5GRUL

Structure of mono-specific diabody
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
228
structure length
228
Chain Sequence
QVQLKESGPGLVRPSQSLSLTCSVTGYSITSGYYWNWIRQFPGNKLEWMGYISYDGSNNYNPSLKGRISITRDTSKNQFFLKLNSVTTDDTATYYCARAYIGFAYWGQGTLVTVSSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSSSSLITFGQGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Maltose-binding periplasmic protein
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Escherichia coli
total genus 55
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2016-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gruL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gruL01
3RZCB 5J6HA 1DQTA 1J8HB 3TIDB 1I8LA 5C0RH 2QSTA 2AXGA 4NFDA 4LGSB 4L8SB 2YRPA 3F6LA 3VXOB 1MREH 2OZ4A 1HQ4A 4WEBH 1K5NB 4ZNCD 4P48A 3TJHC 1FFPA 4P5MB 4JZNB 3RWEB 5I1IH 2OZ4H 1R5IB 3DVNB 3SE3C 3MGTB 4UIMB 3TV3H 1T03L 1CD0A 5C0AA 1KIPA 1A1NA 5TH2B 2V9TA 2EDDA 2VIRB 4MJ2A 2X4NA 3D2UB 4I2XE 1OOAA 4TTGA 1X5HA 2YPKA 1QHPA 4S0TD 1I8LC 1HH9B 1T6VN 2DB8A 3ZZ1A 3H3PH 5GJTL 3L5HA 2VRAA 3QNYB 5IEKA 4XMKH 4K2UH 1GH7A 3VRJB 2NYYC 4IHOA 4ORZC 1VHPA 1C5CH 4XAWL 2O26U 3TZVB 4EOWL 5IHUH 5I1KH 3GBML 4QRPD 1H3PL 1A21A 4G43A 4E0RA 1Q0YL 2A9ML 3V4VH 4NT6A 5IBUG 2HTLD 4ZO7A 4QCIA 3R1GH 4ZS7H 4CMHB 2IANA 3AS1A 3HNTL 5HD8D 3FQWB 3BQUA 4Z7VE 1Q1JH 5CS7A 3C87A 4ZTOL 4P99A 4XH2B 1MY5A 1D5IL 2JJVA 1WC7A 2Y36L 2VZ3A 4FOMA 1XIWC 2K1MA 4MB4A 3REWA 5IESL 4DEPB 4LDEB 4YHMH 3OJ2C 4PGEA 2R4SL 3QO0A 4ODUA 3BWAB 4FN0A 1G6RA 1LO4H 1OWWA 2YUZA 1RUMH 3C60D 3T0AA 5DGQA 2BHUA 4CUCA 3NBNA 2Y1VA 1G6RH 1EJOL 4DCQB 3BQUC 3WLWD 4WW1B 1VGKB 5T1LA 3D69A 1RIUH 3BP4B 5DRNA 3E8UH 4JJHA 4ODXA 2YWYA 2VDLL 4X7SL 1S7WA 1OCWH 4MD0A 3S36L 3T2PA 3AC0A 3V5KB 4R8WL 4KZEH 2G2RB 1ZE3C 5EOCL 2DQTL 4YHOL 4I5BB 3O8XB 3HMWL 2Z4QA 3T2QA 3Q5OA 4DAGH 4XPFH 3RZCD 1E4XH 4OZHA 2QSCH 5CAYB 1E27B 1FPTL 1R5WB 5CCKL 3LSOA 3HCVA 2DKUA 4FQIH 4LU5L 2NY5H 5I75B 2BVPA 5F9JA 4LPTA 3MRFB 1FO0A 1HSAB 5T33H 5FGBC 3GSXB 2AJUH 3ZL4L 1ZLUH 4LKXB 1VKXA 1QA9B 2VE6A 4IDJL 1FO0H 5FYJU 4FZEH 1CL7H 2J3SA 4QRTA 1P2CB 2A73B 1RJZB 3FOMB 2CRYA 2EXWD 1ZTXL 2NY5C 3ULVE 1JPGB 5GRVL 2Z31C 4OJFL 3CDGA 4ZFOL 1AR1C 1IM9A 2R0ZL 4JLRA 4UOW0 1DUYB 2W1NA 5F7YC 3KYOA 3TZVD 1YEIL 1IC4L 4OKVB 4YHNB 4P9ML 1BJ1J 2EIZA 2ADJA 3MYJA 4HZLB 4L3ED 1OD7A 4I3SL 2F74B 3EYQD 3ARVA 2H26B 3C8KB 3I85A 4J1UB 1MVUB 4U6XA 4ZUTB 2X9YA 4JM2A 3KPSE 1FYTD 3HKFA 3OV6A 1QLRA 4NCC1 1BIIA 3CLFH 3HUJE 4LCIL 3AMLA 4KROB 3PWVB 2D7PA 1LO2L 3FCTB 1P7KB 4JM4H 2ZCKL 3MXWH 5BV7H 1A5FH 5K9JL 4WRLA 2HT4C 1J1PL 4XXDA 3K0WA 1S7VB 4R0LA 2MQ3A 1F11B 4RMWA 4X80H 1ZLUK 1KGCE 1G9MH 1BHGA 3MA7A 1KJ2L 1WCBA 1MCPH 5IB1A 4UV4H 5ITFB 4JFXA 4LF3B 3T4YA 4F7TB 3OJDB 3I6KA 3SCMD 4ODHL 1LE9A 4XP5L 1A3LH 4GW5A 3O4OC 4Q2ZA 4LCWB 1UKQA 4G9FA 2OM5A 2P8LB 4BH8B 3QIUA 4NUGH 1MCEA 4ELKB 4CVXA 1T0NB 1W8NA 4HT1H 4BKLB 1RK1B 3EIFA 4R0LC 3VXTA 5IOPA 3O8XD 1YPZE 4FABL 2ESVE 3DRTA 3D3VB 4U3CA 4HS3A 5HGGS 2B4CH 4EI6B 5IJVA 5E1HB 3WKML 4Q9QH 4B5EA 1ZHNA 4JO1L 3ZKND 2EEAA 2OJEB 1WWWX 1T89A 2X5PA 2HWZL 2Q87A 4JB9L 2ARJA 4BQ8A 2RFXA 4TVPD 3QIUC 1DFBL 5IB3B 4NO0B 5F8RC 3U2SB 1R0AH 4GAJL 5T3XD 2BOCA 4A6YA 1QRKA 4PRPD 3W9EA 1ZGLP 3UROR 1KSRA 4HJGA 3LQZA 5B4MD 4JRYE 4MB3A 2W9DL 3H9SB 2IALA 4MAUH 1U8NB 2VAAA 4I18B 3WNMA 3D87B 2VSCA 4JCMA 4LL9A 4BA8A 5KS9E 4CW1A 3HC3L 1R5VA 5DSCB 3IVKA 4TVSa 5DRZA 1A6TB 1T89C 2J88H 3GEWB 1T21B 3FRPG 1Z9LA 4FQCH 4Y1AA 2E9BA 4WHYG 5D7KE 1UH3A 3OJMB 2WV3A 4H1LG 5F96H 3RWCA 4O5LL 3INUH 1CT8B 3S5LB 4OZGA 4YHLH 1JYWA 2BCKB 4PV8B 1KG0B 4NQXA 3LKPA 5FA3B 1G7MA 2UVFA 4DTGL 3PL6A 1MPAH 1F6LL 1YY8A 2BRRL 4PPTA 5HI4C 1EUUA 3F12B 2X4QA 1ZS8B 2AJ3B 3GSUA 4IS6A 4NJAH 4WCYH 2EDOA 2VZUA 4MA7L 3O4LE 4ODVL 3SE9H 5EU7C 4ZYKA 1X5KA 4RAVB 5GS0H 2FECI 2ZCHH 5FYLH 4JFDE 3G6DL 1C5DB 4KROD 1SY6L 1Q72L 1RZKL 3EYSH 4UQ3A 3IDMB 3ZYZA 3JWNC 1KTDA 3W0WE 1HZHH 5HHME 1JTOA 2EH8H 4MZ2A 4YDLB 4LSTL 3HZKB 2B5IB 4NNXA 5ICYA 2BMKA 3PL6C 5E2JA 4NQCE 3TIEB 4YDVA 5GS0C 1DN0B 5MENE 4YDIH 3RUGB 4RRPA 4NM8L 4HKJA 3OKEA 3UTZB 3GKWH 2IH3A 2YD7A 5BOZG 3WIHH 2PW1A 5KSBB 3N85H 4OFYA 2OJZL 3VG0L 3TNMB 3KHQA 2DLIA 3P77B 3I3EA 3DSFH 4M7KL 1EMTH 2QQNL 5ILTL 1SMOA 4K23L 2ICEA 5HDBF 2F5AH 1D9KB 3DV4B 3HRPA 3L5WA 4GW4B 5ADPL 1MHEB 1OTUD 2FCBA 1NKOA 3FONA 1T66C 1RVFL 3EHBD 3NFNA 4MS8D 1Z5LA 3FN9A 3RIAK 25C8H 5I1HL 2EXYC 1RZGB 3FKUS 3UTTA 3WBDA 2RJMA 5JW4Q 4HIIB 4XP6L 3O3DA 3VW3L 3X13A 2FZ3A 2JJUA 2RBLA 3UBXB 3MNVB 5D70L 4JREB 5FM5O 5LQBL 4DFIA 1MH5B 1U2HA 3GMPB 5FFLA 1M7IA 5EU6A 1XH3A 4DQOL 1AD0B 2IMMA 4U6HA 3QDGE 5CBAB 3ULSA 3CFEA 4OGYL 3IF1B 5E5RB 4WV1A 4MD5A 4CJ0A 4GBXA 4LLVB 4TRPH 3RY6A 5LXGL 1JGEB 4F15B 4EVNB 2DYPA 1RD6A 1LO5B 4BJLA 5MI0B 5ERWB 3TESA 4B41A 1J88A 2O61B 4MQ7B 1RUQL 1QFUL 2ZUXA 3JV6A 5GISL 3ZDZF 3OQ3B 4CGTA 5E2TH 3AXLA 7FABL 3BZEA 1BJ1H 1M05A 1E6OL 3B2UD 1UM6H 3SKUD 2E7HA 5DLMH 4GG6B 4BZ2L 4WV1C 2VLKA 3HS0A 4AIZB 3KXFB 3QUMH 3RY6C 4YBQD 1IC5H 1MJ7L 1ULVA 4HUUB 2FNBA 3C2AL 1W72A 3WNPA 1RURH 4D0DA 2OI9C 3P4NA 1KLFA 3SE8H 2N4IA 1AGCB 4FTVD 1P9MA 4PRIA 2CDEA 2VN7A 3FB6A 3NAAH 3MYZA 3WNOA 5BO1H 4OIIH 3D48R 5CMAA 5ICZA 4YHZH 2GJ6B 5DQ9B 1YY9D 2UWEB 4ZUWA 5EULV 5IVZA 5L0QC 2AJZA 5I71C 4GRWH 3TWCL 2VABA 3DX8B 4YBLB 4NQDE 1P9MC 2ZCLL 4X9GA 3GGWB 5LAXB 3CXHJ 3RY5A 1RU9H 1TQBC 1U2CA 5E9DB 3L5IA 1U8HA 4PJEA 3BH9B 2R23B 3KJ6H 5F7MC 4H8WL 3QCVH 3MRIB 4TQEH 2WUBH 3DX9B 1IFHL 1D9KD 3AAZA 1T20A 3BO8A 1U95B 2JB6B 3QP3A 1BZQK 3KPLA 2HJFB 3SDXF 3HE6B 2V5RA 1QACA 1NUGA 2OR9H 2X4PA 4KV5E 5GGTA 3QQ3A 4FQHA 4HPYL 3B83A 4QRPA 3ARBA 3RWHB 4RGOH 1EV2E 3G08A 4NQUA 1KTKE 3I2CL 5DJDB 4YDJB 2M26A 3FB7A 5IVNA 3LVEA 2E7CA 3MRHB 5I76B 4U1SA 3B9KA 5DEFA 1IEBA 4P3CH 3UYOD 2AJSL 1HINH 3MGAA 2RGSA 2HJKA 3LKSB 3BAEH 1N5AA 2PYED 2YR3A 3ZTNH 5D2NE 1HDMB 3ARBC 3IS0X 4RQQB 4FQQA 2PW2B 2AKRA 4Y2DD 2CXKA 3STLA 3DUUB 1A6ZA 5C7XL 1ED3A 2HTLC 5CEZL 3MUGB 3FQXA 3C60A 3B9KC 5E8EB 3ZTJG 5JXAH 3P73A 1OTTD 1J8KA 2XNAB 3BZDA 3T08A 5FO7A 5JIKA 5L2JA 5IMLA 4K07A 5JUEH 1K8DB 4G6FD 5D8JL 3TBVA 5JLZA 3S9DB 1WZLA 2WANA 4Q97A 1RIHH 1MJUL 3WKNA 2P5EB 2AEPH 1LD9B 3F62A 4KVCL 3ARED 4XC1H 1T80A 3VFNB 3F7PC 3M17B 4HWBL 4LLWB 4TUOB 4X83A 3BP7A 3C60C 1NJ9B 3JV4A 3QHFL 3RZCA 5LGJB 3P11L 1TCMA 2VNCA 5GGVL 4J4PD 3WLWC 4NNYB 5D7IF 2YUVA 2R2HB 4L8SA 2G9HA 2AJXL 3IU4L 3GMRB 2XG4A 2R1WB 3E1F1 5I9QB 2Q6WB 1K5NA 1JNLL 3UC0H 1FBIH 4P5MA 1X5JA 4JZNA 2P45B 4MQTB 3RWEA 4LLAA 2BSTB 1LQSR 1P4IH 1R5IA 3DVNA 4UIMA 4QLRA 3QNXA 3RX5A 3P0VH 1MNUL 5KSVA 3L1OL 4OZHE 5TH2A 5CLTA 2VIRA 5E9DD 2VTFA 4HIHA 3OKDA 4IOIB 1A14H 3RZCC 4E41B 5I8CB 3TO2B 1XR9B 4M5YH 4OFPA 4ELMB 1FC1A 4HWZB 1A8JH 4L8SC 3MOQA 4S2SA 2WBJB 3VRJA 5GRUL 4XI5D 1CGTA 3TZVA 4F37K 1WICA 3HZYB 2F54D 4JFHD 3L3IB 5C0CD 1CLCA 3I6LD 2V5MA 4L3EA 1ZT7B 4ZSOE 4F8QA 4HSQA 4NGHL 1JE6A 1LO0H 4M7JH 2CR6A 5SX4I 1J1XL 3BX7C 1ZWIB 1JYVA 1NUDA 5CZVH 1IC7L 1OARL 4KRPD 1NGWB 1FYTA 2G60H 3FQWA 1CDGA 5F7LB 3TT3H 3IRZA 1ETZA 1JZ7A 1PLGL 1CXKA 3TZVC 3FB8B 4QXWA 5CGYD 4Q0XH 5IEHB 1I9JL 4W6WB 1U91B 2FGWL 2FSEB 1J0KA 3NFPB 4P23B 3BWAA 4R7NA 4AMKH 2DTML 4KHXH 4WEUD 4KKLD 2PCPB 3GSQB 3EYQC 2B8OT 2BHYA 2CQVA 3H9ZA 2R0KL 3VRIA 1A1OA 2R0WH 4CMHC 2FGZA 5DFTA 3NCBB 5E7BA 4DCQA 1BF8A 3SCMA 2CLVB 3QG6B 5BVPL 4GLRH 3BP4A 32C2B 3MQIA 3CLEL 4XP4L 1P5VA 3VH8G 3LIZL 4LQFL 4NN7B 1TVBA 4RGND 3V5KA 4DEPC 1JGUL 2G2RA 1U8OB 4LFHG 4FNLH 1I8IB 4I5BA 4YPJA 3O8XA 5JW4M 2ITDA 4UIKH 5IB2A 2C26A 5HXMA 5DVKA 5KSUA 3VCLB 3MV7B 1NC4B 4UT9L 3SEPA 2O5YL 1JBJA 2V5TA 3SCMC 1E27A 3QEHB 4LCCB 4M4RA 4N90E 5ICXB 1R5WA 4OIAA 1PX3A 3S98A 2IQ9H 4L5FH 2VL5A 2JLLA 4NWTH 3O2VH 3MRFA 5EOCJ 1NC2B 1HSAA 1H5BA 4PRPA 3GSXA 4LKXA 2CRMA 2DQJH 4TVPH 3O8XC 4GFTB 4TNWK 2X1XR 1CFBA 4CDHA 1BAFL 4X4ME 5DVNA 4BELD 3N1MC 2YRLA 4DN3L 3UYRH 1P2CA 1KELL 1RJZA 2AJYL 3FOMA 1SJXA 5HYQA 4KRLB 3KYNA 5F7KC 1MFBH 3ZKNC 3ARZA 4ZPTB 3U7WH 1G9NC 3QEUB 3HC4H 1S5IL 4LSRH 4I48A 2OMBA 1SEQL 5I75C 3T0XA 3GI8H 5B21A 4MA8H 5CSZB 4OKVA 4YHNA 3SO5A 2YN3A 3TVMB 5BS0E 1YYMH 1QO3A 1Z6JT 3CZJA 4HZLA 2EDWA 3B2VH 3QI9B 2YUWA 5EU7E 2LFGA 1H3XA 5CIPH 1YMMD 4J1UA 1MRFH 1MVUA 4Y1AE 1IE5A 1HH6A 1BPVA 1DQMH 5D93B 1F3DJ 4XPAL 2LAAA 3CSYB 4YUEL 3PWVA 3FCTA 1IARB 3MV01 4FQLL 4O00A 1FNGA 2P8PA 4OLUL 3ZKMD 2A0LD 4D3CH 3O6LL 4G3YH 3MRBB 1N0XH 4P23D 1HCVA 4KI5F 1F11A 4JPVL 4P2RB 3MV8B 4HFUH 9CGTA 3X3GH 3CPLB 4AIXA 4F7TA 3PGDB 4MJ5B 3OJDA 1JWUB 4X4YB 3VRLE 3QHZL 1ODAA 4LARH 2VITB 1UQSA 1MOEA 4K9EC 4P9HL 4TSCH 3MUHL 4KROC 3EYUH 4NQED 3SJVB 1NGYB 2BNQB 2P8LA 5FECB 4BH8A 2CJUL 1NAMA 1P4BL 5JOFB 4ELKA 4YDKH 2DQHH 5H35B 1T0NA 3MLVL 5HYJE 3LEVL 3QUZD 4BKLA 1RK1A 1QVOA 1ZVSB 1KEGL 1NAMH 3TCXA 3GMMA 4PS4H 2OK0H 4IMKA 5EORL 2A1WL 4LSSL 5H8DA 3DO3A 4EI6A 3ZE1F 1KPRB 3FO1B 4DN4H 3LN4B 3FTGB 5E2UL 1MRDL 4OCRL 4PJ8B 2OJEA 2VOTA 4NKIH 4JFZL 2Q20A 1LP9E 1IAMA 3O6FB 1X4XA 4XP9H 3TBTB 2AK1L 1TJIH 3LY6A 5CJXA 2WP3T 1FAKT 3F58H 3NZ8B 1OTUC 2ZSWA 4G7VL 2YD3A 4G42B 4MS8C 1U8NA 4XTRD 5CEZE 1ZKAA 1GOHA 3ZT7A 4AJ0A 1DEDA 3JTSA 4JY5L 5DSCA 3U46B 3GHBL 4QRUB 4JRWA 1AH1A 5IMMB 3HI1B 1A6TA 2ITCA 1T21A 4X6BB 4L9LA 2XZAL 3RNKB 3G5YB 5E5MA 2X40A 1CT8A 3P9WB 5CJXC 1T03H 4AEHL 1NPUA 2BCKA 3B9VA 3DV6B 5IVXB 4WW2B 5GGQL 4PV8A 1KG0A 5I66B 4XPTL 4X6DF 4I18C 2MCPL 3QI9D 1AKJB 3LRHA 1ZS8A 2AJ3A 2XV6B 4X8XA 4M48L 2DLTA 5LBSL 2B1AL 4AZ8A 4RAVA 5DJYB 3WS6A 2HLAA 4FTVA 3S34L 1AQKL 2DLHA 4L9LC 4XAWH 1OAZL 1ZT4A 5T5FH 4KUCF 4EOWH 3AUVA 3GSWA 4NCDA 4HJJL 5EBWA 4OLVH 3V9FA 1Q0YH 2A9MH 1JYXA 2XG5A 1CN4A 4EQ3A 1HIML 3N1FC 3NCJL 1K4DB 1L9NA 2V2XB 5F7WC 3B2UC 3HZKA 2P5WE 2Q76A 5KAQG 1NFDF 1CDIA 3TIEA 5EFIA 5FOJA 3HNTH 3RUGA 4YBQC 2OTWB 3Q6FB 5KSBA 1NBZB 3RKDD 1IZJA 1D5IH 1LVEA 3TNMA 2Y36H 3P77A 4P46D 1S9WB 1J0IA 2DOCA 3BKML 1I7ZB 2VC2H 3QT2A 2GK0A 1J0YA 1I9IL 1D9KA 3DV4A 4V2BA 4GW4A 4HV8A 1MHEA 5L9DL 4HUKB 4YDLC 3BSZH 2B5IC 4OTXL 3ZT5A 2VZTA 4PJDE 4PY8J 5A2JH 1Y18A 2Y07H 1EJOH 2PXYB 1RZGA 4U0QB 5C0IB 3FT4A 2ICWJ 3DVFA 1FNFA 5EN2B 4KU1A 4PJ8D 2VDLH 1MELA 2Z91B 4U05A 2MWCA 4L4TE 3UBXA 2X4SB 5MEQB 1P84J 5INDA 3BI9X 1M6OB 1EHLH 5CD5D 3CX5J 3S88L 3PDOB 3EO1A 3GZKA 1NDGB 2UY7A 3ALXA 5EOCH 4YHOH 3UTSD 3GMPA 1D9KC 2E6PA 3CMOL 4WO4B 3TH2T 4N1CA 2NY2B 3TBSB 2EDNA 1OQOA 1AD0A 3HMWH 1U58B 5CBAA 3WUWA 3WFCL 2A6DB 4CN1A 3HHRB 2PYEA 3IF1A 3FQTB 2B20A 1OM3H 5DHVB 3MCG1 1I9EA 4L8CB 3DHJA 2XXMB 3QQ9D 4LLVA 1KLGA 1JGEA 4MSWA 4LVHB 5CZKA 3CFDB 1AY1L 2Z9TA 4J8RB 3IFNL 4LU5H 4HMDA 5ERWA 4HDIB 1JWSB 4JREC 2O61A 3ZL4H 1GZQB 4M03A 5F21B 1FIEA 3KPQB 2PTTB 4IDJH 2D4DA 4HUWA 5HYSB 2VISA 1FVDB 3QPQD 1AKJD 1QG3A 5K9OB 2A83B 4GG6A 3LQAH 4AIZA 1JN6B 4WI5A 4JFED 3OB8A 4R4BB 4F15C 1P6AB 2YA1A 1XZ0B 2R0ZH 1F3DH 5D5MB 5E6ZA 1FFQA 2MKWA 5MI0C 3AREA 4KC3B 1YEIH 1IC4H 2PUQT 1ZK9A 3D85B 4NBZB 3QPXL 3HPJB 1OTTC 1SEBA 2HTKD 4P9MH 3X11B 5I30H 3ALPA 3E2HB 3QUKA 3LQAC 4J4PA 2P7TB 2GJ6A 4PP1D 5DQ9A 4OZIF 4EBQL 4X6CF 2EYSA 3RY4A 5IROA 5EU3A 2WMPA 1YEKL 3BHBB 2F53D 4LCIH 2FRGP 3U1SL 4XNZB 3ZE2F 4J3VA 3WO4B 2I60L 1LO2H 2ZUYA 5LAXA 3GGWA 4Q9RH 3L7FB 5E9DA 1J8HE 3BH9A 4P5KB 1F6AA 1N6QH 5BW7A 4U1NB 3MRIA 5DHYB 3V6BR 5IW3A 1KLUB 3DX9A 3OXSA 2VLME 5L8JB 1DEEB 1N0LA 2YSSA 1U95A 2Y5EA 2JB6A 2HJFA 1ZXQA 3CFJB 4LRNH 3FMGL 4ODBD 5ALCL 3RVXC 4CRPA 4NHCL 1GSMA 1KJ2H 1JFQL 5IROC 2H6PA 2ZG3A 5ID1B 5L6YL 3TNNB 2F54A 1S9KC 4YBLC 1EXUB 5C0CA 4WJ5A 4DVBA 5GRVK 3L9RA 5E8PB 4YDJA 4PJGF 4E9LA 1MSPA 3K4DA 1I3GL 2XRAL 5DUPL 3MRHA 1TJGH 5BW7C 2OX5A 3BIKB 4ONGH 1J10A 3RX7A 2NY2D 3HE6C 3LKSA 3EJYD 1UXSB 4N0FB 3WKMH 4NQSB 1IL1B 1TZHB 4HCRL 4ODWB 4Z78B 4F9LC 4ETQA 2BVYA 4RQQA 2HWZH 3GMLA 4F2MB 4KDTA 3LKRB 3WJJA 3QZWG 1JGVL 4RWYH 3SGEI 3DUUA 2N7AA 4XXCA 4P0DA 3MUGA 1IEAB 1UFUA 1U0QA 3FRUB 5E8EA 3U4EB 5GGRY 1K4CB 2W9DH 2XNAA 3B9DA 5JXED 5AWNL 1U3HD 2ZUQB 1OPGL 2BDNL 3T8XB 2VXQL 4GAYA 1K8DA 1KJ3H 2XTLA 3LV3A 4NRZB 5CGYC 2ZG1A 4KDTC 3WJJC 5J12B 2E27L 1YN7B 2DL2A 1U8IB 4L8BB 2AK4D 4XXCC 4O5LH 2E6JA 4KKLC 1I9RL 2YOCA 3NFSL 1FNEA 4H5SB 3VFNA 2R2CA 4TUOA 1ZSDB 3M8OH 1NJ9A 1HWGB 3V79C 3QCTH 3IFLL 2Y25A 4YLQT 4I8DA 5LGJA 5ALBL 4MNGA 4DTGH 4P57B 5MEOA 2BRRH 4NNYA 4EJ1C 1XGUB 4JN1H 2P4AB 2JJTA 4AK1A 1K6QH 4H0IA 1D3CA 4UUJB 2CRIA 4U1GB 1GGTA 5MP6H 4RGNC 2CK0H 1IAIL 2BSTA 4HJ0D 5IWLA 5JOEA 1RUKL 3G6DH 5IB5B 3DSNA 1SY6H 5F1IB 1Q72H 1JHKL 1RZ8A 1RZKH 2BVQA 2GTZB 2GJZB 3RVWC 2LQRA 1FIGL 1UXWB 4JJ5B 5B39B 3UJJL 2OCFD 1MQ8A 4PGCB 3TC9A 3TO2A 1XR9A 4ELMA 1HNGA 1NEZB 2VDOL 2JJTC 1UACL 2WBJA 4NM8H 1L0YA 5I9QC 4N5ED 2RAMA 4Q9BA 1U92B 2H2PD 3RWFB 3ZT6A 3VDCA 3QUYB 4Z18A 2OJZH 5I8OL 5IWLC 1Y0LA 3OKLB 4P2OD 3ZHKA 4RMVA 3VXSE 2ZOLB 4XX1E 2X1QA 3K2MC 4M7KH 1MI5B 2R2EA 2QQNH 5ILTH 3G5ZB 4LDLB 1P69B 4K23H 2G5BB 4OCWL 3GB7B 5DK0B 5C0BE 2UVEA 3LDBC 3UCRA 1ZWIA 1WF5A 4QHMA 1RVFH 1NFKA 3O9WB 2JCCF 3CH1B 3L3KB 1SM3L 5I1HH 2WBJC 1JV5B 4U6VH 1WAAF 4XP6H 3VW3H 4GQPH 3KLHC 4XNMB 3QXUA 3E6FB 5IEHA 5D70H 1U91A 2JELH 1QEWB 4UDUA 4OQTL 4P23A 5LQBH 3BIAX 1YQVL 3MX0A 1YECL 5JR1L 3U6RA 3TO4B 4DQOH 4G6KL 1S7UA 1DSFL 5FM5M 2CLVA 3QG6A 4U33A 4OF5A 3MO1B 3VD7A 2PKDA 3CFCL 2XN9B 4M6OL 4NQEA 4NM4H 2EIBA 4WU5B 3QIWB 5LGHL 2QR0B 4MCZB 1INQB 3QUZA 1VFBB 5BJTA 1U8OA 4PTUA 1CFVH 1I8MA 4P23C 1RUQH 1QFUH 5GISH 2WBKA 1PKQB 2R4RH 1P84K 2FD6L 3VCLA 4LIQH 1NC4A 1E6OH 4LCWE 4Z7UF 2CIKA 4PJ5B 2QLVB 4LCCA 4L4VB 4BZ2H 3SDAB 4JDVA 1WFTA 4HMCA 1EBPA 3ARGB 1MJ7H 2LU4A 5FHBL 3BKJL 4NN7C 3D3VE 4U1JA 4FMFA 2F15A 5ISZD 1U3JA 2ARJQ 1NCCL 2COQA 4N8PA 4BQCA 3OMZA 4S1RL 4TSAL 4UNTA 1TZGL 4LBEB 2FIRT 1HHKB 1RIVH 4PJXF 4LCCC 4ALAL 4ZPTA 4JQVC 3QEUA 4Y88A 3LKQB 2OQJA 3TWCH 4PG9B 3IAQA 5BVJB 4OB5H 3KNBB 4OF0A 5HBBA 2FJFB 1PQZB 4UNUA 3MRNB 3H9SE 4QHNB 1FVCB 5CSZA 1MCOH 2YD8A 4NZDA 1ZGLB 1HI6B 5GQBA 1TJHH 1HN1A 4B0MM 4H8WH 3QI9A 1LK2B 1IFHH 1RV6X 4HGWA 1G7HA 1FL5A 3MBXL 4RA3A 1CICD 2YA2A 3N06B 1MFAL 3O9WD 3WO3B 3N9GL 3VXRD 2W9EL 3KLSA 4HPYH 5DT1L 2EC8A 4NO5A 5IGXL 5IV2B 5IHLB 2X7LA 5K93A 4Z9KB 3LS5L 1QSFD 3IJHB 3V0WL 1Q94B 3QO1A 4U1LB 2DLFL 5D2LE 1QQDB 3MRMB 2DQFB 1CCZA 5J1TC 5TE4L 3MRBA 4CU6A 5C2BL 3NIDE 3QI9C 3ARFB 2WK2A 2AJSH 5KN5B 4TTDD 1R6VA 3PV6B 5I6XB 3CPLA 3NVQA 5J06A 3DX6B 2EDEA 3PGDA 4MJ5A 2EIDA 4H20L 1DLFL 2M1KA 3PP3H 3ARQA 5D93C 4YFDB 2ZWLT 4PRBB 4Z7WB 5DTFB 4K3DL 1WVZA 4XT1C 2EEDA 4WNQB 1I4FB 4Y5XA 3WDJA 5H35A 4GOSA 1CGVA 3TFKD 5CEZH 5IP4A 3RUGE 5EBMB 2VWEC 2DQIL 2NZIA 4XZUA 2D7TH 1SVCP 5FAAA 5I1EH 1XGPB 1EJ6A 3FTGA 2GT9B 2ED9A 4LVNB 2X1PA 4KKCD 4PJ8A 4E5XB 5D8JH 1G7JB 1KBGL 3HZVB 5IFAH 1X4YA 3ARGD 2VO5A 2AQ1A 2EDXA 2MPAL 4W4OA 1MJUH 3REVB 3TBTA 1DJSA 3UTSA 5IB4B 3KPRB 2EYRB 1RK0A 5F6HI 3RBSA 2ATPA 1KYOJ 4KDWA 2D7OA 4G42A 1VFAA 1WFUA 4IJ3C 1RUAL 5C07B 4EDXB 5HVWA 3O2WL 3U46A 4NZUH 5FUZH 4JHBA 4QRUA 4PJ8C 1O7VA 5ACMA 3HI1A 3W5MA 4X6BA 1NANI 3PP3K 1JNLH 3RNKA 2FO4B 3O6FC 4W4OC 4JO2H 3DX7B 2A74B 1MFDL 1AP2B 5AAWA 1ONQB 1SYVA 5E95B 5IVXA 3L1OH 4WW2A 3FT3B 5I66A 2DIAA 2R9HD 5IG7B 5JQ6L 1AE6L 4M7ZB 2VDQL 4HKZB 1AKJA 4JKLA 1MAKA 5HY9B 2CO7B 2E9JA 3QQ9C 4MYWB 4DKFL 5TF0A 1DL7H 1GVIA 4JFEA 3FAWA 5AG9A 2DMCA 3T4AB 1W0VA 2DQGL 2X42A 3SOBL 1WSST 4P4KB 3MOBL 4XNXL 5BRZB 1KIRB 1B2WL 2FYYB 4PIRF 2PN5A 4WW2C 2FO1A 4GG6E 3IJYA 2E7MA 2V2XA 3KXFE 4AM0B 2CKBB 1J1XH 5KZCB 3QPQC 3FO9B 2KDGA 5HTSA 1OARH 3S3SA 2E3VA 3SGDI 1KB5B 4F7MA 4NUJB 1DN2A 4K71B 1QNZH 3ZDYE 2C3XA 2OTWA 2W0PA 3Q6FA 2F53A 5EH1A 1OAUL 3D5OF 1U42A 3P0YL 5DD3H 1PLGH 3GIVB 4NWUL 4O51B 5KVEL 2GJ6E 1S9WA 4M1GH 5FKPB 2HTKC 1I9JH 2UWEE 1I7ZA 2HRPH 2YC1B 2FGWH 4YO0B 2W60B 1NCUA 5C09B 1FFRA 1B4JL 2R0KH 4TYUA 2FX9L 4G8FB 2X4OB 2CLRB 2UZYB 3V5HA 4NC2B 2PXYA 2R69H 2J8UB 1T5XB 2HJLB 5BVPH 4MXVF 5C0IA 1WIUA 4I13B 35C8L 3WCYA 5EN2A 1DCLA 2Z91A 1BP3B 1BM3H 2BNRB 2X4SA 5MEQA 2JIXB 3EOAA 1GYAA 5T3ZD 1KC5L 1M6OA 3SDDB 3C5ZD 3BUYB 1KNOA 1QSEB 1JGUH 3O11B 3PDOA 4TPRL 1NDGA 5J11B 3MOAL 4F7EB 3GSNL 5CBEA 3MV11 3UJTL 3WIIH 3V4UL 3BXNB 2A6DA 3QBTB 2XQYG 4J12A 4UT9H 3VFPA 2O5YH 4XMLL 5L8LB 4J2XA 4L29A 3FQTA 5DHVA 4WDIB 2EICA 2A77L 2PXYC 4L8CA 1JUFB 5C07D 3I6LE 3VXUD 3BDYH 4PLKD 3KPNB 2DM4A 1WBZA 3CFDA 2CIIA 4HDIA 1JWSA 3MLUL 4PGBA 2A6JB 1UG9A 2GK2A 4WO4C 3TP4A 2NY2C 1UWXK 1BAFH 2VXVH 5HYSA 5JXEA 3KPOB 1N3NA 1U3HA 3CSBA 2GAZA 4DZBB 1YYLL 3EJYC 2C3GA 4XRCB 2AJYH 2A83A 5IQ9B 2D2OA 1X5XA 2XTJB 4IOSD 1JN6A 1TQCB 2HP4A 1JGDB 3G6AA 3LRGA 1V05A 4LVHC 1S5IH 2MSPA 5DA0B 3R0NA 4I3GA 5I18L 5K59F 1SEQH 2W0FA 5D5MA 43CAB 1URLA 5L2KE 2AK4A 4BZYA 3W9DB 3GIZL 3P4LA 2LVCA 5FEBA 2FX7L 5BRZD 3D85A 4GUPB 1YEDA 3PNWB 5SWSB 3HPJA 3X11A 2VLLB 4MAYD 3O3BB 4JFOB 3N1GC 2P7TA 4FQ2H 1U8MA 2WNGA 2DBLL 5JXEC 1CWVA 1X4ZA 1U3HC 1ZHKB 4C4KO 5FDWB 5DMIL 2HLFD 2P5EE 4FA8A 1A7QL 4RMTA 5FGRA 1PY4A 2A2QT 4OSUH 3F7YB 4XPAH 4OGZA 2QEJA 4YUEH 3VFRA 5ESVA 5ITBL 2FWOA 4PRAA 2VDKL 2DI9A 3ULUF 1KTLA 4FQLH 1PSKL 3L7FA 2SEBA 4P5KA 4R2GB 3O6LH 1CGUA 5DHYA 2FB4L 3FFDB 3E2HC 4DW2L 5GHWL 2H41A 4JFFD 4JG1L 3CFKB 4KMTL 4UOW1 3FT2B 1MCFA 4PJ7F 5GGVY 4PJ9D 15C8H 4X99B 3SBWC 5ID1A 1MFCH 3PWPB 2NXZB 4HJ0C 4P9HH 1OD9A 1OGAB 4XNZC 1EXUA 3WO4C 2BNRD 1O7SA 4PJBF 3C08L 1P4BH 4E41E 4KH2A 1MFEL 4KI5D 3BGMA 3U9UB 3IDGB 3MLVH 2GFBA 4N8VB 4PJCB 3U36A 3T1WA 4Q6IB 1HHJA 3UTQB 4P2QE 1UJ3B 1KEGH 1YC7A 3BESR 4XPBH 4OLZL 5JDSB 2A1WH 4EI5B 1F4HA 4KWUA 4N5EC 3OKNA 1UXSA 4XCEA 4FFWC 2DQUL 1BVKB 1MRDH 4NQSA 1TZHA 2NY3D 3W2DH 4DGIH 1ZEAL 3QCUL 5DD0L 4JFZH 3PABB 3WHE0 4F2MA 1DLHA 3LKRA 2NW3B 4PJIB 1IEAA 4K3EL 2BY1A 5HVGB 3MFFB 4KAQH 3IT8D 4M02A 5A2FA 1A6UL 4YHIB 2BSED 4MNQE 5FUOL 1U36A 2XOTA 3ARPA 2BOBB 2ZUTA 4JY5H 3T8XA 3GHBH 3GJFB 1L6XA 3AS2A 4NRZA 5F70A 12E8L 3T04D 4NO3B 3PJSB 2YZ8A 4Q7DA 2XZAH 3DVIA 4PBVC 5JPNB 4PFEA 4WI8A 5D96B 5EUOB 1ZSDA 5DMKB 4U7SA 4ZAKD 3QG7H 2MCPH 5E70A 1WIPA 2H3NA 5GZNC 4G8GD 5FV2A 4Y4HB 1Z3GH 2ZUQC 1A1MB 1KYOK 4PRHB 5E4EB 5DZOA 4PJAE 1T1XB 2EDJA 4C55A 5LBSH 1OAQH 2B1AH 4JO4L 3Q5TA 3WV0A 4LCUA 5TDOB 2YMXL 4H0HB 4Y4FD 3S34H 1MIEL 1AQKH 3LN5B 2Q8AL 5J12C 4UI2A 5FA4B 5ISZA 1G9EA 3MV7E 4AG4H 5F1IA 4LNRB 3OZ9L 2GTZA 3U82B 3IAGC 3NCJH 2DTSA 5B39A 1HSBA 1FDLL 1HXYA 4R90L 2EE2A 1SVZA 4HUNB 4BUGA 2D03L 3RL2B 1NEZA 3K3QA 4XX1G 3C5SB 2Q86B 4KUCD 1N26A 4U1GC 2F5BL 3MV9B 3SKNA 3KAAA 3WFHB 2NR6D 1PY9A 1MCCA 3F7QA 2LTQB 2NXZD 1EFXB 1OGAD 4PGDB 3OKLA 4ESKA 4HX1B 4A2LA 2ZOLA 3F6IA 2WAHA 4KKBC 3G5ZA 5GRYA 3JV0A 2G5BA 5H37H 3GB7A 2R2BB 2Z8SA 4X6CB 5L9DH 4OTXH 1CICA 1U8LB 5CD3B 1OAXL 1UCBL 2BXYA 5L88L 3O9WA 1G7LB 2A6KB 4NPYB 4ZNEA 2DWEB 2MTPA 3CH1A 3L3KA 3PQYD 4L3AA 3VXRA 4OD3L 4Y4KB 1JV5A 1NBVH 1IGML 4JFQB 2B2XL 3D39B 5DF0A 4LEOB 5DJ0B 1PG7W 4LHUB 1IGCH 4LCYB 1UENA 1U8PB 3I9GL 1QSFA 5JOPD 5I1CL 3MLZL 4XNMA 1RJCA 3E6FA 5I16A 4UTAL 4LMQI 1XR8B 1QEWA 1CGSL 1ORSB 3SDXA 4WFEE 3CMOH 3GK8L 4J7RA 1JZ5A 1TITA 1N7ML 1A02N 4QKXB 3GSVB 4Z7VF 4HIXL 2HT3C 4KFZC 3O9WC 2OBGA 4O2FB 3QDME 3AY4A 5C6WH 2IADA 3MO1A 4YK4C 1T0MB 3M1BA 3DYMA 3MJ7B 1VACB 1K2DB 3LHPH 4P2RE 3IFNH 3MV8E 4WFFD 3L3GB 4HZAA 5IM7A 4MCZA 1INQA 3CK0L 4X7EC 5I15L 1H3TA 1KCLA 4ZTPH 1CFNB 5F7EL 1MFNA 4YHYC 4DKEL 1BFTA 1PKQA 1QUNA 2VLJD 1XF2B 4O58L 1A0QL 1TETH 3S37L 5TPWL 3SJVE 2BNQE 2X89D 4S10A 4PJ5A 4OI9A 4N0CD 4Y4HD 1F2QA 3IFOA 3KJ4B 3ARGA 1EA9C 3BP5B 2YN5A 2APFA 3BVNB 5E7FA 2NX5D 3QIWC 3NPZB 3FFCB 3TFKC 1P1ZB 3RVVD 5GGUB 2EKJA 5HDQH 3HNSL 3HC0B 2RCSL 4F7PB 4JN2A 4YX2L 5TDPA 2O5ZH 5DRWB 4NBYB 4S1SL 3MR9A 1GGYA 5KVDL 1HHKA 4KKCC 4WHTB 2GITB 3CFIC 5DRXB 1RZ7H 2OL3B 1JP5A 1PG7L 3SDAC 5EIIA 1YEKH 1BZ7B 4JAMB 3ARGC 3VJ6A 4XBPA 2P1YA 5BVJA 4X5WA 1C08A 1PQZA 3MRNA 4QHNA 1FVCA 1I3VA 2I60H 1EAPB 2EKSB 1EFXD 4R4ND 3GMNB 5HPMB 2FECL 4PYHA 1SJEB 1UT9A 5D7IA 3S5LG 4HH8A 1CDHA 4JRXB 3DXAE 3Q6GL 1DDHB 4PB0L 4FG6D 2WM0A 3DOSA 4R4FH 3ULVF 3VFGL 2VH5L 3FMGH 2GY5A 3CU1A 3WN5B 5CJOL 5CLWA 3QIBD 4AENA 5MERA 2NY6B 4Y89A 5IVXE 3EOBB 3OR6A 5L6YH 1CD8A 1S7RB 1ZOXA 4W81A 3IJHA 4IRJB 5EDXA 3AROA 3MRMA 2DQFA 4F57L 1BLNA 3U9PL 4X0KA 2XRAH 5DUPH 1I7RB 3WL9B 4ZUVB 1IAKB 5KN5A 3O0RL 2VSDA 1T7YA 3DARA 3PV6A 4HUVB 3DX6A 4XBGB 4PBXA 4PLOB 4PTTB 3FN0L 3WFBH 5E2WH 2VZ1A 2WSKA 3HUJF 1C5BL 4PRBA 1HK6A 1BJMA 1JF5A 1OWRM 5DTFA 2YD4A 3VWJB 4ZFGL 4WNQA 4NRXA 5EO0B 3BYYA 1I4FA 1JGVH 4RMSA 5GIRA 1ZAGA 1NCDH 3GMOA 4EUPH 4J3XA 3ECBA 3NA9L 5EBMA 4GAGH 1CLOL 2QBWA 3A6CL 5FOBB 1KJVB 1F42A 1XGPA 1P4LB 1C12B 2BDNH 3ESUF 4O9HH 3JWDC 1KXVC 3Q3GB 3EBAA 4ZQKB 3C5ZA 1NCTA 1FFPB 2E27H 3UBXG 3FFCD 2Y5TB 1NMAL 5JMRA 2Y9RT 1I9RH 3NFSH 1YPZF 4B7LA 2FH8A 1KIPB 1FZKB 3IFPA 4PP2B 5EC1B 1GJIA 1KENL 1CS6A 3IFLH 3MJ9L 1CFSB 5ALBH 4BYHA 2P46B 5C07A 4EDXA 3VXUA 3DI2B 5FIEA 4LVNC 2A6IA 3NGBB 1PKOA 4K3JH 1A7NL 5C0ND 2C7UA 2PETA 3BN9D 4K8RL 1IAIH 2A74A 4U6YB 4EXPX 2WZPD 1RUKH 4M8QB 3MLSL 4C58B 4M93B 1MLCA 4NT6B 3BD5A 5BMFH 1FIGH 1QPXA 5I8KH 1KXQE 4Y8AA 3UJJH 3ILQC 4JRXD 5KS9F 4QCIB 2XI9A 3RTQB 5HY9A 2EECA 2J7LA 2IANB 2VDOH 5J89A 4L8DB 1MQKL 5DURB 1UACH 2J6EL 2IPUG 3BPNB 5B38B 4LPWA 4GRLB 1DE4A 5GGSY 1DBJH 4DJMA 2VLRD 3P4MB 1CD9B 1EHAA 4PY7A 4D9QD 5BRZA 5I8OH 3EJJX 4FS0A 3QWQB 3O2DL 4MAYA 4CU7A 4PGEB 2YXFA 4ODUB 1BFVH 4FQ1L 1G6RB 4M7ZC 3P2TA 1QLEL 4FFZL 1NBQA 3UDWC 1KB5A 4NUJA 4ISVB 1GGCL 5D5ME 5I2IB 3EYFB 1SM3H 3D69B 3V6ZA 2UZIH 5DRNB 4OQTA 3GIVA 3QEQE 2XWJB 3ROOA 4P4KC 4D9RE 3BJLA 4K55A 4OM0H 3UBXI 1B9ZA 3VWJD 1OGTB 5FKPA 3VD4A 2NCMA 3QEGL 2YC1A 4MAYC 2AEQL 4OQTH 2W60A 3IDXH 3TJEL 1YQVH 4JFFA 2X4UB 3J8F7 4G6KH 3EOYG 2GEEA 2HLFC 2VB5A 2CLRA 4K71C 4XNQB 4EZMA 1DSFH 4U3XA 1T5XA 2V5SA 1X9QA 2RQ8A 2IPKA 5HJ3B 5KAQF 3CJJA 3LSOB 5GPRA 4Z95L 3HCVB 3ULUL 1WTLA 2BNRA 4NC1C 3WD5H 5FGCB 3LN9A 1DVFB 2KQNA 4GQ9H 4F8TA 4OFIA 3T0WA 3BUYA 4HPOL 3O11A 3G5VA 2WWMD 4OUOA 4F7EA 4N5UA 1I85A 1VKXB 1A6VL 5DFVD 2VE6B 2YD6A 5DD5L 1GC1L 3KWWA 2NXYD 2YZ1A 3BXNA 3DRQB 4PGZA 4WDIA 4QRTB 1JUFA 2NY1B 1LEIA 2L0DA 5DUML 4M9OA 3OG6B 4PYGA 1OP5H 1A7OL 1YJDL 1KN2L 4WI6A 3EOTL 5CINH 5FHBH 3BKJH 3LH2L 4GJTB 2A6JA 5MHSD 1I1YB 4GMTH 2F8XC 5J11C 4RX4D 5BZDB 1I85C 5IMKB 4QHKJ 1XGRA 3P9MA 5FXCH 1F4WH 1WFOA 4Z7NE 3KPOA 4WTZG 4S1RH 2IQAA 4TSAH 1TZGH 3NH7H 3E3QC 5JHDB 1MAML 1EERB 4JM2B 3V4PL 1FCGA 3IU3B 1IZKA 5DURD 1QLRB 2B0SL 4L1DA 5BV7B 3N0PB 43CAA 4GRLD 1YNLL 3PNWA 2NY4D 5C9KA 2KBGA 4D0BB 2VLLA 5HGHB 5MEPB 4EIGB 4JFOA 4XPGL 4MWFB 3KPMA 2CGRL 4QTHB 4G8GA 2O5XH 4N9GB 2HVJA 3MBXH 1AJ7L 2AXFB 2Y7QA 4DGYL 3ZMRA 3RWIA 4JGUA 1MFAH 2XTJC 3MRGB 1TQCC 1CR9L 4FQJL 4Y4FA 2W9EH 5DT1H 1DBBH 1TTUA 1OP5K 2DDQH 4G9FB 4JO3L 3ZYOA 5I0DA 4X6DA 3V0WH 2VDPL 2DLFH 4CVXB 2EIEA 1R3HB 5DJXB 5EA0H 5TE4H 3S97C 1Z0NA 3FFDA 4OLYL 4NC0B 2W0LA 3VXTB 1HYSD 5IT2L 1NKRA 3O3EB 4HS3B 1CZ8H 1I1AD 1KCUL 5IJVB 3EJZD 4D2NA 4CVWA 4H20H 2CKBL 3MRLB 4GXUM 3J7HA 2YD5A 3RWJB 1A3RL 5E6IB 1OGAA 4Z8FL 3IDNB 3TA3D 1WFNA 4K3DH 5DEGB 2ARJB 3CVHL 1DVFD 1MCHA 1I1FA 1INDL 4NP4L 4R2GC 2BOCB 5FO9B 4N8VA 4PJCA 4Q6IA 3UTQA 1EEUA 4NOBA 2DQIH 1IGFL 1U9KA 3Q0HA 4Y16D 2DQEL 5JDSA 2IALB 1UM5L 3MREA 3PQYA 4KV5F 4KJWD 3LEXA 4CW1B 1BVKA 3KHOA 4G8EB 2NR6C 3IVKB 1MWAL 1MI5E 4K7FB 4CL7A 2NXZC 1JHTA 5FCUH 3VWKD 3CC5B 2NW3A 4Y19D 2MPAH 5DWUH 1MJ8H 5FF6A 4PJIA 1YNTA 5I8EA 2OP4L 4OZGB 4U0RB 4U6TA 4AQOA 4Q6IC 3QWRD 3QDJB 2XICA 3K80A 3S37X 4QRSA 3C9NB 2AXJA 1M1SA 3LKPB 1G7MB 1I75A 1RUAH 2WWKT 3VXQA 4EI5C 2BOBA 5DMYA 3WJLC 3O2WH 1JI1A 2DAVA 5IFHH 5JHDD 2EZ0D 1IKFH 4HS8H 3K2UH 4MA3B 3RJDA 1NCWH 4L3CA 5JPNA 5F1NB 4DUWA 1MFDH 4I77H 4FP8L 1ZT1A 4UQ3B 3IS1X 4WFHD 1KTDB 2VLJA 4BQ6A 3IAPA 4UV7L 5JQ6H 4HHAB 1AE6H 2XN9E 3WFDL 2VDQH 2X89A 4NNXB 3T0BA 4Y4HA 1PG7X 3SPVB 5LGKA 5EO9B 3DHMA 4DKFH 1A1MA 4P5TB 3MRQB 1T1XA 3GSOA 3OKEB 4GRMB 2IH3B 5TDOA 3B9AA 3OX8A 4RFOL 3ARDB 5FA4A 3FN3A 1A9EB 2DLEA 2G5RA 2OMNA 5D6CB 1MJJA 5CILL 2NNAA 4LNRA 1B2WH 4LSUL 1GRWA 4N1EA 5D96C 4PJ5E 4L4VE 4UB0L 1AC0A 2I07B 3L5WB 1MEXL 5D1XB 5FYJD 1KJMA 2HYMA 3FONB 5DGRA 5JQHC 4N0CC 1NCAL 4Y4HC 4XCFL 4HWEL 2XFXB 1K8IA 4P3WA 1CFQA 4DVRH 3C5SA 4I3RL 5E4EC 5E8OB 3TEUA 4AEIH 3UTTB 5HHOB 3UAJC 4KVNL 1OAUH 3HAEB 3P0YH 3X13B 1XMWA 5DXWA 1EFXA 5E6ID 3RVVC 4NWUH 4PGDA 1ACZA 4OZHF 2MMXA 4HX1A 5DQDL 5M95B 1QKZL 5SWQB 2YBRB 2V2WB 1K9TA 2R2BA 4X6CA 2UY6A 2EH7H 1LEKA 4HC1L 3F7RA 1XH3B 2IFGA 1B4JH 1T22A 4OM1L 1U8LA 5CD3A 5EC2A 5FB8B 2FX9H 1G7LA 2A6KA 3QIBA 4NPYA 2DWEA 3CFEB 3ULSB 3SQOL 3Q48A 4MD5B 4GBXB 4XNYL 4ETYA 5DJ0A 1QFWI 4KMLB 5FYKL 4M00A 5T1KB 1U8PA 2LTQC 4R4NC 3GSNA 1CIUA 1S9XA 4PREB 4CBPA 1X5ZA 3BKYL 1XR8A 3U0WL 4TPRH 3LMJL 4G80B 2BY2A 3MOAH 2BK8A 4KQ3L 4UNVA 5J6GA 3JV6B 4FG6C 1RPQA 3GSNH 1QP1A 3AXLB 3GSVA 3IDIB 3ULVL 3QDJD 3UJTH 3BZEB 5EOTB 4FZ8L 1M05B 3QUMB 4QHLB 4XMLH 2FH6A 3VA2C 3MXVL 4Y4KC 2A77H 1DP0A 1LO3L 4MXWL 2WQRA 5DC0A 2NTFA 2JE8A 3GMQB 1CDYA 5I71B 5FYLD 1VACA 3C2SA 1NLBH 1K2DA 3W39A 3LB6D 2JK5B 1AI1L 2JKXA 3PWNB 3L3GA 4JQIL 3HFML 4PRIB 5E00A 3QJHB 3MLUH 4HH9A 3ULUE 1D5MB 1EGJL 1UEMA 2IWGA 1X5IA 4U1HB 4MJ6A 3OKYA 4B7IA 1XF2A 4QXUL 4CNIA 4Z7WE 5ICZB 4KI1A 3NACL 5D6DA 4GRWB 1YYLH 3JXAA 1BD2B 4ZUWB 5AYUL 1GGIL 1BQLL 3B6SA 4KXZI 4NDMA 2ZOKB 4P5TD 3R06B 2XIDA 3BP5A 5E99L 1MRCL 3WS3A 3CU7A 1QFPA 1JRHI 2VABB 4NSKB 5I18H 3FFCA 1A7RL 1FGNH 5DJ2B 5GGUA 5DK2A 1OLZA 2VXUL 3O6KL 4YE4L 2FX7H 5HI5D 1LE5B 4LPCA 1U8HB 4PJEB 1AGDB 4F7PA 1ZHBB 3R4DA 3AAZB 1ORQA 2DBLH 5D1XD 5D6DC 5C0GA 3KPLB 3S4SB 2GITA 5DMIH 5DRXA 3BW9A 2OL3A 2PO6D 5DZLA 4LSPL 4ODSH 4FXGA 3QXDA 2X4PB 3KJ4C 1JPSL 3KPRE 1JCKA 1T2QL 1WZ1L 4WIQA 3QQ3B 5HHOD 3N50A 3U7YL 3VXMB 4HGMA 1S7TA 3D9AL 3G08B 4M3KB 3VFOA 1EAPA 2EKSA 4I0PB 2X1WL 3OL2A 1PSKH 3D0LA 3WXWL 1SJEA 3FB7B 2J5LC 4IRZL 5KVFL 1RZJC 4HXAL 4JRXA 3BDXA 4B53A 2WUCL 4U1SB 4DW2H 1DDHA 5DEFB 1IEBB 1T1ZB 5GHWH 5HI3D 4HBCL 4JG1H 3LD8B 4MQXD 3WN5A 5KTEL 1N5AB 2XXCB 1TMCB 1FH5H 3X17A 5C0NC 3BN9C 3BD4A 2VLRA 3EOBA 2DQDL 3QRGH 1FSKB 3K74B 5GRWA 1S7RA 3AS3A 5T1KD 2R29H 3C08H 4NZTL 4ONHB 3ZE0E 2AKRB 1MFEH 3STLB 1A6ZB 4PR5B 1NLDH 1N8ZB 5ECJE 3V8CA 3WL9A 1N4XL 2P49B 1IAKA 5KSAD 1ES0B 4Z0BL 1E4WL 1H3VA 3JWOC 4UZGA 3PXJA 2J4WH 3IJSB 4PTTA 3WN5C 5IKCB 5BRZE 3WNNA 1ACYH 2NY6C 1M7DB 2DQUH 3ARYA 2IBZX 5D1ZD 5L2JB 5IMLB 1KEML 1YA5A 3I3BA 3GM0A 3TBVB 2DLGA 4I2XB 1FNHA 5DD0H 3VWJA 4IRJC 5E1AA 1RHHB 5JHLH 1UWEL 5FOBA 1S5HA 1KJVA 3JV4B 1A6UH 1WAAA 5FUOH 4NC1E 3T0EE 1E6JL 3VRLF 3GO1L 1P4LA 5CZXD 1C12A 4G6ML 1CIDA 1BD2D 2G9HB 5K9KB 2KUTA 3Q3GA 12E8H 1IGTA 1K85A 2AJVH 4ZQKA 5C09E 3VWJC 2AAVA 1BZ9B 5DA4A 3GNML 2Y5TA 4PGJA 1YEHH 4S1QL 3QNXB 5AZ2L 3SKMA 5I1AA 3GDBA 5KSVB 3CSGA 4ZFFA 1EEQA 2J8UE 1FZKA 4PP2A 5F7NC 3QJFA 5EC1A 4O2EA 5L7XH 4HIHB 3OKDB 4WI4A 1CFSA 3U0TB 2WP3O 5TJWK 4M1CD 1GAFL 2NLJB 2OYPA 3VMPA 1Z2KA 1H0DB 1I7UB 1UZ6E 4YR6B 1DBML 1QSEE 2YWZA 4S2SB 1LP9F 3EDFA 3LKNB 4JO4H 1MF2L 1FFOB 1MIEH 5C0FB 4U6YA 4X7TB 2Q8AH 3DO7B 5D7LD 3VXMD 2WWMC 4J23A 2CH8A 3BN3B 1TVHB 4M8QA 5DD1H 4RFEA 4ZS6D 4I0PD 1G0YR 1K3ZA 3OZ9H 1HKLL 1Q0XL 3E3QE 5DFVC 5C2UB 4A2MA 4L3EB 2NXYC 3GM8A 4UTBL 3BMWA 3X3FL 4KUZL 4R90H 3RTQA 4ONFH 1QFWM 5HYSG 1S7SB 4ZUUB 2D03H 1FYTB 5CP3A 1WTGT 2H32H 4L8DA 2X05A 3NGBC 4K94L 1RAMA 5B38A 3QXVA 4DOHB 1ETZB 4GRLA 2C3HA 5CP3H 3P4MA 4C54A 5J13B 4U4BA 1ADQL 1FNSL 5JPMB 5C0EB 4M93C 5ESQB 2Z8WC 3BGAA 4R7NB 4I0CC 2XTJE 4PJXA 4YJZL 1H8OA 1FFNB 4P4RB 1JI2A 2QQKL 4WUUE 4J3TA 3RTQC 3VRIB 1YN6B 4OT1L 1A1OB 4ISVA 5L88H 1DQDL 3PUCA 5I2IA 1QBAA 3EYFA 2ZUWA 3SCMB 4OD3H 2BVUA 4KK5D 4K3HA 1EO7A 2DS4A 1MY7A 5ESAB 2J8OA 5SWSE 1IGMH 4LHQB 2ORBL 2HKHH 1T1WA 2B2XH 3BPNC 2DI7A 5TE6L 4BSWA 4GRLC 2XWJA 4QY8B 3WUZA 2Z0BA 3I9GH 1KB9J 2W07A 5DDHA 1RFDL 2Q1EA 5I1CH 1TVBB 1OGTA 2ED7A 4UTAH 1MHHA 3WDIA 3GI9H 1CFTA 1KIQA 2DKMA 3CVIL 4JKWA 1G84A 3UPAA 2ITDB 4PJHB 2AABL 4JHWL 5IB2B 3V0VB 2X4UA 3AB0C 5CJQL 5KSUB 1BQSA 1I1AA 4XNQA 2KKQA 4OGXH 3JVGA 4MQSB 1JMXA 5HJ3A 1JVKA 3TA3A 5EOQH 2R0LL 1S9VB 4DK6A 2VL5B 1DANU 3RVUD 4XVSL 4LK4A 1DVFA 4KQ4H 4TSBL 4BFBD 1H5BB 2HAZA 3CK0H 4PRPB 3H0TA 5FYKE 1VEPA 5F9WB 2WLZA 4Y16A 1HYSC 4PJDF 4QXGL 3BFOA 1A0QH 4O58H 5C08E 3DRQA 3PWPE 3S37H 5HYQB 1FYHB 3KYNB 1ZLSH 3G04B 1X5YA 1FZOB 4M61B 4GKNA 4LKCA 3TA3C 4S1DC 3VWKA 1AGEB 2IG2L 4PJCE 4Y19A 4WEBL 3SDYH 4I48B 1DVFC 5AAMA 1JZ3A 1XGTB 1I1YA 2OZ4L 3IKCB 3QWRA 3UO1H 2R56L 3CAFA 5BZDA 3MLWH 3A6OA 5H2BA 5IMKA 1QO3B 1ZHLA 3M07A 4H88H 4Y16C 5CIPB 4YX2H 4BSVB 1CXLA 5GRZA 2H2SD 5CSGA 4S1SH 2GCYA 4KJWC 3L3HA 1RZFH 1TXKA 1M7XA 3IXAB 5KVDH 5JHDA 1F8TH 2NY1C 5IJKA 1PG7H 3H3PL 2CK2A 4PJIE 1FZJA 3IU3A 1HH6B 4HLZG 3KLDA 4HKBA 5FM8A 2ESVB 3KPPA 2X09A 4BH7B 5IHUL 1FNGB 2P8PB 4LRIA 5IMOB 4YAQB 5D4QA 5AZEL 5HGHA 4D0BA 4LFHD 5MEPA 1D6VL 1X6LA 4OV5A 2F8OA 4MWFA 5LCVL 4QTHA 4N9GA 3Q6GH 4PB0H 4FXLA 1MHPH 3VFGH 2AXFA 4WFFE 4ZS7L 3LPWA 2NY7L 5C0JB 1EHXA 2EZ0C 2ERJB 5JW3H 5IJKC 1HHHA 4JM2C 3MRGA 5BQ7A 2CKNA 1BF2A 4KTDL 3QR2A 3X14B 3KDMA 3IDJB 3FZUD 3TVMD 5EUOE 1UQSB 5BV7C 1T1YA 2GI7A 4J3SA 1L0XA 3NCMA 3S35H 1NAMB 3EUUA 4LRIC 1G9MC 3WLBB 1R3HA 5DJXA 4F57H 3WYRA 4YHML 3ULVD 4PRHE 1QVOB 2P43B 5IW6B 1L7IL 3MODL 3O0RH 3GMMB 1RUML 5B39G 1WEJL 2PR4H 3O3EA 5FYJH 4JPIB 4XAKE 1U93B 3FB5A 2VJXA 3DGCR 3OTTA 3MRLA 3RX8A 1NEZG 3H6JA 1C5BH 3MRCA 4GT7A 1RIUL 3RWJA 5E6IA 3FRPA 4KJQC 3E8UL 3IDNA 5DEGA 1M4KA 4JFYA 4ZFGH 1B90A 1OCWL 4H1LA 1S3KL 3G6JB 5IHBA 1EIBA 2FEDD 4UDTA 1MCSA 3QFJE 5H37G 1X7QB 5FO9A 4KZEL 5B8CB 2BY3A 3NA9H 3KPSD 4WHYH 4CDGC 2B4CC 4H1LH 3W82A 1J0ZA 1CLOH 2ZSWB 1B3JA 1T83A 3MV9E 1UZ8A 4POYA 4MMZC 4JFDB 1FJ1B 1YZZA 4FFYH 3BD3A 4G8EA 3JTSB 2QSCL 4MJIE 4UT6L 1IQWL 4K7FA 4HF5L 3B5HA 2F19H 5E6IC 3HA0A 2ITCB 1V3JA 3CC5A 4FQIL 4R3SB 4L9LB 4N9OB 4OCXL 1EX0A 1KGCD 2B39A 4NQCB 2NY5L 5E5MB 2OR8A 1EHNA 3CDCA 2CXGA 4NHUA 3QDJA 1G1CA 2D7NA 1T83C 3C9NA 3D39E 1JWMA 1KENH 1FO0L 3MJ9H 3SKJL 3WFZA 3EFDH 2R8SL 4FZEL 4KTEH 2BY0A 3OF6D 4MA3A 1A7NH 1KCSH 2HLAB 2MHAA 4FTVB 4O4YH 4Y5VB 2BSRB 5TFSL 1ZT4B 2ESVD 2IJ0C 5F1NA 4G6AD 2CLZB 3GSWB 3EAKA 2C1PA 4EIZC 5EBWB 4NN5B 2GYSA 4U0RC 3MLSH 4HHAA 4ORGB 1R24A 1GL4B 2Q76B 3SPVA 4GSDL 1CVRA 5EO9A 3OJVC 3WIHA 5EFIB 4YXKL 1L4IA 4P5TA 3DYPA 3MRQA 1HE7A 4GRMA 2J6EH 5D1QB 4YNYB 4RFNB 4FFVD 3MNZB 1WGOA 3CLFL 3ARDA 1A9EA 4NNPL 4OD1H 5D6CA 4JDZB 1PW3A 3QULB 3T3ME 4JM4L 2BC4A 4HUMB 1OLLA 1Q9WB 1CD1B 2GK0B 3MGOB 2I07A 3MPCA 5D1XA 4HV8B 1AD9B 4ZD3H 2XKNB 4KJYB 1QLEH 4FFZH 1A47A 2PO6A 2XFXA 1Y18B 2R1YA 5E8OA 4P5TC 5D7KD 1MCPL 5HHOA 2RR3A 4LGRB 4GW1B 3UTPE 3HAEA 3FT4B 4Q74A 4P49A 4U49A 2VXSL 4Q9CA 1FNLA 2IAMD 3ARDC 1N6VA 1A3LL 3HAEH 5HI5C 5INDB 5SWQA 2YBRA 4NUGL 2V2WA 3QEGH 3EO1B 2AEQH 2VAJA 5D1XC 5I17B 1PEWA 5DR5H 1UWGH 2AW2A 2K7PA 1QBLL 3BEWA 3TH4T 2VERN 5FB8A 4FQPA 5CP7B 3WUWB 4WY7L 3PG2A 1DQLL 4JFDD 4GXVH 2PYEB 4RISH 4ZO9A 2B4CL 1F2XK 4XWGL 5A16A 4I9WE 1YEJH 3W0WD 1KLGB 1PD6A 4MSWB 1F13A 3JV5A 5T1KA 4Z95H 3ULUH 4JRXE 4G6JH 3GSRA 5GZOD 3NCEB 1H15B 4Y2DB 5ADOH 3K7UA 4PREA 2VQTA 1RI8A 4NQCD 1BX2A 4FXKB 3PP4H 4G80A 2HG5A 5MEND 4PJ7A 1JHLL 5KSAA 4HQQH 5HI3C 4OFKA 3QH3A 2QQLH 1KB9K 3IDIA 4HUXA 2FJGA 5DD5H 5HHXL 4HUWB 5EOTA 4MQXC 2VISB 3QUMA 4MAUL 4NQDB 4A6YL 4QHLA 3HI6H 2ZPKL 4CAGA 4XWOD 5TDNB 1FVEA 3ISWA 5D1ZA 4ZFOB 1G7QB 1OTSD 4GBXC 4G6FB 4PJBA 2YPLE 3GMQA 4XPHH 1A7OH 1YJDH 1KN2H 4PRNA 5D7SL 5I74B 1NDMA 4V1DB 5HVFB 2JK5A 1TNNA 3PWNA 4PUBL 5KBNC 3ELAT 3LH2H 3H8NA 3QJHA 1KCRH 3AREB 1Q8MA 4OKDA 1F4XH 2J2ZA 4N0UE 1D5MA 3INUL 1A2YB 3QXTA 4LNVA 4YHLL 1UYWH 4U1HA 3E0GA 1HEZA 1SEBB 4KHTH 4YGVB 2HT2D 3QUKB 1F4YH 4LOUD 4E42A 3MRKB 1RULH 1MPAL 1BD2A 4U2YA 4XHJD 4WCYL 2EYSB 1AIFB 4D0CB 2CDGB 5EU3B 2ZOKA 1R3LA 4QGTA 3R06A 3V4PH 1AGBA 3SE9L 1BREA 2FHBA 3ES6B 4YHKH 5D1QD 5GS0L 4NSKA 3LOWA 1FZMA 3CFBA 5E94B 2ZCHL 5DJ2A 3QDGD 1XF3B 4PD4J 1V7ML 4YH6A 4BQ9A 5KJRL 1T5WA 1LE5A 2EDTA 3EYSL 1AGDA 5I1DB 3EZ8A 5F9DC 2BHZA 1F6AB 3NMEA 4OAWB 1ZHBA 1KJ2B 2EH8L 3OXSB 2CGRH 2QSVA 4FQXB 5DZNA 2JTDA 2YSSB 4U1MA 1CI5A 3S4SA 1AJ7H 4DGYH 2FATH 4ENED 3OSKA 4JFPB 2H6PB 1CR9H 4FQJH 2AS5M 5C0AE 3GKWL 4PJFB 3B3IB 2F54B 4YFLI 3VXMA 3N85L 4OLXL 4I0PA 5C0CB 4JO3H 3MA9H 4WJ5B 3VFMB 2VZVA 4DVBB 5KVMC 5IFJA 3DBXB 1ND0A 3L9RB 2VDPH 3NABH 2N1KA 3C6LB 1JK8B 1SJVA 4M1CC 1T1ZA 1CLZL 2F5AL 4WHDA 3UZVB 4KRPB 4MCYB 1XCQB 3ZTJH 3BE1H 1KCUH 4X8JA 25C8L 2O93L 3FQUB 4PRDB 4OLEA 3S36X 5J3HD 1A3RH 4ETQB 3DJ9A 4IIQB 3GMLB 4BQBA 4M62L 4I0PC 4ONHA 5DJAA 3CVHH 4PR5A 4NP4H 1N8ZA 5K9QG 2IANE 3G9VA 1PJ9A 5FCSH 2M8XA 4C56B 1KFAH 5HHNB 1ES0A 1H8SA 5ACZB 3BDBA 1IGFH 3RI5K 1UM5H 4HK0B 4BZ1L 5HD8C 3LD8C 3IJSA 5IKCA 4NQDD 2DD8L 1M7DA 2ENYA 5F9OH 5DUBA 4GAYB 1MWAH 2MQCA 4TRPL 2H9GB 3LV3B 1FSKC 4I2XA 5DC9B 1KV3A 1CK0L 5D2LF 4RGNB 4MJ4A 4V1DD 1T7VA 4OQ1A 2NYYD 3NIDF 1RHHA 1G0XA 1FNEB 1ZMYA 4XNUH 3FHQA 5E2TL 2DM7A 1HQRA 1KN4H 4MNGB 5MEOB 1UM6L 4APQB 1F97A 5EUKA 4X5LA 4XCCH 2OLDA 5K9KA 5FYKU 2FEEI 2J1KA 4NBXB 1RURL 1BZ9A 3QYCA 5JMOC 3RUGF 4LLQA 4Z7VA 1FRGL 1RZ8B 3VI4E 3NAAL 1W72L 2BVQB 1RSFA 1XIWD 4TUKL 1XF1A 4OCSL 5BO1L 5GSVB 3U0TA 4OIIL 3LDBB 3WFDH 1CLYL 3WHE1 2NLJA 4FQXD 5FGCE 2PF6A 1H0DA 3FAXA 2CSPA 1I7UA 1IRAY 4YR6A 4X4XB 1ZANH 2ICWB 4KJPD 3LKNA 3BQUD 2BERA 4RFOH 1FFOA 5C0FA 4X7TA 3DO7A 3KYMA 3BEVB 1IMHC 2FLBT 2IBZY 1TVHA 1Y0LB 3LKOA 5CILH 4LHJB 4LSUH 4FRWA 1RU9L 5K9QI 1TIUA 2R2EB 3GHEH 2ADIA 1CU4H 4C83B 1MEXH 3C6LD 5AUMB 4DFHA 2VMFA 2WUBL 4QHMB 1YMMB 1C7SA 1CE1H 1S7SA 1NCAH 4ZUUA 2EXWC 1H8NA 3L3OB 4N0YL 4I3RH 4NQTA 3N1PC 4YWGH 1FORL 5HGDB 5DI8B 3CGTA 3NZHH 1AHWA 5I1GH 4RGOL 5JPMA 5D71H 5DQDH 3R8QA 3BMVA 5C0EA 5GGTL 5ESQA 4HC1A 1QKZH 4F7CA 4UDUB 1T3FB 2H2SC 1UC6A 1N2RA 1FFNA 1HYRC 4P4RA 4YQXL 3U6RB 4HC1H 4C56D 4NYLB 1YN6A 4OM1H 4X9BA 1HINL 4F9PA 1S7UB 3QWOB 2I25N 5IF0B 2IH1B 5ESAA 3TVMA 3P30H 2APVA 4WVRA 4XNYH 4EDWL 4NQEB 3ZTNL 3S96B 5IHZA 2YKLH 4QY8A 1AHWC 5J13C 4GG6F 2Z31D 3MCKA 1AR1D 2JF1A 2PTUA 2Y4SA 5BJTB 3QUZB 3U0WH 4PTUB 1I8MB 3WE6B 3LMJH 5A43C 3MUY1 1TVDA 4PJHA 3SGJA 4GO6B 3V0VA 4MMXC 4LP4A 5JORB 3ULVH 2P47B 3ZDYF 3MLXL 4M3JA 4F9PC 4G9FE 3MXVH 2CIKB 1JPFA 2GTWA 1LO3H 1NCBL 4MXWH 3FZUC 4APQD 3HE7B 3TVMC 2VXTH 4JDVB 5JUEL 1DBAL 1S9VA 4PBWD 1ZGLM 3ILPA 1HOCA 2UWEF 2FBJH 3HMXA 4JQIH 2X10A 3HFMH 2BJMH 4U1JB 1VFOA 3KPSA 2BFVL 3MCLH 4S11A 1FN4B 4XC1L 2EE6A 3HMXH 3SGJC 3HUJA 1GXEA 1DBKH 4N8VG 5KVGH 4QXUH 4YIQB 4X7FC 3NACH 3OKKB 3KVQA 2LU3A 3RDTD 5H94A 4XVJH 2UUDH 5AYUH 3G04A 1GGIH 1FZOA 4M61A 5HHVL 4OF8A 5E99H 1MRCH 1AGEA 2OQJB 1LEGB 1D6EB 1FBIL 1XGTA 1A7RH 1U8JB 1PDKA 1H5BC 2HFGL 3IKCA 1JTPA 2VXUH 3O6KH 3MC0A 4YE4H 2ZJSH 4Z0XA 4ZOBA 5F9WC 2NMSA 1WWBX 5CIPA 5B4MC 4BSVA 4LAJH 1CTNA 4QTIH 3MMEB 4HGWB 1G7HB 3F7VB 4R6UA 3IXAA 1FL5B 1BIHA 2ZKHL 1QFHA 3OF6A 4U7MA 4M5YL 4LSPH 4JDTL 4HK3J 4F58L 4OZGE 1C16A 1WZ1H 5JW5B 1YPZA 2ESVA 3EO9H 4NO5B 1TNMA 3QDJE 1CQYA 3TPUB 3U7YH 4OCYL 1A7PH 2X7LB 3GJEA 3D18B 3D9AH 4BH7A 5ETUB 5T5NG 5IMOA 3QO1B 4YAQA 4HK3N 3WXWH 1A6WL 4IRZH 4N90D 1NGZB 4HXAH 5FYLE 5EU4A 1MCWM 2DQCL 1F90L 4R7DA 2XWTA 1S9YB 1SBSH 4HBCH 1MIMH 3T2NH 1LP9B 2ADFL 5CZVL 4PD4K 5C0JA 5CHNB 2BNUB 3BIBX 5KTEH 4J6RL 4OGAD 2Z92A 3X14A 5TQ0H 3IDJA 3TT3L 1OB1B 1IJ9A 2UUDK 2XA8L 1PBYA 3I50H 1ZLWH 4G6AC 1WLHA 4P46B 3EYOB 5KS9A 3F5WB 2I9LB 5DFWH 4IMLB 3HG1B 3WLBA 4Y5XB 1OAKL 1JNNH 1V5JA 1MCRA 4MDIB 1N4XH 4AMKL 4D8PB 4JZOA 5IW6A 4XZUB 4IJ3B 4Z0BH 1E4WH 2DMKA 4JPIA 3GBLA 1NMBL 1U93A 2DRUA 3MJ8B 2ERJC 1FG2B 1GZPB 4K7PL 3RWGB 2HFTA 4WFGD 4FFVC 5BS0D 2FR4A 2IAMA 3HE7D 4QO1A 2Z35A 2HFEB 2V9RA 4YHPB 3KLAA 2APBA 5C6TL 5F93C 3G6JA 5E56A 2A9NL 1JZ8A 4XHQA 4CN6A 1NGQH 2HFFB 1X7QA 3UTSB 5B8CA 3C6SB 2HMID 1RK0B 2DICA 4FNLL 5E2VL 2ATPB 4QWWD 3UTTE 4UIKL 3EHBC 1G7IB 1UA6L 1VFAB 2MQ0A 4IMKC 4JFDA 4UBDD 1FJ1A 1P6FA 3GO1H 3W0WA 2XT1B 5DJ6A 2X1OA 3PL6D 4G6MH 4ZPVB 1P7QB 2VQ1B 2EDKA 3TN0B 1OSPL 2IQ9L 4R3SA 4L5FL 4LHUG 4NQCA 4X6EB 5EU6E 3GNMH 1ZLWK 4KTYA 1G9NL 5J8OA 4S1QH 5AZ2H 5B8CC 1SYVB 4TVPL 4C4KT 1BOGB 5T3XL 1UADC 3OWEA 4CVUA 3VFTB 1WBXB 2OXHA 2BRQA 5GJTH 1WIOA 4OZFB 1MFBL 4JFEB 1DBMH 2GJJA 3U7WL 5HYJD 4OV6F 5GZOC 4R97C 1W0VB 4Y5VA 2BSRA 1MF2H 2WW8A 2CLZA 1LWRA 3GBMH 5GGRA 1H3PH 2QQQA 1G6VK 1HKLH 1Q0XH 3QDHA 2AEIT 4JVWA 3GKZA 3IJYB 2VLKE 4ORGA 4QXTA 4UTBH 3X3FH 3TYFB 2LE9A 1VFMA 3EDJA 4X7DC 4RIRB 4F7MB 1OTSC 5IQ7L 5FM4A 4PRIE 4QOKB 5DO2D 2F53B 1ADQA 4K94H 5D1QA 1DQML 4YNYA 3OKOA 1H3UA 3WS6C 4ZTOH 2OR7A 3MNZA 3OG4B 4Y5VC 4OF6A 4UQ2A 3S3PA 3I84A 3QDGA 4NO2A 1WITA 4JDZA 1ADQH 1FNSH 3QULA 5CEZD 4KK9D 4NN5C 3B5TA 4GRWE 5IESH 4K9EL 1Q9WA 1CD1A 3HG1D 3MGOA 2R4SH 3QAZC 1JMZA 1AD9A 2XKNA 4LOUC 4KJYA 4F33A 1YY9C 2XA3A 4XHJC 4PJAF 2KZWA 1Z0MA 3V5HB 4GW1A 5D1QC 1T6WA 4PJEE 2ORBH 3ORJA 4RFNC 4WWID 1KCVL 4LARL 4X7SH 3H2WA 4TSCL 3EOAB 3S36H 1RFDH 3QUXB 3IDYC 4HIJA 1AXTL 4R8WH 2APWA 1KNOB 4KZDL 2DQTH 5BCAA 3RIFK 5I17A 4QHKI 4BFEA 5CBEB 5DHXB 2AABH 4JHWH 1NAML 3IGAB 5CJQH 5CP7A 1EFQA 4ENEC 4QRPE 3H42L 3VXME 3NIFE 2Q7YA 4YC2B 3VFPB 4L29B 3OXRA 1C1EL 1FPTH 1YUHB 3TBWA 1WBZB 5CCKH 2NTSP 1P7QD 2R0LH 3LS4L 3TN0D 2CIIB 5EZLA 4Y2DA 1H15A 2P5WD 4HKXB 4JPKL 4XVSH 3ROLB 1B0RA 4TSBH 4FXKA 4PGBB 2MJWA 1BVZA 3SE3A 5AD0A 3L5XL 4KRNA 1AQDB 2QADD 3SGEH 3WXVL 2Y23A 1UH4A 4U1IB 4NRYB 4QXGH 4YZFE 4NQDA 1N3NB 1U3HB 2GAZB 4RWHA 5TDNA 1XF4A 4ZFOA 1G7QA 3EW3B 2CUHA 5M94B 1ZTXH 1BFSA 5J3HC 1OQXA 1B4RA 3G6AB 3T3PE 2IG2H 4OJFH 3ARXA 4V1DA 4Y2DC 1CG9A 2W0FB 4RDQF 2AK4B 4WI9A 1JGLL 1A2YA 1YEDB 2R56H 1WWCA 4YGVA 1PZUB 4I3SH 5FUCC 1U8MB 1JNHB 3MSPA 3MRKA 4L4TD 1BWMA 4CN4A 5C3TA 4HWUA 1AIFA 2XKSA 4D0CA 2CDGA 2ED8A 2IMNA 4QOKD 1T0PB 5I74C 5CJ8A 3QISA 3WNLA 2G75B 3ES6A 3VFRB 5ESVB 1MCKA 2FWOB 4PRAB 3PHQB 4NZRL 1A4KB 2GSIA 5E94A 5T5FL 3ZKQD 1NGPL 3RQ3A 3AREC 1KTLB 3ARBD 1XF3A 2B1HL 1EH9A 2ZCKH 5JNYB 1XIWA 2SEBB 1I3RB 4OLVL 5AZEH 5I1DA 4QHUB 5K9JH 4OAWA 2R15A 1DUZB 5F6HJ 1D6VH 1J1PH 4H26B 5D2NA 1KJ2A 1SJHB 3BP6B 1LK3L 1IQDB 1RJYB 5LCVH 4FQXA 4J4PC 4X6FB 3B9KD 4KKNA 2NY7H 4JFPA 1Q9LB 3H9YA 4KTDH 4ODHH 1ZVYA 4XP5H 4PJFA 3B3IA 1O5DT 3QZWA 5IR1B 4P2OB 5F71A 3VFMA 4FHBD 3DBXA 1BMGA 1JNJA 3QUXD 4NQVA 3FQRB 3BGMB 4BFIA 4EKXA 3C6LA 1JK8A 2GFBB 3U36B 1V3LA 2VC2L 5D2NC 4JG0L 4C59B 1HHJB 5BXFA 3BWUC 4FQXC 3OPZL 4MCYA 1L7IH 3BSZL 3MODH 4FABH 1WEJH 1XCQA 2Y07L 4KJPC 3OKNB 1EO8L 4XCEB 3FQUA 4XI5C 4PRDA 3C09C 4JO1H 3GFUA 4LLDB 4L3EE 1H9VA 4IIQA 4MDJB 5B38G 4JB9H 1DLHB 1S3KH 1B0GB 3S3JA 1DFBH 3H9HB 1EHLL 4GAJH 1FYTE 5FGBA 1VPOL 3C6LC 3D6GA 4C56A 5HHNA 1U8QB 1ZVHA 4O02L 5ACZA 2CMRL 4KRPC 5CFHA 2JB5L 1DQJA 3PHSA 4DOHE 4HK0A 1VB9A 5IVXF 4WW2F 4JVPA 1OM3L 3HC3H 3RA7L 1J8HD 4UT6H 4XGZB 1QSZA 5HYFA 1IQWH 3UPRB 2H9GA 4HF5H 1J1OL 4IIQC 4UAOB 2Z31A 2VLMD 4OCXH 4RAHA 2IGFL 4Q6YA 3HRZA 5LKNA 1CTOA 3SKJH 5EO1A 1AXSB 2E7LA 1NUFA 2R8SH 2H3NB 1VEOA 3D2UD 1TZIB 5GRXG 3VXSB 4APQA 4LMQE 4MA7H 4EEEA 4ZSOA 3NIGE 4ODVH 3LQAL 1VSCA 2ILLA 1SY6A 5C0BB 4LCUB 3MRRB 3EGSB 4PJHE 4Z5RB 5TFSH 3RZWA 3DWTA 5ISZB 4HD9A 3EDEA 1UKSA 2BP3A 4PV9A 3L7EA 3OAYH 5I30L 5GSVA 1HSBB 2YPVL 3RDTA 2I26N 4LSTH 1HXYB 2E7LC 5IIEA 4GSDH 4TVPE 3VXNA 4APQC 4X4ZA 5A2LH 5EBLA 4YXKH 4X4XA 5DMJB 5T3XE 4CADB 2ICWA 1FV1B 4PRPE 1JL8A 1S7XA 2H45A 3SKNB 1RZKC 4IM8A 4PLJD 3BEVA 2MNUA 4HXBL 4WTXA 4UT7L 3VG0H 4NNPH 5CGTA 3D25B 2DIJA 4Q9RL 1KPUA 3ESVF 4C83A 5GS3A 1Q9KA 5ADPH 1N6QL 5AUMA 3RDTC 1YMMA 1CICB 2W92A 3L3OA 1V8HA 4LRNL 3VFUA 2V7HB 4RZCB 3VXRB 4YK4B 5HGDA 3O81A 5DI8A 1KACB 3QB7C 4R96A 2VXSH 3ZHDA 1QSFB 4W4NA 3SE4A 2XZQL 5I16B 5EZIL 3FQNB 3T2OA 1T3FA 4LLUB 3SDXB 1DZBA 3DUSA 6FABL 4I4WA 4YHYB 3JBG7 4P2YA 2X44D 1TJGL 4ONGL 1QBLH 2P24A 1FQ9C 1E4XI 4NYLA 1GHFL 1TPXB 3OAZH 4K7PX 3OAYK 3QWOA 4WY7H 4G9DA 5GGSB 1DQLH 4OGYH 5IF0A 2IH1A 2Y6SD 4XWGH 2IADB 1S78D 3K1DA 4WGWB 4X4MA 5LXGH 3M1BB 3S96A 1WJ3A 1J18A 3P9LB 3OGCA 3ZKMC 2A0LC 3ALWA 5IM7B 3SE4C 1BBJB 4RWYL 3WE6A 2HKFL 1AFVL 1JHLH 3MLYL 4OI7A 2VZSA 5JORA 1CL7I 1RUPL 4PG2A 3ZYJA 5D5MF 1LDSA 7FABH 5HHXH 2L7UA 1OF2B 5AYQA 4A6YH 3ME0A 4OGAC 2ZPKH 4MXQD 5BS0A 2YK1L 3VXSD 3A6BL 3HE7A 2WQ8A 3IFOB 1KJ3L 1QR4A 5D7SH 3C2AH 5DVOA 5C0BD 1OP9A 4PUBH 1WT5A 2XACC 3QUZC 3VGGA 1FN4A 4I1NB 4JN2B 3BZFA 1WK0A 5TDPB 4PG2C 4YIQA 3M8OL 2AV1A 3QCTL 1F58L 3OKKA 4QNPE 3MR9B 3G5XA 2AQ2A 5CEYA 5D2LB 3OBAA 4W6YB 3G6JE 4JN1L 3OAZK 2FL5B 3HE7C 2ZNWA 5DYOB 5EIIB 1K6QL 3M45A 3VJ6B 4MD4B 3V8OA 1LEGA 3UYPA 5J0BA 4XBPB 4X5WB 5MP6L 3WSQL 1D6EA 1C08B 4NN6B 2CK0L 4IDLA 1U8JA 1WT5C 4UOJA 1F45A 2ZCLH 2HMIC 1Y6KR 5CUSL 3HI5L 5EU5B 1HHGB 1NANH 1V7MH 5KJRH 4QWWC 1PYWB 5D7IB 1J11A 1NBYA 4XTRC 4UBDC 5ACLA 3MMEA 2EDLA 3F7VA 1HCFX 3NPSB 3WMSA 1LMKA 5HYJA 2C3VA 3OAUL 4AENB 5MERB 2DN7A 5JW5A 5DEZA 4W68A 1BVLB 3OR6B 3TPUA 4OD2B 3CMGA 4CU8A 3D18A 3PXHA 5ETUA 4NKOB 4OLXH 4H8WC 1EZVX 4LCWD 3I2CH 2ZUUA 3NCCB 3RBGA 1EVUA 1V7NL 5J9PB 4Z7NF 1BLNB 1NGZA 4M6ML 5DJCB 4X0KB 2J12B 5ANMB 3RNQB 3AVEA 1S9YA 1CLZH 3DROB 1LP9A 4FTVE 5CHNA 2BNUA 2E6QA 1FL6A 3D3VD 5DJZB 2DL9A 1A22B 1IGJA 3AFLA 1PFCA 1PAMA 3SGDH 1TTFA 1OB1A 4U6VL 4RRPG 1NFIB 4EUPB 4P46A 3RRQA 4XVUD 3EYOA 3SO3B 3K8MA 4NRXB 3F5WA 4M62H 2I9LA 4IMLA 5TQ2L 3HG1A 5GIRB 5C7XH 5I1JL 2JELL 3GMOB 4POUB 4MDIA 3ECBB 3HTLX 4NO0D 4D8PA 4G7YL 4HULB 1U3YA 2D31A 1F3JA 3MUZ1 5FV1L 5KSBE 4Z7OE 2AP2A 4JQXA 5TF1L 1A64A 4BZ1H 5DO2C 3MJ8A 4M8VA 2W38A 1FG2A 1GZPA 3H9SD 3RWGA 2DD8H 4KDVA 4JVUA 4AL8L 4JY6B 3RKDC 5F89A 2VR4A 4QYOB 4BFGA 2EDRA 3BPCB 2HFEA 3HAEG 4NM4L 2DJSA 4YHPA 1E28B 1CK0H 2HA1A 4P46C 1CDUA 4KK9C 4HWBA 4X9HA 3C5ZB 2UZXB 1QFWL 2HFFA 2ICES 4Y5XC 4KVCH 1Q38A 3C6SA 1CFVL 3MUJA 4HWBH 3BKCL 2K3TA 3IFPB 3T1FA 1OVZA 1G7IA 2R4RL 5JW4R 3D0VA 3QHFH 4JQXC 5E0QA 4LIQL 3P11H 5GGVH 3PWLA 1YQ2A 2VUYA 3VXUB 4ZPVA 1P7QA 2A6IB 2AJXH 2VQ1A 3IU4H 4TULL 3TN0A 2P5WA 2C7UB 4X6EA 2YXMA 5CD5C 4WGVB 3U0PA 1UM4L 5T1MA 1OL0A</