3QORC

Crystal structure of human nuclear migration protein nudc
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
117
structure length
117
Chain Sequence
SKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIADGAVVTVHLEKINKMEWWSRLVSSDPEINTKKINPEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Features and Chaperone Activity of the NudC Protein Family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, cell cycle
molecule keywords Nuclear migration protein nudC
total genus 27
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qorC00
3IGFA 3L1EA 3GUFA 1RL1A 4JUTA 3L1FA 4YLCA 3VQMA 3QORD 4YL9A 3GLAA 2WJ5A 2MNWA 1GMEA 2RH0A 2XCMC 4YLBA 2Y1ZA 3Q9QA 2O30A 4YE0A 2K8QA 2KLRA 4M5SA 4MJHA 4RZKA 4ZJ9A 5DS1A 2Y22A 4M5TA 2N0KA 3QORA 2JKIS 5LUMA 4YDZA 3N3EA 3QORB 2N3JA 2BOLA 3QORC 3L1GA 2CR0A 3W1ZA 1WH0A 2KMWA 2Y1YA 1X5MA 2CG9X 3J07A 4ELDA 5DS2A 3VQLA 4JUSA 3AACA 4PBDA 1EJFA 3EUDA 3Q9PA 4I88A 4PCKA 1WFIA 4FEIA 3AABA 1WGVA 1SHSA 2WJ7A 3GT6A
chains in the Genus database with same CATH superfamily
3FTYA 2ERJB 1X5LA 4X83A 5AOKA 2NR6C 3IU3A 1MQKL 5FUOH 3ESNA 4TUOA 1UT2A 3FCSB 5I19H 3H9SE 3PRZA 12E8H 4W9GC 3UPRB 3X12B 3RPKA 4XNDA 4G8IA 5EU5A 5L4FA 2EYTB 4L9LA 3IWUA 5JHLH 2FWLB 2LLNA 1X5GA 5GGQH 4M62H 5BZDA 2VJ0A 2PMZA 5ESAB 1YEIH 1I9JL 2FX9H 3HRZB 1GKOA 2Y1YA 2DMBA 3OR7A 5JNYA 1A47A 3GJFK 3GO1H 4NWUL 5DK0B 4P3CL 3CTTA 3GS7A 4NRYA 3ARSA 1W2KT 4FQJL 3ZDYF 4M8QB 1JHLH 1OTUD 4YHIA 1F4AA 4IOIB 3RFZA 4X6DE 4KTEL 5EO9A 4A6YH 2CIKA 4F8NA 1D7BA 2AEQH 3BD3A 3R1GH 1LNUB 1M57B 3DV4B 3GLEA 4JDVB 4ELKB 3CFEA 3SDXB 4QHKJ 4DK5A 5BQ7B 2RTTA 3NESA 4KKPA 1CGXA 4OM0L 2R15A 3WTSA 1IL1A 3O6FA 2VQ4A 4AMXA 2CLRA 1U8KA 4JN2A 4IU2A 3L2MA 3VG0H 1ZMYA 3EHBC 3NN8A 3E8UH 5GGSA 4AYEC 3F58L 1JERA 1HYRC 3ELAT 2VRQA 2ZP9A 2K7PA 3SO3B 4OH2A 1J18A 1EANA 1WGVA 3VE0B 4EF3A 3PIQA 4BWTA 2BRRH 4UM8A 5F3FA 1CZ8L 1QRND 5ANMA 5F7BA 1XTMA 2MPAL 1CFSA 2HTKC 5D7IB 2Y7QA 3TBTA 5DT1L 4F8TA 3J7HA 4M93C 5HHQA 1XGUB 4RISH 4MQSB 4QNPF 4QAMB 2OBGA 1JPTL 4PJ8B 3RY5A 4NYLB 2Z0UA 4WGVB 4M1CD 1IZJA 3OR6A 1E28B 4HG4K 1EJFA 4NO0A 4Y2OA 4GI6A 3UJJL 5DJXB 5C0FA 3R7RA 4IIZA 2A74C 2C3HA 5BV7H 1H3PH 3B8SA 2HFFA 3R4DA 1NCAH 5AB1A 2DQJH 1OHQA 4OGXH 3HFML 4X7DC 3ZHKA 1JE6A 2R29H 3A67H 3O0RL 3EYFB 2GAZA 4U1GC 2XN1A 3FQXB 4NZUL 3HOGA 1NL0H 5C0IA 1XMWA 3N3EA 1BOGA 1KC5L 1GCFA 1H6UA 1YEJL 3ZHNA 4KQ3H 4WSGA 5FGBA 4XPHL 1T0NA 4LIQL 4XP9H 3SIKA 5JHBA 2HVKA 3BQUA 4M00A 4A7GF 5BNXD 2EIJB 3BDBA 3P02A 4Z8FH 4WHDA 4F20A 1CPUA 3G5VA 4LSUL 3EGXA 5EZIH 2EDNA 3R8BB 2AK4A 4GQPH 1SM3H 4CVZA 4X99A 2JIXA 3OF6A 4UOW1 4DFIA 1A2YB 1I9IL 3BE1L 4LOFA 3PHOB 3H3BC 1M05A 3KJ6L 1K2DA 4OD1H 4XBPA 1LWHA 3BLPX 5I9QC 2XN9E 3ZE1F 3ZE1B 3VDBA 4G9FB 3MV11 3RE0A 5E94A 1WFMA 4KI5C 2HLFC 1WEJL 4N6QA 3GMQA 1WZMA 3CCHB 1FSKC 1JXDA 5HYJB 2BRQA 2AQTA 3L1GA 3EOTH 4HGKC 5T5NG 2AXFB 2H9GB 2ZXCA 1NKRA 5IEHA 3T0EC 3ZLQC 1DQVA 5FAAA 4QLWA 3U9UB 3KPMB 3UP1A 5GGTL 1WLHA 1TMQA 1PQZA 2F8IA 3MRFA 2P5WE 2Q3AA 3HE6D 4WI7A 4ENEC 1FO0H 2UZIL 3HN8A 3VXNB 1NLDL 1JK8A 5DRXB 1EAPB 4POZD 3QFDA 2DZEA 3V0AC 4N24A 3KCPB 4F57H 3S88H 4FF9A 1A7NL 2WXIA 2DB8A 3EO0B 3P3RA 3PWPB 4K3DL 3QIWD 2GG1A 3B9KB 4KHXL 1W0YT 4OI8A 1T4KA 1OOWA 5FOJA 1D6VL 4X98B 3MRRA 2AXGA 4HS6A 1F4WL 4PJEB 3TEZA 1ODUA 4D9LL 1WT5C 1D2PA 2JLPA 3BKYH 4K7PL 5E2UH 4I88A 4AY0A 1BLNA 2ROYA 4PV1C 3KLSA 1W9XA 5IFAH 5FWRA 3OKDA 1G6RL 4M5ZL 3FO1A 3TT3L 5MEPB 3BDYL 1ETZA 1IBYA 2GVYA 4L0ZA 4GSXA 1JF6A 5CCJA 1WCQA 5HI5C 4U3SB 4EOWL 3K6FA 4Y16A 2W91A 5KYNA 3UBXB 2V8LA 1GZHC 1SJVA 3JTTA 5ETUB 3UBXI 4F7TA 3QORA 1ETJA 4P9HH 3OAZH 4DWHA 4JDTH 2BC4B 1UM5L 4HBCH 4WWKB 1ZGLP 3WTVA 5K69A 1GGTA 2GTWB 3I6LE 1TVBA 4P2OC 5ADOL 4NNXB 2NXYC 5E2JA 1WFIA 5BPPA 2XZZA 1NCGA 2QQLL 3RNKB 3QHFH 2VH5H 1L3WA 4X8JA 1VSCA 4YO0A 4OLWL 4YZWA 1MPAL 1GC1C 3VWJD 1QHQA 1KYUA 4LNRB 5KS9A 2CKBB 4N6RB 1ET8A 1BXVA 3IDXL 3CIQA 1O0VA 2X6CA 2CJUL 5DUPH 5C8JA 4AE0A 1IM3D 2ICCA 3HHMA 2N01B 4UTAH 4RDQF 2DMHA 2WBWB 2V9TA 4Z7VF 4PV8B 4FLOA 4OZIE 3VGGA 3QEGL 1B4RA 2BCKB 2XWBB 3WHXA 1NKGA 2MSPA 4GFTB 5D2NA 4E42B 5L6YL 4P5TC 2Z35A 2WLHA 4TYUA 2ZUWA 4AVKA 4MAYD 1UUSA 2HTLD 3K8KA 4M62L 3V0GA 3AUVA 1KCBA 1NPUA 1W0VA 4JHZA 4PJBB 5ACMA 1KBVA 2ICES 1AKJA 4JFFE 5FS5A 1IGCL 4ZMVA 1COBA 1M9WA 4RZCA 3P0GB 3T0XA 1GGBH 1K72A 1W80A 1BV8A 3ULUC 2G0LA 4M6ML 3PU7A 2YOCA 1SY6L 4PJFB 3IDIB 4QYAA 3QJOA 3TO2B 3MJGX 4NUMA 3ZE0B 4FQXA 4J3WA 4MMXA 4PB9H 2PWEA 2ZD0A 4G43B 4UOW0 3RZCC 3MV9E 2GBTA 4GRMB 4DF9A 5SV3A 2AJZB 4XP6L 5CHNB 1MVYA 1TYRA 2CALA 2VJ8A 3VG0L 1DANU 1JK9A 3VFNB 5M95B 1K4CB 5TF0A 5HGBA 5JYLA 1DQTA 5F93C 3BQVA 4LHQB 4QMEA 3P69A 1ZS2A 2VLMD 5BQ7A 1GC1H 4JFEA 4A38A 3TFBA 2GFBB 5EOCL 4XX5A 3MNWA 2NZ1A 1C8PA 3NSYA 4RRPA 4JFED 2E6JA 4IRZH 2EYSB 4L3ED 3EFOB 4NIYE 5CINH 2F19L 2ARWA 4PRBB 3VE0A 4XPFL 4FQCH 3EUDA 3PIQB 2H2SD 1K3IA 2XTSA 1ORQA 3BIAX 3VAEA 1IAII 1DQML 1BOGB 2XTJD 3D85B 4AEEA 2YSTA 4HEPG 2NXZB 1YNTF 5I1LA 4WLCA 5HHMB 4Z95H 1UVQB 4AIZA 1CI3M 1JGEA 1KULA 4L1LA 2WBXA 2B2XL 3C5SA 4LCWD 5HJ3B 2Q8AH 1W6LA 4LXFA 4LSTL 1I7TB 1RIVH 3PHOA 5FA4B 4LLVB 4ZO7A 2PPEA 1UM6L 3ME0B 3MNDA 1NL0L 1PY4A 4KRPD 3B2XA 2AKRA 5EC1A 1TLMA 4DGVL 5JW3L 3TL5A 1UKTA 4KQ3L 4OZHF 1ZVHA 2QELA 2VISB 3FHAA 4M6NL 2D7MA 5J1SC 3MJ7A 1NBQA 3MV7B 3MJWA 4KOBA 5ALBH 2ZX9A 3EYUH 1AE6H 4DUXA 4Z8FL 3QQ3B 3V5HB 5BJTB 2DQCL 4F5CA 4LL1A 2WN2A 3JYBA 4XPTL 1H8SA 3SBRA 4BZ2L 1MCDA 4UYPA 3W1ZA 1A9BA 2XTJC 2I60L 4IS6B 1ADQA 2NX5A 2V5TA 5E99H 4ZFFA 2XVKA 3MJ9H 3QXWA 3QEUB 2BSBA 2VE6A 3ZTJG 2XQ0A 4X5WA 1A2YA 1WWWX 2WYTA 4ANXA 3AB0B 3FFCD 3HC4H 3GSNL 4M8VA 3OZKA 4OZHE 1D2OA 3EKCA 4NFCA 1YJDH 2DQIH 2EDJA 2GJ6B 2IH9A 2Y5TB 1P2CA 5GJTH 3RVUC 2KUTA 4RWYL 1G9MH 1AIFA 4KK9D 4EMZA 4KNSA 4RFNC 1A6UL 4GT0A 4XT1C 5H37G 1BM3H 1XSIA 1ADQL 1JDDA 4MS8D 2B7DT 3QIBD 3EOAB 4PJCF 1FF5A 5IVXB 4YHIB 1BBDH 4JFDB 1BJ8A 5J5EA 2ZSWB 1E6OL 1E9QB 5C0GA 4BQCA 1BBJB 2NYYD 2UY7A 3IJSB 5KTEL 2VDOB 3L4ZA 5EOCJ 1D5XB 1ZLSH 5HI4C 2HKHL 4XRCA 4N2IA 4A68A 1T66D 1RU9L 5HHVH 1IAMA 1T5WA 3FO0H 1OAQL 4FI7A 5D1QB 1UJ3A 3I6SA 5T1MB 1YYML 4CILA 3UZVA 4UDTA 1OAJA 4BIKA 3H9SB 4NQTA 3ESOA 4E41A 2H1LM 3VXUE 3IDYB 3VNYA 3LD8B 4X0KA 5I66B 5TPWH 3SZKC 5GZOA 3EJCA 3HZKA 1REIA 4PJDF 1O6VA 1JFHA 5LVEA 3P9LA 2EH7H 1MI5B 4JFQB 3RUGE 4WSKA 3FDWA 2X12A 4JVUA 2FH8A 3OKNB 4E0RA 5KYWB 3BUQA 2DQ6A 2FWOA 3L4TA 4D0CA 1NDMB 1IC7H 2FUQA 3OMIB 3LSOB 2D3JA 2HYMA 3N85H 3PQYD 3F05A 1PG7X 1P6AB 5DUPL 3MLTA 2IDTA 3TH2T 3KGTA 1V3LA 2RHEA 2I5YH 2FGWH 5FYKU 3STBA 5F1NA 3U0TB 4CNIB 4Q4EA 3D7PA 3VI4E 3OTTA 1M6UA 3H4FA 2BVEA 3BQUD 3KPRA 4RDQG 4PWGA 2KHAA 3G7TA 4QRTB 3O8XB 5I0DA 1EBAA 5AAWA 1Q0YH 2ZUQC 5BCAA 3AUWB 4G6KL 3MCLL 3KDMA 2QGDA 1EFQA 1BFOB 4FYQA 3TYFB 1JK9B 2DQEH 4A6YA 2NY3D 4HLJA 1NGWA 4HXBH 4AK2A 3IJEB 1E43A 5LBSH 3E0GA 4MJJA 5JDJA 5DLLA 1VGKA 4NO0D 3IGAA 4NZRL 3RTQC 4Q6KA 4JM2C 4JRYD 4JRLA 1MCEA 5AD0B 1GYVA 1F90H 3CX2A 3FZUD 5C0NC 4HUVA 1JAEA 3CCHA 3DOIA 1FH5H 2ED6A 4JY6A 4M43H 4JFDE 1HAWA 4XWGL 1I8MB 4P46B 2A9DA 5DHVA 2VLRA 3LH9A 3P11H 4UAOB 4C56A 1NDGB 1XF5B 3U4EA 3WJMA 2HG5B 1IAIH 2B59A 5T1DH 2CM5A 4MCMA 1JTPA 4ENED 3KPOB 3F6JA 3JV4A 4GP8B 4LOVA 4FQ2H 4XBEH 5D1QE 2JFCA 4DETA 2PTVA 2IF7A 2K1MA 4DGIH 3QDGA 3QH3A 4TNFA 3MKKA 1DBML 3C5SB 3BW9A 2RGSA 3BP6A 2ISDA 4BELD 5AZEL 5TH2A 4OJEH 3ARTA 2PYFA 3VFUA 4RIRA 3L9RB 5C09A 1N4XH 5EU6B 1RP9A 5AAMA 3N9GL 2SEBB 4Q4IA 5AUMB 2B20A 3BSGA 2A9MH 2Q2EB 2OS7A 1BLNB 2IAMD 3B37A 4TTGA 4POYA 3W82A 1ZHKA 2EDRA 4FQXC 1QRNE 3VXRB 3ZYZA 5T1KD 2H0JA 1MJJA 5AKSA 1J87A 1AQMA 2KPNA 3IDMB 3OAYH 1N0XH 2NNFA 2EDDA 3GPSA 4XPBL 4YGVB 5LKNA 3CZEA 3O8XD 4BE6A 1MKFA 3O11B 3OKEB 2EEXA 5CMAB 2QBWA 3UAJD 1NA8A 1MWAH 5FYJL 2VXQL 2DQUL 3C09C 5SWQB 1ULVA 2X38A 1YMMA 3ETSA 2FBJH 1M7DA 2HUEA 5HD8D 4MXVF 4I18C 1MREH 2X4TB 4WFHE 3ROLB 3X1GA 4DQOL 3B6SB 5A2BA 1HHHA 3LD8C 4NQXA 3HG1B 1U8IA 3KYOB 3K1DA 2ICEA 1KJVA 4YO0B 3FT4A 5CZVH 3B7YA 1LL1A 3G5YB 3R18A 4PRIB 1C5DB 2APVA 4S11A 2IGFH 2DIEA 1PIFA 4ZMYA 2V33A 3MYZA 3NCYP 4JRYB 2H2PC 3DVGB 4LSDA 4AEHH 1IM9B 2I7SA 5SWSA 3IRZA 2C4XA 3LZNA 1S7XB 3VD2A 1ZPLA 3MRMA 4P46D 1X9QA 3PJSB 4QOKA 4GG6E 4Y4KA 5DO2D 2VB5A 3F01A 1RQ5A 1FUNA 3CHRA 2DQIL 4IBZA 1S9KC 4EI5B 1YEEH 1T0MA 1HSBB 3MX0A 5GJTL 3BZ4A 4XMVA 1GIGH 4HJ1A 3ZT5A 4PJ8C 2X3AA 3BWZA 4NHUB 3BX7C 3HZYA 1FE8L 4NP4H 3TNNB 3JVGC 2EDWA 1MH5B 3SKNA 5T5FA 4NC2B 2R9HD 1IGYA 3CFCH 1RXLA 5SWSE 1ANUA 3IXAB 2W1NA 3HI6H 3EGSA 1EHLH 2W8CA 5D6CA 3WXVL 1QPKA 1I1RA 2X3CA 3SPCA 1ND0A 4PGEB 4HLZH 2O26U 4HKZB 3X13B 1OAXL 1J0JA 3QC5X 2DBLH 4UOJA 5I0VA 4J3BA 2WINA 4TQIA 2Q76B 1S78D 3MR9B 1UFUA 3TO4B 2PCYA 4JFQA 5FUCC 3VGHA 4ALAL 2BSSB 2QSCL 2VUOA 4C8XA 5IREA 2P8MB 2PO6C 5F7MC 4A2EA 1T80A 2J4WH 4KMTH 1QW9A 5EZLA 4OF5A 4WFGE 2VN5A 1HOEA 3MYJB 4UZGA 1VA9A 1BJ1J 2JVUA 1WC7B 3PDDA 4LT7A 3GZPA 4NBZB 4WUUE 2Q86B 4H1LB 3S48A 1P4LA 4X5RA 4HFWB 4UYQA 1TENA 3SKMB 4I48A 2F18A 5BV7C 3CK0H 1NBVH 5E2WH 4L37A 5DD5L 4KTYA 1QSEE 1DDTA 3O3EB 5KYXA 5KYYB 1KIRB 4OLYL 1KTKE 5EOQH 2E6PA 4KUZL 3RTQD 2XYCA 2OV0A 1JL8A 5B7MA 4L4VD 1TMCB 4XO9A 3S6CA 3VDAA 3K6SA 1KLUA 4IKIA 3OX8A 1MI5A 4U1NA 4EN3C 4PLJC 4U2YA 3TA3C 4JPKH 4OT1L 1VFAB 1ZE3C 4R5VA 5LCVL 2DOCA 3X3FL 1Z5LA 3WUWA 4GMSH 5DUML 2VAAB 2W0FA 2H45A 4HWUA 4WTZG 3RIFF 4XTRD 1E2VA 3VW3H 4LEXL 2R69H 5KVFH 4EI5D 3U9PL 4PRIE 1DJGA 4FXGC 2E7LC 2VDOL 3SCMD 4KDWA 4PP1C 1J48A 2Q6WB 1SVZA 2CHXA 3AWEA 2K0RA 1WDAA 3PL6A 1WZ1H 1UG9A 4YDIH 5C0CA 5HXMA 1D7FA 2EXWC 4U7SA 1ORQB 3VFGL 1HI6A 3VM5A 2ZAHA 2VMFA 4XPAL 2A73A 4N90D 3WFCH 3O3UN 3OKOA 5EZJB 5A2FA 4BZ1L 1QVOA 2G5BA 4LOUD 1JVKA 4OM1L 5EIVA 1KF9B 4QHNA 3GSWB 5KYUB 3UCRA 4XXCC 1ZTXL 3NP3A 2BSRA 2A3TA 4U6HB 3MZTA 3TIDA 2VWEE 4U1MA 1CFTA 4X5XB 4OIFA 2AKRB 5EC1B 5C9KA 5GGVH 4F93B 1EJOL 3S3JA 5LQBH 4KO7A 4FXKC 5GRJL 2QGEA 3FAXA 1HXMA 4K9EL 5BZWB 4LLWA 5CD3A 3NAAL 1G0XA 5C0CD 1U30A 2ZOLB 5IBTH 1XZWA 5F7EH 2ZX8A 3UEZA 1A3QA 1QLEH 5ECJE 3UYOD 3VI4A 2EDXA 4HZLA 3LKQA 1R3JA 1JXJA 3T71A 4DERA 4UAOC 5ESQA 5J9PB 3MV7E 5LJYH 4KQ4L 5EU4A 3IU4H 4K15A 1WD8A 1YZZA 5JR1L 3GSUB 3KWXA 3IMBA 4JVPA 4G6FB 1AXIB 2Z65C 4G9DA 4MLIA 3JBG7 1NICA 3PGCA 3WO3B 4MZ2A 3FQ2A 1LQSR 3EADA 3MODH 1EO8L 2CO6A 4N68A 2GPZA 1U91B 1NGXA 2B77A 3O45A 1P7HL 4N0UA 4JBSA 4I3RL 3FQUA 1LD9A 4FRWA 3NCEB 5HHMD 1FNSL 4PI0A 4O02B 3FUFA 2C4FT 2JQMA 2NY5H 3F85A 3OWEA 2J88H 4X4ZA 1BBJA 3MXWL 4NNPL 1N6QH 5IV2B 5C0AB 1ZT4B 2VDRB 1OAYL 2JI2A 4W9FC 4XVSH 2W60B 5DZPA 2RA1A 3BFQG 5IMOB 1GH7A 2VM9A 2MNWA 1X5FA 5SWZB 3D3VE 3MOAH 2MPVA 2BS71 4FMFA 4AG4H 3Q6GH 5CP3A 3TT1L 3VWJB 3EHBD 1LVEA 4KTDL 1OM9A 4YEFA 1O7VA 1IVLA 5TQ0L 2MQGA 4JO1L 4A7VA 4NRZB 1MZYA 4HV8A 4Q6IC 4HS8H 1ZDSA 2DLFL 1N59A 2DL9A 3LX9A 5J4MA 5IWLA 3CQPA 1E4KC 4FNPA 5LWYL 1IKNA 3PWUA 5ADPL 1PW3A 4GRMA 2W65B 3LN9A 4FL4C 4YLQT 3WNNA 1QBBA 3O4LB 2V7NA 3FOMB 3ATFA 5M94B 1CBVL 2NQDA 4NOBA 1CIUA 2IIJA 3FFCB 1KT2A 4MMZA 3CDGA 5AW2B 2GK2A 1QBLL 4D0CB 2CZNA 1MI5E 4Q9QL 2BP0A 2BLFA 2HT2D 3V4VB 4H0GA 4YQXH 1R3IL 1XQ4A 1DL7L 1JWUA 1G7IB 3IU3B 1Y1UA 3NZHL 1SHXA 1WK0A 2C9UA 3LYRA 1NMAL 3N6YA 3KPRD 1E2ZA 2B8OT 2HVBA 1WC7A 2WLLB 3KYNB 4HGWA 4OCSL 4TQ8A 4U05A 1V7ML 5LN8A 5TDPA 1KCRL 3US9A 4A55A 3EDDA 3WO4B 3EJUA 3LJ3A 4NXSA 5L4MA 4PREB 4CJ0A 1HHJB 3NCBB 1EEYB 4NQDE 4NPYB 3MLVH 3JWOC 3RVVC 3QG7H 4PWIA 1V8HA 3N40P 2WQSA 3NEEA 4MB4A 4XC3L 2JKXA 2X41A 4PGEA 5KYYA 4S1QL 5KYXB 1RUAH 3T2PA 4BQ9A 1GR7A 2EDQA 4X7SH 5ILTH 3B9KD 1D9KC 3U4BL 2R0WL 3RWEB 2AV1A 3WY4A 4BFOA 3BRDA 1FL3A 1DBJL 1F58H 4I0PC 4I2XE 4WHTA 4AQEA 3QWRA 1EPFA 2LE9A 3QUMH 3WCYA 4NDMA 4IMLB 1MJ7L 3BN9C 4FNLH 1NGWB 3QH3B 4P4KD 3ATDA 3SPJA 3W11D 1E9PB 1PKOA 5JQIB 3I9IA 2WZPA 4OUOA 1IL1B 3EZJB 4Z77A 1HOCA 3T09A 1AS7A 5B7EA 4ISVB 4JFPA 1R46A 2FIKA 2VR3A 1ZEAH 3FNKA 4GUCA 2MHAB 1ECZA 3B1UA 3E9UA 4Z3FA 4UQBA 3VXTB 5D1ZA 3VXMD 5BJTA 1BAFL 1TZOA 4UQ2A 2WHVA 1TO4A 3SDYL 1P84J 4YUEH 3GMPA 1BCIA 3FQNA 5C0AE 5MHSD 1OTTC 2ZYRA 1XTLA 3KLQA 5C0JB 1ZGLM 1D5RA 2NY2B 2CDEA 3HB3C 5D96C 2FT7A 3LIUA 1ML0A 3FTXA 3U46A 3KVDD 4F3FA 2OTWA 3A4AA 2R1YB 4P0DA 3BWUC 4NZDA 3GBNH 4QTIH 2BM3A 4M1DL 3SDDD 1NC2D 3BMWA 1KDIA 4R26L 2Z4QB 5LDSA 2PABA 5AWNL 3HNVL 1AO7D 4CBPA 2V9QA 5BVJA 2Z7YA 3UC0H 3UBFA 4D2NA 4QO1A 2Y6SC 2CK2A 1GGIL 1X5JA 4QLRA 4QRFA 4DP9X 3KCWA 5BO1L 4YWGH 4L3CA 5IWLC 4AUYA 1F02I 5ICUA 1DQLL 1SJEA 3VXMA 2Z8RA 1H5BC 4L5FH 4JX0A 1FV1A 2VZOA 2YMOA 5TE7H 5H8DA 4AQ8A 4DTGL 4JRYA 5CGYC 4E9QA 5FB8A 2M2DA 3FQ4A 4J2XA 5I8CB 4NN7C 5AW9B 3EJZC 4GSUA 3V4PB 1T0NB 4EN3A 4JHVA 4TNWK 2YD6A 5F88B 4QHNB 1F2XK 2Y36H 3ULUH 2GUYA 3Q9QA 1CR9L 2WUCL 2ODIA 3QQ9C 4Q9RL 1IGML 5IW1A 2YARA 5KEZA 2BHUA 1AQHA 3CZKA 3OG4B 1NGYB 2ZX6A 4K8RC 4PVNA 4B0MM 5IF0A 3DWTA 1ZANL 2Z1PA 4KZEH 1CT8A 2K6ZA 5B1AB 1MAMH 3I50L 1TJMA 1TLKA 1BQKA 3P77B 2DQFA 1ZS8A 2ENQA 3KEHA 1N3NB 5I5RA 3U7WH 2HLAA 3PWNB 5F6IB 3HG1E 4FULA 3VD3A 3GO1L 4NWUH 3F7YA 1HH9A 3P4NA 5D7JC 2Y6TE 3SDAD 1PF3A 1YLBB 2WN3A 5LXGH 3I9PA 4L4JA 2K78A 2EXYD 4LRIA 2IALA 1WQVT 4LLUA 3RNQA 3NSCA 2EE3A 4OCXH 1T83A 4HUCA 2J57A 1JHKL 1EX0A 1MCWM 3HNTH 2P5EE 4LVOC 4BFJA 4TUOB 1PX3A 2IH3B 3F62A 3QUZA 5HJDA 1OCWL 3CHSA 1L9OA 5L4JA 4XP5H 3T0EE 4KI1A 1KGWA 5D1ZC 4NPKA 2FIRT 4MNHA 1PBYA 4AL8C 2NT1A 2DI7A 3GNML 4DW2L 4ZMOA 2ZCKL 4ABUA 2X2JA 2JJTC 2YD4A 3FQUB 4FKEA 3QCVH 5I0YA 2VSDA 3RY6C 4WQOA 3HR6A 5KS9F 2VYRE 2CKBA 4OCYH 4NZJA 3V6FB 4UTBL 1P5UA 4M61A 5D7IA 4WKZA 4GKOA 3VYOA 2PXYA 4QYOB 3CLFH 5KVEE 2JJUA 3SE4A 1AZNA 3B2MA 4JQIH 2OMUA 1CBJA 5FFGA 1P7QD 1UT1A 3FT3A 1S7SA 3PABA 2XICA 4O5LL 1B0WA 5DRWB 4L1TA 3S3SA 4A7QA 2QVIA 1UM4H 2IGLA 1WV7T 1OXYA 2CLRB 5IMLA 4N8VG 5A7BA 1RH8A 3EFDH 3RFZC 4YFLI 2V17L 3S37L 4FFYA 4P2OA 1AGCB 2JKIS 4S0SD 5ICZB 1EWHA 3VSVA 3MN8A 5DHDA 1KMGA 1R3LA 4ABQA 3ZZ1A 4ODSL 2XWCA 1JNLH 4EUPB 5I1HH 1IGCH 2FHCA 3HFMH 4H26B 4EBQH 5IMKA 3T0BA 3I2CL 3IKCB 3TS8A 4K3JL 1LE5B 4RH4A 4YQXL 2GTZB 1DL7H 2KDYA 2UZXB 1G43A 3G6DH 1I1AB 1JPSH 2K8MA 3UDWC 1S7WA 2P43B 3NA4A 3T3MF 1A6WH 4OCSH 5JTWA 4TM9A 3LZFL 5L2JA 1A7BA 3L08A 2YEZA 3O6MH 4DP5X 1J0ZA 1LO2H 2QPDB 4M5SA 3V4VA 4YXKL 1UGKA 3DJRA 5IB3B 1B90A 3RY6A 3IXTA 3MLVL 3L81A 1P9MC 2ZTBA 1KGCE 2DMGA 1NANH 4JFXB 4JFDD 4UINL 4WDIB 5F6HJ 5IW3A 2HFFB 4MJ6A 4ZSOE 3VTAA 5KJRH 4PD4J 3W9EB 3BRGC 1HXMB 4Q6IA 3N44F 5L4IA 3ULVD 4LLDA 2FEDC 1CUOA 2AANA 2P8LA 5L7XH 3MV8A 1RL1A 1TDQA 4HWBL 1OAUH 3DTXB 1NCOA 4FNLL 1HCYA 3RY4A 2VQTA 2WQVA 3L3KB 3CDZB 5DEGB 4CAGA 2X44D 4ZPTA 4MA3B 1QHOA 4KVNL 4OF0A 4RLDA 1FSKB 5KBKA 1BX2A 1I8IA 3L4CA 4XCNA 4CBZA 1R5IA 2XRAL 1ZEAL 5A2JH 1CGSH 1BHGA 1HESA 3MRIA 3QIUB 4Q2ZB 2K6YA 4HDIA 3FQWA 3FJTA 4EIBA 3J2PA 4GAGH 1OM3H 3FCBA 5AVVB 5ESAA 2Q8AL 1UXSB 3UTTB 4PJEA 1P5UC 5D5ME 1INEH 2GC4C 1KYFA 1HEZA 3LKQB 1BVLB 1F4HA 3T2OA 3RGBA 3GMLA 2VXQA 3VMPA 1UOLA 3HBPA 3PQYB 4FDWA 4QOKB 4JG1L 4YFLF 1G7PA 4GUPB 5A2KH 5DMYA 1YEHL 2W9LA 2YAEA 3GXNA 2A77L 3H53A 1NFAA 5HD8C 3QEHB 2IPTL 2FYYA 4IDJL 1PAMA 1A65A 1MFEH 1VAHA 4P23D 3SCMB 1X7QA 3UG4A 2JXMB 5D55A 1OSEA 1AGDA 2R0KH 4LFHD 1JPGA 1S9YB 3SKJH 3LVEA 5TE7L 2I7OA 1HINH 4L3CB 4P2QD 4U7MA 1F4WH 2O5YH 2RMNA 5TE6H 4A1RA 1HKLH 4G7SB 3ZE0F 5J13B 3BPLC 3FH7A 5DI8A 2BH0A 5I6LA 3NSJA 1ZV9A 2YS4A 1Y1DA 5C6TH 5I1GH 2W65A 2DQDH 4R5TA 3SPGA 4ZD3H 3SGDI 1RY7B 3UP6A 4YSSA 4HYTB 3L9BA 3V4PA 1MFDL 2P44B 4LB8A 4GSDH 4XB8A 5IQMA 3QEGH 3SO3C 1MJ8L 3X1BA 4UT6L 5JIQA 4LLUB 5B4MC 1ADQH 4LCWB 3BZFB 1MFCL 4WWKA 4NRXA 1FGNH 4C83A 2CPUA 3S2CA 4NIKB 5F3BB 4M5TA 2X10A 2WV3A 5H94B 3V52H 2OXHA 2KH2B 2OFQA 2XVLA 2V3DA 3X11B 5EO1B 1T5WB 4RA3A 2FBOJ 3FB6B 5IQ7H 2K3HA 5EUOB 1EDQA 5C08B 2AVFA 2LHAA 3O2DL 5L2KB 2BWIA 2O61B 2FD6L 2YMXL 2G5RA 5IHZA 4J3OG 2OYPA 5AL0A 3ESMA 3AJ7A 1ADWA 1FL6B 3C60D 1YYCA 2VXVL 4NQCD 3UBGA 1HNFA 1CICD 4LQFL 5T5FL 2OI9B 3W0WD 3RWEA 2VQUA 4M61B 1KB9K 3WBDA 1QLFA 3HRZC 3IMUA 1RZ7L 1KBGH 1SRDA 1TJXA 4Y4KD 1THCA 1AXSB 2HRHA 4Y1AD 3TJHD 5F9DC 1DVZA 1M05B 3FFCE 1E40A 4UT6A 1IUZA 4TSCH 3TASA 4Z77B 3GGWA 1SY6H 1KSRA 1I3VA 2GTQA 4UDTB 3ARFC 1MRCH 1X6NA 4M1CC 4ZZKA 2AXFA 2H9GA 4ZOAA 3BGFB 4PRPB 3DSFL 1FN4A 3P4OA 4OI9A 1BQLH 3QIBB 4TSBH 2AV1B 5CZKA 3GI8H 3QZWG 4ONFH 4QHLA 4W81A 4JGMA 1DVFB 2WOYA 5ABZA 5FUZH 2CUHA 4ZX5A 5D8JH 1TEGA 4ILDA 5FIEA 1XT5A 4JFOA 2OCFD 2XTJE 4XMPH 4C55A 3S35X 2ADYA 4GOSA 1L9PA 2C9SA 2DJMA 2JK5B 1BFOA 1QW8A 3QRBA 1NZRA 4OLXL 1T4KB 2WGNB 5EHFA 1R75A 5FA4A 4JKLA 2ZAIA 3R06A 5IGXL 1R47A 3T0WA 1CF8H 5JO5B 1FNLA 1NKOA 1K4DB 1PZ5B 1R3LB 5J1TC 1ZSDA 4OSUL 5EBLB 1OKEA 1IJ9A 2ZOUA 1Q0XH 4HUVB 5AOMA 5FUOL 3HR5B 1AE6L 4HOZA 5JIDA 1SVCP 12E8L 4FQ1H 3K0WA 4PR5B 1Y0LA 3G9AB 5T3XD 1F90L 1MLBA 3UFIA 1QZNA 5EC2A 2M83A 1E5YA 2DJUA 2NX5B 3EJYD 3G6AA 1JRHH 1S9WA 2EDBA 4Y19B 1DCEA 3FL7A 5F3HB 2BSCA 4FHBD 3B9KA 2DIBA 3NJLA 4P3CH 4H8QA 4I77L 4AGQA 3RVTC 3HC4L 3C2AH 4PRDA 1LTXA 5CR8A 3UIYA 2LFEA 2WYHA 4HAGA 1NJ9B 5TDNB 5I1DA 4AIOA 5JPNC 1BFVH 5HGHA 4N3TA 5LCVA 1NAKL 4YR6A 4ODVH 1WBXB 4E5XB 1NUFA 3MLSH 3W0WA 4ABVA 2GK0B 1EZVX 4JZOA 1Q9KB 3AT8A 1UZ6F 3DX3A 3IETA 2ZPKH 5DVLA 3KLHC 4G2AA 4L8SC 4WWOA 4GBXD 1BQRA 4PRPD 3F7KA 3S5LB 4H8WH 2Q7AA 4LAQH 1MRFL 1J05A 1P5VB 2O72A 4GXVH 3WIFB 2R27A 2ITDB 4NM4H 1FNFA 2W95A 3VFTA 4DEUA 2WVVB 1CIDA 1TZHA 2BOBA 3BH9B 4RZCB 5EWIH 4RAUB 1FWXA 4GS7C 4F92B 2R1WA 3PL6C 4Q89A 1OLZA 4RDBA 3TVMC 3AY4A 3P77A 3ECWA 3GK8L 2FUTA 2DWEA 3NCCB 3MXVH 3LRSB 3KL5A 3QS3A 4JQVA 5CEXA 5J8OA 2WCGA 1ET7A 3IJ7A 4RA0C 1VPOL 5LNDA 1QO3B 3B7UX 1U8HB 2M8XA 3IS1X 1XH2A 2P28B 3WHXB 5E5MB 3PQYA 3NSDA 4ZDHA 2TAAA 1N5YL 3VUAA 1I4FB 5FW8A 3ZKMC 5EB9A 1O7SA 1ACYL 2WNKA 3DUHA 1RJYB 1YPZF 3D0LA 3VFNA 1KB5A 2IGFL 3LEXB 3L7EB 1I7ZA 4KAQL 3OGCA 1Q9OA 5HSFA 1WBZB 5CU5A 1BQSA 1JUFA 3OZ9H 5JW4M 5JIPA 5JXAL 1S8DA 4Z0XA 3P2BA 1RUQL 3TXAA 1RPQA 2XPGB 3V0FA 2XX1A 3W5MA 4HJEA 4X6DF 3OLDA 3S34H 4N8VA 2VAJA 4KUCD 4E41B 2I9TA 3T0EB 3EJQA 1I9IH 3BE1H 1TNNA 3MFFB 4UNVA 4ZMZA 3MA9L 2BSDA 2MCAA 3CHXA 1N8OE 5D6CB 5H37H 1HZLA 1W0WB 2MNJB 5JIHA 4WEMB 3ARGB 4MJIB 2W0PA 2Q7YB 3BKJH 3MJ6A 5B38B 3QUYB 2J8OA 2AFNA 3MCLH 4OZGF 4QR7A 1LEIB 5IP4A 3FTWA 1LMKA 2MRYA 5C2BH 2FO4A 2ESVB 2OTUA 4GH7B 2QVFB 4TN9A 4MXWL 2DBLL 4YZFF 3NTCL 1XCXA 4IRSD 1JD9A 4AV5A 1MRDL 4ZXBC 2Q86A 9CGTA 4XP4H 1FG2A 4FTVA 3MRQA 4JREB 3I6GA 3JVGA 3EAKA 3QUZC 3WLBA 5BO0D 4ODXA 1KTLB 2AITA 3S88L 5EFIA 1P0SE 3P4MB 1X5YA 2XPZA 2MCPH 3NABL 3O9WC 1NUDA 3RKDD 3MLRH 4PGZA 3VFMB 2YRPA 2BIIA 4QXGL 4I4WB 4H88L 1KCVH 1AGFA 4GRLB 1KTCA 4LHUD 4HEMA 1OLLA 1CLVA 4WRLA 1JVOA 2J8UF 1CTMA 1EJ8A 1HIMH 1U4FA 5HYQA 4KXZH 3QEQD 4ANKA 1L6ZA 2DQEL 5EUKB 3CX5J 1CGVA 4JFWA 1EGJH 4LASL 4XBGA 1JD7A 4UOQA 1Q8MA 2OYLA 4APXA 1GZPB 1RLWA 4JDEB 3CX5K 4H1LA 2L0DA 5DXWA 3EJZD 3ARVA 3DSNA 1ETB1 1Y6MR 1AMYA 3MJ7B 3MV7A 5DJXA 2G60H 3K71A 2HZHA 5E2TL 3ETBJ 2Q6WA 4HWZA 3HEIB 5K39B 4LKXB 4Y2NA 3JWDC 4N2HA 3KPSA 2QVKA 1BXUA 4C56B 1XF5A 1XGTA 3BDXA 3OQRA 2EDHA 2IV8A 1ZLUK 1G7PB 1GYWA 4G9FD 3BI9X 3V10A 1Q0EA 5HDRA 4YHKL 5AOIA 4BFRA 4HT1L 5GHWH 1QVOB 1A4CA 2XKSA 4NO5A 4WWPA 3FU6A 4NJAH 1NGQL 3BW9B 1X5KA 2ZUYA 3IMWA 5DEZA 2VDMB 4UQAA 3BUYB 4XXDA 5I1AA 5JORB 4E9VA 3V4VH 4OW6A 3ROLA 2E8YA 2ESVD 5E8NB 1RULH 2HRPH 3B2UC 4YHYC 4JO3H 4PG2A 5EN3A 1MEXH 1MVFA 1ZTXH 3VFPB 4P5RA 1ZXKA 1W16A 4FADA 2NTSP 1EXHA 5EBLA 2VDQL 4YR6B 3GSOB 4PJ7B 4TVPL 5TDOA 5E00B 1NCTA 4IBWA 1H3GA 2AI0H 3LQZA 3L4YA 2PN5A 2J6WA 3VCLA 3UXFA 2C1PB 3UTTE 5LXVA 1A4JB 5PAZA 2P48B 5FM5M 3FRPB 3GSXB 5D1ZI 1BG1A 3TLRA 2NY0C 1JNHB 1PL3A 1Q72H 3QJQB 3G6AB 3ZW3A 1YEKL 1G9NH 5JMRA 4OLVH 4D8PA 3RGVC 1DEDA 5DGRA 3GF8A 1QQDB 3AG4B 3S2AA 5T1MA 3ZDYE 3BC9A 2GUOA 3FQTA 5IVXE 1RHHA 3OKMB 1DR9A 3OAWA 3X11A 2AK4E 1NMCC 3U7AA 1IQDB 3LS4H 1QKZL 4GBXA 1FPTH 4C4UA 1Y7VA 1ECYA 5CM1A 3ZKQD 3QNYA 3SHSA 3D25B 5MEOB 3BISA 3DNKA 4WF7A 1DLFL 3FSWA 3CN0A 3BO8B 4WK4B 3CSGA 4HC1A 5JUEH 3UO1H 4KNQA 4M8QA 2IWFA 4UWQB 2ADIB 4H40A 4A63A 1DZ0A 2X9XA 1U8JA 2Z6FA 4BKLA 1AFVL 3U4KA 4Z7WA 4HX1B 1KV3A 2ITDA 4UNUA 5IKCB 1R1CA 1K9TA 3BCDA 3LS5H 5SWSD 4DEWA 1GZHA 1S2EA 4LVNB 5IR1B 4FHJA 4FQLH 4YSDA 3ATAA 5F89A 1I3GL 1MCHA 4JO8A 1R3KA 3RPIB 4A2FA 4HUWB 5DYOB 1QUNA 3IK2A 3MLXL 5J6GB 4UU9A 4QIRA 4IDLA 4DVRL 4JUSA 1MF2H 3AGWA 2BXYA 1GGYA 2CA4A 3DRQB 3WEOA 3QI9D 3ZJAA 3B3IB 5BOJA 4LSTH 2EILB 3NQKA 1NFKA 1OW0C 4XH2A 4PWKA 3WJMB 5A3ID 3MCKB 1UM6H 2HG5A 3Q2LA 4M48L 4PTUB 1OO2A 2CSPA 1EQWA 1RIHH 1G7HA 4JPVL 5J12B 1AXSA 4Q58C 5L6YH 4RGNB 2DKUA 1RMFL 5LB1A 1XGPB 4ODTL 4ZAKC 4QHUB 2NTFA 1C7SA 4DP7X 2FO4B 2JKSA 2OTUB 2ZX7A 1FL5A 5E4EB 2VTFA 4D3CH 2A4ZA 1LDSA 4Q6IB 5IW6B 3QDJD 4MDJA 2SEBA 1RV6X 1JHTA 2H32A 4LK4A 4N0CC 5I6KA 3PL6B 3QCTL 4OCWH 3VWJC 4F8QA 1P7BA 4N9GA 4BRVA 1G7MB 1ZHBA 1IRAY 4QKXB 1PZUB 3TVMD 4Y7MA 3TO2A 1HEJC 4P3DA 4ZXBD 1DQJA 3FOMA 4P4KC 1OCRB 2PCPB 3B9VA 3L4VA 4QTFA 4YGVA 4EO5A 2ORBH 3A21A 3E2HB 3GLZA 5HHNA 3ARFD 1MRDH 1TTRA 3OHXB 4XC3H 5EPMB 4J3XA 1GZQA 1VHPA 4UQCA 2JK5A 5F7DA 2WZPD 5DC4B 4NKMA 5C08D 4U6HA 1N18A 2J6EA 4HUMB 5FO8A 1F58L 5DS8B 1B88A 5FHBH 4ZUSA 4GBXC 3VXOA 1PYWB 4FP8H 1NJ9A 3Q8BA 1V3KA 3WL9B 3F64A 1BZEA 4N0YL 2QSVA 3X2QB 1FVEA 4NGHL 5IQLA 3GZQA 3JT2A 5AZ2H 2HSIA 1MHCA 1HEZB 5KJ4A 1CICB 4MZIA 3TNMA 2AHIA 2C9AA 2EIBA 2ZP8A 5IBTL 3LB6C 1E5BA 4U1JA 3Q01A 3FT2A 5CJOL 1NLBL 3QIWC 3QDAA 3BAKA 2YJLA 1PZ2A 1I3RB 3RIKA 2CDEB 3W37A 5ABDE 1ESOA 4IKLA 4FKKA 5I2IB 3H9HB 5I6XC 3P9MB 2A0LD 1FVCA 3Q1EA 2Y1AA 1J88A 5I1DB 1P53A 3UTZB 2Q8BL 4EI6B 4D9RD 4O4YH 1MDTA 2ID5A 4JNXA 1GGIH 4XE0A 1SZNA 4MDIA 3T6XA 3OR7B 1M4KA 3EH2A 1GOHA 1OD9A 2ZXAA 1O6SB 5E56A 1OT2A 1NEZB 1UWGL 1UM5H 4LAJH 1AJ7H 3D39A 3IU4L 2R29A 1R3HB 4AENB 2ENYA 3RTLA 1HILA 2EDEA 5LGHH 2CLZA 3QXUA 4FTVD 3L5HA 4HUUB 3QHFL 1UXLA 4A6YL 4IBVA 5SWZA 1JGLL 2LLLA 1FIGL 3NMEA 4P23A 1F0LA 3BGFC 5FW6A 1TVBB 2HRGA 1ACXA 32C2A 1E4XL 3IT8D 5FYKE 2J25A 3L2NA 4U6YB 3E3QE 4YVNA 3HMXA 4AJYV 4HKZA 1K8DA 4J3TA 4YDVB 1G9NL 3TWCH 4KDTC 5I75C 5E4OA 5DVNA 1XF3B 3WDHA 2QADC 4EN3B 4Z7UE 5DUBB 5T3XH 3BAYA 2Z8WC 1HS6A 4PRHA 4DGYL 4R7NB 4U4IA 3WS6A 3OR6B 1JMZA 1U8NB 1W0VB 4PJBA 1CQKA 2ICWI 1KGUA 1U4EA 1S78C 2NNRA 5FYKL 1OTSD 3M07A 1MI5D 2JI3A 2X1WL 3SDXF 5IJCC 5IM7A 4I5BA 4S0TD 1DBBH 1FG2B 1JIBA 3TV3H 3HA0A 4GBXB 2VGLM 4KKLC 3VGEA 5DJDA 3WEXB 5I71B 5E6RB 1AR1C 4Y2LA 5ANMB 4JRXD 3MV8D 1BWWA 3LRMA 5F8QC 2QHRL 3UZEC 5C9JA 3CNKA 4E41E 1AOZA 3ARPA 1NC4D 4GAFB 3C6SA 4Y1AE 1QATA 2NOYA 2WC7A 3OHMB 4KK6D 1WZAA 3I9GH 3EXLA 2DTML 1T1ZA 2OXGB 4FN0A 4WHTB 5EOCH 2IDQA 4P9ML 4PMFA 3DO4A 4TSAL 3IRCA 1XH0A 4J4PA 5FM5O 5AW8B 3LRKA 1R4XA 5IB2B 4MSWA 5GS2H 2AABL 5CKAA 4J1UA 2H6PB 5L9DL 4HZ1A 1PZCA 3CFBB 1AHWC 3BPLB 4APQB 2ENPA 3C87A 3WY3A 5EEYA 4X42A 4OZIA 3DYMA 1JHTB 2H32B 3M88A 4O58L 5E8EA 2OKMA 5IJBC 4EI5C 4XOAA 3SBPA 1XBRA 1N0LA 1PQZB 5GGVY 1UOVA 2R0WH 5E51A 3QXDB 3LNHA 4FLSA 2VDPB 4HOWA 4K94C 1KLGB 2ED8A 3CFKA 3L6FB 3SYQA 3PHQB 5CEYA 1I53A 5E9DA 4UV4L 4YSUA 3SE3A 1FLTX 2B3IA 4BK5A 1LO0L 5IESL 1KUMA 1IGJB 1EZLA 2CD0A 4BHUA 3EO0A 1JCKA 5DUJA 3EOBB 2EE6A 4X4XA 2N1KA 3NCFB 2XFXB 2V4LA 4AKQA 1Q9KA 1FFPA 2XZQH 4K23H 3UYPA 4FFYH 4JKPH 4P9HC 1GVIA 2F54A 1G94A 2WBJC 3FC8A 4FI8A 1ZT7B 4JHBA 5E7BA 3ZK0A 3VD1A 4U6TA 1BXXA 3QA3B 3W9EA 3WI9A 3D69B 4BGLA 4BDVA 4BZ1A 3NQIA 5T8IA 1GIGL 5EU4B 3AQXA 3ZO0A 1T0OA 2OSYA 4IGBD 4GKLA 5E8OB 5CR1A 5DQJB 4Z3GA 2YGOA 1VZIA 3GBNL 4XNQB 3QWNA 4URKA 3Q2VA 1LP9E 4X7FC 3WNJA 3NCMA 2P80A 4OZGA 3BDYH 3SQOH 3V0WL 3VA6A 4YSAA 3GRWL 2Y23A 1BW8A 1HDMB 2HG0A 5AG9A 3CDCA 4NNXA 1I8LC 1UXWA 5T1LD 7PCYA 5ANME 5AW0B 4AYGA 1CLYH 5I17B 3UZEA 2ITFA 3IDJB 3RJQB 1C5CL 2FEDD 1H15B 4H1LH 4LHUB 2D03H 2BIPA 4MHHI 2WQUA 4KH2A 1J0YA 5DTFB 2HLAB 2G3ZA 2WCSA 3VWKB 3DTXA 4NHCL 2VH5L 4X4MA 3K7UA 3QFGA 3PPSA 1HN1A 5J3HC 2HJFB 1NWOA 4JR9L 4D94A 2DLHA 3C5ZD 5JLZA 4MQ7B 2CDFA 3T8XA 4JDZA 5CKGA 1JUFB 3S5LG 3LIZL 2UX6A 2WVTA 1KPRA 2YXFA 3JYCA 3CMOH 3VFWB 5DQDL 2PTUA 1RZJL 4HV8B 3VMNA 5CEZD 3VQ1C 4K71B 4AZUA 3MTXA 2HKFH 2OAAA 4LNRA 4RFOH 2GSGA 5A3IC 1Z9SB 1UWGH 2DF3A 2VR7A 3BVWA 3FOLA 1AQKH 2JB5L 4WJG3 5MENB 4GMSL 5DUMH 1WAAF 3U6RB 1CU4H 3PWNA 4JB9H 4NM8L 4TRPL 2LU5A 3SKJL 1GGUA 3M8OL 3EDFA 3GXPA 4X0KB 4DKAA 5I66A 3KM2A 3B9AA 4PJDB 3DIFB 1QFHA 1L3NA 5FGCE 5HHXH 4GUPA 5MP6L 5CN3A 5IHHA 5D2LA 2XQYG 5B8CB 3L3OC 3SPVB 3D4GA 1IAKB 3ARDB 4UT9A 3O8XC 3TBVA 4R3SA 3MREA 1SOQA 1J7VR 4EXPX 3PY9A 1P7KB 4QJ5B 2YA1A 4XC1L 4GSDL 4KVCL 5C2UB 4Q97A 1EDHA 1SVBA 5T3ZD 4WW1A 3FQRB 2NNAB 3SDDA 2YFNA 3OAYK 4PREA 3AS2A 5AKVA 1DSYA 2ED9A 4ZMPA 1AS6A 1PSKL 1YN6B 1S7VA 3FN3A 2J1YA 2Y24A 3CFJA 4NFDA 2XBZA 4Z3HA 4JO4H 5I1HL 2BMKB 4AQAA 3QJUB 1MFAH 3MRBA 4G8GA 1HT6A 3BPCB 5D7LA 4PJEE 4WENB 3I2CH 4Z23A 3SJVB 4QRPE 2G3XA 2X28A 3QULA 4KJPD 5IFJB 3WTWA 2F1BA 1OARH 5B3JF 3I02B 4N28A 4IRJB 4GG8B 2Y72A 3W56A 3TEYA 1T7VA 3BKCH 3BH4A 3N2JA 3KYKH 4KFMA 2LU7A 2RIKA 4BUGA 1YY8B 5DD0H 5F7EL 2CBPA 4NQDB 3GHEL 5CO1A 5D7JB 3L3JB 4JG9A 4Y5XB 4HMDA 4RSVA 3C8KA 2O5XL 5JA8B 4M43L 5FPIA 3HBQA 2PXYC 4KK8D 5T3ZH 4Z78B 1MUJB 4N3UA 1E9OB 4PRBA 4U1KB 4ODSH 4GQ9L 4XHJD 3U6XA 4APQA 3FH5A 3DRTA 1DUZB 4IKNA 3ZE2F 2BNRD 2VL5A 4PJ9D 3NGBC 1I8MA 1FYHB 5EMYA 1RK1A 4OZFB 1HWHB 2EADA 3ZMRA 2WD0A 1LEKA 2AK4D 4ZYKB 5HJGA 1T6BX 1NBYB 5EPMA 2X9ZA 2OXGA 4U1NB 1C12B 2XQBH 4YHMH 5HYEA 2W59A 3OLEA 4OM0H 4O9HH 4CSPA 4ZPVB 1P4BL 5T33L 3CH8A 2MCMA 2I60H 5CEZH 2DLGA 1SEQH 1G0YR 5E9DD 1T1WA 5EEVA 1MHCB 2IPUK 4PJBE 5I76A 1OM3L 1CICA 4ETQA 2HFGH 4XMPL 1OAYH 4JGNA 4KROB 4JPWH 4U6VH 5JO5A 3EJYC 2IBBA 4OD2A 4LO9A 3S8GB 4YDJA 3SPHA 3U30B 1VZHA 3C5ZA 3EIFA 5LAXA 4HJJL 2FK9A 1LO0H 1G4RA 5IESH 3IFOA 2Q9OA 3HPJA 4RWYH 4WCYH 5I8EB 4WK0B 3O2VH 4IMKA 4N0FB 1TCMA 4W68A 3ETBF 1FVDB 3QDGE 4PJGE 4HUXA 2VWEC 4QXUH 4XNMB 1IGJA 1BBDL 1SMDA 4AQ1B 1NCNA 3S4SB 3G9VA 1H3PL 4OIBA 5BS0B 2HMIC 4GAGL 4NC1E 3RI5K 3TVMB 5D7JD 1FFQA 2AV7A 4MDIB 1GHFH 2ZF9A 1THAA 2V5RA 4LCCA 5DT1H 1OAQH 1O9VA 2BVOA 3O9WD 2AJXL 2XJLA 4WU5A 4XMLL 4YC2C 1FNGB 4PJCB 5IVXA 4JZOB 4XP9L 4XVTH 1Y07A 2DICA 4IW4C 3WIHH 2VXTL 3ZBMA 4YL4A 4E9RA 1A7RL 1CL7H 2Y1ZA 4HP5A 2MFNA 5AVTB 1CGTA 4DFHA 5T1JA 1NCUA 3HCVB 4G6AC 3ZL1A 2CLZB 2PPDA 1BAWA 4TVSa 3ZHDA 3CN1A 3NUKA 5EDXA 3CN3A 4PJHB 3UADA 1JZIA 2XXGA 1URLA 4CC1A 1DDHB 4LCIL 1XEUA 1B0RB 1IFGA 4H8UA 5B1KA 3G04B 1IGTB 2YPLD 4UBDC 3APCA 5BRZB 3HG0A 2BOBB 3BH9A 1HKLL 1SXCA 3KYOA 3G5ZA 2FSEA 3GXDA 3TJHC 1D7DA 4WEBH 4W70A 2CCVA 2VZUA 5I30H 2QPEB 5EUOA 2WXQA 4ODWB 5FOBB 1EVTC 4LIQH 1QHPA 2RAMA 3FSOA 4EDWH 4Y9GA 2BVTA 2GITB 3P40A 2WXKA 5T5FH 2H41A 3CZFA 4S1DC 4GT7A 1JVLA 5EO9B 4A04A 3MLZL 1UACH 1DJIA 2HTLC 4DPCX 2HKAA 1MCOH 4DSYA 1HHGB 1HX0A 4YZFE 4RFOL 5KOMC 2NLJB 1T7WA 1UH4A 4LARL 4OFYA 5DJYA 5FKAB 3B7RL 2LQRA 3IJ8A 4JFHD 1VLXA 4TSCL 4KAQH 1M7UA 4KDVA 2EZ0C 1U8KB 4L9LB 2VN6A 3BVUA 1LQBC 3QQDA 3WMPA 5BZDB 2ZNXA 1T2JA 2NZIA 5MP6H 1YYLL 1EFXA 4KX8A 1PEZA 1X4XA 1UATA 5IQ9B 4GUOA 2FQFA 2CXGA 4PLOB 2F1EA 3IMTA 4CRPA 1FAKT 3M6DA 4G80A 1FNEB 3PWUB 1A3LH 4NT6B 5HPMA 5TE4H 5ITFA 1BIHA 3V4UH 4MJIA 4P59L 5CF3A 3BPOC 3IMRA 4D9QD 3H1ZA 4YHZH 1BX2B 1I8IB 2DV6A 3OLGA 1R5IB 3KPPB 2QGCA 4MAYA 4DNLA 2UVEA 3NP4A 3MJ8B 3F3HA 5KSBB 1TKWB 5DC2A 3V6ZB 4F7MA 1JZ4A 4WY7L 3WN6A 5JW4Q 3U36A 3IAGC 4YFEA 5HDQH 4LPXA 2RCSH 4MCYA 3MRNA 1FFTB 3MRPA 4JFVA 4BEIA 5I71C 4PVMA 3UTTA 2CJUH 4M5ZH 3TT3H 2DQMA 4EN3D 4FAAB 5DMIL 4ETYA 1N0LB 2OMTB 1JF1A 1ASOA 1Q9LA 4RMTA 1J5OL 1E5ZA 4S1RH 1L5GA 2ATAA 3CLEL 5KZCB 3U25A 4BQBA 4LEEA 2ADJB 1N67A 1RZKL 1FJ1A 3TC9A 3DPDA 4XCNB 2BVPB 3GC3A 3QJXA 4IIQA 4MFHA 3V8OA 1KXTB 3DBXA 1BVOA 1T1XA 5CMAA 2ZONA 3GSWA 5KYUA 5CSZB 2DM2A 1NUNB 1A6AB 3LZPA 3QUMB 1KCVL 4L1DA 1ZIBA 4MB3A 4WFED 4O02H 4UV7H 1EEUA 1BQHG 1SMAA 4PJBF 2EEBA 3QUXD 4M6MH 1HIML 2G2RA 5F7NC 3NA9L 4L4TD 4M7LL 4KPHH 4JRXB 4N0RA 4X5XA 2ADFL 4ATWA 4MD5B 3QUHA 2X0WA 5FYJH 3T4YB 3KVPA 2AAVA 2XA8L 5C0CB 2F58H 4HIPA 2PR4H 3JV6A 4AE1A 3INUH 3FQXA 1QYGL 4XP5L 3UAEA 2IJ0C 2Y7MA 4O00A 2AGJL 5GPRA 1KCSL 5K93A 3VI4B 5LUMA 5DA4A 1G87A 5DSCB 4FNSA 5ID0B 1NIBA 2DEYX 1AG0A 2EUWA 1S3RA 5HYQB 1MJUL 4E9XA 3GMOA 4L23A 1YG9A 4N0FA 3KPQB 2R1YA 3QCVL 1QP1A 1N6UA 5HDOA 4ZTOL 3QI9B 5GSRB 4CA4A 2R2EA 4DGUA 2NY6B 2C7UB 1D5MB 1CFTB 4G9DB 1VJSA 2VLKD 1LP9B 2VN4A 1MCQA 4KXZI 5HGHB 4RAUA 2EO7A 4XOCA 4FA8A 1XF2B 4WUUA 4HHGA 1N12A 2ADGA 3QISA 4GQRA 8FABA 1UB6B 1ED3A 2GSGB 4HC1L 2FR4B 1SBSH 2AEPL 3MACH 5EEUA 1UM4L 3IBEA 5DJ8B 5H2BB 1IM3A 1XIWB 3R4RA 4Z7NE 5FLVA 3RDTC 3VG9C 4PGDA 1TUPA 4GEIA 4FI6A 4GRLD 2XUWA 2IMNA 5HI3C 4I8DA 3CVIL 3AREC 4JE0A 4XOBA 1J0HA 1L7IH 3E1ZA 4LAQL 2YAOA 2QLVB 3Q6GL 3DGGB 3BGAA 2JIXD 3OF6D 2X7LA 3LEXA 3QPXL 2EO9A 3GSXA 5DRZA 3BZ4B 4XCEA 4NO5B 4EBQL 1SLXA 3RU8L 4Y2DD 1B0GB 4U1GB 4U33A 1A8ZA 3PV6A 5CLXA 4GXUM 3KMDA 3WV0A 3NIGF 5JHDE 1TZGL 4H20H 1U91A 4WGKA 1BEXA 3UTSE 1A6PA 1BFTA 1CICC 3WIHL 2C9PA 2DWEB 5CEXB 3VFPA 5F7WC 4LGRB 4HCRA 3CFJB 4H2CA 3UYRH 4CGUB 4NRYB 4LCWE 4Z7OB 1CFMA 3C6EA 2YRZA 4I1PA 4K3EH 1HL5A 2EQDA 1NBVL 1A64A 1T21B 3MR9A 5E2WL 3DX8B 4F2MA 5KSAC 3AGVA 1BM7A 1NGPL 3EBAA 3D0LB 4HISA 2ZOKB 3IGLA 5DMJB 4YLBA 4ONHB 3CDGB 1P7KA 2UXVA 3ULVC 2FX7H 4TQEL 3RNQB 3BPNC 2FEEL 4O51A 4WEBL 4OFPA 4ANVA 4Z7WF 1P4LB 1PEWA 4OV5A 3W9DA 3RL1B 2P5EA 1SEBB 1VFOA 1I8KA 1T03L 2F08A 5TFSL 3QQXA 4J3OD 4B95C 3NZSA 3VD5A 3VWKD 2E9WA 2R0LL 4N22A 5LNGA 3DKHA 2VC2H 4LEXH 5G4MA 3WLBB 1WBYB 4IBUA 1IE5A 3EDEA 1OAZH 2Y2TA 3FB5B 3GM0A 1DVFA 1SMOA 2DWTA 4E5XG 3SDAC 1MF2L 2XBTA 3LQAL 3Q6FB 5EZOL 3ZZLA 5FF6B 4DZ8A 3B5GA 3WKMH 2R4RL 5D7IE 4J6RL 5HHVL 4N0CD 1NAMA 3PREA 5DCCA 1IKNC 3L5WB 4PJXE 4Y2OB 5C09E 3B83A 3QEQE 1MW1A 1QSFE 1G9ML 2WSDA 2P7TB 2UX7A 1A14H 2CHDA 4DHLA 4FCAA 3C6LD 1CDHA 5KG9B 5I74C 4ZJ9A 3VXTA 4RVBA 5BUPA 1Z1WA 3FTGB 1TTCA 5LQBL 5EEXA 4MNQB 1H3UA 1WA0X 5GGTA 5AWNH 2G5BB 2X4RB 5I0XA 1ES0B 1O9WA 2FGZA 2QKIC 3EBHA 4XCYB 1KJ2B 1S9VA 2RQEA 3ARXA 2O5YL 1L5GB 1H0DA 4U0RB 3DETD 1PMYA 4PCSA 2E9BA 4MQTB 3DDGA 1DVXA 4GW1A 4NI6A 5D7SL 1AHMA 1LEGB 3VXUD 1EFXD 1N7ML 2WLKA 1AHKA 4PIBA 3H2QA 2HT3C 1HSAB 3HUJB 2AJ3A 2J43A 2NSMA 4RAHA 3MRNB 4GUQA 5JW4N 3GKZA 3RWCB 3S96A 1GJWA 1RP8A 4OAWA 1NGXB 1UWEL 3VXOB 3RKPA 1MEXL 4QHKI 4G7YH 4YNYA 1NMCB 5D1ZB 3LRSA 3WEAA 2R23A 5GSVB 2EH7L 3SB3A 1RLBA 3T4YA 3STZB 2VISA 1FHNA 3AADB 3KPSB 4G9FE 4QKTA 1EEZB 1AQDB 1SJHB 1C5BH 4PJCA 4NNYA 3IFOB 3ILQC 3N0AA 2K9FB 3QIUD 3MPCA 4PW9A 1B2YA 5T3ZE 3U79A 3AROA 4QRPA 5IHUH 3U1SH 3W2DL 4YBLB 1VCBC 5IQ7L 3CG8A 3VXPA 5HHOB 4JFZL 1NH6A 3L7EA 4W4NA 3M86A 5I74B 1NPJA 1KEGL 5IZ7A 4IS6A 4B9FA 2JQZA 1JN6B 2ADFH 5DJ2A 5I28A 2V0AA 1ZANH 2C3VA 2RFXB 4W9ZA 2J88L 3S0PA 4P46C 4HK0A 4AMWA 4QRRD 1HVXA 4PRAB 5C0EB 3MBEA 3ZSTA 3RNKA 2VXUL 2IG2L 4PBWD 3B5HA 2OW7A 3WELA 4ZQTA 2IDFA 2WW8A 3FCTA 4PS7A 3NEXA 3WY1A 4Z3IA 1J9TA 1IC4H 1MJUH 2FNWA 2CNYA 5GISH 4I0PD 4MZRA 1DLFH 4NUGL 4OGAC 4UILH 3V7AE 1UFGA 3QJZA 4WI5A 2BCKA 1F42A 1OSPH 1GS6X 2BCMA 2YKKA 4JJ5B 1CDCA 3A47A 3Q8EA 2EUVA 2JLLA 1R3HA 4AENA 4I1RA 4V11A 5C0BB 2OSWA 3LTVA 1D5XA 1EAQA 2CCLA 1EAOA 3N04A 5AAWC 4WJ5B 2XN9B 2HJKA 5I1JL 4DP8X 5JQ6L 1G84A 4AH2B 4JS7A 2BK8A 3VFVB 4BFIB 4I7ZC 4P2YA 2XV2A 4FCHA 2IAMC 3CVIH 1KTLA 3EJRA 2G0KA 2E4TA 4LSRL 3E8VA 3O81A 2J5LC 5LBGA 3AVEA 4ODUB 3UO1L 2UZPA 2P5WD 4OV6F 4C47A 1P6WA 3MCKA 1D5ZA 1II4E 3ZKMD 4DZBB 4HJ0C 4OCLC 4H0IA 3D39D 5CN1A 1AGBB 5E08L 1OTTD 1OCOB 4I87A 2XWEA 2YN3A 1K4CA 4PBXA 1WCBB 3C8KB 5DUBA 2N7AA 5HHOD 4KWUA 1F5WA 1SN2A 3EXJA 4FQ1L 1ZSHA 4XP1L 5I8OH 3LSOA 5IOKA 4DT2A 4WFGD 1KPUB 4MJIE 1KG0A 4IRSA 3WAKA 1MJ7H 3MRPB 1OGAA 2BOCA 1F45A 2Z93A 3RA7H 4Q9CA 2V37A 2XY1A 4UQ2B 4I5BB 4ES8A 1T5XB 4BKTC 3DV6B 4R97C 1YDPB 2OX5A 1WF5A 3LH8A 4I77H 1FBIL 5AVSB 1WBYA 4TPRL 3FONB 1PZBA 3HZKB 2YC1A 4WTXA 1QFWI 1F13A 1KFAH 1CMOA 1IIKA 3O6ML 4OTXL 5IB5A 2UWEB 3KG5A 2I07A 4YXKH 4JZNA 4M5YL 2DQUH 3MKGA 4F5CE 3PP4H 3BUDA 1XR8B 4KMQA 4K8RD 3U1QA 5JW5B 3FSAA 3TYGH 3OQ3B 1GOGA 1J12A 4RMRA 4UAHA 2BNRA 2C3WA 1HTYA 2KLTA 3MV9B 5DHYB 3ASOB 1QLFB 1TQBB 4JFEB 4M6OH 3PCYA 1R5VB 2XWDA 2MQ0A 2VW4A 2BSTA 5DWPA 3WFBL 4UQIM 2EP6A 5CZRA 4JFPB 4PEEA 4D3CL 1SPDA 4RFNB 3EGDA 1WWAX 1ZTMA 2DD8H 3OXSB 2VITA 1PKQA 4BQ8A 4MDJB 3IGUA 1TETL 2YPVL 3SGJC 2OP4H 4G83A 3IVKA 1BIIB 4M7LT 3G6JA 4NM4L 4IOSD 1FRGH 1J8HA 2NR6A 2WNWA 1TF4A 1S7UB 1U6AH 5GRUH 4OZIB 4F1ZA 3KL3A 3I6LD 4PP2B 1INQB 2O6DA 3DHUA 4M29A 2EVIA 4TVPE 4IU3A 1G1CA 3K81A 3KXFD 2CHWA 4ZO9A 3U4EB 5ICXA 3QO1A 4G6MH 3KPLB 1RZFL 1T1XB 3CDZA 5DEGA 5TF1L 4AQZA 4B3EA 1PAZA 1MHHB 5HVGB 5KVDH 5E9DB 3D4YA 2W5PA 4GY4A 3J07A 5E8NA 3CK0L 3D9AL 5CN2A 5IBLD 5IBLC 3A6CL 1WZLA 2BDNH 2WUCH 5D70H 3MLPA 2A1WH 1AHWA 2NT0A 2XNAB 2JELH 2XZCH 4LEOB 1YQVL 4UTBA 1UKSA 3CMGA 3LIZA 3GLDA 4MNQA 4X80L 2X53A 2YZ8A 3CHPA 1BZ7B 3T1FB 5C0CE 1M42A 1YCSA 3LPFA 2CCWA 1U93B 4K5NA 3SD5A 3ZO9A 3CZNA 3H9HA 4DVBB 4LU5L 4L8BB 1QSED 3CIAA 1JZGA 3D2UD 5DRZB 5C0RL 3HBGA 1DJYA 4R6UA 2I25N 3LKNA 1NAMH 4Y9BA 3ZQ9A 4PJ5A 4QHMB 3VX0A 1R24A 2E7MA 5DYOA 5D1XC 1D9KD 5E5UB 2D7OA 5EU6A 4NQVA 3WS3B 4Y2DA 2K6WA 3SQOL 4WW2C 1TQWA 2F15A 5L8JB 4OZHB 3BPOB 3RVVD 3C9NB 2DAVA 3VXUA 2XOTA 2GJ6E 4BSVA 3DXAE 2P24B 4FD0A 5E4AA 4AEFA 2AQ3A 3A23A 3A3YB 5C0GB 3L3DB 1M6OA 5DVKA 2A6DA 2X70A 5HHME 4UANA 1WSST 4FMKA 3GWJA 4P4RB 2VABA 1VFMA 1OGSA 4XVJL 5E0QA 2Q20A 2VR9A 4JCWA 5FW7A 1N2RA 3V5KA 2XXMB 4L9LC 5CUSL 2WXGA 1MCNA 1D5BB 1JNNL 3FTUA 4F27A 4QRBA 2VDNB 1UXWB 3VFWA 4ONGH 3QZWB 2BS9A 4ZFZA 3OKKB 3KBPA 4RESB 4XPAH 3VU1A 3I85A 1J5IA 1OSPL 4PRIA 5INCB 1O75A 1U3YA 3WFDH 3AQZA 5C3TA 2CRZA 1UTDA 1V05A 1XO8A 2P80D 4F2MB 5AB0A 4MX7B 3F12B 1KBGL 3AMLA 1A9VA 5GZOD 3HHSA 3FT9A 3GQFA 1Y18B 4JJ5A 1D5ZB 2A7BA 3CFMA 3MCYA 5DJCB 2YEZB 2F53B 5JXEA 4TUKH 2YOAA 1JHLL 2GFBA 3CFEB 3OGOE 5DQ9A 2D2OA 3SDXA 4PP1D 2DS4A 5CGMA 4RMQA 4LHUG 1AACA 2BP3A 4J8RB 5MI0C 2VR4A 4UIMB 3CPLB 2FLMA 1RIUL 1N64H 4GAYB 4PVLA 2WM0A 5F1NB 1B3IA 2YN5A 2VW6A 3IWVA 5H35B 3TV3L 1LLAA 3GXMA 5IMKB 5GGSB 4ACPA 3HRZA 3H0TA 3SGKC 4RGNE 5DURB 4JM2F 3VXSB 3EF7A 3QDHA 4GRWB 3QIBA 2GKIA 5ENWA 3EO1B 1RULL 2HRPL 3KS0J 4QUOA 2DTMH 2AJVH 3IFLH 2G30A 2ZXBA 4YC2B 5FKPA 2C7FA 4WI3A 2CG9X 1KXVA 3ZL4L 2CU9A 1XR9B 2ICWA 3CFQA 3OKLA 4YHOH 4AGMA 2LU4A 2F7OA 3EYSH 1DFBH 4JM2A 3C5JB 1ZLWK 3FK3A 1G9MC 1XSKA 2CIIA 1AD9B 3V7AG 2B1AL 4K2UL 4AQ1C 1DVYA 4PJXB 5CFAA 3T0DA 4JY6B 1OCZB 5LWYH 5ADPH 1T2QH 1TEFA 3PAZA 4YXHL 3T8MA 4Y4KC 2R39A 2DYPA 3DO7B 3VGDA 1W72H 5ITBH 4NNPH 2WXMA 5EULV 1YNTA 4JLRB 3HC0A 2BSED 3QXDA 3X14B 5CBAA 4GQ9H 1JXKA 5ES4B 4LP8A 4GRLA 1V5JA 3ARDD 4AG4L 1TQCB 3GRGA 1JTTA 2DD8L 4NN6C 1NBYA 3A6BL 4JPQA 5ACZA 5EO0B 4F7CA 3LZRA 4NYLA 2QVMA 2GIYA 2BSTB 3LVTA 1MLCB 2BSRB 3AMKA 5I15L 2KLRA 5KANI 3VRJB 1UB6A 3C8DA 5KVGE 3D0VA 4J23A 3QRFM 4U3XA 4OJFH 5GS1C 5E6ID 1CO1A 4JRWA 2P46B 4U1KA 3VDCA 1O6TA 4DKFL 1YRKA 1U8LB 4ZMLA 3V6OE 2EAEA 3CH1B 4HWEH 1EERB 1J8HB 3NK4A 3MLUL 4H8WL 4WUKH 3ZGIA 1BQ5A 3V4PL 5JOEA 3DX6A 2R29L 3A67L 3O0RH 3VH8B 2EXSA 5DWUH 1MLBB 4NHCH 5J0BA 3I84A 4Y1TA 1G6RB 3KPTA 5CSGA 4IOFD 4JZJA 3KGRA 3CU1A 3ESVF 1QRNB 3QNXA 4GKZA 3VXRE 3DMMC 3FUNA 4NO2B 5C0ND 4LESA 5H4ZA 4HAFA 5EZIL 2CBMA 1DBKL 4R96A 4XAKD 3LH2H 5DZOA 2H3NB 4HH8A 2UZIH 1NLDH 1A9EA 1MNUH 1PFOA 2HVJA 2WXJA 2PTTA 3LXBA 1WICA 3T2NL 3GIZH 2Y7OA 2EKJA 2G9KA 3S36L 1XIWD 4NFBA 3FCTB 3VXSE 4R0LC 4G6JL 1C5DA 3HNSH 1I75A 1XIWC 4LLQA 4YE4H 3UAJC 3JTSB 4JM4H 1T04A 4AT6A 3U6RA 4GIAA 4IRJC 4HIEA 4MMYA 5AZUA 2VDKB 3U9UA 2X6MA 1QTPA 3C9NA 1XF3A 1BZ7A 2YWZA 5ESQB 3MOQA 43C9B 5GS1B 5JXAH 1NAML 4JRYE 1J9CT 3NJKA 4ZUTB 1J05B 2E9IA 3D6GA 4HIHA 4HXAH 2D7TH 1OZTG 3CFDA 3ARDA 2QLYA 4HUXB 1LO3H 1ZVYA 3FO9A 4WSJA 5F1SA 2HJKB 5CP7A 2C5DC 1KIQB 3ZRSA 3FB6A 3HE6C 1AKJD 5BOPA 3N42B 2P8PB 4XAWL 1E3FA 1VEPA 2WQWA 3MRRB 5DK2A 4FEMA 1KYAA 4RETB 1BPVA 3CJJA 1HL4A 4L48A 4V33A 4WV1C 5GZNA 2BXZA 3ERXA 4QRTA 3CFUA 1A7QH 2CLVB 3LOWA 4U3CA 3BLBA 1A3RH 5DYFA 4B9YA 2RJMA 1ETZB 1HWWA 1S7TA 3JVFC 3L6FA 4N8UA 5C0AA 4O2EB 4CMMB 7CGTA 2E4FA 1IGMH 2PW2A 3P2DA 4FG4A 1QFWH 1UXMA 3V0HA 4WNQB 2VZ1A 1TVHA 4S1DD 4EDWL 1YY8A 4XN4A 1LK3H 4X8XA 1I31A 4NQDA 4LIQE 5H37A 4G1EA 3EH3B 1E0OB 2R0ZL 5FUZL 5FXCH 5HHPB 1J8HE 5I1KH 2OSXA 2ROXA 2ZQKA 5L88H 3ARBC 3TTYA 3B56A 3MUUA 4XNYL 5HI4D 4RAVA 4Y2DC 1ZT7A 2N0MA 3GHPA 3SQBA 5J11C 3NH7H 4M8UA 4G8GB 4JMNA 4PLKD 4A2LA 4QTHA 5I6MA 4RMSA 1SGKA 3B3IA 2WQ8A 3MA7A 2LTQC 2IH8A 4Q9RH 2ZUQB 2XKUA 5D2NB 2BNRE 5DFVD 4N2KA 1CDYA 3R8QA 4JJHA 4JM0A 4RX4A 1KYOK 3OWRA 4G6AD 5C7XH 4JQXC 1C8QA 3FQ1A 2EE0A 2ZICA 3DVNB 4DIXA 3CC5A 4P5KB 3UAJA 5KSVA 1SJXA 4UQ9A 2EDYA 1AD9A 1PD1A 2FYVA 3NJHA 2VDLB 2PW1A 1IVTA 3UL4A 3GKWH 4CADA 3WAJA 4TNGA 5MERB 2VDNH 3H85A 4EKJA 1TZIA 3DURB 1OE1A 3HE7B 3GMPB 4YVUA 4RFEB 1H8OA 2R56H 5FCUL 3SQRA 4LRNL 3LQMA 3QO1B 4QGTA 4WO4A 4JO2L 1J86A 1E4XH 1M56B 2QKIB 4PRNB 1ASQA 3DX7A 3MOBL 3QFJE 3BP5B 1A4BA 1MAJA 5F3HA 3SGDH 3PLYA 4I9WE 5HGBB 1R17A 4BSJA 3C75A 2IFGA 5I1LB 1Z9MA 2KI6A 5F44A 1NIFA 3EFDL 3GNMH 3O9WA 4DW2H 2VO8A 2BJMH 2IV9A 1HJBC 4YXHH 1QFUH 4Q0XL 2FNBA 5EV7A 2BNUA 6FABH 5CLTA 5EORL 1BLIA 3FBQA 4OLZL 2ICEB 3AWFA 4TVPH 1YEIL 5CWSA 4ZBJA 2Y1VA 1OTUC 1T3FA 2A6JA 1KOAA 1DE4B 1V7NH 1FZKB 7TAAA 4QWWD 4FNUA 4JPWL 1TQUA 4ZX6A 5DTFA 3RGVD 2DYPB 3VMOA 4DGYH 1LD9B 4YJZL 4F9PC 1ZT1B 4MD4A 3SGEI 3W38A 4PJ5D 2EIDA 3LQZB 2Z91A 3VD0A 2Y25A 2AS5M 2YPVA 4GJTB 3R1GL 2BINA 4JM2D 2ZJSL 2JJTA 2VXTH 3OB0H 4LP5A 2CIKB 5I8EA 5L8LB 2YLHA 3HUJF 1DQMH 2NY5C 3BUPA 1E4XI 1KFGA 3KLAA 2P49B 3HI1B 4F15B 1WHPA 2Z7ZA 2HCZX 3MLWH 4ZO8A 4HWEL 4IU2B 2IQ9L 2WQXA 4BINA 2MTPA 2E7CA 1H5BB 1MHEB 2NQ3A 2QJDA 1QAWA 3EGSB 2GIXA 5DHEA 2PNDA 1IAIM 1OAUL 1XB8A 4I3SL 4E9YA 1FP5A 3L17A 3NJXA 3CVDA 5B1CA 5D72H 3SJVA 5E6YA 1KTDB 1MFBH 1FAIL 1XH1A 3ISRA 4IHBA 5L9DH 3QCUH 2A6DB 2UZYA 2X70B 5FEBA 2CGRH 1XD1A 1Z9PA 3NK3A 1SXSA 1JZEA 5EN2A 3MV01 4EUPH 5KBLA 2AVGA 3GM8A 2PETA 2WMPB 3DI3B 3HB3B 5D96B 1RKRA 4YDNA 1NCJA 1VESA 2HWZH 4AITA 4KBPA 4Y19E 2CAKA 2ARJB 3CUPA 1I1CA 4ORZC 3EH5B 3LMJL 3HS9A 5SWZE 2Y6SD 4FQPA 4HWBH 4HQQL 4QRUA 1ZHNB 1O5DT 2Y06H 3IN2A 3SDCA 3U4AA 1MIML 3UZQB 2B08A 2D7TL 2UWEA 1IM3B 2E46A 2WKOF 3EOAA 4QRQA 3MRLB 3VQMA 1E3XA 1UZ6E 1VENA 4K5OA 4LP4A 1MFEL 3UYRL 1WITA 2D3LA 2VDMH 3LEYH 2NW3A 4JHWL 1AZVA 4R2GD 4WWNA 1D9KB 2VDLL 3AXLB 4MAYB 4RQQA 3IBOA 1YEFH 4LBAA 4BCYA 4D9QE 4Z78A 1GTFA 2IBZY 1GYAA 5PCYA 2A99A 1A66A 3BSHA 3CXFA 4I89A 4UNTA 2KZBA 1BZOA 3RUGF 5BRPA 1NCCH 1ODAA 3BVVA 3WO4C 2HFEB 3D30A 5IT2H 4MMXB 1JGIA 1AZUA 1GA2A 1E42A 1UEMA 3BVDB 4ZS6C 2IPKA 4HFUL 1MWAB 1J5OH 1U8OA 4C57C 2NY4D 3PWVA 4ANUA 5CGTA 4BUQA 3QJFA 4LF3A 2VOTA 1KB3A 2VXSL 2FJFA 1G7HB 1MZZA 4RNRB 3V4UL 1DJHA 1CFQB 1CYXA 4OCRL 5B3JE 1I1AA 1XXDC 2JIXB 4TQPA 1CCZA 4Y5XC 1MFMA 2D03L 4DEPC 1XZ0A 5DD1H 1B9ZA 1E9PA 2VN7A 1OB1A 4KY2A 3ZHFA 4KXDA 1NCWH 1XCTA 3BP4A 2LLGA 3HS0A 5AYUH 1IC7L 3H9ZA 3L5WA 1J1PH 2G9HA 5DD6B 3MLTB 4PPTA 4R7XA 2HMID 1BGXL 2YD3A 1KEML 2NX5D 4M56A 3FYEB 1NCIA 5DS1A 1XX9C 3WGVB 4XNXL 4HZLB 3DIDA 2BNQA 4W9HC 3INUL 2L7UA 4AYFB 3CMOL 3FUMA 5C7ZA 2J6EH 1MJ8H 3PXLA 3DX6B 3VH8A 4LLMA 3QC6X 5E0FA 2IAMB 4Y4FC 3PDGA 3QAZC 4GSQA 1N68A 3SGKA 1RZIB 3OHXA 4KI5E 1F41A 4Q56A 3L95B 1CU4L 4JB9L 2YWYA 3U2SA 1UT9A 3KPQA 4X50A 4GIOA 5DK3A 2ILLA 1NFDE 3DETC 5ADOH 5I73B 4R96B 1MCBA 5AAMC 3D0VB 2H3NA 1WAAE 2GW5A 4M7KL 5G5DB 2AW2A 3UG5A 1UC6A 3U6XS 3LAFA 1OHZA 2KQMA 1S3KL 4KRPB 3DX1A 5E8PA 4XX1G 4IIQC 4AM0B 2XA8H 4P2RE 5IVZB 1FNGA 4N6RA 3NFNA 4QDGA 4LLDB 4WO0A 1HH6A 3NRFA 1CF1A 4L4VA 3OPZL 3MACL 5D2LF 3FT2B 4OJCA 4JCLA 2LVEA 4HU2A 2OZNA 2OR9H 5HI5D 1YECH 2X4RA 4NNYB 1E7UA 1KJ2H 2O6PA 3L1FA 5IHLB 5D8JL 1A9BB 5E24E 1B3JA 2WWMC 3BUIA 3DI2B 3RIFK 4Z7WB 1M7IB 1CE1L 5C0DA 1FVCB 1G9NC 3P73A 3KS0H 2KMWA 4A2MA 3BAJA 2VSKB 1CF8L 3GJFA 4W9EC 3L16A 4JPSA 4IOFC 1UD6A 35C8H 4FGMA 1T3FB 2NY3B 3Q2CA 4OSUH 3WJLA 1HDMA 5AZEH 1TNMA 4G59C 1YJDC 3HI5H 3R0MA 2FX8L 3D25A 1CG9B 1OT1A 5D7LE 2D9QB 8PAZA 4HGMA 5I5IA 3L4XA 8CGTA 2FB4L 43C9A 2MWCA 5GS1A 5IBUG 3RLSA 1CD8A 1Q9WB 3FU5A 4G8EA 4KUCF 2O1AA 4QT5A 5CILL 1U2CA 2OJZL 1IC4L 5HHOA 2X40A 3OKNA 3T0ED 3VXPB 5CD5C 4E0RB 1U92A 5D4HA 1JZDC 4XPBH 1GC1L 3T65A 3KLAB 5MEND 3FT3B 3QG6A 5IHBA 2FX7L 1VIWA 2JXMA 4OFDA 4XPGL 4MB1A 4QHUA 4R7NA 1RIHL 5TTRA 5TDPB 3WE1A 4I3SH 2FJGA 2P5EB 2ZUUA 4X4KA 1I8KB 3RUGA 3UZVB 2AK1L 4XN2A 3HAEH 1JYXA 4LSUH 5IQ9A 3RVXC 4MMZC 4YHML 3O6KL 3UJTL 4BYHA 2DEXX 1G7MA 1ZHBB 5CZVL 2GI7A 1UQSB 4XH2B 1H9DA 3DVGA 3WLWC 4WNSA 5EDSA 2IOMA 1H9VA 2YSSA 5DO2C 3HJ0A 1L9NA 4L1BA 5E03A 3MCG1 5B38G 4DN3L 3KNBB 4M3KB 3LQAH 2GBAA 1XGYH 2PW2B 3N1FC 3OB0K 2B2XH 5CJQH 5K9KA 4GEJA 2I69A 2NTFB 2A6KB 1DLHB 4BHUI 4MCYB 3UJIL 1TEYA 1SEBA 1S46A 2IOOA 5AOZA 1IGFL 3APNA 2B3RA 2K7QA 5F1IA 4M6NH 4NQSB 3IJ9A 2R83A 2Z8VC 4PLKC 1OSZB 1WIUA 4MXQC 4U49A 3ZDYB 3VB8A 3DGDA 3OG6B 3GSVA 3T77B 3ATBA 3F8UB 4X7TA 4ZUVA 4K3HA 4X6EB 2XWRA 5I8OL 2P8LB 5IQNA 3HG1D 1JYWA 5BUAA 4R7LA 4M7JH 1CDGA 3MBED 3WDIA 4Z7WE 5EZOH 5D7KD 1CWVA 1DEEB 1KPVA 2ALWA 2ZKYA 4XI5D 3WKML 4QHLB 1AKPA 1H0DB 1NDTA 5C09D 3KDMB 4ACTA 4JN1L 3APFA 4YH6A 2I85A 2X4OB 1M1XA 3T8VA 3QNZB 1TJGH 2BNRB 3MV9A 2W0FB 2VAAA 2FHBA 1A7RH 1CL7L 5C3IA 3DO3A 5LCVH 1HE7A 4G7QB 4NO0B 3TPUA 3X3FH 5TD4A 4B5ZA 1YPZA 4G1MA 5I5MA 3FPXA 1FZKA 2PP8A 1EHXA 2CUAA 3RWGB 3LKSA 5MEQA 2JB6A 2ZYSA 3WFBH 1ORSB 2R23B 3BT2H 3GI9L 4N25A 2VDKH 1KIRA 2D31A 1CJYA 2PO6A 3NDZE 3F7QA 1ZLVK 2JJVA 4FE9A 5BOZG 1KNOB 2HLFD 5C0IB 1J1XL 3QNXB 4GKZB 1LJMA 4MA7H 3D39B 4BV1A 1Q1JH 3ARQA 2ZUXA 3MNMA 5C2BL 1IT9L 2YD5A 4U1SB 2BW4A 1LO4H 1ZKAA 2PR9A 1AY1L 4L8CB 2X6BA 5IJKC 1C12A 4G7VH 4TULH 3CU7A 2CO2A 2ZX5A 3QFJB 4KV5F 4X99B 1RZFH 3B2PA 3BYTA 2WZ6A 3WUWG 3CBJ