3R06A

Crystal structure of anti-mouse cd3epsilon antibody 2c11 fab fragment
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
213
structure length
213
Chain Sequence
DIQMTQSPSSLPASLGDRVTINCQASQDISNYLNWYQQKPGKAPKLLIYYTNKLADGVPSRFSGSGSGRDSSFTISSLESEDIGSYYCQQYYNYPWTFGPGTKLEIKRADAKPTVSIFPPSSEQLGTGSATLVCFVNNFYPKDINVKWKVDGSEKRDGVLQSVTDQDSKDSTYSLSSTLSLTKADYERHNLYTCEVTHKTSTAAIVKTLNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-mouse CD3epsilon antibody 2C11 Fab light chain
publication title T cell receptors are structures capable of initiating signaling in the absence of large conformational rearrangements.
pubmed doi rcsb
source organism Cricetulus migratorius
molecule tags Immune system
total genus 51
structure length 213
sequence length 213
chains with identical sequence C, E, L
ec nomenclature
pdb deposition date 2011-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3r06A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3r06A01
1FL6A 2FGZA 1CF8L 1MNUH 2DRUA 4W4OA 4LVHC 5GPRA 3TCXA 3WL9A 3ZKND 3PGFH 2A83B 5F88B 3G6JE 3BKJH 2V5RA 2YPVL 3BD3A 3HAEG 1AP2B 4F3FB 5KS9A 4K9EH 4U6YB 3MRJA 1K8DB 4UUJB 2ZWLT 3HI5H 3MV7B 4OKVA 4RMTA 3VRLE 1Q9OA 3VFVA 4A2MA 2OJEA 5IKCB 5E95B 3O6KL 1WBYA 2DLIA 1C1EH 4LNVA 3UC0L 1FVCB 5D8JL 2DTML 3PXHA 1IAOA 3QISA 3I9GL 4CU6A 1QVOB 1I9RL 2QR0B 3TO4B 4OFVA 3SCMD 4ALAL 2IQAB 1GAFH 1NC2B 3UO1L 4CW1B 1OGAB 3ILPA 5T3ZH 1X4XA 5ICYA 1NAMH 2WMPA 3HN3A 2CK2A 2R0WH 2FGWL 2J8HA 2XRAH 3MRFB 2VISA 5M94B 3BZFA 2GQHA 5DJCA 5FB8B 2C3VB 4MNQE 1QFWH 2YZ1A 3IDYB 3OL2A 3KPSE 1MJUH 2JJSC 4APQC 4JM2D 5B39G 1S7TB 5HGDB 1BJ1H 3MGAA 1Z0NA 4LDOB 5KTEH 4PJAF 2H9GA 2VLRB 1X6NA 3T1FB 1QPPA 1YYMH 2JB5L 2BSRB 2HH0L 2ZUXA 1YY9C 4EZMA 4LU5L 2ARJQ 3OR6A 1MVUB 1XF3A 3DJ9A 2ICWB 3QIUD 4LCCB 5EG6C 3ARFC 3ZYIA 1YEGH 5GIRB 3UTSB 5CEZD 4M5ZL 5JIHA 2Q76A 1CLZH 5DMGD 2MHAB 5CEZL 3U7WL 1BZ9B 2ZP0T 5F6HJ 1SMOA 4PRNB 4HEME 4X6EA 5L6YH 1QSFA 4OCXH 1RSFA 3OB0K 1L6ZA 5DF0A 1KB9J 3SKNA 3MNZA 5GRUH 2WBJC 1Z9SA 3S36X 4XPBH 4LASH 1K4CA 3SE8L 4U1MA 2FIKB 3PDOB 5HSFA 4XPHL 3GHEL 4XHJC 4FTVE 4K7FA 3DROB 3TNMA 1WZLA 4XVSL 5HI4C 1A2YA 5GS0H 1I8KA 3D85A 2VAJA 5JQ6L 1KOAA 4PJ9D 4F57H 1QRNE 5DWUL 2FJFB 3STLB 4EVNA 4HXBL 3AXLB 4G6AD 3EYVA 5BV7C 3LN5B 4NN7C 5J1AB 1LO5A 2EDKA 3D0VB 4OD3H 5DURD 3IGAB 2BC4A 4F80A 1P7QB 1KT2A 2H6PA 3L6FA 3LH2L 1BQHA 4BK5A 1D5IH 3MUGA 3QNZA 5TE6H 3S36H 3RJDA 4H0HB 2PETA 3DVNA 1ETZA 5JXAH 1T0PB 2NY2C 3C5ZC 1VFOA 2D31A 4CJ0A 1DP0A 1T5XA 2CQVA 1VGEL 1ONQA 3HB3D 4P46D 1BPVA 3RAJH 4K7PL 4AEIL 4NQSA 2WIMA 3LKRB 4DKEH 4KKCD 1NMAH 3P4NB 5D7SL 1JUFB 1N0LA 4KK6C 3RZCD 3SDAA 3PV6A 1LO0H 2ADGA 4YO0A 5ICZB 5FYLD 1WLHA 4HWZB 1R3LA 3MLVL 4S1DC 1NFDB 1PKQB 3TBWA 1H8OA 2VZVA 1JP5A 1JTTA 4TTGA 2DBJA 1G0XA 3WEXA 5DQ9B 4MJIB 3FQWA 4AEHH 1KULA 3BRFA 4LCWE 4LVNB 2BNQA 4WNQB 3EJYD 4OCRH 1I9IH 3MRGA 4P3WA 2B1AH 4KJWC 1U3HA 1IT9H 3ARGC 5L8LB 4NT6B 3DBXB 3P4OA 4BYHA 4XVJH 4KHXH 2Q6WB 5MEPB 2HJFB 4HWUA 5TQ0H 1P1ZB 4MD0A 1FC2D 1MLBB 2PCPA 1HEZB 4M61B 1F3RB 5L2KB 2VLJA 2OM5A 1NC4D 4HH8A 2G2RB 3FN3A 1AC0A 5JZ7C 3U46B 5HI3D 4OTXL 5F93C 4G3YL 4MB5A 3FB7B 1FBIH 5IW6B 3PGDA 2HFEA 2YMXH 1J8HA 3D2UD 4U1SA 2ARWA 5CZXC 1TNMA 4DKFL 3MRNA 2HG5B 5DD5H 5I15L 1X5LA 4X4ME 5DFWH 2AXGA 3M17B 4ZFGL 1DVFA 1VERA 5T1DL 1W72L 1RZJH 4U49A 2YEZB 5SWSA 4YXLL 4Y5XC 5D7LD 4GRWF 4R2GC 3BP7A 4AY0A 4WHTB 4L9LB 2XN9B 1AE6L 1YMMA 3JV4A 1I7ZA 4Z7VF 1I9EA 1QBLH 3GSNB 3MV01 1NAMB 4NSKB 4QWWD 3TNNB 5EZIL 1SY6H 4XBEH 2E27L 4WEUD 1UXWA 4NN6C 4LRNH 1HH9B 2VR5A 4D9LL 3BISA 3ZTNL 1RZ7H 5JPMA 5K9KA 3MRCB 1BQSA 3MRIA 5ITBL 2Q20A 2NY0C 1JZ7A 2PUQT 3MUJA 2DJSA 4KKLC 5K59F 1WFNA 4D0BA 3BPLB 5FYJU 1MFAL 4U05A 4HWEH 3QEHA 3BKCH 3VH8A 3VXTA 4NQEB 4MQSB 5TQ2H 3S97C 4Y4HA 1LD9B 1RZGA 3PWPB 3CZFA 4U1LB 4ONFH 1AGEA 2R8SL 4J4PC 3TJHC 3QEQE 3C5JB 4WO4C 3G6AB 5CD5D 5ESAA 4CBPA 3KJ6L 1NEZG 5AUMB 4NNPL 1UADC 4JM4L 5GS1C 4HLZG 1GHFL 1HKLH 3NN8B 1U58A 2XG4A 2CO7B 4Z6AT 4Z7WB 1N2RA 2I24N 3ARRA 3PHOB 2E7MA 2AI0H 2V2XB 4Q58C 1D7FA 1YYLL 3TPUB 1X7QB 3ULSB 2KL6A 3KNBB 2XWJA 1NGPL 2JJTC 4JKKA 3TYGH 5E2UL 2XA3A 4OZIE 2EDLA 3LD8B 1VFAA 1W0VA 3AREA 2XQBL 4X9HA 1HI6A 1JYWA 2D7QA 1K2DB 2JTDA 3RIFF 4P57A 1F2QA 4XAWH 3FONB 1BD2A 1ACYH 1YMHB 2QHRL 2Y36H 4HDIB 4L5FH 3GI8H 2H32A 4N5UA 1QNZL 2NLJA 3B8SA 3O4LA 5FYJE 1UWGL 4JRXD 3GIVB 3VFWB 5AYUH 3X13A 5J1SC 3GBNL 4X8XA 1SYVB 2DQHL 1MEXL 2UUDH 5EBWA 1BQUA 2AEWA 3BEWB 1NUNB 3IFLH 4X6DB 4FFVD 2CXKA 4GW4B 3OKLB 3IJYB 1T83A 5E9DA 1QFUL 3S5LG 5DD1H 4YFDB 4QYOA 4ZD3H 3FO9A 3QA3B 1NMBH 2YXFA 2V2TB 3N0PB 3K3QA 1P84K 2VN7A 2JB6B 4XPFH 5IOPB 3KYOA 1KN2H 3MRRB 1KG0B 5GHWH 4NO5B 3PWVA 4JR9L 1JNHB 3UTZB 3VMNA 3KPOA 3N1GC 4QRRE 3U6RB 4R3SB 3T77B 3VXRA 4RRPG 2YD2A 4G43A 1EFXA 1FSKB 2JF1A 3W81A 4JDTL 3O2DL 5KOVC 5D1QB 4AQ1B 4KK9C 5I18H 3EFDH 4PRID 3RY6A 3NTCL 4NQCE 5J06A 3H7BA 4X80L 4JO1H 1RY7B 4WWKA 4YBHA 4X6CF 4FQ2H 5E2VH 1T89C 2BY1A 4U1GC 2XNAA 4OFIA 4D2NA 4MS8C 3RVXC 3L9RB 1YNTB 5DMIL 5TDNA 4B7IA 3Q5TA 4L3EB 5F21B 2X4OA 3OF6A 5DFVC 1T1XA 4ZUWB 1QHPA 4ZSOE 4PS4L 1IM9A 4G6KL 1UEMA 4M00A 4PJHA 3SO3C 4OD2A 1U8LB 5IVZB 4Z0XB 1SYSA 4RFEA 3F58L 3LKOB 4LLMB 5CJQL 3VD3A 4POZD 3OKOA 1G9MH 1I4FB 2VTFA 4I3SH 4P0DA 3REWB 1ZLSL 2DQJL 2N7BA 5DQJB 4X6BB 3ZKXB 5HHVH 4X83A 4JDVB 5EU6B 5JHDD 2EIEA 4WFEE 5ENWA 1HZHL 4KRMB 2MOVA 4BH8A 4OLXH 4N1EA 2R2HA 3BPOB 3D0LA 4R0LB 1GXEA 4ELKA 5AEAA 3O8XA 4GW5A 2AQ1A 4GBXC 1I7TB 4DUVA 1N64H 1MFEL 4HUKB 2XICA 1EZVY 4Y2DC 2OR9H 4NC1C 3S96B 5C08B 1HCFX 1R5VA 3B8YA 2KBGA 3QDJA 4YHIB 5CEYA 2DLTA 4P5TA 4JHAL 4LLAA 1U2CA 4PJEB 3KDMB 4NQDD 5FV1L 3SGJC 4AJ0A 3RVTC 3IDXL 4H25B 9CGTA 3U0PB 3ULVH 1JZ4A 5GZND 5ID1B 4OZFH 4F7TA 2VDMH 4LLDB 5IVXA 3BGMA 1FH5H 5J0BA 5DMJB 2Q8BL 4UNTA 4LKCA 4PJXE 1MPAL 4GW1A 1T0MA 4O02L 5JW4Q 4JPWL 2BY0A 4KI1A 4PJFB 3D6GA 4PY8I 5D7IE 4JRYE 3CVHH 3M1BA 3QFJB 3SDYL 1Z3GL 4KMTH 5A16A 1F4XH 5DZLA 1UWXK 3CLFH 4OGZA 2I60H 3BAEH 4YHNB 4NRYA 2Z92B 3M45A 3OXRA 4G8GE 15C8H 4BQ9A 4PJ7F 1AFVH 4X9FA 2PYFB 5GGUA 5T5FH 3SKUD 4HX1A 1DBAH 2MMXA 3HE7A 5DK2A 2KZWA 4TSCH 5TE4H 1RHHB 1Q0XH 4ZOAA 5GRVK 3QUZD 1A9EB 2I26N 3C09B 4U31A 2P8PA 1T80A 4O58L 4FMKA 3MA7B 4MNQD 5HGBB 4LARL 3MODL 4PJGF 1BX2B 2NX5E 5DVNA 3DUSA 1YQ2A 4NZUH 3RHWK 3KPQB 1G1CA 4KJPD 2PW1A 2MWCA 5AD0A 25C8H 4CN1A 2RJMA 2V7NB 3ARYA 2X4PB 3RVUC 4GS7B 5F9WB 2ADJA 2X6MA 5DDHB 2DI8A 4LPWA 2HRPL 1WT5C 2W9EL 3MLTA 4MNHA 3WUWA 5T1LD 1A6AB 1XCQA 5FF6B 4LHUG 3F6LA 4ZXBD 1KB5A 5DD6A 3EYSL 3CPLA 5GISL 4LHJB 3QHTC 4WTWA 5BRZB 5FYKD 2OL3L 4TOYH 4I3GA 4XP6L 1H5BC 5IB4B 4KI5E 2B0SL 2GJ6A 3L3DA 1F3JA 5AZ2H 3RVWC 5FUZL 1I3VA 4OF5A 4LVHB 2FH6A 1B6UA 2FJHB 1IAIM 5IBLC 4XVUC 5DVMA 3H9SB 2DLGA 3TBTA 2NXYC 3QHFH 3CCHA 4LOUC 1SY6A 1MFDL 4W81A 3FOMB 3MRQB 5DUBA 4BZ2L 3W11D 4OM0L 1MAKA 3T0AA 4B53A 3MO1B 3LV3B 4QXUL 5D1XA 4IS6B 5IV2A 4KKAD 4KJYA 1VSCA 2GAZB 3V6OC 4RX4A 4F9PC 1H0DA 3TIDA 4C57C 5SX5H 5HD8D 5IBTL 3MRHA 1S5HA 3U4EA 2IMMA 1QBBA 5CILH 5C09A 3FT3B 1P6AB 5GQBA 2L7UA 3UPAA 4JFDB 1T20B 5GJTH 5GGTH 4K3JH 4TSBL 2X1QA 1VDGA 5IJKC 5ACZB 3GEWB 3EO0A 5A1AA 3MFFB 1IC4H 4APQB 2BXYA 3HUJB 5KSUB 5DO2D 2NY6D 1PYWB 1QA9A 5EO0A 1HSAA 1HNGA 3O11B 1TVBB 4WU5A 2DM2A 4M48H 4LLYA 2YHGA 3NOIA 4UINL 3ZSTA 5HHNB 5D2NE 3ARFB 1PG7W 2VE6B 1MJ7H 3LQZA 5I1CL 3FQUB 5EBMA 2B4CL 1VB9A 4M1GH 4OIBA 3SKMB 1SBSH 1YEJH 3BD4A 1J1XH 1JF5A 2NY7H 3IB4A 3P11H 1F8TL 4OLEA 4HWNA 3V6ZA 1B0RA 4YHLL 5LBSH 2JJVA 2YD8A 3B5HA 3T8XA 2HT4D 4G80B 4HIEA 4R90H 5C8JA 1P53A 2DAVA 2LU4A 4LIQH 4UT9H 1R5WA 2K9UA 1JHLL 5L9DH 4PRBA 3QUML 5J6GB 1OF2A 4LCUB 5FDWB 3UMTA 4FQLL 1P7KA 5HTSA 1CXFA 2FJGB 4R4BA 3ULUD 4K94C 3NH7H 5I16B 5CZVL 4HWBA 3QG6A 1VFMA 4G7YH 3W0WE 1U8IB 5JOFA 4JPKH 1ED3A 2QKIA 1XCTB 2RFXB 4TPRH 1BIIA 1H3WM 4L8SA 5B3JF 1P4BH 3P77A 4WY7H 1NGYA 4QRUB 5BV7B 2ICCA 4G8FA 4FFZL 4NN7B 4YC2C 1S7UB 2Y07H 2CIIA 4DUXA 1IGJB 1NBZB 1ZS8A 2XXCB 3OKEA 4QRQB 1A3QA 1TQCC 1BP3B 4NYLB 1PQZA 2VXUL 5DHVB 1JPGA 5EOQL 2EIZB 4XMLH 4DEPC 4TSAL 3RP1A 4XNUH 2NY2B 3C5ZB 4NHCH 1O5DT 1HXMA 4M7KH 2XWTA 1FZJB 5CHNB 3KS0J 3RUGA 3P0VL 5C0NC 3TBVB 4HUMB 2VC2H 1DBBL 3L3OB 3BRGC 3GSQA 4OLYH 3WFHA 1YY8B 4NKIH 1G6VK 3SQOL 4DQOH 4Y19A 5HHPA 2I9LA 4GH7B 2SEBA 3ZL4L 2GJZB 4FXKA 4PJ8A 3G5ZB 3WS3B 4RAHA 2HKFH 3VXSA 1IGIL 3O3AB 4V1DE 3B9KD 3CMOH 4S2SA 4HMEA 2Y5TA 2FECI 3IVKA 1KV3A 4GRLD 1KELL 4LLQA 3MLXH 1U9KA 4JZOB 3ZE1E 3FHAA 3FFCE 2L7JA 4I77H 4D9QD 2B8OT 3KXFE 4M6OL 2HTLC 2VXSL 4P48A 5C0CA 2XTJC 1FNGB 5CP7B 4N8VA 2H2SC 3ARGB 4ZTOH 2J6EH 2VLKB 4LPUA 3NABL 1MFCL 4GG6E 2I27N 1CXHA 1DN2A 2C3XA 1YDPA 4M1DL 2NMSA 1YEHH 3VE0A 4NO2A 1YA5A 5T1MB 3IS0X 3LZFH 4UIKL 1FG2B 4BELD 1RZIA 1AO7E 5I8KL 3O6FC 1Y18A 3Q3GB 4WEBL 3WSQL 3LS5L 4K23H 1BVLB 2BY2A 4QF1B 5I8EB 3ARDA 3CK0L 1IAIH 4BUGA 3RWCB 3GSOA 1YJDH 2UVFA 1E4KA 2F54E 4P4KA 1YPZA 4LCIL 3NACL 3TJEH 5D72L 2DKMA 1J05A 4QHMB 3I2CH 5FOBA 1ITBB 4YHPA 1I1CA 1OTTC 4NQXA 1RAMA 1DANT 4DGVL 3UEZA 4Y5XB 8FABA 5KS9E 4OZFA 4ODVH 5FYJL 3U9UA 4R2GB 1RIUL 2A6KB 2VXVH 5BZDB 1MY7A 3MUHL 4JQIH 2OK0L 1OAXH 1JPTL 4PJDF 3BYYA 3G08B 4ZAKC 4PJIF 2O5ZL 3PL6D 1N6UA 2UYLB 1M7IB 5GXBB 4RGMC 1DTUA 5GJSH 1KPVB 1T22A 5DUPH 4NN6B 1DEDA 1EV2E 4XRCB 3ECBA 3TT3H 2NY0B 3BYTA 2A6IB 1ZA3B 4IDLA 3HS0A 3PUCA 1AR1C 1KIUA 1A7RL 2VIRA 3NCMA 1MCCA 4UTBH 3RPIA 3FO0L 3Q5OA 4HK0B 4U6VL 4ZPTB 1C08B 2FO4A 3ALPA 1CR9H 3KPPA 1G7JA 3UJJH 43CAB 2WNGA 2HLFC 4OM1L 1T66D 3G6JF 1S7QB 2IADA 4GKSA 1F5WA 5JHLH 2VQTA 4O51A 5E8DH 4WO4B 4HMCA 2A9ML 1JGLL 3QUYC 4NDMA 4F7MA 3NFSL 3UTPD 3RZWA 3QXUA 4XI5D 2VH5H 3BN9D 5HHXH 4Y5VA 5I8OH 1T4KB 4N8CH 2P42B 5TFSH 1ZLWK 3A6CL 2I07B 3VRLF 3MJ6A 3K8KA 5GS1B 4RMWA 5B38G 4ZFOB 2YKLH 3H0TB 3QXAB 4RQQB 2AAVA 2EXYD 3F65A 3REVA 3IRPX 4K2UH 3LY6A 2YBRA 3HMXA 1NDGB 2D7TH 5KZCB 5F89A 2AJZB 4D3CL 1S7XB 4XGZB 3NIDE 2FRGP 3FB5A 3DV4A 1CLOH 3F5WA 3CFCL 4BH7A 4N1CA 1T1YA 4N9OB 3T0EA 3QWQB 1L6XA 3MNWA 5EWIL 1IC5H 4WI4A 3V6BR 4PRPA 1CFVL 5IB3B 4JPVH 1DLHB 4RNRA 5KN5A 3V4VH 4BKLA 2G60H 4WFGD 3O6LH 1BREA 3G04B 4OFDA 1SVZA 5IP4A 5JUEL 1D6EB 5DUMH 5FECB 2FX7H 4LDLB 5DLML 3SDDC 3WKMH 5HI5C 5MEND 1TNNA 1NDMB 5BZWA 1T2JA 2UY7A 1S7WA 4OD1L 4FQQA 3OWEA 4I0PB 5F9OL 1M7DB 2PTVA 4Y1AB 4ISVB 4UDUA 4KVNL 5ITFB 4MAUH 2APVA 2LABA 3AS1A 3EAKA 1EERB 3PWLA 3UTTB 4JFEB 5C6TL 5SWQA 2JIXD 4KDWA 2C26A 2OS7A 5D1ZB 4PJAB 1AQKL 4ZDHB 1FLRL 1A7PL 1ZA6B 1CL7I 3ET9F 3L3IB 5TGBB 3V2AR 4OBSA 1MJJB 1HCVA 5FKAB 3E8UH 2F53A 5TH2A 1PY9A 4GAGH 1FFOB 3MBXH 3D48R 1TZHA 1WC7A 4D8PA 4ORGA 3VD5A 2YPLE 4M43L 1RJZB 3JBG7 5F7FA 2CDEB 1GOHA 1A6ZA 4Q6IA 5EU7E 1I85A 4OZGA 4U1IB 2X7LA 1B2WL 1I1YA 2R23B 3HC3L 1D5MB 4GUPB 5DHYB 3FO1B 4F15C 4F7CB 1RFDH 1HHGA 5F1OB 4G8GD 3BQUC 3QCVH 5AZEH 3EJZC 4OT1L 1TVDA 2BVQA 3UAJD 4JLRA 2CDGA 3JTSA 4IOFD 4XAKD 4HCRL 4JFHE 1N7ML 3O3EB 4U1GB 3HZMA 2DM4A 4QXGH 3QFDB 3VWJC 1CDYA 3P4MB 1VACA 2IBGA 2W38A 1QO3A 3HG1A 3GRWL 4OLWL 2W0LA 1UH2A 3RL2A 4Q9BA 2VLJE 1D5BB 2VDLL 3V0VA 4WHYH 3BKML 3LKQA 5E8PB 5GS2H 3F6IA 5LGJB 3K4AA 2NX5D 4M4RA 1PZUB 5FCUL 3SDXA 3SO3B 2ZUQB 1A3LH 3S4SB 3WNLA 1E4JA 5HDBE 4L4TE 5LG1A 1KLGB 5KVGH 4XNQB 3UJTL 3K4DA 2AEIT 2PXYC 3CFEA 3H3PL 1IC7H 4P23D 3MFGB 1EGJA 4DN3L 3C6LB 5A2FA 4LEXH 5EC1A 3KJ4C 3W9DB 5DJDB 4Z0BH 1TCRA 4XTRC 1BQLH 1CE6A 4K3EH 5SWSE 3RIAF 3DXAD 4PTUA 3TN0D 5EZOH 4Y2DB 3MGOA 5HHMD 5T1KA 4R7DB 2CJUH 2NY4D 5IB1A 1J87A 3BP6B 4MQ7B 3QCTL 3IYLW 4UDTA 4KJQD 5C0RH 1YMME 4NC2B 5CWSB 4KI5D 1OSPH 1ZV5A 2C3WA 4JZJC 2ZCHH 4RFOL 5CP3H 3OX8A 2BNRD 2FB4L 1A9BB 1QACA 3SDCC 3LRSA 1UEYA 1AGDB 5EO9B 2YPVH 3MLWL 4NKMB 2YC1B 3MCKA 4HS3B 3I02B 2N4IA 3K80A 1K8IA 1KPRB 2EDFA 5DK0A 5JIKA 4C58B 2ZNWA 1OPGH 2E6JA 3MJ9A 1FIGL 3TA3D 1D6VL 3HLAB 4TULL 1I1AD 3O6KH 5IHUL 3HI6L 3IJSA 5D8JH 2DTMH 1ND0A 1PEWA 3I9GH 3C5SA 1I9RH 1QSEE 3CFKA 2X2YA 3PP3H 4ALAH 1IL1B 3RDTC 5C07B 1WCBB 5E1AB 3L7FB 3NFPA 5CBEB 5F1NA 2R4SH 2IH1B 4KGLA 4XCFL 2FGWH 4YHKL 4OF3A 3HC0A 1KIPA 4FQIL 5B4MC 2DWEA 1EX0A 1CDIA 4TRPL 4ODHL 3GMNA 1I8IA 1FNEB 2AV1A 1JF1A 5I19H 3E6FB 1BJ8A 3W2DL 5T33L 4GRWB 4XP4L 4HUWB 4LU5H 4XPGL 5IBUG 1HYRC 4UQ3B 4DZBB 5C3LD 1BD2E 4G7VL 4KTEL 4L4VD 4TNWK 3H7LA 5CLWA 4Z7VB 3KPMB 4OCWH 1EJOH 2C1OB 3DUUB 2YUZA 5IT2H 1DJSA 3BVNA 5CEZH 1ZANL 2WINA 3VJ6A 1CXEA 3OAYK 1MIEL 1QEWA 3L5HA 4S1QH 4XNMA 3O41B 4MCYA 2BX5A 5E5MA 4XP9L 4EEEA 3AM8C 2BNUB 1H5BB 3MBEA 2M26A 1KN4L 1N5AA 4QRPA 4JREC 3MV8A 5E9DE 1G7HA 3B6SA 4PUBL 2CGRL 2OMNA 1NL0H 1DDHB 4QTHB 5AWNL 4XPHH 2IANE 3ROOB 4I2XB 4TVPE 5DJ6B 3ZDXE 3CC5A 5FCSH 3AS2A 1FE8H 4OZIF 4FQXA 4X0KA 1A1OB 5JQ6H 2COQA 4LQ1A 5EUOF 5DWUH 4MCZB 3FAWA 3MJ8A 4HXBH 2PYEA 1G0YR 1J1PL 4HF5L 3I75B 4XZUB 3RWGA 3PG2A 4G9FD 3VXRE 4HC1L 2FZ3B 3C08L 5E6IA 4AMKL 4NUJB 1GL4B 2A9NL 2R0LL 1PVHA 1RUMH 3LH2H 4N0UB 2ATKA 2ED8A 2W60B 1I3RA 1WK0A 2AK4A 4N0YL 5J8OA 4IM8A 3VRIB 5SWZB 2YUVA 4PRHA 1YNLL 5F88A 3ZKQD 3PQYE 3HCVB 3VDBA 4JO4L 3NZHL 4OAWB 1AP2A 3T09A 5HVWA 4M7ZC 4U6YA 4HS6A 4ZFFA 2J4WL 4DVRL 2XZAH 2UY6A 1K8DA 5H37H 3S34H 5INCB 4NN5C 1Y6NR 2FX8L 5IKCA 1D9KA 1J5OL 3TM6A 3ILQD 2A6DB 3MLVH 2C7UB 5FYLH 2B7DT 3FFCD 4Y5YC 4X8JB 4QY8B 5IQ9A 3BUYB 5ABDE 4PJHE 1IKNC 3GMPB 1CN4A 4E41A 4MAYC 4PP2B 2QR0A 2JK5A 4Z7UF 4IOSD 3TO4A 5CCKL 5DTFB 3EHBC 2DQGL 2JKXA 4JGJA 2IFFL 1G7PB 5DRXB 2AJXH 2DMKA 3IDNB 1SM3H 3ZSSA 2AXFA 2GIYA 1F6AB 1JNLL 5E56A 1D5ZB 3V9FA 5FB8A 4MQXC 1Z0MA 4GQ9L 1UWEH 3V52H 4R26H 4KXZI 6FABL 3QIBD 3X3GH 5ADPH 1DE4B 1U8JB 1KENL 3QDHA 3FT2A 4YZFE 1ZHBB 3TVMB 5HPOA 3DO3A 4OTXH 1QKZL 2EH8L 3RNQB 4MQTB 3QDJE 4PJCE 1VFBB 4PREA 3NFNB 4FQJH 2PTTB 3VA6A 4AENB 5J12C 1XH3B 1JVKA 5ICXB 3A6BL 5F8RC 4IEFB 3G5YB 2FL5B 1MLCB 5IW1B 1L0YA 3HE6A 4ETQB 5E00A 1BZ9A 2RBLA 4PRNA 5H8DA 4WV1C 5T1DH 3GMOB 4M03A 5SX5K 1TQCB 2AGJL 4X6CB 1OY3B 5DRNA 3JUZA 3BDYL 3GHBL 4DEPB 2R29L 2E7LC 2FIKA 5B8CC 3RKDC 3INUL 3EGSB 4EI5D 3DROA 2XTLA 3P9MA 1JNNL 3LS4L 3ESVF 3O9WC 5EZIH 4DAGL 3O45A 4XP5H 2E27H 2FJFA 3ZTNH 1NLDH 4R96B 3ZO0A 3CH1A 5ITBH 2VKXA 3DX6B 5E4EC 4KWUA 5DRZA 3HI1B 1FORH 3LN5A 4OLVL 5DEGB 4EOWH 3VW3H 1MFAH 5FGCB 3WHXA 3D0VA 4P4RA 2W0FB 2PTUA 5I17B 4XNXL 4E0RA 4QCIA 4O9HL 4CDGC 1CXKA 4PJXF 2GK2A 1CK0H 1M71A 1FZMB 3DVGB 3WHE0 1V3MA 1BFVL 1XF4A 5D7IF 1UXSA 4Y16C 3TFKD 2B4CC 3GSRB 1T21A 1IAMA 3SBWC 1AIFA 1EVUA 2P48B 5IGXL 1V7NL 4WI5A 1FDLL 1XF5B 1WIUA 1NCUA 3K0WA 1F4WL 1JUFA 2IBZX 4X9GA 4NNPH 3GIZH 3BKYL 3OXSA 2F74A 1YN6A 1PKQA 1QSFD 5IJVB 4H5SA 3BIKB 2E6PA 4I9WE 4WNQA 5A2IH 2VITB 1JIBA 2IPKA 3T3ME 1W0YT 2GJ6E 1JHTB 2AV7A 4XB7A 2XQBH 3MLSL 3T0VA 1OWRM 1TFHA 2HJFA 2VZ3A 4DWHA 2QQKL 4XH2B 1IVLA 3MXWL 1KC5L 4Y8DC 2QHRH 2DM3A 4Y8AA 1QLEL 1QNZH 1U3JA 1S8DB 4QKXB 5DC4B 4AH2A 1UWGH 1OSZB 5DURB 4PJ7B 1SEQL 4C56D 2BVYA 5FM8A 1KEGH 3BDBA 1G7QB 3U46A 4ZAKB 2Q7NA 3UTOA 4HKXB 4YK4C 5CJ5A 3QB7C 3GBNH 4RGMB 4MXQD 5EIVA 1S7RA 4XCEB 3FB8B 3HAEH 1X5ZA 4L8BB 2P5WD 2DLFL 4KK8C 1QFUH 1A6UL 4PJGB 3WO4C 4KTDH 1OTSC 4I48B 4UT6L 4JFQA 5C09E 3D69B 2ESVE 4P59L 4EUPG 5JW4N 4NHUB 4QLRA 1PZ5B 1B6DA 2YA2A 3GJFH 2GY7B 1TZIA 4JGUA 5MEQB 1CIUA 1ZLVH 1F58H 2A73B 4ZO9A 3SDAD 1UM4L 4HZLA 2GK0A 2AP2A 3A6OA 4NWTL 1HH6A 2BDNL 3PWUB 4L8DA 5EOCJ 5ACLA 2BXZA 4JY4B 1F6LL 2ICWI 2AABL 4NSKA 3SCMA 2KQNA 3WXVL 4Z7QE 4HS8L 2B2XL 2XOTA 1KB9K 1UKQA 1NJ9A 2BNQD 1JHKH 5KVEL 3QSKB 1MCPL 5BW7A 3JSSA 1R3HA 2XA8H 4PRDB 4BK4A 1T3FB 3DX9A 2HWZL 1GOGA 4F58L 3WXWH 5D9SB 1KIQA 5DJ2A 4ZYKA 5DD3L 5GRVL 1IC1A 4UAOB 3AAZA 3NZ8B 3VXUB 3L7EB 5DMIH 3O3DA 3PWPA 2EYTB 4KRPC 1G9EA 2VN4A 4XCCH 4WUUD 3QCUH 1NMCC 3KLHC 1KEML 4E5XA 3RY4A 1RZ8A 1P4IL 2GCYA 3QIUA 4NBXB 2C1PA 5K9QG 3AVEA 3TH3T 3U0WL 5J56B 1W8NA 2VUYA 1DQTA 5GS3A 1J8HD 4XC1L 3L95B 1W72B 2DQTH 3OKKA 3BWAB 5CJQH 3ARVA 2GTWB 3WUWG 4HUNB 1RZKH 1ROWA 2NTSP 3SDDB 3OKNA 1ZT7B 1S9WA 4YGVA 2V2XA 1JTOA 1BIHA 1A6TB 1HZHH 3OKDB 2F5BL 3OJDA 2DF3A 3KNBA 3JWOL 4YJZL 3ZT5A 5L7XL 1MFEH 4QTIL 4R97C 4ODXA 1IGCL 2WUCL 3O3BB 3B4NA 1HKFA 2VXQL 3U2SB 5A3IC 2YRZA 4QT5B 4PJ9A 1EHNA 3MV9B 4TUJA 3LKSA 1K2DA 4X4YB 3IDXH 4G9DB 1NPUA 2Z31C 3FONA 1YMHA 3RUGE 2DJ4A 1ORQA 4FXGA 1A5FL 5DR5L 4KTYA 4Y2OA 1C5DA 4DTGL 4IOIA 5FOJA 2Q8BH 3VFNA 5L88H 1I7UB 1MPAH 1K4DA 2R39A 4O02H 3LB6C 3D18B 4NCC2 2DBLL 1MQ8A 3VXSE 3T2NL 4HPYL 4X6DA 4GW4A 1FAIL 2B1HL 2RCSL 3SDYH 3TP4A 4Y4HD 3IJYA 3WKNA 5IK3A 2P45B 2F9BT 4F15B 4RAUB 1TZGL 5I1HL 1KLFA 3DMMA 4CVXB 4P5MA 2LAGB 5C0CE 3OJMB 4M7LH 3BQUB 3QP3A 3QUXC 5INDB 1T04A 2X1OA 4JFXB 1NCDL 3RZCA 2A0LD 5IOPA 5ERWB 3E0GA 1KG0A 5ALBL 5BS0D 1JE6A 4NO5A 5FUOL 3VA2C 3C60C 43C9B 1WZ1L 5KSBB 3UTZA 2HLAB 4G8IA 4KRNA 1HINH 1XGRB 5E5RB 3U6RA 1S9VA 4UQ2A 3S8WA 4NZRH 1KTLB 4LARH 3SJVA 2F19H 3WDJA 3UXFA 1CFBA 2FD6L 1XFPA 2NY3C 3GZKA 3QWOB 4HBCH 4X5WA 4ONGL 3IDMA 4OIIL 5ISZB 3AMLA 3KPRB 3R0MA 3IFOA 1SJEA 3ZE1F 4EDWH 3EFFB 2P8MA 3MRDB 1Q94B 2HRPH 2WWMC 3KJ4B 1CFQA 2W9EH 3O2WH 2IC2A 3O4LD 4IHOB 4U3CA 5ECJE 3ULVE 1T1WB 3NIFE 2RHEA 1VCAA 3EYSH 4NZTL 4UBDC 1RUKL 5C7XL 1KPUB 5GISH 4GG6F 3WJJA 1ZMYA 3BMWA 1CVSC 3RJQB 4Y4FC 1MNUL 3QDAA 2WBKA 4XP6H 3PGFL 1ZHLA 4LGSB 3BKJL 3ESUF 5FYKH 2B0SH 2MQCA 1H15A 1YNKL 4AK1A 4X7TA 2GTZA 4X6BA 5FUZH 3RTQA 4IRJC 1DQJA 4UZGA 5FGBA 4AEFA 1V05A 5D7LA 2D0HA 4JDVA 4YLQT 3H9HB 1OLZA 3SDCB 3QRFM 4PYHA 4MMZC 4TVPL 1VADB 4UV4L 1IZJA 4R0LA 3ZKSD 4EI6A 2CLVB 5EZLB 2DJUA 2EYRA 2FYYB 1MFDH 2ZUVA 3GUTB 4LGRB 5FXCH 5C08A 1R3IL 3VFUA 4BZ2H 4OM0H 3GMLB 3WNOA 5IFHL 1JNJA 2X1WL 1C16A 1CFSA 1EFXD 1AGBB 3LKPB 4WVRA 1GAFL 1ZT1B 3KWWA 3D39E 5K33A 5IHBA 3U0PA 3H9YA 1LEGB 2C4FU 5JW5B 2NNAB 2IAMA 4PG9A 2H41A 2R0WL 3IU4H 1AQDB 3GSUA 5AG9A 3RDTB 3HPLB 4JKMA 3VD9A 1QFWL 2OTPA 1XR8B 4WWKD 2VXTL 1FVEA 4OGYL 1UQSB 4PJFA 5KTEL 2HMID 2D7PA 4TSBH 2FWOA 1YYML 3QO0A 4H8WH 3B2UC 3OF6D 5JDSB 1LO4L 4J23A 5IG7A 2XFXB 2Z92A 1OAYL 3OKMA 4M9PA 3T0EE 1YEGL 5IHZA 4MYWB 2WBWB 2BSSB 4OGXL 4L3CA 1CLZL 5DGRA 4LLVB 4UINH 3U0TB 3IAPA 4PJDB 4PD4J 4PJIB 1AXSB 3BZ4A 2N7AA 4OCXL 1RI8A 2FEDC 3ES6A 4NUGH 1KJ2A 1INQA 2QQNL 3QEGH 2DTSA 4NFDA 3X3FH 5GRUL 5I1CH 3JXAA 4HKZB 3F7QA 3MX0A 4LPTA 4XPBL 4HUVB 4NO0A 2NY4C 7CGTA 1BX2A 2LVEA 3SGEH 3O8XD 4YXHL 3UTQB 4NZJA 4DUWA 5FA3B 5TDOA 5GS0L 2WIIB 4R7NA 4JREB 2V7NA 1JWMA 3D87B 2BVPB 5IEKB 4P5TD 1FGVH 4F57L 1EAPB 2PF6A 3QUMH 2GUOA 2HVJB 4MHHI 3NIDF 5DDHA 4FQLH 3VG0L 1E6OL 1RZFL 5E8EB 4I4WB 4KUCF 4HJJL 4Q9RL 3G6JB 3AY4A 1D3CA 2I25N 2ARJB 3ULUH 4C54A 3VWKD 5FF6A 4OD3L 4Q9QL 2P5ED 5F3HA 2BCKB 1PSKL 4PV9B 5EOTA 2MQ3A 3BH8A 1AGFA 4PGDB 4FFZH 4MMXC 1FL3A 3S36L 1LHZA 4OZGE 4JE4B 3WLWD 3PP3K 4BSVA 4J8RB 3GJFA 5T5NG 2MSPA 3RAJL 1CGSL 3TBYB 1BBDL 5EOQH 5GZOC 4DKEL 1NMAL 3U36B 1DLFH 4XXCA 2NQCA 2V17L 3H9SA 1LO0L 4Q2ZA 1OOAA 1DBBH 3EYUL 3VFPB 3FOMA 4KRLB 3MRQA 3EYFB 2XYCA 3HG1E 3KPSB 5I1LB 1CGYA 3MO1A 4NN5B 1HDMB 5B39A 1A6PA 3K2UH 3GSWB 4IS6A 1IGIH 1VEMA 1I9IL 4URTB 3BSZL 2B1AL 5A2JH 1V3JA 4JPIA 1LEIA 4Z7OF 4Y5YB 3C2SA 1HQRB 3W39B 3FZUC 4XVJL 4KHXL 4XXDB 3SDXE 3RWHB 5CUSH 4MAYB 4JFFA 5D2NC 2N56A 4Z5RB 3S37X 1UCBL 1OAKH 1KBGL 1EMTH 1XGUA 2Z93B 3D3VE 4L29A 3BX7C 3IJHB 1T20A 5I8CA 1A6VH 4ZXBB 3MR9B 3VFRA 1GGTA 1MFCH 4H0IA 2VDOL 4MA8H 4LPCA 1BZ7B 3EOAB 2OL3B 3S3PA 1FBIL 2D7MA 1QTYT 2JJSA 5F9JB 4APQA 5EU4B 5KSUA 4KUZL 5IR1B 4RAVB 2YMXL 3GMQB 1OB1B 3V5DA 3ZTJG 5DD5L 4CVZB 3SE3C 5E24E 3PDGA 4GAJH 1KB5L 5C0AD 2R0ZH 4XHQA 3RPKA 1YQVH 4FTVB 4O4YL 2ICEA 1ERNA 5J12B 1CD1B 5JHDA 5DQDL 3LS5H 3RHWF 2MJWA 1J88A 5EZJB 2VE6A 2DQCH 3U9PL 1QRNB 2CLZB 3MRMB 1RUAL 1K9TA 1P2CB 3NACH 1T03L 5HDBF 4EN3C 1U8OB 2CDFA 2C4FT 3DETC 4WV1B 5EU5B 3V8CA 2XKNB 1U93A 5FHAL 1J0YA 4NQDA 2WBJA 5HHOE 5BXFA 1RIUH 4W6YB 1SY6L 1MIMH 1EHAA 1CDCA 3SHSA 4UI2A 5B8CB 5D1XD 1RZ7L 5BO1L 1AHWC 2NZ9C 1GPOH 3O9WB 5I16A 4PPTA 3S3JA 2UZXB 2K3TA 1A4JB 1U8IA 4PBXA 2RFXA 3DRTB 3BKCL 1W8OA 4PJ5D 5TQ2L 3U4BH 1JPFB 1TTUA 1A7RH 5E94A 5D6CB 3FRUA 4LNRB 2E6QA 1QBMH 4U6VH 1IMHC 3WNNA 1JYNA 4NYLA 4WEMB 4HJ0D 2EH7L 2ZG1A 4LP4A 2EZ0C 4LCWB 2EIZA 4OM1H 4X7FC 4YE4H 5C0BA 1UB5A 2J12B 2OR8A 2W0PA 4OLUL 3C5ZA 4Y16B 5CHNA 3NBNA 1DZBA 3QUZA 4NNXB 4C4KO 2Y7QB 3QIWC 3QULB 4RA3A 3ROLA 3MRKA 1YY8A 5DA4A 5L2JB 2R1YA 1CS6A 2GJZA 3WS3A 3O3AA 5DC0A 3QUMB 3T4AB 5J89A 1LQSR 1X5GA 5CGYD 4D3CH 4EKXA 1ZSDB 2LFGA 4LFHD 3BHBB 2HP4A 3CFCH 4G5ZH 5JNYB 1ACYL 4L5FL 3ARGA 4GXVH 5DJ0B 3MV8E 5EWIH 5T1LA 4N0CC 2VLKA 1CFVH 4NOBA 3VXNA 4G6FD 4WUKL 5EO1B 1U95B 1S7SB 5AYUL 3EUUA 3EOBB 5DMYA 3QDMA 4HWBL 5DMKA 4PY8J 5JUEH 5MEOB 3SPVB 3IFLL 1MCFA 5DLMH 1TQBC 1FG2A 2PYEE 2CRIA 3CDYA 3LDBC 1FYTD 4P3CL 5CJOH 1QR1B 4ZS7L 4XNYL 3RGVD 4YK4B 4OD1H 1A1MA 4ZD3L 4YBLC 3QUKA 2P24A 2YA1A 5J3HC 1NFKA 5F9OH 1Y0LA 3CSBA 5CINL 4YEFA 4KVNH 1VGKA 4QF1A 5I8EA 1CFNB 5C9KA 2X40A 1T5WA 1KCSL 2FATH 1MFBL 1IEHA 3R4DA 5GHWL 4TNVK 2AK4E 4GXUN 3CIQA 4YBQD 2K1MA 3S35X 5HYSG 1J7VR 1FCGA 3GJEA 4PRHE 5F1KC 4GAYB 3RL1A 5EIQA 1NGXA 2X4UA 4HH9B 4AL8H 2ADIA 3HMWH 1CQKA 1A7PH 4FOMA 3UBXA 4H26A 1ADQH 2FCBA 1QLFA 1AGCA 3QQ3A 5BZDA 4Y19D 2EC9T 2UWEE 1KYOJ 3G08A 5E70A 3ZDXF 1P5VA 4PJ8D 1ORSB 3Q1SH 5T3XE 5I18L 3EFDL 3VXSD 2HT3C 2R0KH 3L5JA 3QEQB 4M43H 4ZO7A 3N50A 1GZPA 4JO1L 1PG7H 4N5EC 4PGCA 5KSAC 4IRZH 2DLHA 1B2WH 1KPVA 3HC3H 1ZVSA 1U41A 4XRCA 4JZNB 4E41E 4MZ3A 2YD5A 5EFIB 1ZA3A 4GQPH 3OJVC 4GMSL 3SE4C 4LLUA 5JORA 1E28B 1UCTA 1N7MH 3U30C 2EIBA 3RWIA 1J18A 1TETH 5LKNA 5JMOC 3GRWH 4OLWH 4KRPB 1HNFA 2J3SA 2G5RA 1S7QA 1NMCB 3BKMH 4OLZL 4OZIB 5IMMA 3MTRA 3QWRA 5JOPD 3MA9L 4XBGB 1CL7L 3DURB 4BFEA 2MCPH 4X4XA 2QADD 4JJ5B 4XX1E 3IAGC 3CXHJ 4MJ6B 2WK2A 3UJTH 4OLXL 5C0DB 5GS1A 3QJHA 3QXAA 2EDBA 1B9ZA 3H3PH 1N64L 1NKOA 1K5NB 4DN3H 1GZQB 4OUUA 4PJHF 2AJZA 2ZKHH 2JJTA 3FO2B 4JY6A 5M7QA 3IKKA 1LE5A 2E8YA 5EIIB 4CUCA 1IGTB 3ULVL 3JVGA 1OTUC 2VDML 3QCTH 1FH5L 4I18C 2X10A 4GRMA 2G5BB 3FRPG 5IB3A 1DLHA 1KCUH 5FKPB 4YZFF 2EDWA 3GJFK 1ZLVK 2RB8A 1H3GA 5FECA 4PJCF 5FGSA 2R56L 4QXTA 3CVHL 2NW3B 4KMTL 1TIUA 4RDQF 2PW2A 2FB4H 2A74A 1F4XL 1KXQE 4QRRB 4Z7UB 4ZUUA 3UZVB 2I60L 3BAEL 4OBRA 4EDXB 5I1IL 1WTGT 4Y1AA 4ISVA 5F96H 3SGDH 3SO5A 15C8L 3GGWB 5EU7C 5ADOL 1I8LA 3FCTA 4AIOA 1AFVL 5T5FL 4S11A 1CWVA 1IEAA 4QHKI 4NQCB 1ZVHA 1XF2B 4TSCL 1D6VH 5KAQG 1R24B 4LSVL 3QUXB 4GKZB 4HIHA 4U1HB 3HI6H 4ENED 1JPSH 1U3HC 2YSSB 4NPYA 2IWGA 3QRGL 5DS8B 3C60B 5TGBA 1ZTXL 1UB6B 2BRQA 4HAFA 4JGMA 4GRLA 2DQDH 3V5KA 3F7VA 3QDGE 4NZUL 5FO9B 3IDYC 4RZCA 4JVWA 1E0OB 3U4AA 4TUKH 1G7IB 25C8L 2CDEA 4XCFH 4ZSOB 3TYFB 4JANB 4YHKH 3HMXL 3JV6B 4FQIH 5B3NA 3VGDA 4TVSa 5J4MA 1CG9B 1RURH 5HGAB 3V7AG 2NY3B 4F7EB 4ODHH 1H3TA 1NGWB 1IGFL 2FDBP 5T33H 4EJ1C 4PRPD 4XP4H 3UBXI 4L1DA 4JFZL 3O3EA 5KG9A 3ZT7A 1Z9MA 5K9OA 1NGQL 3P4MA 3ZE0E 4G7VH 4KTEH 1H9VA 3JWOC 1DVFC 3EYOA 1D5BA 1L9NA 3G5VB 4K3DH 3WLBA 4OGAD 4TOYL 4MVBC 4I0KA 2GITB 1J10A 4WU7A 2R15A 1ZANH 3F7PC 5A43C 3WFEH 1Y6KR 2PN5A 1ZGLP 5AZ2L 4AM0A 3PWNB 4Y4FB 2O61A 2WWKO 3S4SA 2ZOKA 5JDJA 5H94B 1U8KB 1GH7A 1JWUA 1MCQA 2D0FA 2R1WB 4XNQA 3KG5A 3SEPA 3L5WA 2X41A 4G6MH 4DOHE 4RCAA 4TTDC 4CU8A 1II4E 3QHFL 3TCLA 3TZVD 3SN6N 1SVCP 4YNYB 4ZS6C 2J7LA 4PJXB 1RK1B 2YR3A 5GGVY 4K7PX 5IB5B 1PW3A 2VZSA 4Z76B 1SEBA 2PR4L 4Z8FL 3PL6A 4GBXA 5D7IB 3T3MF 1NSNL 4JRYB 5CKGA 1MCHA 4Y2DA 1MCJA 4R7DA 5HYQB 2F53D 5IB2A 1OGTB 1J1PH 4HF5H 1GGCH 4PY7A 2E7CA 1BJMA 4ODTH 5I2IB 4G8GB 3V6FB 3PHQB 1FIEA 2R0LH 1G6RH 2DD8L 1KGCD 5GJTL 4CMMA 4N0YH 4I3RL 1M6OB 2EIDA 4HFWB 1OCWL 3LN9A 2C4XA 1HHIA 1AGDA 4JO4H 3NZHH 4RGND 1WEJL 4NKMA 3R0NA 1MHCB 2NX5B 4DVRH 1KPRA 3BWUC 5E2WH 1OWWA 2HT2C 4PRAB 3W82A 1MCRA 2EDRA 2W59A 4LVNC 1PX4A 2DMCA 4ZUTB 3NAAL 1MJ7L 3AREC 2RIKA 5AG8A 4FXLA 2NY7L 3P11L 2GFBB 1IL1A 3RBSA 4YFEA 2WP3O 4UIMB 2IFFH 3PABA 1IM3B 1HWGB 4LHUA 3TN0B 4Z7QF 5LBSL 5CBEA 1LEKB 4M8VA 1LK2A 2EDQA 4UU9B 3VFSB 5IUSA 4N9GB 2VLLA 2G75B 2NY4B 4L8CB 1JNLH 2Z4QA 3T65B 5L9DL 1MHEB 1JCKA 2X9WA 5CZKA 1OP3H 4GQ9H 1F4HA 6FABH 7FABH 1EK3A 1KENH 5T1KD 1G7LB 3BESR 1FFNB 3WN5A 2P8LB 4NJAH 5FO8B 3MNVB 4G7YL 5FV2A 2DYPB 1QKZH 4JPKL 2Q86A 4K9EC 5B22A 2EH8H 4F33B 2BP3A 4OJFH 1A1NB 4J3XA 1CICC 1P4BL 4FQPA 4WY7L 4GXUM 5JW4R 3LN4B 3BW9B 2X4SA 3MOAL 1TJIH 1WT5A 5CMAB 4UQ3A 2NR6D 1NBVH 4U6XB 4NWUH 3KPMA 1EEUA 1Z5LA 4DKDC 1SBBA 5JA9A 4JJHA 5TDPB 1V3KA 4NKQB 3NPSC 3LOWA 4XMLL 2IGFH 4XWOC 4M6NL 1I1AB 4NHCL 3AMKA 4HUXB 5LAXA 3QHZL 4M7KL 2P7TA 1I8MB 3QG7H 1JZ8A 1M05B 2VC2L 3BDYH 2IALB 2R29H 1DN0A 4QTHA 3RY6C 3INUH 4DQOL 4I2XA 4NKIL 4RWYL 3TO2B 2QQLH 4HJGB 3DVFA 5IMKB 3UYOD 4DAGH 1A1OA 3CSYB 3CMOL 4NP4L 2QTEA 5FYLE 3GO1H 4IDJH 5CIPA 4KV5F 3OBAA 3ZKMD 2OLDA 3PHSA 4OLVH 3RUGF 3AC0A 1FN4B 1FQ9C 2X42A 4M8QB 4HUUB 5HYJA 4YWGH 1MHHA 1UENA 1EUTA 3SJVE 1UH3A 4N0UA 4O9HH 2R2BB 2W60A 5D2NB 4FQHB 1IQDB 1FG9C 1I3GH 3X12A 1BFVH 3RRQA 1YEHL 1JGDA 5F7EL 1FZOB 2IQ9H 4FG6C 4OAWA 1V7NH 1U3ZA 5IJKA 5FK9B 1FDLH 4JVUA 1S7VA 1UZ8B 1F13A 1DUZB 1N0XH 3PWJB 4FQCL 5GS0C 3BKYH 4M3KB 1A14L 1BZQK 4OI8A 4CNIB 4JO3L 4L4JA 4PGBB 1KFAH 4JFPA 2L0DA 3EOTL 5FDYA 1YJDL 5DC9B 2VL4A 1U8PA 3ZHLA 3GFUA 4P23A 4KZDH 3TJEL 1F97A 2I5YL 2ITCB 3GMPA 5DTFA 4QRPD 3QXDA 3W0WB 2GW5A 3MV8D 5IIEA 3MYJB 3QXWA 3BE1H 3DXAA 5HXMA 5I66A 3VGFA 1ZHNB 5D7LE 4EN3B 4JQIL 3MROB 3AS3A 3LSOB 2CLRA 4Q6YA 1T2QL 1OAXL 1KC5H 1GC1H 4OZHA 4FQXD 3WCYA 3CFIC 4QRTB 3NA4A 4XPTL 3FFDA 1QLEH 1BECA 3E3QE 1U8JA 4TNWF 5E8NA 3PXJA 2PYED 5EBLA 5GJSL 1FNFA 3QI9D 1MRFL 3NCJH 5BVJB 1KTDA 1DSFH 1WWWX 5DUPL 3AS0A 1VFBA 3DX7A 2YOCA 1AHWB 4KGJA 3TT3L 5E6ID 4G8EB 2AVGA 1G7MB 2HTKD 4AENA 3ULVF 4XBPA 4UTBL 3FN0L 3G5YA 5FA4A 3U48A 2ZCLH 1A6UH 3HE7C 4KK5C 2JLLA 5FM5M 2YD9A 4PRHD 2P46B 4GLRI 1D5XB 3SY0A 4P59H 3DIFB 4V1DB 1RIVL 3TA3A 3MLYH 4X6CA 1ZAGA 4RBPK 4CU7A 2PO6C 2VR4A 5D1QC 5HDOA 3FFCB 5T3XD 3FQTB 4OF0A 2FEEI 5HHXL 5HPMA 3KXFB 3MV7D 1MY5A 4N8CL 1N5YH 5T3XL 3EGSA 3Q0HA 3H6JA 1UWXH 2AABH 3C2AH 4P2QA 3WXVH 2MFNA 4JQVA 4HS8H 2B2XH 3CUPB 4K2UL 3QIWB 4I0CC 4HHAA 1P9MA 4MHHG 3GKWL 1BBJB 1URLA 2OX5A 4R96A 3RKPA 3TO4D 2VAAB 4GG6B 4JG1L 1NC2D 1IEBB 1CLOL 3N1FC 3OAUH 2FLRT 3FT4A 1OGAD 1RQ5A 2HWZH 1XZ0B 4XC3H 3PJSB 2W0FA 4ZTPH 1AO7B 3JTTB 1AXTH 3KLAA 4S0TD 2X4TB 1HHKB 4X7DC 4JPVL 3ZYOA 1I7RA 5I0ZA 1FZMA 2YRPA 3QQ4B 1KEMH 2G60L 2VLRD 4KPHH 2YWYA 4JO2H 3GSRA 5DUML 2F54B 2FX7L 1FL6B 4JRXE 3WKML 4WW1A 1A7BA 4QHNB 3P3YA 4KMLB 5DT1L 3UTSD 5D70L 3BPOC 3QQ9D 1JMXA 3OGCA 5KS9B 3N85H 3ZYJA 4CJ1A 1TQBB 2YUWA 4W4NA 3LDBB 4MAUL 4U1KA 1B0GB 4TUOA 1F45A 3O6FA 1AR2A 1Q9OB 3VFVB 3CFBA 1FL5A 1DL7H 5GGSY 5L7XH 4HK3J 1DQQA 2VITA 2Y6SD 4B41A 1EO8H 4WDIA 1R0AH 3I6KA 1IAOB 1ZGLA 4PLKC 3UX9B 3MRLA 3H42L 2EDXA 3ZT6A 3E8UL 4XH2A 3C6SA 4GAGL 3ILPB 3MBXL 5ICYB 1A5FH 1OSZA 2VISB 3BZFB 1QYGL 5DR5H 2ZJSH 5DJCB 4DTGH 2QL1A 1T0NA 5E08H 2DIBA 4HKXA 4NRZA 2KKQA 1GGBL 1INDH 4PRIE 2DBLH 2E9JA 3FB8A 1P7QD 3T2NH 3V79C 4L8BA 5F72S 2B1HH 2RCSH 2NY1C 3OR6B 4QXGL 4JFFE 1HYSC 3OG4B 1X5FA 3DPBA 3MJGX 5HGHB 4OZGF 3U30B 4PLNC 1MWAA 4BQCA 3C09C 5FUOH 5FO7A 1IBGL 2A73A 2XPGA 1A3LL 1QP1A 3SKNB 1MVFA 3MNZB 4PTTA 5JA8B 1WBZB 5KVGL 2O5YH 3EYQC 1PGRB 4JN1L 3QUYA 4MDIA 4MSWA 5FFLA 3LRGA 3LMJH 4R4NC 4U1MB 5D6DC 5H2BA 4K7FB 3QJFB 3TNMB 2VDQH 3KPLA 1A2YB 2FD6H 2WAHA 2ORBH 3AU1A 1XGTA 5JHDE 3D85B 4PRDA 1T3FA 3QIBA 4NCDA 4EVNB 1FGNH 1F11A 4L8SC 3JWDH 5D9SA 1UVQA 2QV2A 4NNYB 3SDXF 2CJUL 4RISL 3L7EA 3VXUA 3L3GA 5L2KD 1UC6A 5ALCH 4P9MH 5C9JA 4JCMA 2H32H 4NQDE 1KT2B 1CE1H 3HC4L 5GGSA 2H6PB 3L6FB 1BQHB 1OSPL 4NZTH 1RUKH 3QNZB 3VI3E 4I18B 4YUEL 3SKOA 2ZCHL 3PNWB 4K8RL 3DVNB 1ETZB 3FQXB 3LQMA 3L95A 1W72A 2D31B 1S78C 2QSVA 3BWAA 2IPUK 3RGHA 2EC8A 2ZSWA 3J7HA 5I76A 1YNKH 4NQSB 2X70A 4ODSH 5F7KC 2X4QA 1N8ZB 3OSKA 3PV6B 1OPGL 4TVPH 1NFIA 4UV4H 2ADGB 4YO0B 3DLQR 2W9LA 2YPLB 4UOJA 4EI5A 1LP9A 3K7UA 2JCCA 3TBWB 4HK3N 5IF0B 1R3IH 3WEXB 3FQWB 1J86A 2X4NB 4QT5A 5IFHH 3RWFA 5C0BE 1KF9B 3MRGB 4XMPL 4X4YA 5T3ZD 1U3HB 2VO5A 1MCDA 3OZ9H 2R4SL 2VQ1A 2F8XC 2DQIH 1IRAY 4MD0B 1VKXA 2PCPB 1I3UA 5IFJA 2R1XB 2VLJB 2VXTH 3IFNL 1U2HA 4WFHE 2DWDA 4OGYH 1F3DJ 1G9MC 1H8SA 5I19L 4NQED 3G9VA 3RIFK 2NYYC 1C12A 3PWPD 2HFEB 1U0QA 4LSTL 4L4TB 4RIRA 5JXEC 3FN9A 4CVXA 4U1SB 1LO4H 2W0KA 3BQUA 1OAYH 3MRNB 1W0WB 4OFYA 3ARDC 3L5XL 4H1LB 1IAKA 5DJXA 4F2MA 4FFWC 4OCWL 4Q74A 4OGXH 1EJOL 4WI3A 3V7MA 1GSMA 5IT2L 5ERWA 5E2JA 3VWJA 4P4KC 4F8QA 2YS4A 1X5IA 1YEEH 2AXGB 4S1QL 2IH3B 4C55A 1GIGL 1WITA 1DVFB 2HLAA 4X6FA 3RBGA 4AT6B 4OB5H 3QDME 5SWSB 1N3NB 3BZDA 2FBOJ 2QQNH 1MCOH 3CH8A 5B21A 3K2MC 3ULVC 5FYKE 4ZPVB 2AEQL 3I6GA 1F4YL 3BP7B 1CBVH 3DYPA 5EORL 1A3RH 1CXLA 1EIBA 3CXDL 1NL0L 1YMMB 4HG4J 4YXHH 3JV4B 4PGJA 1I7ZB 4LCYA 2PXYA 1FE8L 1UXWB 4KY1L 2M8XA 5ISZA 5JPMB 5K9KB 3VG0H 1E6OH 3MRIB 1RZFH 1X5YA 1ODAA 4C56A 4PFEA 1Q94A 4HJJH 4Q9RH 4D0BB 5JPNA 5JLZA 3QEHB 4U33A 3VH8B 4Q9QH 4MD4B 3VXTB 2Y72A 3OG6B 4U7SA 1Q72H 3NCFB 5C0FB 1PSKH 1RUML 4LF3B 4O2FA 4Y4HB 2D03H 3UPRA 1KPUA 2P5WA 3JWNC 1IGYB 1LNUA 2EECA 1P4LA 5CFHA 4M7LT 1DUYA 2A1WH 4JZJA 3RVVC 5ESAB 1NH6A 3QPQD 1CGSH 2JE8A 3DMMD 1BBDH 4Y5VC 1QSEB 1S9XA 2XZAL 3VGAC 4CVWA 3S34L 2V17H 3O2DA 4P2RA 4UNUA 3WFCH 1N2RB 3EYUH 3SQBA 5MI0C 3DGGB 2RQ8A 1F90H 5FYLL 1BLNA 3V8OA 2XWJB 2EDNA 5DI8A 5F7DA 1AGBA 1L4IA 3BSZH 3T0EC 3AREB 1NGZA 2AJXL 3SJVD 1LEGA 4CVUA 1SM3L 4WI2A 3UROR 2UWEF 3BP4A 5HGGS 1A7OH 4QRSB 4P57B 4EXKA 1UCBH 1BD2B 3HPLA 3RDTA 1KBGH 1JGUL 1UWEL 1XR8A 4R26L 5EU3A 3V52L 5C70A 4LDEB 1KCRH 1ZK9A 1ZLWH 3X3GL 5ADPL 4OSUH 3BJ91 4PR5B 5J11C 4WUUA 3N06B 3MRBA 4F9LC 4P2OC 2VDOH 3HZKB 5DD0H 3X13B 2AJSH 2GT9A 1HK6A 4FQJL 4KUZH 5EBWB 4POUB 1KTKE 2XFXA 2XI9A 3ULUE 5IM7A 1NLBH 1TVHA 2EDTA 1JFQL 5E9DB 5C0JB 4I1NB 2BVOA 3P2TA 1KB5H 4QYOB 1CICB 1KUMA 5EC2A 2IANB 1Q9LA 4O4YH 4GKOA 5JMRA 2F8OA 5DQDH 4BUHA 1AXSA 3T4YA 2OTUB 3KYOB 3HZYA 3U9PH 1RUPL 2MKWA 3PWVB 3RTQD 1RUAH 5EU6D 1EXUA 1U8MB 2X89A 1T03H 3BRDA 2VDRH 3HRPA 4HUVA 5I1DB 4V2BA 3NPSB 2DQEH 3VXRB 3VXOB 4EBQH 4G43B 3UTQA 3AM8A 5FHAH 5FA3A 2ICWJ 2IMNA 2R9HD 3C8HA 4Q6IC 5C08D 4HIIA 4M1CD 5I73C 1P5UA 4XP5L 1YUHA 1EAPA 2XZCL 1NLDL 5BO1H 1A4KA 2R2CA 2HVKA 4I4WA 3IDIB 1PD6A 5DJAA 4WWKB 3PQYB 5EPMA 1FORL 4HV8A 1V7ML 1W2KT 1XIWC 2IAMD 2W07A 4EOWL 3VW3L 1HOCA 5BJTA 5DJ8B 2XNAB 4BSWB 1ZKAA 3UBXG 4PV9A 5FIEA 2X4OB 1CK0L 4D9QE 4PGDA 2NCMA 2OSLA 1U91A 4J1UA 3QFJD 4RFNC 4XCNA 1XEDA 2EEAA 4YFLI 1IM9B 4PIRF 2QSCH 3S9DB 2EH7H 4PJHB 4OD2B 1SYSB 5BS0A 4OLUH 3OKOB 1JRHI 5L0QB 4NQTA 3GIZL 1DEEA 4R8WH 32C2B 4PJBA 1OP3K 4CKVX 5ENWB 4BH8B 2BHZA 2ATPA 3D0LB 3KPSA 5I1LA 3O8XB 3VRJA 3HZVA 3IF1A 4GW5B 1HDMA 2FR4B 1KXVC 2BOCB 1KJ2L 3MUY1 1R5VB 4NO0D 2WLZA 4PJCB 2YK1H 3QDJB 4Y5YA 5CEYB 1ZVYA 4P5TB 1HQRA 1EDQA 3H3BC 3RWHA 1JWSA 4MAYA 4Z5RA 1INEH 3CU7A 1JK8B 4MZ2A 1ULVA 3QNYB 4F7TB 3IDJB 3IJHA 2BSTA 4OQTA 1CFTA 1Q9KB 1UJTA 3DSNA 1KEGL 4PGEA 2AXJA 4WUKH 1YEDA 2IJ0C 3KVQA 4AEEA 4HWBH 4MD5A 4I0PC 5IR1A 2AS5M 4NC1E 5A16B 4YIQA 2R2EA 2CUMA 4P3CH 4CVZA 3EDFA 4HD9A 4ZS7H 4XNYH 5BRZD 4WTZA 3ZE0F 4NRYB 4KTDL 3GBLA 2YD7A 2OR7A 4NOFA 1CD1A 5CINH 5DK3A 2CR6A 1R3JA 1AKJB 2DN7A 5GGUB 2VL5B 4HX1B 4RGOH 2CRMA 1KCSH 5E8OB 1MFBH 5D1ZC 2CLZA 3HE7B 4L9DA 5DK2B 2E5EA 4KQ3L 4IIQC 1P2CA 1F58L 3H9SD 5EU5A 2XKNA 1EHLH 2P8PB 3DX8B 4PD4K 1NBYB 2PO6B 4LRIA 2CD0A 3DUSB 4OZ4A 1EH9A 2UVEA 3IKCA 5C0GA 3UTPE 2RR3A 1MRCL 5MERB 5B8CA 1JHKL 5EA0L 4WIQA 2ICES 5J9PA 2Q1EA 5AD0B 5FM4A 4GG8B 4MA7H 5GGQL 4XPAH 2XA8L 3T0DA 2HFFA 5JR1H 3MXVL 1KIRA 5HBBA 2AERT 3WXWL 4JFFD 1BOGA 4NKOA 2BJML 4MNHB 3MLTB 3TWCH 3WUWB 4WHCA 4WFFE 2LE9A 4GMSH 1PJ9A 4JFDD 4LNRA 4XCCL 3LHPH 3C8KA 4P5KA 3HHRB 3HR5B 3QCUL 1F42A 1FZKA 1KB5B 5DD6B 5TF0A 2VKWA 3GSXA 3CPLB 1YJDC 2P4AB 1G1YA 3VU2A 5I0DA 1XGPA 4APQD 2CPCA 3WIFA 4B7LA 2ZUQC 5IMLA 4OLZH 2FHBA 3MBEC 2DQTL 4JM2F 1MSPA 2GJ6B 3L3DB 3MA9H 4J3WA 1CL7H 4WFGE 1YY9D 4EQ3A 3W9EA 1RZKL 5H35B 1KJVA 2EXWC 4JHBA 4PLJC 4MJ4A 3C6LC 5F7UA 1OAZL 3ARFD 5MENE 4U1JA 3FL7A 2VLME 3TBTB 3CCHB 2YZ8A 4IRSC 4YDJA 3ARQA 1X9QA 3T4AA 2ED7A 3ARBC 3I3BA 4R4FH 4KJYB 3BHBA 3OAYH 3DI3B 3S4SG 2WBJD 1BM3H 1T6VN 5CEXB 2H2PD 3MMEA 1ES0A 3DRQA 4CRPA 3TIDB 5C0EB 3LEYH 5DJ0A 4KQ4L 4XHJD 3VWKA 1S5HB 3UDWA 2P5EA 4X9IA 3QEUB 5HI4D 2H8PA 4M7JL 5L88L 5C09B 2ESVB 1U95A 3TIEA 4EUPA 3F12A 2J5LC 4QNPF 3B9DA 1U8HA 2BRRH 1UA6L 2R56H 1P6FA 3EO0B 1RULL 2FIRT 1TJHL 3WE6B 4M62H 4UV7H 4P99A 5I1IH 4DK6A 4M7LL 1D9KC 1HSAB 1OW0A 4Y4KC 4E9LA 4WU5B 1QLRB 2NY1B 5ADOH 5HYJE 1CFNA 5DRWA 4YDKH 1TITA 3BXNB 4LLYB 4XAKE 4LKXB 3ME0A 5C0BD 2D9QB 2NY2D 3C5ZD 4LBEA 1Q0YH 4LSVH 1HINL 4GAYA 2Y23A 3KPTA 3P4LA 3LQZB 4HH9A 1AC6A 1U8QA 4G6JL 3QRGH 5EBMB 5I1GL 4NZRL 1ZTXH 1B0WA 1U92A 4X7SH 5I1KH 4KK6D 5IWLA 4KROC 4M3JA 3V6ZB 1MCWW 2F19L 5FAAA 4WFHD 4BFIA 1ORSA 3T8XB 4JG0H 1JL8A 5C8JB 4S1DD 5E7BA 4HBCL 5I1AA 5DEZA 4ZUSA 1R5WB 1KCKA 3IFPA 4PRBB 3HMXH 1OF2B 1X3DA 1NCTA 4JFYA 2VSCA 3BIAX 3TGXA 4EDWL 4R4BB 4M5YL 4Y88A 4FZEH 4KJWD 1UH4A 3O2WL 3TT1H 3ARGD 5JOFB 1IGFH 1BFOB 1ED3B 2QKIB 1BIIB 2VLKD 4WW2F 2F15A 3HNTH 1E28A 4L8SB 1UZ6E 3DXAE 4KKBC 3HE6C 4NCC1 4JFZH 4DFHA 5KVMC 5HHME 3E6HB 2Q8AH 1NGQH 1A0QL 2CSPA 4RMQA 3E1F1 5I75C 4OZHE 3PE9A 4G8FB 3T0BA 3QDMD 5F97E 5C0AA 2CIIB 3EO1A 3F7YA 4I5BA 3PGCA 1MREL 1ZS8B 3OKEB 5JZ7D 5EUOA 5FYKL 3DURA 2NXZC 3IRZA 5LQBL 4XVTH 1JPGB 5GRZA 1HXMB 4ERSL 5CZXD 1KSRA 5MHSD 5CJ8A 2BNRE 2XWTB 1U36A 3RUGB 1S5IL 3RI5K 3GSQB 1G84A 1CLYH 4PV8A 4JY5L 3RA7H 2DKSA 5HHPB 5HVGB 4YHOL 2I9LB 2SEBB 4ODUA 5EBGA 4F7PB 1DBJL 1JN6A 1S9YB 2KQMA 3VXSB 2PR4H 4Z78A 4Z8FH 3EDJA 3LKNB 1NSNH 2CIKA 5EIIA 4S2SB 4KDVA 4FS0A 3T2QA 4R2GD 3WUZA 2C3HA 2IPUG 3IU4L 4OCMC 5C0CB 4AG4L 1MI5A 4KVCH 4POYA 1GGIH 4PJ5A 4C4KT 1MHPH 2Z31A 4N8VB 4P2QE 1WFUA 1P7HL 2DD8H 3B3IA 1MCEA 2NY0D 4LVEA 4ZNEA 3QNXA 4I3RH 4KKLD 3IT8D 5DJYA 2A6JB 1YDPB 5GSVA 4H8WL 2RGSA 4TNVF 1OCWH 2ZOLA 4QRRA 1CDJA 4Z7UA 4X5LA 1WEJH 5D7JC 3TPKA 1QHOA 1RZIB 3GGWA 3GMRB 1R3KA 4DCQA 1AJ7H 1XF1A 2EKSA 1Z9LA 4M6MH 4J4PD 3TJHD 2XTJE 3NA9H 1XF2A 3QWRD 4WO4D 3GDBA 3ARDB 4L4VE 4U1HA 4NUGL 3GSOB 3QEGL 3NAAH 2YSSA 3GBML 3X3FL 4P4KB 1J05B 1BVKA 5FOBB 3WYRA 4YHPB 2XKUA 4NQXB 4JFOB 2EKJA 1K6QL 4PP1C 3DHJA 8FABB 3QXVA 1HHHA 4OZFB 4W6XB 3TVMC 1EGJH 4JANA 4K8RC 3JV6A 2EDEA 1FGVL 5KSBF 1CG9A 4F7EA 3EDEA 1OQOA 2GHWB 3ZKNC 1T22B 4A6YA 1NGWA 4NBZB 3CVHB 3ULUL 1KYOK 4YHYC 1CGUA 4YGAB 3ECBB 3IXTA 1Q9WA 2BFVL 3HS0B 3MOAH 2NW2A 2VIRB 1J9CT 1FYTA 4LP5A 5D2LE 3RPIB 3U79A 3RGVA 4G9FE 4PG2A 2H1PL 2V7HB 1F00I 1MCNA 1T7VA 2FO4B 3KYNA 4MX7A 5I30H 5K9QI 3VXQA 2IADB 2VMFA 4Y1AD 1REIA 1DLFL 1WBXA 4OCYL 4M6NH 5H94A 3SE9L 2VZOA 3QZWB 3D39B 3SCMC 1C7TA 4NDMB 2R1WA 2Y4SA 3ZDZE 2XZQL 3QHZH 5D5MA 5I74C 3G6DL 3QT2A 3WIHH 1JPST 4Y5VB 2MQ0A 2NTFB 3UTTD 4JFED 2H26A 4H88H 1J0JA 4IRJA 5SX4I 2HJLB 4PJXA 3MJ9H 4KXZH 1RK1A 4RWYH 3VGAB 5BW7C 3REVB 3K2UL 4JAMB 4WGWB 5ELIA 3MQIA 4R9HA 5D7IA 4MGXA 4JM2C 4JRYA 5MI0B 4NP4H 2AJVL 2YD1A 4ELMA 3CXHK 3FB5B 4H20L 3DV4B 3F5WB 3A67H 5CUSL 4BH7B 3WFZA 2EO1A 1OAKL 1AD0B 3T0EB 3V6FA 4HCRA 1EMTL 3MNWB 3QIUC 4KK9D 5F7WC 1A6VL 1QQDA 1ZWIA 4U6HA 5DMGC 3RX5A 4RNRB 5KN5B 1RJYB 4BKLB 1KLUA 4MA8L 1IGMH 4J3TA 4HFWA 3F62A 1MJ8H 5J11B 4FFYL 4MNGA 5F7EH 4MS8D 3RVXD 4P2OB 4Y7MA 1EAJA 5BZWB 1MHCA 4GAJL 1S7WB 2CKBA 2R0ZL 4BQ8A 5DFVD 1YQVL 2OP4H 4FQCH 4H0GA 4ONOA 1H3UA 4UDUB 1A14H 4JO3H 3EZJB 3V0AC 4TQEL 3OPZH 3EOTH 4XWGH 2DQCL 2YPKA 5ANMA 4ZUTA 3S37L 5TF1L 4ZFZA 2DL9A 4PJ9C 2PNDA 2I5YH 1YEIL 3RNKA 2GFBA 2FSEA 4PBVC 4G6AC 2HJKA 4X98A 5CLTA 5BOZG 4FZ8H 2R69L 4ACPA 1H3VA 3NCBB 5EUKB 4UU9A 5ESVA 4N9GA 4U3HA 2WV3A 5GGRY 1MIML 3D9AL 5TH2B 1T2QH 1MHEA 2A77L 1WC7B 4GBXD 4LVOC 4ORGB 4XPTH 2QSTA 1GPOL 4YXKL 4Y2DD 4Q6IB 1J0IA 1G7LA 1LP9E 1FFNA 4OZGB 1Q1JH 2X7LB 2JCCE 1I1YB 2P8LA 3K46A 5I73B 1MRFH 5LWYL 1U8NA 3P0YH 1JGVH 4F33A 3BP5B 3HB3C 4P46C 1HHGB 1RJLB 3RVTD 2LTQC 3FHQA 4KKCC 3U4BL 3P9LB 4JQXC 3STBA 4JLRB 1XIWB 4U6XA 3RZCC 3CFDA 3NGBC 3FN0H 4O5LH 1QBML 1QFPA 5CD3A 3VI3F 1TXKA 5F6IC 1OM3H 1KACB 1VACB 1QO3B 3R06B 3HG1B 3RL2B 4J12A 3L3KA 5I1EL 3V0VB 2GSIA 2J8UA 4YE4L 1FPTH 3KPNA 1RIVH 3LKQB 4RFNB 3EJYC 4ODWA 4WW2C 1MCLA 3CSGA 4DZ8B 3SDXB 1L7IH 1M05A 1HIMH 3V5HA 3WIIH 1GVIA 5T3XH 1T1ZA 3CFEB 3D3VB 5EN2A 1EEZA 3BH9A 3BOVA 3WHE1 3CSYA 3GB7A 4O00A 2DI7A 3RWDA 4NKDA 3GKWH 3MLUL 1UJ3C 1FO0A 5EC1B 4JG1H 4UAOC 5HI3C 5C07D 4WFFD 1F02I 1TCRB 3NIGE 1QSFE 4LHUD 4AIZB 1CE6B 1UYWL 4U0QB 4G5ZL 3U7YH 2WWKT 4GXVL 1E4XI 4A2LA 1JTPA 3DTXB 4UDTB 1LMKA 2AJ3A 3DYMA 4JVPA 1CT8B 4HKBA 3OR7A 3RVUD 3V0WH 4NC0B 4MXWH 3GM0A 1S3KL 1FZOA 3Q6FB 3OX8B 5FGBC 4C56E 4HIJA 3IDGA 5CJOL 5FK9A 3HR6A 2VLMD 5GGRA 3RWEA 5DT1H 5D70H 5GGVL 4YPGA 5HHOB 4KAQL 5D71L 1PLGL 4QWWC 5F3BB 1K8IB 5SV3A 3FJTA 3SE3A 5DYOA 5DK0B 1MH5A 2FATL 1T7ZA 2P5WE 3KLSA 3LRHA 2BY3A 1IE5A 4QHKJ 3TZVA 4JKPH 3J8F7 1HN1A 5IVOA 3QO1B 3IJSB 3UZEA 1YEKH 3ZHKA 3W0WA 4AL8L 4ZOEA 3RVWD 1ND0B 5LXGH 3HMWL 4MJ5A 2X44D 3C5SB 3MYJA 3VFTB 3OMZA 3RWJB 4IIQB 3CFKB 1ADQL 3CSPA 5IBLD 1NUFA 3H42H 3MROA 1JYXA 1HQ4B 4WGVB 3Q1SL 1FP5A 3NFPB 2NXYD 3FB6A 2R0KL 4P2RE 4LOUD 1JZ2A 5JW3L 3EOYG 4IMLA 2HFGH 1EPFA 1PG7L 1QYGH 2W92A 1KIPB 4IRZL 3O3UN 5AAWA 2DWEB 2XV6B 2YA0A 3MCLH 5E2TH 2HKHL 4D0DA 1B4JH 5CD5C 1AHWA 4X99B 1GGBH 5CJBA 3GMNB 1I8IB 2BNQE 4OCLC 2AV1B 4G8EA 4KU1A 1SMAA 1FAKT 1C5CL 5IW3A 3T2OA 5HYJD 3VFGL 5E4IA 2BSED 1J0KA 2WP3T 5ESQB 5SWZD 3MRPA 5A40E 1TETL 3PP4H 4AQOA 2J88H 2YD3A 3BVNB 1FNLA 4WUUE 3R1GL 3VJ6B 3TBSA 2O93L 1QEWB 3VXPA 4XNMB 4DGYH 4MCYB 2MCPL 1IBGH 1XGYH 3X14B 1JYVA 5E5MB 5IESH 3FQTA 3STZA 1OD7A 3MBEB 1J8HE 4DW2L 4JN1H 1N5AB 2LV4A 4NJ9L 5D93C 1G7HB 3B6SB 5DEFA 2IF7A 3MJ7B 3CUPA 3VGGA 3QIWA 4YAQA 1BBJA 4GG6A 1PY4A 4N0FA 2B39A 2EEDA 3IU3B 2ZKHL 5TE7H 4NQUA 4IRSB 1XZ0A 4QOKA 3MJ8B 2PYEB 4MWFA 4QO1A 3ARBB 2LU7A 4XP1H 1WFOA 4FFVC 3WFBL 1FNSL 3JTTA 4RISH 2ID5A 2BVUA 3WNMA 4AYFA 2WM0A 3AGVA 2X4TA 2XQYG 1KCUL 3QQ4A 4LQFL 3HC4H 3ZZ1A 2ATKB 1I3RB 4YUEH 4WWID 2AK4B 4K8RH 1FRGL 4XMKL 5HYSA 4PRHB 4XXCC 4QHNA 4FQ1H 2J5LB 4K94L 3ULUF 5EOCL 2Q87A 5IEHA 1FFPB 4PB9H 1EVTC 5F96L 5F1IA 4HFUL 4HS6B 3WIHA 4ZFFB 2V2WB 2UWEB 4O2CA 1B0GA 3GNML 3EIFA 2Z9TA 4LPXA 1A7NL 1D9KB 4OCNC 2FX9H 5HY9A 4Y4KB 1V8HA 3BO8A 5HYIA 1JPSL 3W5MA 5IQ9B 1NCWH 3HFMH 4W6WB 5IQ7H 3B9AA 4E41B 2C9AA 3F7RA 2JK5B 3EJJX 5BS0E 4XMPH 3NCCB 4P2QD 2DQDL 5C0ND 1JV5A 3FMGL 1NEUA 2GSGB 3GSNH 1FJ1A 3LEVH 2DQUL 4TUKL 2AXFB 4PJBE 4Z7NE 3WO3B 2FHCA 5ID0A 4KROB 4NRXB 4C59B 1TTFA 3BEVB 4HGWB 3L3HB 2Q7YA 3IFNH 1RURL 2UZIH 1AXIB 2HN7A 1B4RA 3FT2B 3CZJA 1MUJA 1HSBA 1EBPA 5KSAA 1RZKC 5IMOB 4POZC 1FV1A 4FN0A 4LAQH 4PREB 1RU9L 4N90D 2HTLD 4LSTH 5DXWA 5IROC 2XTJD 2X9YA 2H2SD 5DSCA 4NO3A 3SGKA 3SE4A 3RU8L 3L5XH 5HGHA 4K3DL 3O4LE 3VXMA 1RIHL 3HE6B 5E00B 4BZ1H 3WFEL 5I75B 1DQMH 1GIGH 3V95A 3EKCA 3GI9H 1WBZA 3P9WB 2AEQH 1I9JL 5DRNB 1H3PH 2AKRA 2NXZB 1F4YH 2H2PC 1JF6A 2QSQA 4G6ML 5CBAB 5EORH 3O6FD 5GZNC 4CL7A 3FRPA 3CXDH 5DJZA 3QJFA 2ADFL 2DOCA 4RMSA 3MSPA 3P9MB 3A0OA 3T0XA 3O45B 4J3OC 3MOBH 4KDTC 1RUQH 1IILE 4G42B 4KY1H 2XIDA 1PBYA 3AB0C 1OAUL 5F7HA 1SQ2N 3CH1B 1FNHA 4NNYA 5E6YA 3QI9A 5DRZB 1HHJA 1OTTD 1GGCL 3WHXB 3VFOA 4ODTL 4P4RB 2OZ4H 4E0RB 2D7NA 4I8DA 3ZHDA 1VPOH 2XWBA 4QCIB 4ZAKD 2IG2L 1G6RL 1BFTA 4I18A 1M71B 3KHQA 3BPCA 3PNWA 3GK8H 3LQAH 3FQXA 1IARB 4LMQI 1XF4B 1UXSB 2A83A 1T21B 1AIFB 3QUZC 1A6WL 4F3FA 1ZLUK 2AW2A 5KVDL 1NANI 1AR1D 3RQ3A 4HT1L 2VZUA 2GEEA 1N8ZA 3B43A 3QDGB 3S88L 5E2WL 4UUJA 4S10A 3MV7A 3OXSB 4JDZB 4KJPC 2YPLA 3H3KA 5D7JB 2F74B 1CU4H 1YN6B 1FVCA 1MWAL 5IF0A 2HLFD 4H5SB 5HDQH 2X4NA 3B2VH 1QVOA 2EE3A 4HEPG 1IKFL 1MF2L 3QUYD 4BA8A 2IPKB 2IQAA 1EZVX 1NC2A 3MGTB 2AV7B 4CW1A 1OGAA 1QFOA 4X7CC 3KAAA 2ZPKH 4ZXBC 3MRFA 5BQ7B 5EULV 1WZKA 2C3VA 1JGUH 5CSGA 2FO1A 2J8OA 2R1XA 1KTRL 4AH2B 4GJTB 2VR9A 7FABL 4HZAA 1S7TA 3BFOA 5HGDA 1SJXA 2VLRA 4NJAL 4KMQA 3T1FA 3VXUD 2BSRA 2WQ8A 4OJFL 1MQKL 2VRAA 4L4TA 3O4OC 1S7RB 1MVUA 1TJIL 5C2BL 1DBKL 3CJJA 1J11A 1ZEAL 2ICWA 1NBVL 4LCCA 4DOHB 1W0WA 4YHYB 3CNKA 1JFQH 4NWUL 5GIRA 4H1LA 3UTSA 5IVXE 3NCEB 3PIQB 3V4PL 2MHAA 2P5EE 4YDIH 4JFQB 5E5UB 5C71A 2IH3A 2AEPL 3W11C 4AT6A 4NQVB 2IGFL 1N3NA 1RUPH 3SDDD 5HI5D 1TZIB 4KKAC 4ZPVA 3QG7L 4HZLB 2QEJA 5FUCE 3G9AB 2GK0B 1HH6B 5HD8C 4L8DB 2ZUYA 3PDOA 4WTZG 4L1HA 3SCMB 4LSQH 2QQLL 5AAMA 4BZYA 5I74B 4U1NB 2L4OA 3F8UB 4YX2L 1NJ9B 2XZCH 3MV9D 4S1SH 3STLA 4B0MM 3BI9X 4H8WC 3GO1L 4IDJL 1TLKA 3AXLA 1R3HB 3DECA 2BOBB 3DX9B 1F6FB 1NCAL 1V7MH 4JM2B 3DNKA 1KIQB 5DJ2B 4ZYKB 5DO2C 5J1AA 2NY6C 2DM7A 4MD4A 2CUIA 3IGAA 3AAZB 1P7QA 2XY2A 3QH3B 2A38A 4YWGL 5C0FA 4LF3A 5K9JL 3O3DB 5GSRB 4LSUL 2Z8WC 2NPLX 1IGYA 1DQDL 4E5XB 1I3GL 3DARA 1RZ8B 2GCYB 3EZ8A 3QIUB 2C1PB 2IQ9L 1QSEA 3LKRA 3BQUD 3UP1A 3P4NA 3EJZD 2I9TB 3OKKB 5LCVL 1RJCA 4OFYD 1N0XL 1DFBH 5ICZA 3OKNB 3VWJD 1RVFH 1S9WB 1A21A 4HWZA 2Q3ZA 1KFAL 2HT4C 4YGVB 4YQXL 3DGGA 1BVZA 1NFDA 3OJDB 2Z91B 2B20A 1A7QL 5DQ9A 4MJIA 5C0AE 3WS6C 4KZDL 4OQ1A 2OQJB 1E6JH 1KJ2H 4LPVA 4ODXB 4LL9A 1OP5K 3ULUC 5EUOE 3JVGC 4PJ9B 1Z2KA 3BE1L 4NT6A 3DBXA 4TUJB 5KANI 1HILB 3LKSB 3WV0A 2Q6WA 2D0GA 5MEPA 4QRSA 2FBJH 3OGOE 2PXYD 1P1ZA 1JGEB 3LIZH 1GC1L 1MLBA 1HEZA 4M61A 5MP6L 5L2KA 1T7XA 1ORQB 4FXGB 5ISZD 3KPRD 1NKRA 1C5DB 3GM8A 4PR5A 4IOIB 2G2RA 3VFNB 3NCJL 1DSFL 3HZKA 1K4DB 4XTRD 3FB7A 4LVOB 5IW6A 1JRHL 1UM6L 3KS0H 4N0RA 3WD5H 1UZ6F 4ZQKB 1I8LC 3GMMB 2HG5A 4IMKC 4FABH 5IK3B 5C0JA 4P46B 1R6VA 2ZCLL 3CLEH 1CICA 3DMMB 4P5MB 3ARZA 4OZHF 2LTQB 1MI5E 2IANA 4PJ5E 1WAAA 5KSVB 1T04B 1NCBL 3M17A 3RZCB 3VDCA 2OTUA 3NGBB 2YEZA 4KI5F 5JQHC 5F6IB 4WI6A 3MLYL 3PV7A 4ZNEE 3N1MC 3B9KC 4KQ3H 1FFQA 1U8MA 4G8IB 3SDCD 4GRLC 5I1DA 5A2KH 1PKOA 4WHTA 4Z7UE 4L9LA 3VXOA 1S9VB 3BN3B 4P2RD 1N5YL 2XN9A 1A8JH 4UQ2B 4U0RC 4F37K 4LSSH 3GSNA 4WW2B 1NAMA 3C2AL 1QOKA 4P3DB 3SJVB 3TNNA 1PAMA 1NCCL 1FC1A 1HH9A 1MRCH 5KVFH 1U6AH 3MLZL 5EA0H 3QBTB 3MRCA 4X5WB 3ARUA 4DK3A 3IDIA 2G9HB 5GGQH 4U7KA 3OAUL 3PQYA 4DVBB 3IDMB 5CJXC 4ETYA 1NC4B 3MXVH 3IFOB 1SJEB 4KHTH 4XC3L 4HG4K 5DJ8A 2DKUA 2P8MB 4BSWA 4LEOB 4ZTPL