The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
51
|
sequence length |
213
|
structure length |
213
|
Chain Sequence |
DIQMTQSPSSLPASLGDRVTINCQASQDISNYLNWYQQKPGKAPKLLIYYTNKLADGVPSRFSGSGSGRDSSFTISSLESEDIGSYYCQQYYNYPWTFGPGTKLEIKRADAKPTVSIFPPSSEQLGTGSATLVCFVNNFYPKDINVKWKVDGSEKRDGVLQSVTDQDSKDSTYSLSSTLSLTKADYERHNLYTCEVTHKTSTAAIVKTLNRNE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
T cell receptors are structures capable of initiating signaling in the absence of large conformational rearrangements.
pubmed doi rcsb |
molecule tags |
Immune system
|
source organism |
Cricetulus migratorius
|
molecule keywords |
anti-mouse CD3epsilon antibody 2C11 Fab light chain
|
total genus |
51
|
structure length |
213
|
sequence length |
213
|
chains with identical sequence |
C, E, L
|
ec nomenclature | |
pdb deposition date | 2011-03-07 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins | ||
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins |