3ZTJG

Structure of influenza a neutralizing antibody selected from cultures of single human plasma cells in complex with human h3 influenza haemagglutinin.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
129
structure length
129
Chain Sequence
QVQLVESGGGVVQPGRSLRLSCAASGFTFSTYAMHWVRQAPGKGLEWVAVISYDANYKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDSQLRSLLYFEWLSQGYFDYWGQGTLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords HEMAGGLUTININ HA1 CHAIN
publication title A Neutralizing Antibody Selected from Plasma Cells that Binds to Group 1 and Group 2 Influenza a Hemagglutinins.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 129
sequence length 129
chains with identical sequence I, K
ec nomenclature
pdb deposition date 2011-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ztjG00
5I1CL 1JPST 4NKDA 2YD8A 4I9WE 4M6OL 5DK2A 5CJOH 1BD2D 2R69L 5GS1B 2OMBA 1H8OA 4PBWD 2CIIA 2B5IC 3RWCA 1BM3L 3TN0D 2IH3B 2K7QA 1AGDB 2R69H 3O2VL 4JRXE 4E41E 4H8WL 4F7PB 4PJHF 3AMLA 4R26L 4Y89A 3U7YH 3P4OB 1MJJB 1U42A 3TVMA 1MCHA 5I6XB 1IEAB 2D4DA 3DGGB 5B8CA 1I3VA 3GSWA 4IJ3B 5INDA 4R26H 2HMID 5IQ7L 2NZIA 5C9JA 4LLDB 3W82A 4P9HC 3T0EE 4L4JA 4Z7WF 3ALXA 3GO1L 5TF1L 3Q5TA 5EOTB 5IQ7H 3GO1H 1VENA 3GSNL 3U7WH 2HH0L 1WAAF 4GUPA 3RL1A 1X5LA 3LAFA 3EBAA 2JCCA 3GSNH 5JXED 1OB1A 3UTSB 4RMUA 4FQHB 1DQTA 3QULA 1F4WH 1U8QB 4LFHD 4YBLC 1JN6B 1KJMB 1NQBA 3R1GL 1RJCA 2OYPA 4OCLC 3HPJA 4KUZL 3LKRB 3K8KA 3GI8L 1RVFL 3R1GH 4JFEA 4PJDA 2B4CL 4IRJA 2HLFC 4DW2L 4GKZB 4ODVH 1GJIA 3BEWB 3CFKB 1RIHL 4D94A 3Q1SH 2LV4A 1HSAB 3U48A 5EO0B 4H1LB 3AMKA 1N5AB 1S78D 5T1KA 4JM2F 4FQJL 4F58L 4GG6A 1W72H 2EH7L 3FO0L 4MCZB 3IKCB 3EYFB 4OZ4A 4UAOB 4KROD 5HSFA 3TO4D 4Y4KA 3FO0H 2VTFA 5HY9A 4YGVA 1NGXB 3R4DA 3ETBF 1MOEA 5E2TL 1P4LB 4JFZL 3WLWC 1ZGLA 2HT2C 5IV2B 1WWCA 4MA8H 4JFZH 1PBYA 5LGJB 3K1KC 4C55A 1IGCL 5F1IB 4NO0A 5D2LA 3BP7B 2WLZA 1WFNA 1FNFA 2QADB 1QO3B 2V2TA 3OQ3B 4Y4HD 3HG1E 1U92A 3B83A 3LQMA 2XN9B 5H94B 1WV7T 5LXGL 3CMGA 1AO7A 1VGEH 4OM1L 2D7NA 4U7KA 2VISB 4KK5D 5LXGH 3P3YA 4JREB 5ICZA 5DO2D 3FHAA 2P44B 3KXFB 1NFIB 4UUJB 2KZ1B 5E99L 1HOCB 5CINL 5DJCA 3QDHA 3T0AA 2ID5A 3VFNB 3ARDD 4NWTL 5F9OH 3KPRA 5C0BD 3STZB 4NWTH 2C3WA 2DRUA 3K80A 1MCQA 1VKXB 1ROWA 3PF2A 5TFSL 3O3UN 5GGRB 1XF3A 4MB3A 5FKAB 3MLVH 1LD9A 1T0MA 5ID0A 4LRIA 3OXSA 5TFSH 1J0HA 2J8UE 4NJ9H 4G9DB 4J4PA 4UNUA 4NCC2 1FG2B 3NACL 1IEBB 1S8DB 3ZL4H 1JYNA 2BNRE 3DX9A 3TWCL 2PO6D 3DIFA 4X83A 5IW1B 5BMFL 4WVRA 3C5ZB 4XC1L 2DOCA 5FA4A 3CC5A 1AE6L 3L3IB 1V3MA 4HCRL 3TWCH 3EHBD 4ISVA 5BMFH 2AV1B 5JHDB 5DRNA 4RGNB 1OPGH 3KPMA 3MODL 4IRSD 2VLLA 1H3UA 2G2RB 2HLAB 1KEGL 1MFBH 2BCKB 2YUVA 1FO0L 3TBVA 4X6BA 1MJ7H 2EC9T 3I6LD 4MNHB 4Q0XH 1KEGH 1WBYA 4P2OC 1WZKA 4ZOBA 4HUNB 3W9DA 4EN3A 1N6QH 1S9YA 2FCBA 2X7LB 1ZSDB 1H3XA 5DJ0B 4RBPH 5HHPB 1NH6A 4NQXA 5D7JB 1BFVH 4HFWB 1T83C 3LZFL 3U46B 1FC2D 4LGSB 5F3BB 3B9KD 4YIQA 5CJQH 3LZFH 1NC2B 1UWGH 3L3KA 1AHWC 4BH8A 5LJYH 4XVJH 3IFOA 1ZT1A 2E7MA 4HQQH 3SE9L 4DKEL 4I3SL 4XP9L 5A2FA 3PHQB 5F88B 4TSCL 3SKJH 4OCWL 4JRXB 1F8TH 4E41B 1I3GL 5EBMB 4OI7A 4LSDA 3K8MA 4FQIL 1X5KA 3ARBC 4TSCH 4O2FA 4OCWH 1QBLL 5E9DD 1AKJD 3OKDB 3ARPA 4B41A 2I9LA 5KANI 1U3ZA 3QIUD 1ZLVH 3MGTB 3T0EB 4HXAL 3QEQE 4QRUB 4DCQB 3TNMA 3BW9A 4PB9L 4IDJH 3AS3A 4IDLA 2HVKB 1IAIL 5A2KH 4Z77B 2CLZA 5FHBH 5J6HA 4WI6A 4CU7A 2QSTA 3K1DA 1ED3A 2Y1VA 3SDXE 1IAIH 1SMAA 4XAWH 2CDFB 1BREA 3EOBB 5D8JL 1BVKB 1L7IL 4JO3L 5EUKB 1B3JA 3H2WA 4K9EC 4L9LC 5D8JH 1T1YA 1L7IH 1NLBH 3LKQA 1EGJA 3VFRA 1G7JA 4R4FL 1SJVA 3MUGA 5I75C 2FJHB 1AGEB 4R8WH 5HYSG 5BQ7B 2FLRT 4OCRL 4J8RA 2Z93A 3AUVA 4C83A 4F9LA 4WHYH 4R4FH 1JZ6A 4YDLB 4YEEA 1NKOA 3ECBA 4M8QA 2PYEA 2Q3ZA 4TUKL 3WJJA 4RAVB 3RZCB 5IJKA 2SEBB 3IU3B 5DR5H 3LEYH 4OD3H 4C4KO 5CZXD 5M94B 1NC4D 3RY6C 1CVRA 4XMPL 4BZ2H 3OR7B 3M07A 3L3GB 4H0GA 5MERB 1FFPA 3FFCD 1RULL 1S5HB 3H0TB 2A6JA 1Z6JT 4PY7B 5B3JE 2ZOLB 4QKXB 1F5WA 1FZJB 4JG1H 4PPTA 4NT6A 3T3MF 4LNRA 4LARL 4M8VA 3BXNA 1U8NB 2EYRA 5JZ7D 1DP0A 3O8XA 3IDJB 2C3HA 4I0PA 3QAZB 2PYFB 5GS2H 5KG9B 1XF5A 4MNGA 4NKMA 3I02A 4N90D 4CADA 3NZ8A 3MXVL 3IVKB 3A6CH 5LQBH 4IMKA 1TZGH 2C7UB 1OAYL 2WIIA 3HG1B 1CFTB 1U6AH 3MXVH 3E6FB 3VE0A 4G8GD 1EFXA 5E00A 1OAYH 2DWDA 5JOPE 3BH9A 4XBGA 5E2VH 4L1DA 1U58B 2X4PB 3QIBD 5C2UB 1I85A 1FFOB 4ZFOB 3TT3H 1M7IB 4Y2DA 3D25B 1RJYB 3C60C 3KG5A 4POZC 3HZVA 3O3EB 3GZKA 2VITA 1MHPH 2XZQL 4Y1AA 2DTML 1QSED 4PRAB 3KS0H 1QP1A 2DAVA 3CX5J 4OZFH 4P9ML 1XH3A 2DLHA 3NIFE 4YZFE 4PJCA 1R0AL 2XZQH 2DTMH 2X6MA 5ACZB 4PJ7A 2VDKL 4L3CB 4ZTPH 4P9MH 4JFYA 5D71L 1ITCA 2J8UB 1L6XA 4H26B 1R0AH 2O5XL 4DJMA 4N9GA 3U4EB 5ID1B 4G80B 4HWEH 2AJYL 2VDKH 3INUL 4XCEB 4XCNA 1VEPA 2UZIL 5TQ0H 3RWEB 3M8OH 2HLFD 2O5XH 1U0QA 2BSTA 2CUHA 1UJTA 2V7NB 2ZUQC 3QDJB 4PJAE 2Z92B 4JPVH 3SGKC 3VD9A 3BVNA 1HIML 3ULVL 2P48B 4PJEE 3IFNH 4MJIB 5DI8B 5DUBB 4JFEE 5K9QG 3P9MB 1HIMH 5C0AD 2YUWA 3ULVH 4P5TC 1TXKA 4O9HH 1KCRH 1ZA3B 4Y16B 3KPOA 1MRCL 4Z7UF 5FUOL 2CMRL 3F7RA 4K3DH 5GSRB 3VXUD 1FE8L 3GSXB 5AG8A 5ITFA 4DZBA 1MAKA 1UKSA 3NH7L 1D5MB 4OKDA 2LABA 2EIZB 4HMDA 1FE8H 2Y06H 3WFHA 1LQSR 2VDOL 3IJSB 1CE1L 2BZDA 1N6VA 4A6YA 3LKNB 1IC4L 1A7PL 1J5OL 2OR9H 1HZHL 2VDOH 1IRAY 4JPKL 4G43A 3LS5H 4XNQB 1CE1H 1AXTL 1MAML 3VH8B 5FO7A 2IPUK 1A7PH 3GRWL 4ACPA 1HZHH 5CJXA 4HUUA 4JPKH 1AXTH 3WSQL 1MAMH 3RWIB 4GT7A 1EEZA 4ETQA 5IMOB 3K2MC 3IYLW 4X98B 2E9JA 4MAYC 5DJ6A 1CDUA 3VXSD 3WSQH 3RI5K 3WUWA 2QR0A 2VQUA 4PJ9A 2LU7A 4TUOA 2A73A 1IKFL 4HK0B 4X4YA 4HDIA 3HC0B 1ULVA 2FYYA 3VGGA 4L4TA 3MO1B 1UCBH 1IKFH 3BPOC 4PTUA 3MXWL 3MROB 1YY9C 4Y5VA 4Z7VE 3EDFA 3MXWH 4EUPA 3QEQB 2IBBA 4JQXA 4JZJB 3NABL 2XKUA 4GKNA 4JZNA 5KS9A 4JVWA 3PWJA 1RD6A 3UYOD 4GW1B 4YBQC 1KPRA 4LCCA 4TPRL 1F4YL 5TGBB 1WISA 3MACH 5J1TC 1QBML 3KPRE 3ZKQD 4PRPA 4TPRH 3V6BR 2ICES 1F4YH 5GGSB 4G6FD 4BH7B 5DMIL 3RY5A 4EI6A 5DA0B 5DURD 3QFJD 4FXLA 2W91A 2XWTB 5DMIH 4R9HA 3REWA 2CK0H 3NA9L 1G84A 1NAMB 1HILB 3PP4L 4NBYB 3FB7B 1P84K 1CLOH 1WWWX 4M7JL 3BKYL 3LIZH 1PX4A 5HVGB 1YECL 2W0LA 3QB7C 3NA9H 1JF5A 2G5BB 5EBWB 4M7JH 5E5MA 1B0WA 1KYOK 4GRLA 5L0QB 3TBTB 5TJWK 3HMWH 5FUZL 5T3ZE 1KC5L 5C07B 3BRGC 4F7EB 1EMTL 4P2OD 5FUZH 5C0FB 4UV7L 1KC5H 3TNNA 4JFHE 4ZO9A 4RAUB 4ELKB 2JJTA 2VZ1A 3S96A 4UV7H 3U6RA 5IK3B 3LHPH 4OQTL 1MNUH 4ZS7L 1SBSH 5CSZA 1P4IL 2Z8SA 3OG4B 2XKNA 1XR8B 5DWUH 1A4JB 1NCWH 5C0DA 4MA3B 4JLRA 4X9BA 3MRBB 3UTPD 4J3OC 2W9EH 3LKPA 4BFIA 1E6OL 1OWWA 1DBMH 1XT5A 3D0VA 3MRDB 2MKWA 2D4FA 5AZ2L 3P9LA 3ULUE 3HZKA 4F37K 4JFDA 3ARBD 2GYSA 4PV8A 3CX2A 2VZOA 3RTQC 2J2ZA 4PJFE 4LKXA 4YHPA 3TBYB 2ZG1A 2CIKA 2FLBT 3S7GA 3GMQA 4LIQE 1L4IA 4K07A 2ZUTA 1X9QA 2AGJL 2E7LC 3FT4A 1OCWL 1FAIH 3L3JB 3VJ6B 3SGDI 4XNZB 3O4LB 4DTGL 1HHGA 4E5XB 3CK0L 3MRNA 2NW2A 1OCWH 1QSFD 3NIGE 4G5ZL 4DTGH 2DI7A 3MLTB 3ES6B 4EDWH 3E0GA 4JCMA 3WUZA 3O6FA 4G5ZH 2YEZB 4FNLH 5DMGC 3BDBA 1WICA 2QKIA 4P57A 1XFPA 4UQ3A 1LILA 4R4BB 2W60A 1KLGB 3P40A 4XXCC 4LSTL 4JGMA 4OZGF 4PJAB 3DO3A 1C1EL 4UTBL 5CZKA 1U3YA 1U8MB 4YWGL 5DJ2A 4IIQA 4PJEB 1A3LL 4FQLH 5D5ME 3LPGA 5KSAC 1C1EH 5DVKA 2K7PA 4HPOH 4OCMC 1A3LH 4YFEA 2VN7A 3S4SG 3AREC 3ZDXE 5AWNH 1SM3L 4C56A 5EOQL 5GJSH 1CD1B 1J8HA 3C8DA 4UOW0 4R0LA 1SM3H 1T4KA 3MNWA 3VD5A 1IVLA 4KDTC 3UYPA 2JIXA 5J9PA 2Z31B 2VDRL 4XMLH 4RQQA 4Q6IB 1S9WB 1TLKA 1U8JB 4M5ZL 4KWUA 4U6XA 4J1UA 2V5TA 2VDRH 4BA8A 2E8YA 3X17A 4NNPH 4W4OA 4QRTB 3ZYIA 2EE9A 3T08A 1FYTA 1OAXL 2LE9A 1FVCA 5CLWA 1U8LB 1SVZA 3IAGC 4RNRB 1OAXH 3GM0A 1H3PH 2ZWLT 3WKNA 4PJ5E 2BNQA 4WENB 2VE6A 2ICWA 2H45A 1TQBB 5CILL 3HS0A 3MJ7A 2FO4A 3MV01 3HB3C 4QXGL 1V5JA 5HGAB 5CILH 3EO1A 4O00A 1CDIA 1N8ZA 4PJXE 3GMRA 3LSOA 3C60D 3EDJA 3HMXA 2XACC 4LBEB 1FL6A 4QXGH 4HUXB 1DSFH 4POZD 4Z7VB 4O2EB 3T2NL 2A6DA 1QEWA 2IPUG 3TYGL 2AXFB 1JZ8A 4OT1H 4ODWB 2Q6WA 3EJYC 4BQBA 4XHJC 1MFNA 3T2NH 3RL2A 3RDTC 1UKQA 4NKIL 4P3DA 3VFVB 3GSVA 4JKWA 1LMKA 4OFDA 2DKUA 4NUGH 1MVUB 2NY1C 1NMBL 4NKIH 5DRWB 3VFOB 3NTCL 1K2DA 1B88A 3EFDL 5ICXA 1NMBH 1W0VB 5SV4A 5DQ9A 3SCMC 1RZKC 4PJCE 1PDKA 3GEWB 5TE4L 3GHEL 1KENL 1EPFA 1T5WB 1EFQA 2GFBB 2BSRA 3OKYA 3JV6B 2BVOB 5I15H 2GSIA 3C8KB 5IB5A 1BVLA 4X0KA 5AUMB 4P5TD 4LLVB 2HAZA 3VXQA 5IG7B 4GOSA 1N3NA 43C9A 3T1FB 2DYPA 3SDDA 4QXUH 2A6KB 4K71C 3CPLA 5B3NA 5C7XH 5T3XE 3UPRA 1UM5L 3HNSL 5FF6A 1V3JA 4P2RA 3UYRL 1BIIA 1F3RB 1NUDA 1I8MA 1AGCA 3DO7A 5F9WB 5D1XB 3CDGA 3HNSH 4P5KA 5GS0C 2F5AL 5BZWB 2VN4A 3TIDA 1WK0A 3MA9H 4M7KL 3ZKSD 4JFPA 2F5AH 1AY1L 1JCKA 2MPAL 4H25A 3PWLA 1ZHLA 4OLZH 2HRPH 3PV6A 2VUOA 4L3ED 4PB0H 1AY1H 2MPAH 1CXIA 2GI7A 2F15A 3D85B 3SQOH 3PL6B 1I7ZB 1IE5A 3B6SA 4MAYD 2IBZY 1IMHC 4QRPD 5JDSA 2ZOKB 4JKPL 4NQED 5GS2D 5I1EH 4RBPK 4KH2A 5T5NF 1C5DA 3UC0H 1CS6A 2FR4B 1KV3A 2XOTA 1I1RA 5FYLE 4JKPH 4U4BA 4UDTA 5IMKB 4WTZG 4EZMA 4WHCA 4MQSB 4TNWK 1GZQB 4DFIA 1PZ5B 3QIWB 3NCCB 4PJFB 1JI2A 4ZUSA 1B4JL 4XNMB 5D96C 1NCTA 1G9MC 1LEGB 5D7JC 3TCXA 3QUMB 3AXLA 4LSUH 3WLBB 1H0DA 2IADB 3U0PA 4FQQA 1VCAA 1OM3L 3D3VE 4FZEH 1BVZA 4YBQD 4PP2A 2DLFL 4LQ1A 1NSNL 2NW3B 1X6LA 5ERWB 2NY3C 4JHAL 4Y5YB 3Q6FA 3BQUC 1IGML 4NYLB 5D6DA 4QRQB 4ZFOL 5E08H 1R3LB 3I6GA 2UY6A 3RWDB 3PJSA 5GGSY 4JHAH 3O6MH 2FL5B 5HDQL 5D7LA 5FB8A 1FGVH 4CMHC 1LDPL 4ZAKB 4BQ9A 1A6ZB 1SYVB 4XPAL 1Z3GL 1AP2A 3BX7C 1LDPH 1A1OA 3T4AA 1TVHB 5F7DB 3I75A 4BQCA 1Z3GH 4I1NB 3GB7B 2VLRB 2VSDA 5T1LA 4MSWB 1U8KA 4ONGL 5I66A 5D5MB 3O3BB 1Q72L 1SQ2N 1RZFL 1ZHBA 4NKOA 2HFTA 4NQVA 3P4NA 3SJVE 3R0MA 4OSUL 3VGAB 4QHUA 5FCUH 3RUGA 4D0CA 4IEFB 2A77L 2CRMA 4OSUH 1JPFA 1VFBB 2QL1A 2B2XL 4HWUA 3ARWA 1TFHA 3OL2A 2A77H 2HA1A 4X8JA 4XWGL 4I13B 4K94L 1ZS8B 3OZ9L 3F5WB 1IGTB 5DQDH 5DQJB 3QXDB 3LMJH 1OARL 4LDLB 5ESQB 3H7BA 4WNQB 4NM4H 3OZ9H 3W0WE 3QQ9C 1UA6L 1F6FB 1RSFA 1OARH 3T4YA 4KI5E 5SV3A 4ALAH 1CGYA 3VFSA 4YDLC 1G7IA 3MRRB 3KLAA 1YEHL 3BHBB 3MRIA 2CDGB 3RVVC 2VXUL 1A6TB 3WL9A 4Z7QE 3MBEB 4XVUC 2ZKHH 2P8MB 4WIQA 1P9MA 2ICEB 1HKFA 3OX8B 5I1HL 2OX5A 4LLMA 1MI5A 5LAXB 2VXUH 4GW4B 5I1AA 4PJ5B 1QRNA 1P7QB 1HCVA 1FFNB 4HT1H 4I4WA 5C0EA 3KJ6L 2ESVA 1JMXA 4WO4D 1U95B 4LHUD 4HAGA 5ICYB 1J12A 4X5LA 3KJ6H 4P5MB 2Q86B 4NUJB 4XX1G 2VB5A 2HG5B 3GMLA 3MCLL 5FO8A 3IETB 1T1WA 1HQRB 1FP5A 1IC1A 4WCYH 1JIBA 1W8NA 2VR9A 3DGCR 3MC0A 3MCLH 4G6JL 5J7CC 1DVFB 3L95A 4MJ6B 2CSPA 4MWFB 3C87A 3VXMD 2ADGA 2OS7A 4XP6H 1NGPL 4G6JH 5I16B 1MHEB 3ULSB 1WFTA 4MMZC 3WDJA 1NGPH 5H2BA 5EU7C 1HQ4B 4O51A 4YR6A 4P4KC 5DMGD 4BKLB 3SDCA 3KWWA 4P9HL 4GBXC 4UQ2B 4PRID 2YD2A 4M5YL 1D5ZB 1J8KA 1WTGT 2Z91B 4G8IB 5I1IH 5F70A 1T5XA 1WTLA 5KSAD 3QQ4A 4XPBH 2EO9A 4EDXB 5IBUB 3V6OE 1YY8A 3QDGB 3RIFF 4WV1C 3VDAA 2QQLL 4FQXC 3V52L 3OAZH 1QLFB 1MWAL 3ARED 1F4HA 3IS0X 5H35B 1U3JA 4KQ4L 2QQLH 2X2YA 3V52H 2NXZB 1T2QH 1DN0B 2V9TA 4KQ4H 3S35L 2FSEA 1HXMA 1NAMH 5CS7A 2FX7L 3S35H 5GHWL 1MFAH 1A0QL 4ODHH 1I4FB 1GSMA 4M3KB 5GHWH 3IXTA 4XTRC 5HBBA 4Q9CA 4WI4A 4U1LB 4U1HB 5BS0B 4X4XB 2RGSA 3KPNA 5E8NA 5HYQA 3VRIB 2FEDC 4TN9A 2DLEA 4YHIB 4HKBA 5I73C 4QTIL 4WWKA 4OBSA 4OF0A 2Y72A 1IZJA 1RZGB 2R29H 1YEGH 3DX8B 4QTIH 4NQCD 4X4ME 4PD4J 3HB3D 3SE8H 4N8CH 5DJDB 1UQSA 2C26A 3C6LC 4OIAA 2QHLA 5I1JL 2BNQE 5I8KL 1UJ3B 3AS2A 2D9CA 4YHKL 1EEYA 4ZYKB 1KGCD 3ARGB 5I8KH 1W0WA 3EJYD 1LHZA 1RUPL 4XHJD 5TH2A 1FN4A 3FKUS 2WQRA 4YHKH 4GMTL 3V4UH 2COQA 2H1PH 3GMNA 1RUPH 3F6IA 2NY1D 3QZWA 3T2PA 2QADD 4NSKA 3PWNB 4GMTH 5E94B 3C5JA 3DBXA 1CXHA 4Q9QH 2XN9D 3W5NA 4RA0C 1UT9A 4YK4B 3LN9A 2AV7B 1OAQL 3QDME 4LCUA 3SCMD 5IWLA 1MCNA 2H6PA 3TC9A 2YPLE 3P4MB 4I18A 1GAFL 2RCSL 4YDJB 3BH8B 1OAQH 2DDQL 1Q9KB 2MCPH 3BI9X 2RCSH 5C08A 1T20A 3TZVC 1K5NA 2GTWB 3MV9A 3R8BB 3EO9H 5D72L 5HYSA 1BZQK 1RK1A 2P24B 3MRMA 3MRKA 5LWYL 1E6JH 3GKWH 5D72H 3SJVB 1D6EB 3ZKMC 3K4DA 5F96L 3BIKB 1UB5A 4YDKL 4A2LA 5AYUL 5I8OH 5IFHH 1A6VH 5LWYH 4JHWH 3IGAB 1BFOA 2OSLB 3VGFA 3KYOB 4BZ1L 4L8CB 1R3JA 3V0VA 4U2YA 2WUBH 5AYUH 3RVWC 2FDBP 4XCCL 2BY0A 5GS0D 1AQKL 2DL2A 3OKNA 2JCCF 1CDJA 4G9FE 4XCCH 4WUUA 1A2YA 1NMAL 4KQ3L 3EFFA 4NOFA 2MJWA 1E4KC 1KACB 3C5ZD 3L7EA 3W0WB 4X8XA 1T1XB 2X40A 1CWVA 2XTJE 4EI5B 4F7TB 3W5MA 4PJDF 5D7IA 5JHDD 1A6WL 1EZVX 2Y7QA 4KKLC 3VXTB 4F57H 1IAMA 2FB4H 4LCWE 1M6OB 4QHLB 2DWEA 3HI6L 1A6WH 3HAEB 2PR4H 4P2QE 4Y4FA 3X12B 1BQHG 4OCXL 1EO8L 2BSSB 3HI6H 4K7PL 4FHBD 4WHYG 5HYJA 4GG6F 2BC4A 2AJXL 1ORSA 2NY5L 4PYHA 1EO8H 4HS8H 1N64L 4KPHL 4MD0A 3G9VA 1SHMA 5D7JD 2AJXH 1WCQA 2NY5H 2Y6SD 1T80A 3DUSB 1DBBH 4HKXB 4KPHH 3O3AB 1DEDA 1H3WM 1S7TA 1ZLSH 4I9WD 1XGPA 3BQUD 3LCYA 2FGWL 2MHAB 2F58L 2BNUA 3CFDA 5I9QB 3C09C 1A7OH 2QSQA 2FGWH 1S5IL 2QQNH 5D2LF 5IQ9A 1A9BB 2G75B 3GMMA 2CH8A 1M7DA 1P7KA 4ZFZA 2DQUL 1S5IH 2VIRB 2BOBB 3MRCA 1EHNA 1CL7I 5L2JA 4GS7C 2DQUH 1ETZA 3EJZC 3T0ED 2ILLA 1FG9C 5CWSB 1UACH 1FVDA 5IJVA 3C6SA 1I3RB 3MQIA 4K9EL 2NY2B 4Z76B 4BSVA 1A3RL 1CXEA 2FHBA 5DZOA 3GSOB 4ZODA 2J8OA 4HUWB 1A3RH 5I1DB 3H42L 5GRVL 1A1MB 2CUIA 1QRKA 1MCOL 2XY1A 1QNZH 1CFVL 4NN5B 4X4ZA 3L5JA 3QQ9D 5JXEA 2X4OB 3L7FA 1I7RB 1YPZE 4OZFG 3B5TA 2OQJA 1B0RA 1OQOA 5E4EC 4BUHA 1PYWB 2IPTL 4WFFE 3WMSA 4RGMC 4XVUD 5ISZB 2WBJC 4IRJC 4RMRA 4YO0B 1FZMB 1CXLA 4N8VA 4WFGE 1MFCH 4U1IA 4YHLH 3X11B 5D70L 1GIGH 5HVWA 3PWUA 3I2CL 3PGDB 4KXZH 4MZ3A 4MS8C 5E8PB 2VYRE 2AABH 4NZTH 1RURL 3OJDA 3CDFA 4Z18A 3I2CH 5IR1B 1K8IA 2HJLA 32C2A 1FL3A 2AK4E 1BZ7B 4Y4KC 4AIXA 1CIDA 3FQWA 4A2MA 3QG6A 3ZDZE 1R3HB 4E0RA 5B38A 4WY7L 1AXSB 4HWBA 1LE9A 5DDHB 5ILTH 5IFJA 4M1GL 4N0YL 2JB5L 5E2UH 3D2UB 1LO4H 2BVQB 3ULUH 2WP3T 4WY7H 4GAYA 4S11A 4LOUD 2W07A 3PP3H 3V0WL 1NMCB 4ZUWA 3QDAA 3VGBA 1DANU 1I9IL 1WIOA 4P46A 3HG1D 4MDJB 5J13B 1IEHA 4P4KD 4KTEL 2GCYB 3V0WH 1NAKL 2VRAA 5JHLL 3QDMB 4NP4H 1KCKA 3QEHB 4GBXD 4IOIA 3MRJB 1HYRC 2YPLB 4GQ9L 2C5DC 4LIQH 3QUMH 1NAKH 2ERJC 4W6XB 1I8LA 4PJGA 4AENA 5GJTL 4TUJB 1DQML 4Y4HA 1ACZA 3RIAF 5TDOA 2P49B 3WNKA 3NGBB 4FQXD 1DQMH 3QEUB 4KUCF 5J8OA 5E03A 3NPZB 2AXHA 3FT3A 3V95A 1RMFL 4LGPB 1INDL 3DXAB 4LLYB 3O81A 5IF0A 3DVNB 5F1NB 3FQRB 2R4RL 2I25N 2FJFB 2R0ZH 1VFUA 3ARDA 3BKCH 3E6HA 4M62H 3MLWL 1XMWA 4U1KA 1KJ2A 4AH2A 2Q7NA 1JNLL 4AL8L 3V7AG 1ES0B 5C0BA 5C6PB 4YNYB 2R4RH 3V0AC 4PG9B 3IXAA 3MLWH 4AL8H 4EVNB 3X13A 3QUYB 1BLNB 3HRZA 4FXGB 4JM4L 4G9FB 2BNRD 2I60H 4XTRD 1A7BA 4LRNH 4PJBE 4LRIC 5EOCJ 5I18H 4JM4H 2ARWA 5BVJA 4MD5A 3RGVB 4O02L 2XTJB 2ICWJ 2FEDD 4AQ1B 4QYOA 1MFEH 1QPPA 3F65A 4O02H 4QHKJ 4LCWB 3CVHA 4YE4H 3FCTB 5HHOA 2PO6A 3V5HB 4N0UE 7FABH 4LAJH 1MEXH 5C09B 4P2QB 4Q74A 3ZE0E 1GGTA 1J7VR 2FIKB 2EIDA 1V7NL 2DQIH 3RKDC 4U1MA 1Q0YL 1V7NH 3QNYB 4KV5F 4Z7NE 1PSKH 1S3KL 4EXPX 4XCYB 5HD8C 4P4RA 5JQ6H 1M7XA 3FHQA 3BAEH 4EN3C 3E2HB 4HKJA 4QRSB 4OFIA 3T1WA 4FXKB 4S2SB 3F12B 1UC6A 1RIVL 2NLJA 4CW1B 4MA1C 4I2XB 2AI0H 4OFPA 2GITB 4PGBA 2D7QA 1JWSB 3CJJA 2GAZA 1NL0L 2DLTA 3B9KA 3VFPA 1T04A 5CP3H 5D2NE 3OKOA 1RY7B 1MCPL 3EYSH 1GPOH 3QUZB 5MEPA 1N59B 4GJTB 5H8DA 1FNGA 1KTLA 3WHE0 2GK0A 1LO5A 3QEQD 1INEL 2CK2A 1CU4L 1NEZB 5KJRL 1I7TA 3ZKMD 5E9DA 1AKJA 3TCLB 1TJIH 3LS4L 1INEH 1GZPB 4G8FB 4IOFD 4MX7B 3ZHDA 5KJRH 2JB6A 4MHHG 2F53E 4HGMA 4NQDE 3S4SA 3QHZH 2DD8L 2E6QA 1K4CA 3VWJA 3HZYA 5DJAA 2NY4B 4PJCF 2DD8H 3L6FB 4DK6A 3DX7B 4PJ7F 15C8L 5IVXA 2V17H 15C8H 4JAMA 2VH5L 1JYWA 1I75A 1F2XK 1G7MA 1SJEB 1TNNA 2B0SL 3IFPA 4KKLD 5T3XH 3QYCA 1KELL 4ZPTB 1I1AB 1AGBB 1FLRH 5F7HA 5CCKH 4F9LC 1XZ0A 4AIZB 5EU6E 3CZFA 5CUSL 3S36L 2GUOB 1A6UL 5JORA 4CDHA 1QYGL 4NJAH 4JFQB 1MCWM 4ZFGH 3P11L 4CRPA 5CUSH 3S36H 3WJJC 4JQIL 1NPUA 3UPAA 4LVOB 5CEYA 4JVPA 3P11H 5TQ2L 5BRZB 4WRLA 5GIRB 2P5WE 1NC4A 4JQIH 2AK4B 5DD6B 3O9WB 4HS3A 1O5DT 1OAZL 4M7LL 1IAOB 5C0JA 4X99A 2ZPKL 2X4TA 5TQ2H 1XGQA 5EUOE 1LGVA 3PQYA 1SY6A 5FDYA 4I3RL 1OAZH 1BBJB 4M7LH 3UBXB 3WKML 5ANMA 1JNNL 1T89A 1RZ7L 4F15B 2ZPKH 2O61B 4Z0BL 4PREB 4QXTA 5FYLH 4I3RH 2FGZA 3O8XC 3WKMH 1F00I 1VACB 1PEWA 2LQRA 3OAYH 1CTNA 5E8OB 3PXHA 1KG0B 1UEMA 3NCFB 5JOPD 3N1GC 3MLYL 5EU4B 3DVGA 3MREB 4IMKC 5LVEA 2APFA 1MRFH 1YUHA 3PABB 4JJ5B 1J1PL 4U1NB 4G8GA 5D1QA 3TO2B 2VWEE 4KRPC 2WWKT 5GSVB 3MJGX 4HC1A 2OBGA 1IAKB 3WDIA 4LEXL 1J1PH 4L8SB 5HVHC 1I85C 3KYMB 3QIBA 1PGRB 4Y2DC 5KS9F 2AJ3B 2VAAA 2QLVB 3R06B 5C70A 3IU4H 5HHME 2CJUL 4AEIH 1T2JA 2XT1B 4J2XA 3FQXB 3OAZK 3JBG7 4PJBB 4BFGA 4JPWL 4DN3L 4FQ1L 4EBQH 1NJ9B 3NCBB 3KGRA 4XGZA 1JHTA 5EBLA 4JFED 1MLCA 2WBJD 1NBYA 3G5XB 4IRJD 4ZPVB 5JIKA 4GAGL 3VWKB 4PJIE 1FLTX 2WANA 3CSYB 4G6AC 3G08B 4J6RH 1I8KB 1FJ1A 1B2WL 3F7YB 4N0UB 4GAGH 1BWWA 1JTPA 4NO3B 1OY3B 3PGCB 5JNYA 1NGYA 3HE6A 4MS8D 2NXZC 5DFVD 2EKJA 4M93B 1VFMA 5C0AA 5T1MA 1CK0L 1K4DB 1VERA 2YC1A 3U9PH 3GBMH 1IGFH 4WTZA 5C0CE 4WFED 3KPQA 1MHHA 4HD9A 1UZ6E 1DLFL 2X05A 3BOVA 3VXUA 5MENE 3BPCB 4OZHE 4OD2B 3EGSB 1B6DA 1KXQE 3HAEH 8FABB 3V5DA 2VLKB 2C4FT 1LE5A 5J3HC 3B5GA 3FOLB 5FDWB 1ZT7B 5CIPA 2J5LC 3TH4T 3O11A 1KLUA 4NQUA 4FTVE 1MRDL 1RK0B 1DDHB 5L2KA 1WT5A 5CBEB 1RHHB 3MCKB 4FQCH 4P59H 1Z9MA 4V1DE 4DOHB 2GY5A 2G9HA 3NFSH 1DBKH 3L5XH 1ND0B 1T6WA 3IFLH 5D2NB 1G0XA 5AAWA 1C7TA 3RWJB 2CGRL 3WEXB 2NY0B 4KHTL 2YSSB 3VXSA 4OTXL 1TNMA 3RWCB 5BXFA 2CGRH 5FYKL 4UILH 4KHTH 1Z5LB 2F5BL 3HE7B 2YKLL 4AT6B 4OTXH 5EU3A 1ZGLP 3QQ3A 5EN2A 3DTXA 3IDNA 4N5EC 4BK4A 5FYKH 1T7ZA 1CGSL 5C0GA 1CZ8L 3TVMB 4NC1E 4HZAA 2GTZA 3ARXA 4Y5VC 2F53B 1A6PA 5B8CB 1RZKL 3KPRD 4JQXC 1CZ8H 4NQDB 2XICA 3FFDB 1KB9J 4KK8D 4YK4C 4LLAA 2DQEL 3R0NA 1NLDH 5BVPL 2VZVA 4U49A 3UJJH 2DQDL 3UTTB 2P8LB 4UT6H 2JCCB 5BVPH 1S7UB 1YMHB 3QFJA 4NQSA 2DQDH 4X9FA 3GGWB 2E6JA 3RA7L 1EJOL 1T3FB 3D1MC 3S37L 3ZE1F 3EYOA 2JJSA 1N6UA 1F6AB 5T3ZD 4NHCL 1R3IH 3CCHB 1N4XL 1EJOH 5GS0L 3S37H 3HUJA 5EU6B 3FTGB 4U0RB 5C0IA 4HIJA 4JFHD 3U2SA 4RDQF 3RKDD 3LOWA 1N4XH 2EYSA 3F8UB 4GXUN 4WU5A 4RA3A 43CAA 1MQKL 1J05B 1OSPL 2PETA 5HD8D 4DEPB 3NN8B 5IHZA 5T1KB 4TSAL 4P2OA 3HR6A 1MQKH 1OSPH 2P5WB 2BSED 2ZG2A 3WFEL 1Q1JH 1W72A 3BZEB 4TSAH 5EUOB 1MFDL 1W2KT 5L88H 5HXMA 4KI5C 4ELMA 1FDLL 4Q9RL 3D85D 3BP6B 3PL6D 3H9HA 2VZ3A 5HPMA 3QXVA 4PR5A 3LD8C 4QLRA 1S7XB 3SGEI 2EDFA 1FDLH 1CGUA 2X70A 2XNAA 3GSRA 3TYFB 5KVMC 3ULUD 2I5YL 4XNUH 4XNYH 1KCVH 2NZ9C 4ODUA 4XZUA 1YMMA 1MREL 2I5YH 3O45B 4CVZB 2GEEA 1HHHA 3FO9A 4ONHA 3V6ZB 4OI8A 5DT1H 3WNPA 4QEGA 1BX2A 4X7TA 3DOSA 1MREH 3ZSSA 3HC4L 5EZJA 1FL5A 1QPXA 4EOWL 3ARBA 1U92B 2OP4H 3TGXA 1NBQA 2AJZA 4KUCD 3DV4B 3MRGA 1AO7B 4HGKC 4PBXA 4U1JA 5BOZG 4EOWH 1A14H 1AD0B 2EE3A 5GZND 2QV2A 2UYLB 4D0BA 4O4YH 2PTTA 1YJDH 4JKLA 1IM9D 5CP7A 4PUBL 3QPXH 3VH8G 4Y19E 2Y25A 1V7MH 4MYWB 2YXMA 4PRHA 1GGBL 3NCJL 4ZSOE 2ZJSL 4PUBH 4LVHC 4QCIA 4OGYH 4C59B 5HHMB 3EJJX 1GGBH 1A4KB 2ZJSH 5MEQA 2Q76B 1R5VA 1B0GB 2NTSP 4YPGB 1QSFA 4DAGL 1OAKL 1J0IA 1J0JA 4WEBH 4L9LA 1LD9B 4DAGH 3OXSB 4KVCH 1OAKH 5HGBA 3V6OC 3NFNB 3UAJC 4PJIB 3OF6D 3JTSA 1N2RB 2VMFA 3LEVL 5F7KC 4HS6B 5TE6L 4MGXA 4MXVE 1EV2E 5IEHB 3LEVH 2R2BB 5TE6H 5HGDA 5FAAA 5JW4M 5C0CB 4NN5C 3RY6A 3HRPA 4K2UL 3AM8A 3RHWK 3OHXB 4XRCA 4R0LC 4X6BB 3L5WA 4OZHB 1IGYB 1IT9H 2HN7B 1A02N 5KN5A 1WBYB 2DMCA 1P1ZA 5E7FA 2ADIB 1J1XH 4FRWA 4KC3B 5FYJU 5A2LH 3WNOA 5JPNA 1S7WB 4Y8DC 3O8XD 1HI6B 2Q8AL 2KH2B 4JO4H 1ADQL 4MJ5B 4FTVB 3ZMRA 4O5LL 4PJ5D 1P7QD 2IEPA 4W4OC 2DI8A 4U6VL 4K7FB 3DLQR 1ADQH 1Q9WA 5I17B 4YIQB 3QEGH 3KPSE 5GGTL 3U36B 3L3KB 5F6HJ 1WIPA 4M43L 1QUNA 1GXEA 1EH9A 4W6WB 2BVPA 1ZT1B 4X6DA 3REVA 2DQCH 3PXJA 1XGYH 5CMAA 3PP3K 1UM6L 2Y23A 1I1YA 1MCDA 1I7UA 2YPVL 2WAHA 4OBRA 1HHJB 4KY1L 1QFUH 1UM6H 1DVFD 2VQTA 4Z8FH 3MR9B 4E42A 3BIAX 1FZKA 5B4MC 4Y2DD 1ZAGA 3MRLA 4PLJC 4KY1H 4LKCB 5ADPH 3KR3L 1XF2A 3DECA 4HG4K 3OBAA 5D9SA 4C57C 2ICWI 1XCQB 1KB5B 3ARRA 2EICA 3P0GB 5E1AA 4YFLF 4QHKI 3PWPE 4YHNB 2XYCA 4KKBC 4QY8A 1CI5A 3W2DH 2E5EA 2XPGB 3MV8A 3WIFB 5K9OB 2O26U 2YA1A 1Z0NA 3GUTA 1FNSL 3VFGH 3QUXB 4FG6D 2R0KL 4X7CC 1HEZB 3MOBL 1FNSH 2X1XR 3O4OB 4G6AD 1E4XH 3LB6D 5FCSH 4MVBC 3MSPA 3MOBH 1G7JB 3AAZB 2H26A 2NXZD 4GO6B 5T3XD 4DZ8A 1HHKB 3PHSA 4J8RB 2V2WA 4HKZA 4AG4H 1KIUA 2Z4QB 4JY4A 2RAMA 4ZUUB 3RUGF 3NBNA 2PYEB 1WUNT 1YQVL 1F3DH 4NBXB 5L7XL 2HT4C 3MRFB 4F7MB 5LKNA 3SPVA 3UPCA 1YQVH 3LRSB 3H9SE 4OGAC 5L7XH 1BF8A 5IB4A 2EDBA 4ZQKB 3UJTH 4K23L 4YDVB 1C5BH 5TDPA 2XTJC 2D03H 2W0FA 1V3KA 1FFPB 4HH9A 3MOQA 2J6EL 2ZNWA 2VNCA 3FOMA 4ZFFA 3W39A 4U1SA 1H15B 2P43B 3T0WA 4K8RH 2P5EE 3OXRA 1H8NA 4L3EA 5FYLD 4LEOA 5L2KE 4QRPA 1E4WH 4GG8B 3IF1B 3I02B 4NQEA 4OKVA 4LSVH 5CBAA 1JGDA 1IC7H 3ARGD 2Y07L 3VI3E 4ODTH 1KULA 3MLRL 4HGWA 5A16A 3B9AA 5EC1B 2Z35B 3D3VD 3QNXA 3E2HC 2WINB 1T7VA 4YHZL 3MLRH 3QO0B 1VFOA 1JPGA 3HCVB 1KN4H 3OJ2C 1Z0MA 1VFAA 1WZLA 4YHZH 4Y19B 1EXUA 4APQB 5IHUH 5IB3B 3PNWB 4KMQA 5ACMA 4M7LT 1U8OA 2VLME 5I2IA 5T33L 5D6DC 4UT9H 4NRXA 2A83B 3ZO0A 5J12C 4OLYH 4ZUTA 5T33H 2IG2L 1AFVH 3GI9H 2FEEI 4M6AA 3O3DB 4OCYH 5IVZB 1R5IB 3HLAB 1S7RA 3ALPA 3GJFB 4JFYB 4TVPL 2AS5M 3TV3H 3SJVD 3OPZL 4MQ7B 3P2TA 2GJ6E 4X7SL 1TETL 4X6EB 5IB1B 2R1XA 4LSQH 2HJFA 4D3CL 1WWAX 2UUDH 4X7SH 2LAGB 1TETH 2CKBB 3KJ4C 4UIMB 2LAAA 2YRPA 5JTWA 1JBJA 1Z9LA 2NY4C 4V2CB 2PW2B 3SKNB 1KEML 4R7DA 2HKFL 2W9DH 2UZYB 5DJZA 3W0WD 1JV5B 1KEMH 4KI5D 2HKFH 4EI5D 1KJ3L 2BVYA 4K55A 3UTZA 3E8UL 1QA9B 4CN4A 1IC5H 2HKHL 4MDIA 1KJ3H 4OIBA 4XX1E 1BOGA 5JUEL 3HC3L 1YEIL 3RWFB 2QSVA 3WIHA 1A9EA 4PRDB 5JUEH 1MHCA 3GSQA 2NZ9D 4OLUL 1CICA 2R2EA 4CMMA 4XP1H 5ESAB 2Q7YB 5JW3L 3KPSB 4DGIL 3HR5B 3VG9B 1CXFA 2NY7L 1I9RH 3JWOL 2MFNA 1IKNA 3DYOA 4G7VL 4JFXA 2VC2H 1CL7L 5D93B 1OSZB 1M05B 2CUMA 3JWOH 4G7VH 1YMME 4KRNA 4PJ9B 4WO4A 3UTOA 1U8PB 2B1AL 4LHUA 4M6ML 3VRLE 4HF5H 1CL7H 5IVOA 3OAYK 3ZKXB 1P69B 4GXVL 2FYYB 3BWAB 2DJSA 3LH2L 3RX5A 4I0CC 4GXVH 3VD7A 4HWZB 2VQ1A 1T21A 1IL1A 1TVDA 2AJVL 5I1LA 3LH2H 1CXKA 1D9KB 4ERSL 5SX4I 2AJVH 3PWPB 2X4UB 5HJ3B 4FS0A 3VXMA 4HIXL 5GS1A 5DJYB 4PRHE 4ERSH 1KPRB 2FH6A 2IH3A 2IBGA 3ABZA 5IHLB 1AGDA 4HIXH 4I0KA 4F7PA 3LRHA 2JK5B 4F3FA 3A67H 5JMOC 4G6ML 3P4OA 1MJJA 3UAJD 2Y5EA 4QRRE 1JZ7A 4UMGA 3DGGA 2N7BA 5HGGS 3X3GL 2R1YB 5AZEH 3SE4A 3QSKB 4LLDA 1KTDB 4Z78B 1K8DB 2LFGA 4Y5XB 1NGQL 4TTDC 2D31B 1CDBA 2Y9RT 1M71B 2VDPL 2YWYA 3UCRA 4YXLL 3V4PH 2ZZUT 1NGQH 4JANB 5E5MB 4OF6A 1H9VA 4CVWA 1ZEAL 5GRWA 2VR5A 2EC9U 4H0HB 1HINL 4FQHA 1E27B 1JHKH 1W0YT 1Y6NR 4NNYB 1U8QA 1X4ZA 4OZIA 1CQYA 5IROC 1ZEAH 2OI9B 4CVUA 2NX5E 1DE4B 2XXMB 3LKRA 3SKMA 5KZCB 1MAJA 4JR9L 2AK1H 1JNJA 1XR9B 3VWKC 2VZSA 4JDVA 5EU5B 1G6RB 4GKZA 1GOGA 3BEWA 5D7IF 1GVIA 3CFKA 1FYTD 4JR9H 5CSZB 1JPSH 3JVGC 4JJHA 2P5EB 3FRPA 4HXBH 5EO0A 4H1LA 1N5AA 3QWRD 3U7AA 4WWKC 2H2SC 4JLRB 3Q5OA 2BNQD 1DBAL 3EYFA 3T2OA 2X4SB 1TQCB 4OIIH 4XPHL 3FN9A 4OV6F 4NQCA 1DBAH 2J3SA 2PCPB 3HZKB 4KJYB 4JFDB 2WUCH 3OWEA 5B4MD 5I19L 4PLJD 4X7FC 3T0VA 1YNLH 5M95B 1P4LA 3EYUL 5CJ8A 1EHAA 5I19H 4XPGL 4HJJL 1FH5H 6FABH 5IMLB 3S34H 3EYUH 3EOYG 3QDMD 1P84J 4PRNB 2DBLL 4HJJH 4UBDD 3N9GL 2YPLD 5F1IA 4DVRL 1F2QA 3BP7A 3FT4B 2DBLH 5DLMH 2BVUA 1QO3A 2Y36L 2L7UA 3D69A 2J1KA 1VB9A 2XN9A 3S8WA 5H94A 5F44A 1UB6B 3HE7C 3N0PB 4MVBD 3QA3B 5K59E 2Q20A 1FSKC 2C1OA 2HFFB 3KXFA 1NFIA 1U9KA 1EJ6A 3I6KB 1AI1H 4UUJA 2E7HA 2XA3A 3SDYL 2XZCL 2GJ6B 1I8IB 3VFNA 1CTOA 3GSNB 5CEZL 4OLXH 3WXWH 1RZ8B 4ODXB 5DJ2B 1XIWB 4IIQB 5JLZA 2DYPD 3STZA 5CEZH 4DVBB 3IDXL 1VKXA 4BSJA 2HT4D 1LP9E 5GGRA 2QTEA 4G9FD 5FKAA 4XI5C 4GKOA 3IDXH 1C12B 4OGAD 4C56B 1EHLH 4K3GA 2NCMA 1Y0LB 1NBZA 2XTJD 4MXQC 5GRZA 4G9DA 2K1MA 1FG2A 3CFBA 1LEIB 3K81A 1IEBA 5FFLA 5LCVH 2X4QB 4LCWD 1UG9A 4EQ2A 1KBGH 5IW1A 5D1ZB 3C5ZA 1V05A 1UADC 5DFTA 1FIEA 3L3IA 2E3VA 4HFUL 2AV1A 5JHDA 4U1GB 2IGFL 3MX0A 5A43C 2E27L 2HLAA 2FX9H 1D5IH 3LN5B 1A22B 2EXYC 1R5WB 1FNEA 5JPMB 4MNHA 3OAUL 4P48A 4P3CH 3NAAL 3M17A 4HUVB 1ZSDA 4RMVA 3NAAH 5DJ0A 5HHPA 3LKOB 5JDJA 3IDIB 1NGZB 5D7JA 3EO1B 3I85A 1XGUA 5ITBL 3DROB 3U46A 1DR9A 4XPTL 5CGMA 5F3BA 3NIDE 5IHBA 1RHFA 2PXYB 5F9JA 2MOVA 2VDQL 1QEWB 4K3JL 1NC2A 5DMKB 1FCCA 3I50H 3BQUA 1CLYH 1QG3A 2QQQA 2VDQH 4QGYA 5FM8A 4KJPD 1ZLWH 1FCGA 1ZHNA 5F88A 3TEUA 3FT2A 4JRXA 3RWHB 3ZZ1A 4E41A 3B9VA 5KW9L 5EBMA 5HHNB 5J57B 2QEJA 4PJGF 2VWEC 4QRRB 3OKDA 2IBZX 3UP1A 5KW9H 4CUCA 5T1LD 5DRXA 3RU8H 4TULL 2FBOJ 3MGTA 1R24B 3AS0A 3T0EA 5I8CA 4DCQA 5E6ZA 3C2AL 3BP5B 4GAFB 2HVKA 2V9QA 2AEPL 4Z77A 2EDXA 1DUYB 1U36A 2NY4D 3KYKL 3QT2A 1YC8A 4YXKL 2AEPH 2CDFA 4U3CA 1EGJL 3EOBA 3SDDB 4PS4L 3KYKH 3JWDC 3IDUA 3CNKA 1BVKA 3CPLB 1ONQB 2DQJL 3TP4A 3J7HA 1OTTC 3UPRB 3IDMB 4DUXA 2NX5B 4WFFD 3G5YB 2DQJH 4PFEA 5F6HI 2AEQL 5K9QI 4UIKL 1AGCB 4NPYB 3ULVE 3DO7B 5KAQG 2KQMA 4TVSa 5J11B 2FJHA 1AGEA 1KCSH 5TE7H 5A2JH 2AEQH 3L3HB 2EC8A 1JNHB 3ARFC 5SWSE 3WHXA 1QHOA 3BE1H 3RBSA 1FRGL 1FO0B 2EE6A 5FM5O 4HPYL 4J3UA 4MZ2A 2XZZA 1TVBA 2BOCB 3MMEB 4RAVA 3RZCA 2H3NB 4NNXB 2SEBA 3IU3A 4K8RD 3S35X 3B6SB 5GGVY 2AQ2A 4I8DA 4ZDHB 1TDQA 2LTQB 3OR7A 1WITA 3O2WL 5DUML 5FHAH 3L3GA 5MERA 1S5HA 3H0TA 2OZ4H 5LG1A 4PY7A 2ZOLA 1QFWI 4N1EA 1FZJA 3ARQA 4KROC 1QLEL 2FIRT 3HZMB 3ZYZA 2HFGH 5F97E 1U8NA 3QO1B 5E4IA 4WWID 1Q94A 4JN2B 4FZ8H 5IKCB 2PYFA 4ZNEE 2EEDA 3O6KH 5T1DL 1EAJA 3AXLB 3CUPB 1PKQB 2ADFH 3HAEG 2EDHA 4P46C 2FECI 2C7UA 3UTQB 3WFDL 3SO3B 5BV7C 2J4WH 3HG1A 5GRJH 2X4RB 3E6FA 3IT8D 1YA5A 4OFVA 5DEGA 3PJSB 4KDWA 5IOPB 4LP5A 2WIMA 4NCC1 1U58A 3QXUA 5EWIH 4QWWD 2X4PA 1I8LC 2CXGA 4J12A 4N5UA 4X6FB 1QKZH 1YEDB 4X9HA 1NFDE 1F3JB 1M1SA 5KVGL 1J1OH 1M7IA 1A1OB 4NC1C 2VXVL 3D25A 1RJYA 4NM8H 4RMQA 3S97C 4FQXA 1SYSB 5E7BA 3O3EA 1LO0L 2XQBL 1K3ZA 1S9VB 1MVFA 1ZHBB 4PRAA 5GISH 3A6BH 4NKOB 4NRZB 1LP9B 1J11A 1LO0H 3ARSA 2XQBH 4WW1B 1MY5A 3GJFH 4XMKL 1EO5A 4NBZB 1DLHB 1RZJH 1BQHB 4L3CA 4LMQI 2J8UA 4H26A 3U4EA 5ID1A 4G80A 1EX0A 4XMKH 1H3TA 4RFOH 4XCEA 5D4QA 3UTSE 3VWKD 2ITCB 4PLOB 3RWEA 5IVXF 4X9IA 5CAYB 4JO2L 2V7NA 5D7SL 2V6HA 3QDJA 5CD3B 3MV11 1OVZA 2W9LA 2Z92A 3MZTA 2CKBH 3K0WA 4P2YA 1C16B 4ETYA 2P45B 4MJIA 2CRIA 2ZCHL 5DI8A 5L6YL 5DUBA 3P9MA 4OCNC 2R1WB 1CGTA 1J86A 5HHXL 3VFSB 5L6YH 2PO6C 2H9GB 1ZA3A 2VABB 1GC1C 4ORGA 2XWJB 4Y16A 4Y7MA 1OP3H 4R7NB 5HHXH 4A6YL 3X3FL 5GSRA 3EHBC 3GSXA 5KSBE 4BQ8A 3TFKC 5I1AB 4KRMB 1D5MA 1NBVL 4ZD3L 4KMLB 4I4WB 1NCCL 2EIZA 5C0EB 1Q9OA 4P2CG 1ZT4B 5CHNB 3IJSA 5EG6C 3BT2L 2IANE 3LKNA 1PFCA 3NOIA 4OFYD 4ZD3H 2D0HA 3QH3B 1NCCH 1NCAH 5JIHA 2I24N 4XNQA 5GGVL 1R3KB 3GMLB 3VH8A 1CN4A 5JO5A 3LQAC 3CLEH 5GGVH 4RWYL 4M1CC 3RWIA 5JR1L 3IS1X 3L95B 2BRRH 3PGFL 3RI5F 2ADGB 3D39E 4RWYH 2BDNL 1IAIM 3B9KC 1Q38A 4QOKE 3S3SA 3PGFH 4HK0A 3HE7D 3WO4B 2BDNH 4FQ2L 5H2BB 4DN4L 4H20H 4O51B 3SDCB 2WMPA 3MROA 1BD2E 3T2QA 3THML 1FHGA 4KZDL 2F53D 4DN4H 4S0TD 4QT5B 5IBTH 3OGOE 3S88L 4OZFB 2PTVA 3SDAB 1JPTL 3QEQA 5K9JL 4JZJA 1T5XB 3P0VH 4NN6B 5MHSE 4APQC 5ALCL 3S88H 3VD3A 2WBKA 3L3DB 1RZIB 5K9JH 5DK0B 3GNMH 3TA3B 4JDTH 5CZVL 4XI5D 5TGBA 3SDXA 4Q9BA 3QNZB 1H5BB 4MXQD 3P73B 5GGSA 4M7ZC 4BH7A 5HDBF 3VWJC 4NCDA 3M1BB 3BKML 5I76B 2XWTA 2UUDK 3MOAH 4GLRH 1E4KA 1NAMA 1HILA 1B9ZA 3H7LA 3BKMH 1KPVB 4NZRL 3DRQB 3SQBA 5EU6D 1UENA 5BOPA 1NANH 3IXTB 4F8QA 5FO9B 4Z7OE 2G5BA 5EBWA 2Q8BL 1PKOA 4OF3A 5JOFB 4L8BB 1J0KA 3TBTA 4QXWA 5E8NB 1N7ML 4JDZB 4WTXA 2EXYD 5C07A 1SEQL 1XF4B 3WS3B 2ZSWB 4NZUH 1N7MH 1ZVSB 4RGNE 4QHNB 4DGYL 1L9MA 1PLGH 4RAUA 4QNPF 1G6RH 1PEZA 4ELKA 3BIBX 2OTWB 2B7DT 3N85H 4UTAH 5IK3A 3GMPA 5SWQA 5CZXC 4NN7B 1XR8A 1C08B 1A4JA 1HHIB 2YA2A 1J88A 3EOAB 4Z95H 3KS0J 5DEZA 4S1QH 4Q7DA 3D6GA 1CF8L 4MA3A 1T89C 3MRBA 1BECA 4W4NA 2Z0BA 4LLWB 2XG5A 2VDML 3QZWB 1VA9A 4LSRH 4YUEH 4GAJL 3U4BL 1AQDB 2IQ9H 3GDBA 4XH2B 3BMVA 4MB5A 5I1CH 1F90L 2YBRA 4HMCA 4M6OH 1TPXC 1NDGA 2EDDA 1T03L 1CD0A 4JB9L 1NFDB 1KIPB 1BM3H 2DI9A 5F7YC 3MGAA 3QWOB 5D1QC 3O2VH 5TF0A 4YJZL 4JB9H 1Y18A 4H8WH 1FPTL 3PIQB 2HJKB 3L3JA 4OAWB 3VJ6A 3QIBC 1D9KC 3T04D 1J0YA 5HHMD 4UNTA 3UO1L 2A0LD 4S1RL 4X6CB 1JMZA 2ED8A 4P23B 1UB5B 4JGUA 1LEKB 1OTTD 1MLBA 2IMMA 3MLTA 3OJMB 5TF1H 3UO1H 3ES6A 4S1RH 4N8PA 3M45A 4M48L 5IT2L 3V0VB 3BZFB 2YEZA 1UXWB 2C1PB 4HSQA 4R4BA 2HH0H 1KLGA 5IT2H 2DQTL 1I9JL 4PJAA 4CAGA 3ARFD 4WUUB 1NEZG 1A2YB 3OKEA 3ARZA 4PJEA 4R2GB 1I9JH 3WN5B 3I3EA 2BMKB 3L7EB 4JFFE 4QO1A 2WBJA 4KUZH 2K3TA 1T22B 3GI8H 1RVFH 4L4VB 3HUJF 2UVFA 3T0BA 5C0CD 2B4CH 3IDGB 4BQ6A 4DW2H 5DS8B 3HE6C 2V5YA 1JP5A 5MEND 1FFRA 5KSBB 1RIHH 2J88L 2IPKB 4Y4FB 4L29A 2Z31A 4OB5L 4AMKL 1TJGL 5HYJB 2EDNA 4Q6IA 5EIIB 1VESA 1S9WA 2J88H 4FQJH 1U8JA 2IANB 2V7HB 4F58H 2EH7H 4OB5H 4AMKH 4FTVD 4RISL 3MUZ1 4YDIL 3I6LE 3AGVA 3U82B 4ELMF 3VGEA 4QRTA 5FUCE 1G9NC 4V1DD 3KLHD 1GGUA 2CO6B 5FGCB 1U8LA 1S7TB 1JZ2A 2N7AA 4P46D 2LVCA 4K3HA 4RNRA 1JRHL 5E2TH 4PJ8B 1UZ8B 1KCUL 3D39B 1WT5C 3CFDB 4RAHA 3ELAT 4RIRB 3HMXL 4QOKB 3PWVB 1JRHH 4LLQA 3BGFB 4ZXBC 3K74B 1IGCH 3G6JF 1ACYL 5HGAA 5J6GA 3DWTA 1BD2B 5E8EB 4I5BB 3BJ91 2EH8L 4HUXA 3QJHB 5JMRA 2XA8L 2MQ3A 4Z7VA 4O2EA 3TN0B 4OF5A 2DBJA 4W81A 3GM8A 4TOYL 3UBXG 1KIRA 2AXFA 2EH8H 4ODWA 4OM1H 1VGKB 4XWOC 2YPKB 3VFVA 1FVDB 3C6SB 3C5SA 1MVUA 1PD6A 5E99H 2ZUYA 5CINH 3TBSB 5DRWA 3VFOA 4GXUM 3HI1B 3IRZA 4GRWE 2UWEE 1W0VA 2H32B 3QI9C 4DQOL 3RNQB 5J1AB 4O2CB 5KBNC 5I1GL 1T5WA 3N06B 2GFBA 2DJ4A 3F7PC 5F6IB 3U4AA 3JV6A 5I1GH 3C8KA 5AUMA 4JRYE 4LLVA 2VLJE 3QDJE 2F8XC 1U3HB 5IG7A 3K4ZA 5HHOD 2JJSC 3BD5A 3T1FA 3NACH 3PDOB 2DIJA 4C58B 3MLUL 4MJIE 3RVXC 2GT9A 3QR2A 3KLSA 4LK4A 2YZ8A 4XC1H 5AYQA 1CGXA 3TFKD 3MLUH 1AE6H 4U1IB 4HCRH 4FFZL 5D1XA 2B39A 4HUMB 5ALBL 1YEFL 3VXPB 3MODH 5BZWA 1FO0H 2FJGB 1JGEB 3QHTC 1WF5A 32C2B 4YHYC 1FL3B 2EXWC 3TO4B 5MI0B 1EHXA 1CR9L 4M1CD 1Y6KR 5B38B 3RNKB 3D85A 2XRAL 3PL6A 3LQZB 4I48B 5FGBA 1A5FL 4YGAB 3S36X 2ZOKA 3LEXB 2XRAH 2ADJB 4ZUWB 3T8XB 3FONB 5DSCB 1YNKL 2FR4A 1A5FH 2CR3A 2FEEL 1EBAA 5IMKA 1LK2A 1T1ZB 3NPSC 4TNWF 4X6DF 4IOIB 4UDUB 3W9EB 3P77B 3QIWA 3Q2CA 4PJFA 3SE9H 4XNMA 4DKEH 4I3SH 3ILPB 4XP9H 1LEGA 4Y19D 2L0DA 4H88L 3QUMA 4N0RA 4APQD 1ZLWK 1CVSC 1LO3L 5BJTB 1I3GH 2IADA 4XBEL 4FQIH 3FMGL 2PXYC 5KTEL 1QBLH 1LO3H 5ERWA 5INCB 3VG0L 4Y5YA 2HWZL 4NYLA 5GQBA 1IM9A 4QRQA 2FZ3A 1R3LA 3RWDA 3VWJD 4HXAH 1D6VL 4UINL 4KMTL 1MF2L 2FL5A 4N68A 4PV9B 3ZDYF 4D8PA 4PB9H 4ZAKA 1A6ZA 2WLYA 1SYVA 4U1KB 2C9AA 4KMTH 1MF2H 4F9PA 4FABL 5C92A 4XP4L 4IMLB 1C5CL 1QSEE 5F7DA 1UEYA 4X5WB 3QFDB 1OD7A 3GB7A 2VLRA 3PDGA 4MSWA 3WFZA 5FM4A 4JO3H 5D5MA 3O3BA 2BFVL 1UYWL 2A2QT 1N0XL 4JFFB 4MD5B 4JGJA 5E24E 1U93B 2NR6C 4GMSL 3OF6A 1UYWH 1N0XH 5CFHA 2CR6A 1U91A 4GMSH 3T77B 4HX1B 4OCRH 3V8CA 1YEJL 1KF9B 4R97B 1BAFL 1J18A 5C07E 4UNVA 1ZXQA 1YEJH 2J12B 1ZS8A 3F5WA 2YN3A 1BAFH 3D5OF 4TUKH 5DQJA 5DHYB 3QXDA 4HBQA 4IRSB 3AM8C 3RJQB 5ESQA 4WNQA 1G1CA 4J23A 5J11C 3PQYD 5EIVA 4K3EL 4XMPH 2AJUL 3MRRA 3RFZC 1H3GA 3F6LA 3BHBA 2Z9TA 4R96B 1RULH 2WV3A 1A6TA 2EDWA 3MBEA 3MLXL 3KPSD 4MJ4A 2P8MA 2ICEA 2YA0A 3BDYL 5LAXA 4GW4A 4LARH 3ORJA 4PJ5A 1W8OA 3LRGA 1P7QA 1FFNA 4D2NA 4LPWA 2F9BT 4KDVA 1U95A 1XF1A 1FNLA 5ICYA 2IAMC 3AB0C 1T04B 4UOJA 2MSPA 4NO2B 4P5MA 4NUJA 5MEPB 4PJXA 5D1QD 2HG5A 2R4SL 5CP3A 3MA7B 4UZGA 3VMOA 1HQRA 2KL6A 2NY6B 2R4SH 1D9KD 2IJ0C 4PJHE 1DVFA 3OKKB 1ZVHA 3PWPD 4MJ6A 4MWFA 3G5ZB 1QOKA 4WUKL 5I16A 1MHEA 4KHXL 3QIUB 3ULSA 3DSFL 4IS6B 3VXNB 3SO3C 1DANT 3QWQB 4W6YB 3O4LE 4Z7WE 4GRWB 4BKLA 2BY2A 4KHXH 2UWEB 4J3WA 4LPCA 2FBJL 3U1SL 3TBWB 1WAAE 2ENYA 2Z91A 4G8IA 2FBJH 1Z9OA 4EDXA 1U8HB 3GJFK 1NUGA 5D71H 4JRYB 2VLJB 2M8XA 4YHOL 3BPLC 1GRWA 2AJYH 3NFPB 1QLFA 3INUH 1G7MB 4XVSL 1L0QA 3MLPA 1RV6X 2UZIH 2JF1A 2D0FA 3HE6D 5EFIB 1GGIL 5BW7A 4XVSH 1DN0A 4BFEA 3H9SD 1IAII 2RR3A 2ORBL 5JORB 1K6QL 4TTGA 1JI1A 5FYJL 5KZCD 2WSKA 1X7QB 1I4FA 3O6LL 5D7KE 3J8F7 2ORBH 5IM7B 3DX6B 4LGRB 5F89B 1MRCH 1BEYL 2G60L 5FUOH 1OP3K 3O6LH 2CMRH 3P30L 1ZV5A 3WFCL 3LDBB 4XVTL 5BS0A 4X4XA 3S37X 2P5ED 1T6VN 1S7VB 3NH7H 4X99B 1BEYH 3F58L 3FZUC 1D5XB 3VRIA 1XGQB 3P30H 3WFCH 4YHIA 1HE7A 3FFCB 1N0LA 5L2KD 1IC4H 3F58H 5IIEB 4U2ZA 1J5OH 3DX8A 1HXYB 4ZXBD 1SBBA 2ZCLL 3L3OB 3LN4B 3G5VB 3GRWH 1WLHA 5DJDA 4XNXL 3MFGB 1Z2KA 4FP8L 3CDYA 2ZCLH 4AZ8A 2FH8A 4F2MB 3T3PF 3VFMB 4ZYKA 3ARGA 1X5GA 3EDDA 3B5HA 4XWOD 4LDEB 3D3VA 3O0RL 1TTGA 4WHDA 3ZE2F 2VLMD 4ODSL 5IB2B 3BGMB 1RJLA 3O41A 1WBXB 3O0RH 4PG2C 3PWNA 4ODSH 2DQFB 2H41A 4LU5L 3QI9D 1IGJA 3NABH 2AV7A 1G7HB 3PUCA 4LU5H 2OJZL 5C8JB 3B9DA 4TYUA 3P4MA 4YDJA 3SKOB 2NTFB 4PP1D 3SOBL 1AD9B 3BH8A 2EYTB 2RQ8A 1QSEB 1Q9KA 2GJ6D 1QBMH 2GTWA 4JZOB 2OM5A 4ZO8A 1MWAB 4YBLB 1X4XA 1WJ3A 2P24A 1XIWD 4CKVX 4HV8B 4DFHA 1RAMA 4HIIB 5EBLB 3SJVA 3RVXD 1HDMB 3TH2T 4QF1B 2JE8A 1NGWB 3BIKA 1NBYB 3QG7L 3IGAA 3TA3C 3PP4H 2OSLA 1AXIB 3KYOA 3BKYH 5T5FL 5IFAL 5F93C 2OL3A 1D5BA 1H5BC 1YECH 1J9CT 5TDNA 3JTTB 5IFAH 5C0AB 1TTUA 4HULB 35C8L 4OZIF 3ULVC 1CFNB 1JJUA 3KDMB 1EMTH 3SE3C 3W0WA 3CSBA 4WW2C 2EXWD 1T1XA 5DRZA 4UT7L 35C8H 4O58L 3VXUB 4EI5A 3VI4F 3D18A 1GHFL 2Y4SA 4UT7H 4O58H 1DQQB 3FO2B 4OQTH 3X14B 1M6OA 3QCTL 4QHLA 3MRPB 4XCFL 3HAEA 5FECB 4ZS7H 4MQTB 3O11B 3WIIL 1P4IH 3QCTH 3X12A 2BSSA 4XCFH 4LCYB 1YMMD 1CICC 1X3DA 2VDLL 1MJ8L 1O7SA 1IKNC 2RFXB 4MLSA 1E6OH 1LK3L 2HTLC 2H8PB 2A9NL 3G9AB 3L1OL 3DUSA 2AAVA 4HKXA 3O3AA 4WO4C 5AZ2H 3VXRE 2NXYC 5BXFB 2PXYD 3EYVB 3ZT6A 1AC0A 3L1OH 1JWMB 4PJHB 5BO1L 2AXJA 4LVNC 3S5LB 5EN2B 3DTXB 4KK9D 3SEPA 3VFUB 1VSCA 4PRHD 3MGOB 3UJIL 1NCDL 1EEUA 1YQ2A 4MAUL 1OTUD 4Z7WB 2JLLA 1NCDH 2CLRB 2G75A 3UJIH 4KZEL 2AGJH 4ESKA 2OCFD 5GS1C 2VIRA 1IFHL 3CDCA 2BOBA 3CK0H 2OTPA 2HVJB 2VZTA 1WEJL 1IFHH 5F7EL 1KTKE 3N1FC 4MLIA 5CWSA 3V6OA 2NR6D 5I6XC 3KLDA 5DMJB 4IJ3C 5FIEA 3QFJB 4NQSB 4JRWA 3SE4C 2VLRE 1CBVL 4Z76A 1M4KA 2H32H 2O5ZL 4LSTH 4UTBH 4YWGH 3VFWA 1YDPA 4NGHL 1F4AA 5I1DA 5ENWB 3ZT5A 3MNZB 3UDWC 1A1MA 4C4KT 2NX5D 3OJVC 3U2SB 5FOBB 1S9KC 2OXHA 4JM2B 2ARJB 2X4OA 5EOQH 1YN7B 1QFWL 2CDEA 2F54E 5IHZB 1YYLL 4CVXB 5DEFA 1PYWA 1QFWH 3RX8A 4JQVA 2F74B 4YO0A 3ISWA 4M5ZH 3GSUA 3CMOL 4PR5B 3X11A 1QVOB 1T7XA 3T3ME 2FECL 4WU7A 2ATKB 1MCBA 2D3VA 3I9GL 3EOTL 4X4MA 3PGDA 3CMOH 3KYNB 3MBXL 2IAMD 4NKQB 2XNAB 5E8PA 4YHML 1AHWB 3QWRA 5FGRA 2EIEA 4HWBL 3EOTH 2WWMD 5IR1A 3MBXH 4UAOC 1BZ7A 4L8DA 3G6JB 4PTTB 1WSST 1R3HA 3G04B 5KSVB 3FB5A 1AXSA 3OSKA 3PHOB 4P0DA 5DDHA 5BV7L 5EDXA 3CXHK 2BVQA 3MRGB 1JF1B 1FZOB 4XHQA 5DZLA 3RZWA 4TRPL 4MDJA 2GSGB 3GIZL 2GCYA 3S3JA 2AJSL 3QDMA 3TYGH 3QEHA 3MRJA 2YPLA 3MV8D 3GIZH 3BO8B 3FAWA 2QADC 1FORL 2VJXA 2N56A 4TUJA 5MEQB 4MHHI 1S7SB 3NTCH 3QEUA 3EFDH 4HMEA 1CT8B 1KJ2L 3RAJL 4JREC 4GH7B 3DXAA 5HGBB 3D9AL 4LLYA 5TE4H 4PGDB 3F7VB 3DVNA 5F1NA 3GHEH 1KENH 1KT2B 5I75B 3BD3A 3QDGE 3FQRA 2FJFA 3CAFA 5C6TL 1ES0A 1AR2A 2ZUWA 3ZTNL 4YNYA 3WXVL 1CFQA 4PG9A 2IQAB 4EVNA 5C6TH 3QUYA 1BLNA 3DMMB 4FXGA 3ZTNH 4G9FA 3WXVH 2I07B 1DQJB 2EE2A 2OR8A 3GMOB 4P49A 1UM5H 3CVHL 1SJHB 5EZIL 3RGVA 3UYRH 4Z7UE 1GC1L 3FZUD 3L5WB 1OAUL 3E3QC 5KN5B 5EZIH 3VMNA 1NCBL 1U3HC 3BZ4B 3CFCL 4LCWA 5DC9B 1X5AA 4RSVA 3FCTA 3C5ZC 5BS0E 4POUB 5JPNB 2OTUB 4M7KH 4XP5L 5C09A 1NCBH 3ZYJA 4B0MM 4P2QA 25C8L 2FIKA 2DICA 3TPUB 5FKPB 4RGNC 3KVQA 5CJBA 4XP5H 1YN6B 3QNYA 3FAXA 1LWRA 3Q3GB 1S7QB 4XCYA 3UZVB 1BZ9B 3IRPX 5MP6L 2BVPB 3V5KA 4QRSA 3VXRB 3ESUF 2CD0A 4FXKA 1RU9L 4NQTA 5CLTA 3F12A 1I1YB 3TIEB 1JE6A 1RU9H 4CW1A 2Y6SC 3B3IB 4MCYB 1B4JH 5HHVL 2GITA 3RPIB 3HNTL 1JWSA 3C60B 4RFEB 1A7NL 1ZWIB 1TCRB 2IFGA 1K9TA 4AK1A 1OM3H 5HHVH 2ZUXA 1A7NH 3QUZA 2DLFH 1NUNB 5E1AB 1NSNH 3RJDA 1ZLVK 4QY8B 1PG7X 1IGMH 4JY5L 1VEOA 3BN9C 4LASL 3FB6B 1WC7B 3V79C 3RY4A 1A7QL 4KGJA 5HDQH 2DM3A 4JY5H 1NEZA 4BUGA 4ZG1A 4OI9A 2IMNA 4XPAH 3TCLA 3B2VL 3TJHD 1GZPA 3H9ZA 4G8FA 4MX7A 4GRWH 3TA3D 1WBZB 4CDGC 4PRIE 3T0EC 3B2VH 3GBLA 3T65B 5SWZE 4ONGH 4LHQB 1Q72H 1V8HA 2R56L 5L8LB 1RZFH 3TESA 2V5SA 5EO1B 3MV7E 4P5TB 3L6FA 2D7MA 3DX7A 3MNVB 3ULVD 2ZUUA 2R56H 3BEVB 2J8UF 3MFFB 1YPZA 2F54B 1JUFA 4R90L 1DZBA 5SWSD 5K9KB 5D6CB 2B2XH 2ITDB 1SJEA 2C4FU 2I27N 2YD6A 5F8RC 4R90H 4XWGH 4ZPTA 4K94H 1I1AA 1AGBA 4MJ2A 3HNVL 5EC2B 4AIZA 1S9XB 4HH9B 3OKLB 1UA6H 2GUOA 1CICD 3E1F1 4HG4J 1JK8B 1CGVA 3OGCB 2X1QA 1RQ5A 4JFQA 2D7TL 3MYJA 2GJZA 1YEHH 3OXRB 3RZCC 3WDHA 1SY6L 3NCYS 1U2HA 3G6DL 2HTLD 4HJGB 4F33B 3GJEA 5I1HH 4MAYB 5GIRA 5DD6A 2AK4A 2NXYD 1IAOA 4TSBL 4GRMB 1MCCA 4YAQB 2RB8A 1UH4A 2W65A 5A16B 3BPOB 2O61A 5E2JA 1X4YA 4PREA 3BISA 3MJ8B 1E28B 1BP3B 4OV5B 1CLCA 3QAZC 4DKAA 5E8OA 2DL9A 1EXUB 4ZUVA 1KG0A 4G42B 5EU4A 2C3GA 4LOUC 4HC1L 4J3SA 3MREA 5FYKE 5GGUA 1U2CA 3VW3L 1UXSB 4XAKE 3U83A 1VADB 2DF3A 2X44D 4U1NA 1H3VA 2ENSA 3TO2A 5GSVA 3VW3H 2NY6C 1IAKA 5IESL 4P9HH 4G7YL 4L8SA 3KYMA 1S7RB 4KKCC 3WFBL 4M5YH 4UV4L 5IESH 4P23D 2GW5A 2AJ3A 4PGCB 1G9EA 2BJML 2Q87A 2R1XB 5ETUB 3SDXF 3R06A 2APXA 4LF3B 1MWAH 3UTSD 4GKSB 2X9XA 2BJMH 3FQXA 2JTDA 4PJBA 4UU9B 2ZSVB 5IROA 3BUTA 1VPOL 4QHMB 1NJ9A 4R2GD 4Z7UB 5B39B 5FK9B 4MMXC 2IH1B 1VPOH 3G5XA 4ZPVA 2FX7H 3VWKA 4U6HB 3CSYA 5F7LB 3G08A 1PW3A 1A0QH 1ZA6B 4K7PY 1XGTB 1FGNL 3F7YA 1MUJB 3P0YL 4YQXL 3JVGA 4N0UA 4KTYA 3PGCA 3LKSA 2X09A 2JELL 5ISZE 1ZVYA 4YQXH 5AEAA 1N5YL 4PGZA 3GSQB 1RJZA 4QTHB 1RUML 5EZLB 5FOJA 2EDKA 1GOHA 4Y16C 1MSPA 1DCLA 1CE6A 5F7UA 4CMMB 5SX5H 2IAND 4L9DA 2HFEB 1G9NL 4Q2ZB 1IBGL 3BYYA 1DL7L 4N0FB 4OD2A 3EGSA 5J89A 1KUMA 5CIPH 2A9ML 5B3JF 8FABA 1DL7H 3LDBC 2VLKA 2XY2A 4KKAC 2YK1L 1CDHA 5I1KL 3FOLA 5FDWA 3RTQB 5I1JH 4OFYA 1IQDB 4PJ8D 2YK1H 5CKGA 1RK0A 1DDHA 1DQLL 1HH9B 1O7VA 4QOKD 5CBEA 1RHHA 1WCBB 3MCKA 4M61B 1QBAA 5CGYC 5D2NA 1ND0A 1DQLH 1WGOA 5BCAA 5BZDB 3CZJA 4X5XB 3RWJA 3WEXA 2P4AB 1CDGA 3VXMB 2YSSA 1UWEL 2R0WL 2VOTA 4J7RA 3FQUB 3U7YL 1L9NA 1Z5LA 1UWEH 3HE7A 2R0WH 4MD4A 1IM3B 1FQ9C 3FQTB 4AT6A 1JTTA 5EA0L 5MHSD 4F3FB 3KXFD 1GAFH 2C3VB 2FWOB 2F53A 3MTRA 5EA0H 2DDQH 4PRIB 4F8TA 1II4E 3IB4A 5E56A 4JZJC 4NQDA 5SWZB 2Q3AA 1OTSC 4PBVC 5KSAB 1WFUA 3DXAE 3FFDA 1R6VA 1QQDB 3U7WL 2E9WA 4IOFC 3LV3B 3MV7B 3NIFF 4YZFF 1JYXA 3MJ9A 1ODAA 3OV6A 4D0DA 5F96H 2XIDA 3AREB 4YDKH 1CYGA 1MIEL 1F4WL 3FRUB 3U9UB 5JOEA 1G7QB 3UTTA 2P8LA 4MB4A 3RPKA 4BZ1H 3RRQA 1S7UA 1F11B 2X4NA 1MIEH 1YMHA 4OZIB 2NMSA 3GGWA 1U3HD 4PJAF 1AQKH 5KOVC 5E1HB 1T3FA 5IVNA 1F6AA 4ODVL 1WWBX 4PJEF 3FN0L 5GRUL 4HZLB 5B22A 3SKMB 3CCHA 1NMAH 4KQ3H 4AY0A 5EU6A 4JDVB 2FHFA 3Q1SL 3FTGA 4GW5B 4RGND 2CXKA 3FN0H 5GRUH 1EUTA 3T0XA 5L0QC 5HHQB 3DUUB 3SGJA 3U0WL 4U6TA 3VFTB 1J05A 1W72L 3ZLQC 4NO5A 3WBDA 1OW0C 5C09E 3NN8A 4CBPA 5HVFB 5M7QA 3U0WH 2VXQL 2P5WA 4PGJA 4IM8A 4IHOB 2M26A 4OCXH 3BZEA 4K7PH 1OT1A 2VXQH 4NQCB 5EUOA 2RBLA 5DA4A 3O2DA 4OFKA 4X7DC 1MCWW 3BP6A 1N64H 1S7XA 2YXFA 4MA8L 4NFDA 1UWXH 1MH5B 1OGAE 1NC2D 3TYFA 5E6IB 3UROR 1X6NA 4RMSA 1X5IA 3RDTB 4I2XE 5F3HB 3CFJB 4CVZA 3O45A 1U8IB 2F58H 3BN9D 4L1HA 4HIHA 2IALB 4JRXD 4E41D 5IEKB 3V6ZA 2NY1B 4KI1A 3BMWA 1VGEL 3D69B 1HSBB 5EU7E 3DV4A 3SCMB 3WS6A 1AD0A 2W0PA 4NDMB 4Z7VF 2UYLA 2E8ZA 3VRJB 4OUUB 1G7LB 2LU3A 1G7PA 2C1OB 4OZGB 3IJYB 5EPMB 5F9OL 2WM0A 2Y5TB 5DVLA 3BP4B 4XNZC 5IMMA 3WJLC 3VDBA 5F8QC 1Q9LB 5JLZB 1A4KA 4K9EH 3MLVL 3IJHB 4XC3L 3HI5L 2Q76A 1B0GA 4WI9A 4YPGA 2A74B 4K71B 1VDGA 1AGFB 4R3SB 1OL0A 4XC3H 3HI5H 4NJ9L 3UZQA 2VZUA 4JFFD 1X5JA 3H42H 3ZL4L 2KKQA 2AQ3A 1NBZB 3NFNA 3FO1B 4X80L 1EBPA 1MCOH 4PJIA 3I84A 1CFVH 5AG9A 1N2RA 3CFBB 1AIFB 3ARFA 3L9RB 4X80H 1PQZB 4WI3A 1ZOXA 4HS6A 4U3HA 5J06A 3NCMA 1CDCA 3BN3B 4PRBB 1QLRB 1OPGL 5JW4Q 1PJ9A 3TJEL 3RZCD 2IPTH 3RQ3A 5IEHA 1KXVC 1MFBL 2R2BA 4CL7A 1SMOA 1MJ7L 5C0CA 3TJEH 4Q0XL 3RHWF 1P53A 1HH6B 3OHXA 1P2CB 4JM2C 5DFVC 5MENA 1BFSA 5JW4R 4OZHA 1N6QL 1FNEB 5D70H 1NFKA 1IGYA 2HN7A 2Z31C 4Q6IC 3M17B 5BRZE 2ADIA 1RURH 4L3AA 1BFVL 1S7WA 1HI6A 3P9WB 5CD5C 4MJ5A 5D96B 4FTVA 4PLKD 3QXAB 5HGHB 1XGUB 5CJQL 1FVEB 3TH3T 4M6NL 1UWGL 3C9NB 4K7FA 4V1DA 2NY5C 5FXCH 4XVJL 3EO0B 4M1GH 2YD4A 2JB5H 4N0YH 2APBA 5F9JB 5I17A 1UVQB 3U36A 4HQQL 4M6NH 2NY3B 3BQUB 1OP5H 3ULUF 3SKJL 3WD5L 1F8TL 1I9IH 3LY6A 1TQBC 2NY6D 1ZHNB 4WJ5B 4KTEH 4QGTA 4CMHB 3FT2B 3WD5H 3EZ8A 3KPPB 5JHLH 1HHJA 4PJFF 4KKCD 2FO1A 3RP1A 4GQ9H 3MR9A 1ORQB 3GIVB 4XB7A 4LKCA 5GJTH 5DRXB 2V2XB 1C7SA 4LPYA 1CFSA 2UY7A 4IDJL 4Z5RB 2JJUA 1LNUA 1XCQA 1KB5A 4YH6A 5I8CB 5FHBL 3WCYA 2O93L 1LDSA 1IQWL 2EDTA 1WZMA 4JO1L 3U0TB 4YHNA 3IAPA 3NIGF 1RMFH 2O5YL 2XPGA 3QZWG 4XAWL 1INDH 1IQWH 1JGLL 2AKRB 4JO1H 3WIFA 5K9OA 1BF2A 2O5YH 4S1SL 4TVPE 3QUXA 1JGLH 4KK8C 1JNLH 1HEZA 1NLBL 4JRYD 4S1SH 3RWGB 2VLJD 3QDJD 2PTUA 2N1KA 4KAQL 4R8WL 3STLB 1A6AA 4MJID 5D5MF 3AAZA 4KAQH 1HHKA 3RGHA 4KFZC 2Z4QA 1CG9A 2OMNA 3WHXB 3ZDXF 4Y16D 4MNQE 4U7MA 4ZUUA 2M2DA 5IW6A 5DR5L 1NDMB 2MMXA 3LEYL 4OD3L 3DRTB 1TVBB 3DMMC 3MRFA 4BZ2L 4F7MA 5FA3A 4H5SB 1E0OB 3LRSA 1A1NB 4KKAD 4ZQKA 3ILQD 5F9WC 5D1XC 4YDVA 3R8QA 1EK3A 1RI8A 4M3JA 3VU2A 4HLZH 3CLFL 4JG1L 1Q0YH 2I26N 1S3KH 1KJVB 8CGTA 4Z0XA 3CLFH 3DARA 1OT2A 1DEEB 2IF7A 2VAJA 2VLKE 1OGAB 2OZ4A 1H15A 5CGYD 1I1FA 1EAPB 1PG7W 5I74B 1WZ1L 1Q94B 3PL6C 3A6OA 1INQA 5FGBC 3A6CL 3EDKA 5LQBL 4YPJA 1RIVH 1TZGL 1ZHKB 1WZ1H 4GG8A 3IF1A 4KXZI 1U6AL 3DURB 4U6YB 5DTFB 4DOHE 3ULUC 1NL0H 4LLUB 5E2VL 1GL4B 4P4KB 5EC1A 2Z35A 5DEGB 3H8NA 2WINA 4PJXF 1MCPH 4GBXB 3QIWC 3QO0A 5ACLA 3TT3L 3HCVA 4OCSL 1JWUB 3CH8A 4ZO7A 4Y19A 2LU4A 1YEKL 4CN1A 1OTSD 4CNIA 4APQA 5IW3A 4OCSH 5IB3A 1CD8A 1DN2A 4ZSOA 3PNWA 3VMPA 3AC0A 1CU4H 4WV1B 1MHPL 5FYKU 3HHRB 1MCSA 1YEKH 4FQXB 4IRZL 5GZNC 1YNTB 5C3LD 4Y5YC 2VL5B 3LS4H 3UMTA 2A83A 2OJEB 5EO9B 4IRZH 1BJ1H 4YC2B 4ZTPL 4NHUB 3WHE1 4IOSD 3O3DA 4FQPA 4ZAKC 4HWEL 2YOCA 5IVZA 1R5IA 3HLAA 4F9PC 3GJFA 1T66C 3AU1A 5TQ0L 3M8OL 4PGEB 3UTTE 4JPVL 2VR4A 2JCCE 4MQ7A 1TZIA 1MY7A 1EVUA 2B20A 3CFEB 4JY6B 2BNRB 2XFXB 3IFNL 4X6EA 5IB1A 2VH5H 2PW1B 3D0LB 3QJFB 5C07D 2B0SH 5DHVB 2ZNXA 2CKBA 4UIMA 4PJDE 3VGAC 1KELH 2MTPA 1KCRL 2YHGA 4O9HL 1BJ8A 2P8PB 5I73B 3JV4B 2PW2A 4HHAA 2CLVB 3SKNA 4K3DL 2WQ8A 4AEFA 1CIUA 4ORGB 1JV5A 4AM0B 1G0YR 4JG0L 1A6UH 3Q5YA 2AXGB 3WIHL 2QQKL 2Y06L 1QYGH 2BX5A 4EIGB 1KNOB 4GG6E 3C6LB 1QA9A 6CGTA 4JG0H 1Q9OB 3WIHH 2QQKH 2OR9L 5L8JB 1OGTA 1G6VK 4CU6A 3LS5L 4WFEE 3RWFA 3WLWD 2HT2D 5JW5B 4LFHG 4XB8A 4M00A 4PRDA 3B8YA