3ZTJG

Structure of influenza a neutralizing antibody selected from cultures of single human plasma cells in complex with human h3 influenza haemagglutinin.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
129
structure length
129
Chain Sequence
QVQLVESGGGVVQPGRSLRLSCAASGFTFSTYAMHWVRQAPGKGLEWVAVISYDANYKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDSQLRSLLYFEWLSQGYFDYWGQGTLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMAGGLUTININ HA1 CHAIN
publication title A Neutralizing Antibody Selected from Plasma Cells that Binds to Group 1 and Group 2 Influenza a Hemagglutinins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/viral protein
total genus 18
structure length 129
sequence length 129
chains with identical sequence I, K
ec nomenclature
pdb deposition date 2011-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ztjG00
4ODHH 4X5LA 3PABB 2FLBT 4HW6A 5GGTA 2X1WL 5CCKH 1ITCA 1AHWB 2YD7A 4I2XA 2DL9A 3TO2A 3QWQB 2FJGA 4KUCD 1OVZA 1UYWH 3PUCA 3FB6B 3PWUA 4P5KA 2H8PA 5F7DA 3ZTJG 3TO4D 2I5YL 4BK4A 4X7DC 2WUCL 4ZPVB 3VGGA 5J13B 2Q8BL 2J12B 4YFDB 5HHOD 2VZVA 4EXKA 4QXWA 1QSEA 5E94B 1L7IH 2LU7A 4ISVA 5DJ0A 1KC5L 3KYKL 1RZJH 1NBYA 4BQCA 1DBML 4F7TA 2QQKL 3GHBH 4YBLC 1KTDB 3MCG1 4HKZA 5SX5K 4R0LB 5HI3D 1P7KA 1AQDA 3C8HA 1U8LB 3DUUB 4G9FE 2BVPA 4OCRH 4OTXL 4N9GB 4S1RH 1GGIH 3ZL4L 2X4OA 4UOW0 3MBED 3WO3B 3GM8A 1IGYA 1J1PL 2LV4A 3EDDA 3HZYB 4HCRH 3RWDB 3HR5B 2GSGB 4NUJB 5I1KL 1FC1A 5B4MD 3ISWA 3KPLB 3WBDA 3LHPL 3QAZC 4I77L 3GSRA 4PJDF 3QHZH 4JG1L 4RGNB 3SE8H 5B8CB 1MAMH 4OSUL 2X10A 3LVEA 4U6HB 3Q3GA 4Z0XB 5JZ7C 3MFFA 3JWOC 1FL5B 4I5BB 1MCPH 4POZD 1CDGA 3L3IB 4LCWD 5IV2B 3MUJA 4NC1C 4JVUA 2GTWA 1KPVB 4AZ8A 2BSED 3LRGA 1C5DA 1OAYL 2CDGB 3BQUB 3UMTA 2E8ZA 1VEMA 3MBXH 5KSBE 3OJ2C 2DKUA 1P84K 5L0QB 1RHHA 5T33L 5GXBB 2CIKA 3HC3H 4IIQC 5IVXF 1A47A 5DO2D 3MGOA 1QPPA 2AGJH 4M6AA 3QDJA 1H5BC 4S0TD 4Z8FL 1MQKL 4YXHH 2BOCA 4XCNA 4WFEE 4EUPG 1WIPA 2GI7A 3VXUD 4QXGH 2Y6SD 1GHFL 5J6HA 4BSWA 4JFFE 4ODVH 3QUXA 4NC1E 4M48H 3MRMB 4MSWB 4JN1H 4NDMA 2AK1L 2OTPA 1A6PA 4C55A 1LE5B 3TLRA 5JA9A 1F11A 5E7BA 3REVA 3MYJB 1DEDA 4L3EB 1R5VB 4MQXC 4ZQKB 5D2LA 1ZA3B 3U2SA 1SEBB 1X5KA 1G9NL 4RWYL 5E5RB 4OD2B 5HYFA 3EDFA 1K6QL 4Y4KA 4N8CL 1OAUL 3L6FB 4PJXA 3TJEL 4BM7A 2JB6B 3MLSH 4TQEL 4Y0GA 2AXGB 5FV1L 2C4FU 3TWCH 5HD8D 3WLBB 4KVCL 4RRPA 4BSJA 1ZSDA 1A9BB 5IB4A 3ZT5A 3CSBA 3P30L 2DM3A 1LEGB 3QDMB 4X83A 1FNGA 3WUWA 5DVLA 5GGVY 4FQJH 3NCYP 1MPAH 1DE4B 3DX8B 5DRWA 1YY8B 1SJVA 2YK1L 2FO1A 4HKBA 2DRUA 4OGAD 4OKVB 3DSFH 2IBGA 3DV6B 4NNXA 1RJCA 4K94H 1YPZE 4S1QH 5C0CA 2NXZB 3PP3H 4V1DD 1ZS8A 3THMH 2GCYB 5GHWL 3IDGA 3PP3K 1ZLUH 3IFPA 1OGAB 4P23C 4PRDA 4Z7UB 4WUUE 3EFFA 4PJEE 5HGBB 5A2LH 4KZDH 1J87A 3CGTA 4TSBL 3RDTA 4HJJL 5C07E 1TVHB 5E2UL 4H1LA 3KJ6L 1FFNA 1Q1JH 2Y5EA 4W4OC 4HC1A 2VDKL 1HZHH 2MNUA 1CG9A 3W39A 3K8LA 1U8KB 1ZEAL 3W9EA 3I85A 3NA9L 2BJML 3UO1H 5C92A 2HTLD 2YR3A 4KJQD 1YNTA 1FH5H 1IEBB 2VLMD 4F7PB 4X7CC 2VH5L 3GB7A 3CXDL 5MEPB 1FL3A 2R0LL 2R1XB 3ROOB 3ZE0F 1E28B 3F6IA 1HWHB 4P3CL 4BYHA 4N0RA 5SV4A 3VD7A 4YXKL 4YAQA 2IFFL 1MFBH 4JDZA 5D93C 1DLFH 1PDKA 2CRYA 1JVKA 2CXKA 5DTFA 3DHJA 3N85H 3QEUA 2YSSB 1DJSA 2R8SL 3U4EA 2HVJA 5F3HA 4GOSA 4Z7VE 2I07A 1HHGB 3LKNA 1NCWL 2YD3A 4QXUL 4DZ8A 5FECA 4GRWF 2DWDA 4DFIA 3LKSB 4MJIE 5BV7L 1HSBA 1IKNC 4RGOH 1UB5B 3PHOA 1J88A 3HI6H 1A3RL 3VH8G 3P9WB 4OI7A 4KXZH 4OZ4A 4M62H 3CFKA 4P5TC 5E1AB 3RWGB 2IQAA 4GG6A 4WDIA 1X9QA 1JV5B 1W0YT 3CVHA 3ABZA 1ZLVH 2PYEB 4DK6A 3O45A 2WBJC 4NM4H 4Y5XC 1FO0H 3T2PA 4ZTOH 3L3OA 4PS4L 3MLRL 3QIUC 2CRIA 4UV4H 1I3GL 4K3JL 1VGKB 3IVKA 1JN6B 2VLRA 4M1DH 3DVGB 3U4BH 3VGEA 4Q6YA 4LL9A 1WLHA 5DD5L 3RKPA 1VFAA 1X5XA 4NZDA 4CNIB 1UXSB 5KVEH 3CLEL 4QRQB 5BMFL 1PKQE 4N0CD 3CAFA 4PLOB 4OF5A 3S5LA 3KS0H 5D7JC 5FGCB 3MV8E 3BYTA 4H5SB 2XXCB 1OD9A 4HWEH 1TITA 2DQUL 5DLML 1UJ3A 2NY2B 1SJXA 3UTTB 3U30C 1S9VB 2YMXL 4JM2B 4FZEL 4Q74A 3H9HB 4WI5A 5DGQA 1QLFA 2CLZA 1RZ7L 1C5CL 1L0YA 1LNUA 2E27H 2HFTA 4JM4H 1WZ1L 5E03A 1YEEL 5GGRB 1LEKA 5MEOB 4O2FA 4PFEA 2YUVA 4Z7WE 4PJIF 3G9AB 4HWZA 1YYLL 5D1QD 5E8EB 4PJBF 5CJXA 1QVOB 3B9DA 4PJFE 3LKPA 3P4OB 4OF0A 3GJFA 1JGUL 4LCYB 4YGVB 3CVIH 1P4LB 2LTQB 4CMMA 5DQDL 2J6EL 4WHYG 3QEQD 4KKLD 1T1XB 3B8SA 4MS8D 4RAUA 3TBYB 3UZEA 2R69H 3LMJH 5GRVL 1QSFA 1V3KA 5JA8B 3VXMB 5EWIH 4AH2A 5SWZD 2JCCB 4Y4FC 5IUSA 2OQJA 4HZAA 1NGWB 3IU3A 3GHEL 4G8EA 4NHCH 3ULUF 3CCHB 3B9EA 1EVUA 3BUTA 4CW1B 5BXFB 4U6VL 1IQDA 4X99A 1VADB 1WC7A 3GSOB 3GMMA 4AL8L 3PV6B 1DBKH 3EHBD 3ILPB 5FOJA 1JHLL 2J7LA 4LPYA 5C0IA 2HAZA 4TUJB 4JFXA 4P59H 2FO4B 4DGIH 1CDYA 3I2CL 4BZ1H 1T0PB 4P5MA 3T4YB 1TMCB 2E9BA 3WFZA 1NGZA 1VHPA 3KWWA 2R23B 3V6FA 4AYFA 4WIQA 3MV01 1CLZL 1DFBH 3QUMB 2O5ZL 3NMEA 4EXPX 4LGRB 5ESAB 2EYSB 4Z7OF 3RWEA 4MD5A 4NPYB 5I1CL 3HAEA 1A6TA 1YEIH 1IGTA 4ZFFB 1FNSL 4NO0D 4Q2ZA 5I6XB 5BS0A 1R3IL 1GIGL 4HWNA 1XR8A 2Z92B 4WJ5A 1S7UB 2VAAA 3SGEH 1WBZA 3E8UL 1UWGL 1QA9A 1IGFL 4XP5H 1F00I 3UTSD 3I9GH 4ZFZB 1U92A 5B39B 1WISA 4YFLF 3WLWC 2WLYA 4EDXB 4YE4H 1HQ4B 5E00B 1G9MH 1BREA 1NGPH 1G0DA 4LIQE 1B88A 3AB0C 4HC1H 43CAB 4GG8A 4XI5C 2EH7L 3I6GA 1AFVH 2N7BA 1BFOB 4ZDHA 1J05B 2V7NA 3GM0A 4Q9RH 3BFOA 4ODXB 3VA2C 2F19H 3O0RL 1YMMA 1YN6A 4MX7B 1MCDA 4X80L 3D1MC 4PTUA 4KQ4H 1JGVL 4JZJA 1FVDB 5I2IA 2IAMA 3T4AB 1S9XB 3BDYH 1IJ9A 1CDIA 4X4ZA 4M3JA 2ATPA 1MCKA 1Z6JT 4G43A 2LAAA 1XGTB 3L1OH 3FAXA 3I02B 3PL6A 4I0PD 1HHHB 3VFRA 2X4QB 3NGBB 4JFOA 4M7JL 3GEWB 1DUYA 3ZKMD 1DBAL 1RZGA 5KVFH 1W0VA 4P3WA 3TNNA 5ITBL 3FONA 1BAFL 4OIAA 3NTCL 4FFVD 4YC2B 2NYYD 1MI5E 3ECBB 3MREA 4KKBD 4KK8D 5FF6A 5L8LB 4JJHA 1JZ7A 4Q9CA 2HJLA 3MNWA 2BY2A 3CH1B 3CUPB 1FYHB 3U1SH 2PYFB 3EDJA 3QQNA 4OIBA 4FQXC 4Z5RA 4P4RB 2CO7B 1MCSA 1I1AD 1Q94A 5T3ZE 4X6DA 4QTHB 5IK3B 2W9EH 2P24A 4MLIA 4TTDD 3K3QA 5GZNC 2QKIA 4XNXL 1U41A 4PJGB 3C5ZB 1BF8A 3S96A 2XACC 3KG5A 4GXVL 5DT1L 2AXFA 2B4CL 3WNNA 2BZDA 5E8PA 3DMMB 2WWMD 3D9AH 3GBMH 3CVHH 3PGDB 1XF3A 2Q8AL 3MRHA 1FZMB 5DA4A 3QQ3A 3C08H 4RMRA 2GJZA 3WS6A 3S36H 2E7HA 5FCUH 2NY4C 1GCFA 1YNLL 1FYTE 3FRUA 1ZT7B 4LPCA 2H2SD 4NC2B 3TCLB 4MS8C 4OLWH 5A2FA 1I9IH 4HMEA 2WAHA 3TIDB 4X98A 5CKAA 4XX1G 3HNSH 3PV7A 4P4KB 2G5BB 3VCLB 1QRNB 3G5YB 2X9XA 1QSED 3CSPA 4NO5B 3V95A 5HHPA 2BVTA 4M6MH 4LU5H 2P8LA 4S1SH 5DJ2B 5D2NB 2D3VA 3RVTD 1YECH 2ID5A 3VGAC 3UYOD 2NY3C 1PQZB 1TZIB 1UZ8B 4MA3A 4KDTA 2VR9A 1VFUA 2ADGA 2OP4L 2QR0B 3L5HA 4FQHB 4HAGA 3TBWA 1W72A 4EUPB 2ICWA 2DN7A 4YQXL 1OB1A 3T1WA 5IMOA 5EN2A 1YJDH 4XCCH 2R1WA 1OCWL 4AT6A 5I1EL 3DNKA 1MHEA 3QHFL 5GS0C 3KLDA 1NBQA 2HRPL 3MOBH 3RVVC 1IC4L 2PW1A 1NMAL 1MNUL 5DJXA 3B5GA 5FIEA 4D9QD 1CK0H 1KENH 2PXYA 1GJIA 4Z78B 5HHXH 4WO4A 3ME0A 4JFDA 3CFCL 3A6CL 4PJDA 4YPGB 3IYLW 1WFOA 3TBSB 3RGVD 5IG7B 3WFBH 1ZA6A 2HKFL 1VDGA 3BKMH 3B2VL 1U8JB 4OQTL 2F15A 3AM8A 4G7VH 5D5MB 1CLOL 3GMLB 3O2VH 3GJFK 2MKWA 2IANA 3W82A 1CQKA 4KKAD 2AABH 1LWRA 4IRJC 5DZNA 5HI4D 2NMSA 3MRKB 3NIGE 2Z93B 2DM4A 3BH8B 5IVXA 4ZSOA 3NCJH 5C3TA 2IEPA 2GTZA 2CKNA 1TTGA 1A6ZA 1MFCH 4NIKB 5FFLA 3BGMB 3D6GA 3OHXB 1P1ZB 1PLGH 1OAQH 1OWWA 4I18C 4Y5YA 1CF8L 3LEXA 1ROWA 4IOIB 5FHBL 1NAKL 1CFNA 2EDNA 2IMMA 1FNEB 3QFJA 3SQBA 1F13A 2FD6H 3MA7A 3STZB 5IFAL 3QUKB 4K23H 1Y6NR 1SY6H 2JJTC 4Y4KD 4EKXA 1I8IA 2FYYA 3LB6D 1KXQE 2R29L 1FNHA 3CXHJ 1NCCH 4RFOL 4LLVA 2B2XL 3QWRA 3SKJL 4CADA 2XZQH 3KPPB 2D7OA 1E4KC 1I1CA 1AO7B 3CDGB 2DQIH 1LEIA 2C7UA 4ELMA 3L3GA 1D5MA 2C4FT 4K7FB 3QPXL 5H2BB 4NKQB 3AUVA 4Y2OA 4MLSA 4N5EC 3ARFA 5KS9F 5E4EC 2LU3A 1NBVL 1EK3A 1IGML 5GSVB 2CLVB 1T1WB 3HI5H 5FYLL 3V0AC 5EUKB 4WI4A 4KROB 4Y16A 4OCMC 3R06A 5DURB 3UBXA 3VFOA 1U3HA 3FO9A 1FVEB 1MEXH 4UTBL 4YWGL 4WY7H 5E2VL 1BFTA 3AY4A 3RDTD 4WWKB 2FIKA 2FATL 2UUDK 3RTQA 3CK0L 4M5YL 1JI1A 2YKLH 3SJVB 3EYVB 4G6JH 5DJDB 4UB0L 1U95B 2X4UA 3VH8B 5EZIL 1A7QH 3GO1H 4LVOB 5HYSG 4LLMB 4EQ2A 4JN2B 2AEQL 1EA9C 3UZVB 2EXWD 3QXDB 1VFBB 3FQUA 4E42B 4AQ1B 3P11H 2WP3T 1XCTA 5C0DA 3C6SB 4KJWC 3BPLB 2X4NB 3OAUH 4JPKL 5D7LD 3OV6A 3KYAA 3IDYC 1QFHA 1OAKL 5JORB 5E9DB 2ENSA 1E4JA 2YA2A 1HINL 3HC0B 2HWZL 3OKMA 3VFGH 2VXQH 2GW5A 2X2YA 2YXFA 3BP6A 4LKCA 2VDMH 2GEEA 1BQLH 3AC0A 3JUZA 1I3RA 4L8CA 5AG8A 2BFVH 4P3DA 5ID0A 2A6IA 4NRXB 3L3DA 4IHOA 5E5UB 3NA4A 3RL2B 4ORGB 4HZLB 5C2UB 5IOPA 1QSEE 1PYWA 4OGZA 5J89A 5JW5B 4KHTL 4KAQH 1IM9A 2X1QA 2VKXA 4GAGL 1J10A 5L6YH 3L5IA 3RHWF 3K2MC 4ZO9A 5GRUL 4M93B 1EGJH 5K9JL 1HHJA 3O4LA 2IBZY 2B5IB 4LMQE 3FL7A 4XCYA 1NGQL 2MSPA 2DJUA 4M4RA 1F6FB 4OZGA 1QFWH 1JRHL 4YDVA 3MO1B 4PUBL 1SEQL 3GRWL 3KAAA 2EYTB 1KB9K 2Q6WB 4E9LA 2VLRD 1H0DB 2MCPL 1YYMH 4YLQT 2ICCA 4FQLL 1X5JA 4XB8A 5ADPH 3QUXC 5I30L 3DVNA 4WI2A 3E6FA 5EBWB 4JB9H 3MZGB 4UDUA 4X8XA 1U58B 3MGTB 2YPLD 1VPOH 4APQB 4Z77B 1DQJB 3QO1A 1D5BB 1NFDF 3QULA 3QDJE 3OKDA 1OLZA 1CXLA 1HXYA 1K4DB 1F90H 2BY0A 1OWRM 4PB0L 3LB6C 2B8OT 4ZD3H 4Y1AD 3KPNB 3TZVA 3IAGC 2AJVH 1MCOH 3BZEA 5GGVL 3GSQA 4AIZA 1T7WA 4I3RH 4XHJD 5JW3H 4JFQB 1S5IH 4XAKE 1RIVL 1JGEB 2Y5TB 1Q9WA 2HT3D 2DI8A 2GJ6D 5D2LE 5GQBA 2B20A 4C56B 3WFDL 4Y4HA 1G9EA 2FL5B 3W81A 4PJIA 5TE6L 1N7ML 4WHTA 1GOFA 3IXTA 4JY4B 1NUNB 4PJBA 1D6EA 3ULVL 2V2TA 4PJXE 3BVNB 2HH0L 4U1GB 2CIIA 2NTFB 4FXKB 1QBLL 4YHZL 1A1NB 3W9DB 4PRID 4QHLB 4URTB 5IB1B 5EA0H 4PLNC 1ZE3C 1QSFD 4OZIB 5IFJB 3PHQB 4JR9H 4S11A 4K3GA 3O6ML 5JQ6H 1BFVH 1Z0MA 4PRHB 3RVWD 1IC5L 4G6FB 4HH9B 3HI1B 1P2CA 4RMUA 3P4NA 2B1HH 3BE1H 3T1FA 2H32A 4NCC2 1IILE 4O9HL 3SE9H 3PABA 3WXWH 2VXTH 2GT9B 1F2XK 3GI9H 5C0CE 1NAMA 1RK0A 2AEWA 3V9FA 1MHCA 1RFDH 3CD4A 1II4E 4HFWB 5IROA 5L2KD 4ZPVA 4UUJB 3VWJD 5E6IA 6FABH 1EMTH 1M1SA 3QEHB 3WNOA 4HD9A 2Y72A 4K3DL 2R4SL 1CFSB 3D0LA 1BP3B 4ETQB 5E94A 3HE6B 2YPVL 4OB5H 2FHBA 1A3LH 4GBXA 3UTPD 1MJ8L 5JLZB 2O5XH 5FYKH 12E8L 1K5NA 4AENA 1F2QA 1KTDA 1OW0A 4OD1H 5AAWA 1MUJB 1MRDL 4U3CA 1S7WB 4ODUB 5DD6A 3HPLB 4ZNCD 3HZYA 2HG5A 2DQHL 2CK2A 2VISA 4NUJA 2CGRH 2Z9TA 1C08B 1PG7X 3H9SB 1FGNL 4F7EB 2DLHA 1D7FA 3EDEA 2A73B 1CVSC 2WBKA 1EEZB 4U6HA 3MXWL 5FKAB 4JQVA 3AMLA 1FL5A 1RULH 4I5BA 5E8DH 3L3IA 1E27B 1TPXC 1DBBL 1X5HA 5HYJB 4O4YL 4ZTPL 2WMPA 1NCNA 5LCVL 4BFEA 4PGEB 4RCAA 1U3YA 3HTLX 3BQUA 2WUBH 4OM0L 1BJMA 4OF7A 5C0GB 4WEBL 5TFSL 1U2CA 2Y1VA 1Q0YL 3RGHA 5DYOA 5KVDL 1AR2A 4ZXBA 5CEYB 4HFUH 4PIRF 1B0WA 1RZKC 1P5VA 1KIPA 3TN0A 4NWUH 4UU9A 4XTRD 4UQ2A 3PL6D 3MRMA 4MSWA 4GG6E 1LE5A 4MXVE 5DFVD 5HTSA 3OB0K 3NIDF 4XCFH 5INCB 4A6YL 4L3EA 3H0TA 1R5VA 2D4DA 4Z7NF 1TJGL 1HKFA 32C2B 1HCFX 1KTKE 4P2QB 4J1UB 4OD2A 4QOKB 1UJ3C 1FP5A 3T2QA 4JREC 4O2EA 3MRDA 1ULVA 2Y07H 2HFFB 5I19L 2GY5A 1XEDA 2VLRE 4KV5E 1Q8MA 2XKNB 3WXVH 1YJDC 2AXGA 4JRXE 1UA6L 2Q87A 3OX8B 4NQDD 3VDCA 1DQML 1GZQB 3EW3B 1IGJB 3RWHB 1HH6A 4K55A 1MFDH 4Q9QH 4TVPE 4LPVA 3RAJH 3RU8L 4GQ9L 4YBQD 5MHSE 1BD2B 3U9PH 1LEGA 3QIWB 1EO8L 5M95B 1S9WB 4KFZC 4E0RB 5A1AA 1YY8A 3HE7B 3RZCB 4JRWA 4X6BA 4PB9H 4HEPG 5CJXC 4PJCB 4OKVA 3DV6A 3T65B 3VU2A 1L0QA 4J8RB 1NUGA 3S37L 4X0KB 1IM3B 1QHPA 2GCYA 2RCSL 2XOTA 4PV8B 3QDHA 5JMOC 1HKLH 4R3SA 5JIHA 3SGDI 4X9FA 1KFAH 4NQCD 5ALBH 2DM2A 5EFIB 1P9MA 2WIIA 5J11B 4R4FL 4UV7L 3TT3L 3BIKB 4Y2DB 5JTWA 2HVKB 5AD0B 1CZ8H 4MWFB 1NCDH 1N0XH 2HMIC 4AJ0A 1S7XB 4EBQH 5IQ7H 4NJAL 3WKML 1EHLL 1XGPB 2AERT 3AU1B 3RIFF 1PD6A 4H20H 1ZT4A 4ZYKA 4FQIL 4MCZB 1GPOH 1J0ZA 1JF6A 3LEVL 5DUMH 3O3DB 4RAHA 4XBEH 5MEPA 2R1XA 4N8VA 4NT6A 3BSZH 4R90L 3ROOA 2C9AA 2X40A 1AXTL 5MI0C 5CINL 3NH7L 3D39D 2EDOA 5FUOL 1A22B 2AV7B 2Y4SA 3SPVB 3NVQA 3OG4B 4JY6B 4MXWL 2A83A 3F7VB 4WEMB 5IQ9B 1BVLA 4G8IB 4O2CA 5J06A 4JFDD 5HGHB 2DQGH 5I9QC 1HHGA 1JNHB 4JFHE 1K3IA 2R2CA 2EDRA 2I60L 1AP2B 1P4IL 1P84J 5AZEL 4JHBA 5CUSH 1G1CA 1SJHA 1DQDL 3LKSA 4NN6B 2NLJB 4G8FB 2IAND 2F74A 3CC5A 4L9DA 1UB5A 4UQ3A 1PSKL 1C16B 4K3HA 2EDQA 3W5NA 3O2DL 4DTGH 2BSSA 2JLLA 4ODTL 3VXPB 5E1AA 2A9ML 3RWGA 5JXEC 2D7QA 4PV9B 3LSOB 2L7UA 4UMGA 4D3CH 1JV5A 1KPRB 4U1LB 2XPGB 3LS4L 4WHDA 5T3XH 1RZIB 1TZGH 1LD9B 2H32H 2VRAA 4D0CB 3WV0A 3BOVA 5BS0E 3WIIL 2NXYD 4KKCC 3D69B 43C9A 5IEHA 2G75A 2XA8L 5FYJH 2PUQT 2FIRT 3ETBF 3O6LH 3IDIB 3DX6B 3BGAA 2FZ3A 4JY5H 3IU4H 1JN6A 2YUWA 5HDBF 4JZJC 3TVMB 3IFNL 2IAMC 2Y36L 4WU5A 1LQSR 3BZFB 3O6FC 2H1PL 4GW4B 4UT6H 1GSMA 4PP2A 2X4RA 4QRQA 2D0GA 2GK2A 3LQAH 5IF0B 2ZCLH 1RK1B 5FYKD 3WYRA 2VZSA 4XC3L 4HJ0D 1FHGA 4H5SA 4MB3A 2FB4L 5I1HH 3GMNB 4JFPB 5HYSB 4MVBC 2CK0L 3LAFA 4Q9BA 3JXAA 3UTTA 3H8NA 4H26B 1YMME 3ARFD 2ZKHH 4JM2A 1DQQB 5BV7B 3H9HA 3SQOL 4HUKB 4YHKH 5CSBA 2YA1A 4HLJA 5BRZB 2W65A 2NY1D 3QQ9C 3NN8B 4YX2H 2F53A 2AEPH 2EDXA 4RNRA 4F7CA 4KK9C 5JUEL 5E8EA 4QHMB 3A67L 4MNGB 3WJJA 1CICA 1QVOA 3IDXL 1K3ZA 3FOMB 5J6GB 3BXNA 4OV6F 4OCWL 1M7XA 2FR4A 4S1DC 5DDHB 3AREA 4LCYA 15C8H 4JE4B 2XTJD 5FDWB 2NY5L 1P4LA 1OARH 4Z0BH 5F21B 5C0RL 5K9KB 5EU6B 3HMWL 3WS6C 9CGTA 3BEVB 2R0WH 3MV9B 5DZLA 2V5SA 1FV1A 3TBYA 4ELKA 3JTTB 3V6BR 3KYOA 4KI5C 1PY9A 4X6DE 5HSFA 5JXAH 2JCCA 3WSQH 1ZHLB 1MJUL 2XN9E 3GSWB 5FGSA 2ORBH 3DX9B 2ICEA 3D85B 5BXFA 3VXOB 3QDGB 5DMGC 5F7YC 1VADA 5JDSA 3PP4L 4DQOH 2WQ8A 1JPSL 5J9PA 3QIBD 3KYNB 4KTYA 1G7LB 5ILTH 2BMKB 3HN3A 5FO7A 3EBAA 1FBIH 3VW3H 1N8ZB 3HA0A 4KDTC 4LHQB 3V8OA 4TSAL 4KI5E 1XGUB 2VITA 1AGEB 1I7UB 4JPVH 4U3XA 3WHXB 3SBWA 3R0MA 2BVYA 4HBQA 1G6VK 1EAJA 1Y18A 3SDXF 1JL8A 4C58B 5D8JH 1DDHB 3IRZA 3G08B 3BKYH 1KBGL 3P4MB 2AJUH 5CBEB 1YC7A 2ZJSH 5ESAA 1A2YB 2EYSA 2A77L 1JBJA 2MMXA 2PXYC 1U8HA 3INUH 4LHJB 4U1KA 1ZGLB 1MLBA 2ZCHL 3ZHLA 5L9DL 4WO4C 1ZXQA 3RUGF 2FNBA 1C5BH 2IPTH 1RZFL 4ZFFA 1GGBH 1CE1L 1N3NB 2NZIA 2GAZB 3GSNL 1MFAH 3AM8C 3I6LE 1F4XH 3P0GB 4HHAA 1FGVH 1U8NB 2APXA 3P0YL 3UYPA 4X5XB 4O02H 1S7UA 2Z35A 3AS1A 2DMKA 4ZFZA 2BSRA 4DKDC 3RWJA 3PDGA 5E99L 2ERJC 4B50A 4ZFOL 4EDXA 5FA4A 1GZPB 3FQRB 4JFDE 3T0EB 4PJDE 4WI9A 3KS0J 2J5LC 2C3HA 4Y5YC 2CJUH 3IJHB 3UC0L 2NTSP 1J0YA 1AY1L 1J05A 5B21A 4ODXA 2NXYC 3ARDB 5D71L 2IANE 2AXHA 3JTSA 1M6OA 2QSTA 1IGCL 4UAOB 1GVIA 1FVDA 3UCRA 1YN7B 2HRLA 2BDNH 3G6DH 4EI6A 1S9XA 3QCTL 5I8OH 2Z91B 2P5EB 3BN9C 5IVXE 4ZSOE 3OPZH 1H3PL 3TZVD 3DXAE 4LLUB 1KLUB 2ZPKH 3MLPA 4XNMA 2ZNWA 3NACH 2FWOA 3QO0A 4GRLB 4BH7A 1ZT1B 3QJFB 1XCQA 4TSCL 5GRJH 3QFJE 5F7EH 1D9KB 5DJCB 2EE9A 3Q6GH 4DOHE 1MF2L 4XPHL 5F88A 3U4AA 1KJMB 3ECBA 1T2JA 3MODL 3VD9A 4Y4HD 1KEGL 2F9BT 2OR9H 2FX7L 3SDDD 4ZG1A 4RMWA 5CLWA 3CH1A 3CUPA 3KYMB 3LKOB 5DMJB 4MA8H 4MAYA 1HSAA 4QCIB 3GNML 2X4TB 3CFJB 2XXMB 4Y16C 5JW4M 5KS9B 1I9RL 2J8UF 4QTHA 5IK3A 2EC9U 4QRRA 2R2EA 1U3HC 4ELME 5F1IA 3EYFB 4JDVA 4KQ3L 1U42A 3HS0A 4DN3L 1CN4A 2YD2A 3AY4C 5EO0B 4D0BB 1DEEA 1B6DA 3GBNL 2W60B 5T3XD 5F9JB 3PGDA 3RTQC 1CD8A 1FZMA 2CUHA 1ZLWH 1BBJA 2XG5A 2EE3A 4ONFL 4R9HA 5FYJD 4M6OL 1ZT7A 3QI9B 4NSKA 4U05A 3TCLA 2XKSA 3HZKA 3MRLA 2BNQD 2WK2A 4P4KA 2G5BA 5GS1B 4G3YH 5H8DA 5JPNB 4NO5A 1XF2B 5DJ2A 3FB8A 4L8DB 2NY7H 4PJAF 3ALWA 5F9OH 1PQZA 1W8OA 1TZIA 3FN3A 3EYUL 1UZ8A 2PTVA 2F54A 5ECJE 4FQHA 2HT2C 1X5GA 1YEHH 2EE6A 3X12B 2R56H 1OSZB 3DLQR 4N8PA 1TVBB 2DQCH 5ADOL 2A0LD 2UWEB 1CGVA 4H88H 3TPUB 3H42L 4LSQH 5E2TH 1DVFB 2X7LA 3BZDA 3TBVA 3ELAT 4JPWL 3VE0B 4QTIL 2GYSA 2XIDA 4RGND 2GFBB 4DJMA 2M26A 3B9VA 2C3XA 5F9DC 2IALB 5CP3H 3ZE0E 2CMRL 3RJDA 3LIZH 5HI5D 3KLHC 1LDSA 4MQ7B 1D5XA 1FAIL 1GOGA 5GISL 1D6VH 2DQFB 3MZTA 3JWNC 4JFZL 4HT1H 2JJUA 4N0YL 3RY5A 5CSZA 1AJ7H 2BERA 3VFPA 4JLRB 3WJLA 4UINH 3MRBA 3WUZA 4D9LH 2CLRB 4GRWE 4OIIL 1MCQA 2CDEB 2BHZA 5CZXD 4YR6A 4CU6A 3MA9H 4NRYA 5EUOB 4F9PA 1EHAA 5FUZH 3BGMA 3FB5A 1ERNA 4IOIA 3C6LB 3JVGA 4L3ED 1G7PB 4EDWH 3O4LE 4X7FC 4XVTL 5I75C 3JV6A 3JSSA 3STZA 3VXNA 3QUKA 4HS3B 3MRCB 3F7YB 3VRJB 3I75B 4X6CB 5FGBA 4F2MB 1H3WM 1T66C 5CEXA 4R26L 4WUKH 3DGGB 3O3BA 3TZVC 1UWXK 4RBPH 4WFGD 3MUHL 1VEPA 3LKQB 1NFDB 3C8KB 4JO3H 4C4KO 3QUMH 4YDLC 1CT8B 2VDNH 3QISA 3QDMD 5BVPH 1JMZA 3MLWL 3ZDXF 1EJOH 3KPMA 1CL7H 1Q9OB 4L1DA 2XZCH 4YEFA 4OT1L 4QGTA 5GSVA 2CLVA 1T1WA 1JPGB 3L3HB 5EUKA 4ZUVA 3TM6A 2HLFD 2VC2H 2NXZD 3RHWK 3QNYB 1YNKL 3MV11 5E8NA 4HUXB 1MJJB 2FHCA 2OSLB 4XRCA 1OGAD 5FM8A 5CP7B 5DZOA 1R24B 3D3VB 3G6JB 5D1ZB 3O8XC 3CDFA 1A1MA 4WWKA 2QQNL 5KJRL 5EZLB 3ZDYF 3LZFH 2DI7A 1H9VA 5I16A 4G5ZL 3LD8B 4LRNH 3L3JA 5LXGL 2NY0D 4PJIE 4FFWD 3SJVA 1ETZB 5DJDA 4FXGA 3SE3A 3VH8A 4PJBE 3CJJA 1CCZA 3LDBB 3ULUC 2FH8A 3P77B 5EULV 3TBTB 4DGVH 2YS4A 1HI6B 1KLFA 5TDPB 2D0HA 5ALCH 4BZ2L 5TQ0H 4W6XB 1VFBA 2N7AA 5IROC 2QSCH 5F71A 3C60A 5E6IC 1T0MB 1SHMA 1X4YA 2DB8A 3C6SA 3PGFH 5DC4B 5E7FA 2E6PA 3TFKC 4DN4L 3MJ6A 2PO6B 3V7MA 5DD1H 3D48R 3RKDD 3ZO0A 3HUJB 1X4XA 4DUWA 5E9DA 4BQBA 4GBXC 1BQUA 1NL0H 4QXTB 1I8KA 4RFEB 4LLWB 3Q6FA 1OW0C 5JHDB 3ULUE 1J5OH 3ZTJH 1R5WB 4UNVA 3C2AH 4R4ND 4B41A 4NOFA 2CKBH 2OXHA 4QF1A 2VQ1A 3CLFH 2QADC 4NRXA 2DTML 3ARXA 3NFSH 2PNDA 1KGCD 3E6HB 5GGSY 2VYRE 5T1MB 5C71A 2QSVA 3RL2A 1P5UA 4ORGA 4HZLA 5DJZB 1JPTH 2DDQL 5T1KB 1INDH 2HT4D 4R6UA 3REWA 3BWUC 4JGUA 2X1PA 3CFDA 4HBCH 4XMLH 4QRPB 4LIQL 5I74C 5F89B 3OQ3B 1AD9A 4UIMA 4XNUL 5GRWA 1QBMH 1ZHKB 3LKRB 2PYED 4U2YA 1BZ9B 2AJSL 1E0OB 3BQUC 4FNLL 4Z7OE 2R1YB 1F6AB 5HYEA 5J12C 5TDNB 3MO1A 4HF5H 3QUYB 4AG4H 2VABB 4HJGB 1CXKA 4XNYH 1CFVH 2Q6WA 1GC1C 2HJFB 5EIIB 4ZXBC 3JV4A 5C09B 4HWBA 3CZJA 5I73B 1H0DA 4KUCF 5IVZB 1EJ6A 4QHUA 1N4XL 3TN0C 5JDJA 5F7LB 4IOFD 1V7NH 4LP4A 4ZPTB 4YHOL 2JELH 4KK6D 3RIAF 3SDYL 1UFUA 1KJ3H 4LHUG 1IC7L 2IH3B 5AYUL 3SE4C 1NQBA 2EKSA 3DUSB 2OK0H 4L3CB 4YFEA 1F58L 3MGTA 1R3KB 1CU4H 1NKOA 4CVZB 2NY2D 3EOAB 3MV7A 5SWSB 3UTTD 4Z77A 4XPGL 4EUPH 4MGXA 3B6SB 1DQJA 1LO2L 1W0WB 2XZZA 3RL1A 3CPLB 2XQYG 1K4DA 4JM2D 1MY5A 4WCYH 1J1XH 1F4AA 4E5XB 4DKFH 2HFGH 5T3ZL 1KJVB 2F58H 4K8RH 3SDAB 4XPAL 5MP6H 4JFQA 3IJSB 2BXZA 4RMQA 4L3EE 1JGEA 4XPBL 3HB3C 5ICZA 1FZKB 5LQBH 1IQWL 4C56A 3GIZH 3B3IB 5IFHL 2YD8A 4ZS6C 2V6HA 2FL5A 1KULA 4WFHE 3SEPA 4RISH 4JY4A 1MCWM 4F37F 1RUPH 1A7PL 4GJTB 1HIML 3BVNA 4OGYL 4P9MH 4LSRL 2HLFC 5D72H 4U7SA 4XP4L 1YEJH 3PGCB 1WVZA 4AIOA 4FXKA 1JWMA 5TDOB 2OI9C 5T1LB 3VWKD 1A1NA 3W9DA 4OCLC 5DHVB 5IB1A 3C5SB 4WI3A 2ZUQC 4OZIA 1VSCA 3PHQA 4KY1H 3VXMD 4E41B 4ERSH 1P9MC 3T77B 2CRMA 4OLVH 4HH9A 4MD4B 3BKCH 3HI1A 4P9HC 1T0NA 2HLAA 5C8JB 3MR9B 4RWHA 3QWOA 4ZUWA 1ADQA 4U7KA 4JRYB 2X1XR 1MIEL 5GJSL 2PTTB 4FZ8H 2Q3ZA 1RUQH 4Z7WF 4J3UA 1MCFA 4HPYL 5HGAA 3ZKND 2YD5A 4M8QA 3WDIA 4Y89A 2P8PB 1I4FA 4PJFF 3QEHA 1QKZL 4I48A 4J12A 1RJZA 4OZFA 5C0JB 1CFSA 1T7XA 1F8TL 1S3KH 3RA7L 1JGDA 5JLZA 3FMGL 1BIIB 3L7EA 4QHNB 5E95B 1MUJA 3G5VB 3EYSL 4NQEB 1WZMA 4PGBB 4X6FB 3UROR 4DVBB 3IF1B 4NQVB 4EZMA 3T8XA 5M94B 5DEFA 3U0WL 5T1DL 2R2BB 3BZ4A 1FDLH 1KTLB 4FQ2L 4ODUA 3STBA 2E9WA 1VENA 1I1AB 4JFEA 3KJ4C 2A6KA 3MUY1 1BVKB 5GS0L 1RUKH 4PJ8B 2Q3AA 3DV4A 1C08A 1RU9H 1CI5A 5I18H 1XF5B 4LCCB 3IJYB 5H35B 4MDIB 2A73A 1KLGB 2EIBA 5I15H 2R4RH 4L4TB 1HHKB 4QRUA 4PR5B 3KPOB 3KXFB 4I1NB 4BA8A 3NABL 3HNVL 4U1HA 1E27A 4EEEA 1L9NA 5DRXB 4HIJB 1FVCB 5I1AA 3PWJB 3UTOA 3TT1H 4PGEA 2OL3L 1A6AA 4K9EL 5TQ2H 3Q1SH 1CFQA 4U1MB 3QRGL 1FE8L 1PG7H 4O58H 2XY1A 1L4IA 2EO1A 4L4VA 4XBGB 1P7HL 3ZLQC 3FO0L 2AXJA 2ICWJ 5CEYA 3U7YH 4UBDC 1R3HB 1DBJL 4R2GC 3DI3B 5EOCL 4EI5C 4M9PA 4LPWA 4MCYB 2OYPA 2EIDA 5E2WH 3BKJL 5B22A 4EN3A 4EOWH 5INCA 4TOYH 3P73B 5ESVB 3BGFC 3TA3B 2HTKD 4OLXL 3GK8H 32C2A 1SBSL 4P2QA 2BCKB 4FABL 1MCIA 5IIEB 2EXYC 4IRZL 2FBJH 3HFML 1AI1H 4JVPA 4XHQA 3UTZA 3OAZK 1JHKH 2RAMA 2XKNA 4KPHH 4JM2C 4F58H 2E6QA 2Y23A 3MLVL 5E1HB 1E6OL 5C08B 1U8IB 2OZ4H 5DJ8B 1UG9A 1F4YH 1IGJA 4J3VA 3RWHA 4QNPE 2H41A 1A4KA 1X6LA 1JJUA 5CFHA 4MAUL 4WW2B 4UI2A 1KIUA 3QIWA 4MJ5A 2EC9T 3C5ZD 1S9WA 2XWJB 4E0RA 2WSKA 4X4XA 3HE7A 1DSFL 3TJHD 4PJCA 4QY8A 3WJJC 1CICC 3DMMD 2J4WL 2QL1A 1D5IH 3MRFB 3T65A 4F57L 1UXWB 4J8RA 4H8WH 4M8VA 3M8OH 1AKJB 3AREC 4F33B 2HYMA 3IT8D 3O2WH 2KL6A 1IM3A 5EO1B 1C8PA 4PBXA 2LTQC 2VIRB 1JNNH 1KXVC 1NPUA 3MJ8B 4PV8A 4X9GA 1A0QL 2F53E 3NPSB 5EFIA 2W38A 5J0BA 1E6JH 1UGNA 5ENWB 2YN3A 5D1XA 3X3FL 3BIKA 4TRPL 1IAOB 3X3GL 2GY7B 4JHAL 4Y2DA 4PY8J 4JPIB 2O5YH 1HEZA 2HVKA 3FQWB 4MWFA 1QRND 4P4KD 5DMIL 5CJ5A 4NC0B 2IQ9L 3T0WA 1MVUA 2KDGA 3B9KC 4M5ZH 5GGTL 1WSST 4WHYH 1V5JA 1XGPA 5AWNH 3RPKA 4WTXA 4HQQH 1JZ3A 1FJ1A 3BO8A 3F8UB 3KVQA 1UEYA 4R96B 4M1CC 4NZTH 3QG6A 4PJ7B 1QHOA 2E7LA 3KPRE 3HZVB 3O3DA 2JCCE 2GJJA 3DX7B 3SBWC 4FS0A 4K8RD 3TCXA 1NANI 2ZSWB 2VWEC 3BEWA 3LN4B 4PYGA 3ZKQD 5MERB 3SPVA 2EZ0D 3BT2H 4YDKH 1K8DB 4N90E 5J8OA 1FFOB 3F7VA 4G8IA 2A1WL 1X5AA 5HGHA 1BFSA 4J3WA 1JNHA 2LFGA 3OG6B 3DURB 2P5WE 4HKJA 1PZUB 3S4SA 3QFDB 4HULB 5D7IF 1AP2A 2Q7YB 3KHOA 4NGHL 1MWAL 1NGXA 4XPTH 5CJOH 3SCMB 2I25N 1NLBL 2ENYA 1F4WL 1TFHA 3T3PF 1C16A 2VWEE 3QG7H 1PEZA 3W0WB 4NO3B 4NKDB 5HHVH 4HK0B 3VFWA 3UPRB 5KOMC 4YHIB 2VZUA 1KIQB 3LSOA 4PV9A 4TN9A 1I9JH 2XPGA 1XH3A 2XFXA 2AJZB 3EYOB 3L9RB 1JPST 3F7RA 3S34L 1J8HB 1VFMA 4BQ6A 1H8SA 4KMQA 3GMPA 1MCNA 3D69A 5FO8B 1E4XI 4X6EB 2OX5A 2XICA 4WV1A 4AEHL 4ZOEA 5EORL 2CR6A 1KT2A 5D7LB 1QSVA 2VXVL 3MRJA 3BZFA 2EE2A 1CBVL 5DK2A 4GW1A 3H3BC 5DD3H 2V9TA 3F58H 5IF0A 4XWGH 4GW5B 2YA0A 3NGBC 1AO7D 1RK1A 2BRRH 3FQTB 2DQDH 5HYSA 3W11C 4JG0H 5KOVC 3NIGF 2ESVB 4F15B 1KELL 4H26A 3O9WB 1L7TH 2Z31A 2D7MA 1NH6A 4W6YB 4YC2C 5ESQB 1CE6A 3K8MA 2V5YA 4PTTB 2C4XA 3KPSB 4ZUUA 1BM3H 1BLNA 4GS7B 4XP9L 4KTDL 2FX8H 4EIZC 1WFTA 5EU5B 5BRZA 4KROD 3Q5TA 5C0AB 5DURD 4MAYC 3GI8H 4LQFH 3WN5B 4S0SD 4Q6IB 4LAJH 4ODBD 2H3NB 3OXRB 4WWKD 3MACL 5J56B 5JQHC 4MNGA 3NCCB 1LDPH 3JWDC 5DDHA 3WL9B 3MJGX 3TYGL 1YUHA 3SJVD 4MNHA 3LEYL 4FFYL 1T4KB 4DUXA 5K9KA 5EU6A 4ONGL 2AKRB 1ACZA 1NUFA 3MV9A 3MRGB 1M05B 2YWYA 4LNRA 2I5YH 3JTTA 3L5XL 2WUCH 3MRNB 2ZCKL 2Q8BH 4QRRE 1ZHLA 1KCVL 4P46B 3MNZB 5KTEL 3VXOA 1KC5H 3KYKH 3S7GA 1A3QA 1K9TA 1DBMH 4MB5A 1Q9LB 2QQKH 4NQXA 4WI7A 3LS5L 4LPTA 5E9DD 1FZOA 2D7PA 4LASL 3DHMA 4W6WB 5JIPA 1G7LA 1RY7B 1NUDA 1UH4A 4OTXH 4PRAB 1N8ZA 3ZL4H 4PJ9B 4OF6A 1N6VA 1J1PH 1HQRA 4P2OB 4PJAB 4CVWA 3N1PC 1T2QL 1XGUA 3G5XB 5I1KH 4JKPL 3QXUA 1TZHA 5DHXB 3CFBB 4R97C 5KSVB 3LHPH 4LHUB 4I77H 3FFCE 4JG1H 4OSUH 3N50A 1ACYL 4B53A 1DDHA 3G08A 5CBEA 3M1BB 2UZIL 3V5HB 1G6RA 3LCYA 2IGFL 4JZOB 4PBVC 1VFOA 5LJYH 1ZGLA 5BZWA 4IMKA 2F54E 1OAYH 3PWPA 3P40A 4TTGA 1CGSL 5DVKA 1N3NA 4ZAKB 3O11A 2GAZA 3RWCA 4PRIB 2J6EA 5KVGL 3V4UL 5E4IA 1U8NA 3QBTB 4X5XA 3LPFA 1CD1B 4Z8FH 1MQKH 2AJXL 3B2UC 3QYCA 1XIWC 2ADJB 5HDLA 1GHFH 3UAJC 4ZO6A 5ISZB 2W0LA 4LSPL 1OLLA 2PETA 4UOW1 1X5FA 2AK1H 3BJLA 3P0VL 1FCCA 3T0EA 4PJ5D 4F9PC 3QJHB 4GH7B 3LY6A 2OJEB 4G9FB 1T80A 3TO4A 1FFPA 4X7SL 3CSYA 5L2KB 4L29B 1G9NH 3QNXA 1WT5A 4RWYH 3ARDA 3WS3A 5CGYD 4PRPE 1RZKL 1OTTD 1K6QH 5HHOA 2NX5E 4APQD 5I0ZA 1G7HA 4N8CH 5C1MB 5T5NG 1OAUH 1YN7A 3TJEH 4TQEH 3ARBC 4ALAL 3S37X 4U0QB 3STLB 4QWWD 1ND0B 5CBAA 4KVCH 4YBLB 5DS8B 1KLUA 4TVPL 2E7CA 3DROA 1ZKAA 5IR1B 1A6VL 1JYWA 1S78D 5AUMB 3P30H 1HH9B 2VLKE 3MBEA 5EBGA 3IS0X 5CILL 5DJCA 1I85A 2DD8L 5KSBB 2IFGA 3MFGB 2YK1H 3IAQA 4C56D 3NIDE 1KJMA 3GSNB 3T0BA 4YUEL 2YBRB 4A2LA 3OR6A 4F9LC 4GAJL 3VFUA 4Z7NE 1JK8B 3QAZB 2EH8L 3KYMA 1KOAA 3LKOA 5GHWH 1ES0B 1KF9B 4HIIA 4QCIA 4KROC 3F12A 3CFJA 3PWNA 3DIFB 4LCWA 1HHIB 4ODSL 4JFFB 1T7ZA 1I3VA 3U83A 4TSBH 4HJJH 5E2UH 4P2RB 4NKMA 5HJ3A 3JZ7A 4PRHD 1QFPA 1NLDL 4G6FD 1X7QB 3NZ8B 3PXJA 4D0BA 2VDKH 3BP4B 4N0FB 2W60A 1NMCC 4IIQB 1ZEAH 3NA9H 2BJMH 1NCBL 2WWKT 1H5BB 1P7QB 4Y19E 1EERB 5IVOA 2COQA 4F8QA 5DI8B 1H3GA 1HYSD 5D2LF 3QH3B 1TJIL 5K9QI 2VH5H 3CXDH 2R0LH 2X05A 5D9SB 2WINB 1LGVA 4K71C 4HUNB 3GMQB 1DL7L 4P3CH 4MHHG 3OR7B 3VXTB 3C60C 3OGCB 1MH5B 4YXKH 5JPNA 2IFFH 4HPOL 3HE6D 1CD9B 4PJXF 3U6RA 5HHQB 2R8SH 4LOUD 1G7JA 3SJVE 4YXLL 4HXBL 4K7PX 4U1NA 3EYQD 1WK0A 4YGAB 1T5WA 1YPZB 1NCWH 4QXUH 3CU1A 1OSZA 1Z5LB 4U1IA 1TVBA 5BV7H 4G7YL 1YEKL 3QCVL 4PJEB 3TPUA 1DVFA 2G9HB 3H7LA 1A3RH 3H9SD 1MIML 5C07B 3VE0A 1SJEB 4G8GE 4L5FL 1H8NA 4RZCB 4WW1B 3P9MA 2H2PD 1UM4L 3ZYJA 1BJ8A 3KHQA 4MQ7A 1BBDL 5HYJD 4V1DA 1TENA 1UKSA 5J57B 4U0RC 1WV7T 3MLRH 4PS4H 1JHTB 2DM7A 1I3GH 4K3JH 3TNMA 2RJMA 3DRTB 1FN4A 2AQ2A 2ED8A 4JLRA 5DJYA 3FQXB 1ORSB 4NN5C 4OCXL 2CLRA 5DD5H 5F93C 5ELIA 2ZOKB 4NOBA 4NCC1 4PLKD 3PHSA 5FV2A 2CDEA 3CLEH 3TV3L 5BMFH 1KG0B 2X5PA 5JPMA 5CAYB 3KR3L 2YKLL 2IH1A 2APFA 3C6LA 1BF2A 4Z7VB 4NO2B 1RVFL 3LN9A 2DQUH 5DLMH 5TF0A 4XWOC 3S98A 2BK8A 4HS3A 3GSVA 1I1FA 3MLYL 4P2QD 3F7YA 3EO9L 4P57B 2YMXH 3VRJA 4MJIB 4QOKD 2MKLC 4X6CA 4FZEH 3NCFB 3D39B 3PNWB 4OCYL 2FRGP 5GSRA 1CDHA 1RZ7H 5D93B 1C5CH 3H6JA 4OZHA 4FQCL 1OSPL 1T89C 1B0GB 1JTTA 1NFIB 3UTQA 1WZ1H 4U49A 1DUZA 2R9HD 1YEEH 4XP1L 1AGCB 4WFFE 5HDBE 4YHPB 3C8KA 4NM8L 1YYLH 1CT8A 1BD2D 3VGDA 3QIWD 2BC4B 3KNBB 2YZ8A 4LMQI 4WNQB 2FSEA 3G04A 1Y6MR 5I8CB 1Q9OA 3HE7D 3RZCD 1JGUH 4L1HA 1V3JA 3MV7E 1U3JA 1S8DB 4FQ1L 1JPGA 1WJ3A 5BW7A 3L3HA 4DKEL 1REIA 2G2RB 5DQDH 2J6EH 5EBMB 1KB5L 1MHHA 1MJJA 3OKKB 2OSLA 4P5TB 3R4DA 4RSVA 5C0ND 1MFNA 5CP7A 2VZ1A 4POYA 3FB7B 1OM3L 3GHEH 2GQHA 2WBJB 3BP7A 4Y5XB 3K4ZA 4JKLA 4Y2DD 3MV8B 2KUTA 4F7MB 4U6VH 4KV5F 2NNAB 3QIUB 5F6IC 4AL8H 1JWUB 2DIJA 1JHLH 3L95B 4B7IA 1ZTXL 5KZCB 3WFHB 4DAGL 3TBTA 4ONHB 2D7TL 2H9GB 4FG6C 1HI6A 4K2UL 3I2CH 4H25A 5DJAB 5FOBB 4JCMA 4OZIE 4NQSB 3MGAA 5DUBB 4MJ6A 5D7JB 2Q86B 4Z7WB 1UM6L 3FN0L 3CNKA 5FO9B 1CLZH 3VXRD 2O5ZH 1CFTB 2DQTL 1OTUD 1O5DT 1XZ0B 3U30B 1XGRB 4QXTA 3RPIB 4RFEA 1UVQB 1Q0XL 4LLAA 4HCRA 5TH2B 5I1CH 1B0RB 5INDB 5F3BA 5C3LD 1W72L 1FNSH 1R5WA 2JJSA 2XQBL 2NY1B 1R3IH 3H7BA 1X6NA 3UDWA 4QRTA 1CXFA 1TETL 2SEBA 3E6HA 4ODWB 2NR6D 4IRSC 3QP3A 3E8UH 4ACPA 2AV1B 1UWGH 1OP5H 1IGFH 2DJSA 3HCVB 3GIVB 4N1EA 1OP5K 5TE7L 1QZ1A 5IMMB 3EJYC 5CHNB 4LLYB 4CDHA 4KTEL 1JYNA 2DMBA 5ITFB 3SDXE 2EH7H 1QQDB 3QEQA 4F8TA 4G42B 1RHFA 2QHLA 5I76B 2R1YA 1F6AA 1JPFB 4JFEE 3O0RH 5TDNA 4OM1L 5SWZA 4X80H 3MTRA 5DFTA 2KPNA 1SBBA 4Y4FB 1JGVH 4HJGA 2FEDD 2HJFA 5EIIA 4IDJL 3LN5A 1KSRA 3HRZA 4JQIL 5IVZA 3TVMD 4PLKC 1LO4L 4M7JH 4XP6L 2ADIB 4DK3A 1DBAH 1TTUA 5IMKB 4ZPTA 4NKOA 1WUNT 4EVNB 5GGUB 4EN3C 3SKOB 2IH3A 5ITBH 2JK5B 1BAFH 4L3CA 3P9LA 5EZOL 4PYHA 4M4PA 3HG1B 3NTCH 3WUWG 5DMYA 3T2NL 3U9UB 1CDBA 4CVZA 1BJ1H 4L4VE 4XXDB 5SWSA 4LVNC 4X4YB 2ZUUA 2CDFA 4NQTA 3SGKA 4DWHA 5A3ID 1EAPA 2PW2B 3O3AA 5K9OB 5BRZD 1KJVA 2Y9RT 3SDAA 3V0WL 3F6LA 3RP1A 3IJSA 5E8OA 4XNXH 2EDTA 5D96C 2A2QT 5DUPL 4GXVH 5DT1H 2B4CH 4IBLT 4H1LG 4HKXA 4G9DB 2Q8AH 4JAMB 3HE7C 5CD5C 1F97A 1BOGA 1AQKL 4HUVA 3EO0A 4XX1E 5ICYB 1AIFB 5FHAL 1YNLH 4U1JB 5EU6D 3FRPG 2ARJB 1OTSC 3MV9D 4LGPB 3TEUA 3PQYB 5DHVA 3C5SA 4U6YB 5JNYA 2IPKB 1QPXA 3AB0B 1PY4A 2GUOB 3FN9A 3T77A 5D1XC 3QQ4B 3S3SA 1U93A 1UB6A 4OJFL 4MD4A 1MLCA 2J8UE 3D85D 3EOBB 2D2OA 3QDGD 2LE9A 4PJCE 4JRYA 1MI5B 2IBZX 3SOBL 5DK0B 1KPUB 2OP4H 1FC2D 1JIBA 4KRMB 1C7TA 4CMHC 4YQXH 2W9DL 2P7TB 5AAMA 2IG2L 4Q97A 4JO1L 4I0PA 4LSDA 1E4WL 3OKNB 5FB8A 5I1DB 3S97C 1OCWH 2E7LC 2P8PA 5I1EH 3RVUD 4XZUB 3QHFH 2HRPH 1AD0A 1AGDA 1PW3A 1IC4H 1U8OB 1NMAH 5KSAC 3MJ9L 1MNUH 3DO7B 3DVFA 1BIIA 4QHNA 5ACMA 3CFCH 3A6CH 1T83C 1G7IA 4PGBA 4X6FA 4DVBA 1LMKA 4NQVA 2HKFH 3B2VH 2R2BA 4OQTH 4FQXB 1KTLA 4G6ML 1INQA 1KUMA 1I1AA 1FYTB 1CIUA 1CLOH 4PJ8A 1HYRC 2Q76B 4TUKL 1TJHL 2X09A 3ARGC 5IB2A 3O41B 5D70L 2NR6C 4R8WL 5I17B 3IJYA 3ZT6A 2NW3B 3SGDH 2UV3A 4KRPC 4PR5A 5HY9B 3KXFA 1FO0A 4J4PA 4KI5F 2B0SL 5DRXA 4LLDA 4MZ2A 1CF8H 3T0ED 5FHBH 1KNOA 1NAKH 4M61B 3UJIL 2DI9A 3S5LG 3VXSE 2PR4L 4WTZG 4AK1A 2QQLL 5IFAH 3BP5B 1RPQA 3VJ6B 3B5HA 5H94A 4XXCA 4XBGA 5JOFB 2BNQB 5HGDB 3ARDD 3MUZ1 2V2WB 4PJHF 4BJLA 4WV1C 1UWEL 2R29H 3AGVA 4RFOH 3FHAA 2B2XH 2H26A 3SKJH 2P5ED 3K4AA 2NY3B 2AJ3A 4KC3B 2C1PA 4JDTL 3P73A 4LSSL 5ESVA 4U2ZA 3IDJB 3QPXH 4HUMB 1ORQB 5ETUB 4GRLD 3UYRL 2DJ4A 1MCHA 1WBXB 3HC4L 4X7TA 1D9KD 1LP9F 2BCKA 5GJTL 3LRSA 1TCRB 1QR1B 1NBVH 4LSVL 1IGMH 2Z31C 5FYLH 3AS3A 4I4WB 4M02A 5D6DA 1FLRL 1XGYL 2B1AL 3VFTB 5C08A 5DJ8A 5B3NA 2X9YA 4TUOB 5IJVA 1EHXA 5B38G 3RGVA 4UTBH 4AEFA 5A2JH 4WW2A 5L2JB 4YWGH 4C83B 5E2VH 3SKNB 4BZYA 2LABA 2FATH 1I7ZB 3ZYIA 4YK4C 2OL3B 3OJDB 3CK0H 3U46B 2BXYA 1L0XA 1FZJB 5CIPB 4M5YH 2EECA 4JHZA 2VKWA 4UB0H 4IRJB 5IMLB 5EZIH 4F33A 4JJ5B 1DCLA 3BUYA 1K2DA 2MQ0A 3U7WL 2BX5A 3ZDXE 4HGWA 2VIRA 2DLGA 2YD1A 2AEQH 3QI9D 5F72S 1XF4A 5FAAA 1N6QL 1T3FB 4BQ8A 4I18B 1YY9C 3MNVB 1IAOA 3D2UB 2ZUXA 1RZ8B 2FX9L 3MJ7B 2IADA 4JPIA 3T3MF 1FORL 2YWZA 3FQWA 3LV3B 4JPKH 5IKCB 4M9OA 4MNGE 1OAKH 5L8JB 1IEHA 1HINH 1F3JA 4OV5B 4GFTB 3BW9A 3ULUL 2HWZH 1JTOA 5EPMB 5LAXA 3ZDYE 1MCJA 1NAML 3HAEG 3I3DA 3O4OB 4LF3B 1MRFL 5EU6E 4ELMF 4R96A 2JIXB 5C70A 3QNZB 4PJ7A 1Q9KA 1K8IB 5CJQL 2KZWA 4D0DA 3HZVA 3QPQD 4FQPA 5KAQG 3DX7A 1OL0A 4Z18A 1DVFD 4NCDA 4TVSa 1G84A 2ZSWA 1JMXA 4KHTH 4KK5D 4GAGH 4WGVB 5E4EB 1K8DA 3PDDA 3QUZC 1IEAB 5IBTL 5GRUH 5K9JH 3FOLA 4U4BA 1P6FA 5F7NC 4IMKC 1NGQH 2ARWA 3SDCC 1ZLUK 4PY7B 2FH6A 1JRHH 5C9JB 3SCMA 4PUBH 1SEQH 3GRWH 5HYQB 4YPJA 5BJTB 1VACB 1T5XA 3ES6B 4FP8L 2EIZA 1QLRA 1H15B 3MLTB 1RIHL 4NO3A 2PCPB 2MCPH 5DHVH 3GKZA 1EO5A 4FQLH 4GLRI 5F1OB 2NY0B 5I1IL 3UPRA 4KJPD 2J8HA 5DC0A 4HG4J 1JZ6A 5I30H 3IDUA 5DWUL 2KKQA 1QFWI 1J9CT 2YUZA 4U6XB 2AJZA 3T0EC 3EYOA 3PWPE 3L9RA 1J8HA 3C6LD 1PX4A 3TO2B 2FJGB 3OJVC 5F9WB 1VCAA 8CGTA 5FO8A 1VB9A 3D18A 3PWUB 1MCWW 4P5KB 2H8PB 3TO4C 1GC1L 1WT5C 3ARDC 3QHTC 4GKNA 1WWBX 2XTLA 3BRGC 4PB0H 4RDQF 5D7LA 3W2DL 4BELD 4AMKL 1CGXA 1PG7W 3IDYB 4ISVB 5DJ0B 3VMPA 5GGVH 3BI9X 2VSCA 3JBG7 1NBYB 4GW5A 4M6NL 3FO2B 3OZ9L 3T0EE 2X41A 5IWLA 3FO1B 1RIVH 5HI3C 1JFQL 3FQTA 1BGXL 1PEWA 5C0BB 1FSKC 2ICWI 3VW3L 5IBLD 2OS7A 3MBEC 2X4OB 3WFDH 2BNUA 4D8PB 7FABL 1IGYB 1MWAB 1I85C 1RI8A 5TE6H 1N7MH 5ESQA 5HHOE 4PTTA 5B4MC 4WHCA 3ULVH 3PIQB 1MAKA 1P4BL 3X13A 3ILQD 1CDJA 2HH0H 1HOCB 2V7HA 5EU5A 1QBLH 1BMGA 3Q3GB 5C0AA 4YHZH 5CWSA 4POZC 1V05A 1ITBB 4OZGF 1N64L 3O6MH 5E56A 3D3VD 3DETD 5D1ZD 1IC5H 5H37G 1ZLVK 3OXRA 1IFHL 3PE9A 3NZHL 1ODAA 4M7ZC 4G6AD 3WL9A 1TNMA 5DO2C 1S9YA 1SVZA 1T4KA 4I3SL 3QDJB 3T04D 1M05A 2Y6SC 4O5LL 1TQBB 4GO6B 5J6HB 5I1JL 2OTWB 4LCWE 1INEL 1RQ5A 3QUXB 5FK9B 4P9HL 2ZSVA 2VXUL 4K3DH 2R4SH 4P46A 2UVEA 5LVEA 1F11B 4RIRB 3REVB 3MNZA 2YPVH 4NQUA 2B39A 1G7MB 1MJ8H 1UC6A 5TGBA 3VFNB 2PO6D 12E8H 2YPLA 4XNZC 1Q9LA 1LILA 2P44B 3OAYH 5MEQB 5IESL 1MRDH 4POUB 5JHDD 4PRAA 3VXUE 4Y1AA 1KCKA 1KCRL 4PJ9A 2AK4B 5F8QC 3DI2B 3OKEB 5FYLD 4P2OA 2DQHH 1FPTL 4GXUN 3G5XA 5HD8C 1AR1D 5LG1A 3QPQC 1IRAY 35C8L 3CFBA 3TP4A 5KSVA 1FGNH 2GJ6A 4DFHA 4ENED 1ZSDB 3S8WA 5IB4B 3MXWH 3WUWB 1FNGB 5T1KD 1IAIL 4ZUTA 3V5HA 2BRQA 1DBBH 2F8VA 1EFXB 1U0QA 4QRPD 4OGAC 4O4YH 4ZTPH 5F7KC 4JHWL 5LCVH 2WANA 1RJLA 4OM0H 5C0CB 4ZAKA 3VWKB 5EG6C 3L5WA 4PRIA 4WEBH 3UBXI 2RGSA 4PRDB 5TFSH 3M17A 1Q0YH 2RFXA 3EFFB 5KVDH 2P48B 1CD1A 1YMHA 3MLXL 3QUYD 4NFBA 4XVUD 4Y5VA 2ADJA 4PLJD 1IAMA 5HHMB 5EC1B 4H1LB 1QBAA 2IWGA 5ISZA 5C09D 1WBYA 3GKWL 1NGYA 2BNRB 5F8RC 5CEZL 1OT1A 3OKOB 3W39B 4A6YH 3ZE1F 2VDOL 3QJHA 4V1DE 5AZ2L 2HTLC 4KJQC 5FKPA 1SY6A 1TJGH 2O61B 2ZG3A 1U91A 4XGZA 5L2KA 1YZZA 3VWJA 2EKJA 5KN5B 5SWSD 4JFYA 5I19H 3GB7B 4HLZG 5GIRB 1FL3B 4YIQA 1UA6H 1ND0A 4ZFGL 1DQMH 1W8NA 4YAQB 2YRPA 5DS8A 5F9AC 4R7DA 4HK3N 3RU8H 3SDAD 5DTFB 4GQ9H 1ED3B 3K74B 3NIFF 1HH9A 2AJYL 5HVWA 1EO8H 2I07B 4G6KL 5ACLA 3WCYA 2VLME 4DZ8B 1JGLL 2F5BL 2DWDB 4QGYA 2WQRA 3GSUA 4CRPA 4X6CE 3S37H 1NBZA 3A0OA 3A6BL 2RCSH 4LCUB 4NYLB 4OZ4B 4OZHE 1JE6A 3DIFA 1HHIA 4JFFA 3C9NB 3BPNC 4LEOA 3CFKB 5T1LD 4R4FH 4UV7H 2OM5A 2CRZA 4CN6A 2IQAB 3TT3H 4GG6B 1FRGL 3TGXA 4P2RA 4E41D 1NMBL 3WFCL 2VLLA 3DJ9A 5BVJA 1I7RA 2QEJA 3O45B 5C7XL 1X7QA 3NZ8A 2DWEA 4K7PY 4GRMA 3VFVB 5ID1A 4NJAH 3WKMH 5IW1A 1EHLH 2P47B 1BVZA 4JRYD 1H5BA 1P7QA 2V2XA 2WBWB 3IVKB 1WEJL 2P8MB 5F44A 4FQIH 1OP3H 5DI8A 3LDBC 2RHEA 3BDXA 1QLEL 1IMHC 4JRXB 1LHZA 3LEVH 5E2JA 3QH3A 4FRWA 1EEUA 5DRNA 1A5FL 2W0PA 5DFWH 5L88L 3Q5YA 1NDGA 3GSXB 2WINA 4N0CC 5D9SA 4R90H 1AXTH 1JF1A 5CINH 3IDNA 3NH7H 1RZJC 3OR7A 5FUOH 3S5LB 2XZAL 3T0DA 1OD7A 2OR7A 4LLQB 5ICXB 5BQ7B 1V7ML 5HHQA 5LBSL 4F3FB 4MXWH 1UJ3B 2CKBB 5E70A 5HVGB 4NQED 4GMTL 1ONQA 2I60H 1P4IH 4NQDA 5AZEH 4FFZL 2JJSC 3RQ3A 1DQDH 1OHQA 4MA7L 4OUUA 3ULVD 4LKXB 4ZUSB 3H3PL 4YHLL 1OQXA 2D03L 4YHYC 3UDWC 4MNQB 4OCSL 4PJ8D 2UZYB 1FG9C 2YRLA 3JUYA 3WE6B 1PSKH 1XR9A 2QLVB 4AEIL 2G9HA 4O2FB 2UZXB 5D1QC 4HWZB 1S5HB 1EGJA 1Y6KR 3CZFB 3O2DH 5DRZA 4L4TD 3CDCA 4ODTH 3DPBA 1EH9A 3KXFD 5FUCC 4Z7UF 1HNFA 2FGWL 3QEGL 2VLJB 1R3LB 3LKPB 2VMFA 1T20B 4J4PD 1UJTA 3LS4H 3GJFB 1WAAF 3V7AE 5J3HD 4NN7C 5TE4L 1T6VN 4CMMB 3GMOA 3WIIH 4KKLC 4NQCA 4U1SA 2XA8H 1JHTA 1UQSB 1OGTB 3RVXD 5B38B 2GHWB 4ZMAT 5D7IE 5I0DA 2O93L 1KCUL 2OQJB 3IFNH 3IU3B 4J3SA 2Y36H 2H1PH 4G8EB 5FUCE 2ITCB 2E5EA 4JEGB 5FXCH 1IQDB 1KG0A 4LSTL 4X99B 1FNAA 1WC7B 3T3PE 4PJHA 3EHBC 1FFQA 3ALXA 3SKMA 1ZANL 4XC3H 2CPCA 1UEMA 2FB4H 3QEQE 3TA3D 4Z7VA 4NO2A 2CK0H 4KDVA 5C0IB 2XNAA 5GGSB 1VKXA 1GXEA 4JFXB 3I3BA 5SWZE 3V5KA 3D39A 3SQOH 5MI0B 4RX4A 3OTTA 1NGZB 1LVEA 4JGJA 1LP9A 3EOTL 3SGKC 1B0GA 4R4BB 2I9LB 1NFIA 5BO1L 5C08D 2R0ZL 1TTFA 1AGCA 4QRSB 3SDAC 3WNPA 5JUEH 3EZ8A 3RWEB 3P3YA 5I9QB 3UPCA 2P4AB 3HAEB 3F5WA 3A67H 1IGTB 1IBGL 2BC4A 3KNBA 4WNQA 3IDXH 4TNWK 4UT9L 4OCWH 4K94C 5BS0B 2CD0A 3OL2A 2CR3A 2BOBA 1XR8B 2XQYK 2NY5H 3TPKA 4RA0C 5C0RH 4M3KB 4QO1A 4WJ5B 3HMWH 1WBZB 1AKJD 1RD6A 1TQCC 2ZG1A 3IFOA 3OKKA 4ZO8A 5FA3A 1BQHG 1MJUH 4BSVB 3ZE2F 3WEXA 4XVSL 2WBJA 4Y5XA 4YFLI 4F7MA 3JWDL 3KPTA 4GG8B 4YO0B 2ZWLT 3PP4H 4OLUL 1JPSH 2V7NB 1MY7A 3BX7C 3L95A 2J2ZA 5F7FA 1YMMB 1YN6B 4QNPF 3UTSE 4PTUB 4JZJB 1S7TA 4HDIB 5CZKA 5I2IB 4ONHA 2IAMB 1CLCA 3U82B 4DVRL 4TSAH 3O6FB 4G43B 4PP1D 2R0KL 4YDIL 2DTSA 4I0PC 3ZYZA 1C12B 2D31A 3FT2B 5CJ8A 3VFRB 3ZKMC 5DUBA 4JFOB 1DUYB 1DP0A 3MRQA 1W0VB 1AGFB 4JM2F 5DMKA 1NEUA 1KBGH 1CFTA 3N9GL 4N0UE 3FONB 5DR5L 1EDQA 3DOSA 3WDHA 3OKYA 4FFVC 2A77H 2X70B 1XZ0A 1XGRA 2NYYC 1EBAA 3E0GA 5DC9B 1UVQA 3RPIA 3VFSA 2ZCHH 5L9DH 1JZ4A 3IRPX 4KKBC 4KK8C 1B0RA 8FABB 5INDA 2ZOLB 5JO5A 1RZFH 1CE1H 1ZVSB 2HJLB 3MNWB 1DQLL 2H6PA 3GSNH 3S36X 1ZVHA 4Z5RB 1KB5B 1I1AC 3P0YH 3SCMD 2VUYA 4PJ8C 3E1F1 4X6DB 3EZJB 2OMNA 3GIVA 4TTDC 2XN9B 3KPQA 5E99H 2VDLL 3W0WD 4Z95L 3W5MA 5I71C 4OFYA 4LLYA 3VG0L 2WWMC 1EEYB 3MCLL 4FTVB 4HH8A 1XF3B 3IB4A 1T2XA 2YD9A 4I9WD 1OPGL 5ITFA 3BRDA 2GJZB 2JCCF 3UC0H 1YEFL 4IJ3C 1AY1H 4M43L 3ULVE 1J8HD 2H2SC 2IMNA 2RB8A 3FRUB 5D72L 4JZNA 3GMRA 3UJTL 3CSGA 2QV2A 4JKKA 4Y4FA 1IGCH 5I66A 4XXCC 3DBXA 3IS1X 5JHLL 1MREL 5IHLB 3QCTH 3GFUA 1DLHB 2VDPL 1H3PH 2JB5L 4IOSD 1UM5L 4Y88A 3QIBA 3RVTC 2P8LB 2ADIA 5DSCB 1M7IB 1IL1A 5IMKA 4EVNA 4I2XE 2NZ9D 4QHKJ 3SKOA 1YEDA 4MA3B 4TSCH 2ADGB 4OFPA 4OD3L 1W72B 3HG1A 1MF2H 5F6HJ 1OB1B 4I0CC 4XPHH 3MODH 4OCNC 2A6JB 2ESVD 1KEGH 4XXDA 3N1MC 4YDJA 5EN2B 3O9WD 2FX7H 1AC0A 4X4YA 2R1WB 3I6KA 3KPSD 1MHEB 3FTGA 4XT1C 1MJ7L 3GNMH 4XMPL 2PW2A 1I9RH 3GDBA 5C0AD 1IAII 3LQZB 3ZKXC 2PXYB 1J11A 4WO4B 1WICA 5IP4A 1EO7A 4PJDB 4KQ3H 3RGVC 3HPJA 4WW2C 4DN3H 1F6LL 3CMOL 4LBEA 1TLKA 3MYZA 1ZA6B 3GBNH 2W91A 2HFEB 4R7NB 4JAMA 4KKNA 1MRCL 3EFDL 4KKAC 5EU3A 4ONFH 1LO0L 1AIFA 2YHGA 5HI4C 1R0AL 3BD4A 5EZJA 3K2UL 4D9QE 2ARJA 1JNLL 4XC1L 5C08E 2HA1A 5FM4A 5IVXB 3FZUD 4YEEA 2OJZL 1KN2L 3D0VB 3PQYA 4HX1B 2GTZB 3DXAB 2C3GA 4PJ5B 2A6DB 1X3DA 2IPKA 1J1OL 2DF3A 2J5LB 3EUUA 1I8LA 3QQ4A 4CGTA 4Y5YB 4N8VG 4ESKA 4P46D 3LEXB 1NC4B 4YNYB 4PGDA 3VG9C 2BVEA 3QFJB 3EOBA 3V6ZA 4L9LB 4ZS7L 5I1LA 1CGTA 2DKSA 7CGTA 5I8KL 1MI5A 3EYUH 5DK0A 3BWAB 4Y4KC 25C8L 2P7TA 5LWYL 1I8IB 2M1KA 2XRAL 3MUGB 2GITA 4NZRL 1G1YA 4PJ9D 5ADOH 4XNQA 4LLVB 2DQJL 4P2OD 2AI0L 1QR4A 3H42H 2N56A 4XZUA 3IFLL 4NJ9L 4JPWH 5CSGA 1LEIB 4FQQB 3L3GB 4LHUD 4QTIH 2VZOA 3RNQA 1N59A 2IPUK 2EYRA 1U8QB 4CKVX 3CFEA 4HGKC 1HXMA 2CMRH 1JYVA 1A7RL 3SDDA 5D7KD 1FAIH 5CMAA 5GISH 2VDRL 4JVWA 4JFZH 2EDYA 2HKHL 4FQXA 4OLZL 4N0YH 5IB5A 1CD0A 4PJ7E 4PJGF 4ZAKD 4LK4A 1J0IA 2VNCA 4Y16B 1HILA 1NDMB 3MLUL 3HNTL 2Q76A 3VFOB 4NHUB 2YPKA 1BX2B 1U3HB 3FO9B 2L4OA 3O41A 2M8XA 5I17A 3V0VA 1T22B 3RDTC 1G9MC 5E08L 4OIIH 3DYOA 4AY0A 2FIKB 3UP1A 3WO4B 3CX5J 1J86A 3HRPA 5ISZD 2E8YA 4N68A 3RTQB 3LOWA 1AHWA 1CWVA 2ITDB 4XVTH 1QFUL 3FB6A 4G9FD 3VJ6A 2VDQL 1JNNL 3S9DB 5HDQL 1BJ1J 1A7BA 2BNQA 2EXWC 1VESA 1VGEL 2V2WA 4OBRA 3I84A 5K93A 2VOTA 5J1TC 2CUMA 1XCTB 1Z2KA 4HWBL 3MX0A 4R26H 4WEUD 1NC2D 3DO3A 2X44D 4UILL 4R0LA 2VXSL 3VD5A 1NANH 2G60L 1U8LA 3DUUA 5DEGB 1RMFL 3OKMB 4N9GA 4XH2B 5IWLC 1LO5B 2FJHB 2XI9A 2E9IA 3BP6B 4LKCB 1WBXA 3MLWH 1UADC 3RWDA 3HR5A 1GH7A 2GSGA 3ROLB 3VGFA 1QR1A 2J88L 4OT1H 3QXVA 3KPLA 4I4WA 2E7MA 4IHOB 1U8PB 5B8CA 5D7LE 5IGXL 1YNKH 4Z0XA 3VFTA 1FIGL 4GRWB 5IOPB 1PYWB 4WI8A 5JZ7D 4WFED 1CFBA 1ZK9A 1IM9B 4TUOA 1T1YB 5IV2A 5D5MF 4JFFD 4CVXB 4C83A 1EUTA 3SO5A 4DW2L 3SKNA 4OKDA 1CL7I 1KPVA 1CXIA 2QQNH 5KJRH 2CDGA 3ARYA 1UCTA 4P2RD 2AP2A 2OL3A 3OJDA 3O4LB 4G5ZH 1FZJA 4U31A 4XCYB 5LXGH 2CUIA 1YDPB 2AEIT 4JJ5A 1P7QD 4M03A 4BZ2H 4PD4K 5C6TL 1T3FA 3FZUC 1B4JL 1B6UA 4P2YA 4LDOB 1MOEA 1GGCL 1ZOXA 3MNVA 3N1GC 3MYJA 4DN4H 1RZ8A 1HDMB 3MJ7A 2LVEA 3MMEB 4ZQKA 5BOZG 4P46C 5I75B 4MQXD 1ZA3A 5IKCA 4EJ1C 3ARTA 2FJFB 1OAZL 1SEBA 4UDUB 1ADQL 1IGIL 1ZAGA 4X7EC 2JJTA 4YHNB 3RWFB 3L6FA 3QULB 2JB6A 4LF3A 3VXQB 3OKDB 3QNZA 1F3DH 1WWCA 2LU4A 3WLBA 2DTMH 4GUPB 4O51B 4BFIB 1RUML 4P2OC 1QYGL 3RY4A 3BPOC 3AXLB 4XHJC 3GSQB 1EXUB 4AIZB 5M7QA 1A9BA 1IT9L 1AC6A 4YDLB 2DDQH 1KN4L 3QDMA 2HT3C 3K46A 1NEZG 1Q9WB 5C07D 4BK5A 2VR4A 1DE4A 3DX8A 2YPLE 4LIQH 1U8MB 1IEAA 2A9NL 4PJIB 4WHTB 4Y1AE 2AJSH 4PJBB 5HXMA 1D6EB 3TH2T 3SHSA 1OGAA 2V2TB 4FNLH 1KCSL 4P23D 4Z7UA 2NY5C 4KHXL 5LGHH 5DVOA 5C9JA 5KG9B 4HIEB 5HGBA 1WAAA 5BJTA 3I50L 1VACA 2LAGB 4LCIL 3ES6A 4LPXA 2FECL 3O8XB 3WD5L 2BVQB 1TVHA 4NKIL 2GJ6E 4NUGL 3RVWC 1H15A 2PCPA 1EIBA 2BY1A 2F5AL 1N4XH 3PWLB 4Y5VC 1P2CB 3P4NB 4HXAL 5C2BL 3T1FB 1CLYL 3TF7C 4YHOH 1U8KA 1L9MA 3SDYH 1G0YR 4U6XA 1IC7H 3H9YA 1Q72L 1YEGL 5AYUH 1N0LA 2UY7A 1OY3B 1S7RB 1F58H 1NAMB 1RK0B 1IEBA 2QHRL 4PRIE 4LAQL 1MHCB 3U0PB 4F7PA 1QSFE 1BQHB 5DQJB 1A6UL 2W0FB 4XPGH 1LO2H 3VWJC 5E6IB 1A6WL 4MJID 1E28A 3VMNA 4RX4D 2M2DA 2MWCA 3VXRB 3D0LB 3ZTNL 2CO6B 3OXSB 5T3ZH 5ISZE 4M7LL 4GBXB 5SX5H 4XPAH 2KZ1B 1K5NB 2YSSA 3FO2A 5HVHC 4M00A 4AENB 4QLRA 3FO1A 2VL5B 4HUUB 4XPBH 2NY6B 4OGXL 4ZODA 3E2HC 1M71B 5C0BA 1IQWH 3EDKA 4K3EL 2QADB 5DD6B 5IFHH 5L2KE 4D8PA 1BEYL 2K7QA 1MWAA 2ADFL 2HG5B 3F62A 4LRIA 3K81A 2VISB 2E7BA 1B2WL 3QDAA 3PIQA 1A7PH 1HIMH 4OGYH 2ATKB 4LSRH 4XP4H 5F7HA 5FM5M 3UTPE 1HOCA 3P2TA 2MPAL 1SM3L 4N1CA 4K07A 3QZWG 5I74B 4P5TD 4K7PL 4RGMC 3TH4T 4FXLA 2PYEA 4NRZB 4PBWD 1OOAA 5J1SC 2WBJD 1BWMA 2DLFL 3MV8D 4PREB 3RX8A 1NJ9B 5J12B 3QIUD 1T03L 1VGKA 1MIEH 1AH1A 5GJSH 1NCAL 2VQUA 1PGRB 5GRZA 2Y06L 3V2AR 2P1YA 5DYOB 3DVGA 2J3SA 4ZXBB 3VRIB 3OMZA 1CR9L 5KZCD 4HPYH 4CNIA 1KIPB 1UXSA 5CGTA 2HJKB 4XTRC 3TN0B 2OTWA 4UU9B 4UQ2B 3R0NA 1GRWA 3PL6C 3C2SA 1QKZH 5FK9A 1C1EL 5DFVC 1VERA 4P2RE 4XMKL 5D7JD 4FA8A 4RIRA 1F8TH 3H0TB 4NWTL 3WDJA 3RA7H 1G7MA 3FMGH 3VFNA 5EOQL 1YQVL 2H45A 1KEML 3EYSH 5MEQA 5GRYA 1S9VA 5AEAA 2ZUSA 2PKDA 3MRRB 3U0WH 4O2EB 3MRDB 4FQ2H 2KQMA 5T1DH 3BH9B 2AK4A 1WTGT 3OKEA 2DBLL 3NAAL 5GS0H 1EVTC 3QCUL 5GGRA 5MEOA 3V52L 3RNKB 1HH6B 1KYOJ 5CP3A 1KACB 4YBQC 2VL4A 3K8KA 1UACL 1CIDA 1EPFA 3NABH 3HNVH 4OFYD 3P4OA 1EFXA 4UT7L 4X6BB 4YGVA 1D5ZB 4LFHG 2OL3H 4K9EH 4OZIF 5CIPH 4HIXL 4KMTL 4GT7A 4NQDE 3QRGH 1UENA 3VWKA 1T1XA 1FE8H 2AS5M 2OI9B 4DGYL 4R3SB 1PVHA 4PGJA 2EDKA 2ZUQB 3FO0H 3VXMA 2C3WA 4LSUL 4Y4FD 2WIIB 1NGWA 3DVIA 1QRKA 4GMSL 5CZVL 3EOYG 1DBJH 3CCHA 2WW8A 5SX4I 5EOCH 1HN1A 4CW1A 5EC1A 4UTAL 4HS6B 4KRNA 2BNRA 3GSOA 3BKJH 1Q38A 3PV6A 1A7NL 3ILPA 2WLZA 3OKOA 1DANU 1OAXL 3J8F7 3BAEL 3WFEL 4OLXH 3RI5K 4CL7A 4TUJA 1GGTA 2O61A 3FRPA 1SBSH 4X5WB 1ZT4B 2FO4A 4ZYKB 2PN5A 2YZ1A 2Y25A 4NQCE 1RV6X 5TPWL 4FABH 4IRZH 3HG1D 3HFMH 3UPAA 1Z9LA 2X4SB 5L7XL 3T4YA 5K59E 1NCUA 3RRQA 5KN5A 5GIRA 4FN0A 3IAPA 4MXQD 4N8VB 4NT6B 3MLZL 5D7SL 2R23A 3MLVH 1E6OH 4X8JB 3UJJL 3QUMA 1I3UA 4MAUH 4PJHE 4NPYA 5IHZB 5HPMB 1ED3A 2A83B 4IMLB 1BVLB 4O2CB 3H2WA 1V8HA 2BHYA 1KIRB 5KW9L 3FJTA 1MCCA 3FT3B 1DSFH 3KJ4B 1L6ZA 1I75A 1A14L 1RURL 1SJHB 2J4WH 2Z92A 4TPRL 4F57H 1XGQB 1OT2A 5F96L 4MD0B 3D39E 2F74B 3CC5B 5JR1L 4UQ3B 3JWOL 4LVHB 1LP9E 5B39A 4LCUA 4NYLA 3OSKA 2YXMA 1A0QH 2EC8A 3VRLE 1HQ4A 5E00A 2BSSB 3WLWD 5E5MB 3C9NA 4J7RA 3X3FH 3PQYD 4HS8L 2OCFD 3X3GH 4TRPH 2C3VB 4UNUA 3V4VL 1IKFL 4JHAH 43CAA 1X5LA 1A21A 5DMIH 4XI5D 1BFOA 3V79C 2IQ9H 3VFVA 1M4KA 3O6KL 3DYPA 1IE5A 43C9B 5IEHB 5IVNA 2G75B 3D25B 5GGTH 4MX7A 5DK3A 1MI5D 1MHPL 4XCEB 3T4AA 2FZ3B 2P8MA 4R2GB 1IVLA 1G7QB 1XGTA 4EI5B 3I02A 2FHFA 4JO4L 4JRXA 4NZUL 4WU5B 1HHHA 2X4QA 4XPFL 4PP2B 2X4RB 3GSXA 2X4PB 1JCKA 3AAZB 3BGFB 2W92A 5T3ZD 4Z9KB 2VB5A 5DD0L 4HJ0C 4WTZA 4WRLA 1UCBL 4LLQA 5ICXA 5BQ7A 5I1GL 4F3FA 4KDWA 2CKBA 2A1WH 2VTFA 3T3ME 3ARFC 2N1KA 4JO2L 4V2CB 2PYFA 4C54A 4NGHH 3VFMB 1MWAH 1ZLSL 5JW4Q 4P4RA 4FQXD 4MMXC 2NY1C 4LKXA 4ZUSA 3WNKA 1FYTD 1NLBH 2W65B 2MHAB 1F4WH 4MNQA 2F53B 2I26N 3WE6A 5FYKE 4PJCF 1T04B 1AE6L 3PF2A 4RNRB 4F7CB 5GZND 4PJGA 3C5ZA 1S5HA 3CZFA 3SO3C 1G6RL 3DMMA 5IM7B 1CICB 3BHBB 4UOJA 2VLJA 1R3LA 3BXNB 1NSNL 1T20A 4KVNL 1WITA 2FR4B 3V4PL 4MA1C 2XTJC 3AREB 2F8OA 1ZLWK 3S34H 4YH6A 1PFCA 2NY4D 1A8JH 1GAFL 1UQSA 4Q0XL 3NCEB 1FV1B 4ELKB 1OGTA 5B38A 4U7MA 1RUAL 3KYOB 3TIDA 4AEHH 3KPRB 5EORH 4OLYL 2GSIB 3VCLA 1CVRA 1QRNA 4MDJB 3FQNB 5IBUG 1MQ8A 2VXVH 3G5YA 1PAMA 2ICEB 1B9ZA 1CBVH 5KVMC 1S9KC 2WM0A 2ITCA 5D2NA 3B9KB 5JDSB 2XTJE 3QIBC 3FKUS 5J9PB 2NY3D 1X44A 2QR0A 1WCBB 4EUPA 5FO7B 2UY6A 3U48A 2P5WB 4OI9A 3DSNA 4FHBD 5GGSA 1KELH 3RBGA 3N0PB 3HMXL 1U6AL 2X89D 5IHUL 2VITB 2V17L 5EO9B 5GS0D 4XP9H 1WTLA 4XBPB 3RVVD 4KTDH 4MXQC 4BQ9A 1RIUL 1MFEL 1Y18B 3GUTB 4R4BA 2I9LA 5TF1L 4M1GL 4RFNC 4Z78A 5A16B 4DEPC 2V5MA 4QRSA 4YPGA 1PJ9A 3TBSA 3LH2L 1U8HB 4U1KB 5IG7A 1MLBB 1KJ2L 1AXSB 2B7DT 3MACH 1U8JA 1LO3L 3QXTA 4HUWB 3MROB