3QORC

Crystal structure of human nuclear migration protein nudc
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
117
structure length
117
Chain Sequence
b'SKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIADGAVVTVHLEKINKMEWWSRLVSSDPEINTKKINPEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear migration protein nudC
publication title Structural Features and Chaperone Activity of the NudC Protein Family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, cell cycle
total genus 27
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qorC00
1WFIA 3GUFA 3VQLA 1GMEA 2Y22A 3J07A 3QORA 4M5SA 2WJ5A 1WGVA 2XCMC 2CR0A 2BOLA 4JUSA 4YLCA 2K8QA 4FEIA 3GLAA 3Q9PA 4M5TA 4RZKA 2KLRA 4PBDA 3VQMA 1EJFA 4YLBA 3Q9QA 2Y1YA 2CG9X 4YDZA 3AACA 4YL9A 3W1ZA 2MNWA 1WH0A 2WJ7A 2N0KA 3L1GA 3N3EA 4ELDA 2JKIS 3QORC 4I88A 4JUTA 1RL1A 3QORB 4YE0A 3IGFA 3EUDA 5DS2A 3QORD 2KMWA 3AABA 3GT6A 3L1FA 1X5MA 2RH0A 2N3JA 2Y1ZA 4PCKA 5LUMA 4ZJ9A 5DS1A 1SHSA 2O30A 4MJHA 3L1EA
chains in the Genus database with same CATH superfamily
1BBJB 1A6UL 1ERNA 4BA8A 1JGDA 3FB7A 1M53A 4Q9QL 1AZCA 1JP5A 1DVUA 1ZLDA 2HX7A 4L37A 2GI0A 4NBZB 1OSYA 1LNUB 4FG6C 2WYIA 1L9OA 5J6GB 3MYJA 1BOYA 4XPFH 3QIUA 4HZAA 4LDLB 4PJIF 1KCLA 3P4NB 4IM8A 4P4KB 4U3CA 4Q97A 1P1ZB 1YNTF 5E00B 3UZVB 1DSWA 1HKLL 2DMGA 1FN4A 4OTXL 3F84A 4TNVF 2CLVA 4WWOA 4WZ9A 2FX9L 8CGTA 2OMYA 1NBVL 5KVEE 1IT9L 4ZQKA 1U3HD 4GKSB 3CXHK 4GRWB 3VWJB 4DZBA 5JMOC 2Q6WB 4ALAL 1C5CH 3WHE1 2DWXA 2LU7A 4CVZA 3U36A 4XOCA 2HH0L 3CZNA 3DO3A 3OLGA 3V6OE 3X14B 3P3TA 1M3JA 1EAPB 5KYYB 4M1DH 4PRIA 1D5IH 3HAEB 4IDJL 4IBVA 4QTHA 1CD8A 2LE9A 2WUCL 4BQ6A 5HVHC 2VDOH 3SIKA 2J44A 5C0RL 4QJ4B 2ITDA 5ENWA 4L3EB 1LE5B 4Z76B 4TVSa 3FB5A 5C0BB 4P57A 3G9VA 1V8HA 3KE0A 5A2KH 2AQQA 2EVFA 3UBGA 2IF7A 1IO4C 3QZWA 3U82B 1JGLL 2EDOA 1H3PL 1PYWA 4XMVA 2APVA 4JHWL 3TCXA 4FABL 4X98A 5C2UB 1YECL 4JHBA 3N9GH 1A9EB 3FU0A 3F58L 3TEUA 1AG6A 1IAMA 2VDNL 4PJAF 1W15A 5HSFA 4WEBH 4GG6B 2ICEB 3FFCD 4NCC2 1EQWA 3BH8A 2KT6A 3LH8A 2BM3A 1H6FA 5GRXG 5FV2A 4RZCB 3PHQA 4HWEH 4JFQA 2OMWA 5E8DL 3FZUC 4ZT1A 3ATBA 3LQAH 4FQJL 5D1ZC 1AIZA 1J5IA 3LKOB 1IC4L 3BJ91 1NEZG 4ORGB 2IBZX 5DUML 4L23A 4GUOA 4TLUA 1KIQB 1EO7A 3WFCL 1UGKA 3KBHE 3JWOL 2CHNA 1H0DA 4PEEA 3PUUA 4AVIA 1KELL 2P5EA 4WQOA 4EQ3A 3FQWB 5AVQB 3CFCH 4KWUA 5TK2A 3QJFA 5KSAD 4FQ1L 5CXPA 2B7DT 1KPUA 3EJZC 1Q0YH 4PY8J 1FSKB 1J0IA 4GINA 4V1DB 3DX7B 4WW2F 4W4OC 3NQKA 4PJ7F 3VFTB 4AC4A 4AGQA 5TDOB 2VDMH 4P23A 1MCWM 4ZX4A 4ZMNA 4YPJA 3ZTJG 2Z8VC 4FADA 4PCKA 1F02I 2YQGA 3BH4A 3Q6GL 5A3IC 3AWFA 2R23A 3RI5F 1PS3A 4PVNA 4MJ6B 4M1GH 4LIQE 3ASWA 2OMTA 4KKLC 5E2WH 2L0DA 3L3DA 2GHZA 2H41A 2ZE0A 3ARBD 4NZUH 4R4ND 1OP3K 5CKGA 4O58H 7PCYA 5T5FL 4LCCB 1TO5A 1P84J 1YEFL 2JJTC 4KZDL 4NJAL 3RDTB 4NHCL 2YGPA 1NCDL 4LCYB 4YAQB 3O6MH 1XAUA 2P7TB 4OCLC 2C9VA 3ARPA 2WC7A 3KGTA 4FFYH 3RVXD 1QHPA 1VFAA 4A37A 4I1PA 3HCVA 1WGVA 1EHLL 3SHSA 1WICA 3ZE0E 5CJXA 5I8OH 1IVTA 3QR2A 4M62L 1JV2B 3GM8A 5DJ8B 1H3XA 3L8QA 5TF1L 1DDHB 3L3HB 1TKWB 2H2SD 1K5NB 1UT2A 2QLYA 1C16B 5KJ7E 4NNXA 3HA0A 4HS3A 4WKZA 3U4KA 1U41A 4P59H 5JXEA 4XZUB 4OD1H 3JZYA 5KYXB 5FB8A 1EHAA 5LGYA 4D9LH 3BP7B 1NPUA 4QXGL 4GRWE 1AGDA 3ARDA 4O5LH 2PPAA 5I74B 2J8OA 2TRHA 5ISZE 2X89A 2HVKA 1BLNA 4DPCX 5E5RB 3LKPA 2JIXB 4FQXA 4LO9A 4P5TB 1Y0LB 5D2LA 4BINA 1M56B 1FUNA 3KZ8A 3OJDB 1KLUA 1MAMH 1FC1A 2O93L 2V5MA 5IHUL 1DQLL 5I6OA 3MRFB 1XGRB 1UCBH 1XD1A 4L3EE 1GTNA 3IN2A 3JWNE 3OGCA 4HOWA 2YZ1A 4L8CA 1S9XB 3UEQA 4ZG1A 2YSSA 2H6PA 5IOPB 3BP4B 2ATAA 4QTIH 4GXUN 5FO2A 4E42A 4HJUA 4AEFA 1WBZB 4OCWL 3F6JA 4ZTPH 1IFHL 4WTZA 3QUMH 3IWVA 3GHBH 2I9TB 1UYWL 1MFCL 4N2AA 1F58L 3TIDA 1KBVA 1YAIA 5KYUB 3BWUF 2L3BA 3QSKB 5AG8A 2YEZB 4F3FA 4ZUVA 3WGVB 1QI5A 4JL1A 1CLZH 1LWRA 5A2CA 4Z0XB 5I6KA 5IHHA 2VLLB 4D0DB 2R4RH 2ID5A 1ZK5A 1FORL 3SBWA 4IMKA 4M5YH 2NX5B 2IANA 3BSZA 4OF5A 3ULUD 3QFJB 4LEBA 3WMPA 4OV5B 1JPST 4KO9A 1L6PA 5DWUH 1CJYA 1QSFD 2AJUL 4TNWK 3NCXA 4V1DE 3V4PB 3FTGA 1MCFA 3C8KA 4H2AA 4ZOEA 4R0LC 4YOKA 4MWFB 5EZOH 4P4KD 3B3BA 4OZFA 1XCQA 2BOBB 2EEFA 3CN1A 4I88A 4PVMA 2ZWLT 2CO7B 5AOKA 3IDIB 3NCYP 1UM5H 2BVPA 4G59C 2VXSH 4LSVH 4LSPL 4PCTA 2D0GA 2WWKT 3TJEH 1INQB 4DN4L 1WFIA 3GSXB 4EN3D 3UJIH 1MQKH 1MVUA 2GAZB 4H0IA 4E5XA 4A67A 3MRMB 3BUDA 3VWJD 3P40A 2IOIA 4KDTC 2B2XL 4MMXC 1J5DA 3DROB 3VCLA 1CR9L 2XRAH 4O02B 3B8SA 2G5BA 2QVMA 4NWTL 1RHHB 3CFKA 5D1QA 1MPAH 2BHZA 4LSDA 1ID2A 2A99A 2MCG1 5C0BD 3BAXA 1SYSB 2QGBA 3QORD 4GAFB 1DSFH 3NG5A 3QC5X 4ODTL 3U83A 5F7KC 3AVEA 1NM9A 4WV1C 2C3VB 2Z3FA 5KSVA 4N2NA 2PPCA 3QUZA 3V9FA 5F93C 3T4YB 5D8JL 5B38B 5T1LA 1G7HB 4WY7L 3VXNB 1SOQA 3D39B 3MNMA 1ZT4B 3NZHL 4QMEA 4Z23A 2EDBA 3LNGA 2WXFA 1QBMH 1W0YT 3HC4L 4FHBD 4FNTA 4J3OC 4JY5L 3FKUS 5MP6L 5FHAH 4LCWD 3RUGF 2PR4H 2WKGA 1JD9A 2V2XA 5F9JA 2G9HB 2JWYA 3QULB 4HIIA 3LYRA 4PU2A 5E6UB 5HYSB 3QXUA 3NCJL 3E0GA 4U6HA 3U4EA 1OARH 4KO5A 2BDNH 2K4AA 3QDMB 5E2TL 1SN2A 4M03A 2D9CA 1F4WL 3GTNA 5DD0H 1RZ8A 1S7VB 2EDDA 1AI1H 4HDIA 4V1DD 2XTLA 1OQOA 3ABLB 1Z7JA 3D18B 3FONB 2Y7NA 2WZPA 3GSVB 1X4YA 5D9SA 3DWTA 1SHXA 4LNRA 5HVHB 4MXVE 3PGCA 1BP3B 3ZDWA 2HZHA 4BFRA 1HS6A 1YPZA 5KVEL 4OCRH 2MNJB 1YMMA 4NT6B 3NJKA 5CZXD 1BZEA 4JFZL 3MMEA 3MRJA 2X9XA 4J4PC 1I4FA 3IJYB 3S5ZA 1WAAE 4HC1L 4Z7VE 1FIGH 4Z3TA 4ZUSA 3SYAA 3P2TA 3VXMA 4LZKA 5TDNB 1IAIH 3H6JA 2C1PB 5JA8B 3KS0J 1PF3A 4IK6A 2ZX5A 1ANUA 3KBFA 5ALBH 1PSKH 1HYRC 4FQCH 2PCFB 1MCRA 3RDTD 4DVBA 5KN5A 5C0IB 4WI0B 2DL9A 4N2LA 1U8OB 4OD2A 1J8KA 1T3FB 4M7ZC 5D1ZB 4R7NB 5K9OA 1UZ8A 3PQYB 4E41A 2HWZH 4DKEH 4F7MB 3ARGC 5K93A 1CFSB 2FL5A 5AW4B 1JDCA 1WPCA 5BZDB 4NI6A 1F90H 1QWUA 4GAYB 4WU7A 2HLFD 1BD2D 4QXVA 5DSCB 5LXGL 2C3XA 1KNOB 2G2NA 4LDCA 4G7VH 5ADOH 1YEGH 3C6SB 2AZAA 1TVBB 5F1NA 3F62A 1MJUH 3BZFB 5BS0A 3NP3A 5IROA 4L1LA 4LSRH 4JLRB 3UDWA 4OGXH 2YLHA 4NKIL 1QI4A 3AXLB 4X6CB 2PO6C 3IS0X 1UASA 1OB1B 2QEJA 1DBBH 4GG8A 2EO7A 1BZOA 2PWGA 4ZODA 3Q43A 2O6DA 2CWRA 3L13A 3VFOB 1TMQA 3SKJH 3UTTA 3PV7A 2A83A 2X9WA 1NL0L 2DDQH 4KITB 3MRRB 2A9NL 2W9EL 3MV8A 5TPWH 1GOFA 2WNXA 3V9CA 2WVTA 3SJVA 4RMRA 2X53A 1OVZA 4C55A 3KCPA 2DBLL 4OW6A 2AAVA 3P30H 1NGQL 4P5TD 4WUUD 4X8XA 3MOAH 3PFQA 2ED6A 5F96L 4S0SD 3PP4L 5D7LE 5CFHA 4JKNA 2VDQH 3LXUX 1IE4A 5GJSH 4LIQL 5EOQL 3S3DB 2F5BL 3QYCA 1GS7A 2P44B 1DVSA 5EO1B 3LKSA 4L8DA 3SGJA 3WEXA 3RHWF 4A2GA 4A39A 3QHTC 2PYEA 4N8UA 4BJLA 2IIJA 3KPRB 4G3YL 3ISRA 4Z1PA 1F1AA 4RISH 1U30A 1ZANH 3CSPA 3KPPB 3UGUA 3FT2A 1UEYA 2VDKH 3NH7H 1BXVA 1XDTT 5DEFA 2B1HL 4MVBC 3K8MA 4JQIH 3W82A 5J1TC 4MA8L 3MRGB 4AK2A 4B7LA 2XN9A 4DP0X 3D39E 3ILPB 2AKRB 3MZTA 4PREA 1M7IA 1LO5A 5GSRB 3U6XS 3ECQA 3QIBD 3Q1EA 3BQUA 4PJ6A 1Z66A 2JMRA 4TVUA 5LBVA 2HKHL 3OAYH 3POHA 3ULUL 5CP7A 3CFIC 3SPVB 1XBRA 3PL6A 1K8DA 4DUWA 1MJ8L 3OAUL 4NO2A 3M17A 2H0JA 4I3SH 4NQCA 4POZD 2NX5D 2J56A 1O7VA 1KXQA 3K5RA 2Z6FA 3QDME 2NCEA 3QFJD 4AYFA 4H8QA 5K9QI 4J8RA 1O6SA 3RJDA 5LGJA 4QHNA 4D9QD 5EWIH 3JUYA 1H3VA 1IGMH 1DLFH 5ANHA 1MFMA 1F1DA 2R2HA 3PGDA 2J73A 1MI5B 1NCCL 3N3EA 5FFOA 4Q52A 3E9TA 1MDTA 4BRJA 1QRKA 5FA3B 3NDZE 3CFDA 4U6TA 2R8SH 1LDPH 1YQ2A 2JJUA 3CFJB 3HI6H 4PJFA 2ZNWA 1ODUA 1OTSC 1EZLA 2NY6C 4LMQE 1YEDA 2IGFL 4YPGA 5D7HA 2HT2D 5DK2A 4OZIB 4HMEA 5EU4B 1P5UC 3UG4A 1UZGA 3SY0B 4YSCA 3QW9A 3WYRA 4Z3GA 1KB5B 1Q90A 1BJ1J 1CS6A 2UXVA 3L4UA 4Y2DC 3TGXA 4AQ1A 4A6YA 4C4KT 2R0ZL 1UH4A 2BY2A 3M1CA 3PWPE 4PRDB 4W9ZA 4EDXA 1RU9L 5KVFH 2BVQB 4W9EC 1ZV2A 1RL1A 4QI3A 1EJOH 5L4IA 1OAKL 4WKXA 3UBXI 5BRPA 3PQYE 3FT1A 2O5NA 5ITFA 5JIHA 5D5MA 4HKJA 3UTQB 3A4DA 4YSQA 1XF5A 1CU4H 3BKJL 2XBDA 3EH1A 4NN7C 1BVKB 5DO2D 2DMCA 4P04A 5EUKB 3ZKNC 3T3MF 3V9EA 2ODIA 3FU6A 4QRUA 4R4FH 1AS7A 4FG6D 1WSST 2AQ3A 1AXTH 1SJHA 3KGRA 2D8KA 2ZOTA 5DU7A 3ILDA 4R0LB 1SOSA 2AV7A 3EYSH 3PHAA 1OB0A 5D70H 3DETD 4ELKB 2CQVA 3S5LB 5IHLB 2X4NA 1JHKL 4EEEA 3G6JF 2ZX8A 1KGCD 4XC1L 5FK9A 1IUZA 5ESAA 2WXMA 2F7OA 4YHML 3EYUH 3Q2NA 4GQZA 1PZAA 1BFVL 3ZIMA 1IBYA 3FQUB 1L9NA 3K3QA 2F53E 1U93B 1ZLSL 5IW3A 5DJ2A 3DHJA 1KFAH 1FL5B 2WBWB 4MMXB 4LARH 1GGCH 3KXFD 4MJ2A 3U4BL 1ZXQA 4G42B 5B1AB 1JGEA 3J7HA 5JR1L 4FFYA 4G1EB 2VO8A 5KAQG 3FSVA 4K3JL 4X4YA 3MV9A 4FI7A 4G8AC 3GGWB 4HKXB 5CCKL 2IAAC 4UQ3A 2YD9A 2I9LB 3KPRE 3TBVA 3WEOA 4TYUA 4M6MH 3F5WB 4MQXC 3IDXH 2G3MA 3B9KC 4KHXL 2AVFA 2WBJA 4WHCA 1A7RH 1KCSL 5EN2B 1XGTB 2CGZA 4U1KB 3FFDB 3ZKSD 1RLWA 1QX1A 2R56H 3CX2A 4JO4H 5F9OH 4EZLA 1AKPA 2FWLB 3A3YB 2B8OT 1N0LA 3KYMA 4W9HC 4LMQI 3BH9B 3MXVL 1FWXA 4LKCA 1OK8A 1A6AA 3CDGB 5GS1C 1A2YB 1CE6A 4R8WL 1JZ8A 3VFRB 5L7XH 4IRZH 2FO1A 4V11A 4XNYH 2EE6A 4ELME 4G70B 3HR5A 5TQ2H 4UUJA 3SPGA 3GJFB 4X6DA 2ROYA 3QEUA 2CK0L 1OCWL 3QQDB 3QZLA 2YD7A 4BFEA 3JVGA 2CJTA 2DIAA 4OAWB 3LQZA 2G30A 2W88A 3T09A 2QKSA 3EJZD 3NSJA 5LQBH 3DARA 4N25A 1B0RB 2N4IA 1E4XL 3BWZA 4ZMVA 3ZL4H 1XH2A 2ZWKA 3LN9A 3PGFL 1AE6L 1MI5E 5H2BA 2LLLA 1KB3A 1PLGL 3EGXA 2XXFA 1YEEH 3WJJC 3HHSB 2XBTA 3OKOA 4IGBD 4AQEB 2A4ZA 3NIGB 4N0UE 4AH2A 2BSEA 1P7KA 4JFHE 4W81A 1GKOA 2YQ2A 3HRZC 2WB7A 2IWKA 4KKLD 2VQ1A 1FG9C 1TPXC 5H4YA 4KOCA 4GKZA 4Y7MA 3DGCR 3BLKA 4KKRA 3NA4A 2K3TA 2F2HA 4AIXA 1QBBA 4ZPVA 2A9BA 3OB8A 5CBAA 3WNLA 2F8IA 5JW5B 1AH1A 2JB6B 3TLRA 5I73C 5HDQL 4XHJD 1F4HA 3ATDA 5DRWB 4AIOA 3MUZ1 2A2QT 3DK2A 3APFA 3SDAC 4M7ZB 1Y18B 2YD4A 3QFDB 1IMHC 4AGOA 3MRKA 2PR9A 3ARGB 1A1NA 3QISA 4OKDA 3C2AL 1OP5K 1I8LC 4KI5C 4NQVA 4MA3B 1SQ2N 5JHDA 1NUGA 4GP5B 3T65B 3VH8G 3W0WB 5BV7H 4FMVA 4NEHB 3JUZA 1ACYL 5FM8A 3LDBC 1W6WA 2H9GA 2IFGA 2H8PB 3GS4A 4KJPC 1HH9A 4B60A 1DEDA 2PO6B 1OAQH 3ETSA 4I77H 2O61B 1MHEB 1UACL 2WSPA 3AU0A 5ALCH 4B9GA 4CGTA 5C09B 3HE6C 4K7FB 4H13C 1U8NA 1TLKA 4NIYE 5ID1B 5KJ4A 4TLKA 4I18A 1NAMH 4QNPE 3QJHB 3H3BC 4BKLB 2WXNA 3RWEA 2DD8H 2P80A 1S78C 4FNLL 2BNUB 5HJ3B 1MI5D 4TKWA 4YWGL 5JQ6L 3F83A 4JO3H 3ASOB 1Z5HA 2WIIA 4M6OL 2PTVA 3IXAB 4U1NB 5DQDL 3V52H 5KSBF 1U8LB 2CU9A 2K8MA 3OXRB 3Q6FB 5CJ5A 4ZTEA 4QCIB 5BZZA 2OYMA 2QL1A 1TZOA 2A0LC 2FJFB 3A24A 3LN4A 3PUCA 4R84A 2VN7A 2WXPA 4XPBH 1FZOB 1YUKB 1FO0H 3OKKA 4K5LA 3PJSB 1TJHL 4S1SH 1H8SA 1J9QA 5IMKB 2EZ0C 2OSLA 4Q9RL 3UACA 4P9HH 2BSRB 3KYNB 2OP4H 3B9VA 3PY9A 4BV1A 4WDIB 3KHQA 1RZFH 4LL9A 3O2VH 1F3RB 1WDAA 5I19L 1UJ3C 5AENA 4UT6L 5IHZA 3SGKA 1A7PL 2Y22A 4JGUA 3RVTC 1LK3H 2Z4TA 2PWEA 1HSAA 2IAMD 3VRLF 4J3TA 2CXKA 5I1KH 3MUUA 1U33A 2W81C 4OFYD 4UM9B 4URKA 1L3WA 5H94B 5DMGD 43CAA 1ND0B 1SEBB 4RQQA 4DSYA 4W1TA 2EDKA 4ENZA 1U8MB 4PWGA 4JRWA 4LE8A 3LAFA 1UFGA 3NIFE 3BGMB 2PW1B 5E9DE 4HOZA 4GP4B 5DK0A 1U21A 2GTZA 2VLRD 1YMHB 3G08A 4I5BA 5FYLH 3DURB 5DZ9A 1QYGH 3DTUB 4M61A 3NIGE 4BZ2L 3LPFA 1NC4B 1PNCA 1TETL 2X38A 1U92A 4JKKA 2V3FA 4FFTA 5EU5B 1E2ZA 4PIRF 1H15B 1R5WA 1ILUA 5EH1A 4NKMB 4HP5A 3X1NA 1IAKA 1N19A 5BPPA 1E7VA 4K3DL 4F7TB 4X5RA 4Y2DB 5E08H 1JV5B 2Y07L 4M7LT 3WJLC 4TM9A 5SV4A 1T1XB 2UUDK 1THCA 2D73A 4UQBA 3SO5A 1DJIA 1G7PA 4IQHA 3EDFA 3BQVA 3N6YA 3QNXB 2OTWA 4KU1A 1P4LA 1TTBA 3B9EA 1HSBB 3RWJA 4X99B 4IU3B 4NN7B 4BFGA 3PFUA 4NO0D 1MJJA 1WC7A 3QXTA 3DTXB 1I9JL 1CLOH 2AK4B 5JIKA 2CALA 3TBBA 3TPUA 3U25A 4KKAC 1I9RH 2B14A 3CLFL 4TLTA 5FM5O 2WTPA 2YD1A 2GJ6B 3Q7JA 3P9LA 1P1VA 5BVJB 1AO7A 1JWSA 1CT8B 2X09A 1A4BA 3T0BA 5JZ7C 2F1EA 5DD5H 3F8UB 3VSUA 3WY2A 3RX8A 4MCYB 3P73A 5G5DB 5JOFA 1GC1H 2ZCLL 2CPCA 3A47A 4NQTA 4Y5XC 5ELIA 2OMNA 1V55B 1ZA6A 4R2GC 3H0TB 1OGTB 3K0YA 3PHOB 4LLYA 2IQAA 3D69A 4F7PB 1C12B 1QWHA 4YIQB 2WQ8A 4ANXA 2BVOA 2V17H 1DQVA 3H7BB 4EDWL 4E9RA 1XB3A 5F0MB 4A7UA 5DI8B 1QO3B 3L81A 2E27L 4JQIA 1GJWA 2ZUWA 3N0PB 3VWKC 2DYPB 1EZUA 5K33A 2J3SA 4BCYA 1JN6A 1ZTXL 1SF3A 4WSKA 5BOPA 4J4PD 5J6HB 4JCWA 4AJVA 1B2WH 1MY5A 1OZTG 2J6EH 1X6LA 5CSGA 4APQC 1QFUH 5EA0H 3B9KB 2EH7H 3GMMA 2AXGB 2DLIA 3MRDA 5I6PA 2CR0A 4H40A 3QXDB 3ZZ1A 2MNUA 2X1WL 3FBKA 1OAUH 3RFRA 2NTFB 1CXEA 2LW3A 1WFUA 4K5PA 4TRPH 5DFAA 3KPSB 4ABQA 2C5DC 3EBHA 4JFYA 1C5DA 2VRAA 3WE6A 1J0HA 3AFLA 4R5VA 2BZ7A 4XCYB 2X2HA 5D7IB 1LP9B 1YC7A 4MZRA 2Q86B 5GS1B 1Z0MA 2R2BB 1K5WA 3ZDXF 3OKNB 1GW6A 1RAMA 4IKNA 5EORL 5CEZE 4Q9CA 1EGJH 3EJJX 3ARGD 5A16A 2TSBA 1MELA 1FFNB 4JY4B 4OGZA 3B2VL 1GR7A 2A7BA 4BE6A 4UYPA 4IKIA 4WI9A 3W0WD 3PABB 2YMXL 3UO1L 1MUJA 3LH9A 1JCVA 2Z0UA 5F7NC 2HFGL 2LAGB 4AG4L 4G9DB 3U7AA 2OPCA 1D5ZA 5MENA 3SSGA 1CYGA 3L7FB 2VABA 1RK0B 3NFNA 1DCLA 4Z8FH 3ECBB 2PO6D 2O5YH 1RPQA 5IB5B 4UOJA 2XZCL 5C09D 3QWNA 2VXQH 1V7NH 1NANH 4FNQA 5IBLC 4DPAX 3HRZB 4TUUA 4Y19B 3QA3B 1SXCA 2AEIT 1GGBH 1NGPL 4QYOB 1TPXB 1ZVSA 1AC6A 3U46B 2WLLA 1ETB1 2FRGP 1BQHA 5T1KA 3NFSL 3L45A 2IADB 5I0VA 2ZJSH 4H26B 1N6UA 4WO0A 2RIKA 3MUGA 2V7NA 4Y9CA 1QR1A 5I73B 4PLKC 2ZKHH 5GRVK 5IFJB 1JVKA 5I1HL 2F18A 1T1ZA 3STLA 3SDAB 3VXQA 5JIMA 1RVFL 2JI3A 4GAAA 1CFNA 1EHNA 1BVZA 2OW6A 4K8RH 3RP1A 4UT7L 2X4UB 2P1YA 2Z31D 3T8MA 4OLVH 2CCWA 2YS4A 1IGFL 5IT2L 2OMVB 3GSRB 4MVBD 4Q14A 5EIIG 1GYWA 3Q8FA 4H1LG 4OIAA 2AK4E 4P4RB 2KC0A 3OC5A 1RSYA 4JFDB 3UMTA 2H5UA 2OX5A 4PGCA 4JHZA 3SDDD 1DL7L 2DYSB 3V5HA 1WAPA 3SPIA 3LDBB 4JK0D 3T0AA 2SEBA 3MGTA 5I8KH 4YFLI 5DUPH 1AZVA 4B9IA 2XPYA 5A43C 4RFEA 5AW0B 5HD8C 3FOMA 3HUJA 2NNAB 4RGOH 4MYWB 1BA9A 1MVFA 3HE6B 4ODWA 1VPOL 2QTEA 4PJCB 2KQNA 3EFFA 2BVTA 2JLLA 5DD6A 3LB6D 1CICA 1T80A 3EXLA 4WFFE 1F3JB 2WXLA 3FQYA 3MLTA 4UM9D 3RPIB 5CNHA 2HLAB 1DSYA 3T9WA 1BF2A 3QCTL 3U0WL 4DFIA 2XQYA 1TO4A 4K94H 4P3WA 1ZMYA 1BIHA 1UGNA 2NY7H 1PLCA 2GSIB 3PV6A 5JW4Q 1YJDH 3IMSA 3FPXA 4RLDA 3QWOA 1YYMH 1T4KA 3RBGA 1XCTB 1A1OA 4XPAH 3QNZA 4F57H 5AW5B 4KZ0A 2EDYA 3IFPA 5K69A 4C83B 2QPUA 4RMWA 3TZVD 5J12C 4PJEE 1YVLA 1RIHH 1N67A 1NC4D 2QDVA 1B0IA 3DBXB 4G7YL 5KANI 3S88H 3W5MA 4JCMA 3W38A 4CMMA 4FMFA 2UZXA 3NJGA 4IRZA 1WUNT 5DHVA 4UB0H 4NHUA 5CGBA 3EJUA 4G6KL 3T2QA 5I1IH 2NLJA 2H1PL 1G5GA 2WMPB 2P9RA 4FRWA 5DRZA 2V2TA 1CC3A 5EF1A 2HLEB 1DVXA 4PRHA 1ECYA 1JTTA 5J5EA 2DQHH 3VI3B 1UJ3B 4OJDH 3ORJA 2K3HA 1QW9A 3DUUA 4LCUB 5F88B 4CC4A 1E28A 4PH8A 2XWZA 2Z1PA 1EXHA 3L3OA 3RB7A 4LB8A 1TG8A 2XVLA 4WJ5B 4BH8A 1YEHL 1PW3A 3C60A 1KXVA 3BVDB 3REWA 4JGNA 4M4RB 4WK4B 2DJMA 5D71H 2GC7C 5DCCA 3UTSB 1LQBC 2NW3B 3RKDC 1CF8L 2DWEB 5JOPD 2O5ZL 4JKLA 5FO8A 1QHQA 3PIQB 2GJ6D 1O7SA 2BRRL 4LSSH 1P5VA 3F7PC 4PGBB 4MX7A 2J6WA 5AOJA 5GRJH 2KDYA 2IALA 3HMXH 1E65A 4EI5C 3ARRA 3QEHA 1MIMH 1G7MB 4H5SB 3T3PB 3TVMC 1XQ4A 1Z6JT 4UIMB 1KUMA 4WV1B 1L6XA 2R4SH 1FVCA 5LDSA 1KT2A 4JHAL 2V37A 4GOSA 5HHXH 4Y19E 1KTJA 4BQCA 1NQBA 1TCRA 5DUJA 2CLZB 5IQOA 5IMMA 2D7OA 5E7FA 3OV6A 3WKML 4PS4H 3VG9C 4KRNA 4KX9A 4X5QA 2QELA 4OV6F 3RWGA 2DQDH 1X5JA 1S9YB 2ZWNA 3TEZA 4EKXA 4DW2L 4HFUL 5FCUL 1N3NA 4N2FA 5CLTA 1TSHA 3CHSA 1JDDA 1OAJA 4LBAA 1OL0A 1Z5YD 1RUML 2LABA 4UINH 4TLSA 4W6YB 5SV3A 3HB3D 2PPFA 4MQXD 3B9KD 4WI4A 4J5VA 5CLYA 4KI5E 4LEXL 4NPYB 2HMID 4MBRA 3QQXA 4WFGE 1U8PA 4CSSA 1ZE3H 1XX9C 2J8HA 4JFDE 4W68A 5E8NB 2G0LA 2GB2A 1ZA3A 1A66A 4N0YL 1VDGA 3KPSD 3UYPB 1PU0A 1Q9KA 3RWDB 4UIKL 4GSDH 2G5RA 1QLFB 5G4MA 1AOHA 2JCWA 1NAMA 3MLSH 4XP1H 4QRSB 3B2UD 2BRQA 4KTGA 4G9FA 4GQPH 1NEZB 1KC5H 2NQ3A 3MRCA 4FJYA 4PRIE 2JKNA 4PJCE 2XXMB 2I5YH 3CFBA 2QV2A 4R2GB 2NY5H 5I1LB 1NDGA 3FHAA 2PTUA 4AI7A 5AOZA 1JXGA 3FH5A 5K9KA 4X8CA 1FLRL 1E3XA 2OCCB 4B5EA 5GIRA 4IS6B 1VGEH 4PB0L 2DQEL 1E9QA 2UY6B 4UQIM 1XR8B 2H45A 2YPVL 4KK6D 1NGXB 4PP1C 3VWKB 2EO9A 5F1SA 3CZFA 4HFWB 3ZHFA 3W2DH 1IGTB 1JGUH 1KBGH 1K4DA 1JYVA 3DRTA 4XNMA 5BJTB 4MCMA 2K4WA 3TBYA 3Q1SH 2XWCA 4KV5F 3V0VB 2WLJA 3IAGC 1K2DA 1E43A 3IMRA 3TEXA 3OXSB 4I4WA 2F0CA 2R39A 4GEIA 2X2JA 2Y72A 4Z78A 5IFHL 3M1BA 2W92A 1N5AA 4MLSA 4JKPL 4PTUA 2CR3A 3Q3GA 3SKOA 4HOXA 1QASA 2WN2A 3SDAD 5HYFA 3A4AA 4L4VA 4WWKC 1F1GA 1FNSL 1U2HA 2Y23A 4L3CA 4NC1C 5GGTL 3K6SB 3NEEA 1ZJAA 2OMZA 2CGRL 4EI0A 3VXTB 1FHGA 3W37A 4JO2H 5BQ7A 4KI5D 1EEZA 2YPKB 4XTRC 3IGAB 3IMTA 3O0LA 5E0FA 3UTSE 4JFDD 2XX1A 4K3EL 3QO0A 2OMBA 4ZX5A 4TQEH 4N87A 2EKSA 1IKOP 1OGAB 4OLZH 2MCPL 4CILA 4FYTA 1BAFL 5JORB 2HAZA 5JPMA 4LLMB 3AG3B 2E75C 3AWGA 3NP4A 4OIBA 1XGPB 3RTLA 3EYFA 1DQIA 5E1AB 2WQRA 4WGVB 5D2NC 1YN7B 3DPDA 5D6CB 4ZMYA 1U8HA 2Z64C 4PJBF 5LG1A 1KGJA 4QJ3B 4Z7NE 1L0PA 1SYVA 5AWNL 1Q1JL 4P0DA 3V0DA 4B9ZA 5GGRA 1YN6B 1CLVA 5DF0A 3LJ3A 1MCJA 2ZYIA 4Y7OC 1HXMB 3A5VA 1K4CA 3CDFA 3CDZA 3FQNB 1S78D 3M86A 4KMTH 4PJXF 2B59A 3IETA 3BKCL 5B3JE 1T04A 2ZPKH 2ZUUA 2R9HD 1CGYA 4CKVX 2HTKC 3X13A 4HWZB 3GNMH 3MJ7B 4YE4L 4JG9A 2A0LD 4E9VA 15C8H 1NBQA 2DWDB 2XV2A 3LRMA 5IVZA 4KMLB 3KPLA 4OKVB 5K39A 4FC3E 1CDIA 1N70A 4GIPD 4KXZI 5TQ0L 4PG2C 5HI4C 1FDLL 3P1VA 4Y1AB 1H3GA 4LLDB 2WBXA 2EZ0D 2OZ4A 4PV8B 3KLHD 1DQMH 3CC5A 3CX5J 1UD6A 2UWEB 4MNQA 7FABH 2ALWA 4LCVA 1NWPA 2XQYK 2YD3A 3KL5A 5BXFA 4NOBA 1CDBA 4AL8H 1P7QB 2RFXA 4KVNL 4N6QA 4YUEH 5D2LE 3SCMA 4OD3H 3ZRFC 2JXMB 1N0XH 2VL4A 4X0KA 5ABAA 3RVTD 3A6BH 2VIRB 3TBCA 3VX1A 2BVYA 4I3RL 4R6UA 2VM3A 1IGIL 2ENQA 4POYA 3D09A 4Q9QH 3UXFA 2RCSH 3FB6B 2FB4L 2J6EA 2FT6A 4NRZA 2IDSA 3ZO9A 2CIKA 4N5EC 3MLVH 4JFFA 4OUOA 2RAMA 3U6RA 5JLZB 4LSUH 3O6KH 1R1CA 1IM9B 4NLAA 2DQGH 2XTJD 5C7ZA 3V0HA 5BZWB 4HIPA 4YHLH 3IDMA 1URLA 3HN8A 4HAGA 1NUNB 2F54A 1NFAA 2XIDA 4DZ8A 4L5FE 1XCWA 5J12B 3Q5YA 3ARFC 3DX9A 4RNRB 1NAKH 2B16A 1FJ1A 4JFEB 1HE7A 2CMRL 3ZSTA 1NBVH 1CL7H 3DECA 4O9HL 4FA8A 4AENB 4HWBL 5I82A 4LKXA 1TJIL 1OAXL 2Z91A 1DVFC 1DBKH 3C5ZC 2ED8A 3G5YB 3ROLA 4AT6A 2X0UA 3LEXB 4N1CA 1KXTB 3V6ZA 1LP9F 2WUCH 3PJLA 4HS6B 3TV8A 5ADPH 4UT9A 3VDCA 4YSEA 1PQZA 2LGNA 4P06A 1FCGA 3M7FB 2ADGA 5DFWH 3BIBX 5B39G 3FQXB 4MXWL 2QQNL 1HN1A 3WFBL 2DI9A 5GSVA 4MKTA 4AMWA 3TWYA 2ZXAA 3B5HA 4I0CC 3MR9B 2VXQA 3V0GA 3D30A 3FO2B 1N26A 5C08D 3JTTB 4NNPL 4OZHA 2F7PA 3I85A 1OE2A 4G6MH 4UMGA 4QIRA 3D0VB 2L7UA 1INEH 2I07A 4N20A 2CA4A 4D0CB 2FWOA 2QVKA 3AT8A 4QT5A 3TVMB 4EI5B 3BP6B 1E42A 4ERSH 3FQTA 5C97A 5E8DH 3HVNA 2CSPA 2R1YA 4GUPB 3EJCA 4NGHL 3WNPA 3BWSA 3MNVB 3VNZA 1BV8A 4HKZA 4QRPA 3MO1A 2XG5B 3BDXA 1VFBB 4R2GD 5D1QE 4Y5YA 5HVFB 2JK5B 1EBAA 5BW7A 4Z7UB 2P8PB 4N86A 1AD0B 3VG9B 1J1XH 4OUUB 3BVNA 5FGBA 5I24A 1EZVY 5HHNB 4OJFL 5DJZB 1FH5L 4APXB 1MWAB 3ZN6A 3N43B 3GO1H 1EO8H 2B4CC 2RB8A 4GMSH 2E7HA 5KVDE 1FLTX 1FFOB 3R7RA 4FZEH 4IJTA 1U42A 2UVFA 2X41A 3DIDA 4UWQB 1XZ0A 1S6NA 2VUYA 3RAJL 3U7WH 3K6FA 3ZOAA 1SGKA 2FBOJ 3U1PA 3TBSA 2EDJA 1T7ZA 4LLAA 1K8IA 1OT1A 4Y1AE 4UTAL 3NN8A 1FFPB 1B2YA 2LT9A 3GSUA 2WLMA 5T5FH 1USZA 4M48H 5T1MB 3VAEA 3ZYOA 2UWEE 3H3PL 4I0PC 4TPRH 1OEZW 4X6BA 2D7TH 4KFZC 3EUDA 4UZSA 3QO1A 2PWDA 2PP8A 3BP5A 2D7NA 3FF8A 4KY1L 4YEFA 4NHCH 2EDRA 1NC2B 4HEME 5KBMA 2WINA 1NCDH 2VUOA 1QRNB 5E6SB 3RWFB 2CDGA 3GSOB 2QSVA 5ECGA 3IU3B 3QZMA 1HT6A 3NK4A 2VSMB 2DQCL 1YPZE 5DHXB 1BQUA 4WI7A 1YMME 4DH2A 4YSPA 3DX4A 3KS0H 3M1OA 4OJYA 5K59F 1BEXA 1HIMH 1XD0A 5HYQA 4KXCA 2BOCB 1ETZA 4M62H 4ZXBA 1OHZA 1AGFB 3P4MB 4AV5A 2VSDA 1OGAD 5INCB 4M4PA 4L8BA 4DGYH 4X5XB 3L3KB 2V0AA 2P8MA 4HH9A 3WKNA 3M8OH 2NPLX 4YHOH 1QEWA 5EZLB 5IBLD 1FHNA 4HCRL 4Q58C 1U8CB 1GZQB 3D6GA 4JFEE 1VB9A 4FP8L 3SQBB 4YDNA 3CDYA 2NY4C 2PLTA 5GGQH 2V7HB 4E41E 2OJEB 5I76A 2W60A 3HPJA 5I66A 5HXMA 1L5GA 1QFWL 3THMH 2A6IA 3CXDH 4PLKD 4YVNA 1CTMA 4JG1L 4TNFA 3UAAA 4BFNA 2G3XA 1ADQH 4NZ8A 5IHUH 4ABUA 3T0WA 3D06A 4WWKB 3MODL 3FQ2A 2AJYH 3GB7A 3B6SB 3K72A 2BNQB 2B0SH 3EYOA 5JPNC 3K6NA 2FQEA 1AGCA 4NM4L 1XT5A 1CFTB 1MLBA 1HWHB 2LVCA 3HBZA 5E2UL 4OCWH 3GMNA 4Y1AD 3EBGA 4HG4J 5EC1B 3VMOA 4PI2A 1UD3A 4U1JA 5C0CA 1F4AA 2AQ2A 4GQRA 2EIZB 1UYWH 4NN5C 4WCYL 1Z3RA 4PIBA 2FNBA 3FT3A 4Z7OB 5I75C 5HD8D 2I7OA 2ZNXA 2D3LA 3NJFA 1BGXL 3VFUA 4QUOA 3SJVE 2IPTL 2VLJA 4ZJ9A 2WUBH 2O26U 1P7QD 5D2NB 3SDXB 4HZ1A 2UY7A 3JWDH 4HUVA 1XFPA 2HYMA 4MQ7B 2MWCA 5CCJA 4KDVA 2VQ4A 4OLYL 4WEEA 5E70A 4Z7UE 1OGSA 1U58A 3O8XC 4UTBA 4J27A 5IBUG 1A6TB 2FSDA 4B9YA 1OPOA 2XQBH 1YNLH 2Q76B 3PDOA 4MCZA 3N5AA 4CKQA 1U36A 3CSYA 4CNIA 5SWZA 2IXQA 4KKNA 3V2AR 1JYWA 2BPBA 4ISVA 3OL2A 3SN6N 2WYZA 1IM9D 4XBGA 2ZCHL 2XN9E 4HD5A 1FQ9C 4EZMA 4TS6A 3E1ZA 1OAYL 1XR9B 4S1QH 1D2PA 3EH3B 3C6EA 4P9ML 4XAKD 1LLAA 3JV6B 4Y4HA 3EGSA 4HV8A 4JFED 3V10A 5JW3H 3QRFM 1I8MB 2YQ3A 5IJKC 1KIUA 1V3JA 4N2KA 3D3VB 2TSAA 3KH4A 5DJAB 1IKNC 2VYRE 4U1SA 1A3LL 5J1AB 2CKBA 1OV8A 3K80A 3GSNB 3MGOB 5EUOB 3H8NA 3S36X 3VYNA 1KCRL 4WGKA 2LR4A 1KXQE 2AXFA 4HUWB 4R90L 2K70A 4NWTH 2X4SB 2XETA 3MOBL 4MSWB 3UAFA 1G6RB 3CBJB 4X5PA 5SWSD 1QRNE 5IEHB 5CEXB 4QRQA 5GRZA 2UYLB 3TBWA 1A7OL 4A1RA 1OD7A 2FX8L 2NR6A 5GPRA 2ESVB 3OQ3B 5EFIB 4HSCX 3FO9A 3RL2A 1BJ1H 5LNDA 2A74C 1QVOB 1AGEA 1X4ZA 4LHUD 3OAWA 4MA7H 4NBXB 2JKWA 5AFAA 3TO4A 4EI5D 4UI2A 3TVMD 4L8SA 5L0QB 1F8TL 1OP9A 2D2CC 5IESL 2O30A 5CSZA 5BVPL 1KXHA 5CZVH 1RD6A 2BC4B 2AAAA 3CVIL 3C87A 4TSCL 4PP2B 3DTDA 4DT2A 3ARFB 4E9WA 5DRXA 2I85A 4DGVL 4XC3H 5AOMA 3NCJH 1KV7A 2COQA 3DMMD 4OLUH 1F6LL 1BLIA 4NDMB 3HLKA 2H1LM 1F4WH 1W72B 2VMDA 1XGYL 2BW5A 4L1DA 4LSQH 1DVFB 4M43L 1R3LA 1A6WH 3C5ZB 5FUZL 3N1FC 3JV5A 1DP0A 2QSCL 4UMSA 5FDWB 3OLIA 3AAZB 2LU3A 1I3RB 1DBJL 5J11B 1D5MA 3NCYS 3GHEH 4ZK8A 3C5JB 5E6IA 2XV6B 3AM8A 3EGDB 4LDOB 5KVEH 1H9DA 3TWCL 4L2YA 4IRJA 2BNQE 4MJ5B 1IZJA 4NC1E 1JPSH 4YQXH 3MI6A 2VRQA 1HILB 3GIVB 2C9QA 2VDPL 3RRQA 4MD5B 3UZQB 4EIUA 5DURD 5B8CA 5DC4B 5L8LB 2VERN 3K0WA 5DR5L 5T1DL 1OT2A 5E56A 2ZWYA 1FCCA 1QUNA 2B9BA 5LAXB 1OF0A 3MFFA 2VR6A 3KBPA 2FHFA 1BX2B 6FABL 5MI0C 3UGXA 4Z7OE 1HZKA 2AXJA 5AZEH 4Z3EA 4G7QB 1NC2D 1KG0A 2IV9A 4I48B 2VXVH 3MJGX 4UDUA 5D2NE 4UDTA 1PX4A 2YUZA 1LO3L 3N44B 1MREL 4OLWL 5E7BA 2OJZH 4PBVC 4TN9A 1FZKA 3BLBA 1DTUA 1S8DB 1ZT1B 4ONGL 4MYPA 1AKJB 2X4PB 1SF5A 4ZX6A 5EZIL 3MA7A 4GRLC 3ZE0F 1AMYA 4PRPA 2QGDA 2Y1YA 1LO0H 3QQ9D 4XXDA 3QIWD 5TE6H 4ZUWA 1URIA 4JRYB 4Q7DA 1EHXA 4KY2A 1PJ9A 4O4YH 4YDIL 2XIIA 4XPTL 1NGZA 2W59A 3EOTH 4KQ3L 1QNZL 1UB6A 1I85A 4NKIH 2OYLA 3VGFA 5ICXA 2WIMA 1IQDA 3B3IA 2UX6A 4AXWA 2WO2B 3KVDD 3S3CB 3ABZA 3ZKQD 1DEEB 4BSWB 5C0NC 1ZGLB 5J3HC 5A2IH 1T5XB 5ETUB 1KYFA 2L7EA 3MNWA 1XF3A 1NL0H 3D3VE 3MRNA 2IGLA 4N9OB 4ZYKB 2W9EH 3I6LE 5ESVB 5FV1L 4JO1H 4N8VG 3L3OC 2KQMA 2VITB 4DEUA 4ZZKA 3ZBMA 5KVDL 3WLBB 1S7XA 2V3EA 4I0PB 3DO7B 5BRZB 3WY3A 5EMYA 3F12A 5AYTA 3KLAA 1R47A 3PP4H 2Q8AH 2H3KA 4WWKD 4ONOA 2Y5QA 3S37X 2VR8A 4LIQH 5IM7B 2BNQD 3NYKA 1KYAA 1GMEA 5I16A 1U91B 3H53A 4NOFA 2NXZC 4G3YH 2HKAA 4XR8C 1T2QL 2YOCA 3MCYA 4XTRD 1A6ZB 2ESVE 4GB9A 4M5TA 2UZYA 1AQKH 3VH8B 5AKTA 1IEBB 2YRZA 4IHOA 4MA8H 3Q05A 2W0PA 4CW1A 5ESQA 1J05A 3ZJAA 4J28A 1O7DC 1KPVB 5CIPH 3RPKA 1LO4L 2BHUA 2J43A 3I75B 4ZSOA 2VLKA 5HI3D 1JVLA 4BWWA 3R0NA 2YUWA 2HKHH 2IDUA 3GMQA 4NZJA 2YKKA 4E36A 5EBMB 2BINA 5BMFH 4BUGA 4RWYH 1TZHA 2P45B 5L9DH 3MCLH 5TDPB 2NY4B 3QVAA 3B2PA 1G0YR 4MB4A 3EFDL 1KPRA 1JZ3A 1WH0A 1ET8A 4NO5B 2VZ3A 5J9PB 1JE6A 2MQCA 3GI8L 4Z7AA 5JHDE 3I2CL 2IH3A 2ITFA 1LEKA 4C47A 4W93A 3DX1A 4GRWH 5JPNB 5HGBA 3GC3A 5GGSY 1Z32X 1J0JA 1IU1A 1WFNA 5MERA 1S9WB 4PJDB 1IBGH 2N56A 3ILEA 1N2RA 1CD0A 1U2CA 2B1AL 2NNXA 4MNHA 3HAEH 4V2BA 2YA1A 5GGSB 1U8IB 2IGFH 4D0BA 3VRJB 3DIFB 3JWNH 3WXWL 3S34H 1FNGB 4XNDA 3ZT5A 4HALA 2L04A 3DRQA 4NN5B 5DWPA 2GT9B 3TCLB 2R15A 5IUCA 3DV6B 5I15H 5I75B 2R0ZH 4ODHH 5EBLB 1NIBA 1IKFH 3NFPA 3HNVH 3HZVA 4FULA 2YEQA 2ZD0A 2WY3B 5DHMC 4N8VA 2BIMA 3UYOD 4KOBA 4F37K 1RUKH 5DJCA 4HF5H 3VVWA 2OSWA 3O2DL 3CSTA 4MHHI 1FVDB 3I50L 2ESVD 3PPEA 4FKEA 3O8XB 4DKDC 2WVUA 5I5MA 1GCFA 3NTCL 2AANA 3EO1A 1I7ZA 4MJIB 4MNGA 4N5ED 4ODUA 4OFDA 3NIDE 3QZNA 4GAGL 1Q9OB 4JRYE 3SBPA 3DSFH 3ESUF 2X70B 4TTGA 4M56A 4N85A 2BFVH 4X4KA 2BY3A 3MBED 1XF4A 1KCVL 2FBRA 2BWQA 1TJXA 2BSTB 5DXWA 3WXVL 2AEPL 2J1WA 5T5FA 3P69A 3ARFD 4XC1H 3VI4B 3CPLB 2MOVA 4C8XA 4MD0B 1MW1A 1KIRA 1MFBH 3QI9A 4CGUB 1BFVH 5GJTL 1MWAL 1M71A 1TLMA 4GBXC 4HK3J 4OR1A 4CRPA 2CBQA 3C5ZD 2RJMA 3EJPA 3UAJA 1E7UA 4MXVF 3UP1A 4CDGC 1DFBH 1K3IA 3FSWA 2NSQA 3BEWA 4AQ8C 3IFOA 3VXRD 5FW7A 3T0XA 2YJQA 5JNYB 2VISB 1BOGA 2PCYA 4FNUA 3IKCB 4YSTA 1IE5A 2EACA 5EC2B 4ZMOA 3FTVA 2Y1VA 2PXYC 4Z7VF 3VNYA 3DO4A 5GZNC 4AC2A 1NCAL 5GXBB 1N64L 4RESB 1QA9B 4HGWA 3PPSA 4OZGF 4IW4C 3TA3A 4D2NA 1RJYB 1I1YA 1EEYB 4IMLA 1E9OA 2PTTB 4QHUB 3MLYL 4H8WC 5GZOC 2A74B 4LPTA 3SOTA 1XIWC 1KLGA 2J57A 4GW5A 3UPRB 1FFQA 3WS6C 4YO0A 1INDL 1KYDA 1ZXKA 3IFLL 4JHUA 3MXVH 1BQLL 4W4NA 5E03A 4ZFQA 4EVNB 4AVJA 3VXUA 4UQ2B 5IV2B 3VXSB 1HHGB 1T0NA 4RRPA 1J18A 3VFGL 2JKRM 1HHKB 5J06A 4YDVB 5IVXB 2GW5A 1T1WA 2Z92A 5DJXA 1QOKA 3BAEH 1ADQA 1P84K 1AKJD 3R19A 2ARJA 1HQ4A 3AADB 4YHNB 1O0VA 2G3NA 4RAVA 1ZAGA 4NLHA 1QFOA 4HXBH 4N1EA 3ZGHA 2OXGB 3UFIA 1XTLA 1YYLH 3LSOB 4DPBX 3HKZA 5EOCJ 2NMSA 5I28A 1Q72H 5GGUA 3QUYD 5AUMB 5CD3B 3QYNA 3DJTA 1KGIA 5D72H 3OF6A 5AAWC 1PLGH 3D87B 1X44A 1UOKA 2PNDA 3EOAA 3Q2LA 4HJGA 1BPLB 4JN1L 1XGZA 3MN8A 4JRXB 1IQWH 3UERA 2VWEE 2GTQA 2EVGA 4NN6B 1WZLA 2FVNA 2OCFD 3BAWA 1FRGL 1UB5A 2C34A 3MX0A 4QHMA 1JF1A 3OKLB 3RWIB 2AABL 2EC8A 3BIKB 3F7YA 4X4XA 3H9YA 2NRDA 5DFVC 1YDPB 5ICUA 5I71C 4PW4A 1AHKA 4FCHA 2KYIA 1I9IH 4I0PD 4CUCA 5BRZD 2C7UB 5MI0B 3E7JA 3WKYA 2CDFA 1DQKA 2V2WB 5C0FA 4S11A 3GBNH 4MDIB 5HDQH 3QPQD 4U3XA 1P2CA 3R1GH 3KW7A 1G9HA 3OPZH 5FUOH 3AWEA 3CVHB 1UT1A 4BH7A 4RSVA 1P4BL 4GRLB 5F97E 3LS5H 2YO3A 1AXSA 4R7XA 2X87A 1U3HA 1JCKA 4MJIE 4C56A 4PJGA 2IO5A 3ZHKA 3G6AB 4KK5D 1UWEL 1IAII 1OANA 3QWRA 5F7DB 1A4KA 1J9CT 2P49B 3MNZB 4K5MA 5C0EB 3NDYE 1IGYA 3UIZA 3S9DB 4R5TA 2NY1C 3WD5H 1VFMA 2Y5TA 2CHDA 3EFOA 2MHAA 2J7LA 1AP2B 4NKDA 4PJHB 4WWID 4HIJB 2AQNA 3S6CA 1ACZA 3FDWA 3QBTB 5HJDA 3WBDA 2LLNA 3V4PH 1KEMH 2NY4D 4QRFA 2MKLC 4JE0A 4GI9A 5F9DC 3IRCA 3DV4A 5E1GA 2JKTM 4HZLB 2GBTA 1P9MC 5EUOF 4JJOA 3Q8AA 1AXIB 2CRYA 3OX8B 5IEKB 3JSSA 5IJDC 1JWMA 1IBBA 3IJHB 4FNLH 4NB7A 4Y0GA 1JPTH 1CLYH 5CUSL 4YWGH 5JDSB 3ZZQA 2YD6A 4YMPA 1RZQA 4QXUL 3TT1H 5MENE 4CJ0A 4OIIH 4NJ9H 2X6VA 1HEJC 3GSNL 3PWJA 2HJLA 2NXZB 2YBGA 4FFVC 4L1SA 4JPQA 4U6XA 5JMRA 3M46A 3KPMB 4HA1A 4WHYG 5EIIB 4H1LB 4O02H 4P2RB 4WHTA 3TBTB 1KEGL 4PWKA 3RY5A 3HG1D 4FHJA 5A7BA 2EH8L 5KSAA 1G6RL 3SGDH 5IB1A 1JGVL 3IMWA 2DV6A 5KJRH 4ZW7A 3ZTNH 1DLHB 4E9XA 5I1JL 1FNLA 1B0GA 5DD3H 2I32A 2BK8A 1AIFB 3D2UD 3VXSE 4B9CA 3IJ7A 4XXCA 4ANKA 1AMXA 4JAMB 5IVXE 1FNAA 1GZHC 1J9SA 5IB3B 4HX1B 1KTLA 3B83A 3CCHA 1XZWA 3P77B 4Z95H 2IPKB 5D7EA 4AGLA 3WKQA 2IQ9H 2DKUA 2QDWA 2NQDA 2BP0A 1GCYA 4XRCA 3O41B 2X88A 4F2FA 4MJID 1T03H 2BJML 2PETA 1M6UA 1X9RA 3V6OA 4EZKA 2EXYC 2R0WL 1MEXH 2VJ8A 1X4XA 5DQJB 3D25B 4IRSD 2E6QA 3A22A 4NPKA 5I1GL 3TJHC 2DMBA 2OR7A 1YG9A 3D4YA 1W72L 4GO8A 3QJQB 4HJJH 5KVGL 2Z35A 3JVFC 5CU5A 1ZGLP 3DX8B 3WIIH 2XHNA 3MLXL 5J13C 3V4VL 3HUJE 4PS7A 3BKMH 5DUBB 3ZKMC 1HH6A 5HGAA 4L0YA 5DEGB 3MOQA 3HNSH 4XMZA 5AZUA 2X1PA 5HYIA 4RVBA 2YJLA 5D7JA 2D4DA 4NKQB 4XVTL 3TO2B 1KOAA 5T3ZD 5I30L 2DEYX 3FRUB 1BAWA 1WLHA 2FIKA 3HZKB 5ACZA 3SQOL 2V5TA 4XT1C 4HIEA 1MRFH 2CLRB 3B56A 4IBLT 1NFDF 4QF1A 3POCA 3HZYA 3IFNL 1VRSA 1PX3A 2O5XH 3OSVA 4ANWA 1U95A 3AXHA 1U8QB 2WANA 5GRUH 1X7QA 3CLFH 2YZ8A 3I6KA 4N2BA 3GKWH 2FECI 3UPCA 2B20A 4ZZFA 2FCBA 5EZJB 1DDTA 3T77B 4G8FA 4LASL 3VXSD 1QPXA 4EI6A 4ELMF 4F91B 4RAUB 4YNYA 4BFIB 1E9PB 2O6CA 2VAAA 4U1MB 5FYJD 1DJXA 3DX2A 1RZGB 4NQUA 4PRHE 3RNQB 1I8AA 2RBLA 4JANB 3KM2A 4TVPD 5EBWB 4JQVC 4U3SB 5HDRA 3LPGA 4ZW8A 2HTLC 3DOSB 2HJKA 3CUPB 4DAGL 4GBXB 1JL8A 1QQDA 2AEOA 2BP8A 4CL7A 3UP6A 3AY2A 4CJ1A 1MLCB 5CAYB 2PW2B 5MHSE 4AJ0A 2WWNA 4J12A 1BMWA 1RSFA 1DQQA 2ITEA 4DGIL 4HJ0C 2ORBL 3GDCA 3O3EB 2BSBA 3VE0A 3BEVB 4ZAKC 5HHQA 4JRXD 1BM3L 4NP4L 4XMLL 2D31B 4F58L 3VQ1C 2XDHA 5T3XE 2CH8A 2PXYB 5CIPA 2ICWB 2Y6SC 4TULH 2A6KA 1ZEAL 1BBJA 1XH1A 4H88H 4OT1L 4BDVB 3JV0A 2XJLA 4P2RE 1JFQH 2ICCA 2ZOKB 5GGRY 2W0FB 3HS8A 4GPVA 1XIWB 4RIRB 5J6GA 4AKPA 2E4TA 3C6LB 1O7DE 4KMQA 4E68A 3QJZA 3P0YL 2CHXA 3QG7L 4H2CA 3RGVA 2DEXX 3GBEA 3P4NA 4P4KA 4OCXH 1I8KB 1WFJA 1P1ZA 2M26A 1J1PH 3L2NA 5E00A 3UZVA 5CFAA 1OSPH 2DQFB 1GPOL 1FZJB 3FCSB 1G9EA 3AU1B 2YAPA 4GRLD 4M7LH 1PIFA 2DJ4A 1Z3GH 3VWJA 4GKSA 3II2A 3W1ZA 2Q6WA 4JM2F 4P2OD 4M00A 3X14A 2OK0H 1NLBL 2NYZA 1QKZL 4J8QA 5AL0A 1EAPA 5KYYA 3HAEA 3SGEH 1LEIB 5DLMH 1TNNA 2AQTA 1FNFA 3X1BA 1YHPA 3ZE2B 4OLXH 4L3EA 4Q4EA 4Z76A 1LE5A 4FKHA 1C5BL 5F1OB 4A04A 5C0BA 5BUGA 3ELAT 4N2GA 2BCMA 2ARJQ 1X3DA 3F7VB 4K07A 5C0ND 1CK0H 5CILH 3V5DB 2WTRB 4LQFH 5F0LB 1A1MB 2Z8RA 1SFHA 5ACMA 1NGPH 3MROB 3F64A 4KFMA 4R7DB 2GJRA 1MG2C 2V5SA 1R3IH 3QRLA 4JE4B 4J1UB 1LHZA 4G5ZL 4W6XB 1A9EA 4P5KB 5I71B 4XB3A 2YUVA 3RE0A 3NFSH 4GG6A 3MTXA 4X98B 2ICEA 1U8KB 2DLEA 2EXWC 2N3JA 4F7EB 4LRNL 4LPWA 5ICZB 2Z9TA 4RZCA 3QR1A 2GITB 4OFIA 4U31A 3H42H 1NCUA 2XZAL 1RUAL 3UMNA 3WHXB 1W80A 3LKOA 4ORGA 1KWKA 4FHKA 2D2OA 3GEFA 1KIQA 4PJ8C 1KB5H 3UC0H 1EJ8A 4P2RD 3BXNB 3K46A 4G5AA 3FQWA 1FV1B 2JI2A 3IBEA 1NOLA 4Y4FD 5BZXA 1KTKE 3ABKB 2CJSA 1X7TA 3BVTA 2UZIL 3L5XH 2W91A 4FG2A 1UD2A 4V1DA 3DX7A 4CU7A 3Q8CA 3KWWB 3CG8A 4P3CH 5DVNA 3VFTA 1UH2A 2WKOF 2YPLD 2D03H 3NUKA 3IJSB 4ABWA 2NY1B 5TDOA 1ZIAA 3DHUA 4S2SB 4UQAA 4ZS6C 5AOLA 5GS0C 2CRIA 2J1KA 1SMAA 4FXKC 2R1WB 4NUQA 4P23B 1T22B 4HQQL 3V4LA 1UWXK 2H26B 4MJ6A 3HC0B 2YN3A 2VC2H 4R9HA 3E6HB 3QNFA 3SE8L 4HSQA 3U0WH 4J3SA 3FCUB 1KJ2H 3PE9A 4LCCA 3NIFF 3RWHB 1MH5B 4K71C 1G84A 4KQ4L 4E9TA 5DVKA 4HAKA 3VD9A 3RDTA 4WWPA 2YGQA 3LH2L 1P6FA 3ARXA 2ETWA 3ARED 4LCYA 3GI9L 5D7KE 3OVUB 2GTWB 12E8H 4JZNB 4Z7WE 5D6DA 4KKZA 2P7TA 4JUSA 4M02A 2NZ9C 3X11B 3EG9B 3IN0A 4LVNC 1J12A 1S5HB 1WHPA 1E27B 5HHOD 1OCZB 4XVSL 3ZTDC 5KS9B 1BF5A 3GBDA 3QHZL 4WFHD 3AY4C 1JV2A 1J1OH 2CIIB 3QPXL 5DJ8A 5T3ZL 3HCVB 4W9GC 1WTLA 5TGBB 1DDHA 3L3HA 1B9ZA 2EDXA 3M6DA 3FU7A 4GXFA 2XACC 3IU4L 1TKWA 4XBMA 1YQVL 2HRPL 1K5NA 5JYLA 3P4OB 1C16A 4NS0A 5E4EC 2BS9A 4WUKL 25C8H 4KVCH 5FM5M 5KYXA 2ZICA 4NNXB 3BP7A 4PRNB 1NDMB 5T8IA 1PPIA 1UA6L 2CO6A 1I85C 3P9MB 1RULL 1F2QA 3BN9D 4ZFZB 4J3OH 1DVYA 3IAQA 1WZ1H 1EAOA 2JIXA 3WY4A 4KRPD 4P5TA 1Y0LA 2BRRH 1OOAA 3GJEB 1HAUA 3GJFH 3OJDA 3PAVA 1C1EL 3K2UL 5FYJL 4JDTH 3Q5OA 5CJQL 1CVRA 3Q48A 4TVPL 3ECVA 3MRFA 1XGRA 4OCSL 3ZE2E 1KCWA 4XOAA 2NSMA 3LKPB 5HBBA 5ILTL 1PZDA 3RZWA 4AYMC 4DCQB 4DP5X 3QRGL 5L88H 4ZS7L 1S9XA 4MNQE 2WPGA 4YK4C 5IOPA 4I1RA 1QSZA 1U3ZA 4JHAH 2HPTA 4XPGH 5ITBL 3H9SB 1WAAA 1L9SA 2IG2L 3DUSB 1UKTA 1WBZA 3QHFH 3QCUL 5F3HB 4AUYA 4YSSA 2BNRB 2AEWA 4ENED 3BKYL 1DBML 2ZAGA 4Q0XL 3WKMH 4AX3A 4F2MB 5IGXL 3EO9H 1FBIL 32C2B 2MJWA 2I9TA 2IPUK 3W57A 2B39A 3ULVE 4FG4A 5M94B 3RY6C 3W9EB 1E4WH 2YEZA 4KJQC 3GXNA 1VESA 3L4ZA 1R5IB 4TTDD 1H8NA 2PXYD 4X6FB 4Z0XA 5GZND 3HFML 2VLLA 4ETQB 1OLZA 3UROR 4KNUA 5CJ8A 4K9JA 1JF6A 3WOVA 5CHNA 3AGVA 2NX5A 3WDIA 4YFLF 2BS71 4AEHL 3QFJA 5GZOD 2F54E 4OV5A 2VMJA 4JGJA 2GJZB 5E9AA 3S36L 4N0YH 3C6LD 3NA9H 3V4PA 5HHME 5DHYB 3G6DL 2O6FA 4L2LA 3LV3B 3V5KB 3VRIB 4YHZL 2ATKB 1DQDL 4MWFA 2Z34A 1LEGB 4MKMA 2BOBA 5KBPA 2CO7A 1QBAA 2MOGA 3IDIA 3SYCA 1TNMA 2R27A 5C0AB 4E0RB 3REVB 2YGNA 1BF8A 1INQA 5DJ6B 2F58L 3GSXA 4PVBA 2WO3B 4MB3A 2GAZA 2IVFC 3MRQB 1J88A 4OQTH 2JF1A 2BVPB 3MRMA 1OM3L 1F41A 4UOZA 5GS2H 3LNIA 3TN0C 3BZ5A 2Q20A 4OFKA 4M93C 1NICA 5AW2B 3EJTA 4F8NA 4RGND 3DROA 3FTWA 5JDJA 4K23H 4XNZC 4JY6B 4O02A 1G1CA 3HBGA 2NYYC 1RHHA 1MCHA 2NY3D 3RVVC 5HJGA 4ZAKB 4GUCA 4OI7A 1SYSA 4HU8A 4B0MB 2CZNA 2WQSA 3O6FC 1WRFA 3ABGA 2G5BB 3N1QC 5EEVA 3LMJH 3JWOC 3WIHH 5IQMA 3E80A 3KYKH 2DY2A 5HGHB 3NQIA 2C3VA 4XGZB 2AJSL 2LHAA 2GABA 1OCRB 5DFVD 3V6FB 5AD0B 5KS9E 4D8PB 4FDWA 2XC8A 3FUDA 2FGWH 5B38A 4JKMA 1G7HA 1B3JA 1PNDA 2JKIS 4QRPE 5CR1A 3VXNA 1KULA 5MEPB 3D39A 3PF2A 1IFRA 4YJZL 2SODB 4HHAB 1ZT4A 3QUXC 5FYKD 4YVUA 2MTAA 3O45B 3V0IA 5KBDA 1QSEB 3LHPH 3ROOB 1A02N 1Z5LB 3BW9B 1DO5A 4ANVA 3SDYH 1TVHB 2YXWA 3WI9A 2EUVA 2G9HA 2YWZA 2C7FA 4WW2C 3QULA 5MEOA 5HYSA 1ACXA 3GMRA 1XF1A 3WFHA 3GRGA 1N59B 3DJRA 3QDMA 2VZSA 4B50A 4HUXB 4F8TA 1PD1A 1S7VA 4HISA 1H8OA 4B95C 4BZ2A 1DN0B 1PEWA 4OCYH 4B97A 3HC2A 5KOMC 3D18A 1ZHKB 3FONA 3U9PH 5CEZH 3GSVA 3GXUB 4P2QB 1OIOA 2ZYRA 3MV7B 4HDIB 1VIWA 4NT6A 2PP7A 3NACL 2HRGA 5L6YH 2FBJH 3L1OL 3IJYA 3F7KA 4P23D 3VMPA 5LBSL 1A3QA 1HOCB 1NWOA 4Z77B 2BNRE 3BIAX 1FAIL 4F2ME 1KWGA 5KZCB 2C1PA 3QDGB 4XH2B 1I75A 5L4MA 3VFSB 4KKBC 1OWRM 1C7SA 5E23A 2PCFA 4JQXC 5C0IA 4WI0A 4ZI8A 2G60H 1U8OA 4KPHH 2GFBB 3BISA 2C4FU 3BVXA 4R7NA 5D1ZA 4PJEF 3PQYA 4JS7A 4OM0H 4FFVD 4F7MA 2XG4B 3WU1A 1CFSA 4PJ8B 2VMEA 5BZDA 3FULA 3ECWA 4HPYH 4YGAB 5F7BA 4GAYA 3OM3B 3IDNB 5DSCA 3OR6B 1UQSB 1KNOA 4BUQA 2PABA 1JK8B 3QJVB 3T2LA 4FQLL 4N4YB 1P6AB 3C6SA 4HIQA 1TVBA 4K55A 2OL3H 1MCKA 3ZZSA 1UD5A 3BZFA 5IBTH 4W4OA 1FNHA 1SBSH 2EIDA 4M6AA 4AEIL 4JLRA 1F45A 3D07A 5IQ9B 3S37L 1G7QB 3AXLA 4UTCA 4X6CA 5AVRB 4LVEA 1RZ7H 1OB1A 4KVNH 1DQJB 5TK4A 3DX0A 4FXKB 3BRGC 1JNNH 3EF7A 4JJHA 2CO4A 3LXBA 3VFOA 2FEDD 1AVAA 4I3RH 4FFZL 1ZLUH 5C0JB 3MRRA 1TT6A 4GG8B 3L6FA 5IBUB 5AYUL 4KK8C 4TNWF 2A83B 2FH6A 2J2ZB 2AXHA 4K71B 3TONA 3ARDD 1ZVHA 2JJTA 4XAWL 4LLUB 4JDEB 1XSKA 3TJHD 2AJZB 5LCVL 1XMWA 5EO1A 5LXVA 1N10A 3KPRA 4QGTA 3D08A 2F08A 4BGLA 3H9SD 4EZJA 2J8UB 3W81A 3KPPA 2BSCA 3BWUC 4LVNB 1LE9B 4JBSA 1KSRA 2A1WL 3VM5A 4O9HH 1PG7W 2JFCA 1ZDQA 5DYOB 5GGVL 1HEZB 1TJIH 1OAXH 2GJJA 3MRGA 3RILA 4HKBB 3ILPA 2AKRA 5HJBA 5EOTB 5GSRA 4D3CH 3TESA 2VTFA 3VYPA 1QSEE 1Q94B 4NCDA 2XQ0A 2W07B 4OF8A 3KEHA 3H2WA 3FN0L 5E4EB 1HXYB 4H8WL 5SWZE 4DIXA 1ED3B 3TNMA 3C5SB 4MBOA 3SPVA 4C57C 3VFNB 1EX0A 2CHWA 4LPXA 1UWGL 2DQTH 3WFBH 4L9DA 3TM6A 4RDQF 4YDKH 3OG4B 4QRRE 4CU6A 2WYHA 3MXWH 5JIIA 3IK2A 5C0DB 2VDOB 4U2ZA 1UA3A 4NNPH 4GKNB 4UQ9A 1MI5A 2QGCA 4GO6B 1E90A 3AITA 4HS8L 1GY1A 1RZKL 3MV7E 2I24N 1BZ9B 4C59B 1KN4H 5FA3A 5FA4B 5C0AD 4YK4B 4JZOB 4NGHH 4PGJA 1CBJA 2IH1B 3CFJA 3O2WH 5E8EB 1RY7B 3JT0A 3WFZA 3MJ9H 4JM0A 2HTLD 3BVWA 1UG9A 5GQBA 4CN6A 4U7MA 3VB9A 5LBGA 4OZIA 3V0AC 1ZT7B 3SY0A 3UYRL 1KB5A 4FTVB 2JCCE 1FH5H 1CGTA 4UOQA 1UC6A 4HJ0D 3SPHA 3CDCA 5SX4I 4PRDA 2EYTB 2BVQA 3CU1A 4OCNC 3F00A 4K9EH 2XA8H 1A7QL 3AUWB 4ZAKD 4WI6A 1SLUA 5AW8B 6TAAA 4L18A 1A9VA 1JFHA 4F7KA 4L0PB 1JTOA 4KUCF 2XTSA 4LNVA 4JMNA 3T6WA 3G5ZB 1EZSA 3HFFA 3UTQA 2J4WL 3IM1A 3KNBB 3LNEA 5FYKL 1BVKA 3A6CH 1YNTB 4TUOB 5EUKA 2JELL 4HGMA 4OFYA 4QOKB 1I3UA 1S7WB 3QUZD 4HIXH 3BE1L 5BO1L 1I1RA 5DZJA 4GLRH 5F89B 5E0QA 5KG9B 1F3DH 3H3PH 1QSED 4R0LA 4U0RC 5DQ9B 4ELKA 3S5LA 2HFFB 1F4YH 3ARBC 4U7SA 1JRHL 4R4NC 3MRPB 5E8OB 3GUTB 1ZHBA 3O3AB 4XN9A 4ZMAT 3VACA 3VFPB 1AZUA 5K9JL 2VN4A 5AVXB 5B1JC 3FQUA 3OKEB 1U93A 1I8IB 2VDNB 4LFHG 3TN0B 1V7MH 4M93B 1FL5A 4M5ZL 1X5YA 4MMXA 5DS8B 1TITA 2RR3A 4PJ5B 2VR4A 1QBLL 5I1EH 4G42A 1UWFA 5C9KA 4M7JL 4P2QD 4XNZB 4G1EA 1IM3B 2D9QB 5IOKA 4FL4C 1ITCA 1IGCL 1YNKL 3GGWA 2VAJA 3NRPA 3O0RH 4PJAB 2ILLA 1PG7L 3O6FB 3OHXC 3MACL 4QR7A 4PD4K 1PKQB 2I9LA 4Z7NF 1DJSA 1YEIH 2J8UE 4HCRH 2WQAA 4WV1A 3KDPB 5JO5B 4H25B 4BSVB 2H2SC 3EDDA 4KJYB 5EN2A 4UQ3B 3SYPA 1XGTA 4U1KA 3FFDA 4ATWA 1G43A 5KZCD 3QDGD 2FLRT 3QUXB 2EXWD 3BDBA 4J3VA 3BH9A 3NCEB 1XGUB 3QNYB 3CDGA 4K7PY 1JXDA 2OI9B 5I17B 3NSFA 4PUBH 3VFRA 5J57B 35C8L 5EEUA 3TPKA 4L9LC 1KY6A 3GJFA 3Q9PA 4WW2B 3LZLA 4PJ7B 1UM6L 1RERA 3QQDA 4ZW5A 2EUXA 4N2EA 2KZ1B 4N2OA 3CJJA 4PY8I 4XNAA 5F1IB 3I6GA 4JO5A 4YXLH 1B0RA 4BFKA 1T21B 4FNSA 3LQZB 3O6LH 2CM6A 1G9ML 4WCYH 4JGMA 2LVEA 4X80H 4A63A 1CGSH 2VZVA 4JW3A 1AJ7L 5D2LF 2C9SA 1HJCA 1X5AA 2VSKB 5GS0D 3HHSA 1H3UA 4J4PA 4AEEA 4AQEA 3O3DB 3QUMB 3FUIA 5PAZA 2PCXA 2QQLH 1TF4A 3LIZL 5A6MA 1J8RA 4RFOH 4OGYL 4ZTOH 5C7XH 5HYJB 5JW5A 4CBZA 4FTVE 1CGXA 3MV8D 4NFCA 3IJEB 3W39B 3O11B 4KAQH 2JB6A 1HCYA 4BUHA 2WVVB 4AJWA 5DRWA 4DP6X 4X4ME 2ICWJ 4GIOA 3IT8D 4IBSA 1E30A 4AITA 4XPHH 1Y18A 3QFDA 4FOMA 2OSYA 3CC1A 3QXVA 3R06B 5AEAA 2NZ9D 1OAYH 3ARGA 4QAMB 4KTEL 2VLKE 4PJIE 3SE6A 2E74C 5CN2A 2W9DL 4XO4A 4MA3A 3X3GH 2H4EA 3T65A 3W0WA 2ED9A 4G8EB 3N41F 1GMIA 2QTVA 1NCIA 5FYJU 1E8YA 2F7IA 3R4RA 4EN3C 4OQTA 4P46C 2H8PA 3RWCB 1ULVA 3FSZA 3D0LB 1UXSB 2J1YA 3GINA 3N40F 1A7NL 2O61A 1J9TA 1J0KA 2PO6A 2V9TA 1MHEA 3KWVA 1RFDL 1W6LA 5JIPA 5C09A 2YKLH 2YPVA 1MNUL 2K7QA 4BEIA 3M88A 4K7FA 1A7OH 4JPKH 1HH9B 5ID1A 1XXDC 3MLRL 4BXSV 1HINH 5JUEL 1K9TA 2J1ZA 2OS7A 4YDLC 4NQCD 3QORC 5AAMC 1G0DA 1GGIH 2YMTA 3QJHA 3SE9L 4X7DC 2IDCA 2I27N 1HJBC 1OY3B 5M95B 1MW3A 2BNUA 2FJGB 4XXWC 5HJ3A 2F15A 1W0VB 5K1JA 5IKCB 4ZD3L 3RWEB 1TJGL 3CIQA 4N0CC 1F8TH 5IESH 3WO4C 3IXAA 4U1NA 2XKNB 1KCBA 3HZMB 1U8LA 3Q6FA 4P07A 1EUUA 3OXRA 3ULAB 3VJ6B 3CLEH 4QCIA 1N7ML 2XU9A 4DQOH 1ADWA 5IQ7H 4DGVH 3LKNB 1X5FA 1U9KA 2FJFA 1PJWA 4LPUA 1FZOA 2BIOA 3PJSA 1RZIB 2E4FA 4F9PC 3PDDA 1TOXA 1I9EA 4JHVA 5IMKA 3KWUA 4PFEA 1R17A 2FX7L 4ADGA 4GXUM 4O2FB 4NFBA 2XX0A 4JFOB 4L5FH 2BSRA 3KYNA 3OTTA 2RQEA 3MBWA 3NABH 4JRFA 1RPUA 4WDIA 3RX7A 3MRIB 4MNGE 3ZW3A 2D0FA 2Y9RT 2NDGA 3N55A 4J7RA 3KBEA 4TSAL 4XBPB 3DVGA 2OR9L 2X6AA 1SJVA 1GL4B 2DLFL 3MCG1 1H6UA 5DR5H 5INDB 3CBKB 4DESA 1CFMA 4DEWA 3BSZH 1CL7I 4UM9A 4QOKD 5CZXC 4G6AD 1BFOB 5H94A 4IIQC 1PTZA 4Z18A 3WELA 1E67A 1ND0A 1MCCA 1SEBA 2ZG2A 4ZMWA 1U8MA 4FQIL 5F9AC 2E7DA 1Z1WA 2TAAA 4D7PA 3BGMA 2PW1A 4DVRH 4LSTH 1S7RB 4AE1A 2MPAL 1YMHA 4LCCC 4TQ8A 2EC9U 4PMFA 1IGJB 1RP9A 3DURA 5IW1B 2B15A 4HBCL 3FFCB 4OLWH 1WEJL 1YPZF 3SKUD 1NC4A 4N6RB 5ES4B 4ONGH 4G6JL 4U05A 2AITA 2OMUB 1H15A 4NKMA 1CTNA 4HOMA 2F8VA 1OTTD 1P5UA 4PJ5D 5DZAA 1XHHA 4AYGA 3HC3L 2AJVL 4Y2LA 3B7SA 2Y6TE 4Y2DA 4F7TA 1JV5A 5JQIB 1IM3D 2CNZA 5EU7C 4N2DA 4Z7QE 2ITCB 1T1XA 1ZD6A 4AUJA 4DP4X 2FE0A 1QNZH 2RQ8A 3O6FD 2KLTA 3QNXA 1RMFL 3T2PA 3RVUC 3K4AA 5DD1L 1JTPA 4PR5B 5C9JB 2C3GA 3MV9D 4LVOC 1HSBA 4IU3A 1NSNL 1OALA 2F5AL 4XBEL 2EILB 1MFUA 2HSIA 2QMJA 3DTXA 5EOCH 2AK4A 5FDYA 3RUGB 3ZHDA 3UJTL 5DTFB 5I9QC 2AF2A 5CGTA 3BT2L 3HG5A 4XE5B 3QUXD 5KVDH 2GJ6A 5HDOA 3EH4B 3IF1B 4U0RB 5C6TL 5BVJA 1CT8A 4OI8A 3K8LA 1J7VR 1SDAB 2DWTA 3C9NB 4UNVA 1DJHA 3BFOA 3FSOA 1NOAA 3ARBB 1R0AH 3ZMRA 2WCGA 4MCYA 5CM1A 5G5DA 3VW3L 1IJ9A 5E99L 1BJ8A 4H20L 1SM3L 1MQ8A 1T2QH 3G04B 3GBMH 1GXEA 2EVJA 3H0TA 3LS4L 1OGTA 3PHOA 4FA7B 1ZHLB 3MLZH 4NZRH 1F5WA 2VDQB 4F7PA 1C12A 1CXFA 2FUTA 4YIQA 4EXKA 5GS0L 2DM2A 2Z7ZA 3FFOA 3H7BA 4JN2B 2VM9A 5I1CH 4HXAL 3MCKA 1LO4H 5DI8A 1QO3A 2UZPA 4FL4B 3WUWG 2LTQC 4HWBA 4TF4A 3CK0L 2YXVA 1HKFA 2DYPA 1CZ8L 3X3FL 3OHXB 5J6HA 1WBXB 4YZWA 1BVNT 1OSEA 1AHWC 3CX5K 3B9KA 3CHXA 1SY6L 1I53A 2AXGA 4UBDD 4YR6B 3QIBC 3QXDA 1HNGA 4UAHA 3IRPX 4PV9B 3FT0A 4U6VL 4XCFH 1DBAH 4P9HC 1BYPA 4DOHB 3GJFK 5HYJD 2NTFA 3K2KA 1CD9B 2EADA 1X5MA 1OW0C 1WCQA 1AR1C 3B7RL 3KPSA 3L5HA 2AGJH 4XCYA 2Q86A 5D7IA 5GS1A 1N8ZA 3L9EA 2R2BA 4PJGE 4XPFL 4FQHB 4TUJB 3TU6A 2W5PA 2D7PA 3PNWB 4N3UA 1HL5A 4L9LB 1BZDA 2KLSA 1FFNA 4JY4A 4YLBA 2MQ3A 5I6MA 1JHTA 3O9WC 1IIIA 2ZQKA 5AOIA 3PABA 3BDYH 1VEMA 4A55A 4YBLC 3TTSA 5AW6B 1SOXA 1URZA 3ME0B 3WXWH 1IL1B 4G9DA 1A4CA 2Z93B 1Z9PA 1S7UB 4IU2B 3L7FA 2D0HA 1C5CL 3RB5A 3T2NH 3MA9L 2DIEA 1CI3M 2XICA 4ZO9A 2QFRA 1WP6A 2HT2C 1QMUA 3ECBA 4M1DL 3WJJA 1D5IL 1T5WB 4LU5H 5IB5A 3ULSB 2QHLA 1WS8A 5IUSA 1O5PA 3Q0HA 2VDOL 3FFCE 3RVWC 5J8OA 2PYFB 3E3QE 4CSZA 1KF9B 3HRZA 1G4MA 1PVHA 3O2DH 4Y19A 3QA3A 5E2JA 4QYOA 2WZAA 4Q9BA 1OE1A 1CDCA 3U46A 2H7WA 4PJFF 2F6AA 4G80B 2IADA 5TFSH 4H26A 3N9GL 5AB9A 1CXKA 2F8OA 5DO2C 3EAKA 2G5UA 2QPFA 4PG9B 5IFJA 5G55A 4UTAA 4FQPA 4GFTB 4WEBL 3SDAA 1JWUB 3QJRB 4Y9GA 4MZIA 2V7NB 5HHPB 2WAHA 1NJ9B 1ONQB 4NWUH 1QSFB 2X4UA 4ICXA 4OGQC 2NOYA 3LPWA 3QK0A 4HWEL 4X4ZA 3HBPA 1I8LA 6PAZA 2UXGA 2OMVA 3DETC 3F2LA 3GSRA 3LQAL 4FZ8H 1VADB 1M9WA 3LNFA 3Q5TA 4XCNB 4XHQA 1MWAH 4Y4KC 3RUGE 4P4RA 2X2IA 5D5MF 3NJNA 4JFDA 4WJKB 4KTDH 4BKLA 3OJ2C 3MBXH 1LXMA 2KDGA 4EN3B 4JNXA 3CFCL 1JPEA 4P46B 2WGNB 1GC1C 2YA0A 5GISH 2SEBB 1JDAA 5I1AB 2NNAA 5FKPB 4BK4A 3BZ4B 4QHKJ 2KLRA 1JZEA 3NAAH 3DXAB 3HE6A 4PV1C 2VDML 1A6VL 3ELQA 1AFVH 3FTUA 4PJCA 2R0KH 4WHDA 4BGDA 2W65B 43C9B 1F3JA 3DSNB 4TUKH 3RPIA 5FUCE 4YDLB 3QORB 3SBRA 5I18H 2HLAA 3EUUA 4XN7A 3A21A 3KDMB 5DD6B 4HCRA 5E2WL 2F7QA 1CD1B 3TT3H 1ZHNB 1NBYB 2GSIA 4X8GA 2OFQA 2R83A 1N8OE 1UVQB 4NBYB 1WFTA 4NSKB 4NZUL 3QR0A 3QEGH 4WWNA 4O58L 5EPMB 2DQJL 2WXGA 3WO4B 1MHHB 1SLWA 2IOOA 3GMOB 5F7WC 4C83A 4JB9L 2J5WA 1JNLH 1FYTB 5FYKU 5E1IA 3DBXA 3P2DA 3ARYA 2FHCA 4RWHA 4ZUUB 3CMOH 2J21A 4LCWB 1JZDC 3N04A 4R96B 1KMGA 1PZSA 1GY2A 3ZDYE 2WMPA 3DPBA 4A6YH 3VQ2C 4DHLA 5I8OL 2M1KA 3T3MB 4TQHA 2E9WA 4U0QB 5DFTA 3K6OA 3VI3A 1UJ3A 4RH4A 1II4E 4LCUA 5F88A 1CQKA 4KO7A 3H7LA 1GHFL 2IFFH 1TZAA 1UT9A 5FW8A 4WO4C 4W9LC 4A7TA 4WJ5A 5DHEA 4EAEA 1ZOXA 1JZJA 4B9KC 1R24B 1FH2A 4M4RA 4X6DF 4OD1L 3UTSA 2IV8A 4IIQB 3G6JB 2NW3A 3UTPD 1M2OA 2DWEA 5F70A 5H37G 4IGBC 2UUDH 3PIQA 4XCEB 1XEUA 2IH9A 3FO0L 3I3DA 4Z5RB 3CN0A 4K7PL 4MQSB 1RP8A 4PGBA 4O5LL 4LP8A 4Y2OB 3RJOA 1G7MA 4H5SA 1RJCA 1T6BX 4BFOA 4XE0A 1MAML 3BWAB 2V9RA 1QFPA 4B27A 4OM1H 1UCBL 4XHJC 1AOZA 5F7YC 4Z3HA 2CLZA 4OI9A 2X5PA 3L4YA 1M7XA 2CUIA 4X9BA 3MLPA 4QTIL 3HG2A 4XO3A 1OAZH 4ZTPL 3ARVA 1GYVA 1OXYA 1QABA 1RZJH 5AVSB 3QRBA 1K72A 1S9YA 1KCKA 1JZGA 1BD2B 2HN7B 4K8RC 1GYCA 3WJLA 3QUML 5EULV 5FM4A 3ULUE 3K2MC 4IBZA 3GIZH 3GHBL 4G72B 4BZYA 3RIKA 1MIEL 4HG4K 1QSFE 1ZLUK 3BUIA 4XNUH 2E7BA 1N3NB 1V3MA 4LVOB 5JXAH 5D4IA 1BSIA 1SHWA 4NPYA 4MB1A 5TE4L 2BP5M 1CLZL 4TL5A 3RU8H 1E2WA 3HN3A 3M7OA 5AKRA 2VO5A 5I9QB 5E8NA 4F33A 4M5YL 4Y1SA 3IXTB 3UYPA 1FGNH 3RWDA 5TE7H 2X3BA 5CLWA 2AJ3B 1QLFA 1PZCA 5DWUL 4QRSA 4B41A 3GD1C 1E4KC 4KUZH 1ZV9A 1Z9SA 4QXUH 1NEZA 5EZOL 2O6PA 1ID5I 3DXAE 4HETA 4Y5XA 4WUUB 5FGRA 3FH8A 3IKKA 3PRZA 3WL9B 1UM5L 4G9FB 4LSVL 2VXSL 5C0BE 1R5VB 4FF9A 4X9HA 3KHOA 3I9PA 4MFHA 4BQ8A 1KBPA 4IS6A 3UJIL 1G6RH 2APFA 1MQKL 5ABZA 1OM9A 2UY6A 2YD0A 3SO3C 5F9WC 3ETBF 2CDEB 1XR8A 1UADC 3ZHNA 1LO2H 1NGXA 2LTQB 4EO5A 3VWKA 1A4JA 4HFWA 1U0QA 4GG6E 4A7GA 1IGTA 2XRAL 4U6YB 1OPGH 1FYTE 2XVKA 4RBPK 1FO0B 4AM0Q 1AHWB 5BJTA 3TYGH 1MPAL 2BIQA 3S35L 4APQA