3QORC

Crystal structure of human nuclear migration protein nudc
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
117
structure length
117
Chain Sequence
SKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIADGAVVTVHLEKINKMEWWSRLVSSDPEINTKKINPEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding, cell cycle
molecule keywords Nuclear migration protein nudC
publication title Structural Features and Chaperone Activity of the NudC Protein Family.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qorC00
3QORB 3QORA 2WJ7A 2CR0A 4M5SA 2O30A 3AACA 4YLBA 3GUFA 2WJ5A 4M5TA 5LUMA 4MJHA 2JKIS 4ELDA 3VQLA 1RL1A 2N0KA 2XCMC 4YDZA 4YL9A 2KLRA 1GMEA 1SHSA 4FEIA 4JUSA 3Q9PA 3GLAA 5DS1A 3Q9QA 2MNWA 2CG9X 2Y1YA 4YE0A 5DS2A 3QORD 4YLCA 4JUTA 3L1FA 1EJFA 3IGFA 3N3EA 4ZJ9A 4RZKA 1X5MA 4I88A 1WH0A 2RH0A 2Y1ZA 2K8QA 2N3JA 3EUDA 4PCKA 3AABA 3L1EA 3VQMA 3QORC 3J07A 1WFIA 4PBDA 3L1GA 2KMWA 2BOLA 2Y22A 3W1ZA 1WGVA 3GT6A
chains in the Genus database with same CATH superfamily
5GZND 4ABVA 4ZNCD 4LSSH 5DMYA 3MLVH 2MWCA 2GJ6B 4OCXH 4D9QD 4NT6B 2GJ6A 2BS71 1CYGA 4NT6A 2WZ6A 2X2HA 3IGUA 5CM1A 2DBLH 4XP1H 4R97C 1JXDA 1MIEH 2YAQA 5D7JD 2FX8H 1YNLH 3EH3B 4HS8L 1GC1L 4YBLB 4NX0A 4F7EB 4KROC 1CT8B 4L5FE 4F7EA 1CN4A 1CT8A 1GY1A 4LVNB 1A21A 3S7GA 5D4JA 5J06A 3T1WA 1ADWA 1FIGL 4LVHB 2R56L 1MJUH 1TZGH 4B96A 1QBML 4A6YH 1CE1H 5DUPL 4O2FB 2A73B 4O2FA 1R5VB 1CGSH 4N0UB 3QUKB 2P43B 4N0UA 3QUKA 5JXEA 1QWNA 2HFEB 3EG9B 2HFEA 3EG9A 1MPAL 4LKCB 3QA3B 2Z8RA 4LKCA 3FFCD 2XWTB 3QA3A 2G60H 5HDWA 2XWTA 3L4CA 4J39A 2QEJA 5A2LH 3D39B 5SWZE 3ULUF 4RISH 3D39A 4KKAC 3IDNB 4IIQB 3OPZL 2QVFB 3IDNA 4IIQA 2B2XL 2YAMA 3L4WA 1DJWA 1T5WB 2JMRA 5IVOA 1T5WA 3P0YL 4FXGC 4EKJA 5KYYB 1LO2H 3FPYA 1JN6B 5KYYA 3K5RA 1JN6A 1NCJA 1NCDL 4PGCB 2BOLA 3S4SA 1B6DA 3GSQB 4PGCA 4BZ2L 3GSQA 3CZLA 1U8NB 4Y4HC 1U8NA 5BMFL 3KCPA 4UCFA 2E4TA 3PJSB 2ESVE 2LABA 5ICUA 1OSYA 1L9NA 3PJSA 4DO5A 5F7DB 2MNJB 5F7DA 4JG0H 3SGKA 1JL8A 4A2LA 3FU7B 4C8XA 3FU7A 3TM6A 2IFFL 4N5UA 2HMIC 3LPPA 1JD9A 2B20A 15C8L 2XWBB 5BO1H 2XWBA 5EOCH 1JF6A 3P54A 5DJCB 4UQDA 5D96C 5DJCA 4UT9A 5H4YA 1WFMA 4R26H 3MN8A 3N85L 2EDHA 2P5EE 4BCZA 5I2IB 5LGHL 5I2IA 5JIMA 3K80A 5B1AB 1MI5B 3HRZB 1MI5A 2YGQA 3HRZA 5MEOA 2ZX9A 3A4DA 3QAZC 3QYMA 2X4SA 1NCTA 2M1KA 1AQHA 1FJ1B 1FJ1A 4WQOA 3DX4A 4ZD3L 2ORBL 5T3ZL 5C2BH 4RRPG 1TUPA 3V4LA 3ARBB 3ARBA 1P4IH 4LASL 1PAZA 4Y1SA 4P49A 3Q3GB 4DP1X 1NOFA 1YAIA 4XNAA 2GVYA 5FO7B 2IPKB 3LS4H 4FXKB 5FO7A 2IPKA 3Q5TA 4FXKA 1NGXB 4OZHA 4RAHA 5F9AC 1NGXA 4QOKB 4HJ0D 4QOKA 3OGOE 5DGQA 4RGNE 3T8MA 1PSKL 2I24N 1P9MA 5AOLA 1ZPLA 4LVEA 1A1OB 3L7FB 1A1OA 5ID0B 2Q1EA 5ID0A 4JL2A 4HPHA 5DMIL 3W9DB 1I1AD 1XQ4A 4TYUA 3W9DA 4PRID 4XT1C 5DQJB 1MCLA 5HDRA 3UCRA 5CJOL 1GL4B 2KI6A 2WM0A 3HZKB 3HZKA 1PG7X 4CW1B 3ABMB 3BAIA 3V2AR 4CW1A 3HHSA 1KGYE 3G6JE 3GXDA 4WJ5B 3LZFL 4Z7QB 3MRHB 3FK3A 4WJ5A 4ONFH 3MRHA 1DR9A 4FQ2H 1U8MB 5BUPA 4NO0B 1U8MA 1PLGL 4NO0A 1U58B 4R96B 1BZOA 1YQVH 3Q6GL 1U58A 4R96A 1TTCA 1P69B 2AQ2A 5IVXF 3IGFA 3SKOB 3UYRH 3MNMA 4K9EL 2FWSA 1EO7A 4L3AA 3RVTC 3ZDYB 3I2CH 1N67A 3ESOA 4HMEA 3MOAH 3WDIA 1TTGA 1BLNB 1BLNA 2DJSA 1LO3L 5T3ZD 5E9DD 1BYNA 2BVUA 2VDOB 2HLEB 2EDWA 3GTTA 4HFUH 4ZZFA 2LT9A 5HPMB 3EJYD 1BQLH 1HU8A 3X12B 1EHXA 3X12A 2X2YA 1UA3A 3MOBH 1K8DB 2GIXA 4XNYL 5AZEH 1K8DA 1BLIA 3RX7A 2OP4H 5F9WC 4J3WA 2PO6D 3P3YA 5I8EB 1TMCB 4XC1L 1NWOA 1I9JL 2ITEA 4FFYH 5I8EA 4JFZH 2CK2A 2XG5B 3LPWA 2B1AL 2XG5A 3IMSA 3QEGH 4Q9BA 4UDUB 2LU4A 3QAQA 4UDUA 4BZ1L 5AVTB 3E8UH 4AIOA 3VFGL 3VFOB 1KELH 3VFOA 1MRDH 2YQGA 2AJUH 3MR9B 4Q0XL 1FNLA 3MR9A 3ZJAA 2ZCKH 3FTWA 4U7MA 1FL6B 1KBVA 1FL6A 4L1LA 4OF8A 5IW6B 1A9EB 5IW6A 4XP6L 5T1DL 5HHOB 1A9EA 5LUMA 5HHOA 4MJHA 4H1LB 5GISH 2IWEA 4H1LA 3X1FA 1U3NA 3NSJA 3BH9B 3BUIA 2VDRB 3BH9A 1I3UA 3NGBC 4NXKA 4WO4B 4WO4A 5E6ID 3ZVVA 2DWSA 2O61B 2O61A 3L5IA 4TQIA 5DS2A 3WO4B 3DOIA 5BUGA 2X4TB 2VN6A 2X4TA 3FUMA 2IAND 1J1PL 3K4DA 4TV3A 4KKBD 4A37A 4XI5D 5IHZB 4YDNA 3GI8H 4HKXB 5IHZA 4Q9RL 5GS3A 3BE1H 1EJOH 3KPOB 4FFZA 4HKXA 2D2CC 3KPOA 3NIFE 1IE5A 4AC2A 5EV7A 3AMKA 4XX1E 5DZPA 4PH8A 2L7QA 3TWYA 4ZMZA 1Y18B 2O26U 1Y18A 2D7TL 4J4PA 2QSTA 4XMZA 3OXRB 4HIEB 3EUUA 3OXRA 4HIEA 2CWRA 1OTTC 4KJWC 4U33A 1GYAA 4XVTL 4QXTB 4N8PA 4QXTA 4Q2ZA 2Y24A 5D6DA 5PAZA 3BZDA 1AHKA 3S35L 2Q3XA 1SY6A 4HS8H 1GC1H 2OCCB 5KJRL 2A9BA 3KLKA 3A67L 3DV4A 4X8GA 5IQ7L 4AIXA 4PCTA 1X5MA 3DPDA 3WY2A 4XMPL 5MP6H 4AENB 2R56H 2L7JA 2Y1ZA 4QNPE 4AENA 4OCLC 1QBMH 2G5UA 5DUPH 1DBMH 1T0OA 5EULV 1HDMB 1LO4L 4PJAF 4BFOA 4PAZA 1Z9OA 1MREL 3ZZQA 4PTTB 1FLTX 3IGKA 1MPAH 4PTTA 5A43C 3WLWD 3MREB 3MREA 3D0AA 1ZTXH 4M02A 4Z1PA 2GABA 5F88B 3ARVA 3HS0B 5F88A 3HS0A 4EIBA 1HXKA 2B2XH 3GMRB 5FYKU 2OA9A 4ZOBA 1WIUA 5TPWL 3VGFA 4AITA 2LTQC 3ZRCC 4PRAB 2O4EA 4PRAA 4BZ2H 3FQUB 1XF5B 1QUNB 3RNQB 3EAKA 3FQUA 1XF5A 1QUNA 2BOBB 3JVFC 4ZOAA 1KV7A 2NR6D 2BOBA 3RNQA 4EAEA 5I6NA 2EEFA 1ONQB 5IMMB 5AOIA 1ONQA 5IMMA 4QJ4B 3KWVA 4P5TB 4N26A 4W81A 3GWJA 3LZRA 4P5TA 3S4SG 2XSKA 4WEBH 2OZ4A 3GRBA 4AC4A 4G82A 3MRRB 3T1FB 4LHJB 3MRRA 2IFFH 2E59A 3T1FA 2HZHA 3VM5A 2J12B 1UFGA 2BXZA 1KGCD 2CO7B 2CO7A 2XOTA 5HD8D 3EJTA 1AI1L 4NQEE 5D4IA 3TEUA 5EPMB 5EPMA 15C8H 5C1MB 3W56A 3K81A 4TQHA 3TCXA 4MJID 3CDZB 4NSKA 3ATFA 4XOAA 1GJIA 5TQ2H 3QNXB 3LHPH 1A8JH 3CN1A 3QNXA 1T7XA 3N85H 4MBRA 4UQIM 2FYVA 3FPXA 5LGHH 4R83A 2H3NB 2VZTA 4ODUB 3SDXE 2H3NA 4ODUA 2C1OB 4QR7A 5B39B 5B39A 2C1OA 3BZ5A 3R7QA 2GJRA 4YHZL 3C8DA 2YD3A 2N4IA 4OGXL 3CFJB 4WKZB 4WKZA 2P4AB 3CFJA 5JXAL 4ZD3H 4Q97A 4AGMA 2ORBH 4NERA 5T3ZH 4JRYB 3KYMB 4JRYA 3KYMA 4YPGB 4LASH 4YPGA 1ZLEA 3RDJA 1GOGA 3IU3B 4ALAL 4N0YL 3IU3A 2EDDA 4KI5E 4A39A 4PJ8A 1YYCA 2ICWI 1AMYA 4LL1A 2MH4A 4KKAD 3QHZL 3VD0A 3B4NA 5LWYL 2H8PB 4GQQA 2H8PA 3O0RL 1SZNA 5ITBL 4OGAD 4BZYA 2OMWB 1PSKH 2OMWA 2RALA 4NQCB 4NQCA 4FNTA 3HLAB 3TEXA 1AKPA 3HLAA 1NMAL 3PWPE 1DVYA 5DMIH 2GHZA 4Y4HD 3S6CA 3GNML 25C8H 4PJ9C 3UJTH 1Z0NA 1J18A 4ZFOB 4AM0B 4ZFOA 4AM0A 3QEHB 3U4KA 2MNUA 3ATBA 3LZFH 3QEHA 1XV8A 4OAWB 4QRPE 2IGTA 1PLGH 2IDUA 1DVTA 4BSJA 2BCKA 4BFIB 4BFIA 3SBWC 3TESA 3VFUB 5KBPA 3VFUA 3T3MB 3DMMC 1AS7A 1ZSDB 2HT2C 1ZSDA 2JV6A 1RHHB 3GT6A 3QDMB 5AB1A 3DUSB 1RHHA 3DUSA 3OAZH 4PJEE 4XNYH 4OLYH 4HBCL 5EOQL 2TRHA 5ACMA 1U8IB 5KZCD 1U8IA 4QCIB 4L05A 2NNAB 1VA9A 4FHBD 2BIIA 4ZTPL 2NNAA 1JCKA 3TU6A 2B1AH 3D9AL 3L6FB 4BZ1H 4FQXA 3L6FA 4H25B 1DVSA 4KRMB 4H25A 1HH6B 3PS6A 1KCWA 4IBLT 3VFGH 5BS0E 3DJ9A 5IBUG 2PCPB 2I9LB 3CX5K 2PCPA 2I9LA 2WB1A 5JDSB 5CGYC 2DI7A 3VX0A 3G9VA 5JDSA 3QORC 3C60C 2YD1A 1WTLA 3I74A 3L1GA 4PJ8C 2LLGA 5ADPL 1VZHA 4GXVL 4Q6KA 4O51B 1NIBA 3QVAA 4LT7A 4O51A 1X5FA 5I1DA 1UACL 5I1DB 1A6TB 3OJVC 5EZIL 1A6TA 3VI3E 4LPTA 1P4BH 3UTTE 3O4LD 5F8QC 3UZEC 2WLHA 2C1PB 4P3DB 4S0TD 5K9JL 4XNZB 2C1PA 4P3DA 5DVLA 4ZQTA 4H1LG 3LDBB 2AERT 4S11A 1N70A 3EXLA 4Q9RH 3F2LA 2XA3A 4M48H 2BW5A 5DHVB 5DHVA 2F9BT 4XAWL 3BZ4B 4DGVL 3VGAC 3BZ4A 2E0PA 4GJTB 1CDHA 1OCZB 1HAWA 2BY2A 1F4XL 3AAZB 4XVTH 2X3CA 2PYEE 2EE3A 4FYQA 1E3FA 1D7DA 2VW7A 1S3KH 1NFIB 3A67H 1NFIA 5IQ7H 2YD0A 4MA7L 4XMPH 3QXTA 5ILTH 4KHTL 3T0EE 4DUVA 2Z91B 1ET8A 2Z91A 3B8SA 4XMKH 1JCVA 1LO4H 3FT2B 5EZJB 3FT2A 1SOSA 4NQXB 5EZJA 4J3UA 1V3KA 4NQXA 5I74C 1MREH 2YQ2A 3TC9A 2AVFA 1KCBA 3WXVL 1P84K 4DKTA 3ABGA 2DQ6A 3C8HA 2I07B 4DTGL 2I07A 2QDVA 4FQXC 4P2OC 1OW0C 5IEHB 5IEHA 4RSVA 5TPWH 1KFGA 4O02B 4O02A 4YE4H 4GUQA 3BSZL 4K3JL 5J13B 3IMVA 3N42B 4E41D 2XC8A 2EYRB 2EYRA 4YXLL 4FYSA 2WXGA 2CJSA 4PJHB 1CFSB 2C7FA 4PJHA 2FECL 4F8TA 1HHGB 1HHGA 5CZXC 4I3RL 4X5QA 3VGDA 3ASNB 3MJ7A 4Q4EA 5AKRA 1AI1H 3ML9A 4AI7A 2KPWA 2ENPA 3N0PB 4NCDA 2X9ZA 4ZUTB 2JI2A 3NAAL 4HAGA 5MENE 1IL1B 5CLWA 3UXFA 1IL1A 5ICYB 2P7TA 3C6LB 4YWGL 5ICYA 1FF5A 1BQ5A 2OMNA 3C6LA 4HH9B 2VR7A 4HH9A 4WI2A 4KJWD 1OTTD 1F2QA 3QJTB 1QR1B 4M7JL 3QS2A 4PLOB 3HE6C 1A7QL 3HA0A 3OB8A 4M5TA 1RZQA 3KBEA 1J11A 5D1ZB 1VZIA 4BA8A 5D1ZA 1Q94B 1D3CA 2IQAB 1VF5C 2Q7NA 2W0LA 2IQAA 3GKZA 3MRFB 3MRFA 4YHZH 4I1PA 4B9KC 4HP5A 4HV8B 4RMTA 4HV8A 1MCFA 1HCYA 1SHSA 2WV3A 3Q9PA 4OGXH 3SSGA 2MCG1 3APNA 3NZ8B 4NOFA 4ZK8A 3NZ8A 1QG3A 2Y36L 1ID2A 5B39G 3FBQA 3P30L 3RG1C 4TTGA 2AMGA 2PN5A 5E5UB 1CPUA 3GSNB 1B90A 3MLTB 3GSNA 3MLTA 1Q1JL 1OZTG 4N0YH 1JZ8A 4YQXL 1XCWA 1D6VL 3H55A 1FVDB 4ZW6A 1FVDA 4PLJD 2HCZX 2YAHA 4YBHA 1FNGB 3QHZH 2QQLL 3KGTA 3QYCA 2OSYA 5LWYH 3O0RH 5E0FA 4G1MA 5BRZE 4K73A 4Z7QF 2WLJA 3V0EA 4JPVL 3AC0A 1JZ4A 1OWRM 3TBYB 4UV4L 4AGNA 3NBNA 3TBYA 3IDMB 1NMAH 3IDMA 2JB6B 3V0JA 2JB6A 1S7UB 3RVUC 1W8OA 1S7UA 3SYQA 3ILDA 3ZDYF 3D3VD 2EC8A 3GNMH 1F42A 4ZO6A 4EJ1C 1HX0A 2GIYA 4BXVA 3US1A 4E5XB 2FX9H 4E5XA 1WV7T 3IRPX 3FT3B 3FT3A 1S7WB 2IXQB 3S3JA 2FIKB 1S7WA 2IXQA 4OD1H 2FIKA 4J3OC 2V0AA 3LD8B 4OCSL 4TLUA 2XN9E 3B3IB 1GJUA 5D6CB 5D6CA 3BRGC 1RV6X 5E6UB 2F8IA 1VZGA 2QHLA 1L9PA 1DN2A 1ET5A 2MQ3A 4I13B 3V5HB 2C9AA 3V5HA 2OV0A 2YWZA 3V7AE 5C0CB 5DUJA 5DJAB 4ZMQA 5DJAA 2AXFB 1S7QB 3EBGA 2AXFA 1S7QA 4HIHB 4AZ8B 2F7PA 4AZ8A 3MJ6A 2EVIA 5GS0L 1GS6X 2BNRE 5AAWA 4BKLB 5EOQH 2BNUB 3VRJB 1FWXA 4BKLA 1JZ3A 2BNUA 3VRJA 5I17B 2F54B 1MRFL 1XCTB 5F7BA 4NUPA 2F54A 1XCTA 2JLLA 3MNDA 4JG1L 4DKEL 5L2KE 5EUOE 3D9AH 1FH5L 3NYKA 5DHEA 2BP0B 4WCYL 2BP0A 2JKNA 2GC7C 3HZ3A 4M8UA 1ZT1B 2XHNA 1ZT1A 4TM9A 4N8CL 3JZYA 3K91A 3U4BL 3GI9L 2DLGA 1N0XL 4GXVH 3S37L 1WE5A 3TP4A 5I0VA 1UACH 4JQIL 4MGXA 1EANA 5EZIH 1JNHA 1KLFB 4PJDF 3EYVB 1KLFA 2J1YA 3EYVA 5CILL 1BF5A 2VQ4A 3BP6B 3AY4C 1CDYA 1YUHB 2NLJB 3BP6A 2NLJA 3OAUL 4OSUL 4R7LA 1HESA 2X5PA 3IFPA 3NCEB 4EI5C 1G9NC 4NPKA 5K1NA 1KXQE 1C1EL 4PJ9D 4DGVH 4LRNL 5DZ9A 4F57H 2L4OA 4UI2A 1OK8A 1KACB 2BSSB 1F4XH 4QHKJ 2BSSA 1A7RL 2XWXA 3EDEA 5GS0D 3GRGA 1AANA 3DTDA 3ZN6A 2VZUA 2E86A 4MDIB 2CJTA 1AZVA 1ZJAA 3MV7D 1G1KA 5CR1A 1ZVSB 3EYQC 1M57B 3CFKB 1ZVSA 4OJCA 1P2CB 3CFKA 4PS8A 1P2CA 3B5GA 3BPLB 3LAFA 4MA7H 2Z9TA 2Z8SA 1RK0B 4KHTH 4WJG3 1RK0A 3ML8A 4PJGF 2HJKB 3DMMD 2HJKA 1U36A 3D85B 2HT2D 3D85A 3NPSB 5CZVH 5H37H 2F2HA 4PWKA 3RURA 1MG2C 4CADA 2FH8A 3B7YA 4OFDA 4NCC1 4YIQA 4DTGH 3FSWA 4PS4L 1M2VB 5CBEB 1M2VA 1RI8A 2ZCLL 3QNFA 3NFSH 4KVNL 1EGJA 3QDJE 4NO5B 1JI1A 1DQVA 2WYIA 3VXRD 5KS9B 4LEEA 2D0HA 5CGYD 2MNWA 3CNKA 3QORD 4JM2B 3C60D 3HN5A 4K3JH 4NKOB 4XZUB 4NKOA 3RDTC 2VMCA 4XZUA 3EO0B 3EO0A 4HWUA 2I26N 5MI0C 3EYSH 1L6XA 4YXLH 2GB2A 5MEQB 5MEQA 4JFDE 4XXDB 1ZVNA 2YQBA 1NLBL 4XXDA 1X5HA 1MAML 4AXWB 4IW4C 4AXWA 4I3RH 4NZ8A 1HSBB 4BINA 1HSBA 1I4FB 5D4QA 1I4FA 1LMKA 3VFNA 2KLSA 3FKUS 4LSPL 5KUMA 4H4NA 3NAAH 1IEHA 4J3OG 2IALB 4YWGH 1T03L 2IALA 1E3ZA 1XVSA 1KGUA 4M7JH 1QASA 1A7QH 4OR1A 5CSZB 4ZT1A 3CD4A 3MI6A 5CSZA 3STLB 5GS2D 3STLA 4LCCB 4LCCA 3AWEA 1BEYH 4M00A 5I1HL 1FGNH 4HLZG 1JGUL 1M7DB 2X4QB 1M7DA 4BXSV 2Y36H 3BT0A 3KWWB 1UWGL 3CPUA 3P30H 4D7BA 1D5MB 1D5MA 5E0QA 4HSCX 3DX9B 3OX8B 3DX9A 1Q1JH 3CFEB 3OX8A 4PS7A 4UANA 4YQXH 3CFEA 3IFLL 3ARFB 3KLSA 3ARFA 5E94B 4AEEA 2AQPA 3OLEA 5E94A 4NAQA 3AW5A 2QQLH 4P2OD 1ZV5A 3A6OA 2AITA 4N1HB 1YMMD 1U41A 1NC4B 4GAJH 4Z7VB 1KGJA 4Z7VA 1NC4A 4WW2B 3ROOB 1TZ8A 3ROOA 4JPVH 3AFLA 4WFED 1M2OA 4UV4H 1RMFL 4WHDA 1J9SA 1NKRA 4M3KB 4AVIA 3BFQG 2JCCE 4MD0B 3NN8B 1KYUA 4HG4J 2ICEB 3NN8A 3NJMA 2ICEA 3ULVF 4FMVA 1XO8A 1YMHB 3PQYE 1YMHA 5A1AA 1KY7A 3T3MF 2X10A 1NH6A 4X7FC 4MYWB 4JL1A 3QR2A 1XL6A 4CU8A 4ES8A 4Q74A 1QSZA 5CZXD 5F6HJ 3IXAB 4OCSH 3IXAA 1FV1A 4E5XG 4TNFA 4Z3HA 2GC4C 4ODBD 4JFHE 4B0MM 2EKSB 3V79C 3QQXA 2EKSA 4HCRA 2VITB 5C0FB 2VITA 4OZGE 5C0FA 4CNIB 2CG9X 4KX8A 4CNIA 1KMGA 3QFJB 1KUMA 3QFJA 1DO6A 1FDLL 2D7PA 3PXJA 3FSOA 5DK0B 4AYFB 5DK0A 3WIAA 3HE6D 4AYFA 4Q52A 1MVUB 5GS0H 4IJ3C 1MVUA 3PAVA 5E4IA 5CCKL 1CFTB 4UNIA 3UZVB 1CFTA 2ZXCA 3UZVA 3BRDA 3LRKA 4JG1H 5EF0A 4DKEH 1HCFX 5DD1L 1EFXB 2G2NA 1EFXA 2TSAA 4NN6C 3X2QB 4KKCC 1S5HB 4TNVF 4HMDA 2XWCA 1S5HA 4L3CB 5CBAB 4WCYH 4L3CA 5CBAA 1MCWM 2BZ7A 3PPSA 2A0LC 4DQAA 4FAAB 2ZUVA 1MAKA 3MLRH 1L4IA 4FNRA 3GI9H 3U4BH 5K1JA 5KSVB 1N0XH 2I7SA 1B2YA 1BMWA 5KSVA 2GSMB 2ZWKA 4TNWK 3SB3A 3S37H 2DQHL 4ZO7A 4CMHB 4G7SB 1MZZA 4Z23A 3X1EA 4HHAB 3H9SD 3PLYA 1B2WH 3I6GB 4HHAA 4JQIH 3I6GA 2E3VA 2IMNA 2DQMA 4PLNC 1IGFL 4L1DA 3R4RA 5CILH 3GUTB 2FR4B 3Q6FB 4HUUB 5D7KD 3GUTA 1JRHI 3Q6FA 1PTZA 4HUUA 1OAYL 2FR4A 3OAUH 1LWJA 4OSUH 4I2XB 4I2XA 2WY3B 5E4OA 3QXWA 5IREA 2D7OA 4OLEA 3UH8A 1MELA 2CUMA 5ECJE 4S10A 2F7OA 4X6DA 4GO6B 4YSEA 2DDQL 2WOBA 5IFAL 3CFIC 2EC9T 4XMWA 4FCAA 4LRNH 2VR3A 2QTVA 4WWOA 1UWEL 4NC1C 3L1EA 1MW0A 5IM7B 1A7RH 4N2BA 4OGZA 1ETJA 5IM7A 4J3OD 1C8PA 1MRCL 2NYYD 1ITBB 1U30A 5BV7L 1PYWA 2QGCA 2GBAA 5CEXB 3V0DA 3FULA 4KY1L 4N4YB 5CEXA 5AUMA 4BFGA 1HTYA 1QI4A 2R1XB 2A6JB 2R1XA 1E4KA 2A6JA 2K9FB 3KXFE 1OP5K 3MNWB 4IBUA 5EIIB 4QAMB 4YO0B 5EIIA 4YO0A 4HHWA 1OSZB 4DKFL 1OSZA 4JFSA 4G8GE 2GCYB 3WNOA 5GS2H 2AQRA 1K85A 2GCYA 3QE5A 4PS4H 2ERJC 2AEQL 1IGTB 7PAZA 1IGTA 2IPTL 2ZCLH 5I8KL 3WY1A 2AHIA 4DP7X 3OKYA 4X7DC 4X9IA 4KVNH 4Z7UE 1PS3A 2VISB 2ZYHA 2VISA 3WHE0 1IM9D 5CAYB 3MUY1 3RL2B 4HQQL 1MVYA 4KJPC 3RL2A 2WUCL 1I1AB 4PRIB 1I1AA 5B1CA 1H15B 4PRIA 4XCEB 4FNQA 1H15A 4MCNA 4XCEA 2KBGA 3R8QA 5T3XE 2YXMA 3HN8A 4PRPE 2WO3B 5FIEA 3EUDA 3MRGB 1H6FA 2FGZA 3MRGA 4BRVA 4MZRA 3AB0B 3M7FB 3A4EA 1F4YL 4PBDA 5JHDB 1NIDA 1TTAA 3QZLA 5JHDA 4WUUD 1AHMA 4Y19E 1ZHBB 1MAMH 2K6YA 1ZHBA 4IDJL 3HBQA 4JJ5B 4JJ5A 5FYLE 3C5SB 4U1HB 3U4EB 1KOAA 4EI5D 4U1HA 3U4EA 1JZ5A 3STZB 4B6ZA 3STZA 5A2CA 5AB2A 5KUKA 1K2DB 1EO8L 5J12C 1K2DA 3M17A 3T8XB 1T03H 3T8XA 4XRCA 1BREA 4FTVE 3BKCL 3V6OE 2F53B 3ZE2E 2F53A 2PO6B 2ZF8A 3K4AA 2PO6A 4RMWA 3HG1D 3LPOA 4IYKA 4U3HA 1D9KB 2CCVA 4OQTL 1D9KA 2HG5B 2JLPA 2HG5A 3EYQD 2VAAB 5I1HH 1IC7L 3BMVA 3C9NB 2VAAA 4MZIA 1WD9A 3C9NA 3GIVB 1JGUH 3GIVA 2CR3A 2CRZA 3N06B 4YHLL 4V1DB 1UWGH 4V1DA 1VEPA 4NI3A 3NCCB 3SY0B 3FB6B 3SY0A 3L48A 3FB6A 4FTDA 2ZKWA 1DBJL 2PUQT 4ZDHB 4ZDHA 4NN7C 5I6OA 2YGVA 4GKZB 3FU9A 4GKZA 3IFLH 1ZK9A 2R83A 1D5RA 5E6IB 4M8VA 2CKBH 5E6IA 2FBJL 3ZMNA 4XMXA 1V7NL 4L0PB 4Y2DC 1NEUA 2IANB 2VZOA 3FCBA 2IANA 4NNYB 3QRFM 4NNYA 4NNXA 2P80A 1H8SA 1SUHA 4Z7NB 5CIPB 5DS8B 4MD4B 5CIPA 3RDTD 5DS8A 4GT0A 4MD4A 4W9ZA 3OAYH 4QXVA 2OULB 4XN4A 1J5HA 2Q20A 2NT1A 4KKZA 1EZVY 5BQ7B 5BQ7A 2F5BL 2ZKMX 3U46B 1JXJA 1GZPB 2NUPB 5TDNB 3U46A 2BCMA 1DVFC 1GZPA 2NUPA 5TDNA 3VXUE 5I1CL 5FW8A 1QSFE 4PGEB 3L3KB 3L3KA 3I02B 2H1PL 4MMYA 4QRRD 3I02A 4D0DB 1WCQA 2AQTA 2HB0A 2NCMA 4D0DA 4DGUA 3UTSD 3ZTEA 4F7PB 4F7PA 1KIRB 4XODA 1KIRA 3PXLA 4CBPA 2DMCA 3NIDB 3NRQA 4L4TE 1E4HA 1OSEA 2AV1A 3AGWA 1ZANL 1R5IB 1X4YA 1R5IA 4W68A 2VR9A 1EO5A 1FDLH 5FO8B 1BVZA 3VGBA 5FO8A 5I19L 4L8CB 1AP2B 2X4PB 4L8CA 1AP2A 3FNKA 4J3OH 1A7OH 1T6WA 4KK8C 3WDHA 1NBZA 4HJEA 5CCKH 1GS7A 1NFDF 1M3IA 5I71B 1VEMA 2X3BA 3F84A 5DD1H 4H0IA 3P2BA 1G94A 2WD0A 1CFQB 2N7SA 3SBRA 1CFQA 2A6DB 2A6DA 3HZMB 5GJTL 4CSSA 3HZMA 3U7YL 3AT0A 2AC0A 2OMYB 1SJEB 5D1ZI 2OMYA 2NCEA 1SJEA 4OB5H 2NR6A 1Z5LA 2ZXAA 1MWAH 2FO4B 3AG1B 2DQHH 2FO4A 3R1GL 3QJZA 9CGTA 2YARA 1MFDL 1WAAA 1WT5C 4X50A 1RQ5A 2CUAA 2ZOWA 3JWDL 3MPCA 1OM3H 1KPRB 2N56A 1KPRA 4AKPA 3JWNC 1KTKE 1W0VB 3TN0A 1W0VA 2ZG3A 3AM8C 2LGNA 5IQNA 2NQ3A 2CU9A 5JA9A 4Y9BA 4POZC 5BOPA 1RZ8B 1N64L 1RZ8A 4N2DA 3WXWL 2DDQH 4CN6A 5IFAH 1JVKA 3QUMH 3Q1SL 1M53A 1MXGA 1I7ZB 1I7ZA 4KHXL 4LOFA 1UWEH 1RZIB 1UEYA 1X9RA 1X7QB 1RZIA 1QI5A 4HFWB 1X7QA 4HFWA 2ZXBA 2UY7B 3QUYC 1MRCH 2UY7A 4Z7IA 5KEZA 5BV7H 2EE9A 2O30A 2J8HA 1G9NH 2R23A 3OKDB 4KY1H 2D2OA 4GLRH 2MFNA 4MLSA 4DO6A 3CFCL 2EVJA 2WLYA 4HK3J 3PXHA 1FO0L 2ZX6A 2E56A 1CR9L 5SWSE 3OHMB 5KS9F 1LQSR 1E4XL 4BQBA 4PTUB 4PTUA 4JM2F 4DKFH 3UROR 3KL0A 5I9QC 3OKKB 3RPKA 1X5AA 3OKKA 3P11L 2D03L 4L2YA 3OKMB 4HJ1A 4PJBA 4PJBB 3OKMA 2AEQH 1UXWB 4K7PX 2IPTH 3V8OA 5I8KH 1CYXA 4KKCD 5C0AD 5E2TL 2EIMB 3GMNB 3MROB 3GMNA 3MROA 1E2VA 5CO1A 1AD0B 2A0LD 4MDRA 3WTSA 1AD0A 3B34A 1UUNA 1W0YT 4UM9D 1SHMA 3TA3C 2EINB 4A55A 4JZJB 5T1LB 4JZJA 5T1LA 4HJSA 2R51A 4KDWA 1E5BA 1OZUA 4FJ6A 4OLUL 1MJ8L 2ZPKL 2DMGA 2E5EA 2X6CA 3NTCL 1F4YH 4J1UB 1I1YB 4J1UA 1I1YA 2HT4C 2CNZA 3W5MA 3TN0C 4YS4A 4OFPA 1TO4A 2F1EA 4FFWC 4QDGA 4IDJH 4Z77B 3VA2C 4Y4FB 1FFRA 4Y4FA 1O9VA 4XXWC 3GS4A 3RKDD 4XE5B 5GS1B 1TQBB 2AJZB 1A4AA 5F7FA 4IRZA 2AJZA 3RY4A 3SE9L 1EO8H 4EI6B 5GS1A 5KSUB 5KVMC 1A02N 1VHPA 1A4BA 5KSUA 2NSMA 2PETA 1N0LB 2XKSA 3GJEB 3F64A 1N0LA 3QEQD 3GJEA 2IWFA 3I3EA 4RWHA 4RCAA 5L4IA 4JEGB 3B2DC 3CK0L 4MXWL 5KZCB 2Q6WB 1GW6A 2Q6WA 4D94A 4OQTH 4WHYG 4W6XB 1J9RA 1MW2A 4HCFA 4Q9CA 1NIEA 1IC7H 1KXTB 4HC1L 4HWEL 3KPLA 1KXTA 5KOMC 4GP5B 4C4KT 4J5VA 4YHLH 4WW2F 1PDKB 2F7RA 3ECUA 5JIDA 1PDKA 2WZ0A 2WQWA 2ED7A 1DBJH 5GJSH 5IBTL 3U83A 4FDWA 5AFAA 5EZLB 1OV8A 1ASPA 5EZLA 1NQBA 3KW8A 4QRQB 5TQ0H 4QRQA 3ELAT 2NY3C 4KGLA 5GSVB 1N9PA 1XXFC 2WTPA 5GSVA 2FBJH 5F7NC 3IMRA 5HXMA 3CX5J 3AUVA 4XVOA 1E6JH 1V7NH 3JT2A 2YA2A 3KS0J 1REIA 4M1CC 2GSGB 1BWWA 2X9XA 3IKCB 5DD3H 2GSGA 3IKCA 1CFVL 1KTBA 4KJPD 1EX0A 3V7MA 1MDAA 4B5EA 4UUJB 4IU3B 2DIJA 4IU3A 5IWLC 3F00A 4DK6A 1X5LA 5I5MA 2F5BH 3AS3A 2HFTA 4FJYA 5JIHA 1J5DA 2AQNA 3M45A 4XBPB 2BM3A 3MZGB 4P2RB 4XBPA 5I1CH 4P2RA 4K71B 2H1PH 2XPZA 1SOQA 4NENB 2YS4A 3NFPB 2RFXB 3O6LL 3NFPA 4BELD 2F61A 2RFXA 3QQ9D 2NUTB 5E8OB 2NUTA 1J1OL 3IDXH 3IAQA 1ZANH 3T2OA 3GXNA 2EIEA 1DSWA 3OF6D 2V6HA 3WENA 3TV3L 1H3XA 5I19H 1JSYA 3K8LA 4YFLI 4ZAKC 3WFCL 5T33L 4H8PA 1KJMB 1G6VK 1A7NL 3V6ZB 3IN2A 3V6ZA 3BEVB 3CXFA 4FERA 3BEVA 2N7AA 3LKPB 2JI1A 1JZEA 2ZAGA 3LKPA 3RP1A 3UC0L 1I3GL 1QRNB 4IOSA 3TGXA 1QRNA 3IF1B 1T5KA 3IF1A 3INUL 3V9CA 5CJBA 3S5LB 3S5LA 3X1BA 3BO8B 3U7YH 4F7TB 3BO8A 4F7TA 3BKJL 4UZSA 1IFGA 4E41B 4QJ5B 4E41A 5L4JA 4HXBL 4X6CE 5E7FA 4GAYB 3ZO0A 3U2SB 4GAYA 1UXLA 4WLCA 4RA0C 2NX5E 3R1GH 4IMKA 4BFJA 4M03A 3W2DH 4C4BA 1GTFA 3HC0B 3HC0A 4M6ML 4Y2DD 2D7MA 4MXQC 4BQCA 3ESNA 4B50A 4KZ0A 2NW2A 1Z9NA 3SKUD 4PRHD 2VDQL 3UPCA 5IOPB 5IOPA 4HIJB 5HVHC 1O6SB 1PL3A 4HIJA 1O6SA 2PW1B 3FH8A 4I0PC 2PW1A 2WXFA 4H0GA 4XTRC 5ABDE 1N64H 3D06A 3WXWH 1DQLH 2QHRL 1PY9A 3EJZD 3Q1SH 3WNKA 4BYHA 4KHXH 5MEPB 1NCHA 2OLDA 2FB4L 5MEPA 4KX7A 5E9NA 2OR9L 4JO3L 1QFWI 1IE4A 5I1KL 1DVFD 3SYOA 3DVGB 4QIRA 4E9SA 3DVGA 5JW3L 1M4KA 1AR1B 4YK4B 2VR5A 5L8LB 4RX4A 4G6FB 3EDDA 1AXIB 3CVHL 2X87A 3TH2T 4P9ML 4YX2L 5LVEA 3ULUE 1ACZA 1RSYA 1FO0H 3TXAA 2J73A 4LLQB 3HBGA 3BSZA 4LLQA 1T20B 2F08A 2P5EB 3LZOA 1T20A 1E4XH 2P5EA 3CZNA 3IMBA 3B2UD 2NXYC 3PNWB 4YSTA 3PNWA 4AQOA 5HTSA 4HH8A 3UC2A 5LXGL 3FH5A 4JY4B 4KNSA 4OLWH 2WYTA 4JY4A 4A04A 4MNGE 1I8MB 1KIPB 3SDAC 1KIPA 1I8MA 5E2TH 4WK0B 1UM6L 1IJ9A 4JVUA 4P2AA 3WFBL 1EV2E 3MLXL 3ESUF 3P0GB 1N6UA 3D3VB 4JGMA 3D3VA 3BAWA 2AAVA 1AXSB 3AGVA 4BFKA 1AXSA 1R24B 4AGLA 1R24A 1QBBA 1KN4L 2H3KA 2LHAA 4OLUH 5IQLA 3VACA 1MJ8H 4NLHA 3MRQB 3MA7B 3NTCH 1GCYA 2ARWA 3MRQA 3MA7A 3RRQA 3AQYA 4MAUL 5E2VH 3E38A 3B9EA 3NVQA 1Z3GL 2GHWB 3DGDA 4FHJA 4A2MA 2VM9A 5C08E 4NQDD 5C07D 1CG9B 1CG9A 2X2UA 4PVNA 4POZD 1WA0X 3U9PL 4PCYA 4C58B 1F1AA 2F68X 3FT4B 4OF3A 3CFNA 3FT4A 4JHUA 3SE9H 5I6XB 5BW7A 1AZRA 4K3EL 2YAFA 2YSSB 4YSAA 2YSSA 3V55A 5I5IA 3UJJL 3MFGB 2WLLB 2WLLA 4OCYL 3CK0H 4MXWH 3QUYD 2ZOUA 4U3SB 3F83A 1D6EB 4U3SA 1D6EA 2P42B 2GG1A 1JFQH 2O5YL 4UOW0 4F80A 2EDMA 3AXLB 4BCXA 3AXLA 3P0VL 4P5KB 4P5KA 4ENED 4FI7A 3N1QC 5J1SC 1IFRA 2QSQA 2F8XC 4ELMF 4APXB 3VD1A 1TSHA 4APXA 2Y2YA 2DM4A 4QI3A 4JM4L 1OGTB 3WU1A 1OGTA 1XGTA 1TTRA 5IBTH 3VJ6A 2P5PA 3CJJA 2CCWA 5IKCB 2WBJB 3MJ9A 5IKCA 1D5IH 2WBJA 2XWJA 3CG8A 1OLLA 3D1MC 5ICZA 4LSDA 2P8LB 1Q90A 4AVJA 2P8LA 1ORQB 1AGBB 3K46A 5KSBB 1ORQA 1Q0YL 1AGBA 1W8NA 2DM2A 4U6HB 4JY5L 4U6HA 1S6NA 3ABLB 4PP1C 2CHDA 1CFVH 4ZUVA 3GSRB 3TA3D 1BJ1J 1PZ2A 1UEMA 2G0KA 2Z31D 4PRDB 4PRDA 4NFCA 4RFNB 5IVXE 3GKWL 3P69A 3T4YB 1UKSA 1U33A 3T4YA 3D07A 1QBAA 5AW3B 5I0YA 2YMXL 4RGNC 4DF9A 3BVXA 4DEWA 1SXSA 5LDUA 1EHLH 4NI6A 1YC8A 4UT7L 1WTGT 2XICA 3ATDA 4HUMB 3Q2NA 2ZIDA 3MV7B 4AJWA 3MV7A 4FG2A 4O00A 5IJKC 1A66A 1T6VN 2KMWA 2QFRA 1LEGB 4WFFD 1P5UB 3NIFB 1LEGA 3O6LH 1P5UA 2FLRT 4FNUA 2XV6B 1J1OH 3K1DA 3OV6A 5J9PB 4QWWD 5E51A 5J9PA 3DX2A 1KENL 1XTLA 3TWCL 4F33B 3NEXA 4F33A 2OL3B 3PPEA 1ZA3B 2OL3A 5T33H 1ZA3A 4FD0A 3VG0H 1A7NH 5CKAA 4ZMLA 4NUJA 4JQIA 2WQRA 2NY0C 3WL9B 3WL9A 4IDLA 2YBGA 3UC0H 1I3GH 2W59A 5DJYA 5BVPH 2C8NA 4IJTA 1IVLA 1DQDL 1EMTL 1TJGL 2IH1B 3FQ4A 2IH1A 5CR8A 2EDYA 1HYSC 3BKJH 1DVQA 1RUQL 2MQCA 4FYTA 1Z9SA 2NY7L 5G4OA 1OHZA 1NSNL 2ZXEB 3KM1A 1HKLH 4F8QA 4IKKA 2CBMA 3S5LG 4WFGD 4HPOH 2NY3D 3BLBA 4J7RA 3SE3A 3VX1A 4FQPA 2V8MA 2X12A 4FF9A 2N7BA 4M6MH 4UILL 4I9WD 4KMTL 4N2OA 4AM0Q 4M1CD 5EU7E 1KV3A 2YJLA 4LOVA 2BVPB 4GKLA 2NXZC 2BVPA 2VDQH 4Z76B 1SDYA 2XX0A 2QHRH 3RHWF 3LYRA 1CDJA 2C9QA 1A4JB 3WEMA 1W91A 1A4JA 1F4AA 4HLJA 3HUJF 3VQ1C 1AGFB 1IX2A 4OI7A 4JO3H 2EDEA 5I1KH 3LXBA 4Y89A 5DI8B 3JWNH 4W4OC 5DI8A 3UAJC 3KG5A 3RPBA 43CAB 3ZXAC 3LMJH 3NA4A 43CAA 5JW3H 4W9JC 5C7XH 1CS6A 4NQEB 5TFSH 4PJAE 4NQEA 2VM3A 4YHKL 4U4BA 4PJBF 4X80L 1FYTE 1UB5B 1MCCA 1UB5A 3F05A 2WMPB 3BVNB 4U7KA 4P9MH 2WMPA 3BVNA 3H4FA 4YX2H 2PWFA 3AROA 4DVBB 3WMPA 4DVBA 1KCSH 3SE4A 5I28A 1A3LL 1QYGL 4L8SC 3SDXA 1KGIA 1W9XA 3UIYA 4O5LL 2WVVA 3V5DB 3BWZA 5LXGH 4LLVB 3V5DA 3VWKC 4LLVA 5C0BD 4ZOEA 5TDOB 2JKLA 1IIIA 4KH2A 4PN6A 5TDOA 2ICES 2RHEA 1CFNB 4JFED 4XE0A 1CFNA 2EDRA 3KR3L 1UM6H 4PRBB 1SYSB 1PY4A 1SYSA 4WSGA 3WFBH 4BUGA 3MLXH 2ZE0A 2ZWYA 4K8RL 4XO9A 4ZSOE 5GGRY 2J5LB 3TBTB 3FU8A 3U30B 4QHLB 3TBTA 2E9IA 1KN4H 4HALA 5DQ9B 4IM8A 5DQ9A 4GMTL 2XIBA 3DJRA 2E6QA 3WSQL 5I6LA 3CXHJ 1OQXA 1CIDA 4W6YB 1PX8A 4MAUH 4MLIA 4X7EC 2CH8A 3PGDB 3RX9A 3PGDA 5KW9H 3MYJB 1I3VA 1JTPA 1Z3GH 3EO1A 3MYJA 1MG3C 3Q0HA 5EN2B 4NKMB 5EN2A 4JHBA 3PWPB 4NKMA 5AL8A 3MV8E 3PWPA 4Y2LA 4D0BB 4IK6A 1G7LB 4I0PD 4D0BA 5A6MA 2B3IA 4GG8B 2JJTC 4ZO8A 4GG8A 3VD7A 3QGVA 3ZTJG 2XTSA 2X88A 5T1KB 4P9HL 4QHPA 5T1KA 4K3EH 3AWFA 1GA2A 5JOPE 3RWIB 4OUOA 3RWIA 4HKZB 3VWJB 4EDWL 4HKZA 4QRPB 3UJJH 3VWJA 3G6DL 4QRPA 3L54A 3JV6B 4P04A 4OCYH 4D9LH 3DHPA 3JVGA 4A7GF 2O5YH 3SJVE 4LCWE 2IMMA 2Q3ZA 3P0VH 3HC4L 3J07A 2PXYD 4X0KB 5DA0B 4X0KA 1K3IA 2DLHA 1A64A 1WITA 1VGKB 2HXAA 3Q48A 1VGKA 3ZTDC 3GZPA 3RBGA 4R4BB 4YSDA 4R4BA 4JM4H 4JO8A 4PJEB 4PJEA 2DIEA 4N20A 3KWUA 2NXYD 3L2LA 2ZKYA 1NCAL 2Y1YA 2IDCA 1JVLA 1L7IH 2BSRB 1INDL 5DVMA 4QXUL 4FLSA 1HWWA 5AW7B 4BQ6A 4JY5H 4DESA 4F15B 3ARRA 3O2WL 1RULL 1NBVL 3VSUA 1N8ZB 3MRDB 4OCWH 3B5TA 1N8ZA 3MRDA 3ZHDA 4U1IB 1ZGLM 2IAMB 4FYRA 4U1IA 2IAMA 2IVFC 2H45A 1MCWW 5SWZD 4OF5A 3GKWH 2K6ZA 3VI3B 1YEEH 1J5IA 3BPOC 3VI3A 1OIOA 1FPTL 5FGSA 1YECL 2ADJB 3HEIB 5KVDL 2ADJA 5E70A 3D30A 3ATEA 2GUYA 3CSBA 1SLWA 1XWVA 4UT7H 4ZMOA 3WFDL 2ZUQB 2H9GB 1QHQA 5L6YL 2H9GA 2EEBA 2R0WL 5CFAA 3A22A 1X3DA 2LE9A 1N19A 3MRPB 4N24A 1CD1B 3MRPA 2HUHA 1CD1A 2ESVD 3K71A 1KENH 4J27A 4OTXL 4TQEL 3UMTA 1UASA 3QT2A 5D1XE 3TWCH 2CD0A 2P3YA 4XCYB 4FXLA 4JRLA 4XCYA 2XCMC 3TH4T 4UAHA 4L2LA 4XX1G 1T21B 4JDEB 1T21A 4JDEA 5IMOB 1YNTB 1PNCA 4MCMA 1KB5L 1X5ZA 1YNTA 5IMOA 2VOTA 3DRQB 3HKFA 3DRQA 5FUZL 3R8BB 3UEQA 3AREC 4GI9A 5JW4N 4ECNA 2VZVA 4J3TA 4PRNB 4PRNA 1OCRB 4JR9H 3T0EB 3U1QA 4P57B 3T0EA 4P57A 5LG6A 1DQDH 3HB3C 4YNYB 1EMTH 1N6VA 1TJGH 4YNYA 2NY6B 5DZVA 1NWPA 1R9FA 1XHHA 1HHJB 2NY7H 4D7PA 1DCEA 1HHJA 4X7TB 2VH5L 3PCYA 2VJXA 4X7TA 2OJEA 1YO4A 4AGPA 5B8CB 3MO1B 3UGXA 2OYLA 1QNIA 1GYUA 4K5MA 5BVJB 1JG9A 5BVJA 1DQTA 4HOZA 4KMTH 2V3DA 5TF0A 2YRPA 3WG7B 4PP1D 5BV7B 3FUFA 2ZUXA 3BQVA 4FKHA 3ECVA 4FG4A 2WAHA 3IJ9A 4MS6A 3SHSA 5ETUB 5ETUA 3TBSB 5CD5D 3GYRA 3TBSA 2J56A 3UDWC 4AKOA 1UWFA 4Y9CA 1O0VA 1JXKA 1NAML 2H32B 7CGTA 2H32A 3D39E 1YQ2A 3E3QE 4AJVA 2JB5L 3HG1B 3HG1A 3QUXD 5K69A 3O3DB 4A68A 4WWKC 1J0ZA 3O3DA 4LSRL 2A99A 2NQCA 2WXMA 4YHKH 1DBBH 4X80H 4CGTA 1XSOA 5MENB 1FFNA 1M56B 5MENA 3WUWB 4X5RA 1WFIA 2YGNA 3WUWA 1E30A 2ZUTA 1GYVA 2B5IC 5C9JB 1PZBA 3DHJA 5C9JA 1L3WA 1U2HA 4GRMB 4GRMA 1YRKA 2WXIA 4PIRF 1BIIB 1BIIA 3L3OC 3ALWA 1A3LH 2MPAL 3IRZA 1A5FH 2LAGB 4AQEB 4AQEA 5DCCA 2NY0D 1ZDSA 1UXMA 5HDBB 2V2TB 4ICWA 2V2TA 3PGFL 4X6EB 4B41A 1OM9A 3VFSB 3VFSA 2P52A 1G87A 4CL7A 3D50A 3KZ8A 4PG2A 3BN3B 3VD5A 1TFPA 5KYWB 5KYWA 1X5GA 2WCGA 1OOWA 4DP0X 3V6FB 1MI5E 4QTFA 3U4AA 3V6FA 4GMTH 1RCYA 1TITA 5FM4A 1T80A 3AG3B 3WSQH 2Q0ZX 3JBG7 1JAEA 1RD6A 5BRZB 1ZLVH 5DWUL 3O41A 5BRZA 5INCB 2X4OB 3OG6B 2ALWA 5INCA 2X4OA 2Y06L 4WI9A 1DL7L 4QRRB 2WNXA 3IMTA 3UTSB 3C5ZB 2NXZD 3UTSA 3DIVA 1MH5B 2CO2A 3C5ZA 1MH5A 3X14B 3FB8B 1WAPA 3X14A 1TZIA 3FB8A 4PR5A 4WI5A 2NSXA 2WVSA 3GTNA 3N0AA 1DFXA 3UERA 4QHMB 4QHMA 3VDBA 4P9HH 3SDCB 4G71B 2W1NA 3SDCA 2BIMA 3A23A 1KPVB 1MCSA 3LPGA 4QXGH 1KPVA 4M43L 5AB9A 3Q13A 3HJ0A 1AG0A 3N55A 2XDHA 1NANH 2I60L 3G6DH 4HEMA 3C09C 2J72A 5EBMB 2DEYX 3UAJD 1EVUA 2XN9B 5EBMA 3OMZA 2XN9A 2BRRL 2CDGA 2JQAA 2NNXA 3CLEL 4JPKH 4D9RE 1XF2B 1XF2A 4OFKA 4Z7WF 2FGWL 5E08L 4LZKA 1N12A 5LG1A 4DKDC 8CGTA 5KSBF 1C7TA 4WF7A 1G9ML 1TPXB 1CTOA 1HWGB 1AHWB 2DQGL 5AWNL 3P3SA 1AHWA 4EN3B 4MA8L 1CL7L 2A9DA 1HOCB 4EN3A 5AB0A 1HOCA 3D4YA 4Y1AB 4Z7QE 1HZHL 3F7RA 3LNHA 2R9HD 4Y1AA 4EI0A 3KL3A 3BDXA 4GMSL 1PQZA 4HUWB 1NCAH 3HI5L 4OKDA 4HUWA 1FGVH 2QDWA 2X4RB 2X4RA 3VWKD 5EUOB 4CAGA 5EUOA 4MMZA 3ZDYE 1INDH 1UZ6E 4QXUH 1TQCC 3MODL 4G8FB 3ZDXF 1QD0A 3LQZB 4G8FA 1TVBB 3PYCA 3LQZA 1TVBA 3O2WH 1RULH 2HVJB 4OLZL 1RURL 2OS7A 1CXEA 2ATKA 4R0LB 2EDKA 5I1EL 3OHXB 4R0LA 3OHXA 3RVWD 4PCSA 5GZOC 1JPTL 3LZNA 1F02I 1OVZA 5KJ7E 3O3BB 3FRUB 3O3BA 3FRUA 2BY3A 5KVDH 2L0DA 3ARWA 2A3TA 1GPOL 5E2WL 4G83A 2YD8A 2MMXA 2DD8L 1QFOA 3WFDH 4ZTOH 4H26B 4H26A 5J5EA 1SGKA 5L6YH 1BJ8A 1X5XA 4OD2B 1BECA 2R0WH 5D1QD 3RJOA 3OXSB 3LV3B 3OXSA 3LV3A 4XPAL 1O7VA 1KXQA 4LOUD 5FECB 5FECA 2AP2A 1RXLA 5I30L 1EEZB 2H6OA 3U2JA 2Q2EB 1EEZA 2O1AA 4OTXH 4TQEH 5KVGE 3WMQA 4K5LA 1BD2B 1F5WA 1BD2A 1CGUA 4KRLB 4XPBL 3QXDB 2E7HA 2JQMA 3QXDA 3O6FC 4P5SA 1L0PA 4MAYB 4MAYA 1KB5H 3CSYB 2YQ3A 1DE4B 2CM6A 3CSYA 2DYPD 3WJLC 1SLUA 5FUZH 3FONB 1KCRL 3ZMEA 5ACLA 5F6IB 3FONA 1JTTA 5C0AB 2FE0A 3C2AL 4KXZI 4QTHB 1NFKA 4QTHA 4AY0A 4H0LC 4J6RL 4M7ZC 4FQQB 2ATPB 4FQQA 4UM9B 2ATPA 3K6FA 1G0XA 4PJDE 5D70L 1RAMA 1I9RL 3TYFB 3TYFA 2PWGA 3AITA 3LH2L 1LK3L 5IROA 2VH5H 2GFBB 3G5WA 1MFMA 4I3GA 3DGCR 2GFBA 5CEYB 5CEYA 2E7CA 3BN9C 4XN2A 1RJYB 5F1NB 5AG8A 1RJYA 2B1OA 3GLEA 1HH9B 1PJ9A 1HH9A 4PY8I 3QDJB 2ZXGA 4F5CA 4Z0XB 3QDJA 4I77L 4Z0XA 4KO7A 2NRDA 3O8XD 4KQ4H 2W95A 3QRGL 3T3PF 1R5WB 1XGUB 1XGUA 4UIKL 3UACA 1TJHL 4OFVA 4C47A 4NM4L 4Y2OB 1FO0B 1QWUA 4Y2OA 1FO0A 1RIUL 1T5XB 1T5XA 1CGTA 1NAMH 1CICD 2ZP9A 1OAZL 5F7LB 3NABL 4JFDB 1IZKA 3VMNA 4JFDA 4X8XA 1M42A 2JB5H 4KNTA 1J0YA 4PJGE 5GGTL 3RAJL 4MDJB 4PV9B 5HYSG 2VMFA 4MDJA 4QGYA 1EJ8A 1IC5L 2IWGA 3VGEA 1VCAA 5AVXB 1LE5B 1CQYA 3G04B 3HE7C 1IKNC 4Z0BH 1LE5A 3G04A 5IUSA 3WIHA 4BQ9A 1NPJA 1IMHC 1URIA 4Y5VC 1A4KB 2WUBH 1A4KA 1NUNB 3I75B 1N4XL 4NBZB 1Q0XL 3S98A 1KIUB 4WV1B 1KIUA 3LNIA 1LGVA 5D7LD 1MFEL 2MPAH 4N3UA 1DEEB 1DEEA 3GINA 4DW2H 5CJ8A 3ARED 3UCQA 2YO3A 4YN3A 1V3JA 3PGFH 3K6DA 3V0AC 5A7EA 1F4HA 2DH2A 3CXDL 3FO0L 3HB3D 4YGVB 4YGVA 5FGRA 5A2FA 4CVWA 3BWAB 1U3HC 4JREB 3BWAA 4K55A 4GRWH 4WDIB 3LKNB 4WDIA 3LKNA 2WZPD 1H8NA 4KRPC 4OJYA 3EZJB 5KN5B 5KN5A 5IFHL 2Y23A 1ACXA 5BS0D 1XH3B 4GQRA 1BXVA 2Y06H 1XH3A 3KPNB 1DL7H 1UH4A 3KPNA 2FEEI 1Q38A 1FVCB 2J1XA 4F58L 3ZE0F 4HC1A 3I9AA 2L8AA 5KWYC 5FKAB 1ZGLP 5FKAA 2DQIL 2LU5A 1DP0A 5DRWA 3BDYL 5E5LA 4M43H 3ARDC 1BOGB 5EO0B 1BOGA 1NOAA 5EO0A 1RZ7L 4GIAA 2KPNA 4N2NA 3R19A 4YHIB 4YHIA 1V27A 4WWKD 2BRRH 1WZ1L 5GRWA 1HILB 3CLEH 3OKLB 1HILA 1EPFA 2Y2WA 3OKLA 4GQPH 5AW6B 3LS5L 3NESA 2DW5A 3I84A 1OO2A 2FGWH 3QQNA 5E08H 2ZKHL 1IQWH 3KVPA 4JO2H 3SKMB 4PJ5E 2DQGH 2VDNL 2VXSL 4L37B 3UBGA 4L37A 1CL7H 2ED8A 2OMUA 2PYED 2Z64C 3MNVB 1HQRB 3V7AG 4F9PA 3MNVA 1HQRA 4N2IA 1HZHH 1UCBH 1S2EA 2WNGA 4GP8B 4GMSH 2PPCA 4F7MB 3HI5H 4KK5D 4F7MA 3KDPB 4MA1B 4U1MB 4U1MA 2CGRL 1T1YA 5A2IH 3ULVE 2Q9OA 2VR8A 2CM5A 3MODH 4JJOA 2YOCA 3CC5B 3N43B 4J3OF 4W9HC 3CC5A 3T3ME 4HPYH 1OGAD 1DJIA 4XP4L 4ANWA 4OLZH 1RURH 3WO3B 3WTUA 8FABB 3QDME 5I1EH 8FABA 1MNUH 1INQB 2Z3FA 1INQA 3TV8A 1JPTH 4KO6A 4BGLA 4LPUA 4TPRL 2QZ5A 2EUWA 1T22B 1T22A 1GPOH 5E2WH 3RQ3A 1ES0B 1ZS2A 4YDZA 4BIKA 1ES0A 2DD8H 5E00B 3KCWA 4L9DA 2L7UA 2WNWA 4C59B 3MRJB 3OG4B 4FLOA 1GOFA 2W9LA 1UCTA 3MRJA 1SF5A 5TD4A 3T6VA 4WENB 1MQKH 4O2CA 5IB1B 4Y4KC 3GJFB 5IB1A 5I30H 3GJFA 1A4CA 2GIMA 1WWAX 5GRJL 5KTEH 2DWDA 4XPBH 5DC4B 3MXVH 3VFTB 3PP3H 1NKGA 2OMTB 2P46B 4NZDA 5IQ9A 3S35X 2OMTA 5CP3H 1LVEA 2R4SL 3VFTA 4CMMA 4M5ZL 2JXMB 1T0PB 2JXMA 4OZFG 3OJ2C 1KCRH 4LQ1A 2CK0L 3PDDA 5E8NB 2CRMA 5E8NA 1T4WA 1IM3B 3S5YA 3TO4A 1IM3A 3ZZSA 3GJFK 4BK8A 3C2AH 5IR1A 4F8PA 3VXOB 3E7JA 4J6RH 2RBLA 3NEOA 3KXFA 3EHBB 2OYKA 4U1LB 4U1LA 5D70H 1I9RH 3IJHB 4F9PC 1DJYA 5I75C 3LH2H 5F70A 1LK3H 2UV3A 1B88A 4G8GA 3KBHE 3P73B 5T5FA 3EBIA 3P73A 3AU0A 4FNPA 2PKDA 3EJPA 3D5OF 3UJIL 4BSWB 3H3PL 1FZKB 4BSWA 1VGEL 1FZKA 1AQMA 3BVTA 4Z7UB 4X9FA 3MCG1 1TNMA 4Z7UA 4I77H 2HP4A 4L4VB 4GYBA 4L4VA 1LMIA 2HKHL 2YZ8A 3QRGH 4JHVA 3QI9D 3CVHB 5E1GA 3PRZA 3CVHA 1EZVX 3L9BA 4UIKH 5K33A 2E76C 3BP5B 3DPBB 4XBEL 3BP5A 3DPBA 2DQTH 4G7RB 3O9WC 3BRFA 4AYDC 3U1PA 1RIUH 5IJVB 2Y07L 5IJVA 1OANA 4JE4B 3NABH 4NN5B 4PWIA 4Y19B 1UJ3B 3AACA 4BH7A 4Y19A 1FN4B 2ETWA 4HZAA 1JGLL 1OWWA 5F93C 5FCUL 2GAZB 2GAZA 2F7IA 4QKXB 3RAJH 4APQB 5FX3A 2XACC 4APQA 3VRIB 1IQDB 1IQDA 1IC5H 1MDTA 2EDTA 2LVCA 4J3XA 3VXME 2R29L 3B43A 4IRJC 1FZOB 1AOHA 1VACB 5I17A 5JPMC 1FZOA 1VACA 3L9EA 1Z6JT 5B38G 1N4XH 4KX9A 1Q0XH 4FTVB 2UZIL 4P2QB 3ARGB 4FTVA 3K74B 3GTVA 4P2QA 3ARGA 4BWUA 3MGOA 4J8RB 2HFGL 2XN2A 5GRYA 4J8RA 4AQ8A 3O6FD 2G5BB 1PD6A 1ZHNB 4MX7B 2CO6B 2G5BA 3BPNB 3BD4A 3EH2A 2CO6A 4MX7A 3BC9A 5DO8A 2ROXA 3TO4C 1YY9C 3WE6A 1IILE 2XXMB 5E8EB 2XRAH 4HSQA 5E8EA 2AFNA 3CXDH 3FO0H 3OKNB 3OKNA 4H2CA 3NOIA 3OGCA 3RVXD 3NSFA 2Z31B 1CTNA 1PW3A 4LESA 2BNRD 4K07A 5E4EC 2WBKA 3GC3A 4HWBH 2VMJA 1NBCA 4MRBA 2E9WA 2LV4A 3LEXB 5A6LA 3LEXA 5E95B 3BN9D 5D5MB 2WVUA 5D5MA 4S0HA 1S3RA 4PREB 4DGIL 3RTQD 1JZDC 5IFHH 4PREA 5I5JA 1NGPL 1S9VB 1ZXQA 5DHYA 3TJPA 1S9VA 2EABA 1FFOB 1UXSB 1FFOA 5SX4H 1UXSA 4JO4L 3KPRE 2W60B 5IJDC 1AC6A 2W60A 2HX7A 1S7XA 4ZMXA 3TEWA 4F58H 1H6TA 4CVZA 2IBBA 3IETB 4L1BA 3IETA 3JUZA 4G6KL 1T0NB 2VSCA 2WINB 4UINL 4LP4A 1T0NA 1BVLB 2KQMA 2WINA 1BVLA 3BDYH 1B0RB 4MJJA 1B0RA 6PCYA 3ZKNC 3D2UD 1TENA 2BFVL 3T08A 2AK4E 1QSFB 3ELQA 1UT2A 4M61B 4M61A 1QSFA 3RUGB 5EEWA 1PKOA 3RUGA 2XWZA 1WZ1H 3KWTA 4H13C 3LS5H 3HE7D 4XN9A 1D5XB 4QGTA 5C0RL 2ZKHH 1A2YB 1F90L 1F3DJ 3K6OA 1A2YA 2H0EA 4TMPA 3FQRB 4FQLH 5F7EL 3UG5A 2Z35A 3FQRA 1KF9B 2M83A 3CSFA 3DDGA 4MYPA 3V6OC 2QQKL 2VDNH 2VXSH 3MCKB 5DVOA 5HVFB 1TFHA 3MCKA 2D7NA 2A5UA 1S7VB 4LNRB 4U2YA 1PZUB 1S7VA 4LNRA 2Q87A 2KH2B 3MNZB 2IG2L 5HHME 3KPQB 3V0VB 2V2WB 3KPQA 3LXCA 3V0VA 2V2WA 2Z4TA 3MBXL 2CGRH 4JVWA 3TFBA 1JV2B 4Z7AA 4FLQA 3WN5B 1JV2A 3GS7A 5HHVL 3WN5A 3ZKSD 1CXKA 1OXYA 2ZOTA 3VM7A 3F7YB 4XMUA 3S48A 5C0CE 1U3HD 3F7YA 4HETA 1RSFA 4N1EA 3ES6B 4LIQL 2V37A 3ES6A 1ZWIB 4XP4H 3VH8G 3ARTA 1ZWIA 3HLKA 4NCC2 4ESKA 2CMRL 2HRHA 2VLJD 5B4MC 4KQ0A 3LVTA 3HAEH 5JPNB 5DFVC 5JPNA 3QSKB 4TPRH 3K5SA 3BUYB 4N90E 3SCMA 2F54E 2NT0A 3BUYA 4UYPA 4DGWC 3TZVC 3BUDA 5CMAA 2E6PA 3E80A 1JNNL 3NZUA 5CCGE 4NPYB 4P8QA 1RPUA 4NPYA 3MAWA 4WEMB 3D52A 5T5NG 4FC3E 2PWEA 4LRIC 1I9EA 1BQRA 2FD6L 2RACA 3TBVA 2E9GA 1YY8B 4EDXB 1YY8A 4CC1A 1U8OB 1NFDE 1T89C 1U8OA 3GPSA 1OLZA 2EDXA 5GRJH 3ARDD 2HVBA 2UUDK 3EDFA 4N0CC 5FV1L 3Q01A 2R4SH 1GGCL 3VA6A 4W93A 1DJHA 3O4OC 1QATA 1CZ8L 5C0BB 5FM8A 5C0BA 5F7HA 3VB8A 3QWRD 4JN2A 2V3EA 1H19A 1KBGL 4X4XB 5LNDA 4X4XA 4XB7A 1R34A 1AAJA 1FC2D 5EEYA 5SWSB 1JPSL 5SWSA 3Q2CA 4X5XB 4DT2A 2O93L 4X5XA 4TQ8A 5AW2B 4P23C 4YEFA 5CXPA 3VXNB 1J86A 2NMSA 4PJCB 3BD3A 3UPRB 3ME0B 4PJCA 4WWNA 1XCQB 3ME0A 3JT0A 3EJUA 1XCQA 1CURA 5F96L 1DQML 2Q8AH 4DP6X 3Q44A 3H3PH 2UXVA 5B7EA 1VGEH 1T6BX 3PY9A 5LGJB 5LGJA 1HL8A 3F6LA 2CO3A 4QLWA 1GMEA 3ERXA 3GBEA 4JDZB 3CMOL 4LSUL 4JDZA 2VDPH 4LK4A 2KZWA 1B3JA 4XBEH 1F1GA 1SVBA 4XPHH 3VO0A 3W0WD 4X5LA 5IK3B 5IK3A 1GS8A 2RTTA 3SCMC 4QYOB 2Y07H 5IB5B 5DFAA 4QYOA 3ZQ9A 5IB5A 4IBVA 1CD8A 5LN8A 2XQ0A 4ZFQA 1JGLH 4AUYA 5FCUH 5AVQB 3WEXB 3UO1L 3WEXA 4OJFH 32C2B 2CDFB 1FNEB 2CRIA 32C2A 5KS9E 2CDFA 1FNEA 3LN9A 3NJJA 2Q76B 2V33A 2PXYB 2Q76A 2R29H 2DQUH 3HR5B 4WEUD 3ZY7A 3HR5A 3U0PB 3T65A 3U0PA 4YE0A 4Y4KD 2W8CA 3QDGB 3QDGA 5B7MA 3KJ4C 3B7RL 4L1HA 1WH0A 4UAOC 4H20H 2HFGH 4ZI8A 5C70A 3LNFA 5J56B 1XGQB 1HT6A 1JERA 1XGQA 4N8VG 1TCMA 5C0DB 1HEJC 5C0DA 1R3IL 4MMXC 3BLKA 5FPIA 1NEZB 1S9YB 2YPLD 2WQSA 1NEZA 1S9YA 4Q56A 1BZDA 4E2OA 3K7UA 4AV5A 3VXSE 3KHQA 4GY4A 4G5AA 4RGMB 4OZFH 4ZXBD 2MQGA 2ZX8A 3PJNA 3ZT6A 2F8OA 4FQHB 4HIQA 4FQHA 4ZW7A 4M5YH 4EQ2A 2WO4A 5GHWH 1OF2B 4TSBL 4NC2B 3K0YA 1EEQA 1U8CB 3NA9H 2OMVB 1U8CA 3U48A 2OMVA 3DTUB 5AKSA 1NGPH 4F8OA 4PP2A 4Q6IC 4XOEA 5DD6A 4JO4H 3V4UL 4OVUA 1YPZB 3HKZA 4KPHL 2JELL 4N2MA 4MHHI 4JUSA 4R2GC 4TVPL 2SODB 3QCVL 3BAXA 1RUML 1RZFH 6FABL 1EAOA 3O9WD 4G6KH 1F2XK 2Y72A 4AE1A 2NNRA 4UINH 1RUKH 1VJSA 4ACPA 1Y1UA 4DUWA 4W9LC 2BFVH 5L4FA 1RPKA 4Z7VE 1FLRL 1NAKL 5F7AA 2ZSVB 5IIEB 2YMOA 2ZSVA 5HVWA 1KFAH 4L8DB 2H2PC 4L8DA 2YXVA 4IRJD 4KOBA 4W1TA 2VLME 2MJWA 5AG9A 5JOFB 4YL9A 4HS3B 3LEVL 1F90H 1YNKH 4HS3A 4KVCL 1TSRA 4M93B 4D9QE 3OC5A 4JBSA 4QHNB 4W9CC 4QHNA 3B2VL 1VPOL 3N43F 5K5YA 4QEGA 1Q9WB 2EO9A 1Q9WA 2XKNB 2I27N 1JGDA 2FEDC 2XKNA 2B14A 2DS4A 1WJ3A 2BY1A 1YY9D 2IG2H 3MV9D 4DHLA 2NQDA 2X2JA 2YFNA 3SPCA 3MBXH 4ACTA 4EE2A 1I8KB 2BVEA 1I8KA 2J6EL 2NY1B 5DURD 3QFJE 4JN1L 4LIQH 2NY2B 4TVPD 1JWUB 1JWUA 1WFUA 2CMRH 5DJXB 1OT1A 5DJXA 4FEMA 2QFPA 3N1PC 2NX5A 3FW6A 2XTJB 1D7CA 4JFYB 4JFYA 3KGUA 4WI7A 3ZW3A 3QUXB 3RGVC 3QUXA 2AJYL 4UTBL 1UM5L 1AO7D 5C7ZA 5KYUB 3BYTA 3GXIA 1JNNH 4YDLC 5KYUA 3IGAA 4W70A 2FT7A 1PKQB 1PX4A 2OI9C 4X7CC 1KJ2B 1NCOA 1KJ2A 5CU5A 1B9ZA 3QUZC 5CLXA 5I1IL 4G6AC 2EH8H 2B0SL 2YGPA 3W3BA 1BPVA 3QG6B 3TPKA 4A2EA 3QG6A 1L5GB 3ZKND 1L5GA 1OGSA 3UYPB 1CBVL 2AQSA 3CZEA 1JTOA 4FI8A 4IRSC 3Q8EA 4N22A 4AYSA 3U1SL 1IFHL 3WAJA 4PJIB 1BG1A 1R3HA 4PJIA 1CZ8H 3UG3A 1CQKA 2EICA 1FA4A 4ELDA 3L4XA 1KBGH 3FT9A 3VGGA 1PZ3A 3FTSA 2BP3A 4GH7B 1E5UI 2WSKA 1JPSH 1CF8L 5C97A 2PR4L 5ABZA 2ITFA 2B39A 4S1QH 4YDVB 3I6LD 4YDVA 4OIBA 1N5YL 3PV7A 2IOIA 1YJDC 2EILB 4KXAA 2VZ3A 2HWZL 1NAMB 1OT2A 1NAMA 2ICCA 2AAAA 5F96H 1YAZA 2WQ8A 2XXFA 3COOA 1R3LB 4XPTL 1R3LA 2A9NH 3BQUB 3CFUA 3BQUA 5HGBB 2IC2A 1OB1B 5HGBA 1OB1A 4HUCA 5LBSL 3CMOH 2TSBA 2BNQD 4TLTA 5DZJA 5GGQL 3TBWB 3TBWA 3FOLB 4HK3N 5B4MD 1QHPA 3FOLA 5J89A 5DFVD 2A4EA 3TONA 4DPRA 3GBML 4MSWA 1PD1A 3ZHLA 5CSGA 1GZHA 3TZVD 4KITB 5JZ7D 3M07A 1JZ6A 4XX5A 5FHBH 3QZMA 2EH7L 3DI2B 4NHUB 5C08B 3UO1H 5C08A 4NHUA 5K1VA 2VDMB 4FFVC 4PRIE 2PCFA 2CIKB 4P4RB 2TRYA 2CIKA 2W07B 1BZ7B 2W07A 1H8OA 1VFAB 1BZ7A 3OQRA 5ADOL 1VFAA 1JUFB 2WIIB 2WIIA 1JUFA 1ADQL 1BVNT 1XFPA 3N5AA 2V7NB 5D4HA 3UFIA 2V7NA 3SBQA 4KGJA 5J4MA 2CHNA 1OPGL 2JE8A 4AKQA 1ULVA 1G7JB 1R3IH 5CJXA 1FG9C 5AL0A 5HYJD 2BLFA 1AKJD 1BZ9B 3PWNB 4LEXL 4LLAA 3PWNA 2WQAA 3X13A 3CFDB 4BFNA 4KTYA 3CFDA 3ULUC 2J71A 4WI3A 2W88A 1EZUA 5T3ZE 1O6VA 2YD7A 1JZ7A 1USZA 5JA8B 2Z0UA 3BIKB 1OKEA 3BIKA 4FKKA 1ACYL 3IGLA 1S9WB 2MOGA 4B9CA 4L3ED 1S9WA 1B0GA 1E50A 2WLMA 1RFDL 1SOXA 3ETSA 1Q1PA 2ZWZA 3IFOA 2JKJA 3IFOB 4TSBH 3QJXA 4PHXA 1AZUA 3KM2A 5L9DH 1ROCA 2AQQA 1KULA 3LVEA 3F7QA 2F58H 3OZ9L 1MHHA 4YXKL 4UNUA 4NUQA 1JGEB 4DOHE 1JGEA 3UEZA 2XIDA 4DP9X 1LHZA 2KZKA 3WNPA 3V4UH 1NUGA 1YG9A 1FSKC 5D1QB 4V1DE 3KVDD 4U1JB 5D1QA 3RUGF 5F0PB 4U1JA 5IV2A 1JYWA 4HEPA 4NOBA 4XCCL 4KPHH 2JELH 4TVPH 1RUMH 5IVXB 6FABH 4NWUL 4J23A 5IVXA 1DQQB 2J43A 4MJ5B 1F0LA 4MJ5A 2FQGA 1G7MB 1CCZA 2ARJA 2DWYA 1G7MA 4WJKB 1Z3RA 4X99B 5C8JB 4X99A 5C8JA 1FLRH 1NAKH 2DYPB 1PFOA 4K9JA 4ZYKB 2DYPA 4ELME 4ZYKA 1XBDA 2IANE 4UQ9A 4ZMTA 3WHE1 3K6NA 4ODVL 3DKHA 3VMPA 1H5BC 4WTZA 3NQKA 3MLYL 4HULB 1RL1A 2FWOB 4JGUA 3VFRA 3LEVH 2FWOA 4KVCH 2YKLH 2O72A 3DIFB 1T83A 3DIFA 2Y1AA 4DVRH 3B2VH 1VPOH 2C4FT 2FO8A 3TYGL 3FQWB 2E7BA 1L7TL 3FQWA 3EO9H 5AW8B 2R0LL 4Z3IA 3RWGB 1WGVA 5F3FA 3RWGA 4PV1C 1B9KA 3FSVA 4LARL 1G84A 3O8XB 3NCYP 3B9KC 3TIEB 2GBUA 1YVLA 3NIDE 3O8XA 3TIEA 4B9JA 4IBWA 3ULAB 1UQSB 2B9AA 4IBSA 1UQSA 2J6EH 4XVUC 4JN1H 4AJ0A 5HJBA 1LE9B 1S4IA 1MIEL 1LE9A 4JFWA 4JO5A 1OY3B 1XBRA 1PZSA 3L5XH 2J20A 1N68A 4ZJ9A 2XTLA 1CICB 2DI9A 1KWGA 3KGRA 3TEYA 1CICA 5L0QC 4ES9A 3V9EA 2LAAA 3AG2B 3ZYIA 4YHYB 2AJYH 4UTBH 3VFVB 1UM5H 3VFVA 5I1LB 1PFCA 4AQ1B 5CF3A 4AQ1A 3RKPA 3T71A 5KYNA 1TEFA 1EFQA 4DJMA 1GGUA 4XCFL 5EZOL 4R2GD 3RTLA 1ZJBA 4JDVB 4OF6A 5FUCE 4JDVA 2BWDA 5GXBB 3BLPX 5I1IH 1X9UA 1HE7A 4LHUB 1MFCH 2HT3C 4LHUA 3UMNA 2B0SH 5HSFA 4L3FA 4GRLA 1P7KB 3T6XA 3T0DA 4LDOB 1P7KA 4RISL 3MUGB 2KL6A 2YXFA 5I23A 1WIPA 3UBFA 1B0IA 2VW6A 4UBDC 1KB9K 4JFFD 1LO2L 2B8OT 1SXZA 3U1SH 3VI4F 1KGCE 1IFHH 4PJAB 3QPXH 3CVBA 4PJAA 1FYTB 2H2PD 1ETB1 1FYTA 2APBA 1OAQL 2YLKA 3QHFL 4N9OB 3F7VB 4KDVA 4DNLA 3CH8A 3F7VA 3TVMC 2X9YA 1I8UA 4HU8A 3RZCB 1CF8H 2BSDA 3RZCA 2WZPA 4JG0L 1LL1A 2DI8A 2FEDD 3V4VL 4BSVB 1MLCB 1I1FB 4BSVA 3TA4D 1MLCA 1I1FA 1NZRA 2HWZH 4F92B 3GDCA 4HGWB 4YJZL 4HGWA 3KPPB 4HZLB 5E6SB 3KPPA 4HZLA 1M7XA 4Y5XB 4Y5XA 1KXVC 2MPVA 4XPTH 3SGDH 3CN0A 4OH2A 3A6CL 5GGTA 3F6JA 3T6WA 1I53A 2P45B 2ILLA 3HUJE 5LBSH 4AMXA 1AC0A 5GGQH 3N6YA 3IJSB 2X28A 1YJDL 3IJSA 4IGBD 1E4JA 3MGTA 4GEJA 3GXUB 3HG4A 4RBPH 3GBMH 1GRWA 2K1MA 2KZ1B 4PJBE 4AW7A 4ENZA 1KSRA 3T4AC 3RGVD 5EU7C 1PLBA 3U9UB 4Z3EA 3U9UA 4LGRB 3HZYB 3VU1A 4FA8A 3HZYA 1VKXB 2EH7H 3UGEA 4G2AA 4BH8B 1VKXA 3T0XA 1KYOJ 2DB8A 1RZPA 4BH8A 5KVEL 4OVVA 5AEAA 2FQFA 3WELA 2WANA 5FKPB 3CCHB 5FKPA 3CCHA 4WI6A 1HAUA 3OSKA 4NBXB 3QUZD 3GD1C 4G6AD 1G7IB 3N40F 4GRLC 5JHLA 1G7IA 4Y16C 3LS4L 3PV6B 2BSTB 3PV6A 2BSTA 5ADOH 4P4KC 4P46A 3QXVA 3Q9QA 3EOBB 3JSSA 4PU2A 4EVNB 3EOBA 1UVQB 2VR4A 4EVNA 2A74B 1UVQA 2JIXD 1NDGB 4AIZB 2A74A 4AIZA 1NDGA 5G4MA 1SBSL 1OPGH 1MCQA 4NGHL 3ILQD 2DIAA 3SJVB 4MQTB 4H44C 2ZSWB 4N9GB 3SJVA 2ZSWA 4N9GA 4LEXH 3ZT5A 1MCRA 2CNYA 2QR0A 3WY3A 4GSQA 2EE0A 4MNQD 2A9CA 1OGAB 1OGAA 5JUEL 1WS7A 4N87A 1AQ8A 1VDGA 1Z9LA 1YPZF 2QADC 2C3HA 1ACYH 3BJ91 3IDYB 4I18B 4G80B 4FQ2L 4I18A 4G80A 5IW1B 2ZP8A 5IW1A 1JF1B 2H2SC 2Y5TB 5F1IB 1JF1A 1YQVL 2Y5TA 5F1IA 3HG0A 4EUPH 4KRNA 1F41A 5IHBA 4HUNB 3T0BA 3UYRL 5H8DA 2YBRB 1U3ZA 2YBRA 3OZ9H 3MOAL 3RVVD 4GIOA 2IPUG 1G43A 3MRMB 5DJ0B 4RAVB 4RAVA 3IPEA 1BQLL 5B1BB 1GR7A 4XCCH 2VQTA 3A6BH 3ZOAA 4LVOB 3VG9B 5JOEA 4NWUH 3LZPA 1KT2B 4PSRA 1KT2A 2VDNB 4FFYL 4HEPG 5IUCA 3OWRA 4UTAH 5FYJL 3CVDA 1TJMA 2ZQKA 3O4LE 3PE9A 5DRXB 5DRXA 2OYMA 3FU0A 3N91A 3CHOA 4PCKA 5HI5C 5IG7B 2JJSA 3DARA 1MQ8A 3DOSB 3ZIMA 1LEKB 3DOSA 5GRVL 1LEKA 4ODVH 4FFVD 1NC2B 2EYTB 12E8L 1NC2A 2EYTA 1I75A 2ZCKL 1YLBB 1TYRA 2MTPA 2VRAA 4X83A 5H94B 2XVLA 5H94A 3R4DA 4JQXA 5D1XB 1U8HB 1WD8A 4P46C 5D1XA 4HG4K 1U8HA 5D93B 3NJKA 4WTZG 5ISZB 1BBJB 2R69L 4U0RB 5ISZA 4ORZC 1BBJA 1K72A 1L7TH 3HAEB 3DJTA 4MFHA 5FFOA 2QGBA 4X4MA 1L9RA 1DZBA 4LFHD 4FP8L 3THML 4GAGL 4DFHA 3BE1L 4HIPA 1IKFL 3ORJA 1BVNP 2XPGB 5EA0H 2VR6A 4LARH 2XPGA 1JWMB 4LBAA 1JWMA 1HK6A 1TVHB 4HWZB 1TVHA 3QI9B 4HWZA 1FAIL 4U4IA 3QI9A 1EBAA 2VQ1B 2VQ1A 4AK2A 4YSPA 5I1JL 4R9HA 2X4NB 2P5WD 2X4NA 2P1YA 1OP3H 3SPJA 1WP6A 1FORL 5FYJD 2VKWA 1QRNE 5DGRA 2NY4B 5MP6L 5JMRA 1DBML 3S3CB 4H88H 1OE3A 2A73A 4ZS6D 1R5VA 1XIWC 4XCFH 3DLQR 4PJIF 5EZOH 2YN3A 3ZYJA 4E41E 2Y3NA 2D31B 3OR6B 3RPIB 3TBCA 1UZGA 2D31A 3RPIA 1ZTXL 4EZKA 2KLTA 3K6IA 3FRPB 7PCYA 3FRPA 3HNSL 3GXMA 4EZJA 1X44A 3L3DB 5HDLA 4OFIA 3L3DA 3MRNB 3W39B 1T7ZA 3MRNA 3W39A 4LHUG 1LEIB 3QPQC 5IBLC 3REWB 1LEIA 5IF0B 3REWA 5IF0A 1F86A 1XGZA 4YHOL 4OFYD 2X89D 1NFAA 4KY2A 1OAQH 2AJVL 3QHFH 1G7HB 3GLZA 4HGKC 4D3CH 4XPFH 1ASOA 1AMXA 4GBXC 1OP4A 4WEBL 3MKGA 3P9WB 4L23A 3UIZA 3MXWH 1JIBA 3UYOD 4OZIF 1E5AA 4NIKB 1NMCB 3D4CA 4IKNA 3V4VH 4DEPC 5HDQH 1J10A 1NGYB 4LEOB 1NGYA 2AQ1A 4LEOA 5E1AB 3RTQB 5E1AA 3RTQA 4GPVA 5I76B 2E27L 5I76A 3B9KD 3WS6A 3A6CH 4F2FA 4L8BB 3QIUB 5TQ2L 5CUSH 4L8BA 4X8CA 3QIUA 4XVUD 5C0GB 3LHPL 5BOZG 2XBZA 3BEWB 1EHAA 4OGYL 1UB6B 2R29A 3BEWA 3MRBB 3OMAB 1UB6A 3MRBA 1JS4A 1YJDH 2P49B 4YBLC 2H3XC 2PR9A 4LVNC 4YAQB 3PWLB 4YAQA 3PWLA 2NW3B 4GRWF 2NW3A 4LVHC 4Y8DC 2JSFA 1GTNA 1L0XA 4JKNA 3H4HA 5E24E 3WNLA 4NQQA 5KVEH 2C9VA 5JXEC 3L9RB 1XH0A 2RQEA 2VB5A 3L9RA 3D3VE 3Q3GA 1IBYA 2HT3D 2E7LA 2BVYA 3GS0A 4XNQB 1SBBA 2BJML 3E3QC 4XNQA 4IIQC 5G5DB 5HGHB 5G5DA 3E2HB 3U7WL 4PMEA 1FL5B 1FL5A 2BHYA 2BXYA 4NWTH 3U82B 4BEIA 2Y7QB 4D2NA 1SBSH 2Y7QA 1A6WL 4NGHH 2PWDA 1QW8A 1WQVT 3D87B 3L7FA 3D7PA 2WGNB 3D6GA 5F0JB 1PZAA 1E8XA 4Y7MA 4IKIA 3TVMD 3UO8B 4N2CA 3QIWB 5DQJA 25C8L 1RERA 3QIWA 3WFEH 3UJTL 3VYOA 1DJSA 5JUEH 3WS3B 4QY8B 4S1DD 3SGKC 3WS3A 1XEUA 1F45A 4QY8A 3V8CA 4ETQB 4ETQA 1JZHA 3UTOA 2VLJB 2XWEA 2VLKD 5C09B 5GSRB 5C09A 1FZJB 4AL8L 1MZYA 5GSRA 1FZJA 3LRMA 2WTRB 3SKOA 2BW4A 1U42A 1W72B 5CWSB 3KBFA 1W72A 4P07A 5CWSA 5K59F 3DSNB 3J7HA 1II4E 2YZ1A 3DSNA 1JDDA 3VNZA 1KIQB 1KIQA 2DL2A 2WLKA 3EDKA 1TR7A 5HPMA 3WY4A 4HOXA 4G6JH 1VRSA 4OLYL 3WKPA 1U8QB 3HRZC 4PEEA 1U8QA 2XIIA 4GOSA 3QJRB 4N2KA 4Z7WE 4R84A 2DEWX 5FYJH 3N2JA 1IB5A 3DVFA 4NEHB 1XMEB 4HD5A 3F7PC 4PM1A 4IHOB 3BVDB 2WXQA 4IHOA 4JFVA 4JHAL 5KSBE 4UM8B 3ARBC 1MW3A 1K4DB 4UM8A 1K4DA 1MXDA 5DZOA 1MCPL 5TE6L 1G6RB 4S0SD 1BAWA 4CUCA 1G6RA 12E8H 1YHPA 2GW5A 1BFOB 1BFOA 4FXKC 4CU6A 3QIBD 4LPWA 3KPSB 4J28A 3KPSA 1P4BL 3TT3L 2R69H 3NSDA 1G4MA 4X7SL 1P9MC 1P7BA 3ZDXE 4FJZA 1QMUA 3P1VA 4K3GA 1BQUA 1C5CH 4HIIB