3R06A

Crystal structure of anti-mouse cd3epsilon antibody 2c11 fab fragment
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
213
structure length
213
Chain Sequence
DIQMTQSPSSLPASLGDRVTINCQASQDISNYLNWYQQKPGKAPKLLIYYTNKLADGVPSRFSGSGSGRDSSFTISSLESEDIGSYYCQQYYNYPWTFGPGTKLEIKRADAKPTVSIFPPSSEQLGTGSATLVCFVNNFYPKDINVKWKVDGSEKRDGVLQSVTDQDSKDSTYSLSSTLSLTKADYERHNLYTCEVTHKTSTAAIVKTLNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords anti-mouse CD3epsilon antibody 2C11 Fab light chain
publication title T cell receptors are structures capable of initiating signaling in the absence of large conformational rearrangements.
pubmed doi rcsb
source organism Cricetulus migratorius
total genus 51
structure length 213
sequence length 213
chains with identical sequence C, E, L
ec nomenclature
pdb deposition date 2011-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3r06A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3r06A01
4LLYA 4MZ3A 5F7WC 4CU7A 3NN8A 1A1MB 2VYRE 1EEYA 1JUFA 4BFEA 4Z7OF 5AUMA 4Z7VB 1B0GB 4I3SH 2DTMH 2NR6C 3FQNB 4G5ZH 4S1DC 5T5NG 3TYGL 4HS8L 5CEYB 3C2SA 1XGQB 4MAYD 3X3GH 4OI7A 5B21A 3QNZB 4CRPA 2WINB 4KUCD 5F89A 3MRFB 1UKQA 3UTPD 1RZ7H 1L6XA 3QXWA 2R8SL 2ESVA 1TVBB 2X1PA 2W60A 3HZMA 5IJVB 5IB2B 1IC5L 1KJVA 2I9TA 2ZUQC 3RL1A 5JOPE 3H2WA 5D7JC 1CDJA 1MWAB 4MAYB 4LLQB 3MTRA 3MUY1 5F44A 1FDLH 2C3GA 2UWEE 4ZFOA 5D96C 5EC2A 3GMRB 3SKNB 2I26N 3PABA 4X99B 2GCYB 3Q3GB 1G7JB 2YMXL 3IF1B 2ZCKL 4MA7L 3OR7A 3T2NL 4DN3L 2P43B 5B8CA 1BZ7B 2L4OA 2X09A 4X6CE 1NGPH 1UT9A 3UJTH 3PHQB 3SJVA 4ZAKA 4C56D 4UDUA 3ARTA 3MYJB 4Y4KA 4LLVA 1DLFH 4RFOH 1YN6B 2IGFH 4ZO8A 1UXSB 1YY9D 2BDNH 2Y5EA 1EHLL 1HDMB 4RISL 3U7WL 4BELD 4X7FC 4GRWF 1R5VA 2MCPH 5DURD 5TDOB 3LPWA 1KBGH 3B8SA 4OCLC 3QXDA 4UNUA 2NY1D 3QDJD 2X4RB 3W82A 1D9KA 4YLQT 2E7HA 3VFOA 4NJ9L 4KZDL 1KFAH 1H8SA 1UCBL 2ED9A 4JHZA 3SDDC 3RL2B 2IBBA 1D5IH 2VLRA 4ETQA 3SGEH 4KDWA 1U8NB 3QIBB 3ZKQD 1S9XA 1YMMD 2VDQL 2VLME 4R8WH 4ZFOL 1P69B 25C8L 4WV1C 3RIAK 1OAUL 3VJ6B 3FO9B 2H8PA 4ACPA 1YNLH 4KRPD 4TPRL 1JJUA 1ZVYA 5MI0C 4YHZH 3QDJB 1U93A 1BZ9A 1AGEB 3SQBA 4MXQC 5LKNA 1RJZB 3HZVB 1HEZB 2GSGB 3JBG7 3GEWB 3ZHDA 2H45A 4C59B 4PTTA 5I1KH 5E4EC 1YMMB 3OAUL 4PJEB 4XP9H 4KMLB 4QHKI 3MRLA 3KYKH 2CXGA 1NGYB 4KRPB 4HUXA 4ODSH 3GJFA 5SWSD 1F6LL 4F2MB 3WMSA 5DJ2B 4KMQA 2YC1B 2AJVH 3ZO0A 3L5XH 4L8DA 5MEOA 1N2RB 1KPUB 4XCCL 2GTZA 5C0GB 3I2CH 3FQRB 4GO6B 4P2OD 2KL6A 3CFKB 4NZTH 4JGJA 2FR4A 4GH7B 1KV3A 1AY1L 4PJDB 1TZGL 4EI6B 5EULV 1B4JH 4H8WC 5GS0L 2BSTB 3SO3C 5SX4H 4O02L 4RRPG 1MFAH 1RHHB 1PSKL 3NAAH 4N5EC 1UB5A 4P2OB 1MY5A 2H1PH 2M26A 1SQ2N 5JA9A 1A3RH 4PJCA 2Z93B 4MA3B 5I1IH 5IF0A 3C60C 1OGAE 4LP4A 3BW9B 3FMGL 2ZCLL 1KF9B 1DQMH 3WS6A 2N56A 2AJSH 2P5WB 2JJTC 4HIEA 1S3KL 3KPOB 4X5WA 4PS4H 3RWFB 1J8HA 5ACZA 3MGAA 2D9QB 5CINH 3EJYD 3K8LA 4M7JL 4NZDA 3PWJB 4Y8DC 3ZE1E 1FN4A 3T65B 5LXGL 5EU3A 4DK3A 4OLVL 5IW1A 1MUJB 3PIQA 4L8CB 4FFVC 1BD2A 3ARZA 4FQIL 4JG0H 5KSBF 1R5WB 4ZTOL 1A1OB 1RZKL 3ZT6A 4PGBB 4TSCL 4U1GB 5KVEL 3V8OA 1LE9B 4U1JB 1JNHB 4YBQC 1KPRA 5E6IB 4YGVA 2QSCL 3ALXA 4DUXA 4BKLB 2XPGB 1H9VA 4LKCA 1AO7E 2F58H 3WKMH 4OF7A 3BP5B 2F5AL 1B9ZA 2X4PA 4YPJA 4JVWA 5ESAB 3BZFB 3EFFA 1ES0A 1GAFL 1MIML 3T0ED 4X80L 4ZS7H 1MREL 3OWEA 4JB9H 1NLBL 3PG2A 1GC1L 4JM4L 3RKDC 1J88A 1FCCA 2XY1A 5IQ7L 5GSVA 2AS5M 1EJOL 4LHUG 4XPBH 1UB6A 2CKBB 1S7TB 3EYOB 1K4CA 3MLPA 2A77L 2W92A 3NIGE 1IC1A 3DVFA 3TZVB 2BSSA 4G3YH 4CVXB 3T0EB 1S8DB 2VL5A 4PG2A 4MCYB 2X9YA 5EO0A 5DRNA 3DV6B 5HHVL 3VXUD 2QR0B 2X89D 1A7NH 1DQJB 1JP5A 5T5NF 1MHEA 3IDNB 1ORSA 1IFHH 2HN7B 3HUJE 3GSNB 5JHDD 1NC4A 3UBXI 3TO4C 1MWAH 5IQ9A 1N5YL 1XF4B 3G04B 1NCWH 2AJUH 2IQ9H 5E4IA 2RR3A 1RFDL 4ZUWB 5FYJH 1P9MA 3RBGA 3WXWH 5F93C 4TUKL 2R2EB 5E8DH 3MRNA 5DRZB 2DI7A 4DGVL 4MDIB 1WWAX 2IBZY 2D0GA 1MNUH 1Y0LB 4KI5F 3HC4H 3OJDB 5DTFA 4HWEH 1NEUA 1NC2A 2VZVA 1F3DJ 2DMBA 4FTVD 4ODVL 5BXFB 3PNWA 5F1NA 2ITCB 2FGWL 1N59A 2YZ1A 2OCFD 5EUOA 1AR2A 1N64L 3P73B 4QXGL 2Q6WB 4R2GD 1S7WA 5EU6E 4HBQA 3EGSA 4ODUA 1L7TH 1UA6H 2VXTL 1X5HA 2ICCA 4BA8A 1R24B 4PJIF 4Y7MA 4XZUB 3EO0B 4CNIB 4EN3D 2EE3A 4Z5RB 4P5KB 3NIFE 5L2JB 1FFQA 1K5NB 4G9FB 2OTWA 3T0VA 1WAAE 2ZUQB 5ICYA 5GS1B 1T3FB 4PY8J 3QR2A 3SO5A 4R2GB 6FABH 1XIWC 4ELKB 2PO6C 1QSFE 3REVB 1CK0H 3N50A 4K94C 2DQGL 4EN3B 1P7QB 3CAFA 4JRYB 3G6AB 5C6TL 2HLAB 1ZLVK 4NN7C 4HG4K 2RGSA 4J3SA 1W0WB 3DRQA 4V2BA 3MV8E 1ZT7A 1W0VA 2BMKB 3BP4B 4I3RH 3HI6L 5FUZH 1FPTL 5JW4R 1SHMA 3KLAA 2P48B 1OTTC 4M7LL 3KJ6L 5EORL 1CXKA 3MJ8B 4M9PA 4F3FA 4LSQH 4PD4J 3RQ3A 3IDXH 1AGDB 1XGPA 2DQEH 5BW7A 3LQAH 4D9QD 5DC9B 3DOSA 2OP4L 4ZPVA 4HC1H 5IWLA 1ZXQA 4WI4A 4U3XA 1I3VA 1MCRA 1YN7A 2OQJB 4RFNC 5DLMH 5CCKL 2GQHA 4Q2ZA 4GUPA 3CDGA 3VRIB 3MV9A 3O9WA 1RZFL 3KYMA 4Y89A 2GJZA 4PJAE 2R0WH 1LEGA 5TGBB 1I7RA 3OX8A 4UU9B 3HRPA 5EBMB 1K8DA 1C12B 3UC0L 2KBGA 1FVDB 2O5YH 1LVEA 5MI0B 4PUBH 5CGYC 1KT2A 1BBDL 3S37L 2NY4D 3FZUC 1KC5L 3O2WH 4OIBA 2DJ4A 3UTPE 5E4EB 4HQQL 5JO5B 5J0BA 5C0AB 2X1OA 1ZLSH 1MRFH 4PJHB 1OPGH 1WCQA 4MA8L 3S5LB 3TIDB 4AG4L 4YQXH 3HMWL 1TTUA 1OW0C 4KPHL 2P45B 4KKNA 4NQVA 1DFBL 5BMFL 4XXCA 3HG1D 3QJFB 4QCIB 4DZBA 2VXQH 1RULH 4U2YA 2IPKB 1RUKL 4QXTB 3O0RH 4DVBB 4P2YA 1H8OA 1RUQL 4MYWB 1HXMB 4K23L 1SY6A 4XP5H 4C56E 2FDBP 1KPVB 3P9WB 3V6BR 1Z9SA 2UZIL 3DUUB 3VFSB 1T4KB 3IU3B 2XKSA 1MJUH 1QSEB 3N85L 3HE6C 2DIBA 1CD9B 1C1EL 4LASL 4ZFFA 2NNAA 4JPVL 1OGTB 3MLYL 4DUVA 2XTLA 3TO2B 1Z6JT 5F71A 5JR1L 4M00A 4KK5C 1MHPH 4EXPX 3BRFA 3QDJE 5TDPA 3CXHJ 4L5FL 3GHEL 1HILA 4QF1A 1T1XA 4P2RD 1XZ0B 3MRRB 2CKBH 2AK1H 5EU4A 4YBQD 4A6YB 1YMME 4PJEE 1A7QL 2E9IA 1JNNL 1GIGH 5D6CB 4J3WA 4JHWH 1CLOH 4Z7QE 3QFJA 1IAIH 1AFVH 2FYYA 5J4MA 3BH8A 5LAXB 3UP1A 3GSNH 1GSMA 1SY6L 3DUSA 4UQ2B 4CMHC 8FABA 3RKDD 5T1LD 43CAB 4RMSA 1VFUA 3TC9A 1BHGA 1GGCH 3FRPG 2HAZA 3E3QC 4PJDE 2HJKB 5E7BA 3SGJA 5IW6B 3EAKA 1R3KB 5KVFL 3MRBA 3GZKA 1A7OL 5DUBB 5JPMB 3QNXB 4KRNA 3STLA 2Y7QB 3ZDXF 3RGVD 4OD1L 3HE7A 1T7WA 3GJEB 1NLDH 3MCLH 1Q0XL 3O6LL 1NQBA 2P5ED 1ZGLA 3CXDH 3MCG1 3LEYH 5T1LB 9CGTA 4FFYL 2R56H 1FORH 2LU4A 2OR7A 3SDXA 2XZAH 5C0NC 3HZYB 3QUXA 2DQCH 1BQSA 2OTUA 3EYVA 3RGVB 2VDPL 4K9EL 4NKDB 3DHMA 1W72L 2P5EB 2V2WB 2VDNL 2A1WL 3R4DA 2KKQA 2UVEA 4XNMB 2OZ4H 4U1SA 4XPGH 2VSDA 5EA0H 4OZHF 5EUKB 4BH7A 5TF0A 3IDMA 3P4NB 5E2TH 3SDAC 2VTFA 1QLRB 1FL6A 1D6EB 3SGEI 4NM8H 3AC0A 2HA1A 4KFZC 2FZ3A 4H26B 4QRRD 1YEEH 2BJMH 2YBRB 4RGOH 2EDDA 3GSRB 3H9SB 2K9UA 5CJQL 2E27H 4UBDD 1EFQA 2EE9A 1DUYA 4Z0BL 4WHYG 4LQ1A 3V4PH 2JTDA 1A22B 1UH3A 1I3GL 4JR9H 2BFVL 1RURL 3S88L 3ZE2E 1J1XL 1NGXA 1XCTB 3P9MB 4Y1AD 4PJXB 3EJJX 3ILQC 4I48A 1JGUL 4J3TA 3ARWA 5LQBH 4L29A 4FXKA 1IVLA 5DWUH 3LN9A 4WW2A 3AMKA 3ULSB 3TFKD 3MUHL 3T0EE 1XIWB 4Z7VF 1MCOL 3JV4B 2PO6B 4LEOA 3INUL 4JFDA 3QUYD 4LHJB 2DOCA 1S7VB 2A6JB 2DQTL 5IHBA 1JFQL 4R7DA 1J12A 3WHE0 3L7FB 3QEHA 5TDNB 2H2PD 4XP1H 2XWBB 4EEEA 4HF5L 2EC9U 3FT3B 1OAKL 1OAQL 2YS4A 3UAJC 4NZUL 5KSAD 5E8PA 3L1OL 1JRHH 1CFVL 1KG0B 4NKOA 3VXUE 5D1XC 1FAIH 2P46B 5CEXA 5HYQB 2D7NA 1FZOB 2UUDH 4ZNEE 3SGDH 1HHJA 5JHDE 1X6NA 5KSAB 3BP7A 4F9LA 1V7MH 1JZ8A 4UQ3A 5DMKB 4X9FA 1XR9A 3ESUF 3MUJA 2BY0A 5B8CC 5F88B 1CVSC 1E4KA 2VIRB 1JIBA 1JPFB 4ONFH 4ZAKC 1U2CA 3TNMA 1WZ1H 4RFNB 3L3GA 1AH1A 3BKCL 5GPRA 3FRUA 4IRJA 4Y4KC 4P9HL 5F3HA 1R3IL 3FZUD 4S2SB 5HBBA 2HTLD 1F3DH 1MCPL 5D7SH 4FTVE 5C09B 4BYHA 4QXUH 4G9FE 1HHHB 1G9ML 4K55A 3B3IB 1U3JA 2JIXA 2A6DA 3E0GA 5EU7C 1D9KC 3CFBB 3GMOA 4IM8A 2J1KA 1T66C 1BFVH 2X9WA 3K46A 4PP1C 1HOCA 3PGFL 1U8JB 3V52L 1FH5L 2OJEA 1I8IB 3HC3H 1CL7H 3PWUA 3TVMA 3B9VA 4U3CA 4UAOC 1YUHB 4P4KC 5EC1A 1QRKA 3MREA 1T7YA 4JQXA 2FD6L 4A6YH 3VE0B 3H3BC 2CDEA 4Z7WA 3OSKA 1KLGA 2Z9TA 1PG7X 4D0CA 4U6VL 4DZ8A 3WNMA 3PUCA 2B2XH 3JV6B 1T89C 2GY5A 1CDIA 4FZ8L 5B4MD 2WMPA 1F58H 3DXAA 4KK5D 4N9GB 4H20L 5KW9H 3PF2A 1N0XL 3C6SB 3N1QC 1DQLL 2VITB 2D03L 3MBXH 3O4OC 3MRIA 3CX5K 1IT9L 3HE6B 1RZKC 3WUWB 4Y4FC 1HINL 5HI4C 4D9QE 4N90D 4IDLA 3SBWC 3EUUA 1JZ5A 3BUYA 4N8VG 3DGCR 4HUKB 1RIUL 3PQYB 2F53B 5INDA 1DUZA 1X7QB 3OXRB 3PV7A 4YDJA 3FB5B 1DQQA 5JA8B 4Y8AA 1HYSD 1TPXC 4YZFF 2OK0L 4KQ4H 3LKNB 5EZOH 5C0AE 3EZJB 1CE1L 5HHMD 4PJHE 4AENB 4YDIL 5D7LB 3DUHA 4PGEB 3SGKA 1CDGA 3D39A 5IKCA 5DR5H 2FX8H 4Q9RH 3FFCD 1GC1C 5T3XD 4NM4L 4E41B 1RY7B 5EBLB 3KPPB 1BREA 3EDJA 3CSYA 5BO1H 4LRNH 3TESA 1ZGLP 3MOBL 3RX8A 3WFEL 4YEFA 4R97C 4CMHB 4YK4C 5HHMB 3CH1B 4NUJB 1KCSL 4LF3A 5IHLB 1Z5LA 4K7FB 4JO3L 4HPYL 3OAYK 1J0HA 4HGWB 4MB3A 3RVTD 2R1XA 3FTGB 4Z7UF 4OIIH 4ZFGL 4HS3B 1LEKA 2VR5A 3FFCB 3QAZB 2HMIC 5IP4A 3BMVA 1KENL 1RUMH 2BXYA 5C0ND 4ERSL 1UQSB 4JFZH 4LU5L 1IJ9A 5FGBC 2HVKB 3K74B 4NWTH 5EN2A 2GK0A 1QSEE 1KB5A 1I1AD 4I9WD 4NO5B 2W9DH 5D2LE 4GMTH 1P4IH 2X7LB 4K3EH 3MRDA 2APBA 4WFGD 1QBLH 2DD8H 1RIVH 1OP3H 2DICA 4BQ9A 1GXEA 1A7RH 3BAEH 4LGRB 4R90H 5CHNA 1FFRA 4NZJA 3SDAD 4JQVC 2IANA 1NPUA 1XMWA 4N0YL 4WUUD 2P44B 3DWTA 1MRCH 5T1DH 2BNQD 3LKSA 4DFIA 2MWCA 4HD9A 4MHHG 3LKPA 3KPTA 5SWZA 1VKXA 2DQHL 5I0ZA 1H15A 1KLUA 1WBZB 3IFPA 4PP2A 4M6ML 5MERA 3SDAB 4UT7L 5FGCB 5EO9B 2QBWA 1YEHL 4WUUB 4K94H 1ZAGA 3CK0H 4XBEH 1MJ8H 3TNNA 1BEYH 4OI8A 2Q3AA 4J1UA 4NO3B 4PG2C 4P2RE 5HDBF 2BNQB 4JDZA 4JO2L 5CFHA 1FJ1B 2YUZA 3KYOB 2MQ3A 3SE9H 4AEHH 5ITFA 3GB7B 1YDPA 5TQ0L 2VZUA 3FQTB 1U8HB 2H6PA 3D85D 1VFBA 1NCAL 1CGSL 1K6QL 1MLCB 4XRCB 1S7XA 1G6VK 1ZLWK 3GSOB 4MD4B 3L6FA 3Q6FA 5DJYA 4YAQA 3OTTA 2BC4A 1SYSB 1SEQH 4YXHL 5BS0A 2PTTA 1IBGL 3TBTA 4XHJC 3VXPA 5LGJA 3OKNA 2VDRH 4X6EB 5ILTL 3D85B 2Z8WC 1X5KA 1HHKA 4LSDA 3RNQA 3LV3B 3DARA 2FJHB 4N68A 1MIEL 5E8NB 4O4YH 4KROD 3REWA 1CTOA 2EIBA 1KJ2A 3KR3H 4O2CA 1FBIL 3MPCA 4ALAH 2CLRB 2P5EE 5F89B 4M61A 4HHAA 5DMIH 2WUBL 5ENWB 4G42A 2ESVB 3BMWA 2E9JA 3W2DL 4XH2A 4EUPB 1QD0A 1EZVX 4WW1B 4LCUB 3E6FA 1SYVA 3O11B 4ODBD 3RL1B 3DGGA 1Z3GL 5KAQG 1XF3A 2W65A 4DEPC 4P3CL 1CBVL 1QACA 1UWXH 5D1XB 1KACB 5EBWA 4ZFOB 5I8KH 2VAAA 1INQA 4PRNA 5E1AA 3GMNB 3PABB 1NKOA 4JPWL 3ILPA 1QTYT 3ARDA 3UJIH 1EXUA 1YYMH 2CK0L 4U3HA 2C1OB 5HD8D 5HHOA 3MNVA 1ZEAL 4OLYL 4PRBB 2D2OA 3JV5A 5ETUA 3X3FL 1L7IL 4JDTL 3EHBD 1IM9A 2C5DC 4WVRA 3C2AH 3K2MC 3QDGD 2J2ZA 4ZSOA 4ZAKB 2RFXB 4YR6A 4PLKC 5HGAB 5C0BD 1G7IA 4QRRE 2CDGA 1J0YA 3MODL 4UB0H 3D2UD 3MNWA 2ADGB 2J12B 4PJXE 3TGXA 2ZUSA 2NPLX 4LARH 4Y4KB 3IDJA 3WL9A 4BFIB 1T66D 5GS0D 4WDIB 3NZ8A 4LK4A 2G5BA 4PP1D 5BW7C 2RIKA 4NNXB 1IAII 1VDGA 2CKNA 2DF3A 3HMXA 1F4YH 4PJGF 5H37H 2ID5A 2DLGA 2ZWLT 1MI5D 3K2UH 3O6ML 3TH3T 4N8CL 5IWLC 1NMBL 3CC5A 1LDPH 4X7TB 2X4UA 3WEXB 1AIFB 3KXFD 3QDGB 4P4KD 5I1GH 3B9AA 1PZ5A 3O6KL 4KJQC 3IFOB 4PGCA 1XGUA 4GLRH 4Y1AE 5IBUB 1GRWA 2FBJH 4I2XA 5L2KA 3HZKA 5HYSB 5T1MB 5FYKD 2VLRB 3O9WC 3MJ9A 3ZDZF 2CRMA 5C6WH 1MI5B 5IFHL 2HT2D 2CDFA 4UAOB 1JTOA 3KXFB 4P4KB 1A7PH 3BZDA 5CEZL 4LCWD 5A16B 3UPRB 4L3CB 2J6EL 3RDTA 4MD0A 4PTTB 3A67L 3MRLB 2DKUA 3JSSA 3VMPA 4Y4FD 3V5DB 5DRWA 3J8F7 2IMNA 1M71A 1W2KT 3VFNA 1HZHH 1IGCL 4LCWB 4MS8C 4HXAH 3G5YB 5HYFA 5CJXA 3VXTA 4Y19A 4ELMB 4JJ5A 1NFIB 1OTSC 3O4OB 1OQOA 1JWUA 1LO4L 4JDVA 1OAXL 3CLFH 4Y4FB 4H5SA 2VDMH 5HYJB 1IGFL 4HJGB 5FO7A 5C09E 5HVHC 1MCQA 3GGWA 1U91A 4QHMA 5IMKA 4Z95H 2DBLL 1J0ZA 4HKBB 2XNAA 1HHIA 2V7NA 3U36B 1JF1A 2HT4C 2YEZA 1IL1A 1C08A 1KULA 3CFJA 3UDWC 3SDCA 1ADQA 1ZOXA 1TPXB 2NY0D 4XXDB 3ZZ1A 5J89A 2H3NB 5IF0B 5CBAB 5K9KA 3NFNB 2OR9L 4OZIF 3RWCB 5IT2L 1DJSA 3AS3A 4HIEB 3MUZ1 5MEPA 1ITCA 4X5WB 4YHKL 3VFMA 3HRZB 2XZQL 2XQBL 3T77B 3U7YL 4M6NL 1YECL 4W6YB 4EIGB 3B9KD 3TYGH 4HS8H 4NPYA 2AQ1A 3CCHB 1ED3A 3BSZL 4YO0A 4YK4B 1BD2B 2V9TA 4K9EC 3ULVL 1U3YA 1JMZA 2R8SH 5DEGB 4GW5A 4YX2L 1UH4A 4JM2F 4I8DA 1IC5H 2WANA 3Q5OA 2E9WA 5J57B 5I2IB 1L0QA 2A9NL 5M95B 3ZTJG 2COQA 5DQ9A 2AEQL 4PJFA 4WFED 5ISZA 2FCBA 3MJ7B 4M1DL 4LKCB 5AG8A 4ONOA 4LSPL 3SGJC 3K1KC 3WO4C 1BGXL 2YMXH 3PQYE 2ZCKH 3OG6B 1ES0B 3SGDI 5FB8A 4MA7H 1F6AB 4DN3H 3F7YA 2PYFA 5IB1B 4WTWA 2WLZA 4GOSA 5D7IF 3GSWB 1OD7A 4M93C 5E2VH 2Z8SA 4J8RB 1PKQA 4N90E 4OTXL 2OM5A 3TYFB 5CIPA 4CL7A 1K4CB 3U0TA 5HGBB 4CVWA 3QUXC 4XCNB 4GXVL 1EHLH 2BSSB 4RISH 4E41E 3U7WH 2EIDA 5EO0B 3ZT5A 4EUPH 5F9WB 1U95A 4AT6A 1IRAY 1INDL 1YYLL 4NJ9H 5HHME 4KZDH 4NP4L 4HKJA 1UCBH 4JFXB 3GSVB 4Y16D 2GJ6A 3D5OF 2HFFA 4X6FA 4JFYA 1F4WL 1ETZB 3E3QE 3ARFD 2VDQH 2BOBA 2DQDL 3FFCE 3MZTA 5IROC 25C8H 5T3XE 1JWSB 4F7TA 1JI1A 2VZOA 5K33A 4TPRH 1BQHA 1H0DB 4L8BA 4IMLA 1CL7I 3OBAA 4MJ5A 4XMKL 4QRPA 3UTTD 5KAQF 3HR5A 1YPZA 4PY8I 4HV8A 4X4ZA 4NRXB 4X6DA 2FO4B 3ZLQC 3OAUH 2R9HD 3PNWB 1BWWA 3LN5A 4Z77A 4PYHA 4BM7A 4MHHI 5EIQA 4GG8A 1CGVA 1H3UA 4GAYA 3F7VA 4ODUB 3HNSH 1S9VA 4XCCH 5L8JB 1A6TB 3F7PC 2JCCB 3SHSA 4WFGE 4H1LG 2AEWA 4WW2C 3Q0HA 2V5TA 2OTWB 3VFUA 3UYPA 5C0IA 1AY1H 1AHWC 1P53A 1QOKA 5FGCE 4UT6L 5F7UA 4GG6A 4P9HC 1TZGH 4MJ2A 4W4OA 4WUUE 3WCYA 5I76A 2R39A 5GS0H 1IAKA 1S9WA 2BNQE 3NIDE 1PSKH 4JFED 4PLKD 5MENA 5C07D 5E95B 1G9MC 3SQOL 1G7LB 2OSLB 1DVFA 2FSEB 2LTQB 4PJ8A 2DIAA 5GRUL 2CLVA 2EZ0D 1I1YB 1F45A 2B4CL 3VD9A 2OX5A 2AVGA 1QBBA 3FMGH 4G8GD 4M9OA 2ZCLH 1HKLL 1GOHA 1I9RL 1A0QL 1S3KH 4XPAL 5FOBA 4HIHA 4OKVB 4I77L 5C07B 3G6JF 3O6FD 4M7JH 2X70A 1JYXA 5LXGH 1TJIL 4OLVH 4KHTL 1EFXA 4NN6C 2WP3T 2PYEA 1G7PB 3C5ZD 3OHXA 5BZDA 1Q9LB 4ZPVB 4FQIH 4Y5VA 3LKQA 1E4KC 3KJ4B 1X5GA 2ZKHL 3QUML 1YN7B 4R0LB 5DT1L 3W0WD 4ZTOH 2APWA 1RZKH 4GUPB 4TSCH 3IGAA 4PJ7B 1JWMA 3L3JA 2ZOKA 4IRJC 2Q86B 5KVEH 3O9WB 4IS6B 3QDHA 3FN3A 5F1OB 1I7RB 3OX8B 5C2UB 2QSCH 1EJ6A 2XFXB 1K8DB 2QTEA 4LVOB 5ICZA 3W0WB 3VRJA 5DHXB 1FCGA 4B50A 3ZKND 2F5AH 4OCSL 4J3OC 4KTEL 2BY3A 3C6LD 4LAQL 2XKNA 3WLWC 4AMKL 3LSOB 1CD1A 3O4LA 1GAFH 1MIMH 2EC9T 5C1MB 4X80H 3QXVA 1MREH 1LP9A 5FGRA 1NLBH 1DBKH 1TETL 5B3JF 43C9A 1GC1H 4JM4H 3TVMC 5K59F 4QRUA 5IQ7H 3QZWG 1EJOH 2Y36L 3TBVA 2L0DA 1OF2A 3C6LB 2A77H 3EOBA 4JN1L 4HWNA 4MMXC 2YN3A 2HG5A 3RWJB 2ZZUT 4J2XA 5FM4A 5IFJB 5HHVH 2EDOA 4G6FD 3NH7L 2X10A 5JPNA 2AK4A 3QWQB 1FVCA 1WICA 1HH9B 2KH2B 1N5YH 3QDGE 3PXHA 4GW4A 5C0BE 4TUKH 4PGDA 4NOBA 4DGVH 4WWKD 3ZKMD 4ZFFB 4G6FB 2CSPA 3CMGA 4XBGB 3VRLF 4BSWB 1JGLL 1LO5A 1MI5E 3MLSL 2W9EL 1NEZG 3VG0L 1XGTB 2CUIA 3KXFE 5IEKB 2YPKA 4CU8A 1NGQL 5DJDB 4ODVH 2ZUTA 5FEBA 3FOMB 1YEJL 1K8IA 2FGWH 4U6HA 1X6LA 5FUOL 3QFDA 3BGMA 3QCUL 1N64H 4FG6C 4WWKB 5FYKE 4QXGH 2O93L 2CGRL 2XWTB 4XI5D 4NDMA 4X5XA 1K4DA 3BPNB 3PWLA 5ERWA 2J8UF 5J9PA 1TJGL 3DROB 5CWSB 4LP5A 5DUPL 2VXTH 3DETD 2WBJA 3SGKC 1JZ6A 1W72B 4LCWE 3F7RA 4M4PA 3FOLA 2WWKO 3CSGA 3FB7B 4OLZL 3QFJB 1MQ8A 4ELME 5E9DA 2MQ0A 3STBA 3DUSB 4S1QL 5DFWH 1YEIL 8FABB 3B43A 3UXFA 2XWJB 2DQGH 3UBXA 5HYJE 2V9RA 5EFIA 5C6TH 4QKXB 2OBGA 3RNKB 3WO4B 1JI2A 1OLLA 2EKSA 1BP3B 4IOFC 3WNLA 4O5LL 5ANMA 4KY1L 4NBXB 2DTSA 2VQ1A 1KEGL 3HI6H 5EPMB 1FPTH 2E7LA 4LBEA 1NBYA 1I85A 3QQ9C 4C4KT 2O26U 4M7LH 4J4PD 5EORH 3BRDA 3QEUA 4HEPG 1G7QA 4PREA 3RWHB 4OAWB 3OR6A 2VKXA 3L5WA 5E6ZA 4WENB 3DIFA 3EYVB 2D7TL 5L8LB 4HKXA 1TZIA 4ZDHB 2OP4H 5DJ0A 3F5WA 5AZ2L 4HIXL 2A6IB 4WI9A 5HY9A 1TZHA 3PGCA 5FO8A 1SJVA 4L3EA 3V7MA 4FFZL 5CCKH 2R0ZL 4U1SB 3HS0A 5KN5B 1RZFH 1QLEL 5C86A 1AJ7H 3VD3A 4PV8A 4J12A 3V0VB 3OZ9L 1U8MB 3RTQD 1CD0A 3UC0H 1GGTA 4O9HL 3QJHB 5FDWA 1DLHA 5DK0A 3EO1B 4KMTL 1BBDH 4NO2B 3S37H 3GBNL 2AV7A 1KC5H 1PGRB 3PL6D 1C5BL 4HQQH 3MNZA 5GGTA 3I50L 4QTHA 5J1SC 3RTQB 1L0XA 4MA8H 4AG4H 4CJ0A 3HMWH 2DJSA 5A2LH 1UVQB 3HCVA 1WIUA 4KPHH 1DFBH 1T1WB 3L9RA 1UZ6E 1CFTA 2WBKA 3WJJA 3PL6B 4FXKB 4G8FB 4UI2A 1F11B 1WBXA 4OM1L 4WW2B 2DKSA 3CX2A 4MZ2A 4P46D 1RUKH 1AHWB 1AKJD 1UEMA 4XNZC 1FRGH 5H94A 1IAOA 1RUQH 3QI9A 4M7ZC 4K23H 4LEOB 3VGEA 4QOKD 4CVZA 1EK3A 3D25B 2UWEA 2UZIH 3QEHB 2Q7YA 5KOMC 1XCQA 4NRZB 3N85H 5A3ID 2I07B 4CMMA 1K85A 1C1EH 4LASH 3T4AB 4JPVH 1KSRA 3V5HA 5J3HD 3MLYH 4XCEB 4KVCL 1JHTA 3DYMA 1EHNA 1UACL 5JR1H 4X6CA 5CEXB 4L8SA 5GGTL 3FT2A 4L5FH 1A14L 3ZDYE 1V7NL 3GHEH 1KCRL 3VI4E 3BP7B 1Q9OA 4NN6B 4JKMA 5FYLL 4ZOEA 3G5ZA 1A7QH 3RWEA 1JNNH 5IB5A 3W11C 1AP2B 2NW2B 2HFTA 1O7VA 3P11L 4YHYC 4AY0A 2IH1A 3DURA 4NSKA 2KQMA 3WSQL 3FRUB 1F4AA 1AQDA 2J88L 4APQA 1P2CB 4HAGA 1V05A 1QR1A 3C09C 3EYFB 4MQXC 3R0MA 2JCCE 4WWID 1SY6H 3VWKC 5GJSL 3WO3B 5IGXL 1TJHL 4D8PB 1Q72L 3KDMB 3QWRD 4ISVB 4CDGC 1QEWA 5KVFH 3C8DA 3VGHA 1A7OH 4EI5A 4OD1H 3OJVC 2ATPA 5DMYA 4U0RC 1Q0XH 3O6LH 4YZFE 3ME0A 4X7SH 3PWUB 1GGUA 4P9ML 4X0KB 1BX2A 1PG7L 4FFYH 4JPKL 3ALPA 4FQ2L 2X4SB 2MHAA 4P5TA 3MRPB 2ICEA 3RDTC 3MROA 1AD9A 2CDEB 4ZTPL 5C07E 4K9EH 1ZKAA 4DKEL 4D0CB 2UUDK 2VABB 3T0XA 1CFBA 5KTEL 1W72H 2VDNH 2A1WH 3P9LA 3C5JA 4U49A 2FECL 4FQQB 5DD6B 4ZD3L 1G0XA 4GSDL 5JMOC 3VDAA 2R1WB 3DXAB 5CBEA 4L1HA 3ULVC 1FQ9C 4GBXD 4I0KA 1ZT1A 4M5ZL 3NPSC 4LCCA 4NN5B 4PJ7E 5CD3A 2IFFL 4PR5A 1VACA 1OVZA 1BVZA 2JK5B 3MLZL 1FNEA 4WJ5A 3BUYB 1OGAA 1GHFL 5JORA 2Z35A 1N7ML 2BY2A 1AR1D 5ALBL 5CJQH 3T2QA 3WFCL 5INDB 3W0WE 2HH0L 4ODXB 3STZA 4TUOA 4Z0BH 3SDCC 1BQLL 3MV7D 4GKZB 1OSZA 4KJYA 1I3GH 1O0VA 2BFVH 4CADA 1RURH 3S88H 3O3AA 5TFSL 4UV7L 1J1XH 5FCUL 1WISA 4NNYB 5GRJL 1RZ8B 3G5XA 3TBWA 1JGUH 4PJCF 1S7UB 2UV3A 4FQXC 5JDSB 5K9OA 1FFPB 2Z91B 1YQ2A 2OS7A 3K4DA 3QISA 3VGAC 3ULUF 5B39B 1U92A 3LOWA 5H2BA 1P84J 1MCOH 1RK0A 3INUH 2AJ3A 2DQTH 1JFQH 3U0WL 2C3VA 1F6FB 4RSVA 3MBEA 1QO3A 2R1XB 1JYNA 1UJTA 3VXNB 3DMMA 3IFNL 4HF5H 1LEKB 1OAKH 3LKOB 1OAQH 4NZUH 4YC2C 1AO7A 1IKFL 3L1OH 4LCIL 3GSUA 3FB6A 2G60L 5HSFA 3L3OA 3Q5TA 3M07A 1ZHNA 3T3PF 1BOGA 1CFVH 1REIA 1G7HA 4J3UA 5GGVL 2NYYC 4P2CG 4U1IA 2DLTA 2XZZA 4WFHD 3K0WA 4FQCL 3AREC 3MRDB 3FFDB 1F3JB 1C7SA 3FQUB 4YXKL 5C0JB 1EEZA 4ZXBC 2F74A 4PRDB 5CHNB 3WV0A 1LILA 2GUOA 5KOVC 5L9DL 3W81A 3OXSB 5DD0H 3ZTNL 5I1AA 1P6AB 3TT1L 1I1FA 5AAMA 1M05B 1MFNA 3KPSB 1U3HC 4HMDA 2YPLD 4NO0A 3BKCH 4N0UB 3M1BB 2CLZB 2XOTA 2V5YA 3LRSA 5SWZB 5D1ZA 4P9HH 5D5ME 1R3IH 3QO0A 4LPVA 3HUJA 1BMGA 4LDOB 4ENEC 1J05A 1KN4L 4H25B 15C8L 2CD0A 3NA4A 4V1DD 3DYOA 1ZVSA 3TNNB 1FP5A 2HP4A 1G9MH 3NCMA 1X5AA 4M7KL 4MD5B 4POZD 2DL2A 5CD5C 1HSBA 1YDPB 1MJJB 2NZ9C 2WQ8A 3PGFH 3V52H 1FH5H 1NBZA 3LB6C 2BHUA 4V1DB 1D7FA 5CJ5A 2VSCA 1DANU 3QCVL 1CIUA 2AP2A 1NCNA 1MELA 3JUYA 5DJYB 3H9ZA 2D31A 2FD6H 3TH4T 1KB9K 4RNRA 3MLXL 1MCKA 3TBTB 3X17A 5EU6A 4BFGA 3L7EA 3OKNB 5M7QA 2FNBA 2QHLA 5C71A 4K3GA 5HYIA 1YEFL 4U6VH 4EQ2A 3RNQB 3N1FC 3IT8D 5JOFA 2IADA 4PGJA 1JPSH 1MAKA 1WAAA 5EOTA 4M7ZB 2GTWB 1EV2E 2JB5L 4OZFA 1M6OA 5EUOF 4H20H 1QSFA 4HHAB 5IV2A 1N0XH 4G42B 1DQLH 2B5IC 2D03H 2VH5L 2YRLA 3AB0C 1WWWX 2CK2A 1IT9H 2GY7B 1FNGB 4DAGL 3E6FB 3EO9L 1HINH 4LOUD 2MPAL 1F5WA 5F6IC 1XF3B 2JF1A 2NXYD 4W4OC 3IU4L 5CSBA 3MV8A 2EDXA 3KPLB 4OJFL 3CXHK 1RIUH 3U7AA 1FYTB 1T5WA 4PRNB 2R1YA 5KS9E 4PJBE 1EXUB 2ZPKL 3WIHL 4PJ8C 2P8PA 1ZLUH 1K3ZA 3D48R 2BVTA 3MFGB 5DJZB 3MNVB 3DPBA 3QUZD 1ZMYA 1CE1H 3MRKB 3VWKD 2ADFL 1BFTA 5ETUB 3U9PL 1A1MA 4QXWA 4YDIH 3BESR 1IM9B 4YHYB 4ZSOB 1CXIA 3FQNA 4CJ1A 1PEWA 1G7IB 5I1HL 4WO4D 5CEYA 5IUSA 1XGQA 1G9NL 1MJ7L 3IDJB 3QNZA 4QNPF 1SM3L 1VADB 3N1PC 3NZ8B 4TULL 2Q87A 3MOBH 3WFEH 5GXBB 3GHBL 3MRFA 3QUZB 3VWKB 1KCSH 3U48A 1TVBA 4JO3H 4HPYH 2X4UB 4Y5YB 5IB2A 4ZFGH 5JMRA 1PZ5B 1B88A 4XWGL 4YDVB 1CE6A 4PGCB 4HK3N 1XGUB 5H35B 1KENH 1MWAA 5F7NC 4MAYA 4JCMA 1A1NA 4ERSH 4ZOAA 3HZKB 3IAGC 4LU5H 4AK1A 4U0RB 5CILL 3SKNA 4EJ1C 2QEJA 2HRPL 3HC0B 1DBBL 3DECA 4NHCL 1LQSR 4MA1C 4W4NA 3Q3GA 1G7JA 4YE4L 3IF1A 4IJ3C 5DJXA 2IG2L 4M43L 4QOKE 4JRWA 3RDTB 3BZ4B 4N0YH 3FN0H 3EW3B 3MYJA 1U8OB 4HSQA 2JLLA 1WTLA 1YN6A 1UXSA 1S9KC 1PX4A 2NW3B 3DNKA 2DQHH 1TQBB 4M6MH 4UT7H 3GMLB 4JJ5B 4YFDB 5TDOA 1YEHH 4C56A 2FBOJ 1KCVL 1JWUB 3VG9C 2X4RA 4XP6L 3QA3A 3DX6A 4JO2H 2VAJA 3MRMB 3RL2A 2GI7A 1FC2D 3GGWB 2DM7A 1UM6L 5IMKB 5TQ0H 3JWOC 3V6ZB 3VJ6A 4G43B 3FO9A 1JF1B 1KB5H 1I8LA 1NCAH 1CGSH 5JIHA 1IL1B 1K6QH 3CFJB 1H3TA 1MCEA 2PXYD 4M8QB 2WIIA 4YHOL 3QDJA 5CP3A 1AGEA 2QSVA 4Z76B 1C5CL 3HZVA 4YXHH 5L7XL 2GSGA 2RCSL 5IVXB 4OBSA 1IBGH 3TF7C 1YMMA 4PJEA 3LMJL 5ILTH 4FQXB 5DJCB 1NGYA 2YUWA 3ALWA 2JKXA 5JZ7D 4PLOB 3NZHL 4F2MA 5T1KD 5KZCD 3BUTA 5DJ2A 1MIEH 2YC1A 5ESVA 3VFWB 4P3DB 1ITBB 4XAWL 4HC1A 1FBIH 2DMKA 1N2RA 1KPUA 3X12B 1QRND 5C0GA 4MNHA 1IGTA 3CFKA 1U8LA 1EIBA 2A6KB 4O2EA 4RAHA 1CF8L 2WUBH 3ARED 2WBJC 5HYEA 4WHTB 3W2DH 3PWPD 1ZV5A 5IBLC 4YC2B 5E2JA 4JLRA 4PJDA 1A9BB 5E2UL 4ZXBD 5T1KB 4EI6A 5KZCB 2BSTA 1VB9A 1Z3GH 5JLZB 3BDBA 2FL5A 4P3CH 4L4JA 1RHHA 2YR3A 1AD0B 4QHKJ 5DQ9B 1CBVH 4P2OA 3FONB 4KGJA 1U3HD 2Y07L 3ARGC 3AREB 4L4TD 1GGBL 4JPWH 2Z93A 5HI3C 3WFHB 4QWWD 3SJVD 2CK0H 1PY9A 3BW9A 5HDLA 5F7EL 1U36A 4ZXBB 4P2QD 4N1HB 4D9LL 4OLYH 3VWJC 5C2BL 3X3FH 3RWFA 3SE8L 1L7IH 4JDTH 3TWCL 2ZOLA 3PWJA 1VGEL 5CJOL 2C1PB 4NCDA 2E7LC 3T65A 1U3HB 5EOCL 3MODH 1PKQB 1MUJA 3ROOA 3NACL 4WRLA 1F02I 1AGCB 4FXLA 4X7DC 3K4ZA 5DZLA 4LPXA 3O41A 4XPFL 3O6MH 4N8CH 3MV7E 1YQVL 1NMBH 1R5WA 3SDXF 5HVWA 1A1OA 5IVNA 2V9QA 5JW4N 1Y6NR 3WJLA 3O6KH 4ODTL 4Q9BA 1CQYA 3BD3A 5I1CL 4U1JA 1JNHA 4HKJB 5E6IA 3L3DB 2HT3C 4PRPD 3E2HC 3VXRD 4BKLA 2XPGA 5D7KD 5IFHH 3BP5A 1R3HA 3VXQB 4CW1B 1E4XI 4L8BB 3BZFA 4KQ3H 5CEZH 4MJ5B 2IJ0C 5F6HI 5K9JL 4JFPB 3QPQC 1QG3A 4X6DB 1T5XB 2J6EH 4PRPB 1CWVA 5HHPB 4Y2DC 2HTKC 3EYSL 3A67H 4NQCD 1KYOJ 3H0TB 1S7TA 3WFDL 3EYOA 3V7AE 1V3LA 1IGCH 1P7HL 4XX1G 3S4SG 4RA3A 2AJZB 3IFLL 4OQ1A 1N6QL 4CVXA 3T0EA 1S8DA 1NFDB 3VDCA 4MCYA 3KPSE 4WFHE 3WJJC 2B5IB 2QR0A 4N0UE 1DQJA 3QH3A 3QUMB 2N7AA 3VXMD 3AB0B 3IDNA 5L6YL 4XNYL 4NQCB 1LO4H 3VFUB 2AJXL 1OAXH 1DTUA 5C0IB 1IGFH 4AYFA 1XF4A 2X2YA 4XMLL 5I76B 3G04A 3QI9C 4WW2F 1BJ1H 1IAKB 5I17A 4ZUWA 1Q9KB 2DBLH 1GH7A 3W39B 3RVUD 2Z31D 3VXUA 2YPLE 2X89A 4MDIA 3VXMB 4Q6YA 1P1ZB 4ZNEA 2CLVB 4K8RL 3GBML 4UNVA 5HHXL 5JHDA 4F33B 1HWGB 1AGBB 1IEBA 2OR9H 4V1DE 3PHSA 2ICWB 5IT2H 2W59A 5BXFA 3WNNA 4TSAL 3H9HB 4I3GA 4YHKH 5FOBB 2XZQH 2XQBH 4L8SC 4MWFA 3BXNB 3P73A 2Q6WA 3U7YH 4M6NH 3VFGL 2VISB 2X70B 1YECH 4KKCD 4NZRL 2PYEB 1FGVL 4WTZA 3VA2C 4RIRB 3OHXB 3BSZH 4CNIA 1QBAA 3EO0A 4Z5RA 2DBJA 1WFUA 5L2JA 3GI9L 4FTVA 3RA7H 3ULVH 2BXZA 1K5NA 4G9FA 2E8YA 2OZ4A 3MQIA 5GS1A 1P4BL 1T3FA 2Q3ZA 3PDOB 5GJTH 4P4RB 4APQC 3L3JB 2ZOKB 4ELKA 3IRZA 4PJ5D 3REVA 4EZMA 3BKML 3DTXA 2A9NH 2CO6B 4EN3A 4JRYA 3SDYL 3G6AA 2AEQH 4MA1B 3P40A 3VRLE 4M1DH 1S5IL 2DQUL 4S0SD 1AXTL 4LSPH 3VRJB 4GW1B 5AEAA 1BGXH 4Z8FL 2BMKA 1E6OL 2WM0A 4PJ5B 3C08L 2DLIA 4XWOC 2VERN 3FO1A 5GQBA 3LZFL 43C9B 3SOBL 3RY6A 2R2BB 2J8UE 1AGDA 1CQKA 2EDQA 1BIIB 4OD3L 4U1MB 3TBVB 4OQTL 5FOJA 3EOBB 3QEGL 1EO8L 4B7IA 4GXVH 3TJHD 4GT7A 3EOAA 1OP5H 5CS7A 4UTBL 3VG9B 4ZOBA 3HN3A 2GITB 3QQ4B 1Y18B 4R4BA 5D93C 3S9DB 1UM5L 4Z7WF 3GJFK 1VPOL 2W0FB 3C9NB 1INDH 1YYLH 2DLEA 4NP4H 5TGBA 3VW3L 1U8QA 1F4WH 5EBMA 1OM3L 1C12A 2DQDH 4GW4B 4POYA 1FVDA 1DN0A 3U82B 4LCCC 2CH8A 1FIGL 3QUKA 2XTJD 4XMKH 2W9LA 3QP3A 5JO5A 1FNAA 4MJIB 5C0AA 4MMZC 1T1YB 3QHZL 4PTUB 4PJHA 1F4XL 5D9SB 2YPKB 3S5LA 3TIDA 1HKFA 3MLWL 3U1SH 3PWVA 3BYYA 2BY1A 1MOEA 5CZVL 3DX7A 1PY4A 3MYZA 3KLHD 4RBPH 3QJFA 3PWLB 3UJJL 2BRRL 1FL3A 2IPKA 3ARGD 2WBJB 4HULB 1DBJL 1MCBA 1NANH 4DVBA 4QXTA 2C3WA 1YZZA 4BZYA 1TQCC 3D0LB 4OGYL 4F58L 1QQDA 5IG7B 4UT6H 5TE7L 3VWJD 5E9DB 3RU8L 1BPVA 2HLFC 4MQSB 1KPVA 2H32B 3MGTA 3DUUA 3VFSA 5F9JB 3V9FA 3CVHA 1T4KA 4Y5XA 3IU3A 1JTPA 4OT1L 3RUGE 4BZ2L 1QSEA 4OZGB 2ZSVB 4D0DB 5BJTA 1LK2A 3ARGB 3MBEC 4XCFL 3SQOH 3Q6GL 3SEPA 2NTFA 3DMMC 5DD5L 4OI9A 1X5FA 1XGYL 5GRUH 2Y72A 1OGTA 4LVEA 4U6TA 2EKSB 4QYOA 3TO2A 2B4CH 4OFPA 2EDEA 3VWJB 1HKLH 3ES6B 1I9RH 1A0QH 1MHHB 3RI5F 4XPAH 1CLYL 4LBEB 2DIJA 3BDYL 1NBYB 4I77H 4OB5L 5IVXE 1XZ0A 3MRRA 4PREB 4J3VA 4ZODA 4A6YA 1XR8B 2XN9D 5CKAA 2HT3D 2F8OA 4KHTH 3L5WB 5D6CA 5GS2H 1T83A 3DIFB 1DBAL 2MNUA 1TZIB 3F5WB 2ZKHH 5DEZA 3WNPA 3QUMH 5HY9B 1TZHB 1D5XB 5FYJU 5FO8B 4L3EB 1KJMA 1MCHA 5DT1H 3U2SA 4P2RA 4MNQD 2GAZB 1T04B 1I7ZB 3E2HB 43CAA 3CVHL 2DQFB 1NUNB 1GYAA 2CQVA 3H3PL 5IW6A 2BVYA 3WHXA 5J7CC 1NCCL 1R3KA 2BK8A 5DUBA 5FYLD 4FOMA 5JPMA 5FDWB 4C83A 1NMCB 3QNXA 1MCSA 3SKMB 1QRNE 4WNQA 4OCSH 4KTEH 3GJEA 4AMKH 2YA1A 4Y2DB 5B3NA 4KK6C 3RVWC 5T1LA 3PWPE 1NJ9A 4QTHB 5T5FL 4JRXD 1TETH 3K1DA 4OD2B 2Y36H 3HZYA 3P4MB 2V5MA 1NH6A 1QFWH 4I0PD 1ZSDA 3RGVA 3BN9D 3L9RB 2QQLL 3Q5YA 4JN1H 3GRWL 4NKDA 5E00B 3ZYZA 1CD8A 2FATL 1D5BB 4L4TE 2P5EA 1WBXB 1CIDA 1R0AL 2J8HA 3WYRA 3HAEG 4JRXB 4XNMA 2V2TA 3BEWA 1E0OB 4P2QE 4URTB 3TA3C 2VZSA 3NH7H 1G9NC 5EUKA 5H94B 3PP3K 5ESQB 3P4NA 1SMAA 1QLRA 3K81A 2YRZA 2OTPA 1D6EA 3JUZA 4FNLL 3MOQA 1XT5A 4YIQB 3PWNA 4H26A 2P7TB 1XCQB 3B6SB 2YBRA 4MXVE 3H9SA 4CU6A 2R4RL 1JGLH 3MLSH 2VXSL 1BQHG 2W9EH 3VG0H 5GGSB 3ARYA 4X6CB 3NGBB 3OKLA 1NGQH 3SCMC 1MAML 1HK6A 3IJYB 2MKLC 1YEJH 4GQ9L 5ICXA 3B2UC 5FUOH 4QRRA 3QCUH 4HWBA 4PRPE 4PJXA 2CGRH 3G5ZB 1NSNL 2YD6A 3VXRE 4NOFA 2F9BT 2VQTA 1DANT 1TJGH 5DUPH 1I4FA 4M1GL 3ULSA 1KIPA 5KJRL 2EYSB 4OLZH 4ZPTA 5DO2C 4J3XA 1QR1B 1NFDE 2PO6A 4MJ4A 4Y1AA 1EDQA 1S7VA 2A6JA 5DI8B 2Y06L 1HHGB 5GGSY 3L7FA 3HKFA 1YEIH 2XWBA 4NQCE 3FT3A 3B5HA 3HE7D 2SEBB 3SY0B 3SKJL 5A40E 1WJ3A 4LGSB 4MAYC 3OV6A 3RX7A 5HPMA 4O5LH 3QUYA 4KY1H 2ATPB 3VXME 1KEGH 5HYQA 1PLGL 1JYVA 3VI3E 5TQ2L 2W38A 3V2AR 5KSAA 3L5JA 3V5KB 1JZ7A 3VGGA 2YN5A 3QG7L 3LEVL 4N0RA 4XNQA 3NMEA 2D7TH 2VIRA 5FHBL 1I8KA 1G0YR 5AZ2H 4DOHB 4HIXH 5D93B 3PGDA 1NAKL 4XC3H 5D72L 4IOIA 3OKMA 4FFZH 3T3ME 4R26H 1MAJA 1N3NB 1ZHKA 2R0ZH 5C09A 5HI5C 3WE6A 1QLEH 1CXEA 1HHHA 3HI1A 2P8MB 2H32H 2AEPL 1RJYB 4UT9L 2ATKB 4RAVB 3OZ9H 5JHLL 4LCCB 4JJHA 3AROA 1CGXA 1DL7H 3CFBA 4O9HH 5F1KC 3T4YA 3ULVF 3BFOA 4H0HB 3AGVA 4OLWL 4KMTH 1YY9C 5DC0A 1U8JA 1JNLL 2ED7A 5F1SA 4JZJB 1I8IA 3D3VD 1C5BH 3CIQA 4LSTL 3QDMB 1I8LC 3I50H 3DHJA 1YUHA 5D8JL 5IHZB 4NFCA 2NY1C 4KJYB 4PJ5E 4CADB 2HLFD 5SV3A 1VCAA 2AGJL 1NMAL 3VE0A 1JGEB 3VMOA 2ZUUA 3G5XB 3D3VB 3JV6A 5TE6L 4JFDD 4OM1H 3QT2A 4D3CL 1TQCB 4KRPC 1UH2A 4A2LA 4K7PX 5FA4B 2G9HB 4KU1A 4YFLF 4NUGL 4N9GA 2YPVL 3BZEA 5H2BB 3ESVF 1RK1B 5GGVY 2VITA 4KK9C 1WSST 2AJ3B 3MBEB 1JF6A 3D9AL 3WUWA 3O3BB 5DJ8A 1BJMA 1AO7B 1C8PA 4AL8L 3VDBA 3DV4B 3GSUB 3PQYA 2W0LA 1ZHNB 1EMTL 4O58L 1BOGB 4KVCH 3JVGA 1QKZL 1UACH 1VGKB 1X7QA 4P2OC 5IMMA 2FHCA 3OXRA 2AKRA 5GGTH 4WU5A 3I3DA 5DFVD 2QQNL 3LKNA 1A14H 3VFPB 1V7NH 4UIKL 4MJIE 1KCRH 5DDHB 4ZUUA 4QT5A 3ZE0F 4PJFF 2JJWA 3IDGB 3L3HB 4L4VB 5FYLH 4EIZC 3THML 4PGEA 3ARSA 2MQCA 5IESL 4HUNB 3QIUD 3P11H 4E41A 4NKQB 3KPPA 5A2FA 3WSQH 2J88H 1CICD 1PYWB 1QVOB 5I1EL 1EERB 3ZKXC 4L1DA 2X40A 3HUJB 4NUJA 1J05B 4K7FA 4P23D 4HGWA 3FTGA 5GJSH 4HS3A 5IGXH 3FFCA 1N5AB 1IAMA 3DO3A 1TJHH 3EJYC 3PE9A 3QIUB 1Q72H 3BWAB 2HKFL 3WJLC 5E08L 3HPJA 1X5ZA 5CAYB 4WI6A 4U1GC 1UQSA 1X3DA 2HVKA 2VRAA 1CICB 2APTA 1EGJL 5DS8B 5GSRB 3E8UL 3UBXG 4OZGE 4NO5A 3FO0L 4W81A 3GNML 4LLDB 1RIHL 4P23B 4UNTA 2LABA 3MLRL 3UO1H 3VA6A 2X7LA 3IRPX 1Q94B 1UENA 3TA3D 4P9MH 1EZVY 1L6ZA 1PG7H 2AJYL 2QSTA 4JPKH 2H9GB 2D31B 4YFLI 3VH8B 3DX8B 4ZFZA 1JTTA 1JZ3A 2DWEB 1UYWL 4WEUD 1EO7A 1YPZF 2X4NB 4DKEH 3RGHA 2FHFA 5SX5H 4X6DF 4JKWA 1JHKH 3TA3B 1WBZA 5EOTB 3BEVB 4LNVA 5IB4A 3SDAA 4ZD3H 4GSDH 1H5BA 4M02A 5EBGA 1U3ZA 4WUUA 3LVEA 4OZFB 3T0EC 1M6OB 4NO3A 5JXED 1QSFB 1II4E 1NCTA 1TVHA 2BNQA 2Q1EA 4M5ZH 2DAVA 2R23B 1FVEA 1YEDB 1PFCA 4P59L 3PHOA 1T7VA 3HFML 2XN9E 3KYOA 5T3XL 2IFFH 3CDFA 5GIRB 3T2OA 1NAML 1Q8MA 3GB7A 4Y4HD 3FQTA 2QQKL 3MLZH 5EOCJ 5HGDB 3GI8L 2OL3A 5IHUH 4ODHL 1GHFH 3PDDA 4OGXL 4PG9B 1CDCA 1N7MH 4XRCA 5ALBH 3SCMB 3WFCH 1T5WB 3D6GA 4MD4A 4GG6F 2HH0H 1A5FL 3QRGL 4MNQE 1SYSA 1AI1L 1BQLH 3D39D 2APFA 4BQ8A 3LHPL 2P8PB 3BX7C 5MEQA 5TFSH 4UV7H 4X6EA 4G6AD 3LKRA 3TN0D 4IHOB 3D85A 5FCUH 5GRJH 4NCC2 2YHGA 5D2NE 3O8XD 3RY4A 3BGAA 3LV3A 2FJHA 5FYLE 5E8NA 2EDJA 4XHQA 3ARQA 5DK2B 4X9HA 2NLJA 2AQ2A 1C5DB 3WDIA 2CLRA 3UPAA 1CTNA 3CPLA 5ENWA 1T21B 4JKPL 4EUPA 4JRXE 4PJAB 3U0WH 1BFSA 4LCYB 4WW1A 2CXKA 3BGFC 4LCUA 3I6GB 3IFNH 3O11A 1CE6B 5D71L 4PY7B 5GS1C 3IJHB 4KUZL 5BRZD 1IKFH 1A1NB 3QEQD 4LCIH 4R2GC 2PNDA 2G60H 3F58L 5D1XA 2OL3L 1A3QA 2D3VA 1KTLB 1Z0NA 3QIWD 4EN3C 3GMNA 5GGVH 3IKCB 2X41A 4FQCH 2C1OA 4HWUA 4YH6A 5DJXB 4GKNB 4PRBA 5HI5D 1KTRL 4YXKH 3IVKB 3QEQB 1S7QB 5L9DH 4JREB 3ZTNH 2RFXA 4HG4J 5HGAA 4G6ML 4KJWC 4MDJB 1HCFX 2ADGA 2XZCL 3TT1H 1I7TA 3S3PA 1PBYA 3RY6C 4BFIA 4WDIA 5H8DA 3VFVB 1GCFA 4KTDL 4NNXA 1LP9F 3X13B 4JZOB 2Q8BH 3EYUL 4CN6A 1T03L 4HXBL 1KN4H 4NQXB 15C8H 4X7TA 1I75A 3WEXA 1AIFA 4TVPL 3QDGA 4C56B 1N8ZB 5C0BA 3IFOA 4U1LA 4M7KH 3D2UA 3F6IA 3QA3B 3DX6B 3OPZL 5HYSA 5T1MA 2ZUXA 3QO1A 2C4XA 4AH2B 3JWDL 5I8CB 2ICES 1MI5A 4OLEA 1QLFB 2WAHA 5DURB 3KXFA 4P4KA 4L9LA 3QCVH 2WIIB 2NY1B 3NCBB 5A16A 3UPRA 4XC1L 2V5RA 4HIJB 5I1DA 4L3CA 4TTDD 1KELL 1TLKA 5FK9A 4Z18A 1VA9A 3MLXH 4KK9D 4ZG1A 2A0LD 5B22A 3KGRA 4TQEL 1ZK9A 1S7SB 4NRYA 1QFWI 1T89A 3V5DA 4X7EC 4JY4B 4LPWA 1YEFH 4LCWA 4BSJA 3DLQR 3JTTA 5ESVB 1LHZA 3G5YA 3EDFA 4ELMA 1N26A 1NFIA 2NY4C 1IGTB 1FIEA 4MNHB 4DOHE 2RB8A 5I30L 4OCXL 2JB5H 3SE3A 1U8LB 5IOPB 4O2EB 4KAQL 3O2VL 2W0PA 4Y4FA 4I0CC 4IRSD 5HYJA 2VH5H 5E8OB 4LNRA 5SWSB 5IFAL 4D0BB 1U6AL 4HJGA 1RZJL 4JLRB 1A9EA 4DAGH 1TVDA 5DVOA 3EO9H 3SBWA 2MPAH 1IARB 2FL5B 4HKBA 5B38G 3U36A 5GRXG 3IU4H 3HNTL 5ID1A 4OJFH 4W6WB 5HHNA 4Y5XC 2AXJA 4QHUB 4XXDA 2H3NA 3FQXA 4IRSB 2ZPKH 2NY6D 5CBAA 1D5ZA 3NFNA 2H1PL 1UWGL 1RU9L 1NBQA 3RWCA 5T3ZL 4AEIL 5CMAB 1TENA 2JJVA 5FYKL 3O81A 3QDME 2YUXA 2LAAA 2ADFH 3HRZA 3U9PH 4BQBA 3T77A 4DN4L 4M1CD 2ZOLB 1MFDL 2H2SD 1QFHA 2XKUA 5BV7L 5I1HH 2BSRB 5CINL 3CCHA 1G9NH 1MJ7H 3ROOB 3ZKXB 1SM3H 2FLBT 3D3VE 4TULH 4C55A 4LMQE 1T83C 4KRLB 4XBPB 3GHBH 3O41B 4OZFH 5DEGA 1DE4B 5BZWA 3G5VB 4K2UL 2NY3D 4K8RD 1S78D 4XWGH 1WCBB 3B9KA 5I2IA 5FGBA 5IMOB 4IRZL 3MOAH 1WC7B 2D4DA 3OB0K 3Q1SL 4ZUSA 1J1PH 1UJ3A 5J6GB 5CILH 2VXVL 2OXHA 3O2DA 3MJ7A 2HRPH 5C8JA 1DBBH 4NHCH 4IIQA 4RGND 4MVBD 4YWGL 5F9AC 1R3HB 4YE4H 2EH7L 3N1GC 2VKWA 4TOYL 4WFFE 3QSKB 5KANG 3MLVL 4JQVA 4OGAC 1FNSL 2IG2H 1F6AA 2PW1B 1T0MA 4M43H 4YHML 1CLCA 5IB1A 3D18B 3BVNB 3LRHA 2BNUB 5DA4A 4ZO9A 3GSWA 3OGOE 1RJCA 1HN1A 1UG9A 3OKYA 4J8RA 4L4VE 3TYFA 1OTUD 5I15L 4PRAB 1SJEB 1GGYA 5HGBA 4XCNA 2I60H 1WZKA 2AXGA 3RP1A 3RGVC 5FGSA 3UTSD 3MRQB 5I9QC 3QH3B 4OCYL 1TMCB 1ULVA 1KCVH 5F9OH 4G6KL 4XP6H 2EXWD 4JFXA 3WDHA 4BK5A 3GSVA 2DI8A 2NY7L 1ETZA 3S96B 4H88L 1IFHL 1R3JB 5I17B 4KI1A 1UM6H 1U8PB 2ARJQ 1A6VL 1I8MB 1JWSA 4DGIL 4KRMB 3O2DL 3UTSB 3MR9A 3VXUB 3RZCD 1H0DA 2DLFL 5FYJL 4YHOH 2ORBL 4CAGA 1C5CH 1IZJA 1WT5C 4NRXA 5JHDB 1X4ZA 2UWEF 2FO4A 5L7XH 2RCSH 3QWOA 1IEBB 3ARFA 3LMJH 4KXZH 3N9GL 4GFTB 3PJSA 5DJ6B 1JN6B 4MWFB 3RZCB 3H42L 2MOVA 3NZHH 4X6CF 4XAWH 1T6WA 2B1AL 3RAJH 1DDHB 1J11A 1A6TA 2ZUYA 2JCCA 4FTVB 4UBDC 4Z7WE 1CF8H 1FLRL 4LVHC 3BGFB 2BOCA 1A6ZB 5C0CD 5KG9B 2HFEB 4HS6B 4KGLA 4BUGA 5E2UH 2Z92A 4M6OL 1QHPA 3DTXB 4KJWD 4PRHD 6FABL 5GRZA 3S8WA 3FRPA 2XY2A 1G7LA 1M7DB 2OSLA 5DQJA 4ZS6D 5EWIL 2FSEA 4JEGB 3BOVA 2LU3A 4NT6B 3ZMRA 5I73C 2Y07H 1CGYA 1GGBH 1I1YA 3TFKC 1BF2A 5C0CB 3DO7B 5CP3H 4MGXA 5DGRA 5F7EH 3NTCL 5D4QA 4D9LH 4JO1L 3QUYC 5C2BH 2QQQA 3LCYA 3FO1B 3SE8H 4PRHB 2DM3A 3TWCH 4OKVA 5C07A 2EIEA 1QFUL 2H2PC 1VGEH 4PLJD 5CJOH 3EYQC 5FKAA 4XTRD 5EOCH 5KSAC 2XXMB 4Z7NE 2DKMA 2Y5TA 1G7PA 3TT3L 2X4TB 3NACH 1MQKL 1Q9LA 4LSQL 4G6JL 1A6WL 3BP6B 2C4FU 1CI5A 5BQ7B 3P0GB 3EOAB 4XPFH 1VENA 3U30C 4R0LA 1JNJA 1YQVH 3O6FA 4R4BB 2B7DT 3KPMB 2IWGA 1BVKB 3CMOL 2Q86A 3P0YL 4PJ7A 4ODTH 1QA9A 5FUCE 5I1CH 4IS6A 1BFOB 1YEKL 1TITA 4LKXB 3C5ZA 1U8QB 1CGTA 2XFXA 1FNHA 4FQHA 1DN0B 3W0WA 5A43C 1A7BA 5ADOL 3QUKB 5HVGB 3LSOA 4PUBL 2HTLC 4Q6IC 3UPCA 3UZEA 2AV1A 2EH8L 1QYGL 1CDUA 3EYSH 4MX7B 5C7XL 3RWGA 3RRQA 3DJ9A 5BRZE 3PWVB 4FQPA 1NL0L 5D1QC 4Q97A 3QEQE 3U4EA 35C8L 3DX7B 1BLNA 1YNKL 3WFDH 1OT1A 3C6LA 4XMPL 4WY7L 3IFLH 2NY4B 3TM6A 1N6QH 2FECI 3WXVL 1T22B 3IS1X 3RWJA 3RHWF 1FL3B 3ZE1F 4ESKA 5IFJA 5E8EA 1NDMB 3P77B 4S1SL 5L6YH 4XNYH 1JPGB 4B0MM 2AJXH 1QQDB 3RVXD 5MEND 4HCRL 3U6RA 1HH9A 2VMFA 4WTXA 4BQ6A 1DVFD 2GJJA 1ZLVH 2EDRA 3HG1B 4XMLH 5DEFA 3MGTB 3GMMB 3CVHB 3UDWA 4Y5XB 1XAUA 3BHBB 5BJTB 1LK2B 5D2LB 1IM3B 3MLTA 1C16A 2NTFB 4OF8A 3B83A 4YHIB 4XBGA 4AM0B 3P4LA 2H26A 4K8RH 4QYOB 4BSWA 5HHXH 5B4MC 2KZ1B 2OLDA 4PRID 1XGTA 4LSRL 5IEKA 3JVGC 5DJDA 3FOMA 4TSAH 1CGUA 2BVPA 2Z8RA 4WWKA 2OJZL 2XWTA 3VFGH 5JW4M 5E70A 3M17B 4NZRH 1FGVH 3DROA 4MQ7B 5CWSA 5DZOA 4HMEA 5D5MA 4C54A 4MSWA 4HJ0D 3IDIA 1W72A 5TE4L 3GI9H 2CJUL 3FB7A 1UWEL 4Q74A 5GGRB 2YD5A 5CUSL 1KJMB 1VEMA 4OGAD 3U2SB 4P2RB 1P4BH 3GMQB 3NIGF 4LIQE 1HYSC 1HSAB 4NC2B 3GO1L 4MNGB 1Q0YH 5FAAA 1G7MB 1JE6A 2NQCA 3BKMH 4PGZA 2XWJA 3H9YA 3SDYH 4U6YB 3GM0A 5SWSE 3N0PB 3L3KB 3MSPA 3RNKA 3QAZC 3HUJF 3WHXB 1F3RB 2Q8AL 1S5IH 2YD9A 2DQUH 4C83B 5SV4A 1P7KA 4WNQB 2X4QB 4DTGL 4Z8FH 1E6OH 2YWZA 3TCLA 2WP3O 1WF5A 5E99L 5EPMA 3QULB 3C08H 3CDCA 1NJ9B 3RVTC 1PZUB 3LZFH 2DDQL 2VL4A 3SOBH 5E5UB 3RWHA 2XA8L 1IGYA 4OAWA 3ZYOA 4EVNB 1U58B 4LMQI 4OD3H 1ZSDB 1MFEL 1XF5A 4X83A 4OQTH 3QEGH 3MV11 4ZDHA 4B7LA 4GRWB 4JE4B 2AK4D 5I9QB 1I1AC 4PB9L 4DVRL 2A6IA 1I1RA 3JV0A 4UTBH 3F62A 4WUKH 2UZYB 4J4PA 2V2TB 3BEWB 5I16B 5KN5A 1CGWA 1VPOH 2CMRL 4JO4L 1ODAA 4C57C 1B3JA 3OB8A 5IROA 1H5BC 3NIFF 1XF2A 3VW3H 3V0VA 2WZPD 4LLMB 3RFZC 1U8MA 1OM3H 1N4XL 1WAAF 4OFVA 2L7UA 3PWNB 4D9RD 3QJHA 4PBVC 1PKOA 2F5BL 5I1LB 4HK0B 5KS9A 4PJBA 5KANI 3EO1A 4E5XB 1FIGH 4NO2A 4N8VA 5GRVK 2JELL 5BCAA 1SJHB 4EXKA 4DJMA 1T1ZA 4K71C 2OMBA 3HNVL 4QHLA 1SVZA 1GZQB 1CFQA 4HUUB 1F4XH 4X9GA 5INCB 3OKLB 3RTQA 1VESA 2E27L 5ICXB 3MLWH 4LL9A 1T2QL 4M3KB 4QRRB 5CZVH 1UVQA 4YPGA 1T1WA 3BO8B 3UJJH 5K9QG 3PL6A 4G8FA 1F11A 2BRRH 4I4WA 1EVUA 2VC2L 1I4FB 3BIKB 2V2XA 4LVHB 1DBJH 1KIPB 1AHWA 5FDYA 4ZPTB 2WNGA 4OFDA 4OGYH 4F58H 4NHUB 2ZP0T 3RBSA 4Y1AB 5TE7H 3RU8H 3WLBB 1TNMA 1WFNA 1MLBB 3IKKA 5LVEA 3D25A 4X8XA 3UYRL 4UDTA 5ECJE 5SX4I 3TJEH 3EYQD 4OT1H 4BZ2H 4NRZA 5I73B 3GK8L 4OKDA 2I07A 4IOSD 4XCFH 4P46A 3Q6GH 3ZHLA 1AKJA 3KPNB 4FMKA 4XVSL 5DD5H 3T4AA 5C08D 4HLJA 1XGYH 3GSXB 4KROC 4NNPL 3AY4C 4XCEA 3H6JA 4R6UA 5ACMA 1EAJA 3TIEB 4GKSB 3HLAB 5HPMB 4FRWA 3UTSE 1MPAL 3QUYB 3JWDC 4QOKA 3T2PA 1FV1B 3K3QA 1CLYH 2QKIA 2YXMA 3BDYH 5IW3A 2EYTB 4OB5H 4UV4L 1PVHA 5C08B 3V4VL 1B2WL 1F8TL 1XGRB 3VCLB 1AP2A 1BJ8A 4XNQB 2NW2A 3VMNA 4EBQL 1DBAH 3GIVB 1I8KB 3U30B 2QJDA 3R06A 3QRFM 5I66A 3ARBC 1TTFA 3PGDB 2R0LL 4WTZG 1CDBA 1P2CA 4IOIB 3OKMB 3EYFA 2A9ML 3E6HA 3LY6A 3I02B 2EDYA 1ZHKB 5HD8C 1LO3L 1N6UA 1DP0A 4XVTL 3WE6B 3EIFA 1FO0L 3HI1B 3EHBC 4H8WL 4WHDA 4D8PA 3KDMA 3CVHH 3ZYJA 4XVUD 5D1QD 4ISVA 4D94A 5DK3A 4GKOA 2Z4QA 1NCCH 3T4YB 1RZJC 5CLWA 2HVJA 5GS0C 3MO1A 5DHYB 4Q6IB 4F8TA 2X1XR 1KYOK 4LDEB 3K4AA 5C0CE 2VUYA 4IMKC 4X0KA 3QWRA 4JVPA 3TEUA 3GMPB 4L9LC 5T5FH 5D1QB 2X4SA 3G9AB 5GGUB 4KWUA 3MRPA 4PRHE 3T08A 4K7PL 4F7EA 2QQLH 4X6BA 3GRWH 1OAYL 2W07A 3FAWA 3U9UB 2LAGB 2VABA 3QDAA 3TCXA 2HT2C 1R0AH 1IQDB 5JIKA 3D69B 3NABL 4FQQA 1V3JA 4KI5D 5BV7C 4PJEF 5DD6A 2R1WA 1D5MB 5DD1L 3W9DB 3BZEB 1NDGB 4Y0GA 5J56B 5BOPA 4EDXA 4KKLD 3MCKB 4Z7QF 1GZPB 3SE3C 1IGML 8CGTA 4FXGB 1T2XA 4FNLH 4M6AA 5KW9L 5DJ8B 5HXMA 2JK5A 1X5YA 5J1AA 1IGJB 2R29L 3CFEB 3FHQA 2R4RH 4HT1L 4LPTA 5C0FB 2VXSH 4GBXA 4PJDF 3AS1A 4ODXA 1CDHA 5IMMB 4S1RL 2AKRB 4GKZA 4WU5B 1MAMH 4HUVB 4LLWA 4GQ9H 4EDWL 1U0QA 4ZUUB 4QT5B 3S5LG 3QHFL 4NNYA 1RZ8A 4PJIB 1NSNH 2VDOL 2EE6A 3MRHB 1H3VA 1S7UA 2EKJA 1GGIL 5JDSA 1CDYA 4M1GH 1FFPA 4Q9CA 2Z91A 5FF6A 4O00A 5KJRH 2PF6A 1FNFA 3MV7A 3FJTA 4U2ZA 3LN4B 2NY0C 5B39A 3ARUA 3MRGB 1ONQB 4HIIB 5KVDL 1BF8A 3MA9L 3QCTL 1BM3L 1CS6A 3VXNA 3LKOA 1Z9MA 4EI5D 3ET9F 1WWBX 3WS3B 1NAMB 3HPJB 1G0DA 3HG1E 2X9XA 3SKJH 3B9KC 2DMCA 1ZTXH 4V2CB 1UJ3C 4P5TD 2VLKD 1PLGH 4IIQC 5MENE 5TQ2H 3FFDA 4BJLA 1F3JA 4GMTL 3FQUA 5C0JA 1JZ2A 1JCKA 4PRDA 1S9YB 4Z7OE 2A73B 4HWBH 1QBLL 3OXSA 3QG7H 4AIZB 4QY8A 3LEVH 4ZFZB 1I1AB 5IVOA 3NPZB 4HKZB 5FHBH 3T04D 4JAMB 1M05A 5F8RC 3KPSA 3KS0H 4GRLC 5TH2B 3DX9B 1NAKH 3M1BA 4FFWD 4N0UA 2CLZA 5D72H 2HFGL 5DHVB 3ZE2F 5DUML 1ZS8B 5JXAL 4PRIE 5IB4B 2EDFA 1MRDL 4H25A 1H5BB 4FP8L 2QADD 4WU7B 2AEPH 4QRQA 3BH9B 4MD5A 4UT9H 4NQED 1TVHB 5KVGL 1FVEB 4MNGE 5F9WC 2GYSA 3PHOB 5JHLH 2YPLA 5GZOD 3BQUD 5F7HA 2EEDA 4RX4D 1U41A 3U4BL 5JIPA 1QFOA 1MJJA 2OL3B 2VN7A 4K71B 1DSFL 4V1DA 2IPUG 2QADB 1JGVL 2Y4SA 3LRGA 2MKWA 3P3YA 4LSTH 5DVKA 4NQEB 3NFPB 4HX1B 5D8JH 3RJDA 4Q58C 3S34L 5MEQB 1JL8A 5EO1B 4Y16C 2AGJH 1NMAH 3LKRB 2BVEA 3KPRD 4TVPD 3ARFC 1W0YT 2Y6SC 2BCKB 12E8L 2DQJL 2IPTL 1AXSB 2PW2A 1A6AA 5TE6H 1P5UA 2BX5A 4I1NB 4D3CH 1BQUA 4F15C 3OAYH 5I8OL 1M4KA 2GTWA 2NLJB 4GRWE 2A2QT 1VFAA 4NUGH 1YY8B 3A6CL 3CPLB 3KPRB 5JOEA 1RJLB 2R9HC 3D9AH 2VLLA 4GQPH 1FNGA 3ZL4L 2AEIT 4KROB 3GIZL 3DBXB 4HFUL 5BVJA 4NQSB 3KPLA 5F1IA 1LE5B 3RVVD 4O58H 1EMTH 1FYTA 2ED8A 3ARBD 2MJWA 4LHUD 5F7DB 3CU1A 4J6RL 2LTQC 2QQNH 1MHCA 3JTSB 4BSVB 5DJZA 4UIKH 2J6EA 1FGNL 3MRKA 4OF3A 4NO0D 2WBWB 5A2IH 2NY2D 5K9QI 3MLUL 4U7MA 3THMH 2BZDA 2ARWA 2DS4A 4ZUVB 2FEDD 4D9RE 2BNRD 1B6DA 2EO9A 3ARBB 3H7BA 5ID0B 5IESH 1EO5A 4LHUB 1I7TB 4I13B 2J8OA 1VADA 2EZ0C 3EDKA 4JQIL 3L5IA 5I1EH 3QUZA 2VWEE 3VWKA 4JFQB 5JQHC 3FHAA 3KJ4C 4P3WA 4Y5YA 1WFOA 2EXYD 2BNRB 4YDVA 1MCWW 4R0LC 5C0BB 5CKGA 4U1LB 3O6FC 4WO4A 3D2UB 5H35A 2LQRA 2HKFH 3RWDB 5E08H 5T3ZD 3LPFA 1ZLWH 3QO1B 1EGJH 3E8UH 2ITDB 1G6RL 2OMNA 3C5ZC 3WHE1 1FFOB 1HQRB 3HC0A 4JFOA 3FO0H 4FQJL 3GNMH 1RIHH 1HCVA 2FIRT 3MLRH 5KSUB 4LVOC 2PUQT 3QPXL 4WIQA 4L9LB 3RPIA 2XQYG 1ORQA 4UINL 5I1DB 3VFTB 1M7IB 2AJYH 1XFPA 1AC6A 5FO9B 3BZ4A 5FK9B 1P6FA 1MFCL 3DVNB 4GAJL 4NRYB 4JHAL 1U8OA 1UYWH 3NVQA 4LPYA 5GGQL 5C08E 5BV7B 3JTTB 2NW3A 2CRIA 4OZHB 4PJHF 4POUB 3ZKNC 5KSBE 1X9QA 3C6LC 3GMLA 4XCYB 1NUDA 2Q7NA 3AS2A 2FX9L 3OKDA 4HZLB 3ZT7A 1XH3B 2I9LB 3G08B 3MV8D 3RUGA 4P59H 2VZ1A 3HFMH 3MRMA 4LNRB 4KVNL 5T3XH 1A9EB 2EDNA 3LD8C 2C4FT 2E6PA 2QQKH 3GI8H 3V6ZA 4G43A 4ODHH 2YD4A 5ID1B 5F96L 4OGXH 4M8QA 5HHNB 1DQDL 4XT1C 4RDQG 2ZG3A 4Z76A 1A5FH 3MX0A 2HRLA 3QRGH 3FQXB 3KWWB 3BPOC 1AI1H 4ZQKB 1D5ZB 3RJQB 5IVXA 5JNYB 4JHBA 1IEAA 1QR4A 4FQXA 5DJCA 2A74A 3WIIL 3F12B 2PXYA 3BKJL 2NY0B 3VFWA 4P3DA 1SBSL 2OYPA 3T8XA 4WWKC 5DHVH 2EDWA 3MXVL 3ZKMC 3BPNC 3X12A 2UYLB 4WCYL 5CP7B 2A6KA 2VDKL 3UTQB 1ZVHA 4KZEL 1MY7A 4JKPH 4P57B 4WHTA 4LSVL 5FYJD 5H37G 5BZWB 5DSCB 2K7QA 2I5YL 1A9BA 1QP1A 2X44D 5T1KA 5D71H 1D3CA 3B9KB 1YEGL 4KUZH 5JLZA 2E9BA 4XI5C 1JRHI 1AD0A 1QRNA 1SMOA 3F58H 4ZUSB 3WUWG 1UJ3B 2OL3H 3FONA 4TYUA 3WNOA 2LFGA 3EJZC 5J6HB 2X4OB 4GRLD 5C8JB 3AREA 3DETC 3W9EB 1L9NA 4KI5E 4IIQB 3WFHA 3PWPA 5FA3A 5FHAL 2GSIA 4ZXBA 4HDIB 1QZ1A 1NGZB 3T2NH 1T0MB 2JB6A 4NBYB 4H0GA 2C1PA 2IFGA 4GRLB 5M94B 1U3HA 1CZ8L 4G6MH 1TCRB 4L4TA 3QZWA 3U4AA 1TDQA 5TF1L 2XZCH 1MCWM 3LEXB 1R3LB 5AD0B 4O2FB 4PJIE 1I7UB 3MGOB 4KTDH 4P2QA 5E2VL 1AGCA 2IAMD 4YHNB 5CSZA 2AXGB 1EVTC 4E42A 3EYUH 1T03H 4HXBH 1WUNT 3QIBD 4MCZB 4TVPH 3AU1B 1X5IA 2GT9B 4J4PC 3V79C 5HGHB 1G84A 1FG9C 1YA5A 3OPZH 1QBML 3NCFB 3L3DA 2IAMB 1CFSB 1KIRA 2Y6SD 3JWDH 1OAUH 3EDDA 3QB7C 3MR9B 3VXQA 3T0BA 4CW1A 2AAVA 2O61B 1EBAA 4JFPA 4XC1H 4ETYA 1JK8A 1VSCA 1NEZA 1FYHB 2EEAA 1T5XA 4Y16B 1KELH 3QWOB 4PRPA 1F13A 4NFDA 4NQDD 5HHPA 3NBNA 3ARFB 4KC3B 3VXRA 5C0RL 3GSQB 3KLDA 4TQEH 5EZLB 4G8EB 3RTQC 3H0TA 4OF6A 3PJSB 2NXZD 3O3EA 4F15B 5DA0B 2AJZA 3UTTB 5JW3L 4I9WE 1BBJB 1NFDA 4NQDB 1KCLA 1CU4L 2VLKE 4KKBD 5I30H 3PL6C 4OCXH 3CFDB 3QUMA 4KAQH 4PJXF 7FABL 3HNSL 3O2VH 3A6OA 4NQCA 2BOCB 2VLJD 3VXSD 5F6HJ 2NXZB 5IFAH 3DVGB 1U6AH 1RZJH 4G80B 5GZNC 2GEEA 4X5LA 2Z92B 4NKMB 1Z9LA 5E0QA 3T0AA 1XF1A 1Q9KA 1KXQE 4O02H 1FC1A 2YWYA 2FWOB 4JZNB 3W39A 3HNTH 2P24B 4PJ9D 2P5WD 1IILE 3VXMA 5DQJB 2O5XL 1P1ZA 1HI6A 3L3IA 2VLJB 4P46C 3VXSB 1KOAA 1CT8B 1ZA6B 4F33A 1AGBA 1UWGH 1RU9H 2ICWA 5T3ZH 3QXUA 4AEIH 3CD4A 5FYKH 3LS5L 1WQVT 3H9HA 4NQEE 4N0FB 5EIIB 3PV6B 3MFFB 1LGVA 4JFEB 4DN4H 2Z31A 3BXNA 2QSQA 4PJ9B 1MFDH 3B4NA 2VISA 5FKAB 1DZBA 2L7JA 5A3IC 3LIZL 5BV7H 4CGTA 3RIFF 2J3SA 2J5LC 2Y5TB 4WGVB 4X4YB 4RIRA 5MHSD 2BVOA 4XB7A 4G8GB 5J3HC 5LWYL 3LQZB 5EDXA 1NKRA 4Z7UB 4OLXL 5E6ID 4JM2C 3OKKB 3O6FB 1WBYB 2BVUA 1HWHB 3PDOA 4K2UH 1H3WM 4P4RA 5FKPA 4OFYA 5LGHL 1IKNA 2EIZB 3IAQA 4EUPG 2IEPA 1QA9B 3KPRE 4IRZH 4KJPD 4GRMA 1FZMB 4TVPE 1F2QA 3C5ZB 3X14B 3Q1SH 5IMLB 2WK2A 2ADJA 1OL0A 4PPTA 3MC0A 2VXVH 1YJDL 4X4ME 4P5MB 4FQHB 4UILL 1U2HA 4GW1A 4YWGH 2PTVA 4Z78B 4KH2A 2EH7H 4TOYH 6CGTA 1CFNB 1S7RA 3MLVH 4PJ5A 1FNSH 1T0NA 4YHMH 4KK8D 3OQ3B 1I3RA 2AV1B 1L9MA 5IM7A 1RUPL 2CIIB 3TZVD 4RDQF 3Q2CA 1WZLA 3RWGB 2R2BA 3OGCB 1SBBA 1RMFL 3ULUL 4K3JL 2PN5A 3U4EB 1BIIA 4HMCA 1DBKL 5I15H 1BLNB 4U1MA 4JPIB 4HLZH 1T80A 4RWYL 2GITA 3QQ4A 1Y18A 3FO2B 5E8EB 3UROR 4OCYH 3CFIC 1P4LB 4YHPA 2W0FA 3C9NA 4G6KH 1KCKA 2ARJB 3LD8B 1ZHLA 5LBSL 2V5SA 3U6RB 4FZEL 2NY7H 2YD7A 5LG1A 4H88H 2BNRE 1RFDH 5IBUG 2V6HA 4XPHL 1A6VH 5HYSG 4DGIH 3O2DH 3ZDXE 4NN5C 3MLTB 1C16B 1NUGA 2DLFH 2HYMA 3BPOB 2ORBH 3SKOA 2NR6D 4OV6F 4QTIL 4S1DD 2H26B 2EEBA 4MJIA 4RWHA 1T1YA 4PTUA 1HNGA 2WUCL 5D9SA 5HHQB 3QXTA 4GBXC 3HA0A 3MUGA 3N9GH 5C9JB 4RMWA 5T3ZE 4QHNB 2BVPB 2F54D 3H42H 4WI3A 5SWQB 4FQLL 3B2VL 4KDTA 4G9FD 3I9GL 5D7JD 3EJZD 5D5MB 1MSPA 1NGWA 2B1AH 4MSWB 3IDIB 5EU5B 1AR1C 1MEXL 2R2CA 4OZHE 1FLRH 3D0LA 3QQNA 2GW5A 3V6OC 1P7QD 1NCDL 4JRYD 3B9DA 4L3AA 5IG7A 1R6VA 2F54B 3C8HA 4E0RB 4M6OH 3S36X 2H32A 5F9JA 2AABL 5D7JB 2PCPB 4OZGA 2ZSVA 4QLRA 5FCSH 3CJJA 3ARGA 3UTZA 4D0DA 1LO0L 2B0SL 5EWIH 4CUCA 4GJTB 5D96B 3CSBA 1L4IA 1UKTA 3L95B 1P7KB 3VWJA 3DSFL 4OFIA 3NTCH 3TCLB 3ES6A 4JO1H 1MHHA 3TV3L 1K9TA 2HJLB 3KJ6H 1BOYA 1QFUH 2AQ3A 4M7LT 1XR8A 1IGYB 1KNOB 5A2JH 1UC6A 3TT3H 4PJGB 1XF5B 1MQKH 3SDDD 4G6JH 1A6WH 3TPUA 3U0PB 2XI9A 1D5XA 4Z7VE 4HLZG 4O51A 3P0YH 3CMOH 2GAZA 1IZKA 2XN9A 2Z8VC 1T04A 1EPFA 1I7ZA 4GLRI 1LD9B 1EX0A 1YEKH 4MXQD 1XF2B 2DQFA 3SDDB 3ZHKA 1MVUB 1KIQB 5C0AD 1AJ7L 1ZWIA 3MRJB 4WV1B 1IAIM 3SKMA 5KS9B 4PJBB 3WN5C 4ZYKB 4MNQA 4Q7DA 5ADOH 4N8VB 4NJAL 3NIDF 4Y2DA 4HH8A 1T1ZB 4HUWA 1EEQA 5FYJE 4QHLB 1CFQB 2EH8H 3P4OB 1QYGH 4TUJA