5GRUL

Structure of mono-specific diabody
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
228
structure length
228
Chain Sequence
QVQLKESGPGLVRPSQSLSLTCSVTGYSITSGYYWNWIRQFPGNKLEWMGYISYDGSNNYNPSLKGRISITRDTSKNQFFLKLNSVTTDDTATYYCARAYIGFAYWGQGTLVTVSSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSSSSLITFGQGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system
total genus 55
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2016-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gruL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gruL01
2FIRT 2QLVB 4ISVA 3LCYA 1G7IA 4M5ZL 3A67H 1OAZL 43CAA 3PNWA 4O58L 4HCRA 1KB9K 3V4PL 4NHCL 5I71C 4KJYA 3TJHD 3FB6B 1G7QA 1BD2B 5AZEH 1CGVA 5HHOA 3MRGB 3B9KC 3QEUA 3UCRA 1H5BC 2VZTA 2J12B 5CD3A 4QRUA 4KXZH 3NTCH 3H9SD 1SQ2N 1S9WB 3W39A 2DIJA 4MJ6B 5IMOB 1W72A 1GIGL 2YSSB 3IRPX 3SOBL 3MBXH 4NOFA 3SBWA 3DUUB 2L7UA 3UTQB 1A7QH 1IGFL 1U95A 3WS3A 4I2XE 5ETUB 2VC2L 3UX9B 1F58H 4WW1B 1QO3B 3VXQB 3KPRD 4QF1B 4X4ZA 3FO9A 3QUKB 5CSZA 3EYQC 1KJ2A 2B4CL 4RFEB 4TSCH 3LOWA 2Q76B 1D9KB 4MHHG 2AXHA 1NMBH 1Q9KB 2LTQB 3IKCA 5B8CA 4JKKA 3IDGA 3JTTB 4HJGA 1M7IA 3ARYA 3QISA 2F74A 4DN3L 3C60A 3L5XH 3EDFA 1B3JA 3QDGB 2P43B 2NTFA 4FQIL 1B0RA 1IBGH 2JKXA 5DMKB 1F11A 3BUYA 2IFFH 3RNKB 1UM4H 3CFDA 5I1JL 2F8OA 4PJGE 1IM3B 4LLYB 3GSUA 1UB5B 2DL9A 2IH3B 2NR6C 1Q9LA 3WNLA 2VLJD 3QO1A 1CFNB 4E5XA 1FZOA 3RI5F 4DGYH 1SY6L 1UKQA 3D0LA 1GPOH 3FO2B 4FS0A 4AK1A 5CZXD 4NJ9L 4WEUD 4UIKH 1AI1H 3P4NA 1WZ1L 4JO3H 4QXTA 5C0BE 3S36L 4X5WA 4Z95L 1LNUB 1XGYL 5DJDA 5E7BA 1BZQK 5TDNA 4L4VE 1NC4D 4NRZB 5D1XA 4BZYA 1JGEB 4BQ8A 1KENH 5DJ6B 4GQPH 4XBEH 2DQHL 5D1QC 3MRJB 4DAGH 3IB4A 1KCSL 2HTKC 3UPCA 2Y6SD 3I2CL 4FQJH 2FGWL 4JR9H 3KPQB 1NLDH 1TMCB 2EKSA 3QI9B 1Z5LB 2R29L 4QRPB 2NY1B 2CXKA 1JFQL 5DD0L 4ELKB 3CCHA 3DSFH 4N5EC 2DYPD 5E8DL 1S7TB 3RWFA 3WLWC 4JY6B 4QHUB 4WI4A 1BBJA 4GMSH 4PJAA 5T1KA 3SDXE 4DW2L 5E4EB 2KQMA 2DQTL 2XYCA 3D25B 4ERSL 5BV7L 4PP2A 4XC1L 5DD5L 4ZTOL 2EEDA 4M43H 3P3YA 4M61B 4IRJA 1ZVSB 1I7ZB 4OCNC 3QCUL 3QIBA 3AU1A 5EU6D 2BDNL 1OGAA 4EI6B 2NXZD 3MRIB 3OHXA 5L8LB 1OWRM 2AXGB 3OPZH 4XPTH 3RGVA 3SDAC 2YZ8A 3HZMA 3PWLB 4LVOC 4JG1H 1NC2D 4GKSA 4OGZA 4GRWF 2DJUA 5KTEL 3SO3C 1TQCB 4JPKL 1HINH 1JBJA 4NBYB 2WUCL 2ZUSA 3ETBF 1BAFL 4K71B 4YH6A 3RKPA 1RU9L 2GQHA 1KCLA 3QNXA 5IVXA 5IT2L 1KJMA 3W5NA 1A1MA 3NZHL 4FQQB 2QHRH 4JN2A 4OZIB 2D0HA 2Q86B 3RL1A 4MAUH 5E99L 5FECB 4Q6IC 4G7VL 1KFAL 2I5YL 1EGJH 2EYTB 3IYLW 2NQCA 1TETH 1CIDA 3AAZA 5J9PA 4O2FB 2R1XB 1TQBB 2GCYA 4NDMA 1XF2B 3I85A 4ZSOB 5LGJA 1F4XL 2HFGL 1VSCA 3P9MB 5LXGL 4XNQB 3N9GH 1T7VA 3TO4C 4XXCC 1XIWD 4I0CC 3SDYH 3U4EA 5ANME 5IB1A 5CLWA 4RGNB 2VDRH 5JOFA 3GSOB 2ZG2A 2NZIA 2QSTA 3G6DL 5D1ZC 5HY9A 5HD8C 5GS0H 1NCTA 1BFOA 4XH2A 4X9IA 1GAFH 4HK3N 4U1KB 4X99B 1ZA3B 1KCRL 3ARBB 4J6RL 2DDQL 3V0VA 1OM3L 1AGEA 2APBA 1FYTB 3ARTA 3GHBH 1EXUA 5FO7B 5I8OL 4KZEL 4QHKI 4GS7C 1ZV5A 3T65A 1H3PL 3PGFH 5EFIA 2EXYD 2D7QA 3UJJL 4ISVB 3C5ZA 2D4DA 1JPST 1G7IB 2HKFL 4NZTH 43CAB 5DEFA 1P7QA 3L7FB 3CFCL 3PNWB 1MEXH 2YPKA 4AYFA 5LGHH 4HS8L 4KJYB 1G7QB 1MRDH 3L95A 4K94L 4M5YL 5TDPA 5HHOB 4M4PA 4PFEA 2QSVA 4OKDA 3QEUB 2NW2A 5INDA 2CH8A 4YDIL 3C87A 5CD3B 4P2QD 4GJTB 1DBML 4AMKL 1VGKA 4LCWD 1JWUA 3MLYH 4JZNA 2P49B 4X83A 3W39B 4DVBB 1Y18B 1W72B 4P23A 4HIXL 3IDMA 3MRRB 1IKFL 5C0NC 4ZS7L 1I4FA 5GGVL 4KK9D 1X44A 3K46A 5EIQA 4RFNC 3D3VE 1Y6KR 5FYLD 1G6RL 2L0DA 3FO9B 4KTEH 5CSZB 1KJ2B 4RQQA 3CDGB 1AJ7H 4N68A 1QHOA 4H20H 5MP6L 1UQSA 5DURB 1RFDL 3A6BL 1QACA 1U42A 5I74B 1OP5H 1KEGH 4GW1A 2D31A 2OCFD 2F54E 5B8CB 3IKCB 5AYQA 1DQLL 3BE1H 3IDGB 4S1SL 4YHYB 1FO0H 2F74B 3C60B 3RDTC 3VWJD 3C5SA 2EDKA 3MCLL 3UZVB 3TA3C 2X1PA 2NTFB 1B0RB 1BP3B 4WWKC 1Z9LA 1F11B 3BGFC 4OCWH 3BUYB 4Z7UE 1A7PL 3CFDB 3MBED 1KACB 1KXVC 2QSQA 3F7YA 4OQTA 4RMVA 3T0EC 4TUJA 1ZS8A 3GSUB 4UI2A 4ELME 5SX5H 2BFVH 3HC0A 1Q9LB 3QO1B 1B0WA 4E5XB 1FZOB 5FCSH 4Y5VC 2J8UA 2UY7A 3D0LB 1KLGA 4YFLI 3T0AA 5FO9A 4KI5D 1ZTXH 3MA9L 2YHGA 3P4NB 4FMKA 3ZHLA 2J8OA 4QXTB 3ZYJA 4X5WB 5E6ID 2GK0A 5F9AC 4LF3A 5E24E 5DJDB 4BZ1L 3O9WA 4BK4A 5TDNB 1H8SA 2A77H 4JKMA 5D1XB 2AJZA 4QHLB 4XBGB 3RQ3A 5DRZA 2A6IA 3BO8A 5IQ7L 2NY4B 3QRFM 4U1GB 5C6TH 5T1LA 3HPJA 4BSWA 2HMID 4U6VH 4X6DA 3OBAA 4AG4H 2EKSB 1F4AA 3HMXA 4P46B 5GGSA 4OI9A 1WTLA 3DX9A 2XQYG 2I25N 1YNKH 3VXMD 1I3GL 2YN5A 3K4AA 3ULVC 3RWFB 5BRZA 3ARDA 1E4XH 2P5ED 1BBJB 1NCNA 1UGNA 2ZUQB 4PJAB 5T1KB 4XVTL 5CINL 4LSVL 4JQVA 3WKMH 1TJIL 3BAEH 3G9AB 5GHWH 4PP2B 4LHQB 3P0YL 5DMYA 4H5SA 1A7BA 3VGDA 2DM4A 2VR9A 4IRJB 1WAAE 3LHPL 5I17B 4J8RA 3OXSA 4Z6AT 1RIHH 2IANE 3T0EE 5JHLL 3AU1B 3QT2A 5JDSA 4FQ1H 1OGAB 1BBDH 4LSDA 4MXQD 3SGEH 3MZTA 3DV4A 3RGVB 5HHQA 3HZMB 1A8JH 4KVNL 4QXWA 1MF2L 3C8HA 4KHTH 4YGAB 2HFFA 4EXKA 4KRLB 3ZKMD 5TE4L 3NN8A 1D9KC 5TF1L 1WQVT 4PD4J 4YGVA 4QOKA 1E4WH 2LTQC 2HLAA 1MI5D 1TTUA 3SE9L 4FZEL 3O4LD 3HG1E 3QNXB 5HHVH 5IVXB 1KJMB 2PKDA 1A1MB 4OF3A 4O9HL 5IEHA 4JN2B 4DKEH 2X1WL 5E2TL 3RL1B 2EC9U 3CZJA 2XA3A 3MR9A 3MLRL 2YR3A 4KZDH 2Q3ZA 4R90L 5C0RL 3AAZB 5A43C 5J9PB 3NIFF 2GCYB 3QQ4A 2OJZL 4NDMB 5LGJB 4R4FH 1UACH 1FPTL 5ESVA 3C6SA 5F44A 3U4EB 5DK3A 5IB1B 5JOFB 4M6NH 1JYXA 4LARH 4LVHB 4AM0A 5IWLA 3H9SA 5HY9B 1BQHG 1F3DH 1FFNA 1CGTA 3DX8A 2XFXA 5C07D 1BFOB 5JW4N 1YUHA 1ZANL 4HKXA 1C5CL 2EDTA 5ADPH 5FCUL 1BQLL 2X41A 3DARA 1AGEB 2C3HA 2ICWJ 3QA3A 1EXUB 4ESKA 3BW9A 3QI9C 3WIIH 1GJIA 3KPRA 2Z8WC 2NY1C 4JRYD 2DQJH 3T65B 3NA9L 4N8VA 5EFIB 5GJTL 3RWDB 3HNVH 3C5ZB 2UYLA 3RVWC 3U4BL 5ISZD 1CGSL 5DEFB 1UCTA 2KL6A 5LWYH 1V3MA 1KBGL 2YPKB 5E4EC 2B8OT 3UTZA 5DUBA 2Z91A 4U1NA 1F3JA 4WIQA 4XPFL 1T20A 2NW2B 1IZKA 5INDB 5EZOH 3OKYA 1VGKB 1NSNL 1DQDH 1OB1A 3K4ZA 1JWUB 4JZNB 3BH9B 5EUOF 1JHLL 5F9OH 4P23B 5IW6B 1WLHA 1YYMH 2VLJA 3IDMB 4X8JA 3TGXA 3ZTNL 1NEZG 2AEWA 3DVGA 3VXSE 4NQED 1V7MH 3MLUH 4I4WB 1NKOA 4HBCL 3HMWL 1TQCC 2EDDA 3VGBA 3CH8A 4PRIE 4RIRB 4K71C 4UINH 1JF6A 1D7FA 1FNEA 1NC4A 4AL8H 3LSOA 2IF7A 3QUML 5L2JA 3WSQL 2OMBA 3MREA 3WHXA 2D31B 5L2KE 4ZYKA 3WJJA 1FVDA 1T2QH 3P4LA 3VXOA 2BVYA 4JZJA 1KN4L 5I18L 4JFDB 2LVCA 3HFMH 2XXCB 4K9EL 3BKYH 2XQBL 5J4MA 4HFUH 2NZ9C 4YBHA 3I3EA 2NY0D 4FXKA 2VN4A 3VGGA 1TQBC 3F7YB 3WYRA 2QHLA 4HT1H 1C5DA 4TUJB 1ZS8B 2DYPA 3HC0B 4N8CH 4U1JA 3VA6A 1MJUL 3MGOA 1DQTA 2ARJA 2J8UB 4RGNC 5E03A 1KLGB 5SX4I 3HRPA 5FO9B 5IFAL 1Z9OA 3QDMD 4W70A 3WFBH 2IH1B 3EOTL 2HJKA 1GGCL 2GK0B 4LF3B 4DKDC 2R2CA 3O9WB 4ZUWA 3ARBC 2AJZB 5EU6A 5A2IH 2VISA 3D18B 5DRZB 2A6IB 3BO8B 4PBVC 4G8FA 4OUUA 2WUBL 4M7KL 3BDYL 4B7LA 5T1LB 2IG2L 3IFLH 1NC2A 2DWEA 3HPJB 4BSWB 4OLZL 1FBIL 1TDQA 4X6DB 5GGSB 3RVVD 1MJJA 1WZLA 2ESVD 4OZGA 3DX9B 1EZVX 2Q20A 1IMHC 5J12B 3QRGL 4LGRB 3MODL 4G6FB 4WDIA 5BRZB 3WBDA 3ARDB 5A3ID 1F4WL 4HAFA 4YHIB 1NGPH 1G9NH 2AJ3A 4NN5B 3D87B 2ZP0T 4H5SB 4BUHA 1IAII 1K8IB 5A2FA 4KUCF 3SBWC 2C4XA 2KQNA 4J8RB 4LRIA 3OXSB 5HGBA 4XCCL 5JDSB 4R7DA 5DQ9A 1XIWA 4OLXL 5EC1A 3T3PE 3DV4B 1BQHA 1FL6A 3T77A 5HHQB 4JFFE 5C0CD 5FIEA 5J6HA 5AD0A 2HFFB 3QEGL 3TYGH 2FNBA 2N7BA 1X5FA 4KROB 3UTSD 2JTDA 2WNGA 5I74C 3KLSA 3NN8B 3BX7C 4K8RL 4QOKB 1NAMB 5B8CC 2KPNA 1JL8A 5GSRA 3H2WA 4JGUA 4FP8L 1TXKA 4YHYC 4G6KH 3C60C 4QY8A 1PSKH 2VDNL 1RZIA 4NGHL 4M8QA 4MMXC 3KPPB 4NZRL 4P3CL 4LNVA 3MR9B 1JYVA 1JMZA 4EDWL 4KC3B 2F53D 4K7PH 4P59L 5DHYB 3AM8A 5C6PB 4PRHD 1WIPA 4F7EA 5GZOC 1YQVL 3ORJA 1GCFA 3QQ4B 5LG1A 2LVEA 5JW3L 4WFFE 4GMTL 2HT3C 3ALXA 3C6SB 3RVTD 5IGXL 5KSUB 2WANA 5SV3A 4LHJB 4QT5A 3STLA 3C08H 3GJFK 4P2QA 5DLML 3O3AA 4JREC 4AM0B 4LCWA 5D1XC 3H9SB 4KKBD 3EHBD 1NEZA 43C9B 5I0ZA 1FFNB 4HUXA 3TBVA 4NWUL 2RR3A 1GGIH 4R4BB 3RU8L 1NKRA 3S5LG 3DX8B 2XFXB 3BVNA 5HDBF 4MQXD 3MROA 2YMXH 1YUHB 5J57B 2DMCA 4U1GC 1UM6H 2I9TA 1WIUA 2H2SC 3WD5L 3QA3B 2VXSL 3FB8A 4P46C 1QSFD 2VDPH 2P24A 3BW9B 2DD8H 2DKUA 4KJQD 3W81A 3A6CH 4P5MB 4N8VB 3ES6A 4MA8H 3DROA 5FYKL 2CRZA 2UYLB 3VXRD 4E41D 4MA1B 4U7KA 3THMH 1JNHA 3REVA 4PD4K 2ZUQC 4LSQL 3UTZB 1I7RA 5DUBB 2DLTA 1BHGA 3WN5B 2Z91B 3LN5A 1A5FH 4U1NB 3VWJA 4EOWL 1F3JB 1C7TA 1T20B 1KXTB 3B8YA 4POZD 4LCCC 4IRJC 4JHWL 3CFKA 3MBEA 1SBSL 1CDBA 1U3ZA 4HIIB 2AQ2A 5KVEH 2RJMA 5JIPA 5C0EA 1ZVHA 3CFEA 2D7PA 3ARVA 1KIUA 1EJOH 2VLJB 4X8JB 3RGVC 1YYLH 4MQSB 2Z8SA 3VFVA 3DVGB 5F7DA 2AGJL 2X4PA 1QG3A 1ND0A 5E6IA 5I19H 4H8WH 4PJ8D 3WIHH 2MSPA 4GRWH 1NC4B 3S35L 3D48R 3LSOB 3DURA 5L2JB 1WK0A 3MREB 4X0KA 3WHXB 1VFBA 2A0LD 4ZYKB 1FVDB 4PY8I 3VXOB 4AEHH 4JZJB 4K7PX 3MXWL 3C2AH 1OSPL 2UZIH 3WNPA 2FX7H 1P4IH 4HPYH 4FXKB 4ZQKA 2NPLX 3G5XA 3QHZH 3CVHA 1CBVH 2BRRH 4YHOH 3CC5A 2W0LA 3IFOA 4XTRD 5D72L 2XN9E 3HS0B 3VXMA 2E7CA 1C5DB 3X13A 2DYPB 1RIUH 2FLRT 3QEHA 1HWHB 3UJTH 4U1JB 1BOGA 5IBUG 1V7NH 5D2LB 5FHAH 2P5EA 3B9EA 3GMRB 2ARJB 4DUXA 4PS4L 3X14A 4ZUVA 1FORL 2OLDA 4LVHC 3LEYH 4AQOA 2AQ3A 1FGNL 1CE1H 4PP1D 1QFWI 2X09A 3PGDA 2J1KA 2HJKB 1A7NL 2JB6A 4DVRH 1RI8A 3GNML 4LPCA 1PX4A 3QEQD 1MJ8L 1WZMA 3U2SA 4Y1AD 3F5WA 4ZUWB 1UB6B 5EU6B 2VISB 3RWGB 2NXZB 5EBMA 4G8FB 3IU3A 4OUUB 5F6IB 1L6XA 3SKJH 1NC2B 3C5ZC 5HHMB 1EAPA 1MFDL 4F8TA 1MJJB 3FFCD 2CKBL 3V0AC 1VDGA 3MUZ1 3ET9F 1UWXH 4M6ML 1MI5A 4J3OC 3O4LA 1EFQA 4KAQL 4KK6D 3PHOA 4HKZA 2BVOA 2Y72A 3DMMC 2K7PA 3DVIA 2RCSH 4JGMA 4NM4L 4M7LT 4TUKH 3G9VA 4FA8A 2AJ3B 3VMOA 4P23C 1FVEA 3ZYOA 3IS1X 1UM5L 1R0AL 1DLFL 2GT9A 1VADA 5HGBB 4S1DD 4R7DB 5DQ9B 3TIDA 1HQRA 5EC1B 1WEJL 1FL6B 3T77B 3P73A 1ADQH 5CEZH 1SJEA 5J6HB 5AD0B 2ZWLT 3EYUL 3S5LA 3GBNL 1TZIA 4KDWA 4WW2B 4XPAH 5MEND 3H3BC 4GFTB 5C07A 1JP5A 1J0HA 2QQKH 3CX5J 1S5IL 4N0YL 4HW6A 2YRPA 4YHLH 1CE6A 4KU1A 4QY8B 1EV2E 3INUL 3U83A 3CDFA 1RZIB 4DZ8A 1KB5A 4JRYA 1X4ZA 4M8QB 5KS9A 1OOAA 5GPRA 3V4UL 3CLEL 4M5ZH 1OAZH 1IILE 2ZOLA 5ISZA 5JPNA 3OZ9L 4O58H 4F7EB 5IROA 5HHPA 3V4PH 4R3SA 5JUEL 3ROLA 1YEEL 1NCAL 4FFYH 5HHNB 4G6JL 4QT5B 3DETC 5AUMA 3SE4C 1F45A 4P2QB 3O9WC 5EN2A 3O3AB 3MUY1 3ZHKA 2YOCA 4I3RL 5J1SC 4LCWB 4U1SA 1F6LL 4XVJH 1NEZB 3GJEB 4HUXB 5I73B 4UOW1 3BVNB 1NBQA 3MROB 3CNKA 5IP4A 1IGFH 3JWOL 4NQEA 2I9TB 5MHSD 2VC2H 5AWNL 1HCFX 4P5TD 3FB8B 4HUKB 2H2PC 3EW3B 4DEPB 4CN1A 4AZ8A 2P47B 5J12C 1OW0A 4JEGB 1CIUA 1CFBA 4B50A 3DROB 2E6QA 1CD9B 2VQUA 1OAKL 4NWTL 4ZS6D 4AT6A 4HUVA 4E42A 4MMZC 5E70A 5IB3A 1JNHB 4LNRA 4OZHA 4Z76B 1GRWA 1S7WA 3AMKA 4DN3H 1I7RB 4JQVC 4XNZB 3LN5B 3VWJB 5FM5O 4FQIH 3WUWG 4EQ3A 5DGQA 3VXUD 3U79A 3GSVA 5EOCL 3MBEB 5I1JH 2J6EH 4G6ML 7FABL 1A7OH 1QTYT 4IOFD 3CFEB 1IGCL 2VZVA 3RY6A 1J88A 1SY6H 3RWHA 4CN6A 4U6YA 5DHVH 2J8UE 3VFVB 1RMFH 5F7DB 4OFVA 1WJ3A 3QDMA 4HPOH 4KROC 2X4PB 1R24A 1WZ1H 3OKMA 4MXWH 1XR8B 3S36H 1ND0B 5E6IB 4AEEA 5C2UB 4Z95H 5GRYA 1XGYH 4GXVL 1GGTA 4FN0A 3QFDA 3BJLA 1T21A 1CXIA 4ODSH 3DURB 3QUZD 2AJVL 1I8IA 5DVMA 1DUZA 2DQHH 1KCSH 1RZKH 1YEIL 2EIEA 4ZQKB 2ESVA 3G5XB 3QH3A 1KJVA 1JFQH 4PJIB 3CC5B 3IFOB 4YZFE 5DD0H 1H3GA 1MWAH 5KOMC 3TJHC 3VXMB 1RPQA 3X13B 1X5HA 4O02H 3DIFA 3QEHB 4JN1H 5BRZE 5HI5D 1BOGB 1ZLWK 2OQJA 2P5EB 4XP5L 4ZD3L 4V1DD 4RCAA 4XAKD 2DQTH 3X14B 5J11B 4ZUVB 2XV6B 5IWLC 3FOMA 4ERSH 2YD5A 4FHBD 2X4NA 5HGGS 1FL5A 3PGDB 4XC1H 2JB6B 2G60L 3TJEL 4ZTOH 1G7PB 3U2SB 4UTBL 2YA1A 3L5JA 3F5WB 4ODBD 3MRLA 4C58B 3WXVH 2BDNH 3PP3K 3IU3B 3V6BR 5TE7L 5DS8A 2FEDC 1S9KC 3VRJA 3SE8H 5C0CA 4RWHA 4GRLD 5JOEA 3UTSA 4PJ7A 4WJ5A 3ECBA 1EAPB 4MA1C 1Y0LB 1PG7L 3FN3A 1NUNB 4WTWA 1MI5B 1RU9H 4WUKH 3O4LB 5ITBL 4OM0L 3KS0H 3WN5C 3PHOB 3QHTC 2HA1A 2BVOB 2FWOA 1WFNA 5DFVD 1KFAH 4QGYA 5HPOA 4PJHF 2F53A 4TYUA 3STBA 1YEDA 5GGTH 5IHLB 1FVEB 3BN9D 2ADGB 4CADA 4PRHA 4LEOA 5C3LD 2GT9B 1YEHL 1VADB 5CZXC 4BYHA 1F4XH 2HFGH 4IIQA 3S36X 4GO6B 5K9OA 5JHDD 3VJ6A 5BS0E 3TIDB 1HQRB 2X42A 2VB5A 3KGRA 2M2DA 3P73B 3QJHA 1NL0L 1EEZA 1SJEB 5BJTA 3S5LB 1TZIB 3G6DH 3H9SE 1GYAA 3MRNA 2BY1A 1OTUD 4U33A 5BVPL 5C07B 4K3HA 3WJJC 2HVKB 2ZUXA 3NH7L 4JZJC 4Z7VE 2V2TA 1J86A 2Y6SC 1KCRH 1CE6B 2DDQH 3S9DB 1TTGA 2ZUVA 4KZEH 1QSFA 4R2GD 1N7ML 2ZZUT 3WNMA 3KPRE 3WL9A 4DZ8B 2AVGA 4JRYB 1H3PH 2CKNA 4Z7WF 5KS9B 4PJEE 2APFA 3UJJH 2BSTA 3VXRA 4E41A 5JPNB 5ISZB 2ZOLB 3HUJE 1RZFL 3CFCH 1AC6A 1AR2A 4HS8H 4LIQL 4R3SB 3ROLB 3WUWA 3CSPA 2K9UA 4GG8B 4JFHD 4K94H 4M5YH 2EH8L 4GAYA 2FJFA 4DFHA 5KSBF 5CCKL 4YDIH 3MC0A 3SE3A 5EN2B 1EFXD 1EERB 4EEEA 1CGYA 1AXSA 4L1DA 5F6IC 1IKFH 2EE3A 3Q0HA 3QAZC 5IBTL 3EYOB 5ICXA 4ZS7H 3I3BA 5D5MF 3BPNB 4KFZC 4NQEB 4Y16D 5EZIL 4IDJL 1D3CA 1K4CA 1K8DB 5CIPA 3DX6A 3B43A 4JFYA 4MNQE 2C3WA 2FEEL 4PJ8A 4I3SL 3FT4A 5MP6H 1HXYA 3WO4B 2A6JA 1RFDH 2APWA 2ZCKH 3A6BH 5FEBA 4CNIA 1MCQA 1H8OA 4AT6B 4HUVB 4E42B 2Q8AL 5IB3B 1DQLH 4LNRB 4S1SH 1S7WB 4DKAA 3FZUC 1G9MC 4YXHL 3ZE1E 3CX5K 3NBNA 3OB0K 2EZ0D 2V5SA 5JR1L 2NY0B 1WF5A 2BJML 5IVZA 1ITCA 1JF5A 1MHEB 1A7PH 1FLRL 1HHGA 4DKFH 2VXTH 1MH5A 1LO0L 2AK1L 2I07A 2FH8A 5E5MA 4KMLB 1T03L 2OXHA 4X4ME 4U6YB 1AE6H 4WW2C 1Y6NR 3MA9H 3LMJL 3R0MA 3QDMB 4HXAL 4F58L 1R24B 3OKMB 3JV0A 1J0KA 4WI8A 1QSZA 1Q0XL 4X4XB 3FN0H 1IFHH 4K8RD 3QEQA 3M1BA 4Y1AA 4LSUL 5SWSD 3QFDB 4OZFH 3O2VL 1T21B 4Y19E 2P5WB 4PJXA 3WUZA 5EIVA 4Z78A 1I8IB 4GQ9H 5DWUH 5F7LB 5E2UL 2MQCA 1HCVA 2ORBL 2EO1A 3L1OL 1ZGLM 5F6HJ 2EXYC 2CO6B 1UXWA 3MV8D 1U92A 3BRDA 2RAMA 3AM8C 3FFCA 4OZGE 3QH3B 1KJVB 5D7KD 1I3GH 1MY7A 5C6WH 5FYKU 2E9WA 3P77A 5K93A 3DIFB 1YQ2A 1MCWM 2VXVL 1ZOXA 2OQJB 4FQCL 1UCBL 4JAMB 4JQIL 3LIZL 4XVTH 3KPSD 5CINH 4ZNEA 2P44B 3NACH 3FOMB 1TJIH 5E2WL 5D96C 1MFAL 2X4NB 1FL5B 1L6ZA 4CVWA 4L3CB 5J1AA 5I73C 3U7AA 3EOYG 5BCAA 1LP9A 5FF6A 4HGMA 2Q6WA 4MVBC 4Q7DA 5FA4A 2D7TH 4PJDF 3MRLB 2HKHL 4KK9C 3QZWG 5TFSL 3U48A 4AEFA 4OAWA 2AXFA 1HSBA 2YPLD 4DEPC 1R3HA 4KVNH 3VRJB 2QADD 2CSPA 3LS4H 1MF2H 1G6RA 2WBJD 2YD4A 2VTFA 5MENA 3UTSB 1T5WB 3MRCA 4PJ7B 4WJ5B 5TE4H 3VFUA 3ECBB 3P9LA 3MLWL 1T4KA 2XG5A 3LB6D 5CGYC 5FOBA 3SE9H 4XNZC 1FC1A 1ZT1A 1U6AH 4O9HH 1OP3H 2OI9B 2FWOB 1PDKA 4U3CA 2XWTA 2FATL 4OLUL 3I50L 3MBEC 4LQFL 3ELAT 2DF3A 1N59B 1XF4A 1CXHA 4MSWA 4R90H 1EGJA 1YEDB 5EO0A 5C0DA 2ZUYA 4CADB 4PRHB 4LEOB 3IDNB 3MRKA 1SVZA 2VZ1A 4KI5C 4IIQB 5K9OB 1FPTH 3VJ6B 2IGFH 5E6IC 3ESUF 1JPTL 3UTPD 5IESH 3LRSA 1KJ3L 3VGEA 3QJHB 2ICES 5C0IA 1EEZB 4XAWL 4WCYH 5BJTB 5GRJH 4JPIA 4YUEL 4LCWE 2YS4A 4X98A 5TE6L 3SDXF 2JJUA 3CDCA 5GS3A 4OJFL 2G75A 2DB8A 1YEFL 4NP4L 4RMSA 1ZANH 1INQA 3ULUD 2V2TB 1C5CH 2PYFA 5GGRB 3ULVL 1BQLH 2J3SA 5FHBL 2HMIC 1BWMA 1P69B 4P5TA 2VWEC 1QSFB 4PRAB 3WL9B 5F1OB 2MTPA 4BFEA 5DJAB 1BJ1H 25C8L 3U4BH 3VXRB 4E41B 1IGTA 1C7SA 1KBGH 1F2QA 5J11C 1CXKA 2VDQH 3WUWB 1S7QA 4HF5L 4GAYB 2FJFB 1YDPA 1OHQA 5BV7B 1FDLL 3K8LA 4ENED 1QSVA 3VXUA 4FFWD 1NFKA 5H8DA 5ELIA 5T5NF 1HH9A 1JHLH 4MXQC 4YE4H 1AXSB 5FM4A 2Q8BL 1NMCB 3T2OA 3ALWA 4DFIA 5ICXB 4LL9A 1I1CA 3NCEB 1WVZA 3ZKMC 1K4CB 5CIPB 3ARGB 3DX6B 4JFYB 5T3ZD 3EYVA 3GIZL 4PJ8B 4WHDA 2OBGA 5C0JA 1J1OH 1HXYB 1M7XA 2A6JB 3QUMH 3RWIB 3WSQH 4CNIB 3QUZA 3EZJB 3TZVD 3PGCA 5FV2A 4PIRF 1KN4H 3OWEA 4K9EH 3HI1A 5B21A 2XQBH 3DWTA 5J13B 3E3QE 1BOYA 2X4QA 4NCC2 4BK5A 1RUKH 2ADFH 3EBAA 3GKWL 3QPXL 1HHGB 2C3XA 1UZ6E 1A0QL 3NVQA 3BEVA 1MH5B 1PEZA 2R0LL 4Y88A 2I07B 5E5MB 2WP3O 3PWPD 1HZHL 4V1DA 5JOPE 1HEZA 2R2HA 4WGVB 1Y6MR 3MLPA 2RQ8A 1JJUA 5IHUL 4NN6B 2LQRA 4BH8A 1HYSD 1GGCH 1VGEH 3HNSL 4RFOH 3QEQB 3M1BB 2FDBP 4Y1AB 1E27A 4JRXD 4HC1L 4PJXB 4J7RA 2MMXA 4Z78B 3DV6A 1FH5H 1OPGL 3S4SG 2ZKHL 4M7KH 2IG2H 4GRLA 1UXWB 3ZMRA 2DLGA 5F9JA 4OLZH 1U92B 4FG6D 3DO7A 1CFVH 4P2OD 3MGTA 3SGDI 3FFCB 1E0OB 5FUCC 5IROC 1MI5E 4L4TD 2XTJD 1XGRA 3QRGH 4GSDH 1QBAA 2VERN 3MODH 3P77B 3V6ZA 2IPTL 4N1CA 2A73A 4YBQC 1AD0A 4JZOA 3BJ91 1F4WH 1HHKA 3PDDA 2LU3A 1HKLL 1L7TH 5J1AB 5LGKA 5FF6B 1LP9B 3WDJA 2Q6WB 2EO9A 4OKVA 3BPNC 5FA4B 2YN3A 5GGSY 1MFBL 5E08H 4ZPTA 4K3DH 1MFCL 5JHDA 1QR1A 4OLXH 4OAWB 1U8NA 4CMHB 1HSBB 4C57C 2OZ4L 4KMTL 4D9LL 1OW0C 3MOQA 3QEGH 4F7CA 1G7JA 3WO4C 3MRCB 5ALBH 3VFUB 1MOEA 4PPTA 3P9LB 5TQ2L 4N0UE 4J3XA 4GRWE 1T4KB 5FOBB 4FP8H 5C07E 4RMWA 3NCBB 1RV6X 3H42L 3DYOA 5FDYA 1F90L 1ZT1B 2VDNH 2J2ZA 4D0CA 2NY0C 5AAMA 2XWTB 1P4BL 5F9WB 2OS7A 2IPUG 3CVIH 4QRTA 4NZRH 4UV7H 5KS9E 1KEML 4P3CH 1MFNA 2DM2A 4YO0A 4ODHL 4EDWH 1XF4B 2QR0A 4MSWB 3H3PL 1PVHA 4AEIL 1QP1A 4EKXA 5EO0B 5C0DB 4X6CF 1YQVH 5HI4D 1SM3H 4G5ZH 3BMWA 3FB5A 1S5HA 1INDL 1XR9A 5JW3H 4GMTH 3MV7B 1MCRA 3V0WH 5IGXH 2JCCA 2HTLD 3LRSB 5C0IB 4M1GL 3BYTA 5E5UB 1BZ7B 5E1AB 2BNRE 1EFXA 4ETQA 5HVWA 4JPIB 4PJCA 5JO5A 1VKXB 5I8KH 4NWUH 1XCTA 4A6YH 4X98B 3ZTJG 2XTLA 4HCRL 1AHWA 2G75B 1OVZA 3FCTA 1FYHB 1GXEA 4QYOA 2PYFB 4FMFA 3WD5H 3TFKC 2BSED 4Y16A 2VXSH 4P5TB 2BERA 2OR9L 3PQYD 3RVVC 4JHAL 1A6ZA 4TOYL 5KVGL 1W72L 5FYKH 3VGFA 4Z77A 3MGAA 4ZFZB 5HGDA 1YMHA 4KHXL 2X7LA 5D7JC 1MREH 5I1KL 4OZHE 1IGTB 4LSQH 3CLFL 1Z0NA 1J9CT 4M1DL 4EOWH 1T22A 1S7QB 1EHLL 3R1GH 1JZ3A 3SQBA 1YDPB 5D71L 5CAYB 2HG5A 5ID1A 4JHWH 3VXUB 5C9JA 3P2TA 3KLHD 4HMCA 3EDEA 1I3VA 2UWEA 4H1LG 1T2XA 2Z8RA 1HH9B 3V9FA 5D7SL 3TO2A 1UC6A 1L0YA 4BFBD 4NFDA 4HEME 1TCMA 2AGJH 3IGAA 5I15L 5F89A 3QDME 3MX0A 2Y06L 5CEZE 1T66C 3EJZD 3B4NA 4Y89A 5IF0B 4OCRL 2R9HD 5I1IH 4EDXA 3EYVB 4WNQA 3ULVF 3S35H 5SWSA 3S4SA 5ADOL 5C0JB 3S8WA 2HH0H 2Z93B 2OI9C 1IC4L 1QOKA 2NR6D 3QUZB 1I9EA 3PGCB 1GHFL 4PBWD 1QEWA 3BRGC 2W59A 3HI1B 3SQOH 3MXWH 3C8KA 3MV8A 1OSPH 4UAOB 1QBLL 4NQCD 1KC5H 2X4QB 3DOSA 2ESVE 5EWIH 4NM8H 1A7RL 5D72H 3NPSC 3BQUD 3BEVB 4WFHE 4IIQC 2R2EB 3VD4A 2N7AA 1KIQA 3RVTC 1QVOA 1G6VK 4LLUA 1AXTL 1PLGH 4UILL 3KPSA 4PS4H 4V1DB 2HTKD 1CXLA 1FORH 1HEZB 2R2HB 4EVNA 1FGNH 2VSDA 2E9BA 2HFEA 3EHBC 4X6FA 4BH8B 2HWZL 3GNMH 4ORZC 5DFWH 4MQXC 1VEOA 1E27B 1J12A 5LCVL 3DV6B 5IVOA 1NCDH 4XRCA 4D94A 4KJQC 1VFAA 2YPLA 3QG7H 1FG9C 3NA4A 2XZCH 2WBJA 3RA7H 5C0CE 4GRLB 5F9JB 2NCMA 1JUFA 4RISH 5DJ2A 3DO7B 1U3HD 1MFDH 2G5RA 3MGTB 4ZO9A 2CKBH 1PW3A 4BFIA 4M6MH 3BN3B 1QRND 3QDJD 4NNYA 2IBZX 5J8OA 1XGRB 3ARED 1BREA 3DTXA 4KAQH 3P30L 4PGEA 2AW2A 3V6ZB 1L0XA 1A64A 5BV7C 2BRQA 2A73B 4LLWA 4POZC 1AD0B 4Q2ZA 3SDAD 2DRUA 4JZOB 3SE3C 5K9QI 2CK2A 1HHKB 4ODTL 4NC2B 1A14H 4OCSL 2F53E 3EDDA 1UVQA 2RHEA 3PV6B 4HFWA 3S88L 5ICYA 3G6AA 1R0AH 1MCEA 4OKVB 2IEPA 3W2DL 4ZPTB 2VDML 3BOVA 4N90D 4RNRA 1BEYL 1QR1B 3ARGC 1U8NB 2VQTA 3LD8B 3HAEH 3S35X 4C4KO 3EYUH 3QJFA 3GBNH 4PJ8C 5LVEA 1HH6A 5I1AA 4PTUA 4F7CB 1G7JB 3DXAE 4NKIL 3ZT6A 4QTIL 1T83A 3KPMA 4PGDA 2A0LC 5FYJD 5K9KA 3DBXB 4OD1H 2CGRL 3INUH 3V7AG 3TO4D 3H9ZA 2AK4D 4D0CB 5K9JL 3P0VH 2PYED 2D4FA 4QRTB 4UQ2A 4XTRC 1WWWX 3V4UH 4YO0B 4TPRL 5D93B 5D1ZD 2QR0B 2PTVA 4MJID 2OJEA 3O11A 4KRMB 4NKDB 1ZXQA 1D5IL 2FJHA 4PV8A 3X3FH 4YIQA 3OZ9H 4NZDA 4PJHA 4XBPA 2EKJA 2FJGA 1YEKL 2FIKA 2OMNA 3FB5B 1S5HB 2EEBA 2ZNWA 1XR9B 1YEEH 3NIFE 1FIEA 1YMMD 2FB4L 2WWKT 3UTTE 4RAVA 2JELL 4G6JH 1JNLL 3HR5A 1EHXA 4H1LA 1QQDA 2XQYK 5MI0B 4PLNC 4M7JL 4Z0BL 3KG5A 3C6LD 4I3RH 4ETQB 5JO5B 4PJCB 4JO4L 4TVPL 2DQCL 1XCTB 4OZIF 4D3CL 3KXFE 2DQGH 3FCTB 1CWVA 4MZ3A 4QYOB 5GS2D 3JWOH 5L7XL 4HUNB 5AWNH 1TFHA 4OB5H 3MLVL 3ZYIA 1NH6A 1I9JL 4JKPL 1CK0L 1MCBA 3ZL4L 1A6ZB 4MDJB 2Y36H 4OF0A 1TVBA 3FN9A 3DRTB 4Z77B 4OFYD 4KK6C 1OAKH 1QSEB 2BNQE 4WEMB 3TZVA 3WO3B 5HGDB 3TT3H 1YMHB 2FR4A 2X7LB 4LKCA 2GUOA 4M7LL 2NY6B 1YNTA 4L8SA 2VLRD 1T22B 2VDLL 2WWMD 2XT1B 1MCIA 4NCC1 3BP5A 3CXHJ 4JY4B 2HG5B 3HN3A 5ID1B 5C9JB 4M7ZB 5JA8B 5DZLA 5HDQL 1FIGH 2UWEB 7FABH 1UWEH 2N4IA 1IC7H 5DRWA 1O7VA 4PLKD 5GRWA 3WFEL 3E8UH 5AZ2L 3PWPA 2OTPA 4W68A 3TO2B 2YD6A 5F3HA 3GJFH 4HKBA 5ECJE 1IL1B 3QCTH 3IGAB 3QQNA 5F89B 1X3DA 3U7WL 4K55A 4ZNCD 3NIDE 3T09A 4ACPA 5F7EL 4GXVH 3RNQA 4XMKL 2XZQL 3EOBA 4EDXB 2M1KA 4OQTL 4WNQB 1YN7A 2VAAA 3QEQE 5ERWA 2ED8A 2AJSL 4JRXA 5SWSB 3S4SB 3FFDA 1FAIH 2P42B 3FQTA 2AJVH 1U8KA 4PJXE 1K85A 2A9MH 1RUQL 3F58H 5F9WC 3BP4A 1QEWB 4IS6A 3W9EA 1YEIH 3OAUL 3HI5H 1UG9A 3C8KB 3MV8B 2B1AL 1AD9A 1M71A 4P2OA 3GSQB 1HNFA 3FL7A 4DCQA 3FFCE 2MCPH 3CXDH 3EJJX 4HUUA 4L4TA 4M48L 3S97C 3KJ6L 4XX1G 3TCLA 1NBYA 1BF2A 4PREA 4RX4D 5JIIA 1UA6L 1KIQB 2CRIA 1QVOB 5ESAA 3K80A 3GRWH 4XP5H 2FX9L 4G8EA 4LLUB 3FHQA 3KPSB 5KZCD 4EVNB 2ED9A 1YJDH 4X7SH 3EJYD 4X6FB 3O81A 5GGUA 3OQ3B 2O61A 4MLIA 2G60H 4HG4J 2KZWA 1LP9E 1WTGT 2LU7A 5FUOL 1CTOA 2X1XR 3MJ9H 3PIQA 4P5TC 2YZ1A 5TE7H 2J88L 4XRCB 1VFAB 2YPLB 2Z4QA 4OQ1A 3VFSA 2QADB 2WBJB 3MCG1 1CCZA 2CK0L 2XRAL 5MENE 1JUFB 1OP9A 5DJ2B 1TVHA 4P2RD 2R15A 4ZS6C 3UROR 4QKXB 4BFIB 3E2HB 1RUPL 1KPRB 1OWWA 4OD2A 4NNYB 5ITBH 1RZ7L 3PDGA 3DTXB 4X7CC 2E5EA 2B7DT 4PGEB 2YUZA 4U3XA 2G9HB 5HHXL 3K8KA 3T2QA 4LLWB 4Q2ZB 3CX2A 2NYYC 2NY5C 1KTLA 1PKQA 3MV9D 1UT9A 1NAML 1T89C 4IOFC 4LSPH 4PJBA 4EUPG 1LO2L 4GKZA 4U4BA 2FD6L 3G6AB 1RK1A 2IMNA 5KVFL 4K3EH 3GSNA 4HLZG 4WI7A 1T1YA 4RNRB 2Y5TA 4PJDA 4U49A 1JTTA 3PL6C 4Z7OF 1NL0H 3F62A 2VUOA 3QJFB 5ILTL 2ZCLL 3TNMB 1HH6B 5I1AB 1FFPB 1X6NA 3KPMB 3QUZC 4CU7A 4PGDB 4PJAF 4CDHA 4HGWA 3NH7H 1SJHA 5K9KB 2VOTA 2GJ6E 4UAOC 2WINA 5MHSE 2E6PA 3PQYA 2DQUH 3ZDYF 1J0JA 4UQ2B 3NCCB 5DC4B 5EZLA 4L5FL 2OL3A 3OKKA 4NN7C 2DM3A 4LP4A 4RAHA 2OJEB 1C5BL 3O11B 4YC2B 3VFNA 1OQOA 4MA7H 2FJHB 4PV8B 4UOW0 5HI5C 5L88L 4YIQB 2FJGB 1XF1A 2DLHA 4I48A 4LIQH 5I30H 2X4OA 3JTSA 3D9AH 3TVMD 5F93C 2ENYA 1U8JA 1UJ3A 3G5YB 3QI9D 1QLEL 4RAVB 4QRPD 3CK0L 5CCKH 3ARZA 3HR5B 5B39G 1QQDB 2XICA 1T6VN 4LMQE 1NANH 3F7QA 2HP4A 2DQDH 5IVXF 1LWRA 3LRGA 4HLZH 4FQLL 3EZ8A 3RVWD 1I8LC 3BSZL 3LKRB 4WUUD 5JW4Q 3D6GA 1HILA 1ZWIA 4GRLC 5TF0A 4XNUH 4IDJH 1PG7X 1GGUA 3I75A 4KWUA 3E6HA 3K74B 4PJFA 1P53A 3MYJA 2CD0A 1S78D 5C0FA 1TVBB 4I3SH 5FKPA 1JVKA 3TZVB 2FR4B 2EE9A 5LBSL 1NEUA 4BA8A 4YXHH 1VPOL 4RRPG 4LKCB 2GUOB 5IK3A 5DJ0A 1I1AD 4L8SB 4ZODA 1IRAY 5JR1H 4O4YL 4NQCA 1SEBA 3BP5B 1H0DA 3UBXI 1K4DA 2BJMH 1H9VA 5E2VH 2DLFL 2M26A 1LHZA 1S7SA 3BQUA 4OGXL 1LO0H 2YXFA 3MRBA 1ED3A 2FBJH 1GZQB 5DRWB 3CMGA 5JORA 1JZ4A 1G0DA 2DQEH 2ZUWA 3LD8C 3PWPB 4POYA 4JKLA 4NJAL 4XAKE 5F3HB 4HKBB 4GKNB 4HXAH 2E3VA 3ARXA 3HE6D 4S1RH 3MUJA 3CJJA 1OTUC 5GZND 1Q0XH 4QTHA 2ZPKL 3RNQB 3EOBB 4LVEA 1MUJA 1YN7B 5ERWB 2YD2A 4JDVA 5F71A 3B8SA 4JRXB 3O2VH 3FFDB 2E8YA 3FQTB 5F96H 2C1OA 1IAOA 1U8KB 1QFUL 2C26A 3ZT5A 2ORBH 3BP4B 3FONA 4YQXH 4IS6B 3W9EB 4X7EC 1DFBH 3HLAA 5D93C 2D3VA 1AD9B 5B38G 1M71B 1U3HA 2X4UA 4DCQB 2QQLL 4KRPD 1QRNA 4A2MA 4JDTL 4ZOBA 3QDJA 4HUUB 4L4TB 2XTJB 3AREA 3RRQA 4OGYH 3ARBD 5T5FH 3TCLB 1NBYB 3KR3H 4UMGA 4PREB 3VXTA 1GH7A 2VXVH 5ESAB 4FQCH 1UCBH 4G8EB 4JQIH 1LEGB 5MI0C 4XMLL 3SDAA 4JFOA 4EUPA 1NBVH 5DI8A 4YLQT 5GGUB 2O61B 3JWDH 1N4XL 2GJZA 3MV01 2ITCA 5LQBL 1BZ9A 3CXHK 1GVIA 4M3JA 1ACZA 1VFUA 5HXMA 5TFSH 3PIQB 4F3FA 1NLBL 2O26U 5JHDE 3CIQA 1G9ML 1MHPL 1RIVH 2Z4QB 2XZZA 4U2YA 3VFSB 4LGSB 1JZ5A 1A3RL 3BZDA 3LQMA 2O5XH 2J8UF 3HC4L 4FTVD 4Y4KB 3QIUD 2YD8A 4OD2B 4U1LA 5GISH 3S37L 3PXHA 2NY6C 4J3TA 2EZ0C 5HDOA 2W9DH 5IOPA 3TO4A 4KXZI 4YFEA 2AK4A 4XXCA 3S3PA 5KJRL 2FATH 2PYEA 3GUTB 4M7ZC 3IDUA 3ZT7A 4JGJA 2XNAA 1I1YA 1KTLB 1PKQB 3MNVA 4J2XA 5D1ZA 1IGMH 2GAZA 4MJIA 3UJIH 4PJBB 4N1EA 4XP1L 4GKZB 1WBXA 1UWXK 1X5GA 2EE2A 5GGTA 1RK1B 1ZLWH 1X5LA 2H41A 3BKML 5HPMA 5IFHH 1B4RA 3GSNB 4X6DF 5IQ9A 1T1YB 4OLYH 1Z0MA 2Y5TB 1YMMA 3IETA 3O4OB 2XG4A 4YZFF 1JPTH 2JCCE 3M45A 5HJ3A 1F5WA 1R3JA 4Q9BA 1ULVA 3C6LA 4NO3A 2JLLA 4NT6A 2PCPA 4OF7A 4PJCE 3LEXA 3PP3H 2BX5A 1BFVL 1DL7L 2ATKA 2CUHA 4HG4K 4OJFH 1YEFH 1U8PA 2F5BH 4NP4H 1SJHB 1W0WB 4TNVK 3ULVH 2HN7A 3GI8L 3IFPB 2CUIA 2WINB 3AS3A 3OR7A 1MVFA 4ONHA 5ACZA 3PQYB 2F19H 1KGCD 4NCDA 5CSGA 3GFUA 2VITB 3PP4H 2OL3B 4JVPA 3OKKB 5I75C 3MOBL 4OFYA 2P1YA 3VFNB 1W0VA 3VFGL 2FLBT 5HSFA 4RRPA 5EBLB 4U0RC 1II4E 4I48B 1NBZA 5AYUH 2X4OB 3JTSB 1C8PA 4PGJA 4IM8A 2VLRA 5FYLL 3IKKA 2XA8H 4PLOB 1U8JB 1UJ3B 4P46D 1CU4L 5GGRY 3SN6N 2YRLA 2H3NA 4DOHE 1AFVL 3HCVA 2H6PA 2C3VA 4AY0A 5C2BL 1J0IA 3GBMH 1G7LA 1RUAL 3DGCR 2Q8BH 4OF8A 5FA3A 5JIKA 4LLQA 4GT7A 1JYNA 2QADC 5I16A 4TNWK 4XPBL 3HPLA 2IC2A 2WBJC 1HILB 3NABL 2AEIT 8FABA 2D03L 2X9WA 5DD1L 3Q6GH 1A6WL 3LB6C 3E2HC 1T7YA 3E6HB 4WTZG 3KJ4B 4PJFB 3MYJB 4NRYA 5C0FB 5SWSE 4TQEH 5FKPB 3CD4A 3TESA 4J3SA 3ISWA 5B38A 2KDGA 3DVNA 5IK3B 4XNYH 2VKWA 3LV3A 3MV8E 3GM8A 4NQCB 3C5JA 4NKOA 1SEBB 1H0DB 5KVDL 1K4DB 1RURH 3QPXH 3VW3L 5TQ0L 1SJVA 4LLAA 3D39D 1SEQL 1I85A 3BQUB 3V6OE 1N6QH 5LAXA 4QXGL 1X4YA 2R0LH 3WLBA 1ED3B 5EBGA 4RX4A 5JORB 5F1SA 3B3IA 2DL2A 4FRWA 3RUGA 1PZUB 2VZ3A 2F5AH 4X9HA 1U8LB 4N0CD 15C8H 1B2WL 1JN6A 1Z6JT 4XC3H 1T83C 1KIPA 4QTHB 5FFLA 1OAQL 4Z0XA 1MUJB 4BJLA 1W2KT 4WO4D 4JDVB 4S0SD 3ULUC 1DQMH 4LPYA 1KYOJ 1IAOB 3P11H 4PYHA 1OPGH 4BQ9A 5C9KA 3EGSB 4NUJA 5KSVB 4MD5B 1YC7A 3FONB 4OIIL 4ZUSA 4GAJH 3KYKH 3HLAB 4DZBA 4OT1H 1QR4A 1V5JA 1RULL 5IFJA 3GO1L 1IAKA 4YC2C 1U3HB 4P2RA 1CT8A 2X4UB 5FYKE 4OIBA 1LVEA 5CJBA 2V2XA 1QRNB 5HYFA 2EDQA 3QDJB 1F6FB 1JMXA 3AREB 4X80L 5HYQA 5AG8A 3OB0H 1MWAB 1RJZA 1LO5A 3VXTB 1JGLL 2VL5A 1QO3A 4UDUA 1MJ7L 3L3IA 2W9EH 4ENEC 3QQ9D 1LE9A 4JFOB 4FFWC 5F9DC 4EUPB 3MV9A 4RFEA 1H3UA 1KCVL 3UPRA 1HKLH 2K1MA 2X6MA 4TVPD 4Y0GA 1M1SA 1QRKA 1S7VA 3BKJL 3ZE1F 2ITCB 3V5DA 3IVKA 1BZ9B 4QXUL 1O5DT 3T0DA 4MS8D 2ZG3A 1Q1JL 2RB8A 3DMMD 4L3AA 2MWCA 1CD8A 2OZ4H 4KMTH 5DMKA 3DVFA 3UTPE 5HYEA 1U8QA 3RNKA 2W1NA 4H88L 1NDGA 4NBZB 3JXAA 4HJJL 5H37H 2VN7A 4MZ2A 1UB5A 1ZLVK 4X7DC 1EVTC 4FQXD 5L0QB 2A2QT 3QWRD 4U1LB 2YA0A 3FO2A 1F90H 4L8SC 5IOPB 3S3SA 2NXYC 2JF1A 3QIWD 1CLYL 5IB2B 2PYEB 1KEMH 1QNZH 2CJUL 2XNAB 4ODHH 1I1YB 2P48B 3NFPA 2GAZB 3H3PH 4MJIB 3C9NA 2XKUA 1WBXB 1A6VH 5FK9A 4PJHE 5T33H 3MRJA 4G8IA 4ODXA 4JFDD 1INDH 3S3JA 4WU5A 3DECA 3IF1A 5IQ9B 3O6LL 3TVMA 3KPQA 3W11D 3FHAA 5C09D 1QFPA 1ZHKA 4OZGF 2B0SL 1YMMB 3IETB 1HYSC 3QI9A 4QRPA 2FECL 5HJ3B 4OM1H 5C0AD 4GG6A 3JWNC 1R3JB 3SGJA 3C6LB 2ZNXA 4NO3B 3O3BA 4NT6B 3LQAH 1WFTA 3RWEA 12E8L 2DBLL 3LEXB 4HC1A 4WUUA 4HCRH 1BPVA 1D5BA 2ATKB 1U8PB 4LPTA 5JMOC 2OTWA 3WHE1 1FGVH 1J10A 4WTZA 1N3NA 2OR9H 3OR7B 4ONHB 3AB0B 2VLKB 3FOLA 4JHAH 3UDWA 3F6IA 4NQDD 2R0KL 2XTJC 4TOYH 2OP4L 3CSYA 3OKNA 1W72H 4ONFL 1CQKA 4N0RA 5FKAA 4Z7WE 2FHFA 3GM0A 3S6CA 1W0VB 3MRIA 4I13B 4KHXH 4NO0D 3T0WA 1MIMH 1L0QA 1NBZB 2H9GB 5GXBB 2EEAA 4G8GD 4M1DH 1I1AA 3E6FA 2VLRB 3MLZH 1EHLH 3O2DA 3C2SA 1FJ1A 2VQ1A 1KJ2H 3A0OA 4NZUL 2H3NB 1K3ZA 4C56D 3HCVB 2H6PB 5B3JE 1K9TA 2V5TA 1A9EA 2BVEA 1G7LB 1MRCL 1FV1A 5D7SH 5FA3B 4LLQB 3G04B 3N85H 3D0VA 5I16B 5FECA 3HPLB 1FFRA 4WEBL 2EYTA 5A40E 8FABB 3HE6A 4O51A 5D5ME 1X5IA 3JV5A 3ESVF 4Y4KC 3MO1A 2FX8L 4NRYB 1E4XI 1OD9A 2CUMA 4JRXE 5ADOH 3T04D 4LASL 3EKCA 1IC4H 3WFDH 2NLJA 1GHFH 4LSTH 1OGTA 2YWZA 4O5LH 5B38B 1MCLA 1OCWL 2DTML 1QBLH 3LV3B 1T5XA 2EECA 1C1EL 2V9TA 4NKOB 2X40A 5HI3D 3F8UB 1A7RH 5HI4C 3QB7C 1XGPA 3SGEI 4KKAC 2VJXA 4Z8FL 3ULSA 3ARBA 5LAXB 3WLBB 1RVFL 3O4OC 3B3IB 1YPZA 3RUGB 2HTLC 4XZUA 1AXTH 4UILH 2VR5A 5DJ8B 3W0WB 5KZCB 4KUZH 1ZLSH 3U0WH 1JN6B 1SYSA 8CGTA 2AABH 2EDWA 1KIPB 4NQUA 3BRFA 4Q58C 4EBQL 3U36A 3L7FA 4Z0XB 3VFOA 2PO6C 5I1LA 1CLOH 2NY7L 3QHFL 5LCVH 4Q9QH 5EA0L 1SHMA 3GMNA 2CLZA 4NUJB 3LDBB 5HVHB 1YECL 4ZUSB 1MHHA 4DK3A 1ZLUK 4DZBB 2BHYA 2DIBA 1JIBA 4OCXL 5IFJB 1IAKB 1IGIL 4DVBA 1Y18A 4P2RB 1CT8B 3U9PL 4FTVA 5L9DH 2V2XB 3MRRA 1KULA 4KI5F 3V7AE 2GY5A 4OCLC 1FE8L 3QIUA 4L4VD 3OJVC 5HYQB 4HMDA 1RJZB 1LO5B 1UJ3C 4UT6L 2VL5B 1BFTA 2N1KA 4UDUB 5L6YL 3L3IB 5D4QA 2FEDD 1LE9B 4LK4A 4IHOA 3KLHC 1NFDA 4QHMA 5IR1A 3MV9B 3CDGA 2RIKA 4OCSH 5I1HL 3UPRB 3UMTA 3FO0L 1QUNA 4PJBE 2O5ZL 3S88H 1T0NA 4QNPE 1S7VB 3CU1A 3V5DB 3IVKB 2XPGB 4LCUA 1QFHA 2VXUL 3B9DA 2VDMH 3EJZC 4PJDE 1LO3L 4PJIF 1UZ6F 2XXMB 4JG0L 2R9HC 2E7LC 3KJ4C 1U8QB 5F72S 4GW4A 4J1UA 1NDGB 1CVRA 3ZHDA 4QTIH 3VH8G 4S11A 4R7NA 4XXDA 1URLA 1FP5A 2MQ3A 3B5GA 2UVEA 2CGRH 3MLSL 1EMTL 1KYOK 4MD0A 1X4XA 35C8L 3B6SA 3LPFA 5K9JH 3PQYE 4WU7A 3VMPA 1IQWL 3BQUC 5CSBA 2O93L 5DYOA 1WFOA 3NFPB 1HQ4A 4QHLA 4UQ3A 4XBGA 3C9NB 4WRLA 1D5IH 3PUCA 3X11A 3OKEA 4MXVE 4MNHA 5FK9B 1MQKH 4G8IB 4ODXB 1F00I 5T3XL 4WU5B 3IF1B 3TVMB 1OP3K 1ZHKB 2FB4H 2JELH 1F4YH 4P46A 4ZO8A 4DN4L 1JNLH 4I0PD 3LPGA 3SJVD 4XVSL 1JNNL 3MXVH 4GG6B 2N56A 2YUXA 4LLDA 4P9HC 3O3BB 2X05A 3RWEB 1J8KA 5CMAB 4WUUB 2CIKA 1D5BB 4XVUD 4UT7L 2OTWB 2V7NA 4YXKH 4DK6A 1RZKC 1G7HA 4PJ5D 1N3NB 2AEQL 1U3HC 3FOLB 4F9PA 1I9JH 2V5MA 4JKPH 4QHKJ 4LCCA 4XP9H 4PJFE 2MHAB 3AREC 3NTCL 3CSYB 3OKNB 3RX8A 5I17A 5F8QC 5FKAB 3F6LA 1I1FA 2WZPD 3TH2T 3TV3L 1IAMA 1GGYA 1G0YR 3BH8A 1P7KA 3ZKND 3ARPA 1A7QL 1A3LL 3GMPA 4IDLA 1I1AB 3E6FB 5HHMD 1FJ1B 5CZVH 2VQ1B 1LDPL 2IALA 4JM4L 1CYGA 2WLZA 3D39A 3TCXA 1A9EB 3OTTA 1FV1B 2EDXA 5KS9F 5AZ2H 1T1XA 3D0VB 3FZUD 3U46A 2ITDA 3L5XL 3MJ7B 3U7WH 3HE6B 3FB7A 4O51B 5HYJE 5BXFA 1KTRL 2VDOL 1IBGL 5F7EH 4JFZL 4XMKH 1JPGA 3MO1B 5L0QC 4M4RA 4OQTH 2IFFL 3LRHA 3JV6A 4HWBA 5E7FA 5A1AA 1UM4L 4WO4A 1RK0A 1DQQA 1DN0A 1RUQH 2NLJB 2CDFA 1OGTB 1Z2KA 4DGYL 1IEAA 1GPOL 5DRNB 1ROWA 1AI1L 4I77L 1T5XB 3S96A 3SGKA 4JO3L 2QKIA 5ICZB 1TJGL 4KRPB 3RWCA 1XGPB 4M48H 3RZCD 4W6XB 5MERA 3ULSB 1KUMA 3CGTA 5GJSH 1BQUA 3SKUD 4NOBA 1NCWL 3WFCH 4OFDA 4LIQE 2F54D 1YPZB 2Y5EA 1KENL 4XZUB 2B2XH 4ZO6A 4UB0H 3C6LC 1CDGA 4FQJL 4JR9L 3RWDA 3HMXH 1SYSB 1NLDL 4JFEE 4U7SA 4OZHF 2Q1EA 2EIBA 3OAYK 1SMOA 3ARUA 3U36B 3LKOB 3HZYA 3VFOB 5I1LB 1Z9MA 1GOGA 3UPAA 1N6UA 3AB0C 3DMMA 2J88H 3GMNB 1VEMA 5CILL 3PJSA 2CLZB 1EPFA 3VH8A 1MHHB 3RBSA 4L3EE 2XRAH 2CK0H 2A6KA 3DI2B 2B5IB 1N5YH 4TNVF 3TBTA 3BH9A 2IBGA 4WGWB 5F7NC 5IW6A 1RUPH 2CMRH 3HC3H 4FTVB 5JNYA 4FQXA 4MVBD 3QWRA 3QIUB 4YHML 4KTDH 3V95A 4DTGL 4WHYG 4I4WA 3V6FA 1U41A 2WWMC 3QIWA 2AK4E 1MCDA 1MFEH 5F7FA 3KYNA 4XPTL 4RIRA 1RQ5A 4IHOB 1NFDB 4QHMB 5IR1B 1AO7E 3QXVA 1VB9A 4ZAKD 1QHPA 5EPMA 4TUOA 2X4TA 4N8VG 1T0NB 1HINL 5CGYD 4PLKC 5KVFH 5E95B 1CQYA 4LCUB 4I9WD 3TT1L 4JFDA 4DGVH 2H26A 1MLCA 1I3RA 4YFDB 3EO1B 1CFTA 5C09A 2CR3A 2QHRL 5SV4A 4PB0L 2W07A 1Q0YL 2X4RA 4MAUL 5C0AA 3BWAA 4GW4B 2A1WL 4J1UB 4TNWF 1EGJL 1QA9A 5IJVA 4KV5E 2PTUA 1IZJA 4R7NB 1MCSA 4XXDB 3ARFD 5A2JH 4OLEA 3SEPA 2Z92A 4NBXB 3WJLA 4JPWL 3UZQA 5E8OA 4RWYL 4ODUA 2IH1A 4MD0B 3N9GL 1A4KA 3B6SB 3SDYL 2WSKA 4WU7B 1EHAA 4IMLA 4NQDA 2VDRL 4XNXL 1I85C 3SE4A 4JREB 5DYOB 5H2BA 3O3EB 1HQ4B 4UQ3B 2GSIA 4TN9A 1DQJA 2BHUA 3D18A 2PF6A 4WFGD 4UT9H 3EAKA 3UEZA 3X11B 2H8PA 1C12A 4NO0A 3OKEB 4MNHB 5A2KH 2Y07H 3QUXD 3HG1D 1GAFL 4PJ7F 4G8GA 4X6CE 2DI7A 3EJYC 4BQ6A 1T7XA 4HKJA 2OK0H 2R69L 5EOCJ 3Q1SL 3HRZA 4J4PD 1JGUL 5GS1A 3PGFL 4B5EA 4C56A 4LLDB 1NGYA 1L9NA 4FQLH 2HT4D 4N9GB 2ADIA 2YC1A 5D7IA 3UTOA 2CIKB 3IU4H 3BGAA 3FMGL 4HUWA 3LDBC 5HVHC 2V7NB 3I02A 1G7HB 1YZZA 4YHIA 3OAZK 3RGHA 4K7PY 1MRDL 4G7YL 1U3JA 3VE0A 1OAYL 4ZTPH 5DUML 4HWNA 2R1YA 1H3TA 1K8IA 4HHAA 2NY5L 4LCCB 1EDQA 1JZ7A 1WITA 3TIEA 5DJCA 4PRPE 1AGCA 4U6HA 3WDIA 1I1FB 5F7WC 4R8WH 1OTSD 4KQ4H 3DO3A 3BH8B 3W9DB 1P7KB 2BHZA 4Y5XA 4ODVL 2FHCA 3GMPB 4I2XA 3VG9B 4O4YH 3EFDL 3CUPA 1NAMA 2IALB 3FQXA 3LVEA 3MUGA 2CPCA 3D39B 5C7XL 4OSUL 4YHPB 2WBKA 1AJ7L 5DHXB 2JJVA 4H20L 4JVUA 3VXNA 1T1XB 1OARL 2IPUK 4NJAH 4L9LB 3KPPA 1FO0L 3G08A 3U46B 2ITDB 5IKCA 1JV5B 3VFMA 1QLRA 3FB7B 5BXFB 1WWAX 5DHYA 1JPGB 2A83A 4MD4A 2X1OA 4RZCA 2J4WH 3JV6B 4NFBA 2EYRA 4WO4B 1JK8A 4PJGA 4XP6L 2R2BA 1RK0B 5IUSA 1H3WM 5DR5L 4X9BA 1DQQB 1BD2E 2BFVL 3ULVE 1QFUH 1DN0B 2CDFB 1HIMH 5KSUA 3L3JA 1IEAB 3FAWA 4YAQB 3VXSD 4WV1A 2ADJA 2UV3A 3QDHA 1FCCA 5D7LB 3S96B 43C9A 1S9XA 2QKIB 4R4BA 3J8F7 1A4JB 4PRID 4K23H 2QQLH 5B4MD 3ILQD 4JDTH 3V79C 3RWCB 4L4VA 1FFQA 2BXYA 1PX3A 1X5XA 1T7ZA 4HH9A 2PR4H 4LLVA 2A77L 4LPVA 5MERB 4OCMC 4KPHL 2E7HA 3TVMC 3L6FA 5D6DA 5L2KD 1GSMA 1J0YA 5IEKA 1D6EA 4P5MA 3GRWA 3SGJC 3QCVH 3MV9E 1GZPA 4JO1H 4ODWA 4U6VL 1QPXA 4AG4L 2V2WA 4M8VA 3CSGA 3HZYB 3MFFA 1MCPH 2MPAL 2AS5M 3WN5A 1NLBH 3TC9A 3DMMB 3QDGE 3MJ9A 3UDWC 1RZJH 1MHPH 2BY2A 2PW1A 3LAFA 3PJSB 5INCB 4UU9B 4YBQD 3VH8B 3ARQA 1W0YT 3VFWA 4R6UA 1MY5A 2A6KB 1S78C 5C86A 4HIIA 1UH3A 3TBTB 5DK2A 3HC4H 1JWMA 4LDOB 5JNYB 4FQXB 3S37H 1S8DA 4QRSB 1LO4H 3NIDF 3MACH 1I1AC 1RIHL 1QFOA 1K2DA 3V6FB 1A1NB 4FQ1L 5K9QG 4X6BA 1BBDL 1JZ6A 3QIWB 5KJRH 2C4FT 3KYNB 5JXAL 3CU7A 3D1MC 1MIEH 4XMPL 1PFCA 4PJXF 3EUUA 5ID0A 3L3KA 1CF8L 5EPMB 4TUOB 2X4TB 4YEFA 4YDKH 2AI0L 1E4WL 3LKPA 2BCKA 4FQ2H 2YK1L 5EO9A 3BKMH 1CDIA 3TNNA 1JPFA 2H26B 1MLCB 1I3RB 1CFTB 5C09B 4Y4HD 1LE5A 3HE6C 2DIAA 4PLJD 5GZNC 4I0PA 3BIAX 3BISA 4DKEL 4QRPE 1DVFD 2X4RB 3SJVA 5C0AB 2J7LA 4GG6E 1MNUL 3BWAB 2E7BA 3QBTB 2A74B 1S7XA 3EYSL 1QA9B 3HS0A 4ZFGL 3F7PC 5IJVB 4H0HB 4P0DA 4XP4H 1HDMA 3GIVA 3R0NA 4KZDL 1U58A 1RZGA 3SKMA 3MRDA 4WUUE 4NQXA 5D2LA 3GMRA 1NAKL 2FHBA 2Z92B 3H6JA 2LAGB 5E8OB 5TDOB 4PJ5A 4KK5D 4ODUB 3RVUC 1A4KB 1UACL 1LP9F 2EDYA 5ANMA 4HQQH 4IMLB 4NQDB 4KRPC 2APXA 3OG6B 3MOAL 4M6NL 1VERA 4LARL 5I0DA 1MLBB 2YBRA 5H2BB 4PUBL 1UB6A 4QRQA 3MOBH 2GSIB 2P5WD 3VFGH 1DQJB 1LK2A 3RWGA 5HGHA 1CFQB 2H8PB 1C12B 4NO0B 1E4KC 1FSKC 1KNOA 3MRHA 5DQJA 5CKGA 4G8GB 5ADPL 4LAQH 5FYLH 1NDMA 4HKJB 3TFKD 4R97B 3QXAB 5EORH 1ZHLA 1CU4H 3WIIL 3HRZB 2VMFA 2BVQA 1BVZA 3BPOB 2DQJL 2HT2D 1AFVH 5GS1B 4C56B 1NGYB 5C2BH 2HJFA 3DLQR 3HNVL 4I1NB 1RUAH 3O6FB 1ZT4A 3VDAA 2ADIB 2YC1B 5CJOH 5D7IB 1KPVA 5D7JD 5D6CA 5FAAA 4HUWB 4OZIE 4XPBH 1ZT7A 3OJDB 3I02B 1BIIA 1DE4A 4XNMA 5DUPL 2B5IC 4WFFD 5J3HD 3M07A 5BOZG 4BFGA 2D03H 3VE0B 5FGRA 3S37X 3V8OA 2R1YB 3SDDD 4HHAB 1KTKE 4F37F 3QIUC 1AP2A 3TIEB 5DJCB 3F65A 5BO1H 1AGCB 1DQDL 4ZSOE 4U6HB 4WY7L 5F9OL 3RY4A 3NCJH 3HE7D 5E9DD 4RGNE 4Y5XB 3T08A 4U1MB 4PGZA 4I2XB 2QQQA 4WW2A 1V7ML 1U91A 2VYRE 2YD1A 1T66D 3CUPB 3VW3H 5EBWB 5TQ0H 3FQXB 3MUGB 1SEQH 4UINL 3C8DA 3RZCA 4IRSD 4QLRA 3UYRH 3MFGB 2BZDA 5KN5B 1FYTE 1P5UA 4NRXA 3SDCD 2F54A 3VXNB 1OAUH 3AMLA 1T2QL 4MYWB 3B9AA 3G08B 3HFML 5IKCB 3VFMB 1CICB 3WS6A 3KHOA 1QLRB 3GJFB 3CVHH 1OAQH 4P2YA 1INEL 1C16A 2A83B 4AENA 4MD4B 4RZCB 2EYRB 1JK8B 4PJGB 2R2BB 4ELMA 4WENB 4HIHA 3U6RA 4TSAL 4N8CL 5HHNA 1DN2A 5HHOE 2V7HB 3T4YA 3OXRB 3L5HA 2XWJB 3L3JB 2Y1VA 3GGWA 4WV1B 2ADJB 2HJLA 3GO1H 3GJEA 1S9XB 4F7MA 5CJQH 2CO7B 4Q0XL 4L4VB 3DI3B 4HH9B 4LLVB 3AXLB 5T3XD 1SJXA 1TTFA 3L6FB 1P4LA 4D0DA 1BMGA 2GTWA 3QPQD 3GMQA 5IIEA 2XKNA 4C54A 5IEKB 1D6EB 4PGBA 3PHSA 5ALCH 1IC5L 3IFLL 4O00A 1GZPB 4ZAKA 4ODWB 1U0QA 5J1TC 4OLVH 2V2WB 1BJMA 4Z76A 1KCKA 2XN9D 3FRUA 3MFFB 4FQPA 5EIIB 2D0FA 1TPXB 3MRFA 2PW1B 4HLJA 4F9PC 5KVMC 4G9FD 3O2WH 3VFWB 4H88H 2YWYA 1NGZA 5IM7A 2CLVB 4J12A 1XGTA 2ZSWA 5DK2B 3TP4A 1JWMB 3ARFA 1WAAA 3VD3A 1L9MA 1S8DB 3VI3E 2HRLA 4G80A 1AY1L 5H35A 3VG9C 1K2DB 4X6BB 1NFIA 4G3YH 1XR8A 1U8MA 3ARGD 1TVDA 2R4RH 3ARRA 4LVNB 5ID0B 1XF3A 3L3KB 5HYSG 5I66A 4CVUA 4UTAH 2H32A 3LH2H 4KKNA 3LKPB 2BCKB 3ULUL 5EO9B 5E6YA 4L9LC 3QUXA 3HG1A 4G6KL 3TNNB 1JPFB 4N0CC 2LU4A 1PSKL 2B0SH 3V8CA 1LE5B 1KB5H 1YNLL 4HK3J 1MELA 2JB5H 4I0PB 3G6JA 3SJVB 4J4PA 3MNZA 4JJ5A 4PJIA 5IMMA 4WO4C 1I7UA 2BMKA 5I1EL 1S7XB 3R06A 4Z7OE 7CGTA 3STZA 12E8H 2DBLH 1HDMB 3GIVB 1U58B 1RZGB 3SKMB 4K7PL 1UH2A 3VA2C 3MRDB 4AQ1B 4CU6A 4NQXB 4JFPA 4OBSA 2Y7QA 1S9VA 2QSCH 1N6VA 4PJAE 4OTXL 4N1HB 3TWCH 4PJ5B 1AGDA 4MB3A 3SGKC 3MA7A 3JBG7 1AGBA 3M8OH 3BD4A 5ANMB 1JF1A 1HXMA 1G7PA 2OP4H 4ONFH 3ZE2F 2YBRB 5SWZD 3ZDYE 4MJ4A 4QRQB 4FFZL 3HA0A 5CJ8A 1LK2B 1GGIL 1OGAE 5HGHB 3K4DA 3WMSA 1ZHNB 3QAZB 2DQIL 3QQ9C 2YMXL 1KNOB 1P9MA 3MRHB 5DQJB 5C71A 3ROOA 3IDYC 4JM2D 2DI9A 1NDMB 1IEBA 2NTSP 3PV7A 5AEAA 4TRPL 1ZHLB 4F33A 2VDPL 2YUWA 1Y0LA 5T3ZL 1J5OL 2JE8A 1VHPA 2BVQB 3B2VL 4LHUD 4XGZA 3D39E 4MA8L 4MS8C 2HJFB 3B9VA 1D6VL 5IVXE 1MCKA 1ZT4B 2SEBA 3KYMA 4ZXBD 2L7JA 3O45A 4HBQA 4HWZA 1KPVB 3Q48A 5D6CB 1NCBL 1JRHH 4Z7NF 1ZT7B 1CL7H 1BIIB 1DE4B 2A9NH 4XNMB 2XOTA 2APTA 5CLTA 1U8OA 1YN6A 2ADGA 4LSSH 4FQXC 4M62H 4S10A 2Z9TA 1AP2B 3VD5A 2JCCF 1R5WB 3FTGB 3QIWC 3OJ2C 1EJOL 3F7RA 3OKDA 4LMQI 4PJCF 3VXSA 3T0VA 4QHNA 1MCOL 4HIEA 1QBMH 1U91B 2QQNL 1C1EH 4K3JH 3OF6D 1MVUA 1OT2A 4PRIA 2HVKA 3MLXL 2R23A 3RZCB 4Z8FH 4BKLA 5E8EA 5TPWH 3W11C 4J3WA 5I1CH 4NRXB 5L2KA 2F54B 4EJ1C 3ZE0F 1J8HD 3NPZB 3QNYA 4P3WA 4AEHL 1H15A 3C2AL 5JZ7D 2EDHA 1WUNT 3PWUA 2FX7L 3TLRA 3PWVA 1P4IL 4TVPE 4Z7UB 1C16B 4AENB 4P3DA 4NHCH 2NY7H 4XHJD 3WJLC 3QHFH 4GG8A 2C3GA 4ELMB 4HIHB 5EA0H 3MV7D 3U6RB 1G1YA 3UJTL 9CGTA 1X5JA 3T4YB 1L7IL 5FHAL 2UWEF 4BSVA 5I76A 5CD5C 3GGWB 2NY2B 4OCXH 2HJLB 1CE1L 1IGIH 5D96B 5JLZA 2D9QB 3T3ME 4F7MB 1KXQE 5GS0D 1GIGH 1OD7A 3SOBH 4C55A 3EYOA 1FE8H 3WXWL 3WNKA 1F6AA 4UNVA 4RSVA 1ZEAL 4D0DB 1P4LB 4R97C 4UT6H 5HBBA 2X89D 2GTWB 5L6YH 3GMQB 3REWA 4DUWA 1K8DA 2XKNB 5IIEB 4LEXL 5HYSA 3BPOC 4PGBB 3BIBX 4WI5A 5GS1C 2B4CH 4FOMA 3GI9L 3SKJL 4ZAKB 3O6FC 1KOAA 1U8HB 2UY6A 2O5ZH 4S0TD 4L1HA 4JFQA 5IHBA 3CPLA 3GDBA 5EDXA 3FRUB 4P9ML 4JFDE 3FT2A 3O6KL 5E00A 4Y4HA 3MRFB 1DVFA 1MHEA 5KSAD 2NYYD 2RCSL 2VLME 1NGZB 5IM7B 4MB4A 2V17L 4NC0B 1MCCA 2MNUA 5F7UA 3HI6L 1XGTB 4TUKL 2ZSWB 1GOHA 5DTFA 3VWKD 3ARFB 1MRFL 3GSNL 4Y5XC 4CDGC 3LQZA 4G80B 4NJ9H 5H35B 1A6TB 3MLSH 1EMTH 3MRMA 4XPGL 1UEYA 1NFIB 4F15B 1U8MB 5HI3C 4HH8A 4X4XA 3PL6D 1IQWH 3GSRA 4NQDE 1ADQL 1S7RA 1OL0A 1XF3B 4D9RD 3UZEA 2AXJA 5I66B 2P5WA 1HI6A 4QRRD 2H32B 1AH1A 3I2CH 3HG1B 3GMOA 3QUXB 3GMLA 1A6AA 3U0TB 2FGWH 5EC2A 1VFMA 1CICC 4CMMB 1XCQB 1UYWL 4DN4H 4X6DE 2R29H 3RAJL 3G6JB 1JNNH 4XVSH 1REIA 5CGMA 4UUJA 3MNZB 4JJ5B 5IMMB 2OL3L 1I7UB 2BMKB 3BDXA 2AV1A 5EB9A 3R06B 4YNYA 2ARWA 3STZB 1I1RA 3FQNA 5E8DH 3ZDXF 1F8TL 5FV1L 5D7IE 4KRNA 4UT7H 4JFPB 5D7JA 2Y7QB 4WVRA 4JAMA 1ORSA 1S9VB 1FL3A 4DW2H 4WV1C 1HKFA 1AGDB 2AEQH 5BS0D 1QLFA 4FFYL 3MA7B 5BV7H 3GKZA 3DGGA 4L3CA 1AGBB 5DD5H 1ZLVH 4OZ4A 1LQSR 3H0TB 1JF1B 2CDEA 3SDDA 1HXMB 2ICCA 4UIMA 5I8EA 3QCUH 3Q5YA 4XVJL 5D6DC 3UBXA 3TV3H 2WQ8A 3AS2A 4WFED 4Z7QE 3HE7A 3Q5OA 1A3LH 5E9DA 2P45B 3ROOB 3GSXA 5CIPH 1IEBB 1YJDC 5KTEH 1T5WA 1P1ZA 3PWNA 4F33B 3DRQA 1LDPH 4JPKH 4JM4H 6FABL 3ULUF 4QOKE 4RGMB 2I27N 2WUCH 1XMWA 4XGZB 1BAFH 2KKQA 4IRSA 5CGTA 5IT2H 3IDXL 4LHUG 3NZHH 1Q9OA 2SEBB 3KYMB 2DLEA 3SDCA 1TPXC 3O45B 4HWZB 1V3JA 2UUDK 1Q72L 5E99H 2GHWB 5DRXA 3QG6A 1OSZA 4G7VH 2I5YH 4FFVC 2NX5D 1N59A 3MRPA 4JO2L 4MLSA 2VDOH 1U8OB 1YN6B 4JFZH 5JIHA 4LU5L 1BQSA 3BPCA 3RWJA 3IDNA 1AQDB 4RDQF 2J6EL 4YBLB 5DC0A 5ABDE 2HLFD 1A7OL 5LXGH 2GJJA 3OKDB 4OF5A 2FSEB 3M17A 4JCMA 3VXSB 4LVNC 1RMFL 4QHNB 2DS4A 1H3XA 4HIEB 4I77H 4MNGA 4HPOL 3Q3GA 4YWGL 3ME0A 4MXWL 3FO1B 4MNQD 3CFBA 1MVUB 1V3LA 4PRIB 2B1HL 1TJGH 4P9HL 1E6JL 3KDMA 2DQFA 2R23B 4WWID 3CFIC 4BKLB 5GGRA 5E8EB 4J6RH 3VD9A 3CSBA 3E0GA 3VRLF 1NCWH 4ZDHA 1OM3H 4ODSL 4FABL 5I8OH 5L2KB 4I0PC 1ZAGA 4PRAA 1F97A 3QNYB 1H15B 1RZKL 5C92A 3G5ZA 5DJAA 4R4ND 1X7QA 3PWUB 5EO1B 2HKFH 3PWVB 3RIFK 3TPUA 4XVUC 3KPNA 4F8QA 4P3DB 4XWGL 1MSPA 2XN9A 4O2EA 1MWAL 2X10A 1IAIL 4O02L 5EUKA 4PRDA 4JN1L 4YFLF 5CILH 3J7HA 2HRPL 1AGFB 5B3JF 4G9FA 4BSVB 5I76B 5BW7A 1DBMH 4AMKH 1BECA 4X4YA 1ZSDA 1CXFA 1Z3GL 4P49A 5JLZB 1EEUA 4KDVA 2GW5A 4HIXH 5DSCA 3R8QA 1GC1C 2VLJE 4YHMH 3ZKNC 1F6AB 1F2XK 4XCEA 4OFKA 4DTGH 5GGVH 5AAWA 4Y19D 4JCLA 3GHEL 3WXVL 4W6WB 3PE9A 4BUGA 3REWB 1AC0A 1OF2A 1G6RH 3ARGA 3PWJA 5C0GA 5HYSB 3SE8L 4EXPX 1DDHA 4X5LA 4IJ3C 5J6GA 3QNZA 2EIZA 1QSED 3RWIA 3SY0A 2F58L 5FYJL 4L8CA 4JFQB 4PG2A 1CN4A 3TT1H 1J1XL 4WUKL 3CPLB 4BH7A 2NY6D 3KYAA 3FT2B 3P4MA 3MCLH 5E00B 4Y4HB 4PB0H 3V52L 3RX5A 1Q0YH 2ENSA 2EDBA 1DVFB 3SJVE 3F12A 2A1WH 5I1DB 2OX5A 1IM9D 1U93B 2E6JA 1IGYA 5GGTL 3PF2A 5DTFB 4PY7A 5D2LE 3LQZB 4JPWH 2DAVA 3RKDD 1ZLUH 4XCYA 4RWYH 4YDJA 3MRMB 4PJ5E 3L3HA 2PUQT 2I60L 1KV3A 4APQD 3CMOL 4JFFB 3GSRB 4XNXH 4BZ1H 2DM7A 1S7RB 3RZCC 5SWZA 4ONOA 4U6XA 3BGMA 1EEQA 1HI6B 2I9LA 5EU6E 1OLZA 4N8PA 5IB5A 5IQ7H 2B20A 4WI2A 1DANT 3GMOB 1A6AB 3GMLB 4Y7MA 5EC2B 4JM2A 3IJHB 3WS6C 2R69H 1JPSL 5HHME 2Y9RT 3Q1SH 1JNJA 2AEPL 5DO2D 1JGUH 2ATPA 4UUJB 4LHUA 2AV1B 5JA9A 4YNYB 3FQNB 4ZXBA 4OCYL 3FMGH 3V2AR 5D7JB 5JQ6L 1ORSB 4Y4FD 1FL3B 2VIRA 4LSVH 4UDTA 5F1IA 5I2IA 2NY2C 2MKWA 4PJBF 1B4JL 4QNPF 4G7YH 1OAYH 1QLFB 3BT2L 5DUMH 1CVSC 3DGGB 3P0YH 4OZ4B 2YA2A 4LDEB 1MHCA 2CDEB 2NY5H 3SDDB 4F7PA 1T0MA 4QRUB 4KMQA 3LHPH 1A9BA 4MA3A 4UIMB 5I8EB 5I1GL 4X8XA 5JHLH 4OV5A 3VG0L 3UBXB 4I0KA 3UYOD 5CEYA 1R6VA 3T2NL 1J7VR 3HE7B 4ODVH 5E9DB 1U95B 4FXLA 3WS3B 3GSXB 4U31A 5CWSA 3EFDH 4ZAKC 4CGTA 4HS3A 5TF1H 2NW3A 1P1ZB 3AUVA 2MFNA 3PWNB 4LLMA 3DRQB 3OF6A 3KHQA 4M1CD 4MQ7A 3IDIA 2AV7A 4O2CA 3JWDC 1F42A 5C7XH 4FZEH 4OSUH 4W81A 2UZXB 4PJ9D 1OTTD 5FUZL 2CR6A 4DGIL 4IRSB 1FHGA 3HTLX 4KQ3L 1Q9OB 2ZCKL 4NKQB 3SDCB 1J8HA 1OARH 2VSCA 5E2TH 3WE6A 4HJGB 4KGJA 5DRXB 1M7IB 3QG6B 1FQ9C 1OSZB 3MLRH 1LMKA 1IAIM 2W9LA 4MXVF 2C5DC 3MRPB 4CW1A 5C0RH 1BM3L 3ARFC 1QKZL 3BPCB 1QFWL 3KLDA 3RWJB 2OJZH 4XP6H 5F1NA 4DKFL 2VXTL 3NPSB 2IBZY 4K2UL 1B90A 4HWEL 5DR5H 3MV7A 2EDEA 4F15C 3MCKA 1JGVL 5IB4A 3M17B 1NCUA 1BZ7A 1J87A 5E1AA 1DLHA 4EI5D 4P2QE 1AE6L 4HJ0D 4MDIA 1VKXA 2FO1A 4MNGB 2J8HA 3Q3GB 1NQBA 4XCNA 3VCLA 4ZFOL 3CFBB 3FN0L 1IFHL 2NY3B 3KDMB 2EIDA 2WBWB 2DQFB 3QUXC 4OLWL 5FCUH 4KPHH 4PRBA 3RVXD 4ZDHB 3K1DA 3GB7A 3LY6A 2X89A 3JSSA 4GQ9L 4PJFF 5FYLE 5DWUL 3SKOA 1P6AB 1TNMA 2XACC 4J4PC 1EA9C 3NA9H 5GJTH 3G5ZB 1EX0A 2MKLC 5CUSL 1X7QB 2HT4C 3DYPA 3MNWA 1CGSH 3OV6A 4ZFZA 3TPUB 3KPNB 5SWQA 4J3UA 5DZOA 3TBWA 1JZ8A 4HIJA 2XN9B 1VFOA 4O2EB 4I9WE 3CCHB 2MPAH 4HS6A 5EUKB 2B39A 4PRDB 1UH4A 3HHRB 1JTOA 4XPFH 5LKNA 4G9FB 2CXGA 3OJMB 5JOPD 5KSAA 1DBJL 5JW5A 4Y2DD 1SVCP 1NSNH 4X4YB 3NACL 1ZSDB 1Q38A 1T89A 2NMSA 1OTSC 3ZTNH 5DSCB 4X7TA 3VWKA 1RJLA 1P9MC 4XCEB 4NQTA 5EU7C 2D7TL 3QIBB 3UO1L 4KI5E 3N0PB 1RJYA 4HBCH 3OHXB 3HMWH 3GMMA 1OF2B 3KPTA 5IF0A 3PWJB 4RGMC 5C0GB 5JXAH 3PL6A 3QSKB 4XMPH 4L8BA 2BC4A 2FL5A 3LS4L 1DJSA 4QWWD 1DDHB 4GKSB 5J6GB 1CF8H 3QNZB 5EU4A 2EIZB 4MB5A 2Z93A 4WFGE 3SY0B 4QRRA 2AI0H 4L8CB 5DVLA 2YK1H