5GRUL

Structure of mono-specific diabody
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
228
structure length
228
Chain Sequence
QVQLKESGPGLVRPSQSLSLTCSVTGYSITSGYYWNWIRQFPGNKLEWMGYISYDGSNNYNPSLKGRISITRDTSKNQFFLKLNSVTTDDTATYYCARAYIGFAYWGQGTLVTVSSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSSSSLITFGQGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system
total genus 55
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2016-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gruL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gruL01
5LAXB 5FYJU 2NY1C 4Z76A 2DIJA 5IFJA 2QR0B 2NY6D 3TO2A 5DJ8A 3CFKB 5DVKA 4NUJA 4GW1B 4AEHH 1SYVB 3CVHB 35C8L 3ULVE 1C1EL 1N64H 1AXTL 4JRYA 1S9YB 1O0VA 4HZLA 3TN0C 4BH7B 3MA7A 4EDWH 5BMFL 1K2DA 2NY0D 2VQTA 3VXTA 4HZAA 2BHYA 1HXMB 4RCAA 1KPRA 1IEAA 4OLWH 4XBEL 5JPNA 3H3KA 3VJ6B 4Z7NE 2EKSB 3T4AA 1WFOA 5FYJL 2R29L 5D7LA 3SGJA 4ZNEE 5EBMA 2ITDA 2R23B 3BZDA 3EIFA 2YPKA 5HPMA 1FRGL 4TNWK 4CU8A 3LEXA 2A77L 4NO0A 4ZUWA 5J0BA 2EDNA 3D69B 3K80A 5TFSH 4MNQE 4PGBA 5DJZA 3JWOL 4U1SB 1KUMA 1HHIB 5F9AC 2FEDC 4GW4B 3QDJB 3SQOH 3QEHA 12E8L 2OSLA 1FVEB 2N4IA 3P30L 4MNQD 5D8JL 3PG2A 2WBJC 4FQ2L 4KQ3L 1T6WA 4ZO9A 4PJCE 4LOUD 1RZGA 1AP2A 5FECB 4NZJA 3ARWA 4P3DA 4NQDE 5KW9L 1BWWA 4G6FB 2V5TA 3BDYH 1OGAE 1JGUH 2GI7A 3O3EB 4MVBC 2NY4D 3DHMA 4YXLL 1N7MH 3RA7L 5K9JH 4MD4B 4O02L 3UMTA 1XGYH 3L5HA 4K3EL 4CMHB 1CDJA 4NQDD 2DIAA 4UZGA 5TPWL 3TNMB 4N8VB 4ODBD 1OGAD 3U9UA 1C5CH 4IIQC 3DETC 1CK0L 1Z5LB 4L8BA 3OG6B 1TJGL 2QEJA 3JV4B 2AGJL 4NCDA 5E9DE 2MFNA 2OR9H 3UZVB 3B5HA 1RZKL 3RQ3A 1OP3K 1OTSC 1WCBA 2APXA 4IRSA 3H9YA 3BZFA 1I9RH 1JFQL 4PRNB 2A73A 3MACL 1ITCA 4ODHL 1C5BH 1RVFH 1FVDB 5IJKA 5E9DD 1UT9A 4HX1B 1NMBH 2VZ1A 4KK6C 4P46C 4ORGB 2AEQH 1F4YL 3TVMB 4YHYC 2Y36H 4PJIE 3QDMB 4GRLA 4GRWB 3LPFA 4RGNB 2PCPB 2WZPD 1KEGL 1S7VB 5C09E 1RJCA 1AFVH 1OF2A 2YWYA 4KUZL 2C7UA 3MX0A 1H0DB 1RJZA 5D1QD 3EYFB 4JJHA 2DWEB 4S1SH 5IV2A 2G5BA 3O4OB 1YJDH 3L3IA 3RVVC 4I48B 1P7QA 3GB7B 5F1KC 3WIIH 1G9EA 4OGXH 3OKEB 4B5EA 5C09D 1EO8H 4NRYB 1M1SA 4OZFH 4PJGF 4ODXA 4J1UB 2YZ8A 3CCHA 4K7PX 2R9HC 3MUZ1 2FL5A 4HKZA 1AGDA 1IAIL 1JGLH 3FT4A 1LQSR 1BQUA 2D7PA 3WIHA 1CE6A 3OAZH 5IVXB 1Q94A 1G7LB 5JOFB 2O5YH 3OZ9L 3ZDXE 1A6TA 3S88H 2Z31B 5ID0B 5FGSA 3IFNL 2BNRE 5EWIL 4G6KH 1KLUA 5B3JF 2DTMH 4Y5XA 2ZUSA 5CJXA 2G2RA 2DLTA 2YXFA 1F4WH 5C0RH 4GAJH 4QHNB 4LLYB 3IXAA 4C58B 3X12B 3REWB 3HZVB 1RZFL 1MI5B 3S8WA 2YEZA 4LVNC 4ZO6A 3KYNB 2R56L 2PETA 5HGAA 2B5IB 2IFFH 3O6ML 1WQVT 4NM8H 5BO1H 1YDPA 5DT1H 3VW3H 4L1DA 2QHRL 3E6FA 1U8IB 5FM8A 3MV9E 1DUZA 3ALPA 5IVZA 4AM0A 4JPKL 2F8VA 4QHLB 1RPQA 2XG5A 4HW6A 4PJAF 1VA9A 4R3SB 2APWA 3BJ91 3FQTA 4Y4HA 1QLRA 2Y4SA 4YBQC 4HUVA 4L8SA 2YD6A 3TYFB 3MV8E 5FB8A 3PWPD 4EBQL 4AT6A 4MMZC 4ZOAA 3BGFB 3U1SH 4U1HA 3TT1H 4RGOL 5FKAA 1BOGB 4NFDA 3ARSA 4XVJL 3HFML 3QRGH 4RAVA 5BW7C 5JOEA 2IAMC 2VNCA 3MRGB 5DVNA 2HWZL 4X4YB 1CXEA 1DQML 1T4KA 1RIHL 1VEOA 4O5LL 4WTXA 1QNZL 4UUJB 1A6VL 1OPGL 5BV7L 5E8PB 5CWSB 5D9SA 3CXDH 5IFAL 4JR9L 2VDRL 4OGYL 2I9LB 3KLHC 5LKNA 5DMKA 1Q9KA 4LVOC 3S96A 1LO4H 5FHBL 3P4OA 1UQSB 3BIAX 1FIGH 5FO8A 3VG0L 1KF9B 5GS3A 3PL6C 1KIUA 4PJDF 3S5LA 1INDL 4UOW1 5GRJH 3SE3C 5DSCA 2XZQH 2VAAA 2PR4L 2FGWH 2PO6B 3RY6A 5D1XA 2NY5H 2MPAL 3V6FB 5CJ5A 4ODVL 4NSKA 4QXWA 2X9XA 4P2QA 4KAQH 4WUUD 3MRIB 2CLRB 3KXFD 2B1AL 1CDHA 3AXLB 3KPLA 2JK5A 2D7TL 5IMOA 2BVEA 3WDIA 3GSOB 1IBGL 2QL1A 4HFWA 5E1AB 4YR6A 3WFEL 4OFYA 2PYEB 3UJTL 1NBVH 4JHAL 3X3FL 1IZJA 3U46B 5LG1A 1JNNH 4E41A 3FJTA 5FDWA 1SYSA 3Q5YA 1N0XH 1V7ML 3ARYA 3C08L 1S3KL 5ICZA 4IJ3C 3HKFA 3MRLB 1MJ8L 5HYJE 5F3BA 1U8MA 5I8KH 3L3JB 1HCVA 5C6WH 2D7QA 3FB6A 3HZYA 2FNBA 4HT1L 2AXGA 2A38A 3RFZC 2NX5B 3JV6A 4G8FB 1WBYA 3U0WH 4PRIA 1XT5A 4HGMA 3RWFA 5HYJD 3O6FD 5DR5H 2JB5H 1BGXH 2EDFA 5EDXA 3ESVF 4FFVD 1JZ2A 4CMHC 1T89C 4WEUD 4G8IB 4NUGH 4JFOA 4UT9H 2ED9A 2J8UA 5CP3A 4KHXL 3TJHC 1C16A 1KJ2A 1DE4A 1JPGA 1X4YA 25C8L 3LQAC 4F58L 5CBAB 2WINB 1HHKB 3PQYE 1T1YA 2QTEA 1UWEL 3QULB 4K23H 1G7HB 1AGFB 2PNDA 3R06A 1K4CB 3EYUL 1J8HE 1NUDA 4HJGB 1MFEL 1JMXA 1EMTL 4WV1A 5DEFA 1M6OA 3U0PB 1UM5H 2VLJE 4RGNC 4X6DB 2VISA 4NKIH 4NO3A 2DQTL 4AENB 3VD3A 4P2RD 5DHVB 3HLAB 3FMGH 1HYRC 2VXTH 3I6LE 3O4OC 1CTOA 4UT7H 2W59A 4LDOB 1JGDA 4L3EE 2VLJD 5FYLL 3CSYB 3RGVB 2CLVA 3FL7A 3EFDL 3CD4A 5SWQB 1GAFH 5FA3B 2XOTA 3HUJA 2JB6A 3C6SB 4XPFH 4FQJH 3I6LD 4LCYA 3SJVB 5EIIA 1P4BH 4ONFL 4L3ED 4ZS6C 3IFOB 1MHHB 4R7NB 4JFDA 2MTPA 4O2FA 4UNVA 2NQCA 5HYSB 3KPQB 4P9ML 4U1JB 4LCUA 4HHAA 2Z31C 4LVHB 4UQ3B 4FQHB 1J05A 1IGYB 5DZNA 3NIFF 4LNVA 5EUKA 1PY9A 2AXJA 4GBXA 1A6UL 3L5XL 4JKPH 2IC2A 1I8LA 4RMUA 3L7EB 5H35A 5IW6B 2APFA 5C07E 2RHEA 4MB5A 1ND0B 3ROLA 1IC4L 4HK0A 3U6RB 3S3SA 5DURD 1TITA 1HHGA 3ZLQC 4YHML 4F37K 2B5IC 5DUBA 3WNLA 2BSSA 1EUUA 4BSVB 1HCFX 1A0QL 5C07D 3O9WB 3B9EA 3O41B 2IBBA 4AG4H 1JGVH 5TQ2L 4G8GE 5GRWA 1ZA6B 4BH8B 4Y1AE 2B2XH 4PGCA 5GS0C 1HKLL 5DFWH 2JE8A 5JW4M 1TMCB 4OQTL 3RHWF 2QLVB 1F6LL 3BP7B 3QXAA 4HXAL 1BVKA 1UJ3A 5FIEA 2L7JA 5EBWB 2FEEI 5F6IC 1X7QB 1RZIA 3BGFC 2VH5H 4Y16D 3DX9B 1CXIA 2R8SH 4GRMA 3CDGA 3DV4B 2VXUL 5FAAA 4N5ED 4Q9RH 4C83A 4MLSA 3L6FA 3FZUD 3NZ8A 2M8XA 4OLVH 5F6HJ 4XMPL 5HI5C 3S3PA 5IBTL 3BPNB 1NUGA 4JRXE 2XN9B 3SCMA 4MCZA 2E8ZA 1VEPA 4P5TB 3T2NL 3WIHL 3OL2A 1FC1A 2V5YA 1RZ8B 5DRZB 5JORB 1MJJA 2H2PC 2X70A 3KPOB 1R0AL 3NBNA 1A6WL 3C87A 2P7TA 4JRXD 3OKNA 1A1NA 5E2VH 2J3SA 3FT3A 5JPMB 4PY7A 4YDIH 3W9DA 4MA1B 1JHKL 3G08B 4K8RH 4HJ0C 5F9OL 2YC1B 4JDZB 1NLBH 3IXTB 2IADA 3S4SB 3V6ZB 4OSUL 3RL2B 2PXYC 1S5IH 3UTZA 1RURL 3M1BB 4KRMB 4XCNA 3WFBH 1HEZB 4Q58C 1KNOB 4QRSA 1YEFH 4C4KT 3BWAB 2HRPL 4XMKH 1X44A 1G7IB 3C09B 3FFDA 4R6UA 1AGEA 3KDMB 3PGCA 1N0LA 4Z7OE 1S9VA 5LXGL 4E5XB 4R26L 4JM2B 5DWUL 4AEIH 4LEOA 1MLBA 2NMSA 3GSVB 2EZ0C 1FL5A 5DI8B 5BVJA 4WFEE 4DKAA 5EZJA 5I30H 4E0RA 1ZAGA 2J6EA 3FO1B 4HH8A 5EC2B 4OCSL 4Q9QH 5GHWL 1YEGH 3GRWA 2X4NB 3PWUB 4R4BB 1QFWH 1WTLA 1RK1A 4PBXA 4RZCB 1TETL 2EYTB 3QI9B 4WFED 1I9JL 2NTSP 3MNZA 3A0OA 4KDTA 2IF7A 3NABH 3W81A 2GK0A 4FNLH 4JCLA 3VH8B 4C59B 3KPSB 2W0LA 2XPGB 5MERA 1HDMB 5GS1B 1A6ZB 4HWZB 5A2JH 2V2XA 4V1DE 5DTFA 4FMKA 1NC4B 3F7YB 4Z18A 1OAXH 3C9NB 3U0TB 5D6CA 3GMOA 1AR1D 2HLFD 2OQJA 1GL4B 2IPUG 4F57L 2IANE 3UX9B 5TDNA 4AYFA 2DLFH 3JV0A 4DGVH 1FLTX 1E6OL 4U1MB 3CUPB 2WW8A 1PG7W 3RVUD 2DOCA 3C8KB 2XWJB 2Z35A 2NNAA 3WJLC 3KLDA 2YK1L 2E9BA 3RUGF 5DJ6B 1WVZA 1F4XL 1AH1A 4RMQA 5DUPL 1R3JB 4XP5L 4XP4H 3VD9A 4OCLC 4I0KA 1B4RA 1QFWI 4NJ9L 1TJIH 5E5RB 4FP8L 5CJOL 4KHTL 4ODWB 3MUJA 4PLNC 4EN3A 2VXQL 2HLAB 3H8NA 4MAYB 3HI1B 3PHSA 3G5VB 5IROA 1ODAA 1IQWH 4YWGH 4O2EA 3W82A 3QPXL 2HT4D 3RGVC 4LAJH 2DDQH 3TO4A 5HDLA 1PZ5A 3MRRA 3MJ7B 2BRQA 4LIQE 4J2XA 1RUQH 5DJDA 4KGLA 2P5WA 2ILLA 3RX5A 5HHXH 2HTLD 4DUVA 2DQIH 3CMOL 1KIPA 5D72H 4N9OB 4OZIA 4P5MA 2AKRA 5C0NC 1CFQA 3AROA 4ONGH 2F5BH 1SJVA 3BKCL 4LVHC 1B9ZA 4R90L 1F90H 1KFAH 1YNLH 4X6FB 1TTFA 4X7EC 5FO7B 5JW5B 3O2WH 3N85H 5ANMA 5E99H 5F1IB 4HCRH 3ZKMC 1T0NA 3EZ8A 1M7XA 4CNIB 3UXFA 3QAZB 3H9SE 4D0CB 3NA4A 1MCFA 5FYJD 1T83C 2FJGB 1Z6JT 2VE6A 3LDBC 2D9QB 2FX9L 4YEEA 3LZFL 5C0BA 1RU9H 1LILA 2E7HA 2YPVL 4M62H 2B1HL 1YNKL 4PJFA 4LKXA 4QRQB 3H9SD 3O9WC 1N5AB 1BQHB 3GHEL 1P4LB 2D2OA 4LHUG 2LFGA 1KOAA 4NRZA 5JHDB 2CXKA 5GRUL 4EI5B 5IW1B 3QPQC 4JZNA 4QTHB 3S36X 2YRZA 1LEGB 4U05A 5D2LA 2RIKA 5CAYB 3AU1A 1QHPA 3LN4A 4JG1H 3GI9L 5ESVB 1A64A 3FN9A 4P23D 3VFRA 3WIFA 5IGXL 3ZKNC 1CI5A 4ZFOA 3ARGD 1NCDH 2VRAA 3LKPB 3W0WA 4PJEA 1UWGL 3GI8L 4KDWA 3CDFA 4MA3B 3VFOB 3O8XA 4WW1B 2R0WH 1MRFL 3K0WA 3IFPA 1IAKA 3TCLB 2A0LD 4G6JL 5I75B 4DK3A 3F12A 2BZDA 4I0PD 3TIEA 3BPNC 4D9LH 4POZD 4ZYKB 4HWNA 1GXEA 3BD5A 3MYJB 4JY6B 4Z7UF 1XGQB 4P5TC 4ZUUB 1CGWA 1XF1A 2XT1B 3B8YA 5E6ID 4QRRA 4B0MM 2BRRH 3BKMH 3PWLB 5FYKH 3P2TA 3TV3L 3GSNB 1D6EA 5ILTL 4XNQA 5D1ZD 2JJTC 3EYOA 2FIKA 2C4XA 3O4LE 4V2BA 4HFUL 1ZSDB 3JZ7A 4MA1C 1O7SA 1A4KB 2XQYK 2BHZA 2DQJL 3UZEA 3NTCL 1OARL 2M26A 1KELH 3S5LG 2F58L 4FZ8H 1QBML 4DOHE 3HHRB 4PJ9B 1CDBA 4R8WH 4HUWB 4NKMA 4LSQL 3CSGA 2XXCB 4E42A 3RTQA 4M1CD 1JNLL 4PJGE 1HH6B 4OV5A 4ERSL 3BWUC 5DJXA 3RVTC 3RX8A 3PGDB 4JM2C 1OAZH 4YPGA 2A6KA 1TQCB 1S8DB 2XTLA 5DMGC 1IRAY 5H94A 1D5IH 1X5IA 5LQBL 4ZSOA 3MLSH 4C56E 3DV6A 1MHEA 4U3HA 3AM8A 5D7IA 3VRJB 1GC1C 4M1GH 3QI9C 4QRUA 4UAOB 4BFIA 1BM3H 5M7QA 1RFDH 4C56D 1IGIL 1AI1L 4HF5L 4J3VA 4MHHG 1NQBA 4QHUB 1BEYL 1H8NA 2X1PA 3IDXL 1E4KC 4ZXBB 1ORQA 3EJYC 3LS5H 5GIRB 1CFVH 4BJLA 4UTAL 4NO5B 4HS8L 2FX8L 1FNGA 3DX8B 2QSQA 4NKDA 1BBJA 5MEQA 1DDHA 4PJAE 4Z76B 4K71B 5FXCH 2UZXB 4WI4A 3UPRA 3TO2B 5DD5L 2ADFL 5DJ8B 1A02N 2Y5TB 1GHFH 1NANH 4NUJB 3T2OA 1A7OL 4G8EA 4IDJH 4HZLB 4JFFA 3MA7B 2VOTA 1K2DB 2NW2B 3AREA 1KPRB 4ZS7L 1YN6A 1IEAB 1R3KB 2R4SL 3QZWB 1NCAH 1Z0NA 5JPNB 4RMRA 2Y72A 3V4UL 1DBMH 2I25N 3BQUC 4MCYB 2DLGA 5D7LB 5EBMB 1T5WB 1JGEB 4GKZA 3UYPA 2ITDB 3FB5B 1E4WL 3VCLA 5HPMB 1RULL 3LEXB 2DQHL 4NO0B 4MAYC 4XCFL 1EGJH 3EO9L 1WWCA 3RIAF 5TDOA 3GMRB 4PGBB 5DJZB 4OTXL 5CEYA 3CFJA 3AUVA 4JGMA 5IMMB 3RIFF 3HI5L 1RJYA 1KYOJ 3CZFA 2DQUL 3SE9L 1HKFA 3IDUA 4YFEA 1RZGB 3GNML 1AP2B 4PJDE 2Y6SD 3W9EA 3NH7H 4HUUB 4MJ5A 3HN3A 3VXRD 1NANI 3RBGA 4NQSA 1J87A 1MCOH 3S7GA 3D85A 4Q6IA 3D3VA 3EOTH 2CJUH 5FV1L 5SX5H 2YPLA 2FLRT 3PHOB 3CVHH 3PABA 4FQIH 3GO1H 4Z95L 3D87B 4GH7B 1IVLA 4FQPA 2VXVL 4RAUA 1INEL 1FVCA 4L8BB 3HE7D 4MJIE 5L0QB 4H1LA 1QSEE 2R69L 2ZCLL 3NVQA 4OGAC 3FTGB 1ADQH 4M6OH 2LQRA 2B4CC 4YHPB 1GOFA 2X89D 2HFGH 3HNTL 2V5RA 3I75B 5CIPH 2DICA 1A3QA 4MWFA 2A6JA 4MJID 2A73B 1WAAA 3MO1A 1MCPH 4EI5C 1QSED 1AQDA 1X5FA 3STZA 1KCRH 3G6JE 2GT9A 2H3NA 4EQ3A 1OF2B 2JCCB 3SDYH 1OCWH 2C7UB 4TSAH 2VLKE 5CKAA 3BVNA 5DJ2A 4F9PC 5IV2B 2NY6B 4XPGL 4M6MH 1Z9LA 4Y0GA 3L3IB 2Z91A 1P7QB 2GY5A 2YUVA 2JIXD 2XZCL 3TBVA 4XC1L 3TIDB 3QFDB 2VLKD 2E3VA 2ZUXA 3ZYZA 3IRPX 5I75C 4JRYE 4ODXB 5C9KA 4P9HL 2AJVL 4W68A 3MV7A 2EDWA 3CCHB 3LPGA 3IYLW 1XZ0B 2FL5B 1M4KA 2R0LL 4DGYL 3M8OL 4KK8D 2ZP0T 2ZSWA 4R2GD 1QYGH 5TE7L 3HE6A 3H3PH 4G6AD 4N5UA 2AJSL 3P0VH 1IGFH 2VDPH 2CRIA 1IARB 3KAAA 3MA9L 1KLUB 4Z8FL 1YMME 2LU7A 3FQUA 4Y5XB 1JI2A 2DI8A 2IFGA 1J5OL 3RWDA 5C2BL 1AGCA 2QHLA 3G6AA 1WWWX 5FYLE 3WXVH 1IJ9A 2YEZB 3G5YA 4I8DA 3DSFH 3G9VA 3VFSB 4PJ9C 3WXWH 3MRHA 1I9IH 5HGAB 1YMMD 4ODUA 1FFOB 3CFCH 3OGOE 4GRWH 4J6RL 1YDPB 1RI8A 3B5GA 5FYLD 4IMKC 4Z78B 1FORH 3FT2A 4JN1H 4PJEF 1K5NA 2NY4B 4IRJD 3OV6A 4XVSH 4RIRA 1MWAA 2ICWJ 3FQTB 4HUVB 4L8SB 4LCCA 5EPMA 4FA8A 5J06A 2DTSA 1TQCC 3FONA 3K2UH 2FWOB 3MSPA 5FB8B 5JIPA 4X83A 3QG7H 5I1GH 1E6JH 2H26B 4PGDA 2FSEA 4X4XB 5E2TL 4DZ8A 3UDWC 4U1HB 5KSAD 1XGTB 2JJSA 4KH2A 3NIFE 3TCXA 3IU4L 4L8DA 2WUBH 4RAVB 1Z9OA 2EC9U 1NC2D 4MDIA 5LGJB 4JO1L 1W72A 4LNRB 4UAOC 1T4KB 4WU7A 1RIVH 3NFNA 1FZMA 2Y07H 5HHOE 1YMHA 3S36L 5FHAH 3V95A 4YC2C 4ZXBC 5J57B 1QFUL 1NEZG 1PG7L 1CLOH 5D1QB 5DMKB 1Q9KB 4IRSD 1R3HA 5ISZA 3QWOA 5HHOD 1H15A 4P2YA 3FCTA 3P4OB 3HMWH 2A74A 4K71C 3BIKA 3QEQE 3VMOA 3P9MB 5GGRB 1P6FA 1K9TA 1T66C 1Q9WA 2Z4QA 1UC6A 5JDJA 2WMPA 3T2QA 4P4KD 4UDTA 3OF6A 5CJQH 2COQA 3LQZA 2VAAB 3I85A 4HIIA 1N8ZA 2NXYD 4NSKB 4R4FL 1FCCA 2BOCA 4P2QB 3QEQD 4TOYL 2G75B 1XF4A 3L3KB 3KPLB 2QQQA 1ZHKA 5IMOB 4WI2A 4KMTL 2PW2A 4XX1G 2HG5A 3SGJC 3HC4H 4HFWB 4YR6B 4ZMAT 1ZVSA 3MRJA 3CX5J 1YEHL 1T2QH 4JJ5A 3A6BH 4M7LH 2WLZA 4E41B 3BEVA 5I1DA 1GPOH 2WK2A 3MLXL 4TYUA 1LMKA 5ICZB 4RBPK 1IE5A 5IHUH 3BW9B 3MBEA 5F3BB 1U8MB 15C8L 1Y18A 4UINL 1EZVX 3FB6B 1TZGL 2JELH 2AXGB 1OAUH 3JV6B 1ZTXH 1JRHL 1WBYB 4PRIB 4NNPL 4QXGH 3D2UD 3PF2A 3TH4T 3PWPB 5F88A 3T08A 4KKLC 3SDXB 2ZJSL 4LHUD 1AR2A 5E03A 1EV2E 1P4IL 4LHQB 2A6DA 2D03H 1DCLA 3TM6A 4JFOB 4KPHH 4ZUVA 2X4TB 4MD5B 1A3RL 3AC0A 1CDYA 3J7HA 2F53D 2V7NA 1C16B 1KJ2B 1MFCL 1DE4B 5GXBB 2R2BB 1FNHA 2ZNWA 3NIGE 4UQ2B 4LLWB 3V9FA 5J8OA 3I2CL 3R06B 3IAGC 3CDYA 5IJKC 1VPOH 1JL8A 5GISH 4OZGF 4ELKA 4WV1B 4XAWH 2GITB 4GRLC 3WMSA 4KK9C 4NO3B 5L7XL 1DEEA 1S7TB 1V3LA 3WSQH 2ZKHL 5DA4A 1CT8A 4IS6A 4OFDA 4M48H 1LO5B 2YUWA 1IKFL 3Q1SH 3DX6B 1I1CA 3C60D 3OG4B 4PJXA 3HNSL 1FC2D 3F8UB 1I1AA 3I50L 2ARJA 4QRPA 5IFHH 1CD1A 3HUJB 4NC0B 4WUUB 2JB6B 4LCYB 3KXFB 4Y7MA 2J5LB 5B38G 2AJXH 4X6CA 4M7LT 1LDSA 4JFDB 5ESAA 1K6QL 2Q7NA 5E08H 1F4AA 2H9GA 3BX7C 4GMSH 3ZTJG 5EOCL 2C3WA 1DEDA 4HHAB 4LCUB 5IB1A 3VWKD 2AV1A 2DWDA 5TE6H 2XKUA 1J05B 1NMAH 5EUKB 4GBXB 1R5VA 3M17A 4Y5XC 1UCTA 3IKCA 4BZYA 5H35B 4P2OD 3SGEH 2IQ9L 1X4XA 3ROLB 4I18A 4HK0B 1GIGL 5JOPE 4JAMA 2WSKA 3NIDE 4D9QE 2R0KH 1DQLL 3OAUH 5DUBB 2AK4A 3OJVC 2BSSB 1OQOA 5IEHA 2EYSA 1A5FH 3BSZL 1INQB 1SY6H 3VXPA 5IMLA 1LP9F 5JOPD 5EZIH 3WKML 4NQCA 4OCYL 4XP9H 2NY4C 3INUH 4LSUH 4D9QD 4PGCB 4HIJA 3O6FB 4IHOA 5D71L 3ARDA 1F45A 4AIOA 4Y4HC 2E9WA 3LOWA 4L8SC 5M95B 5ADOL 3QXAB 3MCLL 4U7KA 5KZCD 3B3IA 1UJ3B 3I3BA 5IEKA 1BZ7B 3D39A 3FOLA 4P3CH 1NBZA 2AABH 3U30B 2ID5A 1RZIB 4EOWH 2W0KA 1Q9LA 2J8UE 3CAFA 1C5DA 4GRMB 4OLXH 3ECBB 4DN3H 4FQCL 1VGEH 4JKLA 4RWHA 1RMFH 3IRZA 4I77L 3L6FB 1GGIL 2B39A 4OB5L 3I6GB 1X5XA 5T1KD 1KB5B 1BZ9B 3QUYD 1XF5A 4U1NB 4XVUD 3SGEI 4HIXL 4MCZB 2MNUA 3SOBL 3NCFB 3MNVB 1PDKA 3BFOA 1CBVH 2OI9B 4P2RB 5D1QC 5I8OL 1UXWA 2X70B 4JPWH 2XG4A 5F71A 1I7UA 2BY3A 5MENA 2P7TB 4H0HB 3OKNB 1OT2A 1A1NB 2HKHL 2K1MA 3FT3B 4PY7B 1QFHA 3SY0A 1EHLL 2SEBB 2FX7H 4P4RA 5DZOA 5GSVB 2W65A 3QUXD 4RDQF 3WS3A 1S5HA 2IADB 5ACMA 1D9KA 5I1EH 5F7MC 1CVRA 4MZ2A 2DLIA 1WZ1H 1CL7L 4K3JH 3RY6C 5HHQA 2LU3A 5HJ3A 3UTZB 4XCNB 4YFLF 4LP4A 4XNYH 1ROWA 4ZFGL 3VDCA 5DF0A 1MPAL 4I3SH 4KI5D 2VABA 3PGCB 3QWQB 1S9VB 5C71A 4YXKL 4LEOB 1MLBB 3GSQA 4Z7UE 3MBXH 1ZEAH 1ZLVK 4X6EA 5BCAA 1FL5B 2B0SH 2A9NH 5BVJB 4F7PB 4MXWH 3EAKA 5DURB 1SBSH 4E0RB 2UUDK 4AEHL 3BH9B 2AAVA 4JO3H 1N64L 2NY2B 5IHZA 3HI6H 3CZJA 1S78D 1RK1B 2VQ1A 3ELAT 3T3PF 1UH4A 4XTRD 4CADA 4OLWL 3MXWL 2UWEA 2BERA 4GKNA 5MERB 1FV1A 4FQXA 4CJ1A 4FTVE 1NGWB 2V2XB 2XZZA 5DTFB 4NCC2 4PLKD 5DC4B 5FGBA 1OAQL 5MI0B 4I0CC 5D6CB 2DI9A 5D7SH 3GMOB 2CKBA 2OQJB 4LARL 1FAIL 3IU3A 1CLZH 2BVPB 3SQOL 5E1HB 3HC3H 5JHLH 4KJWC 4FTVD 4YDLB 5C0JA 5HI4D 4G6MH 3WKNA 3TFKC 4KZDH 1PLGH 4H1LG 1CVSC 2DF3A 4M6NH 4GLRH 1JYVA 3NA9L 1JF1A 5AEAA 4JFPA 5B8CA 1G9NH 3TA3A 4CAGA 2GHWB 1JHLL 5KN5B 3QIBD 5BJTB 3PWJB 2VZSA 1VSCA 2AI0L 3BDYL 4LSRH 2IPUK 3V5KA 1EX0A 4U7MA 4OIBA 4WV1C 1N7ML 5FKPA 5K9JL 1U8NA 1Q38A 2W91A 1F11A 2I07B 4TNVK 1UWXK 4PJBA 1BLNA 5BRZE 4EN3B 5I74B 3GMQA 1D5ZB 4PV9A 5DD3H 5ENWB 1GH7A 1JP5A 1XCQA 2XYCA 4H88H 2OR9L 3BZ4B 4Z7VA 1LVEA 1D5MA 4O2EB 5CILH 3U83A 1JE6A 1KJ3L 1PZ5B 2OXGA 4KFZC 5BRZD 3FFCA 5DJDB 2P5WB 3N50A 4HBCH 4U1LA 1DP0A 1C5BL 1RVFL 5ICXB 2J5LC 3CU7A 4U6XA 1YPZB 1HYSC 1KIPB 2IG2L 3WJJA 4LSPH 4OZIB 2Y36L 3GSUB 4ZUSA 3BO8A 4GLRI 4PJ7A 3RHWK 1N6QH 4NBXB 4ETYA 4GBXC 1YJDL 4N90E 5ANMB 3CH1A 1FNEA 2QSTA 3ULSA 1KT2A 3Q2CA 4OGXL 1I8LC 5E8DH 1KCLA 2BMKB 4MS8C 2GJ6A 1EO8L 3MRQA 2VE6B 4PD4J 1YN7B 1ZHLA 4MZ3A 3DROA 1U92B 4OD2A 5DD1H 2C9AA 1WIPA 2ATKA 1JGLL 4LKXB 4YHOH 3O45A 4MXVF 1MCLA 3ZE2F 3E3QE 2R1XA 2MQ0A 5J11B 2O5YL 1R3IH 4I5BA 4NRZB 4RDQG 3S88L 1U3HD 5DUMH 3VXME 4AQ1B 1JHTA 3RKPA 5D2LB 4G6KL 2DTML 3ARVA 4JO4H 1YYMH 5HYFA 1H3TA 1UJ3C 3LN4B 2R39A 4B7LA 3HZKA 4GAJL 3WIFB 5C0RL 3SO5A 4P59H 3PDOA 2E5EA 4JFEA 3VXMD 2YMXH 2CDFA 4HC1L 1B0GA 3PUCA 1IGJB 2Q76A 1IC5H 1LK3L 4F9LA 3LKNA 1FG2A 3IFPB 4A6YB 2E6JA 3U36B 2YUZA 3F12B 1J88A 4EIZC 4XT1C 2YKLH 4H26A 1CCZA 4G5ZL 2E27H 2QQNH 3GMMA 5K9QI 3G6DH 2WP3T 4MD0A 3P9WB 3SCMC 2RCSL 4MA8H 1KENH 4XX1E 3M07A 1IQDA 4QRRB 5F7EH 1FZJA 2VLRA 3WDJA 1D6EB 3EYOB 4KK5C 3LRSA 2FIKB 1BFTA 2VZOA 3SDAA 3U1SL 3V0AC 4PUBH 5T5FL 1G7PA 4HDIA 4QXTB 4GAFB 4M8QA 4WU5A 4QHMA 3VFWA 4DUWA 4XMLH 2YXMA 3TNNB 2XQBH 1DN2A 1A7PH 3W5MA 3RU8H 4NDMA 3DYPA 4G9FA 1YEJL 4NKMB 4X4ZA 2XA8H 3UTTA 3D0VB 4OT1H 1TNNA 2DBJA 2NY7H 3QFJE 3TBTA 3ZTNH 4E42B 3ZL4H 4MQXD 3FKUS 4OI7A 4G9DA 5EO1A 4Y4KD 2W9EH 3T04D 2FJFB 2O5ZH 4YPGB 3X3GL 2A6KB 5FCUH 1UVQA 5CEZD 3QFJD 5H94B 4FZEL 3V4PH 5E5MB 4U1KA 1HXYA 3IB4A 4ZSOB 4OCRH 4ELMF 2CR3A 1VFMA 3DV6B 2FGWL 5C0BE 2NY2C 1MHEB 4U0RB 3WFCH 1LK2B 5D7IB 5FUZH 4PJFE 4X5XB 2OZ4H 1SJEA 2GFBA 4BFIB 4KDTC 2DKMA 1D5BA 2ZOKA 2MKLC 1DQQA 3MRPA 5CCKL 2CRZA 1MCHA 4LSTH 3R1GH 3VXUD 4ZPVA 3SO3B 2X9YA 2H41A 1ORQB 4YBHA 3K7UA 2P24B 2LABA 4JQIL 3ARGB 3OB0K 3KJ6H 3RPIA 5JMRA 5MI0C 3W0WE 1N0XL 5HVHB 4NKDB 4PJEE 1BBJB 5MEQB 1UM4H 1ZANL 1ZT7A 3QQ9C 4Z7WA 3NAAH 4YDLC 3UPRB 4OZFG 3CX5K 3PGFH 4JY4A 1DBKH 4OKVA 1CF8L 4OZHF 4EKXA 5I8KL 4G8EB 4PJ5A 4FRWA 3HB3C 3U0WL 3AREB 1YN6B 3MQIA 1U3JA 2HA1A 1BGXL 2EO9A 1E27A 4K3HA 1F5WA 4KWUA 2VB5A 4HCRA 1PW3A 5L6YL 3KPRA 3VCLB 4EN3C 4W6XB 1DBBL 1EK3A 3WUWG 5I74C 3NMEA 5TDOB 4U2YA 5EOCJ 5KVFH 5J6HA 1LD9A 3GSWB 3CFJB 3OXSA 4GQ9H 1CR9H 1RJYB 1ZLSH 5CINH 3BMVA 4K23L 4IOFC 2E6QA 3CZFB 5T1MA 4HWBH 4GKSA 1NDMB 3DTXA 2Q1EA 2AK1H 4OFVA 4M5YL 1EVTC 4Q9BA 3HG1E 1B0WA 2XV6B 1NCUA 3W9EB 1TPXC 4MJ5B 3JWDC 4IOSD 4DQOH 2AEPL 1QSFA 1M7IA 1KJVA 3D85B 4Q6IB 3ZHKA 3D3VB 2C3VB 3V6OE 3T65A 1DBJH 1WT5A 4PLOB 3KPMA 1HK6A 4HGWA 1EHNA 3HG1D 3OHXA 4WHTB 1HSAA 2FCBA 3MRFA 5KTEH 1R6VA 3VMNA 2YOCA 4Y4FA 2ADJB 2QQLH 1CLCA 1RUPH 2VITA 2E7MA 1AQKH 2DYPD 4XRCB 1FVCB 5BS0A 3DMMD 4KJPD 1WGOA 4XPFL 1P2CA 4FQJL 5B4MD 5C0CE 4DKEH 2KQMA 4NPYA 1P4BL 3BE1H 1U95A 4YUEH 2DQFA 3DBXA 1KSRA 3STLA 2DQEH 4NZRH 2ADIB 3UO1H 5C8JB 2OJZL 5J11C 4MWFB 2GCYA 4KV5E 4K3DH 1T21A 2WWKT 5C0CD 5T5NF 2EXYC 4FOMA 2BFVL 1NL0H 1TVBA 5ESQA 1OD9A 5FUOH 3I02A 2GT9B 1NGPH 4JKPL 2BNUA 3BVNB 3O3AA 4YO0A 1QACA 4ENEC 2RJMA 1OM3L 3CXHJ 2Z91B 2HJLA 3CFEA 3O8XC 4AZ8A 1FJ1B 1WBXA 4WCYH 3HAEG 3TBVB 4GUPA 2ARWA 4NQXA 5HI3C 3W39A 3MLZL 4PJ7F 2X4RA 2ZUVA 4JFFE 3L1OH 1JGVL 4CMMA 3MV7B 2GY7B 2HJKA 1UM6H 3MR9A 4LRNL 2EDQA 3EBAA 1MHPH 1T22A 3KYKL 4LBEA 4OUUA 2ZSWB 2BXYA 4RFNB 3HE6B 2FZ3A 3PWVA 3OBAA 2ESVA 3ZYIA 4AIZB 3FQUB 4WO4A 1NGXA 1JPSH 4HWEL 3GK8H 2W0PA 4OZGE 3RWDB 2FIRT 4Q9RL 1QSZA 4OLVL 2OYPA 5KANI 2V9TA 3QDGA 5AYQA 5CP7B 1L7TL 4N0UA 3C8HA 2CDEA 2FYYA 2C5DC 2NLJA 1FGVL 1F6AB 1NFIA 4NQEA 5A16A 5HHMB 4KTDH 3BGMA 3VXRB 3RTQC 4XAKD 3SDCD 4EVNA 3FT2B 5GGTH 1K5NB 1KCSH 1T1XA 3GSXA 1ZLUK 1KTDB 4RIRB 4ZO8A 5E2VL 5IIEB 4LCCB 5EPMB 3IFLL 1KCVH 3ULUF 4GJTB 4K8RL 4CVZA 4ZFZB 4FMFA 3TJEH 4XZUB 4PGDB 2FSEB 3O2DH 1NLBL 3RVXC 5BVPH 1MFBH 3LD8B 4FXKA 5F9JB 2LTQC 1NGQL 4F7CA 4U0RC 1T04B 2J88H 4GXUM 4L8DB 3BN9D 3ULUL 5MP6L 4MDIB 4R96A 5BZWA 5TF1H 1YEFL 1W72B 2D3VA 4WU7B 3D0LA 1FZMB 3VFMA 1ZVHA 3MZGB 4BQCA 4JLRA 2VL5A 2OL3H 3MJ9A 3LKRA 3KPTA 3AMLA 3HS0A 2YA0A 3ARGC 3QWOB 5I30L 4WTZA 4FFYH 1LP9E 1H15B 5HYQA 3ARFD 2BOBA 3FCTB 5HVHC 4Q9QL 3C6LD 1NFDF 5L8KB 2Y1VA 1MREL 1AGBA 1YEGL 2JIXB 2A74B 2MQCA 4BKLA 4B7IA 1F42A 1A47A 5F44A 3LV3A 5KVEL 4NWTH 4UBDC 2Q8BH 1Q9WB 1DLFH 3MRCA 3FB7A 4HJJH 5FUCC 2X4SB 4HIIB 1N8ZB 3MOAH 4FNLL 2WQ8A 2EE9A 5GGQH 1CLYL 1QLFA 3AREC 1JPST 4R2GB 4APQA 1RUAH 2OMNA 3ILQD 1UH3A 3P11H 5EO0A 1WC7A 2C3GA 2PW2B 1DSFL 1OAXL 4XPBH 1IFHH 3DECA 1ZVSB 1JNJA 3LKSA 3UBXB 3OAYK 4AL8H 4D9RE 1HXMA 1EH9A 2C1OA 4HG4K 3BEVB 4CW1A 5I1DB 4M7JH 5GJSH 5C08A 2C3HA 3VJ6A 1UFUA 1ADQA 2EKSA 4L9LA 4HD9A 1GZPB 1UCBL 4PBWD 3TYGH 2R23A 1MCRA 3KGRA 2NXZD 3E0GA 4XP4L 5CIPA 3GMNB 3MBEB 3D69A 3ARBD 5H2BA 2VERN 4IRJB 3NACH 3UTSE 4NRXB 5IKCA 4O4YH 4OIIH 2O5XH 3K1KC 3QDJA 4Q6IC 4L8CB 5IM7B 2CMRL 4PLJC 4RX4A 2O61A 2X9WA 4JY5H 1AIFB 3SKJH 3UTSD 4YWGL 3LIZL 1ED3B 2X4QA 4ZUVB 4DAGH 4G7VH 4HQQH 3EDKA 3KVQA 2Y7QA 1NC2B 1L9MA 2V7NB 3DO3A 3I3DA 4K94L 3OMZA 4MD4A 2FB4L 3WNOA 5D2NE 4KTYA 4W6YB 4U1IA 4F8TA 1NUNB 2BSED 4XC3H 1UH2A 4YX2H 4KRPB 3S97C 4MJ6A 2Q87A 1JYXA 1F90L 1KFAL 1YNLL 2ADGB 3LN9A 5ISZE 3T3PE 5CLWA 1DEEB 4QOKB 4IS6B 2VWEC 1CGVA 5FM5M 1ZV5A 5FM5O 3LRGA 3EHBD 1PKQA 2CLZA 4PRNA 4HBQA 2X1XR 1FVDA 2IWGA 4PJXB 3TVMA 4ORGA 3TBSB 2BJMH 2OK0H 2NXYB 1S7VA 2BVOA 3HMXA 4NQTA 1I1AB 5I1LB 3WO4B 3IETB 1S7RB 2DWEA 4J4PD 1T2JA 4OF0A 4X6CB 1D6VH 3K1DA 4XWGL 2DQDL 4ZNCD 4WW2A 3O3BB 3VI3F 3KWWB 4RFNC 5A43C 1YQVH 3HE6C 5IB1B 5FEBA 4BFGA 1JPTH 2AV1B 2DWDB 3T0EA 4TPRH 5CP3H 4Y19E 1NCDL 1UA6H 4TUOB 3S35X 4J1UA 1KJ2H 3BRGC 3BT2H 3PXJA 3M17B 4S1QL 3IKCB 4PR5A 2R0WL 3RWHB 3SE4A 3TEUA 1G7LA 5JOFA 4OI8A 4J3TA 3VRLF 2R4RL 4Y19D 4OCNC 1MSPA 3SHSA 5ALCH 4DVRL 2AK4B 1H3UA 3HRZA 4JHZA 1FO0H 1P9MA 5IEHB 3I84A 3VXPB 2BRRL 3BKML 3QRFM 5I8CA 4NQCB 4LLYA 3OKKB 5LBSH 3X12A 3TT3H 3HZVA 4HIJB 1G7MA 3MMEA 3KYNA 4LCCC 5KVGH 3EDFA 5A2KH 1RIUL 1CE1H 4F33A 1TVHB 3GIVB 4TSCL 5EA0L 1FN4A 3D39B 1DVFD 4FXGB 3VXNA 1KELL 2N7AA 4FZ8L 2F53B 2BNQD 4YZFF 1NEUA 4UNUA 2JJSC 4QHLA 1U42A 5JDSA 3QHZL 3QWRD 3SDDD 5I73B 2HFEA 3O6LH 4LEXH 4QHKJ 2JLLA 1PFCA 5E6ZA 4XBGA 1G6VK 1B4JL 3EGSA 3ZYOA 4HIHA 1T6VN 3JWNC 3MUGA 5DMIH 2I24N 4Z7NF 1M7DB 4MXVE 1REIA 2YRLA 5MENB 5TF0A 3ZE2E 3MRGA 4U7SA 5L2KD 3IJSA 1H3XA 1XAUA 5KSBF 4K7PY 1PJ9A 3SY0B 4UUJA 3C60B 5GS2D 4P4RB 3C5SA 1BPVA 4PP1C 5E8PA 2W65B 3RZCD 4NM4L 3WS3B 5D70L 1D9KB 1U8QB 4QRPE 1BM3L 5CZXC 1FAKT 5HJ3B 4KK8C 3BKYH 4PJHA 3L95B 3D5OF 1UQSA 3LS5L 3K8MA 3VWKB 2P45B 4QRPD 2YWZA 2HT2C 2ZUYA 1TJHH 2EDKA 2VABB 2XWBB 5EN2B 3P73B 3QG6B 2VZVA 5I9QB 2PO6A 2QADD 3GSQB 1IEHA 2DQCH 4XVTH 5LWYH 3QEGH 4LU5H 4X6EB 3RUGB 1J0ZA 5C0FA 3IF1A 1KB5H 3MRIA 3ZKXB 2CLRA 1GHFL 3VGGA 5I16B 4WY7L 5F7LB 2HFTA 2C4FT 5IHZB 3EO0B 4PG2A 5CSZA 5E1AA 2PYEA 3IT8D 2GKIA 4PPTA 5I8EB 1U93B 3MBEC 2P1YA 4CADB 4FABL 3VFPB 4UIKH 1NCAL 4IRJC 3QHFL 1DBML 4GKNB 1LO2H 1SM3H 4IMLA 3PNWA 4EEEA 1EEUA 1EGJL 4J3OC 4PJIF 4XNXH 2CKBB 1JCKA 3L3JA 4OCXH 1F00I 4H8WH 4L5FH 3EW3B 4GXVL 1CYGA 1T20A 5C0JB 4G8FA 2VLLB 4PS4H 2J1KA 1BOYA 5T1KB 4AH2A 4ESKA 3QUYB 5GZOD 3FO0L 4JDVB 1CICA 4JFPB 5B8CB 3UTPE 1Y6NR 1CXKA 1I7ZB 3NH7L 1CD0A 2RB8A 1FSKB 4G8IA 1MCOL 1BBDH 4KRPC 3EOTL 1U36A 4D3CH 4IBLT 1SVZA 1GGCH 2J6EH 1YYLH 5FKPB 3FRPA 3CVHL 3GRWH 4S2SB 2WINA 3H9HB 5CBAA 3ZDXF 2OBGA 2AJUH 3BISA 1X5HA 2NYYD 4GQPH 3QULA 3QUXB 3GMQB 1G7HA 1AGFA 3LB6D 3T09A 4DGIH 1K4CA 1XCQB 2JKXA 4JKKA 4LPCA 4NC1E 1MEXL 4Z7VB 1ADQL 1D5MB 3T4YA 1ZGLM 5GZNC 2HFGL 2NXYC 4X6DA 4XPHH 1I1AC 5J6GB 3FFCB 1QA9A 4FS0A 1NCBH 1SY6A 1FYHB 1VCAA 3FQNA 3H7BB 4M93B 5DRNB 5EU3A 3VGAB 4U1LB 5FGCE 3HLAA 5LVEA 4U6XB 3DXAD 2KBGA 1MFAH 4ZUSB 4OZHE 4ODSH 1S7SB 4R7DB 3R4DA 3D25B 3SDYL 1OCWL 4TSAL 3BO8B 1F02I 1TDQA 4ZOCA 5IF0B 3IDGA 5SWQA 5FA3A 2CK0H 3MUY1 3C6SA 1Z3GH 1KT2B 3DVNB 4R7NA 1XR9A 5EU6E 2NR6D 2D0HA 4Z7UB 4Q0XL 1ZHLB 2VZ3A 1I8KA 1J9CT 1ZWIA 3CXHK 5AYUH 4UQ3A 4OD2B 4MNGE 1IGYA 1B90A 3P40A 4NYLA 2UWEE 3O45B 2DM2A 5EU6D 2R1XB 4KMQA 4MA7L 2P5EA 2VTFA 5TJWK 3H3PL 4I5BB 4WI3A 1VEMA 3U6RA 1IGFL 3ARDC 1J1XH 2HT3C 2WWMD 1JHTB 3G04A 4NFCA 3ISWA 1KEMH 3LQAL 3MC0A 4A2LA 2CH8A 2MHAB 1F8TH 5CSGA 4PBVC 4BSVA 3PWNB 3O9WA 5DQJA 3O41A 1WITA 4NZUH 1QBAA 4JFEB 4X7CC 4BH8A 1QKZL 3QUMA 3WXWL 1B0GB 1I9IL 3LKNB 1FG2B 2NY5C 5DYOA 1IT9L 3JWDH 3LKQB 5JUEH 4H26B 3BMWA 3WNNA 4MD0B 4XVSL 1E28B 1KC5L 1AHWA 3DX9A 5IVXF 3TA3D 2BDNL 3DV4A 1IQDB 3DGCR 5AZEL 1XIWA 4PJBE 3QG7L 5H8DA 2VLRB 5I1GL 3GJFA 3WHE1 4PRHE 2EYRA 2A83B 2WM0A 2BVUA 4WTZG 4LCWE 4W81A 3SDAB 4HDIB 4ISVB 1HHHB 4WU5B 3CGTA 3VFWB 1EPFA 4P5TA 4UI2A 2WUBL 3THML 3WNKA 3P4LA 2BVQA 3MCG1 1TQBB 5DRZA 1D9KC 4PRHD 4LCWD 3LAFA 1RIVL 1VFBB 2BSTA 3O0RH 2Y07L 4ZQKA 4QWWD 2DLEA 1W0YT 4WWID 4NDMB 4G9FB 8FABA 2NY3B 2R0ZL 5FHAL 3UTTB 2ZCKH 3P0YH 5JPMA 1G6RH 4Y2DD 3G08A 3TBTB 3C8DA 3V0WH 2IJ0C 4J3XA 3DVFA 2YC1A 1OB1A 4BFBD 4PJ7E 1T0PB 6FABH 5EO1B 3VGEA 1GOGA 5DVMA 5I9QC 3HMWL 3DPBA 5CHNB 1UVQB 4HXBH 4A6YH 1WK0A 4PRPD 4HUMB 3GIZL 1HEZA 2GJ6E 4U1KB 1HXYB 3DARA 4Z0BH 3ZKXC 4Y8DC 3BWAA 4BUGA 1RZJC 5CJQL 5GS0L 4PGJA 1MQKH 1GSMA 4WRLA 5DLMH 3PJSA 4E5XA 3GSVA 1NBQA 3QUZA 4L4TE 4F8QA 1I7TB 1YQ2A 1SJEB 2GFBB 3GBLA 4RFOH 3V4VH 1J0YA 3MRPB 2VC2H 1FPTH 1GRWA 4FQXC 1BWMA 3HC4L 4ZPVB 3P3YA 2CRYA 4HPYH 2GSIA 3JVGA 3ALWA 3PWUA 4R4BA 2YD2A 4L4TD 2EIEA 4D2NA 1T2QL 5ELIA 4M7LL 5F7NC 5FGBC 2EYTA 3RPIB 3RDTA 1ULVA 4H25A 4ZTPL 3VH8A 3KPSA 2XPGA 1HDMA 4Z7WB 5GS1A 4JY4B 8CGTA 4YIQB 4HWZA 1AXTH 5CBEA 4I2XE 4OKVB 1OY3B 4K8RD 1URLA 3QUYC 4OV6F 5IHUL 3TWCH 5B8CC 4DN4H 3IS1X 1OAUL 4GG6A 4WHYH 4XBEH 1ZTXL 1FSKC 1IM9A 1T0MB 4JM4L 4QXGL 4N8VG 5FYJH 2R29H 3PHQB 3B9KA 4PJ8A 1OT1A 3ULUD 1AC0A 4DVBA 4N0YH 1FRGH 1E27B 1V7NL 4F2MB 2DBLH 3C8KA 2XWJA 32C2A 2D03L 5DJ6A 4OI9A 4NT6B 3JWOH 1JTPA 4WFHE 4KPHL 4K07A 1KTKE 3OAZK 5D5MA 1FCGA 1LD9B 3T1FB 3C5ZA 2BVTA 4MXQC 4MNHB 1DANU 5I1HH 3OXSB 5D8JH 4WFHD 5F6HI 4ODWA 5T1MB 5GGSA 2D4DA 4M93C 3VGAC 1NFDE 3AFLA 4GKSB 3DTXB 1VPOL 1NDGA 3G5VA 4X5WA 5GISL 4XAWL 4KROB 4KI5C 1KJMA 3K46A 5CD5C 1E0OB 4YE4H 4JPVH 4U0QB 2AW2A 4RNRB 4YXLH 1BD2A 4UT6L 1QSFB 1M7IB 2QBWA 1KJVB 1AKJD 4O02H 3VD7A 2EDEA 1A7QL 4M48L 5MEOA 4I9WD 3KPMB 4XHJD 4HGWB 4HUNB 5TPWH 3OHXB 4X9GA 1SJXA 4WFFE 1CK0H 3EYVA 5IMKB 2YD3A 3DO7A 4LFHG 4Y4FB 2AGJH 2VITB 3HR6A 4JO2H 5A1AA 3F7VB 4O2CB 1P2CB 1RZKH 4GT7A 2VDMH 1H9VA 1U95B 1JJUA 2AJXL 5J1TC 4X6FA 3DBXB 5FO7A 3MACH 3SKUD 3STLB 5JW5A 4JFHE 5F1IA 1ZA3B 3VXUB 5HGBA 5E08L 4CNIA 4NOFA 1VADB 5ID1B 2FHFA 5CGYC 2FJGA 5I1KH 4IRZL 4RBPH 2V2TA 5ESQB 3BUYA 3VWJD 3GKWH 1NJ9B 4JFHD 5AD0A 2BNUB 4WWKB 4YQXL 3PDDA 1UACH 3O3AB 1N5AA 4YO0B 5JXED 1BQHA 3KHQA 5KBNC 1I1YB 2Z8RA 5JHDA 2W9DL 3CFEB 3D48R 3GHBH 3OAUL 5IW1A 1WBXB 4QTHA 4F9LC 4GUPB 1LEGA 2ICCA 3RWGA 3W39B 3VFUB 4PJ5E 1A5FL 3QCUH 2X4RB 2EE6A 1MF2H 4XPAH 4DUXA 5ESVA 2HJKB 5EZIL 4M8VA 4XP9L 4ZAKD 4LSUL 4X7TA 1C7TA 3MR9B 4X4MA 4N9GA 5INDB 2CDGB 3BPOC 4OUUB 3SGDH 4MA3A 3A6CL 3VFOA 5EWIH 1NFKA 5HDBE 3KPRE 2FZ3B 3PWVB 4P3CL 4TTGA 1U2HA 3SDAC 2ZG3A 4ZYKA 1KIQB 1RZFH 3MYJA 4WO4B 5SWZE 4DN3L 2I60H 3BHBA 4ZUUA 2R56H 1TQBC 3KPRD 3PWLA 3O6MH 4ODTH 3QDGB 3V5HA 3TN0D 1OWWA 1QP1A 4N0UB 1B3JA 2VDKL 2FYYB 4WHCA 5SWZD 2NY3C 2NLJB 1TTGA 4NN6B 4ZUTA 1NFIB 4NQEB 5A16B 1ZSDA 4JPKH 1A4KA 3BGMB 1A22B 1CBVL 3SN6N 1DLHA 1MCSA 4JPWL 3GEWB 4CL7A 3O6KL 1T1XB 3GSXB 3TGXA 1OLZA 1ZGLA 3RJDA 1VHPA 4JGUA 4EBQH 5D7KE 4L4VA 4YXHL 4UIMB 2FX7L 4M4PA 4CVZB 4HUWA 4MLIA 3B2VL 1J12A 4Z0XB 4RGOH 3WDHA 3DMMB 2FEDD 1WICA 2GSGB 3VI3E 2AXFB 1OP5H 3ABZA 4FXKB 4IMKA 5BS0E 4D0BB 2X2YA 2HKFH 3SGDI 3GBNH 4F7CB 5TGBA 3UAJC 4WFGE 1B88A 2HWZH 2I5YH 1DQMH 2WBJD 1RIHH 3PGDA 3F6LA 4XNYL 2EO1A 1SEQH 4O5LH 5DO2C 1QNZH 5KVDL 4LAQH 5BZWB 5DFVC 5BV7H 3R0NA 1JNHA 1SEBA 3D0LB 5ACLA 4JR9H 5F3HA 2VDRH 4OGYH 3VRLE 4NBYB 4WFGD 4MVBD 1WTGT 4Q2ZB 4JLRB 2VL5B 4GSDL 3LKRB 3MBXL 2E7LC 5FHBH 5IJVA 2A9NL 4MXWL 1QRND 3VG0H 4LMQI 2BOBB 3DETD 2LV4A 4DK6A 1MVUA 1AO7D 1NMCB 4BKLB 5BOZG 1INDH 3HI6L 3LV3B 1EA9C 2X4UB 2PR4H 4MQ7A 3VXSD 3MXVL 2GJZA 3X14B 2X05A 3MRCB 4HWBA 1OTSD 2HYMA 4PRAB 3WLWC 3GZKA 4EZMA 1L7IH 5KS9A 3V2AR 4YZFE 1QLFB 2D7TH 3V7AG 4KK6D 4P46D 3V0VB 1P6AB 4APQB 1IBGH 4WUKL 5E4IA 3WFEH 3UJTH 2Y5TA 5EO0B 1WC7B 4HIEB 3FRPG 2ED8A 3X3FH 2ESVE 4LIQL 1FYTD 5D7SL 5J4MA 1J0JA 4P57B 2VZTA 4JM2F 2ENSA 1OP9A 4OCWH 3LKSB 3RVVD 5HDOA 4OM0H 4P48A 4G6ML 1W72H 2W9LA 2NW2A 2C1OB 3MRBB 3UZQA 4KZDL 3C08H 1S3KH 4CW1B 1JWUA 4M6NL 1R3KA 3QZWA 2GEEA 5C08B 1TCMA 2IPKA 4L9LB 3E8UH 4MCYA 3ULVD 1S7UB 4JB9H 3KS0H 2R9HD 5KSBE 1T5WA 1JGEA 2LU4A 3FB5A 1T5XB 5CIPB 3KYMA 3QSKB 4LSRL 5IG7B 1JMZA 3OR7A 4KROC 4LQ1A 1J1OL 4GKOA 3QNZA 5H2BB 3GMRA 4CDGC 2AV7A 1I75A 4CN4A 1B0RA 1Y6KR 5IKCB 1EFXD 5IMMA 2EEBA 1JUFA 3BD4A 1GC1L 1YY9C 1WT5C 2YD4A 1W8OA 3WE6B 5DD3L 5SWSE 2O61B 3SGKA 4H88L 5C0AE 3DIFB 4Z9KB 5CILL 4Y4FC 3L7FA 2X4QB 3DHJA 4HUUA 4Y5VA 5HYSG 4F58H 2Y7QB 1ZLVH 5T1LD 5SWSD 1EEZB 5C70A 2K7QA 5C0AD 1P5VA 3PHOA 6CGTA 5LGHL 3NCCB 3EYUH 3MOBL 1MFEH 4U1IB 4PRBA 1MOEA 5HVGB 1MFDL 2KKQA 2J12B 3VE0A 4BQ9A 4YBQD 3H2WA 4MJ6B 3LHPL 1VERA 3B4NA 5TQ0H 2QQKL 5JW4R 4U6HA 2X40A 2XKNA 3FTGA 5DD0L 1IILE 3LMJH 4KJYA 5E8DL 4WWKC 4YHPA 1U8OB 5C3TA 3I75A 1PKQB 1OWRM 4NC2B 5FYLH 2CLZB 4CBPA 2F54E 3EFDH 5I76B 4HAFA 5DD1L 1FGNH 2IAMD 2VIRB 1I4FB 1CQKA 2IMMA 2PYFA 4YHOL 2BVOB 2JCCA 2G60L 3WS6A 4S0TD 4F3FA 1R3IL 3B43A 2F54D 5GGTA 2C1PA 4P9MH 5GJTL 3KLHD 1K4DB 3E2HB 3DGGA 5D7JD 4WW2B 1YYML 3TIDA 2IEPA 3BKJH 1A6UH 3QFDA 3T0EB 3OJMB 4P59L 3EOAA 3O2DA 4BZ1L 1NKOA 1XZ0A 4WO4C 5HPOA 4PR5B 3PL6D 3UBXI 1IC5L 2WUCH 4QNPF 4YHMH 1RV6X 2XICA 5F1NA 2A6IB 1NCNA 1UWXH 4JDTH 4L3AA 1YEKH 1BF2A 2F8OA 5EZLA 1FLRL 2YKLL 2DMKA 2NXZB 3VG9B 2E27L 2QQNL 4WNQB 3G6DL 1IGTB 3STBA 1HWHB 4U3CA 1ACYH 3HRZB 4MA8L 4NN6C 5EOQL 2AERT 2APTA 1WISA 2ITCB 3F5WA 3OXRB 4ZNEA 1HKLH 2ZNXA 4M43L 5I8CB 2OL3A 4OQTH 5E8NA 3QDJE 3N9GH 4HXAH 1G7MB 5E2UL 3S4SG 5AAWA 3MMEB 3VFSA 2BNRD 5ALBH 1QUNA 4PUBL 4MNQA 4Z5RA 2B4CL 1HN1A 1FFOA 4F33B 1BVZA 5EG6C 4QTIH 4XMLL 1FN4B 3DUHA 1KGCE 3VXNB 2XQBL 4UILH 1BJ1J 2VXUH 4JZOB 3VU2A 1QO3A 4Z78A 1A7PL 4F7MA 5KSUB 3RU8L 5JDSB 5I19H 5IBTH 4X5LA 4J12A 2HFEB 3FAXA 2XA8L 4YAQB 4OT1L 2NY7L 4NQDA 2FWOA 2DL9A 3MV9D 3WL9B 1OGAA 2H26A 4G6FD 4X4XA 4XBGB 2OCFD 3QQ3B 3EGSB 4LSSH 4HIHB 2W9EL 1MFNA 1XGTA 1FNSL 5E7FA 5FCUL 3MUGB 3T8XA 3MV8D 3V4PL 1QVOB 5LGJA 4RFEA 4OCRL 3IJSB 4LNRA 5F9OH 3CK0H 3GGWB 4XH2B 2X44D 5E9DA 1JZ8A 1NMCC 3VH8G 3C5SB 3WFCL 1FFNA 3QDME 5F96H 4GRWE 4RGNE 3EOBA 3GSNL 2OZ4L 3BJLA 5D1QA 3RRQA 5DJYA 1A9EA 1NSNH 2E9JA 3FQRA 1JYWA 2HRPH 4PJHB 1T03L 4UU9B 3QDMD 5C09A 4RGND 4APQC 2RR3A 3P9MA 5GGRA 1KIRB 1PYWB 3O81A 5EU7E 3OKOA 4M7ZB 5K9QG 3RL1B 1UM4L 3KNBA 2VDLH 3NAAL 3PXHA 5LCVH 5INCB 2C3XA 5DC9B 2ZUWA 4OCSH 5C0FB 3IF1B 5GHWH 5IBUB 2G75A 5IVXE 3L3KA 2H6PA 3P9LA 5E4EB 4L9LC 1TETH 1I9JH 5CSZB 4AIXA 3MGTA 1KCUH 4ZS6D 2XIDA 4P2CG 1T1WB 4N1CA 4X8JA 4P5KA 4KKAC 1MI5E 2Z31D 3GMPA 4IMLB 2YR3A 1YEDA 1VFAA 3KYOB 3PNWB 5DRWA 1CGYA 3RNKB 5HVWA 1LEIA 1K8IA 3G6JF 5KVFL 5T3XH 3BW9A 4HLJA 4JPIA 2BNQB 1MI5D 5ERWB 1MH5B 1E6OH 4GOSA 4FQQA 1CR9L 3SDDB 1ZLSL 1G7JA 1AJ7H 1T20B 2CK2A 2AJ3A 1A7NL 1LHZA 2E7BA 1VENA 1F4XH 4I1NB 1U8JB 3K8LA 4JHWH 3PP3H 4AH2B 4RMTA 5DUPH 3PWPA 3SDXA 1CICB 5JNYB 1BP3B 1EXUA 3CFBA 4GAYB 5GS0D 4DQOL 3REVB 2X4TA 1UEYA 4KHTH 2OR7A 4MD5A 5C0IA 1RZJH 5L2KB 4Z77B 2VXQH 5IWLA 1EIBA 3WNPA 3W11C 5IR1A 2R2BA 1F58H 2P46B 1RUPL 1YA5A 4EIGB 5T33L 3T0DA 2AQ3A 4DJMA 1BQHG 4UQ2A 1H8SA 1JWMB 4LLWA 5F9DC 2B8OT 3QPXH 3Q6FA 1T7ZA 4OM1L 3T4YB 3TVMC 5HI5D 2GITA 1DFBH 3PQYD 2WAHA 2DQEL 1MIEH 1FO0A 3UO1L 1IAMA 1QA9B 1S7TA 5A2IH 1J7VR 1Y0LB 3FQNB 4GS7B 5EU3B 2XKSA 3DJ9A 4K3DL 1J8HD 1VDGA 1NL0L 2F5AL 3L3OA 5JO5B 2H2PD 1LO5A 1LWRA 1ZMYA 4R90H 2CKBH 4WW2C 1NGPL 3DX6A 4MJ4A 5ICYB 4ZFFB 2QADB 3T0EC 1F3DH 3IDGB 5EU7C 4WUUA 4HJ0D 5C6TH 2N7BA 3KXFA 3IGAB 4PB9L 3FHQA 5A3IC 1I3GH 4WCYL 1EZVY 3HNVL 3SE4C 3CSPA 1XR9B 4NCC1 1UB5A 4PIRF 1K85A 2PXYD 3L1OL 2NXZC 1I8KB 3VG9C 1ZWIB 2PYEE 2GYSA 3LH2L 3GHEH 4TRPL 4TNVF 3ZMRA 1UM6L 4NYLB 4YDKH 1P9MC 1BJMA 5D93B 1MHPL 1RY7B 3CVIH 1I85A 1I1FA 3NGBB 2P5EB 1S7XA 4K9EC 2E8YA 3G04B 4I3GA 2EZ0D 5CJBA 3WFDH 5IGXH 3MCKA 1XH3B 4JVPA 3HA0A 1JPSL 3GK8L 3HR5A 4U3XA 3TESA 5DQJB 1A1OB 1LEKA 3GI8H 1INQA 1MRFH 2NX5E 1FIEA 5EU4A 4HKXA 3EYQC 3QUMB 4X7SL 5HYJA 3O6FA 5IBLC 1RJLB 3UC0H 5HD8C 5DYOB 5AWNL 4KTDL 1BZ7A 4G8GD 3V7AE 2NX5D 1KCSL 2P47B 4Y1AD 2VR4A 1AHWB 3TV3H 1UG9A 4LLVB 3T1WA 1KCVL 3ECBA 4ELMB 5FCSH 5JA8B 1XIWB 3MRNA 3GJFB 3TJEL 2QJDA 2EYRB 3I6GA 4FQLH 1GYAA 1KB5A 1BZ9A 2F74A 4U1NA 1BIHA 1OARH 2F58H 3S34H 2J88L 5M94B 4GW5A 1CZ8L 3MNVA 4QGTA 4N8PA 5IB4A 2BVQB 5TF1L 4JQXC 4P2RA 2BSTB 2EH7H 3B6SA 4ZQKB 3RKDD 3DXAB 8FABB 3O2VH 1JNLH 4Z7QF 1J18A 2VLJA 4WJ5A 2SEBA 3ZO0A 5GSVA 4MAUH 1OB1B 1T1ZB 2R2EA 4FFYL 1AC6A 1IAIM 3FN0H 1UXSA 4W4OA 4UNTA 2YUXA 2PO6C 3EDJA 4K7PL 3SJVE 4L3EA 4TTDC 5FO9A 3MFFA 3QA3A 4XCCH 4NWTL 2YZ1A 4JFXA 4WVRA 3RGVD 3QDAA 3QZWG 5E4EC 3A67H 5AUMA 4HJJL 2VR5A 3PP4H 3IJHB 5SX5K 3BIBX 3DI2B 4PG2C 3F7RA 3SJVD 3PJSB 3VGDA 1FFQA 5GGQL 1IGIH 1AI1H 3QUZB 1H3VA 3MLVH 4NJAL 5C0ND 4R4NC 1RUAL 3U7YL 5MHSE 1UYWH 4F7PA 3IDXH 3NIGF 3P11L 5J13B 3ARPA 5KANG 2DB8A 3BH9A 4LL9A 3QEUB 1IFHL 4O51B 2GSIB 4HS8H 5BZDB 5T3ZH 5B21A 3ZKMD 4JANB 5C07A 4AL8L 4ZD3H 4RMVA 2WIIA 3RDTB 1JBJA 4H25B 5DRXA 2ADFH 5GJSL 1XGPB 3V6BR 1LGVA 5KSVA 1BECA 4N0CC 5I1JL 3MLWL 1YY8B 3TYGL 1A7OH 2P44B 4OD3L 5CBEB 1NGWA 3CNKA 1CICC 4OF5A 3BP4A 4RRPA 5E70A 4D0DB 4Y16A 3NACL 4DZBA 1ETZB 4GG6B 1JK8A 3RY4A 3QPQD 4OIIL 1IM9B 2BVPA 5HXMA 5F97E 3B9KB 4PJ8B 4V1DD 3UJJL 4DVBB 3DWTA 4XWOC 2DQHH 4LLMA 32C2B 4JY5L 4XCFH 3SKJL 3EO9H 4RMSA 1U8HB 4YHLH 5DK0A 3EYSL 2XN9E 4OTXH 3M45A 3MJ6A 5JMOC 5KN5A 4DAGL 5BJTA 3PWJA 4HQQL 2IAND 5D5MB 1IGCH 3AS2A 3HI5H 3T0VA 3RAJH 3C5ZB 4PY8I 2BY1A 4LPYA 1N2RB 3SE9H 3AS0A 4JRXA 1MJ7L 3CMGA 2BXZA 2I07A 2XN9D 4ZTOL 1J1PL 3GNMH 5GGSB 3NIDF 4GS7C 4XCYB 1HHJA 2J8OA 3U7WH 1NDGB 4X5WB 1D5ZA 5ENWA 1KJMB 1S9WA 2Q3ZA 3Q0HA 2HVKA 4MQTB 5L9DH 3BZ4A 1BD2B 3BEWB 4OF3A 2I9TA 4U2ZA 3D6GA 2BCKA 3QXDA 1JZ7A 1HI6A 4PRPB 4YGVA 5MEOB 1BQSA 4Z95H 3SDXF 4HSQA 5ICXA 2VXVH 1INEH 1YPZA 3EYVB 3DO7B 4M61A 1VESA 2JTDA 2BJML 3GSUA 4CVUA 1KACB 4QKXB 4WI5A 5SV4A 3ARRA 3CPLB 3Q3GA 2V9QA 1A7RL 2J8UF 2WBKA 1MELA 4LF3B 1KV3A 1VACB 2EDHA 1XMWA 1ZT1B 2OJEA 5CZVH 1D6VL 5EUOB 5C86A 4CN6A 2EDTA 2VZUA 5DHYA 5HGBB 1F2QA 4JZJA 1Q8MA 3H6JA 2BMKA 3NGBC 5B22A 1JPTL 4TPRL 4L4TB 1YN7A 4JM2D 4CKVX 4PTTA 2CR6A 2V2TB 3HCVB 1KJ2L 2C4FU 2YD7A 1X6LA 1U92A 3BUYB 2Y9RT 4XGZB 5DMGD 3QCTH 2IH1A 4XPGH 3GM8A 5AD0B 4NP4L 1CGTA 4XP1L 1X5AA 2OS7A 3ARTA 1TZHB 1YEEH 3KPSE 3L5IA 1P1ZB 4XC1H 3QBTB 1OTUD 1UZ6E 5ALCL 4NGHL 3ZDYF 2D0GA 3OPZH 4P9HH 3QI9D 3QO0B 3RWGB 4H0IA 3ZKQD 5IP4A 3QUKB 2KL6A 1KN2L 3VI4F 5IESH 5CEZH 3M8OH 1G6RA 3HUJF 5J3HC 3AS1A 4W6WB 5LBSL 2UZIL 3QIWD 1QEWB 4X7TB 3N1FC 4PB0L 3EJYD 4N9GB 1AHWC 2DKSA 2AJSH 2H1PL 2FLBT 1IGJA 4JVWA 4X6BA 2CGRH 4M3KB 5KVGL 1NC4D 3HTLX 1CE1L 3MA9H 1XIWC 5F1SA 4Z8FH 1HZHL 4A6YA 3U36A 2X7LA 4OJFH 2FJHA 1CXHA 1DBAL 1ZS8A 2D9CA 4DEPB 2HRLA 1H3GA 4HMEA 3BHBB 3O6LL 3X13A 1NCTA 3GMLA 4JVUA 3V5HB 5CMAA 3RPKA 1FDLH 2J2ZA 5K9KA 4U1GB 4TQEL 3FB8B 5GQBA 5FOBA 4ZUTB 4QXTA 1E4XH 2HMIC 4RQQB 1MHCA 1F3JB 4LLDA 3BQUD 5DMIL 1BMGA 1DLHB 1AKJB 2X4PA 3TNNA 4U31A 4M02A 2MSPA 1ZGLB 4MAYD 4L4VB 3O4LD 4XNUL 3MOQA 3D0VA 4KKBC 1WFUA 1YC7A 4OLUH 3ME0A 43C9A 1MRDH 3C09C 3W5NA 3H0TA 5TGBB 3UPCA 1G9NC 1NAKH 2KPNA 3BKYL 3F58H 4HUXA 2FJFA 1N3NB 2DQGL 5I15L 3QUZC 4LRIA 3P77B 1EAPB 4QNPE 3ILPA 1JNHB 1SEBB 4BK4A 1QBBA 5E5MA 5J13C 5F3HB 3T3MF 1PAMA 1D5XB 1PG7H 3BXNB 3BRDA 3VWJB 1A6PA 3JVGC 3JUZA 4TULL 1LK2A 4HK3N 5LWYL 4OQ1A 1FQ9C 3H9SA 5IJVB 2B7DT 1KB5L 4X5XA 3RDTC 1E4XI 1MVUB 2AVGA 4KTEH 3ROOA 4X98A 5JHDE 4LP5A 1GZQA 3NZHL 4ALAH 5GS1C 4OGAD 3QIUD 1G84A 4MQ7B 4KI1A 2GJZB 2VMFA 3EFFB 5JTWA 5I66A 4P23A 2P24A 1K8DB 1I3RA 3ARGA 4ZAKB 4LGSB 3KHOA 1LO2L 1SM3L 5KS9B 4EI5D 1BFOB 2VXSH 4X4ME 4NIKB 5F7DA 1SHMA 3EKCA 4KMTH 3LN5B 1X5GA 3B9KC 1A4JA 4PJ8C 1CFTB 2E9IA 4I0PA 4UV7L 2RFXA 3SPVB 1YEHH 4N1EA 4PYGA 5I6XB 1S9XA 4L5FL 1MUJA 2DD8H 1NAMB 3K74B 5F21B 3MLXH 4L29B 4NNXA 1L0YA 1PQZA 4PS4L 5E6IA 3C5ZC 4UDUB 1JWUB 4HKJA 1MCQA 1WFNA 2IPKB 5D1ZA 3TZVD 3B2UC 2EEAA 3MJ9H 5IQ9A 2XWTA 2ENYA 3EDDA 3KYMB 1ZT4A 1BBDL 4LSVH 3MPCA 3OR7B 4NHUB 4D3CL 3KLAA 3QNZB 2AV7B 2J6EL 2YN5A 3GSWA 5EFIB 1B0RB 4KJQC 2ZJSH 1K3ZA 3T0BA 3GRWL 1JUFB 2AJUL 4ZDHA 4PV8A 3T2PA 2R1WA 1O7VA 5I2IA 1NDMA 5I1CL 3C2AH 4ONOA 4S1RH 4X99A 1TNMA 5DZLA 4KKCD 3L7FB 4G7YL 4K2UL 1WUNT 2DRUA 3QNYA 1MFCH 2XTJB 4PJ9D 4XPHL 4Y5VB 4CVWA 2WBJB 3N1PC 1NBYA 1AD9B 2H2SC 3WEXA 1NCBL 4Y88A 1LE9B 2C3VA 3EOYG 3I2CH 1F13A 4PJGA 3MLRH 4WHTA 4FG6D 5MEPA 4PRBB 2R2HA 3QAZC 3QNXA 2ADJA 3VE0B 3B8SA 3SKMA 4XRCA 1QRNB 4U6HB 1RQ5A 2XKNB 3FHAA 4IIQB 4KJYB 4C56A 1CU4H 1AO7B 5DHXB 2ADIA 5C8JA 5DQDL 1SMOA 3VXSB 4L3CA 3HNSH 5AYUL 4AMKH 2Z0BA 3B83A 1VFOA 3WD5H 3MTRA 2PYFB 3BRFA 2EH8L 3IAQA 4H5SA 4P46B 4F3FB 5HY9A 5AG9A 4ZXBD 2C1PB 1YPZF 43CAB 3OTTA 2P4AB 2Z9TA 3DGGB 4OZIF 1KEML 5K9OA 1FJ1A 1FYTB 1RUKL 4NHCH 1RZ7H 1F8TL 2Z92A 1H3PH 1OTTC 4CRPA 2NY0B 1DQDL 2OTUA 4UB0H 3UYRL 3EOAB 3K2MC 5GRZA 4DEPC 4JFZL 1A2YA 1PSKL 1T66D 5L88H 4P0DA 4KC3B 4X9IA 4UTBH 3LS4L 5F1NB 1DQLH 2J4WL 2VSDA 3JWDL 5D7LE 4JRYD 5EZLB 5JUEL 4X80L 4YEFA 5C2UB 4U1GC 4XNMA 3DLQR 1S7QB 3WKMH 4PJFF 4AIZA 3F5WB 1U8LA 2OL3B 5D7LD 5I1IL 5E8NB 5ADOH 4JKWA 3MCLH 3GKZA 5FV2A 4NO0D 4MNQB 5CP7A 4Z5RB 1BVLB 5D2LF 1UENA 2P8PA 2HN7A 3KPPB 3HMXH 1F6AA 4QF1A 5GRXG 1J0IA 2ATPA 5JQ6L 1BFVH 2FH6A 3VXRA 4TVSa 1QO3B 3G5ZA 2FBJL 4F7MB 5SWSB 1GGIH 2D31A 3MV01 4OB5H 9CGTA 2ORBH 1KTDA 4PJCB 1MIMH 5IIEA 1FFPA 3NN8A 3P0YL 4PJDA 4NQDB 4ZFOL 4ZFZA 1OGAB 4XZUA 2CO6B 3HE7A 6FABL 5I1AA 1MLCB 5F9JA 1DQJA 1OAKH 4KKLD 2JJUA 1H5BA 4HXBL 1T04A 3T8XB 1RSFA 2X89A 1FL6A 1GOHA 2HH0H 2HKHH 5JXEC 3IS0X 1CGSH 1EHLH 3LEVH 4Z0BL 4RFEB 4MJIA 3OSKA 5E9DB 1QSEA 1JVKA 2PKDA 5DLML 1FFNB 3VRIB 2Y23A 2D7MA 1NGZA 1CL7H 2IQAA 3EOBB 3PIQB 3JTTB 2JCCE 4K9EH 5JLZB 4ZFGH 4ZAKC 2GTZB 4PP2A 5DJYB 1A9EB 3FQRB 5DXWA 4RFOL 3S35H 3V4VL 1FPTL 2Q3AA 1J8KA 1MPAH 4PJIB 5D7JB 2A1WH 2JIXA 4GRLD 5C09B 4N8CL 1MAMH 4JRWA 2VLKA 4GMTL 4UV4H 1MVFA 1CFSA 3OKOB 5I6XC 2X42A 2X4SA 1MAKA 2Q6WA 1XF2B 3PL6B 1HINL 3KNBB 1P7QD 4XP6L 2MCPL 4CGTA 3QCVL 2VKWA 2H6PB 3P9LB 3TWCL 4U49A 1PGRB 1C12A 1CWVA 2V7HA 4DN4L 3MGTB 3MXWH 4XI5C 5D7IF 2W60B 1TCRA 3OR6A 3UBXA 4XXCA 1EERB 2BHUA 3LCYA 1X4ZA 4GG8A 4X8JB 2IBZX 4N0YL 4P5KB 2BNRB 2DBLL 3GMPB 2PTVA 5DJ0A 1WBZA 1CL7I 4CVXB 4EI6B 4EXKA 1YEDB 1VFAB 4KV5F 1YMMA 5DRWB 1GJIA 4PGEA 4I3RL 1OAQH 1Q72H 1GZPA 3J8F7 3MLYH 1LEIB 1P53A 1K8IB 1P69B 1FAIH 4LARH 4Z7QE 1OQXA 3U4BL 3P4NA 3SGKC 3GMNA 4JPIB 4QYOB 3VFTB 5CGTA 5I1HL 4IRJA 4DKDC 4FQQB 4IJ3B 1IAOA 2XTJC 1G7JB 4NRXA 4Y5VC 4TUKH 2AJ3B 3NA9H 4YFLI 1I8MB 2VQUA 4OAWB 3BPCB 4L8CA 1JHLH 1JN6A 5IM7A 3MV9B 3OJ2C 2G9HA 2AI0H 1BAFH 1EXUB 4WI9A 5HHNA 5DMYA 3CFBB 4YE4L 1AIFA 4JPVL 3OKDB 4S10A 1ZLWH 5KSAA 3FQWB 4Y4HD 1ED3A 5JW3H 5GRVL 3IJYA 3MV8B 4NQUA 1OGTB 5E2WH 5L0QC 1NC2A 1PEZA 4M5ZL 5C0IB 4BSJA 2Y06H 1IKNA 4LSDA 1EFQA 4YNYA 1JWSB 1KLGA 4GFTB 1JV5A 3EJZC 5IR1B 3S3JA 3H42L 3K4DA 1I7RB 4JO2L 4HUKB 1V3KA 1KJ3H 3Q6FB 1WZMA 1B2WH 2VDML 1VB9A 2LVEA 2ADGA 1OW0A 1FO0B 4G3YL 5HHOA 4DKFL 1U8KB 4YH6A 3WS6C 4QOKA 1HNFA 2IG2H 5CEXA 2V6HA 5DJCA 2NY6C 4OQTA 5I1KL 4EUPB 1RD6A 1LNUB 3L3OB 5CFHA 4TVPH 4P4KA 5DA0B 2W0FB 4KVNH 3GKWL 3TBSA 4OD1H 1L0QA 1QD0A 1UACL 2GUOA 5JR1H 2NY0C 5IB2A 2OP4L 5F7UA 2OTWA 5I1LA 5F7YC 3QEQA 3IETA 1A1MB 1S7RA 4P2QE 3AY4A 3OKMB 3UTQA 1IGML 1JF5A 3GHBL 3VXQA 1WWBX 1U0QA 3DYMA 3ULVC 1UB5B 3QCUL 4OLZH 3O3BA 3KWWA 5D1XD 1MF2L 4XPAL 5T1DH 4O58L 4HS6A 4P2QD 4TUOA 4TSBH 1MRCH 2VUYA 4GAGL 3D9AL 2VSCA 1I1FB 4E41E 5GS2H 3NCMA 4LGPB 3RWHA 3GFUA 1WAAF 1I9EA 1FH5H 4OFYD 1S7XB 3BAEL 3DVIA 1A9BA 3MCKB 4LCIH 4LOUC 4E41D 2BC4A 3HR5B 2I60L 2C26A 1YEIL 1LEKB 4HC1H 1J11A 2HAZA 3OX8A 1LK3H 3B9DA 4ODTL 5EU4B 3OKKA 1LO3H 4HKXB 3D2UA 1EDQA 4PRIE 2PN5A 5HYJB 3RBSA 4J8RB 5FA4A 2A9MH 5AZ2L 3PWPE 4LHUA 5IB5A 3SDXE 4G5ZH 5CLTA 1GGTA 1J86A 4B50A 4WHYG 5I18H 2RCSH 3GBMH 1TVHA 3GIVA 3VFVA 5H37H 4MGXA 1NLDH 4FXGA 4PRID 2F53A 3L9RB 1AE6H 5F6IB 1KPUA 5T5FH 1MAJA 3MRNB 4KVCL 3QJHB 2F74B 4KJWD 2HKFL 2KZWA 4LLAA 2AQ2A 3GBNL 3DURA 3TFKD 3D1MC 4ZODA 1LO0H 1TENA 2I5YL 3PQYB 1TZIA 4GW5B 2ICWA 1SJHA 5IB4B 1SEQL 1P7HL 1X9QA 4LAQL 5K33A 3VDBA 1YEJH 5I17B 1M7DA 1Z2KA 3B6SB 3UPAA 1J8HB 1OSZB 3IAPA 2XZAH 3V52H 5KOMC 5D7JC 2VLJB 1T80A 2RGSA 3IKKA 4WJ5B 3C60A 3DUUB 1VGKA 4M1DL 3ZDYE 1XGRA 5EBLB 1AXSB 3X3GH 4W4NA 1N4XL 5F7KC 1UJTA 2R2EB 3U9PH 3VI4E 3HPJB 1U8QA 4RISL 1NCWH 1UXSB 3QUMH 3HUJE 4WUUE 4FZEH 4BZ2H 2H32A 2ZSVB 4L3EB 3KXFE 4YDVA 5FO9B 3MFFB 3QA3B 4LK4A 3FRUB 3I6KA 3FQXA 3L95A 4QRTB 5ADPH 1KPVA 3HAEH 1FE8L 4JFDE 2PXYB 2ARJQ 4JFXB 4OLEA 3S98A 2UYLB 5E94A 5A2LH 1D3CA 2O93L 3VWKA 1IEBB 3QQ4B 3O3DA 5AUMB 5KG9B 5DVLA 4EDXA 1MWAL 2XWBA 5EN2A 1L7IL 1EJOL 3P73A 3QG6A 2DMBA 5EU5A 4CDHA 1HYSD 5CCKH 4JFDD 4P2OA 4LPVA 3GJFH 2G5RA 3RUGA 2MQ3A 1CFNB 5I16A 2IALB 1JZ6A 3ZHLA 4KXZH 4JQIH 2EC8A 2L0DA 4GBXD 4OCWL 3EO0A 1NCCH 4EDWL 3QJFB 5C07B 4OM0L 1UEMA 3GSRA 5CZKA 1W72L 3AS3A 1WSST 4MS8D 1ZANH 2WIIB 5I8EA 1U93A 3MRDA 1NGYB 3VFGH 3CFIC 3VFPA 5DRXB 5ABDE 3MGOB 4G42A 3E8UL 4QCIA 1CF8H 5KSVB 4JB9L 5EBGA 2XFXA 3DRQA 4U6YB 2WLYA 4G8GB 5B39A 1U58A 3BP4B 4HG4J 3R0MA 5TFSL 4KQ4H 4Y1AB 1EO5A 4Y16B 4DZBB 3A6OA 1JK8B 1X3DA 2VLLA 5L6YH 1A3LH 1ZKAA 5T1KA 1DBBH 1Z9SA 5E00A 4LLMB 3QUYA 4IM8A 4JDVA 5IWLC 3QB7C 4TUJA 3C5JA 2ZPKH 5DK0B 3T3ME 1I7ZA 4HKBB 2GTWA 2NW3A 5DK3A 3R8BB 1JGUL 3BN3B 4KXZI 1ERNA 1DN0A 4P2RE 3OJDB 3CJJA 4JRXB 4BYHA 1QFPA 5DK2B 1XGYL 4OFKA 4QHKI 3SCMD 4M5YH 4S2SA 3H9HA 1HHJB 1C5CL 1MCEA 3QUXA 1L6ZA 5CUSH 2AEPH 5C9JA 2P48B 1S9WB 3VXOA 5TQ0L 5FK9A 1ACZA 2HVKB 1BJ8A 3WHXB 3LMJL 1G9MC 1L0XA 4KK5D 2I9TB 3SBWC 2BCKB 4QT5A 3QXDB 3S37H 3T77A 1BQLH 5J6GA 1HI6B 4YGVB 5F89A 1I9RL 3H7BA 5DRNA 2WQRA 1FGNL 2KH2B 1NMBL 4M61B 2AEQL 3MFGB 3PV6B 1S7SA 4R7DA 2VO5A 4BM7A 1AFVL 3D25A 3Q3GB 5IF0A 2OJZH 4S1SL 3ARUA 2OJEB 4ZPTB 1CIDA 2CPCA 1XEDA 1I85C 5DHYB 3WIIL 2BFVH 4JZJB 3DVNA 4YHKH 1DZBA 3BKJL 5DQ9B 2NZ9D 4J23A 4Z7UA 4PTTB 2EECA 4N90D 2IH1B 1AD0B 3LDBB 5SX4H 1OM3H 3RWEA 2WUCL 1II4E 4JDTL 2JJVA 2NY2D 1YEKL 5C92A 1CDUA 1QBLH 3MLZH 5DD6B 3O6FC 5F7WC 2ZUUA 1ACYL 4JREB 1B6UA 4JN2B 4PJXF 2KUTA 4FFVC 2X6MA 2MHAA 4WEMB 1G6RB 2XY2A 1V8HA 1F4WL 4LRNH 2YSSA 5F1OB 4F7TA 3PWNA 3KYKH 4WENB 4FTVA 3U30C 3OKYA 4HV8A 4V1DB 3N9GL 3F7PC 3CC5B 2F8XC 4M7KH 4X6CF 5ALBL 2R2CA 3H9ZA 1U3ZA 4X6BB 2P8MB 1ZE3C 2IFFL 4NM8L 5BO1L 4QTIL 2X7LB 3LKQA 5DT1L 3QIBA 2IGFH 3VW3L 2FJHB 2IANB 4UILL 4HWEH 1ZS8B 2H8PA 3UJIH 3QQ9D 1S7WA 5E0QA 4ONHB 5F7HA 2GIYA 5EIQA 5I19L 1E28A