWIA 1N6OA 3GD7A 4EPXA 4HB4A 2DFLA 3NHAA 4TSFA 5FTKA 4GMXA 4HLUA 1IOZA 4Q4AA 5JS7A 2X1VA 3PUYA 2J41A 2IK8A 3V4FA 4DZZA 3SQXA 2J0VA 4DVGA 2LCFA 5FR2A 2K5UA 3RWMB 3UPUA 5JJLA 2XITA 2DYKA 2WWYA 5J47A 1JJ7A 2PZGA 1KDOA 1OKKD 3B82A 3SBDA 2MMCA 5A5GA 2RGAA 5LUMA 3B85A 3SR0A 4R2HA 4DUGA 4LV8B 3W90A 4EPRA 5DN6D 3DL0A 1E0AA 4W9MC 2XNDD 3H4MA 3NIBA 4LSGA 3KJEA 5AJXA 3FMIA 4PCKA 1XMJA 1G20E 2YC2C 4TT3A 2K8QA 1DEKA 4RJLA 4GBMA 4HB2A 3ETLA 4MGZR 1CU1A 1FUKA 3K9LA 1Q0UA 4M21A 5J4KA 2XB4A 6Q21A 1Q1QA 4B73A 4QJ4A 4BECA 1COWD 1MABB 2BMEA 3EWSA 1E3MA 2REXB 3LH5A 4QXAA 2QORA 4DLWA 1OHHD 3IUYA 3PEVA 1OYWA 2Q3FA 4M4SA 4E09A 4GT1A 4PO8A 4DJTA 8OHMA 3WYAA 1VG9B 3WBJA 3WNDA 2W00A 3U5ZB 3ZLJA 3BIFA 2GKSA 4PQRA 2FZ4A 4ZIRB 4WXRA 3TIFA 4MDFA 2YOFA 4AYTA 4GOJA 2IYWA 5KU1A 2RH0A 4OHZA 2OM2A 5HKKA 3IO3A 4C4PA 1D2EA 1GKIA 2QAGB 3CKLA 3CW2A 4JBXA 4R98A 2QENA 1S3GA 2HT1A 1XEWY 3BD9A 4FD2A 4XWOA 4U5XA 4TL8A 4FN5A 4AYXA 2D62A 4HUQB 3KXIA 2Q9BA 2FFQA 2DWPA 3CZPA 2ZRPA 3X1WA 2VEDA 2V1XA 5F2EA 1Y3AA 1RL1A 2BWJA 4Y0AA 2ODWA 1DAKA 1TX4B 4NYIR 4O2LA 3CF0A 4TLAA 5HZKA 5FOSA 2CCKA 1KMQA 4Q5IA 1QG2A 1WCV1 3OESA 1CTQA 3LWNA 4JVLA 5DI3A 4A2PA 5FOWA 1RVDA 1KJWA 1N5KA 1QG4A 2ZRGA 4MGYR 3TSOA 4JLPA 1QHGA 2XXAA 2ZXUA 4D0NA 2ZJ2A 4CDGA 1IXRC 1G5RA 3CNOA 1Z47A 3FTQA 5GJVC 3Q3JB 5EZ5A 5HCNA 1AGRA 2D7DA 2W2TA 1B0UA 4OBEA 3BFXA 2YOGA 1P3JA 1CRQA 1N5LA 2JLSA 3SFZA 4XH9B 3KQLA 4MYCA 1I4DD 1W4RA 4NYJR 4CT5A 3MJRA 4DBLC 3BFVA 4LJYA 1COWA 1WXQA 4OL0A 1P9NA 5FPSA 4DLRA 2LKDA 3TUJC 1H8EA 3QXJA 3HYRA 3C15C 1NY5A 1ANKA 2QTFA 3QORB 1MO3A 4QBIA 4C0SA 1OH8A 2GJSA 1CJUC 1N6KA 4BUJA 5J4VA 3WRYC 4YXWA 1Z28A 1VHLA 2OFOA 2O0KA 3TVTA 4IVPA 1KSGA 4YONB 4POAA 5CYPA 3U6BA 2J3EA 5FOUA 1ZM4A 3A58B 3AVPA 1NKTA 3ADBA 2YYZA 5FL7D 2A5DA 3SFVA 5TARA 2ZRMA 4DDUA 4UNSA 1FQJA 3L1EA 4PBDA 1EFHA 1A2BA 4I81A 4RCZA 1U8ZA 1XMVA 4Q4HB 4Q03A 1J8YF 2VP0A 1KDPA 1XMSA 4B43A 3FHTA 4ZI3A 2NZ8A 1OH7A 4Q1BA 4Q00A 4BEJA 3NEYA 1H8ED 2OAQ1 1DO0A 4FI3C 4FXPA 2W6JA 4NYMQ 4GL2A 1US8A 2D06A 3OZXA 1W5TA 1Z08A 1BS1A 1OFIA 4ZCMA 1IY2A 3AF3A 4NYMR 1PUJA 3REFA 3GT6A 1HTWA 5SZJA 1TF2A 3CWQA 4XD7D 3WHKA 4QM7A 4KHZA 4LHZA 4NE2A 3EAQA 4ACAA 1TEVA 4PX9A 2BKEA 1LB1B 1T6NA 2FEMA 1E98A 1T4GA 1ZM7A 2GNOA 3P27A 3CBQA 1HT2E 1L8QA 2F7SA 1NVVR 2FPLA 1UBEA 3FYHA 3TW4A 2KLRA 1Z0JA 1QF9A 4MKFA 5DI3B 4F7WA 2V3CC 4NCIA 5FUYA 3H86A 3GJ7A 2CLDX 1E69A 2H16A 2REOA 2PLFA 3RS5A 4EQ6B 5D3MB 4C0QC 4L4UA 1DOAA 2A9KA 4IDQA 2DB3A 1SHKA 4B71A 1JR3D 4AIIA 1F6BA 2ZR9A 5CJ2A 5A4JA 3L0PA 2WPDA 3F5FA 4BFYA 1PLKA 2OESA 4MGIR 4V0KA 5EXSA 3X1ZA 3EG5A 3OFNA 3C16C 2RH5A 4BGDA 2IC5A 2ZUBA 1X3SA 2J59A 4KO8A 1IY1A 4D0GA 4DRZA 2D3WA 3VX4A 1U94A 1OH6A 3E5HA 3QBTA 3IIMA 5AWFC 3RVBA 5E95A 1Q57A 3BC1A 3TAUA 5TV2A 2RHMA 4B47A 3BWDD 2ZRDA 4HAZA 3TR5A 3U4QB 1GRQA 1R10A 1Q1ZA 3IIJA 1HUQA 2IUTA 2CEAA 3MWYW 3MCAA 3LLUA 5FTJA 2W2VA 2GDJA 4TMVA 3GLIB 1ZIOA 3AP2A 1E2DA 3QKRA 2ZETA 2PX0A 3I32A 4NDZA 4R9UC 4DCVA 4BE7B 1KDRA 5JJIA 1W36B 3U3RA 1E2LA 3EWAA 1N0WA 1TQ6A 4QGGA 5C1BA 3NC1C 3CZQA 2VF8A 2OCPA 3GP8A 2RGGA 3X2SA 5DH9A 1N0VC 4JLMA 1JI0A 2A7QA 2ZJOA 3OFND 1SVWA 4D4MA 3THWB 2HDNB 4C2UA 2NZJA 1TL7C 2VP4A 3KFXA 1GFIA 4OKSA 2XTNA 4QNRA 4YDZA 2H8KA 5TXGA 1X5MA 2IS2A 2QBYB 2D7CA 1XBTA 4EDHA 1E2IA 4C3ZA 2WWGA 4BLPA 2QPOA 3ZZ0A 1EK0A 4I99A 1CULC 5EP4A 1ZP6A 2ZRBA 1UAAA 3K70B 3SOPA 3T1VA 3AH8A 1KY3A 1CIPA 1UJ2A 4IFBA 2KSQA 3DM9B 4V02A 3QG1A 1AQUA 3QEJA 2BOVA 5H68A 2ZJAA 2FOLA 1G8PA 4D2IA 2GAOA 4ILEA 1SKQA 3KUCA 3QF4A 1VDZA 4XD7A 1W36C 4KYIB 3MUFA 1US8B 1OH5A 3RC8A 4FMBB 2Y8EA 1GL9B 3O8RA 3I3SR 2WM9B 2FSHA 3QXCA 3OEEA 1A82A 2AFHE 1AZSC 2C78A 2JCSA 2WVJA 4XSGA 2OXCA 2CVFA 1ZM3A 2ODBA 3BFKA 3ECCA 2VSFA 3RRMA 2FNAA 4YL9A 1JAIA 2Z43A 1W44A 1CR4A 5B64A 3TUIC 1OV4A 4EUNA 2QMUA 1WBBA 3AKEA 2HCJB 2R2AA 2ZEJA 1NKSA 1N2CE 1NSFA 1ODFA 5B30A 1F5NA 4EAQA 1R5NA 2C77A 5FUWA 3T06B 5L3SA 2D2FA 2BEJA 2IYRA 2TMKA 1WRBA 1NVXQ 4DDWA 2A78A 4NU0A 2Z6VA 4Z51A 3UMSA 5DE3A 3LX8A 1OXVA 1GMEA 2GCOB 4M1WA 4YMUA 2FFAA 2QPTA 3JZMA 2AFIE 3W5IA 2RAPA 3PEWA 3W9YA 3ZZUA 4Q02A 4LBVA 3U7GA 1H65A 1J90A 1NIJA 1G8HA 3M6AA 3F3YA 2QN6A 1XFAA 1KY2A 2YZ2A 1SXJB 1YR6A 1U2RA 4JJZA 3KUDA 1OXSC 5DHAA 2ZROA 3F8TA 1GKUB 2OHFA 1RE0A 2CG9X 4IOLA 4P0TA 4B2IA 1CS4C 3CX6A 3ZS8A 4DLYA 3PUWA 1SXJA 5E7JA 1KNQA 1SVIA 4G1UC 4AD8A 1KKLA 1R6BX 2NPIA 4TQ9A 4S2EA 2HXSA 3CH4B 4D4KA 3QXSA 1LTQA 3ZIAD 1IN4A 4RZ3A 4DT1A 1RPZA 1QHNA 3WXMA 1V43A 4EPTA 3R9WA 4M53A 1KGDA 5IHPA 1GNQA 1IJEA 1D8TA 4BPBA 1LV7A 4I1SA 5CK4A 1HE8B 4BFTA 1E2NA 3FDIA 3Q72A 4TLEA 4Q7MB 2QT0A 3LNCA 2ZPTX 1E9CA 2OCBA 2ATXA 2RGNA 4N0EA 4Q9KA 4EFLA 2C04A 2ERYA 3PCRB 4N3NA 4Q9HA 3EA0A 1ZYUA 2ZYTX 1A7JA 1R8SA 3CRMA 2FZLA 4MRRA 1CJKC 2O8EA 821PA 3NEJA 1ZINA 4QM6A 4A1FA 4TMZA 5IK2D 4AG5A 3A1WA 4V0OA 2OZEA 4NHOA 3SHFA 4ABYA 3UWKA 1RRCA 1R5OA 4LYJA 4JLNA 3LW7A 1IN8A 1UKZA 2GTPA 2FSGA 2IYLD 5EE3A 2WJHA 1W2GA 1RYHA 4Q19A 5EXTA 5IF9A 2JEOA 2IL1A 1NJGA 2BMFA 1A5TA 1P72A 5FR1A 1DAIA 4BFWA 1JQJC 3K70D 1FTNA 1KYIA 2CCGA 3SQWA 3A37A 5JCZA 3TRFA 1P4SA 2VHQA 4FCTA 2Y1YA 3UANA 3WRXC 1KK3A 3TQCA 2O8FA 4Q4HA 1R8QA 2VHUA 2VH5R 1MRNA 3CRVA 1T5IA 4DC9A 2X2EA 2KMWA 2WOOA 4L8GA 1HA3A 1F2TA 2VLIA 2DFTA 2CJWA 1Z0FA 2DWQA 3T5DA 1E9RA 4O25A 2ZAMA 4JBWA 3EZ7A 4B2LA 3TSZA 1MT0A 5C4GB 2WWHA 4X8LA 4LV5B 4P32A 2OSBA 2X19A 2V4ZA 3GLHA 4YQFA 3IDQA 3VX3A 3I73A 1EX6A 1YQTA 1KAOA 3F0TA 3W34A 3QOFA 4TYNA 3OIYA 3BOSA 3QENA 4HATA 1D9ZA 3TMKA 2ZJYA 3L0IB 2ZE6A 3B1VA 1WA5A 2WMNB 4TSFD 4FW9A 5BN4A 5E4FA 1N6NA 1WP9A 4WZAE 1XTIA 3NH6A 4C0HA 3LA6A 1I2DA 4URWR 5KNBA 3WY9A 2OFXA 2G1KA 4B74A 3I5XA 5AJVB 2JASA 2GK6A 1AKEA 1ZNXA 2QI9C 4IJMA 4CGZA 4MH0R 2XSZD 4JSYA 1QHXA 1TQ4A 1W48A 1M6NA 1Z83A 4MDEA 4QG7A 1G3MA 1J99A 3U6KA 3KL4A 3C4JA 1OFHA 1AN0A 2N46A 3GUFA 3OF5A 1U81A 1Z2CA 3SN6A 3ZS9A 1Q3TA 4MA4A 1AS2A 2A5FA 3A1UA 3THOA 1G16A 2CVHA 2DWOA 2H5EA 1KAGA 1W47A 2HYIC 4G5GA 1XD9A 2VYFA 3U4QA 3T15A 4PPFA 1WQ1R 3CX8A 4JMPA 2Q21A 4JT4A 2F55A 2DFKB 2CLCX 2O8BB 4RVCA 2O8CA 2BMJA 4KVAA 1AS3A 5TY0A 2OXRA 4XWKA 2P6RA 2ERXA 2ZS8A 2IT1A 4V03A 4L5BA 3VNUA 1NN0A 1M34E 1R0ZA 1OIVA 1CJMA 1YZKA 4HAXA 1KDTA 2IXGA 1P2UA 1KO1A 4JLBA 3DMDA 3PG5A 1G3IA 2QL6A 2YOHA 1A4RA 4IOKA 2NO0A 2IYQA 4CEIB 1YE8A 2J1LA 1KJZA 4V0LA 1ZNYA 5JEEA 1G19A 3W6NA 4CW7A 1G4UR 2WKPA 4TL6A 1SVMA 2P6NA 2ZYUX 1ZNZA 4ZDJA 2BOLA 4E5UA 2BM0A 3B1XA 4A0GA 4S35A 4DDVA 1LS1A 2OCAA 3NBZC 1O87A 1Z22A 3JZAA 2OBLA 4QJ3A 3P4YA 1UKVY 1XCGB 4L15A 2HCBA 2AK3A 1XD2B 2XNSA 1S1CA 3CPEA 3EUDA 1GG2A 5DNYB 4AKGA 1N5IA 3CB4A 3GJ4A 1DAHA 1NVVQ 4P4TA 4YMSA 5HE9A 1P5ZB 2YWFA 2P3SA 3MAAC 4BQSA 1KSJA 2N3JA 4YLCA 1NVUQ 3HP1A 4KCGA 4U7DA 2ZE8A 2XOKA 4NPHA 5EE5B 3QY0A 3U44B 3TUZC 4LC1A 4MRSA 4KFRA 2WOJA 4BRUA 1YRAA 2A2ZA 2DBYA 2J7PD 3ZD6A 2EU8A 4DCTA 1EESA 4TYWA 1KI4A 1VYVA 1Y63A 2HT6A 3I4LA 2DPXA 4OI1A 4BLRA 1SVLA 2ORVA 3SEAA 1Z6XA 1JR6A 4YXWD 3VNVA 1DARA 3K0EA 1RYFA 3T61A 2GEDA 2B7BA 4RD6A 4XSHA 3LVRE 1DTSA 5DYIA 3K09A 3RS3A 4B48A 1BH2A 3Q5EA 4MITA 1PZNA 3LV8A 2FFBA 1IN7A 3E2IA 5E3HA 1TU3A 4BRWA 2G0NA 2CLSA 5FUXA 4W5JA 1E4YA 4PPGA 1W7AA 4FMCB 1Z2AA 2AR7A 2X2FA 3C14C 2J46A 1QVRA 2ZSEA 3VMFA 1XRJA 2B6HA 2AD1A 2GAAA 4PC3A 2C98A 4QNMA 2JLRA 2V8OA 2OEPA 1GOTA 4U02A 2WWXA 2W6JD 1JXMA 1N0UA 4HUTA 5AUQA 3PR1A 5D3MA 4EFNA 1SVSA 1V5WA 1WF3A 3A36A 4KLNA 1VG0B 1UFQA 3VKWA 3W6PA 5FPTA 4Q48A 2MNWA 4G5SA 2AD5A 2WPDD 3QIAA 2ZRLA 5GJCA 4RY2A 2WWIA 1KKMA 1OJLA 3OHMA 4AWXA 1U99A 3AVXA 1G21E 4M8NE 3QPUA 4O2RA 3KQKA 3U7HB 3QKRB 1AA9A 3UWOA 2JDID 2ZSDA 3G0HA 2CE7A 1AQYA 1U9IA 4ZCLA 5H1YA 4TLBA 2ZI5A 5BYJA 2NO9A 1ZJ6A 4XTCS 3QKTA 3KKNA 4KYUA 1E99A 1ONBA 4FMDF 4P31A 3UIEA 1NBMD 1BYIA 4M9QA 4TQAA 3RS2A 1W1WA 1AGPA 2FMXA 1U98A 2PCJA 1HH4A 1JXOA 1NI3A 1GP2A 5G41A 1K6MA 4LRWA 4KBFA 3R7WA 4AC9A 4UNNA 3K8YA 5KNCA 4BLOA 2J0UB 2Q3HA 2WWFA 2MSCB 2LKCA 3FKSA 3R9XA 1W4BA 2FJUA 4ZCIA 2JLUA 4DLVA 3HU2A 4YMTA 4JVNA 3KJIA 5BQ5A 3T1QA 4EQ6A 3KQHA 1R4AA 1KI8A 3D7MA 4NMMA 1B23P 1S9DA 4TLCA 4GPTA 1IJFA 3U61B 3EASA 1R0YA 3KB1A 4URXR 4KJZA 3A6PC 2BBOA 3CIOA 3VHXA 1UDXA 3MG9A 2JLVA 1E2MA 1SVKA 2RB4A 5EE0A 4DCNA 3FMOB 4IOJA 4RFSB 4U00A 4A15A 3QVVA 4ESHA 3KTAA 3ADKA 4Q1EA 2QA5A 3Q8XB 4JLJA 4PAOA 3K0CC 2CE2X 3EZ9A 2FSIA 4RFSA 4GI7A 4TZ6A 3FKSD 3THXA 4C7OB 2IS6A 5CDFE 4MQBA 2ZE5A 1Z06A 3QEOA 5TMPA 1UBFA 4P4SA 1M8PA 1G5PA 4NCHA 4KFSA 1S3SA 1KSHA 1G8GA 2CHQA 2FWRA 2HJVA 2QTVB 3T12A 2NGRA 2WTUA 5M04A 1WH0A 2EVWX 2KB0A 2GJAA 3PEUA 1OXTA 4TTRA 4M5SA 1K8RA 1XZPA 3OE7A 4D0LB 1FMJA 5KO2A 3DOFA 1CRPA 1RJ9A 2WICA 3LDAA 3MMPA 5H70A 4NCJA 1Z63A 4M1TA 3AVTA 5JMTA 2JLWA 3W8RA 2I4IA 1D2MA 5J4HA 5JEDA 2WV9A 4RKFA 4HUQA 1NMXA 3P4XA 4PFSA 2HF8A 2WJVA 2AX4A 4JUTA 3T34A 1CKEA 1YVDA 1E2EA 2BHRA 1E4VA 3BH6A 4I1VA 421PA 4ZKDA 2R6DA 1IM2A 1HV8A 2QROA 5EQTA 2QEQA 3IBGA 4OYHA 1P2SA 1ESMA 2J0SA 2V1UA 2PEZA 2AXNA 3P20A 2EFEB 2J7KA 4NBSA 2BIFA 5AUNB 2PZEA 2W6ID 1XCMA 1VYUA 4OK3A 4Q18A 4B3GA 4YC7A 3AABA 2GF9A 3NG1A 5JRJA 3PITA 2H1LA 2IEYA 2P2LA 2PMKA 3CO5A 4LJ7A 4JLOA 2P5SA 1II0A 2NOAA 1SZPA 2DCUA 3L43A 4Z8XA 3TLXA 4A6XA 4NL4H 3I8XA 2GJKA 2GEVA 1X8JA 4W5WA 2IYYA 3RRNA 4HLCA 4GP6A 2FH5B 5CJPA 5EXXA 2GZDA 1OE0A 4WW0A 3T1OA 4KITB 1U9IC 3K0AA 1XU4A 3LXRA 5A0FA 2GILA 3SBEA 4MKHA 2XTZA 5DHFA 4UQOA 1T5LA 3VKHA 1MO6A 1AIPA 3S1AA 3EIEA 3OEHD 1LF5A 2GK7A 5K8TA 2RGEA 2ZS7A 1JPJA 2RMKA 2GRJA 3OIUA 3H0KA 5AK0A 3KDSE 5FFMA 3U3OA 1Z0KA 4OQNA 2NG1A 3TAHA 1MABA 4A2WA 2Y1ZA 1Q44A 2WJGA 3FPAA 2W58A 2GF0A 3SZRA 2XAUA 3IKJA 1E9DA 2IHYA 1RRFA 1XXHA 2PZFA 3LQRA 5AUPB 1E2PA 3TVDA 1E2GA 1XXHE 3DOEA 4ZO4A 5DLQC 1WGVA 4OJKA 3LAWA 3OAAD 3GLGA 4HI0E 1GNRA 4FIDA 3VR6A 4ZI2A 2GZAA 5FL7A 1E0KA 3O8BA 1PJRA 1PV4A 2P67A 1EX7A 2HV8A 2JJ8A 3EZFA 4CEJB 4C2TA 3OEHA 1D5CA 2ZTSA 3AKYA 3QJYA 1KOFA 3K9NA 5IRCD 2IXEA 1DELA 1XTJA 3V4RA 1NG1A 4D6PA 3CF2A 4LBZA 3O8CA 4BFXA 4IDPA 1NF3A 4W5HA 2JIZA 5JHHB 3QORC 3RSLA 4B6FA 3PJRA 1P61B 5EE1A 1R0WA 3SYKA 4TYPA 1KTVA 4WZ6A 3UXMA 2EFHB 3N3EA 2PCLA 2CHGA 3QKUA 4ARZB 4IW3B 5SZIA 3FHOA 2GBLC 1SKYE 2OE2A 4B3BA 4FEIA 1Z6GA 2ZANA 3B9QA 1W4AA 5JCPA 1MH1A 5LD2C 4FCWA 2RCNA 3BB4A 5L3VA 4B34A 4QJ5A 2O8DB 1H8HD 5FBWB 1S0UA 3GJ3A 1G1MA 2ODEA 4G0NA 1S8FA 1E1RD 3IEUA 1Q12A 4Q1FA 3ZYCA 4B3XA 2QE7D 1PLJA 2N0KA 1LY1A 2XNDA 4IVRA 1UBGA 1Z07A 2GWHA 5CM8B 2J9RA 3SC3A 4F38A 5JI3E 2ORWA 3HU3A 2QMOA 3CR7A 4IDOA 2B7CA 1E32A 2EW1A 4GMDA 1DS6A 1G6HA 1M7BA 4JL6A 3FFBA 1N6LA 3U3MA 3LBIA 2OT3B 1S9HA 1FTSA 2WBLC 4ASUA 1VG1A 2FN4A 3AVUA 4OI0A 1XD8A 3H2YA 3E1SA 3ZVNA 5FBVB 1P60A 1UEJA 2I1QA 4JT2A 4QBHA 4IDHA 3C8UA 4K8OA 4M9SA 3ZGXA 4BLSA 2ZITA 4EJSB 3TQFA 2B21A 2YV5A 4DLXA 3GQBA 1OFUX 5C4MA 1NL3A 4F93B 2PBRA 3FHCB 521PA 4N0DA 2VQSA 3BK7A 2FU5C 5AR1A 3H1TA 3U2QA 3I1FA 1TADA 4IXNA 3P1JA 4PHHA 4XVRA 3ZQJA 1Z3IX 4TYQA 3RHFA 3Q5DA 3THWA 1G7TA 2BM1A 3DZ8A 2ZI3A 4HDCA 3DHWC 2A5JA 1YZGA 4QFMA 3U7FB 1Q22A 4LHYA 2JIZD 1XPOA 3C5HA 2NPFA 1BO6A 2ASEA 4A4DA 4CRWB 5BN5A 4AKHA 3LXXA 4ELDA 3CUEF 3L8ZA 3QKSB 1ZIPA 2NTYC 4C0BA 4O3MA 1W2HA 2C9CA 3JVVA 3EC1A 221PA 2ZRHA 2Q9CA 2GVDC 1S2MA 2C9OA 3UMRA 1DPFA 5DGXA 2H92A 1KI6A 1GILA 1K5GA 1NN3A 1YZNA 3KKPA 2HF9A 1WBDA 4UJ5A 3CPJB 2FGKA 4LYAA 1WE2A 3TJZA 4TZ0A 4XOIA 1JALA 4OHYA 1WMSA 2QAGA 1GSIA 4C9BA 2RGCA 4PO1A 5F9HA 1E1RA 3X1YA 5B2ZA 3B60A 3UK6A 3NXSA 4A8JB 2V7QD 3SHWA 3DVLA 4PANA 5BXQC 2OG2A 2CDNA 3BB3A 1YZUA 4TTPA 2QAGC 5CK5A 1CR2A 1YR7A 3L82B 1IXZA 5ELXA 3HR7A 1E9BA 4JZKA 1E9AA 2WSSD 2KWIA 4M9XA 4PHFA 2PLRA 1W0JD 4E03A 1QZXA 3GEIA 3N2IA 3ZVMA 1GM5A 4ACBA 4ZDWA 5BYKA 1R2QA 3KXKA 4Z8YA 3WHLA 4DLSA 5FI1B 1EFRD 3IQWA 1II8B 3VR4A 2ZSFA 4DHEA 4X8MA 2R44A 2NMVA 1FZQA 2IYXA 2G88A 4HDOB 2LWIA 4PZYA 1AM4D 1C1YA 1E2FA 2JA1A 4X8HA 5K8UA 2ONKA 4YLGA 3L8YA 4KXFB 3J81k 2IX3A 2GXSA 1NJFA 3NKVA 3QQ5A 2KBEA 3NWJA 3NDPA 4V0MA 1ZC3A 4PSKA 3PUXA 4FMCF 2ODNA 5EP3A 1X8KA 2YC4C 4OHXA 1KMHA 1CF4A 2IYUA 1GDDA 2DHRA 4Z1MD 1KK0A 3I8SA 2CHVA 721PA 3AM1A 4Q4JB 4PXAA 2QMHA 3QKSA 2PJRA 5FBRB 1E9EA 2CXXA 4QOSA 2HUPA 3EZ2A 3KKQA 2IEZA 4PC2A 4JYCA 3C41J 3N2EA 2NO7A 2Z4SA 3DO6A 3QNUA 4PQFA 4BEBA 2ZU0C 3TH5A 4F4CA 3MGCA 1JECA 3B1YA 4CT4B 1ETUA 2ZUDA 2FG5A 5BW8A 1TAGA 1EFCA 2VHTA 1GL7A 2Z0MA 2V7QA 2CCJA 5L3QB 1KNXA 5EP1A 3JVUA 3W1ZA 1OF1A 4DXAA 2ZYVX 1GUAA 2EFCB 5KTYA 3A4MA 1XJCA 1T3SA 1TU4A 3GLIA 2RKOA 5JRZA 2Q6TA 1DO2A 3LVQE 3EC2A 4TT3D 4XVQA 1IN5A 4LCBA 1XTSA 1Z8FA 2ZSBA 2GETA 2DFNA 2QT1A 3U7EB 4JKIA 3I62A 4KAXA 2NO1A 1VMAA 4LJ4A 1X6VA 2PX3A 2R6GA 4JVMA 4DCUA 4LUCA 1Q3HA 3ASZA 5DIFA 2ZR0A 4KFUA 3VQLA 2GXUA 4M1KA 2OBMA 2G83A 2WWWA 2QE7A 2GZHA 4EPYA 1VECA 4QGAA 2KE5A 3EPLA 1W49A 2W0SA 1CLUA 2CR0A 4HSEA 4PZZA 1YRBA 5TB5A 3IBYA 4LJ5A 1T91A 4ZJ9A 2QU8A 3L0SA 4C7OA 2R62A 4FWTA 3R20A 4US2R 3UG7A 2GXAA 2D2EA 3MSXA 1HY3A 1ZC4A 2FEOA 2N42A 2RGNC 4NYJQ 3RDPA 3UMFA 1FP6A 3GLFA 4NH0A 2ANBA 3K1JA 1OPXA 2IF0A 1VYTA 2R6CA 3GLHE 3RRYA 2IYZA 1CJVC 2CK3D 2WIBA 4AI6A 3RS7A 3AGPA 4CEHB 1TUEA 2HEIA 1QHHA 2ZRNA 3TK1A 4ZDKA 1II8A 4V0ME 5FPYA 3ZVRA 1FNMA 5FPKA 2AKAB 3GFPA 3EXAA 4QBFA 1DG3A 2CMKA 1NBME 2QNRA 1O3YA 2N1BA 4YDSA 1DVRA 5JJKA 3GJ5A 2WMOB 1CR1A 4KBGA 2BC9A 3C5CA 3L1GA 1MO4A 2W83A 4DIEA 2R6FA 4BASA 2QGZA 2IA5A 3B1WA 4OJQA 3R9IA 2QM7A 2IF2A 1HEIA 4BFSA 5UKDA 2CNWA 4M5TA 2J0UA 3EZ6A 4PHTA 4WZBE 4QKQA 3RYTC 1GNPA 2UZ3A 4Q7KA 5FOXA 1OSNA 1M1YE 3QPVA 3OE7D 3DMNA 5KYKA 1EGAA 1X86B 1G4AE 1IBRA 3FKQA 4V0NA 3O47A 2FV8A 2ZRFA 4NP6A 4HDQB 5LPNA 3B9PA 2BMDA 1EG7A 2SHKA 1F2TB 1KI3A 3AQ4A 3K0SA 3QPWA 1EFUA 3KJGA 5J4LA 3AVYA 3AVOA 4RD1A 2FGJA 1OB2A 1AJEA 3HWSA 4GNKA 1UBCA 1CP2A 1NY6A 4JVSB 5GADl 4LBWA 4MYUA 1FOEB 2KBFA 4L9WA 5J5CA 2G77B 1PLLA 2WSMA 1Q1BA 1QHSA 2XX3A 4TWZA 3UKDA 2R65A 1Z5ZA 4US1R 4Y0VA 1X8LA 2QRZA 2ZSAA 1A1VA 2ATVA 1NP6A 5EZ6B 1FW6A 3CONA 4GP7A 1YZQA 5GVSA 2JDIA 3HR8A 2ZVPX 2IWRA 2ONJA 4OI4A 4HLQB 1SVOA 3UATA 2IS1A 1XEXB 2AHOA 2X77A 3PQCA 4XWAA 1GKYA 2QGNA 2FSFA 2BBTA 2IYVA 3M0EA 4IVQA 4Q21A 1FPMA 4LJ6A 3QORA 2ZR7A 2ZREA 4LI0A 5FOTA 2GJ8A 2JJ2D 3QBVA 3K0FB 2J87A 2HYDA 2MSDB 4EIWA 3KQUA 3IQXA 2FA9A 4IDNA 2GESA 4EJSA 1OYYA 2O0JA 2OCYC 3CR8A 5FL3A 4CZ2A 1T0HB 3T1TA 3WYGA 3GLGE 3WNBA 1TF7A 2HJGA 4IRUB 1NBMA 2CJWB 2RGDA 3BORA 1ZNWA 5CDFA 4I4LA 5TDHA 1FUUA 1IN6A 3ONWA 5LDDC 2BBWA 3W3AA 4MGKR 2QZ4A 1X1RA 1E96A 2VTKA 5LB4A 1AK2A 5L8VA 4KODA 4D26A 4Q1DA 5KDDA 4Q7LA 4JL8A 1QBKC 3QORD 1OLOA 2NIPA 2QM8A 5EE9A 1YJ5A 5IK2A 1MV5A 2WJ7A 2WJ5A 4F92B 1P2VA 2Z4RA 4MKGA 1LFDB 1N5JA 3IPYA 4LV6A 4PHGA 2GJ9A 4L9SA 5FBQB 3IPXA 1ZCAA 4YDHB 2FPMA 3QVUA 4H1VA 4RD3A 1ZUIA 3Q7PA 1T0JB 5DYGA 5IDVA 3ND9A 3IHLA 4IXMA 5EUQB 2IYTA 4DB2A 3EX7C 2ZVQX 4Q1AA 3WBKA 1N6HA 2OFWA 1IY0A 4HB0A 3MJHA 1P73A 3AV0B 1AS0A 2IYSA 4KSCA 1I4TD 4QRHA 3A8TA 1I2MA 5GVRA 5FTMA 3DKPA 2CK3A 5B58C 1EFRA 4CF7A 2JLZA 1G18A 4B6EA 4AYWA 5TVKA 1NMZA 3RAPR 2IW3A 4KFTA 1RRGA 3SNHA 5LBIA 2GXQA 4A0FA 1U8YA 5F9FA 4FMDB 3WP1B 1D9XA 3W8NA 1NLYA 3RLFA 3LFUA 3MLEA 4PC6A 1KK2A 4DCSA 3FVQA 3NBXX 1KJYA 2VA8A 5DISB 3VU9B 2XZPA 4I88A 1P9RA 4CEHA 4UXHA 1OHHA 1E2KA 4M1YA 2QRNA 4P3YA 4DEYA 1QVAA 2R6AA 5LB2A 2EWVA 5H8WA 1U0HC 1F3OA 4KV9A 3ZVLA 1T3HA 3REGA 5HTKA 3ZDQA 1F2UB 3ZD7A 1J8MF 3TW8B 1XPUA 1M74A 3WMEA 1G3UA 1VHTA 3NVAA 4B3DA 4WOPA 1T8TA 3GMTA 2IHBA 2C99A 5CM9C 2ZUCA 4LPKA 5J4YA 3NDBB 2C2HA 4Q01A 4DB4A 1HQYE 4ZKEA 1ZVQA 4DKXA 1RW4A 1VCOA 3U60B 3R7WB 5AJZA 3CRRA 2ZIAA 1ELOA 1E1QA 3MD0A 1GAJA 4JJKA 3WYFA 3DKVA 2VP2A 4OQFA 5EP2A 2AL7A 1VCNA 1L4YA 3D8BA 1Q20A 4K81B 1NN5A 3ZJYA 4DLUA 4TL9A 1TEXA 4OHWA 5E7MA 1NNEA 2I1VB 2G9NA 4HAWA 2OLKA 2J0QA 1ZD8A 2ZJ5A 4US0R 5JHGB 1ZRHA 1W0JA 3LW8A 4LX0A 3ND8A 4GOKA 4TLDA 2GVZC 5DI9A 1D6JA 1DAEA 4MRNA 3BJIC 2WJJA 3Q7QA 5JSZA 4B75A 3EW9A 3SJCA 4OQMA 4B3FX 2QQEA 2H17A 4L16A 5FTLA 3ADCA 2GCNA 121PA 3D6TB 1E2HA 5L3QA 2EFGA 3RANA 2KI5A 1ZCBA 1E79D 3TE6A 4ERNA 5JZVA 3CRQA 2ZS9A 4RKEA 1DE0A 4MRVA 2ZYWX 2ZRIA 1YHNA 1FP7A 1KK1A 1U0LA 2PH1A 4RZUA 1OXUA 4DSNA 3FMFA 3T5GA 2H18A 1KO4A 3LX5A 4P33A 1U90A 5L3RA 3EIHA 1RZ3A 2A30A 3THYA 4MRPA 1IXSB 2F1IA 3B78A 5KDLA 1SKYB 3SJAA 1W36D 3EPHA 1SGWA 4ZDIA 1IAQA 1TNDA 3LLMA 1XNJA 1GVNB 4Q9JA 3WP0A 2VHCA 4Q66C 2PL3A 4M9ZA 3PENA 3KKOA 1G3QA 3TNFA 1M2OB 2EQBA 4LYFA 2OLJA 3KX2A 2F3TA 3VHLB 4QHTA 4QGFA 1N6RA 4JLKA 3LBNA 1DAFA 2WZQA 5CIWA 1NRJB 3BH0A 1H8HA 1LS6A 4M0LA 1TF5A 1MOZA 3AF4A 4F4IA 3L0OA 2YWHA 1YZLA 1UPTA 2V55B 3CWZA 4Q9IA 5CYOA 1BYUA 4WXPA 2PMDA 2XB2A 3HPRA 2VPPA 2YVUA 2ZI6A 3MFYA 1CR0A 1JAHA 3BAFA 4H1UA 4BLQA 2IWHA 4C30A 4HEJA 4PSAA 2VL7A 3V9PA 3FE2A 1ZBDA 1QHHB 3PUZA 2J45A 1BMFA 2VHJA 4TMXA 1OB5A 4K46A 4WAUA 2ANCA 4UKDA 3A4NA 4TQUS 3VAAA 3Q9PA 2P65A 3EA5A 2QTHA 2XTMA 2XCMC 3CLVA 4EPVA 3SDZA 621PA
chains in the Genus database with same CATH superfamily
4CDRA 4JUSA 4WADA 2E8ZA 5I1HL 3LEYL 3RKDC 3A6GA 5JUEH 1MR3F 3FDXA 2VQ3A 1QG0A 3L7IA 1S96A 1D9KA 1JW9B 1XEWX 1TTQB 1DBVO 1IQPA 4IOSD 3PIDA 3BP7A 1CUHA 5CDYA 3RDTB 3M8OL 1BMFD 4N90D 3RFFA 2ZIUB 4NDAA 5KSBB 1CHDA 1CK4A 4WWKB 2CXTA 2NAPA 4MD4B 4KGVA 2QPDB 5F3RA 2NU7B 5AZ2H 3OJ0A 3T7IA 2LHAA 3VU1A 4TL4A 2YXPX 3VXUE 4YRDA 1RNLA 3IEKA 1H2XA 4HLZG 1CIDA 3ZDYE 1BIIA 3LDFA 4XP6H 3PFIA 1DDTA 5KSZA 4YIQB 3TBYB 2FQQA 3OWXA 5J40A 1N0HA 1FMLA 3ONVA 3N3AC 1Y6GA 3ZSSA 2ECKA 3T9EA 3IMRA 5H3LA 4Y4FA 3ZWMA 2GFIA 3VZDA 2X4NB 3CF4G 2W1NA 3UTSA 1KB5L 3ZGHA 1IBMB 5D7IE 1XR9A 5GRJH 3GBVA 4PSVA 1JAYA 1MLCA 2I6SA 3DJZA 4FYRA 1NBIA 1QS0A 4H0NA 2OQIA 3R0MA 4ARSA 2IYNA 1A6WH 4FL4B 4MS6A 4XNBA 3UTQA 3VO9A 2XWTA 2WF9A 4H7DA 4M8IA 4Z86A 1BA2A 2D5LA 1I14A 3ST7A 1U8FO 2HNBA 4GLOA 1J2YA 3BB1A 4DIDA 4IU2A 5D2NC 1C9JA 1BA9A 3G9TA 2GYSA 1JPNA 3IXTB 1NU6A 4X80L 2GHZA 1G63A 4H3KB 4IS6A 1RAEA 4OU4A 2YN3A 2X0JA 1NG9A 1I1AD 4XN9A 2E5WA 2BDTA 2IDUA 3VFSA 1LPNA 1XP8A 3NX4A 2NQCA 5JAQA 3QFJA 2VJKA 2GKGA 1T04B 3S2ZA 3VKGA 2BSTB 1GOHA 1JR3A 1R6AA 3CM0A 5HK9A 4GP4B 4LDJA 4DCMA 3GNSA 1RIIA 4RXTA 3VHXB 3W5VA 2FTAA 2YD0A 4BQRA 1VADA 2Q4TA 4OZFH 3TO4C 4LEOA 3EPPA 3MRGA 1SC9A 3JTTB 1YVEI 1OCWH 6CGTA 3G1WA 5BN5B 3HNVL 4JDVB 5FYJH 3S5YA 1SXJD 3ZY5A 2MHAA 3OLYA 4G0PA 4G5ZL 4ODIA 4Q9LA 3ZBUA 1P7KB 1PD1A 1XFDA 2VXTL 4MUAA 1UBRS 4P4UA 1QIEA 4G0MA 1CFNA 3ENKA 5B6IA 1ZK3A 4NM8L 1UUFA 2KYRA 5HWSA 4PJEB 5J7CC 3K0AB 1JR2A 4PSUA 5JECA 2DWDB 4O5LH 3VM5A 3HGMA 4Y67A 2F59A 2J3IA 1NIFA 1G8FA 1QLFB 3AEUB 1OC2A 4LKCA 4J0KA 1V3KA 4BSWA 2BFVH 2BGGA 3PGDA 2NW3A 3GLFE 2AI1A 4X1IA 3VGAC 1RAMA 4AJEA 1KB5A 1OSZA 2AFHA 2JBWA 3HYTA 4ZAVA 4NN5B 1D5ZB 3BUBA 2P42B 3AUXA 4LTDA 2L8AA 1TJ4A 2HIHA 2JGNA 1YR8A 1UBSB 2WF5A 3E5MA 3D1JA 4KQWA 1N7HA 1NSNH 1Z7GA 2HTEA 5A03A 4PLGA 5A04A 3KJ6H 1I7LA 3FPYA 2WJ6A 1YE5A 3NLLA 5E8OB 1N7GA 1TJYA 5K0TA 2YSSB 1PT7A 1WAEA 1KKUA 2PE5A 2ZI4A 3HRZB 1QEWA 1O94A 2NY7H 4WCVA 2CL0X 5KSVA 1ZVNA 3A2LA 1WHOA 2Z1KA 3ASOB 2PT5A 5I1KL 3TH4T 3BXZA 2GCYA 1A4XA 2EKSA 2VT2A 1J39A 4PJ5D 1VSCA 3JWJA 3W9EA 4MLZA 1V11A 3TEFA 3QU2A 3KR1A 1HGXA 4JZJB 4Q3NA 1LK3H 4AJKA 4F37F 4PTYA 5B3AA 1OWOA 2XA9A 1IUOA 4O2CA 1U6IA 2MQ3A 2AEQH 4MA1B 1U0FA 5FBLB 3S3CB 1DCLA 3S48A 1JGLH 1XAHA 2F1BA 2GT1A 4ECNA 2VTBB 1AZTA 4D5GA 1S2DA 3SOZA 4XC1L 1VIDA 3MCKB 2YJNA 4ZOEA 2FWNA 4JIMA 4YDMA 1X3LA 4Y98A 5HVGB 5DGRA 1LV8A 3HZHA 5J56B 1CUYA 1NCTA 3ZCVA 4MTLA 4GVPA 2N3ZA 3KBBA 1LVGA 4EW1A 3GC3A 1OC4A 1OAYH 2HY7A 2XQBL 4FLOA 2ZPUA 5AAMC 1TT7A 3JCZA 4X6CA 2UYLA 1VHDA 1GZDA 2H9AA 2REBA 3NBFA 4AZTA 4EAAA 1MREH 4YCMA 2GASA 5T3ZE 1HZKA 1YY8A 2EADA 4Q82A 4ERSH 3W8DA 4PLOB 1JFQL 1G291 2EXTA 2YXEA 1OR8A 2E27H 1BJRE 1B6RA 3BPSA 4JZJC 4NOFA 3RFZA 1J8QA 1E28A 4NKRA 4EKDA 1RHJA 1HZZA 1WZEA 3P5BA 3H9YA 3CURA 2IVZA 4JODA 3AI2A 1FDWA 3FGOA 1JU3A 1QHQA 4M22A 2IS4A 4UU9B 3LZNA 1U6AL 2NY1C 1L5FA 2BTQB 2DRIA 1PT9A 2JCYA 1DZ3A 1TSRA 3RODA 4UVGA 3T3PE 3UJ8A 3ZLUA 2J3KA 2Q3MA 2WNSA 3E22B 3GNMH 3QIUA 4JQVA 1LQUA 1ORQB 3DMMC 4YPGB 4Y16A 2V58A 3TPZA 2ZX8A 2X76A 1R0XA 4RF5A 4JN1L 2AR0A 1URIA 3CV3A 1LLFA 2C3VB 1IJNA 1OAZL 1TC1A 3HBLA 4E5KA 5BY2A 5EKDA 1NMBL 5A1TA 3PUHA 4CKVX 1DG1G 2NNAA 2WTAA 3UMCA 1Y7PA 4KH1A 3HIZA 1TVKA 4FUTA 4Q15A 1E3WA 3Q8BA 1FO0A 1SPDA 1T36B 3QH3A 1B4RA 1PK7A 3MK31 3NRFA 3OHXB 4LSTL 1UADA 2H3EA 2WUCL 3QIBC 2J5XA 2QSYA 3NUQA 4WZBA 3VVMA 3IKMB 4OLWL 4EUPA 5EMNA 3FVWA 5FLVA 2GA8A 3LOUA 1MAMH 1U1DA 2BR3A 5I18L 4WA7A 2PXYC 4LDCA 3ZHKA 4U1LB 3BRWA 4MR7A 4Y2PA 5T57A 5IF3A 2JKZA 4FXKB 4Q2ZB 2BFVL 3KPYA 4DT1B 2OXHA 2YV2A 3FH0A 1GRNA 3GBMH 5IX8A 3EYAA 3FB8B 1LM8V 5CEYA 1C5BL 4LARL 1YCHA 2C20A 3BRWD 3QCUH 4NQSB 4EABA 1SK9A 4R69A 3LD8B 4OJNA 5DMHA 3G6AB 2ZWOA 3HXLA 1X3DA 5CCBA 4QREA 2IQ9H 4WUUE 5I7EA 2WJYA 5F1NA 2C7GA 4D1YA 4EPXA 4ZP1A 1N32B 1H5BC 2IK8A 2Y2TA 3PPVA 2HQ1A 2PS3A 3BD6A 3WIUA 2NVOA 3H5OA 1ZCJA 3MBIA 1Z35A 1NGQH 2DY2A 4GAAA 1NBZA 4DIUA 4Q6IB 1XLTA 2HA4A 1BIHA 4G0OA 1TJHL 3IFLL 5C1OA 3QVMA 5C8YB 1AC6A 1ZVYA 4RJLA 1Z4LA 4MMYA 4BTVA 4FG4A 3DWIA 4YBQC 1Q1QA 2FUCA 3R0VA 2R4SH 2CNNA 1TZ8A 3U2IA 1MABB 5CGBA 1EX0A 2B59A 4LJLA 3FQ4A 5JSUA 4DEPB 4CMMB 3N8DA 5I23A 3ARDA 3OJVC 2Y67A 1F5SA 2EAEA 3MBEB 4N0CD 2ZE0A 4JG9A 2P3YA 3V80A 4CKWA 1HQ4A 3D52A 1TD1A 1QIHA 5DZSA 4Z3KA 4L3CA 3W79A 3KNBA 2A74C 4M61B 2X4DA 3UHJA 5HKKA 2A57A 4DJDC 4YYEA 4P5MA 2SICE 1MRZA 2QAGB 5A06A 2WU1A 4CNIB 4YDLC 3ZL1A 4LP8A 3G5YB 4AWAA 3AY7A 3KHTA 1ZIAA 2EAUA 2ZBRA 1RL1A 5BZWA 5C7XL 4O2LA 5EZJB 2O2XA 1F42A 4BM7A 3IAPA 1BQUA 1CTQA 5HDWA 4KPYA 2AJVH 1H8OA 3D25B 5KBLA 4GMKA 3EGIA 1JUDA 3LY7A 1ULTA 2UUDK 4UANA 5KBMA 3T2LA 5FO9A 3T08A 1NQVA 3FTQA 4KOBA 2QZZA 1VFAA 2ADFA 2D7DA 3BFXA 1LFAA 3RX7A 2WA2A 3OZSA 3OOJA 1NFAA 1DYZA 3N1MC 3MJRA 4LJYA 4OGAD 3TIEA 4CBZA 4GX0A 2ZUQC 3TUJC 4DLBA 3G13A 1S8DA 1OH8A 1OWPA 3MZ0A 1M1UA 4WLFA 1JN0A 1PNVA 4BO1A 2H2HA 4NS4A 4HUVA 1ZM4A 4MV9A 3RJ9A 2YYZA 4JJ5B 3VBCA 3IOBA 1HCVA 4YBZA 3G5VB 2ZXWB 4H3VA 5FP0A 1BEYL 5EBWA 2BIPA 3EXHA 4PJEE 3P96A 2BUAA 1DUIA 5LDUA 4KXVA 5CW2A 2XZCH 3OZXA 2MKWA 1BS1A 4I0PA 2R56L 2WZ6A 1NCHA 5IKCB 3WQHA 1WV1A 5JHMA 3BIJA 1ZY9A 1I1AC 1TEHA 3CLFL 4RS4A 1CSEE 1Y7TA 1UT2A 3A9WA 2V3CC 3E2PA 3GJ7A 4MZDA 4AL8H 1SJMA 3D64A 1FNEA 4L74A 3G79A 4IH4A 5DPMA 1TZCA 4BFYA 1KJ3L 2OESA 1TO5A 1HYSC 4DDMA 1U0TA 3LKOA 5EJ6A 1OF0A 1NP3A 3BC9A 3VX4A 2A4MA 3ZIDA 5E95A 1C80A 5HFNA 4IDDA 5FB8A 4OHUA 5ES3A 2F1AA 4K2AA 4LGSB 3QKRA 4DCVA 5I0VA 2YD4A 3HB4X 1R1CA 5KBPA 3SCMC 1CY1A 1N8NA 3OSKA 3G49A 5LFAA 4EENA 2AQ8A 3HY3A 4JLMA 5A62A 4U2FA 4HEPG 4IBLT 1I3KA 2WD0A 4MMZB 1JBJA 2Q7OE 4JQYA 2NZJA 4AMZA 3NS7A 4RKYA 1FZTA 4ZJZA 3RYFA 3LXCA 1I1AB 1FF5A 5FV2A 4UPEA 3D5OF 5HKAA 2L7JA 4WCFB 3RVPA 1BWMA 2EX4A 5JA9A 4OJEH 1PCXA 1E4EB 2JVJA 1SKQA 1PBYA 4F7EB 2FJGA 3KVNA 1VFMA 4NNXB 4XX1E 3TA3C 1XO1A 4QOKB 5KVFL 4YLQT 1RD4A 3L1UA 1Q6ZA 3BDVA 1IQUA 4Y1AE 3PBKA 4Z4CA 3AK4A 4LSSH 5D01A 4NHCH 5JPMB 1FU7A 4NS0A 4YC2B 3LUCA 2WXMA 3DE2X 3G6JA 1N2CE 4RZCA 1NSFA 3KM0A 4JPSA 4XMUA 3RIFK 4MZ2A 4EAQA 3EGXB 1F41A 3AF6A 1DP4A 1VGEH 5KYXB 4DVRH 1UVQB 3I8OA 4GQAA 3PEWA 4QTTB 3HA2A 4LSRL 2QTNA 1ILSA 2EKDA 3WGQA 2WQAA 1GKUB 2NSJA 4BE4A 4JAMA 1QMGA 3CX6A 1XT5A 3VRIB 3ZTYA 4K94H 1QRNA 1YRLA 2FPPB 3LC2O 4HGQA 1PLGL 1VXRA 1GNQA 3AR8A 3BKML 2CDEA 2YXWA 1I6WA 1BQ5A 1E3ZA 1NC2D 2HL6A 1S2LA 1IKNA 3HLAB 2UZ4A 4Z5XA 4ZTOL 4FXLA 3KG5A 1LJUA 1E43A 4RFNB 1FFGA 1IM3D 1YEHH 4TMZA 5ENZA 2DDQL 2VH2A 1UOOA 4JG0H 3G3LA 3CNBA 4EEXA 4X8JA 3WNLA 1IAII 3NYRA 5DO8A 3NRBA 1R5OA 4DEUA 1IN8A 3K1DA 3NHPA 2IYLD 5IF9A 5J2TF 2BMFA 5C7OO 5AL0A 3P69A 4MR8A 3MRGB 2X2HA 4GG6F 1S7SB 5L6MB 3SQWA 5JCZA 3JTMA 4XQEA 3HHRB 3IAGC 5C0JB 3R0XA 2FUTA 5T4BA 1S7GA 3Q2LA 1CEXA 4J7RA 3IAFA 4N2NA 4PJ5B 2KMWA 2XTJA 4L8GA 4EZKA 2QT6A 1AKQA 4F3FA 2IFFH 4LSTH 1E9RA 1SB9A 4N0QA 3TSZA 3BIKB 5REQA 3GI8L 1JTPA 1XLWA 4TLLB 1I5EA 2IYOA 5JALA 4FONA 2YR0A 4XCNA 1I3LA 2JELH 3DI2B 1JKMA 3D6AA 2HWUA 3AUSA 4XXCA 1A4UA 1CNFA 4EUKA 3AEUA 4GKNB 5BN4A 5E4FA 3EH5B 1UJ3C 3FPGA 1BGXH 1QPXA 1XGPA 3H19A 5I8CA 3SS7X 2O5CA 1G7QA 3GD1C 1WXEA 4D3SA 4OV5A 3DZBA 4CLXA 1UM5H 1HYEA 2E86A 3LD8C 1Q7RA 1U81A 1WETA 5EVCA 4IDEA 3HPLA 3A1NA 3E0QA 1RRVA 4QO7A 1TMOA 3H42H 1PFCA 3U4QA 4Y89A 5BCAA 4PRHB 3OUZA 5FHBL 2IG2H 1VPVA 2W6MA 4P7GA 2ERXA 4U0JA 4X91A 4L5BA 1M34E 3ZDXE 1W76A 3RGVD 2UXTA 2X2OA 3RPKA 4Y9RA 2WBJD 4EM6A 2CWRA 3PG5A 3SDYL 4A16A 5C7XH 4C29A 1UPCA 2J1LA 5JEEA 4XYGA 1D8AA 2R2CA 1SVMA 1EM8A 2VJMB 2G9QA 1LLDA 4YHBA 2MTAA 1BXRB 3ZQUA 3BP7B 4I14A 5DYYA 3VFOA 1RURH 1NYRA 3CXDL 4CKWB 1RQXA 4K1LA 5SX4I 2Y6UA 2JFBA 1XBDA 4R2GC 4ANUA 4HGOA 2IOHA 2QMYA 4HOXA 4BNGA 4HQ6A 1IAOB 5TTRA 3WX0A 4UT9L 4IIDA 3CVVA 3EO1B 3AERA 1L8LA 2A84A 1JZIA 4IEFB 4N4YB 4NZTL 4YN3A 4PJFB 1B43A 3PWLB 2XBZA 2ACKA 1P74A 3QUKB 1GGBL 5D7LD 1DARA 2AGVA 4G26A 3LVRE 3K09A 4NLHA 3ZNNA 3EYFA 1R0AL 3KOYA 1M05A 3FUIA 1F4WL 1PZNA 3UXHA 5ALVA 5E3HA 2FLVA 4JC5A 4ZS6D 1YZYA 4MWZA 3ZCPA 5LBGA 4Z2AA 4XP5H 2YRPA 5EOCH 4CKXA 5CP7B 5MGNA 4LOIA 1C16B 2KZBA 3RKRA 2NDFA 2XWBF 1AZRA 4C7XA 4GOSA 4BJ5A 2JVKA 4GXUM 2YXVA 3L7AA 2JTDA 4JP1A 5D3MA 3GX1A 2WSPA 4UTBA 4QRRA 1HKFA 1CQIA 3KLAB 3W6PA 1QV7A 1MQ9A 1YEGL 5L2KA 3GM8A 3GR6A 3R1GH 4Z7NB 2R4UA 4PW9A 3BEVA 4AT1A 4RK5A 1W80A 1Z5HA 3VH2A 1EDQA 1FFXA 5BYJA 2H3KA 5C92A 2LXNA 5J2UB 5DEGB 1WIWA 1KPRA 2GKIA 5B7GA 4S12A 4UBDD 3TQRA 1L7RA 1DVQA 1I6MA 4L08A 3WL8A 1YJDC 2J0UB 2Q3HA 4IJ3B 5IWLA 2E4VA 2LKCA 3C12A 5LWYH 2H7YA 5L53A 1GCOA 2WOYA 3D7MA 3N1QC 1HORA 4TLCA 5JAOA 1IGYA 3I42A 1DJGA 2AA3A 4A7QA 4YDRA 4C0WA 4EG1A 3NIGB 3SXJA 1HRKA 3MG9A 1QSZA 5EU6E 3W0WE 4Q1EA 4KWTA 2H2SC 2RB5A 2YZKA 3K0CC 4C4ZA 2FSIA 4IXDA 3FXAA 1C2TA 2NX5B 4X6EB 4TOYH 2D8MA 5B8CC 4NCHA 3OD3A 3T12A 4CA4A 4NUGH 2BVUA 2WTUA 1CFZA 3EG9B 3F6LA 1IC0A 4OLJA 2VZ0A 3L1KA 4L3EB 3A4DA 2WICA 3MNZA 1V1RB 3BXFA 4IRMA 5AWNH 3SYPA 5J13C 3JT0A 2F7PA 4QYOB 4RKFA 4UAJA 2NNLD 3CSGA 1TJHH 1REIA 5KN5A 4URHA 4NIMA 2HXGA 4KQ3H 1E4VA 1I2AA 3AUKA 2Y4OA 2F54A 1FS4A 4IQHA 1P2SA 5MEOA 5DFVD 2ZWAA 3LYLA 4WLUA 5DK0A 5LKRA 1ZGLM 2OZPA 4M9CA 1WNFA 3ZX5A 2IEYA 4ZQBA 4LJ7A 3INTA 5EJ7A 5AXDA 1NQXA 2WN2A 5HYJB 3E1GA 3AREA 2GJKA 3I8XA 4RQUA 2R0LH 3RRNA 3MOAH 4JI0B 5F21B 4KITB 4XGZA 8CGTA 3GEPA 4N24A 3DFFA 8PAZA 1JTVA 4KFZC 3M46A 4R3UC 3QUYD 3NWBA 4MYSA 2ZS7A 5AK0A 5TF1L 1YQGA 1MH5B 1FYVA 1A8HA 2P5YA 2YV1A 1Q44A 1L4EA 1T9CA 3OU2A 1PKOA 4HWGA 3GLGA 4HJJH 2Q50A 4ZI2A 2V0NA 2CEKA 3CKYA 4X7FC 4CSZA 2LR4A 1HOCB 5BRZE 5B58T 1VDMA 3FU8A 3C6YA 1L7OA 3QJYA 1RXCA 4O2CB 3EOTL 4REMA 4UEKA 1LDSA 3VQ2C 1XD1A 5F78A 4S2UA 4TYPA 1SNYA 4G8IA 3OI7A 2YPLD 1Y5RA 4OXYA 5AESA 4IW3B 4LSDA 4A2EA 2FEDC 2OE2A 2WIIB 2ZANA 2X15A 1NVFA 1CE6B 3HB9A 4ALJA 1T80A 1VPDA 3BQUD 3FTGB 5BW7C 5JW5B 1S8FA 2XH8A 4J9VA 4Q1FA 1K8IB 4LNRA 1WBJB 2A33A 1PU2A 2ECPA 1Z07A 1XQ1A 1FDOA 1EI9A 3HS9A 1ADQH 2IV9A 1QWOA 4NNOA 3ABMB 3BUIA 1EMTH 1VP9A 1K3IA 2DOCA 1JPGA 3H2YA 3E1SA 4EFDA 4AQ1B 1A27A 2MIIA 2ATPA 5IMOB 2HMTA 7FABL 4V33A 3OG9A 1CZLA 5C0RH 1PZDA 5AOBA 3NAZA 4BMYA 1YCSA 3I2YX 1Z3IX 3UICA 4X54A 1M33A 3AFGA 1T4BA 5FOQA 2AQPA 4CRWB 5KAQF 1QGDA 5BN5A 3IJPA 4KZDL 3KPVA 4I55B 3B7PA 3FVVA 1ZIPA 2HUEA 1OFGA 1OZAA 4I4TF 5E2VH 3X1KA 5I3ZA 1ZCFA 4OQEA 1ZVJA 3O3AB 4LNUB 4KOEC 1JRHI 2I54A 4EHIA 1GILA 5D5MB 3G8CA 3D18A 2JCGA 4KKBD 1AV6A 3TJZA 5K5YA 4A7PA 2CUNA 4OKVB 4N6OA 2B4AA 4HD5A 1K4KA 5AW8A 1YR7A 3ZGYA 1IXZA 2DSTA 3HR7A 3KYKL 1Q77A 4CDHA 4OXRA 1JS4A 3DAHA 3BCDA 2HSEA 2CFIA 5DP2A 1DTWA 1KF0A 3GFVA 2VSKB 3GG9A 1X5KA 1P5UC 4GUAA 4J5VA 4X90A 4FGZA 4LVNB 2QVGA 2C8NA 2VITB 4NQRA 2MQ0A 2O4EA 5EQFA 3QHTC 4QWWA 4HC1A 4MSWA 5GGVY 3TNMA 4X6FB 1EFXB 2DEXX 4GKKB 4KXFB 5IVZB 3Q12A 3D5EA 1OSPL 1NAIA 5EP3A 4BCBA 2EXYD 1KBBA 1C7JA 1QK3A 4I2VA 4D9EA 1JH9A 3ODGA 3I02B 2E48A 3PYCA 4DLPA 2HA3A 1Y6QA 2AFNA 5GISL 3AR4A 2ZUVA 5BRAA 4ZCTA 5HVHB 3MTQA 4EY3A 3KSUA 2HK9A 5G5DB 2DOKA 5DBGA 1AD9A 1WLYA 2YKLH 4N4AA 4LF3B 5CZRA 4L1KA 4ZT1A 2XKBA 1XJCA 4OU3A 3GLIA 1D7CA 2QWXA 3HBAA 5DYTA 2PLAA 5TDOB 2WUWE 2C7FA 8AT1A 1N6VA 4GUQA 2A6KA 3PGKA 1YYLH 5IZ4A 3ZJAA 1TIPA 4M1KA 3OZ9H 1VDGA 5FW7A 4U3HA 3DTUB 1YEEH 4EB8A 5EA2A 3UABA 4R41A 4BXOB 1QU3A 3ZHRA 3QYJA 1SCDA 3C6LA 1XA3A 5EHNA 1FSGA 2LAAA 1CF8H 1XA0A 4YDLB 1CD8A 4CETA 3F6PA 4MYPA 2P90A 5CCGE 1J1UA 4YRCA 1NUTA 3HFRA 4WAFA 1NW8A 1GPOL 3U46B 4QNNA 1MP0A 4P9NA 4BQIA 3T1WA 4U1JB 5JH7A 2BC9A 3A6JA 3LYAA 1XGQB 1H8LA 4MQFA 1RQ5A 4ZNCD 1ZGHA 3ISTA 2I7XA 2GM4A 3ZU8A 4RV9A 2R7AA 4WFEE 3LY8A 2N1MA 3L3KA 3UZEA 2WP3T 4BO8A 2EO7A 2IKSA 4NZRL 3VFUB 4TNVF 5HKLA 1GZ4A 3UQZA 1Z7BA 1YUHB 4NC2B 1GYRA 1VL1A 4TV9B 2PKDA 4IBVA 4L8BA 5B39G 1CP2A 2WDZA 4E0RA 2UZYB 2F1EA 4LGRB 1P2BA 4IUCS 1Y98A 3IP6A 2XG5B 1LDPL 1KFBB 3UTPE 4PRAB 2Q1TA 5HBRA 2QM0A 1HEZB 2KHZA 1UBUS 3L5JA 2N7BA 2HQOA 2PMFA 2A7XA 4G5AA 4LVHB 2XI4A 1UK9A 2HM7A 4OHPA 3L4ZA 3RBZA 4PRHD 1CVLA 4D8WA 2DIEA 1ZW1A 3VYWA 2HBQA 1S3KH 5DWQA 1XCLA 1MW3A 3JTSA 2GZ1A 4M61A 3KQUA 3T1TA 2G5CA 5DK2B 3PNWB 3CGTA 4QDJA 4V1DA 4QDTA 3V55A 1PTJC 4TQEH 1XRNA 1FSPA 4JA0A 1EWYA 1LRJA 2P24B 3F05A 1RAIA 3O4OB 4Q1DA 2Q8PA 1WA0X 3G02A 4J94A 3QZWA 4RAQA 2CLOB 2K9UA 2YVQA 2K3TA 4NWUL 1V7NH 4HADA 1XQXA 5CA1B 1ZUIA 1NDGB 1FVDB 4TN9A 4ONGL 4IXMA 1KCSL 4JP8A 4Q1AA 2IH3B 4LU5H 2IYSA 2H1CA 3NOXA 2JGRA 1UEYA 2NTFB 4YJGB 3BH8B 1XZMA 3SNHA 2AP2A 3R7AA 3U1VA 2TMDA 2FQ1A 5CT9A 1D9XA 3LN5B 2DI7A 5IF0A 2OMXB 3FK3A 4I5EA 4BO6A 4XVUD 2AI2A 1OHHA 3K72A 1XZIA 3TNDA 3EIWA 2R6AA 5LB2A 1E4HA 4RAVA 3ETHA 4WXEA 1OTSD 3VXUB 1WAAE 4HPYH 3KPJA 1ARZA 2GD2A 1R5WA 3NVAA 2VT0A 1T8TA 2PYIA 2O1EA 1MQKL 4L8VA 3R5KA 4I4TA 2ZUCA 1CUZA 5J4YA 3U7RA 4BMOB 1JEOA 3C6KA 3FSGD 2NZVG 4XQ0A 1SC4A 3DW3X 1EXDA 4WZBB 3TIIA 4UAUA 3C09B 5FNVF 4JJKA 1TFUA 5ADPL 1IM3A 4GIBA 3BUPA 2VP2A 3D48R 3ZZLA 2OHOA 5CH8A 3ZDZB 1B00A 3VW3L 3S8GB 4EX6A 2O6EA 4C06A 3IDFA 4IK6A 3SQOA 1ZRHA 4L9LB 1GZQA 4PWGA 4TLDA 4XAWH 1WPXA 1LI7A 5HHTA 2G5PA 1RUAH 4OQMA 1L7MA 4B3FX 3MRLB 4XNZB 3O4LD 3IAHA 3KVDD 3GMQA 3NFSL 1VQ1A 1SO8A 2FIRT 3TV3H 4OFZA 4QHMA 4Z2YA 4UDYX 2VXQL 5FPIA 5BWBA 5TPZA 3B6JA 1Q83A 3GLRA 4DZ8B 5KJFA 4KVPA 1U90A 1JGDB 1ZN2A 3US1A 1TNDA 5DHQA 2FT6A 4PY8I 1GPKA 1RM5A 2WYIA 2NY5L 1IC5H 1TTUA 5DDHB 1A0QH 1JHOA 4QU9A 2ROXA 3BFPA 1RJYB 2QBWA 3LBNA 2OVFA 3L02A 3ZWWA 1G6RL 2W48A 3FQ1A 5TH2A 3L04A 1PMYA 2EXWC 4WXPA 4N1HB 2P52A 4NAUA 2OSWA 3BAFA 1HETA 2EVHA 4C6SA 1QHHB 4J07A 3GLTA 1EHKB 3NWOA 4HUKB 3FCTB 4IRSC 3FUHA 1SKAA 3F67A 4N1EA 3WLSA 1ZR4A 3L6OO 2LDXA 3UTOA 5FB3A 3Q3HA 3DV4B 2X5OA 1F6WA 1IZ9A 4KXLA 1EUYA 2QN2A 4RGYA 4CQJA 3W39B 2BKUA 1J5EB 3PVSA 4ZVPA 3LC0A 2ZRJA 4M1MA 2P5WB 5A9TA 1C4OA 1LE5B 1UK6A 1FQKA 2QJOA 5C0IB 1X2EA 2CBQA 4H60A 4DWJA 4P23D 5FV4A 3RLSA 1P3DA 4DSUA 1D6EA 2RK4A 2BOCA 4MV1A 1M2GA 2QE6A 2J9ZB 5ALSA 4AN4A 1A7AA 4ETIA 1EUTA 1FDLH 4JFDD 2Y1CA 5JDCC 4CEJA 1T3ZA 4RETA 4PLKC 2UZXB 3T3NA 1J8HB 1K4CB 1PSWA 3UBTA 4KV5F 3DHVA 3AVWA 3ICQB 2WC7A 2ZG2A 5AYQA 3SPVB 2HN7B 4R4JA 2JIPA 2DQFA 4QKXB 5AOAA 1MFDH 1C8LA 4HJRA 4XPFH 1QO7A 3EVFA 2NTEA 4Z7VE 4JHXA 4Y3UA 3DURA 3CZLA 5ED4A 5F88B 2VP5A 4PWFA 3JALB 1AKNA 3SQDA 1PSKL 1KTJA 2H32B 2FFJA 4EG6A 3C8DA 1T0MB 4JGNA 4G83A 2QPAA 1KE1A 1RMQA 1Z39A 4O2AF 4HAVA 2CDGB 1E1QD 5DLYA 1WZ2A 4L05A 2XOEA 4JKYA 2X70A 1K6XA 4QGYA 4JP3A 3Q9LA 3H5TA 4TPKA 4C1BA 4P5KA 3ZVVA 1ODJA 3J27A 2A77L 3D50A 3GIZH 1JHKH 2ERJB 1ZAKA 2LTQB 1G7SA 5HHOD 4YXKL 3CE9A 3DUHA 4XWTA 3CC5A 4WACA 4DR5B 4DO5A 1EJFA 2QV2A 1XIWC 1KUMA 3QRGH 3GDFA 1G0NA 4ZT3A 4WEEA 4IF4A 1VE7A 1E58A 2Y24A 5IESH 1VG8A 4Y88A 1EMTL 2B61A 4I1RA 1N9PA 4ON9A 4RX4D 5F1KC 5GJBA 3G5ZA 5EUOF 2QP4A 5BP7A 1G7CA 3O1HB 5JW6A 2VLMD 3TYFA 3FBKA 4YAWA 3HG5A 4N9WA 3G5XB 5JISA 5SWZB 1S78D 4G01B 1B4LA 5WRFA 5HR5A 3QIVA 1JSLA 4J3FA 4GHWA 2FQYA 1OP3K 5CB4F 1V05A 3B6MA 4N9GA 3IDMB 5CN1A 1H8NA 1GTG1 5IG2A 3OX4A 3JQCA 2EUVA 1AP2B 3F7VB 2BZDA 4HIJB 5G4KB 4LYYA 1M1NB 4MRAA 1I7NA 1JPVA 1K8IA 1SWVA 4AJIA 3BS4A 1SJHA 3EUAA 1L9KA 2FT8A 1CE6A 4WVFA 5IMLA 3LX4A 2HCZX 4ML3A 4QTHA 1E2QA 3IRCA 4R8KA 2JLQA 5C0BA 2A1WL 1WZ1H 4I48A 3N0PB 1M3IA 5CEEA 3A6FA 2ZKLA 3U3KA 4A68A 4WEBL 1JFFB 5CLWA 1K5DA 5A6IA 2IBBA 1L4UA 2GTZA 2H4ZA 4KK5D 1TG8A 4QJ5B 4O5OA 4JKMA 3E2MA 4DW2H 3ZZTA 2BHZA 3AWGA 4MVJD 1QF7A 3FUKA 5DFWH 4LTNA 4BCYA 1JD7A 2F1JA 3JASB 4DEWA 1GITA 1XTBA 2QUKA 4XCEA 3A23A 3D59A 3KLHC 1J8SA 2FPSA 2FH6A 4BO7A 4PV9B 4CI9A 5DEGA 5JQHC 5IROC 3P02A 3LO5A 4CU6A 1FMFA 3RADC 2AKYA 5EO0B 5JW4R 4BFIB 3SU8A 4LOVA 4M1EA 3RFXA 3IOCA 3GEHA 2R84A 4LCCC 2E82A 3OH8A 3Q6IA 1T5SA 2W80C 3H11B 4CMHA 1PWZA 5T5NF 1JFRA 1K7YA 5EJEA 5BS0A 1CE1H 1BDHA 2Q3DA 3L4VA 2VMDA 5C2JB 2CAKA 1WFIA 6AT1A 3QPKA 1BKYA 3IBTA 5TX7A 4AIZB 4DRXB 5LGJA 3V00A 1X1SA 3VSUA 3MQIA 3CX7A 5A1AA 1PG5A 4CNQA 4M43L 2ZKMX 1RWBA 4I0PD 1ZM2A 1H42A 4D9FA 2P26A 4P2OB 3A4YA 2ZIEA 2YD6A 4TWRA 2W95A 1J7KA 2XD4A 3UOWA 4QRRD 5HILA 3HKZA 3WEAA 2WIDA 3F85A 3K46A 1EFXA 3A0RB 2C5HA 4DMRA 4J0GA 1CTNA 1BP3B 2HO4A 4MB4A 3H0EA 4JN2A 4JKLA 1U8MB 3I3BA 2ITEA 3C4VA 1ESNA 1RJ9B 3DP7A 3LXUX 2C9UA 5U4XA 1A1NA 1HDOA 1JAEA 3I50H 1XXHB 5C07D 4H9GA 3JV4B 4Q3KA 2X0IA 5I8CB 1OZHA 3D9AH 4MS1A 5AP9A 2NY2B 2L19A 2LV4A 4JDZB 1X7XA 3KTAB 2X3BA 5BNXD 5IT5A 1E6OH 2J1YA 1K8YB 3QXUA 1TZMA 3CMMA 4Y16B 4HN4B 3S34L 1H5BA 4U7TB 4TTIA 2ZDQA 1N1GA 4ZAKB 3DV0B 1JVBA 2AW5A 4YRFA 1YS6A 1U2YA 4D80A 4QPJC 3TGPA 3TR0A 3BHMA 2X58A 4JSTA 1U7XA 3BZEB 2L04A 2BZGA 3ABRB 3JX9A 3WDLA 2VERA 1DC6A 4RTPA 5CJQH 5KNLA 3LN4A 3KPMB 3HG7A 1EEQA 4KR7A 4N85A 3SZOA 1E1CA 2OL3H 1V7ZA 2LCQA 1V96A 3LEXB 4MI3A 2Z1NA 3E3OA 3KGRA 3FLAA 5IGXH 4H0HB 4HU8A 1I4LD 4OR1A 1MFUA 2J8OA 4PJEF 2ZSJA 2W4IA 5IT0A 1KI6B 8ADHA 1DXYA 4BRVA 1OAXH 5ANRB 5BR4A 2AK4A 3BCRA 4JCWA 7ADHA 1FLVA 4E2WA 3O9WC 4FQXD 2BEWB 5H3HA 1LBIA 4BNLA 2H2SD 3WJJC 3J2PA 4HCGA 4LNAA 3DDHA 3B5TA 1DVZA 4EHFA 1E5DA 2B8EA 4NK5A 4CSPA 4QRAA 1G2IA 4P08A 5JNYB 4FYYA 2ORBH 1RLMA 4D02A 3JD4A 4PPQA 4U2YA 2H1OA 3PV0A 2MSEB 5HYSA 3DAPA 1KT2A 3TOZA 1MA3A 4CC4A 4DUGD 1ISHA 4XARA 1RZJL 2PMWB 4MHOA 1AS7A 3FOMB 4HC4A 4F2HA 3IKTA 5EL0A 1CDOA 5IVNA 3SLRA 4HNHA 1CYEA 2PYEB 1I1YA 4P2RB 1VRSA 1T1EA 3D2UA 2GVYA 5FR2A 3EQ7A 2ECFA 1A2YA 2PZGA 2VSYA 1YR3A 4RBPK 1UQRA 5K1ZA 4RPLA 5FIUA 3U7YH 5K9OB 1AZZC 4KKQA 4DUGA 1E0AA 2C2BA 1YS1X 1KBKA 3UMVA 4WX2B 3HXQA 4LSGA 3KJEA 1R3HA 2A83B 3LNEA 1DEKA 1YVUA 4GBMA 1ZEAL 1FUKA 3HB7A 3K9LA 3LQZA 4DZTA 1ISRA 2ZUUA 5KJEA 3AG1B 4FQ7A 1QFWI 3VVVA 5FA6A 1OYWA 4H25A 1BM3H 5F5XA 2NY5C 1I6KA 3QXDA 1BE0A 4ZEOA 3D51A 4IVNA 4PQRA 1JLKA 1XZFA 3FPXA 3ROOB 4BLWA 4XI5D 4IRJD 2IYWA 2A1UA 1NUUA 4Z3EA 5DX8A 4BZWA 3LKRA 4FA8A 2GHRA 4FD2A 3JUYA 2G4EA