3QORC

Crystal structure of human nuclear migration protein nudc
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
117
structure length
117
Chain Sequence
SKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIADGAVVTVHLEKINKMEWWSRLVSSDPEINTKKINPEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Features and Chaperone Activity of the NudC Protein Family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, cell cycle
molecule keywords Nuclear migration protein nudC
total genus 27
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qorC00
2CG9X 3GT6A 4ZJ9A 3L1GA 3VQMA 2WJ7A 3AACA 4YDZA 5DS2A 4YLCA 3Q9PA 2JKIS 2Y22A 4MJHA 4PBDA 1WFIA 3GLAA 4YL9A 4YE0A 3QORA 4ELDA 2MNWA 4JUTA 4I88A 3N3EA 2XCMC 3J07A 2RH0A 2KLRA 1SHSA 3L1EA 3QORD 4M5SA 2K8QA 3Q9QA 4RZKA 3VQLA 2O30A 2BOLA 3AABA 4JUSA 5DS1A 3QORC 1X5MA 3W1ZA 4FEIA 2KMWA 2WJ5A 2N3JA 4YLBA 2Y1YA 4PCKA 1EJFA 5LUMA 1WGVA 2N0KA 2Y1ZA 3L1FA 1RL1A 2CR0A 3QORB 3EUDA 1GMEA 3GUFA 4M5TA 3IGFA 1WH0A
chains in the Genus database with same CATH superfamily
4DKTA 5A2FA 1IQWL 4FQCL 1NWPA 4ZX3A 1FVCB 3P02A 4HP5A 3HR6A 2YA0A 4C57C 1RZGB 1ZJBA 1P6WA 4MAYD 3D2UA 3GHEL 4X9GA 2WC7A 5JDSB 3DETC 3SKMB 1S9YB 1U41A 4MTMA 2NPLX 5HPOA 2IGTA 2CM6A 3MCG1 2WXNA 4PJEE 1Z9OA 1Z5LA 5HGAB 2VXUH 3QJZA 4AITA 5MERA 1SBBA 2X9YA 3OX8B 4ENEC 1J1PL 4DEUA 5D7KE 4XTRC 3ME0A 4BRJA 1QASA 2RJMA 4GP4B 2LVEA 3MV11 3VW3H 4JDEB 4EI6A 1W15A 3L4TA 1S5HB 3VXUB 2PXYB 4YBQC 3SE8L 3EDKA 1CE6A 5EZJB 4AG4H 4KVNL 2YSSB 2BNQA 3O3EA 1P1ZB 1NFDA 5EEWA 5GZND 1E4WL 3QXAB 2COQA 1UXSA 1YN6A 3SDCB 1UKTA 5GRUH 1ZWIB 3C6LB 1XCXA 3DYPA 3SGEI 4YJZL 4UNVA 1PJWA 2VDPL 3B1TA 3AS2A 1RZJH 5I0XA 4PW9A 4ZFOL 1W9XA 4GQZA 3DPBB 3R7QA 1AQHA 4MJIE 1HCZA 3MA9H 2ZWKA 3FUDA 4ZW6A 5IQMA 4OR1A 3TJEL 3V55A 2R8SL 2I07B 3P11H 3SDXB 3OJVC 2BVPA 5FW8A 4LNRA 2WQSA 3NESA 2NZ9C 2LLLA 3DARA 5DFWH 3GRWL 5HGHB 1JZ5A 3MOBH 2DH3A 2APSA 3UTQB 3A6OA 3CHPA 2PPDA 4NOFA 3HG2A 5FF6A 1WO2A 2DBLL 2W95A 3O3BB 1OAYH 4K5OA 4WLCA 3DGCR 3KWTA 3GKWL 1M57B 1CFMA 5ITBH 1ZV5A 2XQBH 1PZDA 1OE2A 3JV6B 4ES9A 4DKAA 5D71H 4NZFA 1KPVA 4O58L 2ZX7A 5JPNA 4JGNA 3QNYB 5MI0C 1E50A 2CBTA 2OK0H 4IEFA 1A1MB 1DDHA 5HVWA 2H7WA 3O6FB 3L1OL 2X05A 2DYPA 3JWOC 1Y18A 3UJJL 2EDRA 4JN2A 4MBOA 4CGUB 4J3OH 5J57B 4OD1L 5IMMA 4NQVB 3W0WB 1S9WA 3ARFC 5EU3A 4PCYA 1SXCA 3SDAB 1MFDH 3HR5A 4Z23A 4HGMA 4NFCA 5I5RA 4GG6B 3X3GH 5AVTB 1RIVL 2NW2B 4ZFGH 1RZFL 2ZPKH 2F18A 3V5DA 1EH9A 4U1NA 5D1ZA 4K8RC 5C3LD 3H4FA 4AKOA 4F58H 1X7QB 4OUUB 4EIZC 4WKZA 3RWGB 2XT1B 4CL7A 2FR4A 3RBGA 5C0BB 5BOZG 4UM9D 4XP4L 2Z8SA 4D3CL 1D6EA 3FH8A 4PTTB 2FTAA 3MBWA 1U8HA 1KJVA 4JDTH 1TYRA 3AITA 3OQRA 3EH2A 5EDSA 2A6DA 2IH3A 4J7RA 4Y4KD 1H8NA 2XG4A 3RUGF 5C2BH 4Z7IA 1BBDH 2BVOA 3NGBB 3QB7C 4PJEF 2NXZD 5I1AA 2IH9A 1VFOA 3HS0C 3KLAA 1UA6L 4I77L 5CLTA 5D8JH 5C09E 5T5FH 2R1WA 2ZNXA 2FEEI 1JNHB 3FH7A 1QFOA 4OZIB 4UOQA 4XP9H 5BNXD 3MLTB 5CU5A 5EO9A 3W9DA 3WUZA 4N2DA 3NUKA 4WUKL 2BVEA 2OMNA 3S8WA 1QBLL 4W68A 5JIDA 5E7BA 5SV4A 2VDNH 1E9QB 4GRLD 3NSYA 2Q2EB 4NKIL 4ODBD 5TJWK 4I87A 4PRAA 3AG3B 3DMMA 4WHCA 5FYJD 5LAXB 2HJLB 1FBIL 3UGXA 3ETBJ 5EN3A 3HG5A 1TIUA 4B9KC 2VSCA 2P5WB 3IJ9A 1JPEA 4YGVA 3ZRSA 1N6VA 2YMXH 4EDXA 4DKFH 1BA9A 4KGLA 3BUYB 3J8F7 4AC4A 2VN7A 3BAJA 3F85A 4GQRA 4GMTH 3ARDA 4JO1H 1R4XA 1YUHA 3C5JB 3WMSA 5DDHB 5GXBB 2PPEA 2EC9U 1HZKA 4B5EA 1U8OA 1KGIA 4OZGB 3MA7A 2UV3A 1LD9B 1I1YA 4Y4FD 3PFUA 1SLWA 1LO5A 4JREC 1IGIL 3DPDA 4X98B 2KLSA 2OM5A 3Q1SH 1V7MH 4U6VH 4WEUD 2RIKA 3WIHA 2YEQA 5LCVH 3ZDZE 3BHBA 4P2QD 4PMFA 3QNYA 1A9VA 4ONOA 3SKNA 2E9GA 3TIEA 5I18L 4TULH 3GUTA 1E5BA 1KJ3L 4QHLB 3TPUB 3DI2B 4X7CC 1P84K 3C2AH 4XN1A 2EKJA 3G5ZA 1U91B 3TBSA 1W72A 4LIQH 1YMMD 2DQHL 3T1WA 2GJ6E 1ZVYA 4TUKH 3ZKMD 3HKZA 4MWFB 4MNGA 2F8VA 1G1KA 3BLBA 4MAYA 4Q6IB 4U3SB 3P4MB 2XNAA 1PQZB 3O4LE 4U3CA 3QR2A 5GGQH 1KXQE 4X6DA 2VMCA 4Y5XC 4IRSC 1FNGB 1EMTH 2I85A 2HX8A 3MJ9H 1KENH 4DP8X 1OIOA 3F8UB 4HVBA 5L2KB 3NQIA 3K6SA 4DJMA 3U6RB 1Z0NA 1GS7A 3H9SB 2P44B 3VFWA 1OALA 2AXWA 4FFVC 1D2PA 1E42A 4QLRA 4UBDC 2HMIC 2XY1A 2D3JA 3L2MA 2CGRL 2EADA 4OCWL 4BKLB 1BV8A 4LASH 1F1GA 5I6PA 2QHRL 3O11B 2GY7B 2VWEE 4V1DE 4AZUA 4M7ZC 4NO0B 4TVPE 1NEZG 4JPVL 3ZDYF 3VXMB 3BRDA 2XPGB 2A6KA 2CNZA 3NIGE 3Q2WA 4XBMA 5GGVH 5HHMB 5BVPH 3ULVC 4EQ3A 2NTFB 3MFGB 3MGTA 2F15A 2GW5A 4E9QA 2QSCH 3QWOA 2OMVB 1WIOA 2HFGL 3J27A 4L37B 1RZ7H 3RNQA 3IFLL 4M6MH 4Y16B 1AXIB 1NIDA 3BGAA 3OHMB 4Y5VA 5IB5B 1RUAL 3LKRB 3MXWH 1FYTB 1Q38A 5F2FA 5IJVB 3Q8EA 4LCYB 5KVGE 4S2SB 2KBGA 1KT2A 1MI5D 4GRWH 1IV8A 4X42A 2HFFB 1OAYL 3IETB 1U8JA 3QPQC 1KBGH 1PSKL 1N9PA 4HH9B 3EKCA 4MA7H 4DGIH 3LVTA 4XWGH 1F58H 1CI3M 1YQVL 1VJSA 1EAOA 4OQTA 1R5WA 5MHSD 4MJHA 1FO0H 1AGEB 1NAKL 1R5VB 5FGCE 5CD3B 4PIBA 2JFCA 1IU1A 1DBBL 2FSEB 2YD6A 3BQUB 2PR4L 4HS6A 1FNSH 4M1CD 4QRRA 5L9DH 3TBWA 2CUHA 2MKLC 1KLGA 1SJEA 3DTXB 3RP1A 4ZMPA 4WV1C 3C5SA 2QV2A 4U7KA 4CBZA 2LE9A 3RIFK 3VFRB 3ERXA 4QXWA 3FOMA 5F7DB 1RAMA 1N0XL 2FJFA 5KSUB 1MUJA 1WAAA 4ABQA 1KTLB 3TO4A 1L0YA 1SHWA 1CICA 1NA8A 3HG1E 3L3OB 4XNYL 1FDLH 2CLRB 1VRSA 4B5ZA 5BPPA 1P9MC 4FQ1L 4AW7A 5LXGH 2YAMA 4S1QH 1WGOA 1VFBA 5DJ2B 2Q3ZA 4A2HA 4G83A 4YHIB 3P0GB 2BOLA 1MCPH 2W92A 4ODWA 2F53B 1DEEA 1I1RA 3BP7A 1OLZA 3F05A 4ELME 1DBJL 2EUXA 3WI9A 2Z4TA 1KOAA 4PRBA 1ECYA 2WK2A 3ULUL 3CLFH 4GXVL 4JVUA 1XZ0A 2C1OB 2PMZA 1SM3L 4YL4A 3SYQA 2CM5A 2OCJA 4IKKA 3V4PH 3KS0J 1DQJB 3B2XA 3FCTB 4LOFA 5IBUB 5TDOB 3SCMD 1NCCH 4RETB 3VWKB 4X5LA 2HP4A 2YGOA 3QZLA 3SDDD 1UZ8B 3D87B 2WNGA 3ZDYE 3L17A 5CBEB 2XN9D 3GINA 5D5MA 2VC2L 2E8ZA 4OBSA 4LLWB 3PRZA 4YSPA 1CE1L 3VFTB 4IMLB 4QTHA 3QK0A 1I8IA 3V52H 4EDWH 1FCCA 3NOIA 3KAAA 4Y5YB 1O9WA 5IBTL 3ARSA 3U2IA 4D7BA 2K8MA 4MNHA 1T1XA 4L4TA 4YXLH 3IFPA 2EXYC 2F6AA 2GTZA 3QEQA 4P9HC 2DMGA 4HWBH 4M1GH 3F7KA 2WLZA 2HH0L 2W0PA 5SWSD 2YA1A 3RVTC 5DMYA 1OF2B 3Q7JA 2WOBA 1VCBC 5DWPA 3WFZA 2F7OA 3VXMA 1OKEA 5ESQA 4NC1E 1P7BA 3QEHA 2OZ4H 3NZSA 1SJVA 1RL1A 2VJ8A 3N50A 4NPYB 2H1PH 3PHOA 5JHDD 1J9RA 2IVFC 5KTEL 3JBG7 3P4MA 2AKRA 3WNJA 2CDFA 3V8CA 2QL1A 2UVEA 4XX1E 2JH2A 4FG6D 4Q6KA 2JB6A 1TZ8A 3WAJA 4LKCA 2C3VA 4OTXL 4MA1B 3SCMA 5IJKC 1EVTC 1QNIA 4JQIH 2J6EA 2CK0H 4QUOA 4BK8A 4L18A 1IAMA 4ZFGL 3QIBC 3O2DA 1VSCA 5KSAD 3QR1A 1FGNL 4MXQD 1EO8L 1FGNH 4PJFB 3OKLA 1ADWA 3S2AA 4UOJA 3DHMA 4V33A 1BYPA 3OAYK 1I1AD 2OULB 3UPAA 3OKDA 1HHKA 4M61A 2X4RA 4TNFA 1HAUA 4XBGA 5F8RC 3TH4T 4G8EB 1CDHA 4NS0A 5H2BB 1UGNA 5ICUA 4U1GC 2I27N 5MHSE 2M8XA 4Z7QE 4DZBB 3UYOD 1JF6A 1LO2L 4GQPH 1XB3A 1A9BA 1RZPA 1OZTG 3CC5B 4P07A 3U9WA 1I1FA 1WEJH 1ROCA 3PAVA 3NIFE 4GMSH 1MCQA 1CIDA 3I2CL 1VGKA 4K2UL 4B9PA 4Y4HB 4UNTA 5T5NG 3BPNC 1NH6A 3D18A 3H1ZA 3QW9A 4IIQA 2ED7A 2R0LH 1CT8B 3QDMB 2VR6A 2HX9A 3OC8A 1GOFA 4XE5B 5LAXA 1D9KA 1M71A 3CN2A 4WFHE 2DQDL 3BX7C 3E3QE 3WXWL 4KQ4L 2QZ5A 2IH1B 2O26U 4R3SA 4M1GL 2WY3B 2GG1A 4JRYA 5KYUA 5DHYA 1KGXA 2W9DH 5HDQH 4PJIE 3MA9L 5AVQB 4ALAC 4UUJB 1IGML 4L1DA 1WH0A 2ATAA 3JWOL 1A4KA 1Q72H 3SCMC 2GYSA 3GSRA 3OKNB 2QPEB 3HC3L 1XR9A 3HZVB 4DHLA 3CFJB 3PG2A 3MFFB 4B0MM 2ORBH 3N85L 3C6SA 1AGBA 4PJ5E 4E9LA 2IOMA 3DX7A 4LSSH 4AM0B 3LZRA 5D6CA 4H8WC 3UTSA 3WE6A 1BBJA 4PJAF 1CD8A 1M7XA 2UXTA 2UZYA 1Z9NA 1ZVSA 3S9DB 3K6DA 1Z3GL 4PTUB 5C0IA 4OLWL 1MHHA 4KV5F 2IQ9H 3AQDA 4GRLC 4H25A 3LZFL 2QTEA 4Y1AD 2NY2C 2VLKB 2JF1A 4LSRH 4YH6A 1IFHH 3RIAF 3ETBF 1EHLL 4G70B 4KC3B 1A6ZB 5H35B 1DVYA 5GS3A 4N87A 4Z7VE 3VH8B 2EXTA 3ESVF 3FFDB 1IGTA 4BDVB 3OWEA 1BXAA 4BZ2H 1BF5A 4WHTB 5DR5H 1L9TA 3X3FL 3QQXA 1J1XL 3A6BL 2LQRA 1AQDA 1GXEA 4JFZL 1J9SA 1DUZA 1JWUB 2WWMC 1DBMH 2F74B 2UUDK 3KYKH 1NDMA 4R7DA 4MXWL 1BQUA 3O2VH 3V4UL 3O45B 1YEDA 1YEDB 3GIVA 4GB9A 3ZT6A 3NZHL 3OHXA 4LEOB 4J12A 4XO9A 5H37G 3SGKC 4M4RA 1NGQH 4PRPA 1NGXB 4KO5A 2EH8H 4CMHC 3CFQA 1E9PA 1ASPA 1RPQA 3HNVL 4JRFA 3ZTDC 2WXOA 5CCJA 5E94A 4C56D 1WZMA 4YX2H 3Q0HA 4TV3A 3WLBB 1AGDB 4HCGA 2OXHB 3QHFH 1E0OB 5AW0B 5LDSA 4Y0GA 5FB8A 4U0QB 2J8HA 5KS9F 3OX8A 5HXMA 3QXUA 4L23A 2HN7B 1JHTA 2HJFB 1YYML 1JHTB 4F1ZA 1T4KA 2RCSL 1A6AA 1JWMA 3PWJA 2YOAA 4FLOA 2VR4A 3PFQA 5GGSA 5HYJA 3SDDA 3AGWA 1GGCH 1OT4A 2HUEA 4ANWA 2PF6A 1Y0LB 4Y88A 5MEQA 1TZHB 3ECBA 3R19A 5B39B 2CIIB 4Y1AB 2C3VB 3FQXA 4AGQA 3QDMD 3WFBH 2FJHB 4M8VA 4ZO7A 4WV1A 1I1YB 2R0WH 2ENPA 1LNUB 3SGDH 2GJZB 4BINA 4P2OC 4RIRA 2CRYA 3RKDC 2D0HA 3SPGA 5LBGA 1M4KA 3RL2B 2YPVL 4EN3B 3CSTA 3MI6A 3N0AA 1DR9A 5DMJB 3KLHC 4QRRE 3BE1H 5D7JB 3OKMA 4HLZG 5HHNA 1U93A 4PJIF 2VDLH 3AABA 4X8JB 3WO4C 2P1YA 2V33A 4IK7A 2FWSA 3DXAA 3V0FA 1A4KB 4K94L 3REVB 2R0ZL 4AKQA 1YJDL 1OT1A 2ZP0T 4GIAA 1PZ3A 2LFGA 4TVSa 2DV6A 1K5WA 1I7RA 1YAZA 2JI2A 1CL7I 5BJTA 1BFOB 3PGDA 5IGXH 4JQXA 5B1CA 2J25A 4BQ6A 5MEOB 2EE6A 3I9AA 4E9VA 3T6VA 3CMOL 2F58H 1VKXA 4HMCA 1R5IB 2GIYA 4G9FB 4YAQA 3KCPB 2WXIA 2WXKA 1GIGL 3EW3B 3CK0H 2X2IA 4ORGB 4QGYA 1ZGLA 5CGYC 4NX0A 3GSNH 5FYLL 4CNIB 2VSDA 5T3XL 5DC0A 2PYFA 5EEXA 3CDZA 2DEXX 2UXGA 4QXUL 2P8MA 5IMKA 2Y07L 3A4AA 1S7UA 5C08D 5IM7A 3QZWA 2ESVE 5LCVL 5K1JA 3BWUF 1IFRA 2J1ZA 1JMZA 2NYYD 1RZGA 2VOTA 4IHBA 1JDCA 5DEZA 2XG4B 1H0DA 1T3FB 3UAJA 5KYNA 1MCIA 3BP5B 5DFVC 5EBMB 5HVHC 4TL5A 3UO1H 4NSKB 4PGDB 1BM7A 2IPKB 2DICA 2DIJA 4N2EA 1XR9B 1TT6A 3FT2B 1FZKB 3WOVA 2JXMB 1IGFL 5I6OA 4ZBJA 2VW7A 3MVSA 1BJMA 3UBHA 4YDMA 3ZHKA 5FW7A 5CJXC 2IWGA 3A3YB 2WMPB 2ZUXA 2CNYA 1AVAA 1RK7A 2H8PA 5EN2B 4ZK8A 3ZOAA 1WZKA 4ONGH 4XH2B 3F6JA 1G87A 3KDMB 1A3RH 1UZGA 2EDMA 1J0KA 1IB5A 1RXLA 5FO7A 5L2JA 4PGCA 1DJXA 3TT1H 2HG5A 3HUJE 4KXBA 2XN9B 5GGTA 3OJDA 2ZJSL 4BK5C 3UZVA 4Z7NB 2H47C 4XB7A 3BPLC 5HYSB 4X6DE 4ZO6A 4ILDA 4U1JA 4HS6B 4BXSV 1MFMA 3BGFC 3V6ZB 3QIWB 5CGYD 5ITBL 5HVFB 4HF5H 1WFTA 5FXCH 5JHDB 2YFOA 3H2QA 4F57L 3DVGB 1UC6A 1HH9B 3ZR6A 1A0QH 1OLLA 1WTGT 2N4IA 2NOYA 3INOA 1FG2A 2GJ6B 3S4SG 1UA6H 4DGYH 4YQXL 4PJ9B 1Q0YH 3BZ4B 2CGYA 5DQDH 1C16A 4HKBB 5I8CA 1HL4A 3AZUA 3RZCB 1XF4B 3TZVB 1QNZL 2IAMC 3RDJA 2R23B 3HEIB 3TO4D 1AZNA 3NA4A 2WO3B 2AQRA 2HFEA 4WUUB 3U9PL 1NCWH 4I5BA 4QOKA 5FAAA 1IAIH 3BVVA 3HRZA 1D6VL 1GC1C 1KIQA 3DYMA 5D7JA 5FUOH 5C0CE 2X4OA 1MQ8A 2DI7A 1QW9A 4JPSA 2D0FA 4E68A 3GZQA 1EXHA 2BNQE 1MI5B 4JO8A 4LFHG 3BSZL 4XMLH 5BV7L 4PJHF 1KYAA 1P4IL 4JPIA 4K9JA 4KROB 4MXQC 1P1VA 3HC0A 3MRHB 4JN2B 4GKSB 2Q0ZX 5AVVB 1FNAA 1SUJA 4K4KA 3PV7A 3QCVH 3UEZA 4FLRA 4Z7UB 2AJYL 1IC4H 2E9WA 2IIJA 4LSPL 4YSQA 3PNWA 3TV3H 3KYMA 1GRWA 4UIMA 1E90A 2ZUUA 2O6FA 3A6CL 4MQ7A 2AQPA 1N18A 3CVDA 4RFNB 3BDBA 1J0ZA 5B1JA 4R4FL 3LN4A 3PGFH 1N0LB 4NHUB 1N5AA 1DN0B 3CAFA 1U8QA 3CFNA 3IAPA 2ZYRA 3LEVL 2BP3A 4Z7NE 1R3HA 2OSLB 3BJLA 3TNNB 5BXFA 4X4XB 4JFEA 1PY9A 4BSVA 2JJTA 2N0KA 2XTJD 2Y7LA 4Z7OF 2GTZB 4OZGF 4YZFE 3TVMB 2G3ZA 2DYRB 3S3BB 4M1DL 1OGSA 4WAFA 3L1GA 4KXAA 1MCDA 1PU0A 4QGTA 5FK9B 1G7JB 4ETQB 3GMQB 2NW3B 4WO0A 5D2NA 4ZOBA 1ITCA 4DPBX 1NZRA 1L9PA 1V10A 4UQDA 4JFYA 3IJSB 4PREB 3VXMD 5DZNA 1XF2A 4Q9QH 1PEZA 2F74A 5C71A 1K72A 4HT1H 4WO4B 3BXNB 3PY9A 5IW6A 2DQMA 2D7OA 4G8GE 4QF1A 5IMOB 2Y06H 4GBXB 5LBSH 3VXQB 3FFDA 2F19H 4PJBB 3APNA 4PN6A 1P53A 1T6BX 2Y3AA 4LHUD 4TTGA 2ZUQC 3WEOA 3EGSA 3VQ1C 4JM2C 4S1SH 1ACYH 1P4BH 1FL6B 3MCLL 4I3SL 3VFGL 3I02B 1VF5C 2YUWA 4H0HB 4N8PA 2APFA 2Z9TA 3ZDXE 3ROLB 3CDZB 2NSMA 3FQUB 3FS9A 3BH9A 4CMHB 5JO5A 2G75A 2WBKA 1QABA 3DUHA 1S7VB 1I9JL 5I1EL 2B9BA 3EOAB 1JPSL 4XI5C 3EADA 4ES8A 1XV8A 4ZW3A 3IGUA 1SJEB 1S5IL 4GG6E 5I1JH 3AT9A 1AHMA 4X6DF 5ADPL 5F7AA 4CN1A 5IVOA 3V9EA 5CN3A 2A9ML 5EUOE 1TYJA 3WY1A 4DFIA 4ELDA 4JS7A 4FQXA 3PDGA 4PJDE 5JORB 1FSKB 4U1MA 4ZUUA 1KB5B 3INUL 1U8JB 2YLHA 4YHNB 4NQED 2Y5TA 4LLUA 3MV7D 4K5MA 1UJ3C 4CADA 5SX4H 3B9KB 4X6FA 2QVFB 4DP1X 3IF1A 4DUWA 2BSEA 1XF5B 1BAFL 3OKMB 3QJTB 4HK3N 1QKZH 1XH1A 1OGAB 2HRHA 3OMNB 2UY6B 3BKYL 4OLXH 3U0PA 3BH4A 1FVDA 3REWB 2WBWB 4FC3E 3TA3C 1YC7A 5D4JA 5K59F 3TOPA 1OTSC 4L4JA 3PXLA 2DL9A 4W9EC 1ICTA 1CL7L 4JL1A 3ZMRA 1W0YT 2WINA 4PCSA 3V4PB 5BRZD 4PHZA 1Z0MA 2KQNA 4FXGB 4G6ML 3DUSB 5CLYA 5DUBA 5HYJE 4IBYA 2QDWA 3M6DA 1HOEA 1T2XA 3FF8A 2ALAA 1W72H 2QMJA 3MRDB 4JKPL 4WRLA 2FJGA 3U4EB 3UBGA 5B3NA 1QFWL 4E41B 3QS3A 1ZGLB 3C08L 3GSXB 4G80B 4AL8H 1NPJA 3SDAD 4PRIB 1J9CT 5L2KA 2A77H 3B7SA 4LP8A 1QI4A 2YIHA 1WA0X 4QRTB 1O7SA 3SGEH 2CBOA 2R4SL 3NFSL 3NG5A 4OD2B 2OMWA 3OSVA 4H8QA 4X8CA 2YKLH 4R8WH 1HKLL 3DROB 3IN0A 1QKZL 4WWKB 1G1CA 2ZWNA 5I30H 1HNYA 1KPUB 1I7RB 1U21A 5DUPL 3ASWA 2FATH 3K81A 4S1RL 4XNQA 4MX7A 3S5LG 2KUTA 4PGBB 4N9OB 1MNNA 5T3ZE 3VFVB 4N22A 3QQ9D 2VN3A 5BQDA 4AYFA 1H5BA 2WKOF 4NKMA 1H5BB 4C47A 2Q86B 3D48R 3P2DA 4KDWA 3BAEL 4YDJA 1NANH 1D9KC 5HHXL 2PKDA 1GCYA 2Z8RA 4N2CA 4ABUA 2CR3A 3BN9D 5KVDH 3CDCA 4AE1A 5CR1A 4Q2ZB 1RPKA 3QUXC 2RQ8A 4L8BB 1PS3A 2YRBA 4WTQA 1AGDA 1EXUB 1X5JA 4FQIL 3W0WE 4XWOC 4JY6A 4TSAH 4R4BA 2NY1B 1BD2D 4OM1H 3N85H 1U8KA 4HGWA 1HSBA 1BQHG 3H4HA 2XICA 4LL4A 3E6HB 2GHWB 3QJRB 4I48B 1NBYA 3NCCB 4NAJA 1HINH 1IBHA 4ZFOB 1V05A 1G9EA 2OXGB 5L0QC 4NUJB 3VM7A 1MCNA 3WFDH 1URZA 3QFJE 4AVHA 4GG6F 3PV6A 5AAMA 3QUKA 2YD5A 2YPLD 2X4PB 5E6SB 2HKFH 2HKHL 3CXDL 3II3A 4U0RB 1CYWA 3FTVA 2VLJB 4F9PA 2CJTA 4LZKA 2FUQA 2YC1A 4XWOD 4AV0A 1AQDB 4KTGA 3P2BA 5IHLB 3P3SA 3G5XB 2IQAB 2WD0A 3ARFA 2IPTL 5EWIL 4EZKA 5GS0L 1MUJB 3NDYE 2R56H 4JVWA 4OB5H 1RZ8B 1K9TA 2GB2A 1HJBC 5IJKA 3GIVB 2FD6L 4HWZA 3QJOA 4XE0A 3B9KA 1QP1A 1WEJL 3NZUA 1BG9A 2WWKO 4XMPH 3TEWA 1QSEB 3AXIA 3OXSB 3I6KB 4I0PB 3BP6B 3OPZH 3WIHL 1CB4A 3H9HA 1J87A 1EV2E 5DQJB 3X2QB 5D1QD 4B9IA 4POUB 1ZRUA 4FKHA 3M1BB 2NX5D 3QJUB 4FG6C 3K8MA 2BZCA 3AXLB 2J1XA 2K3HA 4LQ1A 3LKSA 4PB9L 4A6YH 5C0AD 2ADYA 3WHXA 1UWYA 1VZGA 2WCPA 1JVKA 1BPVA 3MREA 3CX5K 1P7HL 3ZZLA 4AMKH 2KZWA 5EZLA 2Q8AL 3BDYL 2D73A 1NLBL 2P5EE 4Z7OE 1IT9L 3FU7A 4XODA 1ZHNA 4PEEA 4O2EB 4O2EA 4TXVB 4LHJB 1UEYA 4FNQA 3QCVL 2GITB 1HFUA 2NNCA 3HZKA 1R0AH 2AQ2A 1YVLA 3QI9C 4W6XB 2NR6D 3QPXH 2CG9X 3ARED 3PJLA 2CO2A 5KOVC 3MJ8B 4G43B 1G0YR 3O4LB 2IH1A 4P5TD 4XRCB 4XPAH 3ZYIA 3S3JA 3AREB 4K71C 5FUOL 3CFEA 4QXTB 3HNTH 4M1CC 3BSHA 5AOMA 3VVWA 5GS1A 3BPCB 3FOLB 3NFSH 4NCC2 4G42A 4WKZB 3RWGA 2XXMB 3BP5A 5EBMA 3TYGL 2WNKA 5K39B 4PJ8A 4NQDA 1DBKL 3KWWA 3FFCE 4FNPA 3GMLA 5DMIH 2XFXA 5EIQA 5ESVA 3RURA 3V5DB 3WNOA 5CBAA 1DQQB 5CSZA 4HUVB 5K9KB 2E7CA 2N59A 3M46A 3US9A 3WEXB 1JZ7A 2ENYA 5TF0A 5FFOA 1UXSB 3FQRA 1U4EA 2AXGB 5JLZA 2A0LC 4M7JH 1MHCB 1A3QA 1ID5I 1BVNP 1U8IB 3S34H 4LCWB 3SODB 1K3ZA 4MNGE 3BYTA 4R4BB 1C1EL 3V52L 2DWDB 1I9RH 5C0JB 3LN4B 1KCSH 2B2XH 2PO6A 4MCNA 3WNPA 2XN2A 1PZSA 1O6SB 3EFOA 3G6JB 4IRJA 4PJBA 2EKSB 3ME0B 4JM2B 5CZRA 4JPQA 4MD0B 4OFVA 6PAZA 3GRWA 3U2SB 4MDIA 3BKJL 5ELIA 2PABA 4HKZB 4HYTB 2EEDA 4UU9B 1RKRA 3RGHA 2E6PA 3GLEA 2A83A 1B0RB 2Y7OA 4M7LL 2VDQB 3DHJA 5B1AB 1IEAA 1M53A 4X0NA 3ORJA 5C07E 3RGVD 4YNYA 4CSPA 1DFXA 3S35L 3NJNA 3NACH 3EUUA 2GEQA 3PWUB 4HIIB 4Q52A 1AD0B 2UXVA 4KI5F 1NLDH 1AD0A 2YAPA 3KPTA 5GSVA 5GSVB 2EINB 3LHPH 3U0WL 1DTUA 5IOPB 3QYMA 2H6PB 3QRGL 2I07A 4NJ9H 5DRZB 2BXYA 5HJGA 5ADPH 2HFEB 2HLFD 5DTFA 4NT6A 4I5BB 4XPTH 4FA7B 3S37H 3MLXH 1YNTA 3SKOA 1FUNA 3TIDA 3OLGA 1L3NA 2DQEL 1C5DA 4QRQB 4XNYH 3RDTB 4JHVA 3VXOA 4DQAA 4PP1D 1KB5A 4J23A 1FRGL 3KXFA 4K3JH 3IJ8A 4I0PD 1RJYB 2VQUA 5IR1B 1GKEA 3TH2T 1H3UA 4GXFA 3N43B 3LH2H 2GUOB 4BWUA 2P8PB 5D5ME 4ELMB 1MCOH 2WINB 1TETH 2KZKA 2ZXAA 4PLKD 1PBYA 4EN2A 1MI5A 1QPKA 4P57A 2X3AA 2G5UA 1PDKB 1X6NA 2CO6A 4FQQB 1DQDH 1NAKH 1CXIA 4ZOEA 3S0PA 4HOZA 1EX0A 3F5WA 1TG8A 3RWCA 1RPUA 1E4JA 1ZGLP 2FJFB 5JPNC 1FRGH 4K3JL 4OF3A 5C0RH 2QQLL 2OMZB 3RJOA 3DUUA 3JWDH 3BEWA 3FB7B 4L3EA 2KZ1B 2UX7A 4MD5A 4C55A 5KSAA 4LBEA 3KMDA 4WI7A 3KR3L 3RVVD 1BGXL 2V9RA 4IRSA 2YWZA 3TTSA 1WTLA 5DFTA 1YN7A 3O4OB 2BVUA 1J5OL 3BESR 4EUPA 4HOXA 5EEZA 4OLUH 2EICA 3MLWL 4F9LA 4GBXA 1GGUA 4XNXL 3L7FA 1DQIA 1T7YA 5F6HI 4MAYC 5A6MA 3EYSH 4F92B 1RI8A 2OYMA 4FG0A 2K45A 1OHQA 4M93B 2X44D 4NP4H 4NO5A 4GW4A 4TVPL 5JDJA 5EFIA 4DEWA 1IJNA 1G6RA 2BNRB 2WNWA 4F5CA 3IJSA 4JY5H 4MCYA 4DK3A 1LYQA 1IAIM 1MLCB 5F3HA 1DBAH 1KTDA 1ZA6B 3QULA 5DO8A 1D2OA 3D2UD 3GZPA 4GXUM 5CHNA 5HTSA 5BQ7A 4LEXL 3HKFA 4UDTB 2OSXA 3QUZB 4LSPH 1ED3A 1S7SA 5I6NA 4N0YH 4HWBA 3FU7B 1UM6L 2KPNA 4M7KH 3S37X 5IOKA 1OSZA 5KVEL 1R3IL 1UG9A 1S8DA 3QIBB 3A4DA 1NINA 1WT5C 1SJXA 2NTFA 1E8WA 2CDEA 4I18C 1FL6A 3QR0A 4J2QA 1DCEA 2VRKA 3EOYG 4XVJL 4YZWA 1KIRB 5FS5A 3FFCD 1KIRA 1QEXA 2PPCA 5BUPA 2GAZB 3NIGB 3VDBA 4L3CB 4TSBL 5DD5L 1KCLA 3UGUA 3LXUX 5AZUA 3B9KD 4K9EL 3GXIA 4F5CE 2YRZA 4JFVA 5GJTL 3T3PF 4E9TA 3UTTE 1U3HC 2ZG1A 3O0RH 3WFCH 3KNBB 2IPUK 4L4TE 4P46D 2DJUA 5J9PA 3QZOA 1AQKH 1MH5B 2HKAA 3FU9A 3N9GL 1DBKH 1TQCC 3DIDA 4LAQL 4IBTA 4LAQH 3V7MA 4KKNA 1U6AH 2UX6A 2AQQA 2NZIA 2RR3A 3Q2LA 2H0EA 5GIRA 2OYLA 4D0BA 1JZDC 4YFLI 4JG0L 2X1PA 1IKOP 5D70L 1OGAD 5IMOA 1M7DA 3DMMC 4FQXD 3ZO0A 1BFSA 4DPAX 5AFAA 3N41F 1JFQL 3E80A 4LNRB 4MMXC 5EU4B 2MOVA 4OZFG 1TO4A 1NQBA 1SN0A 3EO0B 5D93C 1WFNA 3WE1A 2CIIA 4Y1AA 1E6JH 1NCBL 1X9LA 2WVUA 3GI9L 2HT2D 4DOHB 4CW1B 4PB0L 3QGVA 1ETZB 4F1SA 2ARWA 4I88A 1BOGA 3B6SA 3B6SB 1ZHLB 4JFTA 5D1QE 1GGIH 2BSSA 5AZEL 3C9NB 3RWFB 1OCRB 4DKFL 1OCOB 3ARUA 1F6FB 1YPZB 2W91A 4MNQA 4QRTA 4RDQF 5I0VA 4HLJA 3EYVB 3L2NA 4JY5L 2H45A 5HGHA 1U58A 3BLKA 4A2GA 3HJ0A 4PLKC 2DWEB 3TC9A 1P0SE 3CFDB 2BOCA 5K1NA 1QWUA 2QGDA 3UBXI 4EMZA 1A47A 2CUAA 4QRSA 5AVYB 1KCRH 1QBBA 1WF5A 3RZWA 3X1EA 1QBLH 4ALAL 3WV0A 4EBQH 4MJ6A 2Q86A 2YK1H 4MJ4A 2JI1A 3MLVH 5FFLA 4QTHB 3WLWC 4XNQB 4M3HA 1CLZH 2Q5BA 4G6FD 3T2OA 3FO0H 3MNZA 1R9FA 1NPUA 4AIZB 4MXVE 2XWBA 4PJ5B 2OSLA 3N41B 3M88A 4V1DA 4WEEA 3ZIYA 2HLFC 2KLTA 3AXHA 3L4CA 4G43A 4JM4H 4GINA 2Y23A 3GSNL 4PWGA 4WUUD 4LF3A 1AHWA 2V3EA 1ZSDB 5DA4A 5ID1B 4B0MB 1RZIA 1A6TB 1H9DA 4MS6A 4PS7A 3ZUCA 4MJIB 1BF2A 2EECA 2EIBA 5J3HC 5A2JH 3T4AB 1CLVA 2J56A 3LH2L 2WBJC 4AM0A 2DMBA 1BQLL 5IVXB 4P9HL 3W5MA 1IUZA 4QDGA 3FSZA 2YN3A 4QWWC 4YHOH 3BD5A 4KTDL 5DQ9B 5K9KA 2WKGA 3B9EA 2OYKA 3HLAA 1X9QA 1DSFL 3HZMB 3PL6D 2R2BB 3MUGA 1XGPB 1SF3A 1RH8A 1NIBA 2GAZA 1TTUA 1JI2A 2C3XA 1MW3A 1RZFH 2FGWH 4YBHA 4K7FA 2UZYB 4CKVX 1MJJA 5DRNA 1T21A 2E5EA 2YQGA 2CHXA 4XNMA 5D6DA 8CGTA 4ZUSB 3TO4B 3QO0A 3MLWH 1R34A 2OBGA 5CEZH 1KJ2L 3L7FB 4LE8A 1L6PA 4FXKB 2BMKB 4P3CL 4W9KC 4JRXB 3TWCH 3HE6A 5KW9H 2G3NA 4FTVE 5C0BE 5T1LA 3C8KB 5FKAA 5JXED 3EGXB 2OTPA 4H88H 4TQPA 3ARBA 4K3HA 3ML8A 3GHBL 3VUAA 4ANXA 4RX4A 3O41A 4FD0A 2Z35A 3MX0B 2YD8A 1QR4A 4XXWC 2F7QA 5IK3A 4F27A 3N1PC 1ADQL 4PJFE 3WMQA 3QYNA 1N19A 4EJ1C 4EN3C 1GTNA 3E9TA 4XCYA 4U6XA 3WS3B 4TUJA 5I5IA 3MRKB 1R24A 5KS9E 3QFDA 2C5DC 3WO4B 4IOIB 3IN2A 4MMZC 3AM8C 1JTTA 3VVVA 2E7LA 5TQ0L 3CJJA 3MUJA 1KELH 2G75B 3PP4L 4FNRA 4ZFOA 1JNLH 1AD9A 1Q8MA 2AI0L 3NCBB 2K78A 3BP6A 3GS7A 3BUDA 4DZBA 4L05A 5T1JA 1MJ7H 3MREB 5D7LD 3DOSB 4RBPH 1RCYA 1TVHA 2C34A 4WEMB 5CLZA 3BGMB 1IE4A 2X4RB 2I9TB 5T3XE 1GA2A 5E9DE 4ZXBA 2ZKXA 2GSIB 2ZCHL 3ZHDA 4HXBL 1UWGH 4P4KC 4JZJA 2WZ5A 5HP5A 2VR8A 1PQZA 4TUUA 5GSRB 4OM0H 3VYOA 4HWEL 2YZ8A 5T1LD 5AOZA 5D7IA 2VISB 1FNFA 4JKMA 2PUQT 3N04A 4WW1A 4I89A 5INDA 3UTZB 5J1SC 3DRTA 5PCYA 1CGUA 4U1NB 3MNVB 3TO2A 5E4IA 5KYYA 5IESL 2GQHA 4L3EE 2GBAA 4RX4D 4GI8A 1QVOB 5DJZA 2G2RB 4NN7B 3DUUB 1FQ9C 4OM0L 4NQXB 3GTNA 1B3JA 4P2CG 5EO0A 3TJHD 3TWYA 1YMHB 1YEGL 4BSVB 3RWCB 1FIGH 2VDML 4DOHE 3MRRA 3MMEA 3SJVD 4JDVA 2KERA 3MCKA 4M93C 5LN4A 4CKQA 1KCSL 2B2XL 5F70A 4NRZA 5HY9A 5EF2A 5BO1L 4MA3B 2FX9H 1ZLSL 4NO0A 3VXUE 3EXJA 2Q8BL 5C08B 4PRPD 1JUFB 3QRLA 4D8OA 2R2HB 5F9OL 1CC3A 4U1LB 3IRZA 3U4EA 5AQ0A 5FYKH 2VXQA 4GRMB 5JPMA 1ZLUH 2IDCA 5JPMB 3ZPDA 3G5YA 4HIQA 4AT6B 4JFFD 1C8PA 2WP3T 1BZ9A 1BX2A 3FB5B 5CJ8A 1NBZA 5D7JD 4P3DA 1OSPL 1T1XB 4L4TB 1ZVSB 5CSBA 2BH0A 3UTTB 3RPKA 4U1HA 4JO4H 3SJVE 5B7EA 3NFPA 3LY6A 3BPCA 3FOLA 1UD2A 2H26A 1WCBA 3KS0H 1F4YH 3LKPB 3MV8E 4M4RB 1PNDA 4Z8FH 3F3HA 4N2GA 4DEPB 1RD6A 2IADB 5GIRB 5CBAB 1EAPA 3CU7A 1QACA 5AENA 3HI6L 4EDXB 1QLEB 4K07A 4NNXB 4M1DH 4OCNC 5E0FA 3RDTD 3B2DC 1OSPH 1KCRL 1ZV2A 3QRBA 5A3ID 1AKPA 1P2CB 2WSKA 4YO0A 3FU6A 2DWSA 1OAXL 3DVFA 5ISZE 1UA7A 4JO3H 1CGYA 1W2KT 5GISH 4FTDA 1CXLA 2P47B 2E6QA 4TQHA 4M5ZL 1DL7H 2WLIA 1JP5A 3E38A 1IEBA 1JHLH 1QQDA 1A1OB 4G7SB 1SMAA 1TTAA 4NN6C 1MCLA 3CHSA 2CIKB 4L2LA 2I26N 3IVKA 1GGIL 4YHYB 1FIGL 2VDMH 1RUQL 2OI9B 4G82A 1NBCA 1H19A 1QHOA 4GPVA 2MPVA 3LZOA 1PF3A 2JJTC 1R3KA 2FEDC 2YUZA 2RAMA 4GS7C 1CYGA 3GM8A 4Y9GA 3TONA 4OJDH 2CSPA 2C1OA 3C8KA 5D2LE 3RIFF 3DDFA 1YNKL 43C9B 2PW1B 2YPKA 3P77B 4J4PD 1T1WB 1WICA 1G6VK 4RFNC 4K7PL 3RVWC 5DVOA 3QQ3A 4JZJB 4Z3GA 1E27B 3TX4A 4FEIA 1LDSA 1T20B 3MRQA 2ZXBA 4EI5A 4QHKI 2AQ1A 3ARDD 5GGVY 4ZTPL 3TFBA 3MLSL 4FDWA 2X5PA 5CUSH 1UUSA 3L3KB 3W11D 3ZE0E 2B5IC 4K94C 4N4YB 1JJUA 3P4NB 3D25B 5CJXA 3WKMH 3QPQD 1I75A 2HLAA 1XGTA 1HESA 4QD2E 3BIKA 4U6HB 3PJNA 4WZ9A 4OGAD 4PJXF 1NPNA 3U48A 4PW4A 3BEVA 1KPVB 2AXFB 4U6TA 5F0LB 1BM3H 4EUPH 4HF5L 4ZUVA 3NH7H 5CO1A 2XBZA 2FK9A 3EO1A 3O3AA 4LXFA 4E5XG 1T66C 1RJLB 4G9FA 2WUCH 3LQZB 4ZFFA 2VMJA 4WKXA 3FH5A 5EZIL 5E24E 4OZIA 3U82B 1Y0LA 4KMTH 4FP8H 1JCKA 3POCA 4NQEA 1ILUA 3DX4A 5I6XB 1R3JB 1IM9D 1WIPA 5GGUB 5BZZA 3VD9A 3EJSA 3X1FA 1T7WA 4JR9L 4URTB 3VFUA 2CWRA 4PYHA 1F4WH 5IIEA 4UTCA 4S2SA 1TXKA 3WMPA 4L5FL 2D03L 4XC3L 4DUXA 5JOFA 3CD4A 3GZOA 3S35X 1U93B 4ZMAT 2VAAA 3U36A 1VEOA 4GP5B 5JHBA 4X8JA 4KH2A 2DIBA 4DH2A 1JPFA 3K46A 2H26B 4MCZA 4P3CH 3N44F 4U3XA 2XWBB 3II2A 3LS4H 5C6TL 4X4XA 2VLRE 3HBZA 4EPSA 1L9NA 3BH8B 5I75B 3B5TA 2ZCHH 1KJMB 3W9EA 4D0BB 1J5OH 1RIHL 2JCCF 2VABB 3LIUA 3M7FB 3PDDA 5FK9A 1JPSH 3GB7B 3MRNB 5SWZB 5EU7C 1FH2A 1YY8B 1T1YB 1ZA3B 1MFAL 1MH5A 4FLSA 3Q43A 4LLMA 3ZKMC 2IDSA 3RL1A 4NQCE 3ZQ9A 3L3DA 4UV7L 5HGDA 4RMQA 4NQUA 4YHOL 3ILDA 3NCYP 5HGAA 5MERB 1Q94A 1JGIA 2HT3D 4RAUB 5IP4A 1QFUH 2NUTB 1BBDL 2OP4H 1O6SA 4YL9A 1N8OE 4AZ8B 1W8OA 3T04D 2AEOA 3QUML 1VPOL 2HTLC 4HAGA 4FQXC 1G7MA 1UOKA 4JDTL 3I3EA 5D7LE 4O4YH 4J3OC 1EPFA 5E2TL 4AYGA 3VD7A 4H13C 5IT2L 5JQIB 1U2YA 3BWUC 4QRRD 3VD0A 4W4OA 1T22A 3NYKA 4H2CA 4HUWB 3HNSH 3QZWG 1RU9L 4RRPG 4XP5L 4K73A 2AXJA 3FUMA 1DBAL 4IM8A 1IIIA 3U4KA 1EBPA 5I8CB 1NDMB 2ZKYA 4B97A 1BD2B 1RIHH 2PYED 4KO9A 2WQVA 3NCWA 3HG1A 3ZE2E 1MFDL 3QO1B 3S3PA 1EEQA 4EXPX 4ZS6D 5AW2B 1SGKA 5IK3B 4MA8H 3IKCB 4RDBA 3RX8A 4CN6A 3ULAB 2Z7ZA 3OKEB 2L7QA 4ZUWA 2H6UA 2VR3A 5GGVL 5BVPL 1CICD 5ICYB 3I75B 2VQTA 5A16B 4DO4A 2WXHA 4ESKA 2APBA 4JE4B 5F89B 2HJKB 4FTVD 1BIIB 3AACA 1GJWA 3SQRA 4MVBD 5H37A 3ARPA 1O7DC 4FYTA 1AD9B 4TM9A 5FHBL 2YPLA 1QD0A 4JRLA 2IAND 2QPUA 3MHZA 2V3DA 4TPRH 2APVA 2V6HA 5IT2H 2ZWZA 1RZKL 2UVFA 5HJ3B 1KG0A 5JIMA 2WO2B 4PB0H 3CSGA 3LQZA 5EZIH 4NQDB 2WGXA 1MJJB 5DRNB 2ENQA 4XPBL 3R1GL 4W6WB 4XXDA 3BPOC 1K5NA 2XZAL 2I69A 4KMQA 2A6DB 3KVQA 1NDGB 2Y36H 4N1HB 4ACTA 4HDIB 4R2GC 3GKZA 4Q74A 4M7JL 1HXKA 5IB1A 5IQOA 1KDIA 2IANE 4NSKA 2O93L 1FLRL 1NCWL 3ES6B 4FNTA 1NAMB 5G4OA 1MCKA 4L8SA 4NWTL 2DQEH 2QPFA 4KKCD 5ABAA 4AXWB 4AXWA 2X42A 3MRFB 1G7JA 1Q9KB 4JE0A 3OZKA 4F93B 1KJ3H 3D3VA 7PCYA 3HE6B 2C9PA 2SODB 4OV5B 4J3OD 2FYVA 5J6GA 2GI0A 5J1TC 5LBSA 2PO6C 1J05A 4MQSB 3MRLA 4PJHE 3NACL 4UTBL 4XPAL 5F6HJ 3T0XA 1J10A 4N1CA 5EU3B 4LLVA 5JHLL 4IBLT 5EIIB 1YRKA 1E2VA 3SJVB 4XXCA 3VI4B 2X88A 5BOJA 1IEAB 1UFUA 3UJIH 1PZAA 2CBMA 1E2WA 5DZVA 4PLJC 3L81A 1CPUA 4ZMNA 3DIFB 1K6QH 3JWNG 5I1HH 1XGRB 5I1IH 2MWCA 2NXYD 5HGGS 3WJJA 1EGJL 4IOFD 4HIEA 4JRXE 4NIKB 3P3YA 3NFNA 1JZ4A 3E1ZA 2DM3A 1SJHB 2DQIL 4PJIB 4HCRA 3Q9QA 1Z3GH 1L5GB 3ML9A 4KGJA 2BSDA 2P5EB 1ZPLA 4A2DA 5AW3B 1T7ZA 1OOWA 2F61A 1XVSA 1F8TL 1MELA 1KTRL 1IAOB 1DJIA 2E86A 2EEFA 1LD9A 2BVQA 1PZCA 3L4ZA 3NJLA 3R4DA 4NI3A 4XCEB 2V17L 2MSPA 1RLWA 3B83A 2NY0D 4NN6B 2ATKA 2CJUL 3SPVB 4JKWA 3TFKD 1NFKA 1IFGA 3H7LA 4PWKA 4RIRB 4PREA 3EYOA 4FEMA 3PP3H 3ABMB 4PU2A 1DZBA 3DPBA 1XH3B 5DMIL 4B9GA 2IMMA 1J5CA 4OZHA 3DXAB 4PRID 2A74C 2Y7NA 1S4IA 4AH2B 5LUMA 1ZHKA 4JZNB 2PTUA 1IBZA 1WD9A 1HE7A 3IDYC 5TK2A 1GW6A 3QXVA 5A2CA 4E41D 1GOGA 5GGSB 5HYJB 2OTUB 4AK1A 1A0QL 4BH7B 1AO7E 3N42B 2GIMA 1J8SA 3CVCA 1DVQA 4GUOA 1A7OL 2BVTA 4WVRA 1IC5L 4RCAA 2VC2B 2YSSA 4K7PH 2Z7YA 5FYLH 2FJHA 3R06B 5EF3A 2Y7QB 2CHDA 1NEZB 1U0QA 3QPXL 4F9LC 3SBWA 3QAZB 2J8UB 4HIXH 2MQ0A 3G6AA 5GS0D 2YXWA 5CP7B 1EIBA 4ZNEA 5EB9A 5ID0A 3EUDA 2VE6B 4PS4L 4APXB 3GSXA 4OGXL 2WLJA 3G5YB 3O81A 2XLLA 4X9HA 3H85A 3SKNB 3TIEB 3DX6B 1QYGH 4AUYA 4QY8B 4HPYL 3WU1A 12E8L 3PGCB 4XMUA 4N2LA 5EO1B 5F9OH 5F6IC 2R0ZH 5AKSA 1RZJC 35C8H 5I19L 1E5ZA 5CEXA 2WQUA 3QORC 2P7TA 5KUMA 3FQNA 2IH3B 2JCWA 2PP7A 3FHEA 4GT0A 3NJHA 4LL1A 2IMNA 1QZNA 1QR1A 1UZ8A 3FK3A 3R8BB 1TDQA 1OAXH 2WLNA 4WK0B 5TE4H 3PUUA 5A2KH 1AG6A 2X38A 3UO1L 1T04A 3BVNB 3H3PH 4OD1H 4ZW8A 2X6VA 4BQ8A 2Q76A 4XVTH 2Y1AA 2GVYA 2NQ3A 4HC1H 4P59H 4PRIA 1IVTA 2QTVA 1C5CH 2Z3FA 1G9ML 1X6LA 5F0MB 5HYEA 4XP5H 4YXKL 4Z8FL 2AEWA 3WDIA 3UJTL 3BAXA 1FVEA 2IF7A 1OGPA 5I30L 1SBSL 2NY3B 2A6IA 4LLQB 4BCZA 4ZUSA 3GXNA 1N5YH 2OL3H 4PRAB 3C5ZD 5LKNA 1BLIA 4PJ7F 2DLEA 2QPDB 3VI4A 2K4AA 3WFEH 5LNGA 5AW9B 2YAOA 3G3LA 2EYSB 3UBXG 3UZVB 1YNTF 1S7VA 5L4FA 1MCOL 1SQ2N 3IE9A 4PJ5D 1CFVH 1KGJA 4HJGA 3VMNA 5DQ9A 1PKQA 4IRZL 1QFUL 2NR6C 4N0CD 2R9HC 3HRPA 4ZUTA 2KHAA 3BLPX 4KDTA 1B0IA 3TJEH 4NXSA 1Z5HA 4UV7H 5DJ6B 1LL1A 3L3JB 1U8LB 2DI8A 5TQ0H 1S9KC 4DETA 1JNJA 1OAJA 2BIPA 4PVMA 1CL7H 4XVOA 3OWRA 1OK8A 4X6CF 3S37L 2ZSWB 3AQYA 4H40A 2YBGA 4U1MB 5DHMC 1T4WA 5FKPB 2A9BA 3G9VA 1EVUA 2X4SA 2MJWA 4XMTA 5I0DA 3RY6C 2ZOOA 3MGAA 3MTXA 4IMKA 2EE2A 1DVFA 3A22A 4OLXL 2ZSVA 3OAUH 4WW2B 2X10A 3ARGD 4F3FA 1P5VA 3TXAA 3GMOA 1MCHA 4U1KA 1JV2B 2NNAA 4I85A 1BAFH 4WDIB 3I6KA 1T1WA 4Z78B 1A3LH 2IANA 1DE4A 4ODVH 2IALB 1VCAA 4U1IA 4XMKH 4YIQA 5LG1A 5CR8A 3R7RA 2JQAA 3QFJD 5C6PB 1IKNA 5KJ4A 4GYBA 3ZKSD 4DFHA 1FYTA 5IJVA 3H9SD 3LDBB 3ZHFA 4NRXB 1XGUB 5D1XD 5DUPH 4L29A 3OKOA 3VWJC 3P9WB 3BJ91 5FR3A 2R15A 4IJ3C 1GY1A 2HSIA 1F1AA 1T22B 4IS6A 4I2XB 3OAUL 2EEBA 4U3SA 2R4SH 2I5YL 3BDYH 2R1XA 3EJYD 1Z9LA 4KK9D 2A9NL 4Y2OB 5J13C 5CP7A 3NAAL 5FYKD 2HVKB 2AV1A 1JS4A 5JR1L 1IL1B 3OKEA 4KKAD 4PAZA 1VZIA 4IEFB 3QI9A 4Q9RH 3M1BA 4S1DC 2WHVA 3C6EA 1MWAA 2NY5H 4UIKH 5C0BA 4GSDL 4BZ1H 3QUZC 3RVXC 3DO4A 1X9RA 3U4AA 3IJYA 4MJ2A 4ODHH 2J1WA 1JYNA 5ILTH 1ZY9A 1WZAA 4QJ3B 3VSTA 3OF6A 3VI3F 2GBVA 4I18B 4ADIA 1KWKA 1SEBB 4OAWB 4JDZB 4Y2LA 5K9JH 4JN1H 1N59B 3WFEL 5K9QI 3L9YA 4R0LC 1AI1L 1CFTA 4BFNA 4MNQE 3FB8A 4PJFF 3KW7A 4G9FD 2MOQA 2V7NA 3GPEA 2ROXA 5D5MB 4MS8D 2R0KH 3P3RA 5EWIH 5FM5M 5E8EA 2CE6A 1K4CB 2IWKA 3Q8BA 2LOEA 3U36B 3EFFA 1EDYA 2XIIA 3KPMA 1VAHA 2VZ1A 3AAZB 3LRSA 4YWGH 1LWRA 3GNMH 5HJDA 1F41A 3HS0B 4ALAH 2JB6B 5DZPA 2WAQA 4EBQL 4KUZL 3HHSB 3WJMA 3DX9B 1T1ZA 2AJSH 3BDXA 1U3NA 3OR7A 5CEZL 1P1ZA 4FI7A 5GS1B 5DZOA 2JELH 4X4KA 1HSBB 3CLWA 4JM2A 4Z5RA 2OTWB 1T1YA 1ZA3A 2Q8AH 3DX8B 2KDGA 4M6NH 3U2SA 5C08A 4ZFFB 3WD5H 1HOCB 3ZTEA 1E4KA 5DRWB 5AL8A 1MW0A 2EE3A 3SBRA 5I1EH 3K0YA 3O6FD 4G80A 3KEDA 5D1XC 5AKTA 3VFTA 4XNDA 3DBXA 2AQNA 2XXCB 3I85A 1PLAA 4KJWC 3NFNB 4M6NL 3A4EA 2P48B 3MLTA 3FQRB 4NKOB 2E75C 3CMGA 2GY5A 3VQ2C 4Y2DB 3W9DB 5A6IA 4Y7OC 1L7IH 1M6OB 1YUHB 4KNQA 5I16B 3JXAA 3ZDXF 3GMPA 4JEGB 5AUMB 5I74C 2SEBB 4DKEL 5GGSY 1DQLL 4YWGL 5DURB 3BT2H 1ZHBA 4W9GC 5ISZA 3NJFA 4WFGD 2I24N 1N2RB 3N5AA 1F00I 3GMOB 2VO8A 1UADC 1R5VA 4JBSA 1D6VH 2EUZA 4XZUB 2DQFA 4BYHA 3MLVL 4XB3A 3RE0A 2XWZA 1DANU 1Z9MA 3WO3B 2HKHH 4P5TA 1YY9C 4RQQB 4JN1L 5AAPA 3C2AL 1J86A 1XZ0B 3Q6FB 3WN5C 3PWVB 1EHAA 3FTGB 1Z9SA 1AGCA 3G5VA 3HG1D 5C0BD 3T0BA 3TBBA 3V0IA 5AG8A 5KANI 2FAUA 4ODHL 4YQXH 2B4CH 4XN9A 3UIYA 3GFUA 4DGYL 2A99A 4NBZB 2WWOA 3VAEA 4F57H 5DUBB 4IIZA 4PWJA 5EZLB 2ZXEB 1HYSD 1W80A 3IDMA 4QRAA 2JTYA 3D52A 3CNKA 5BZWB 1QQDB 4U6VL 1IGIH 4WGWB 2YAFA 1JPTL 1ADQA 4YFDB 2G60L 5DC4B 4QRRB 2WVVA 5TE6H 1C5BH 1CICB 5HJ3A 2E46A 2O6CA 4AWJC 1U8MB 5HHVL 2BZDA 1V3JA 1R17A 4UI2A 2ATPA 2X40A 2EC9T 2PTVA 1DVUA 5JIQA 1YJDC 5F97E 1IM9B 3FFCA 2ADGB 3T6ZA 1HQ4B 4AQEB 3TN0D 3D5OF 1J18A 4ZZFA 3GJFH 3GSOB 3B4NA 4Y9BA 4ETQA 2W9LA 5FO8A 4NAQA 2J12B 4R97C 3REVA 3BFWA 4HWZB 5EFIB 4YHLH 1WWBX 5DTFB 5FLVA 3ZMEA 2KYIA 1KFGA 5B1BB 1KYFA 2J6WA 4QHMB 3QHTC 1AR1C 2DTMH 2FGZA 1UWGL 4XNZB 5DF0A 1GL4B 3QDMA 4L3AA 1QSED 1F1DA 2C9XA 3BUPA 2OSYA 3N40F 2V2WA 4HSCX 3MRIB 3WXVH 4H8WL 4YNYB 4Q4IA 2XI9A 4FXTA 2KC0A 1BGXH 4HISA 2HT4C 1A4JA 4UQ2A 4LCYA 4C56B 4IOFC 4ZX6A 5DS2A 1IEHA 3T8XB 1IGYB 4QYOB 2EZ0C 2YOCA 5HDBB 3WJJC 4LP4A 4Y16C 3L95A 1GY2A 4HZ1A 1OF2A 2XTJE 2QDVA 4KV5E 3D0VB 5E1HB 3RA7H 2F9BT 1WAAF 3ARBC 3FQYA 4FQQA 4ZFQA 1KELL 3PP4H 5GRJH 5E9DD 2CPUA 3IDIA 5DD1H 5T8IA 4NBYB 3SKOB 1CFVL 2A6JB 2Q3XA 3U1PA 4F7CA 4RVBA 1CDGA 3BUIA 3G04A 3BZ5A 4AIXA 3GT6A 1NCHA 1G94A 3WHE1 1EEUA 1SHXA 3BQUC 3O4LD 3RFZA 5DDHA 2OR7A 1NOFA 1GC1H 1KB9K 1XD1A 1SBSH 3E2HB 3HG3A 4WWPA 3IJHA 1M7IA 4LVNC 1F90H 4GLRI 1FFQA 2YAHA 4JK0D 5AYQA 1OP9A 5IFHH 1FZMB 2FUTA 4EXKA 1JYWA 4N2BA 4ATWA 2R1YB 5K39A 4ODSL 4DO5A 2EEXA 4L1BA 2V2XB 3SKUD 4EUPG 2EIDA 3EG9A 4HIJB 5DHVB 4WTZG 4AVIA 2BZ7A 1PG7W 1ZE3C 2QADC 4W4NA 3FU5A 1KJ2H 1XXFC 4XNXH 4PVBA 3AM8A 3A24A 2BVQB 5KBNC 4MQXD 1MCPL 1WHPA 3K1DA 5HI4C 1PY0A 1TMCB 3THML 3LPOA 5EMYA 4G8IB 1T5WA 3S88H 1AP2A 1U91A 4NQEE 3UJJH 1RP8A 2GCYB 35C8L 3KPRB 4LCWA 4X5PA 5I26A 3UTOA 4CJ0A 3F2LA 5HDBF 1G4MA 3JTBA 4LASL 5IB4B 1E4XL 1JMXA 4L0ZA 4MSWA 4G9DB 3AMKA 3ULVF 1VENA 4I8DA 4PM1A 1QI3A 4OFKA 3U46A 3AU1B 1KY7A 2D2CC 1X44A 5GJSL 1YEKH 2JJSC 4PS4H 1GIGH 2HPOA 15C8H 4UTBA 4JCWA 3QFDB 5I1KL 1JPGB 3T4YB 3BD4A 3CMOH 3LXBA 4E9YA 3ZDYB 3CN3A 3AXLA 3P9LB 1ZOXA 4FXLA 4AQAB 1F0LA 1OSZB 1OW0A 3D39B 4CC1A 4NUQA 2DEWX 5AB0A 1CLZL 1CQYA 1KBKA 5KN5A 3O2WH 1NWOA 1UM5L 1WWCA 3FUFA 3KJ6L 5EUKA 1MFAH 4CVUA 3VYPA 2IALA 3M1CA 2KS0A 1UURA 4YIQB 5HD8D 5CEZD 2B77A 5E9AA 1TCRB 3CFKB 3VO0A 2J8OA 2XV0A 4JM2F 1RIUL 1S7TB 4R3SB 1T04B 1F42A 2F54A 1TJIH 3BVNA 4X8XA 4Z7QB 1ZK9A 3SO3C 4CSSA 4GO6B 5CZXD 4ZUWB 5IG7A 1R3JA 2NYKA 3SDAA 2LLGA 1FZJB 5E1AA 1Y1UA 4XP6L 5B8CC 1MOEA 1F6AB 3IXAA 5J0BA 2WTRB 4IRSB 2NY6D 4G7YL 3EH5B 3T0VA 4BE6A 4X99B 2C7UA 2R83A 3QH3B 2AK4E 4NI6A 3HLAB 3IMUA 2R2BA 1G1OA 3MUGB 4DWHA 3TV3L 2OTWA 4PJDF 4QY8A 4F7PB 2DQTL 3MROA 1JDDA 4M8UA 2ESVA 3TL5A 1JTOA 1MVUB 3QUYA 4JAMA 1XL6A 2VIRB 3FRPG 5CAYB 4MCMA 2MTPA 3QHFL 3ZHNA 3OXRB 3CE1A 3VFOB 3W82A 5TE6L 4W81A 1IC0A 4XPFL 3C5SB 2IDFA 2YMXL 3LQAH 1SEQH 3NCEB 5ABZA 2JIXD 3ABLB 5FGCB 2WJ5A 1HCFX 5EF0A 1ZLWK 5HHOE 3IGAB 4TLUA 2X70B 2J5LB 3OAZK 1I1AA 2G9HA 5GRVK 3STLB 5AW1B 3PIQA 2I9LA 3WKML 3IGKA 4A7GA 3GPSA 3GLDA 3SO5A 1JHKL 3HA0A 3OHXB 2CKBB 1I1FB 2CKBA 4LHUB 5E5LA 3GMPB 5AUMA 1TQTA 2FEJA 4AY0A 5CUSL 4MZ3A 4LRIA 4IDJH 4JFFB 3MR9B 4YVNA 4DVBB 4A1RA 2HTLD 4NKOA 3G7TA 4OT1L 4BZ2L 1OB1A 4WHTA 4FQLH 5I1CH 4JKNA 5DD5H 1GZPB 3DHPA 2OXHA 5L4JA 1YNKH 5C0GA 1AMXA 3IBEA 3QDME 5BMFL 4G6FB 4K55A 3CX5J 1UWFA 2DAVA 3FJTA 2YFNA 1MKFA 1WK0A 2XWJA 2XXFA 1C8QA 3PQYA 4HJUA 5JA8B 5TQ2L 1KLFA 1GR7A 2F58L 3GJFK 3FU8A 3F62A 2FWOA 4FE9A 3U0TA 4AJYV 4OCXL 4X4MA 1WA1X 1PLGL 1LGVA 3X1BA 2J55A 4KX8A 1XGUA 2H0FA 4IBSA 4NKQB 3S36X 2AJXH 4ZX4A 1SOKA 3VXOB 3OPUA 4KJPC 1T80A 4RDQG 4QRSB 5E94B 2J43A 1NC4D 1GSKA 4QRUA 5GISL 5KJ7E 1KYOJ 2HLEB 3BE1L 4Y8AA 5IB2B 2AF2A 1NCGA 5I6XC 2CHWA 2FQEA 3WIHH 2DMHA 3FW6A 1M7DB 4U33A 5F93C 1J48A 3VSQA 1Y07A 4A7QA 3KPQA 3L45A 5HSFA 3UFIA 2JKTM 2D7MA 5IWLA 3VGAB 3MAWA 1NFAA 5DD6A 4KTEL 3EJRA 4JRYB 4XMVA 1CD0A 5KYUB 2NY2B 4ZJ9A 5IW1A 5C0RL 3O8XA 3VWKC 1GZQA 1P69B 4PG9A 1ASQA 2NY6C 3OVUB 1KGWA 3FUKA 3O6MH 4N9GB 1KEML 5SWZE 4UTAH 3DVNB 4PGDA 2E9JA 4C56A 1FH5L 1FN4A 1IM3D 2ZF8A 4JO4L 4O4YL 4KXDA 1HL5A 1AIZA 3CVIH 4JY4A 3BFQG 1H6FA 2DBLH 3UCRA 4H1LB 2OJZL 2VR9A 3KPLA 1XGPA 2ICWJ 3GSUB 4PJ9D 1G9NC 5LGYA 3HNVH 2HVBA 1PW3A 1MVUA 3KGRA 4YOKA 3SDCC 1HZLA 1S7UB 3ALPA 4U6HA 2H2PC 4ODXB 4ODXA 3VACA 2EH8L 5I23A 4P46B 1NDTA 2Z92B 4PV8A 3S5LA 1PKOA 4U1SB 3O3DB 3Q2CA 3D69A 3FCUB 2ZOWA 4A39A 2VN6A 2NY2D 1WAPA 3AJ7A 2FHCA 4MJIA 3MRBA 3TVMD 1ZLSH 3NJMA 1ILSA 4XNUH 2TRYA 2TSAA 4JO2H 2HB0A 4ELKA 3QQDB 4FNLH 3NAAH 3IRPX 4TLKA 3VSVA 1CE1H 3RRQA 5BZDA 5DYOB 4S0HA 4BSJA 1TVBA 2JXMA 3BXNA 5IW6B 1QEWA 3TNMB 2QHLA 3LPPA 3TNMA 4OIAA 1IGTB 1NBVH 4LU5H 4BDVA 1T3FA 2AERT 1IM3B 1S9XB 3BZFB 3S3DB 2X4QA 4HEME 4F2EA 1OF0A 5A43C 3FMGH 4W9ZA 1YLBB 4Y4HA 1DO6A 1N68A 2D03H 4HCFA 4XC3H 4LKCB 3AC0A 3DO7B 2VDPB 3UTPD 2IFGA 3GTTA 1A2YA 2UY7B 2AJUL 4XVSH 5LO7A 4YSRA 5KTEH 5HDOA 4I48A 4PR5B 5CJ5A 3JV0A 1NKRA 1DQTA 1HH6B 1B4JL 2GIXA 3ABZA 1TQUA 3L1FA 5LG6A 1SXZA 2C9AA 5C07D 5T5NF 3BAWA 1RHHA 3GHEH 1KCKA 3FC8A 4WI9A 5HYSG 2VLLB 2BRRH 3JSSA 3VRLE 1V7NH 25C8H 5BV7C 3QARA 1NBZB 3HLKA 1QRNE 3O9WC 2ZZUT 5ECGA 4D0CA 1QWHA 5HDRA 1KXTB 4MZ2A 4BSWB 1YZZA 4OF0A 4ZQKA 1K4DB 2NSXA 5FCUH 3BMWA 1CURA 2BSBA 1UB6A 5MP6H 3LXCA 1BPLB 5D2LF 5FOJA 1F4XH 4G8FB 4JHAH 4PJGF 4FMFA 4KQ0A 4JANA 3OG4B 4NO3A 5TE7H 1F02I 3L3GB 1HCVA 1EEZB 3GSVB 4JKKA 4YHKH 5AD0B 3DX3A 4CSTA 1S3RA 2P8LB 3SE3A 5GZOD 3BWAB 1S7WA 3GYRA 1BYNA 2Y06L 5D6DC 5LBSL 2MCMA 4N2IA 2CHNA 1NFDB 4ZO8A 3RNKB 1JIBA 4DVBA 2AEQH 1KMGA 4ZMLA 2E7HA 4NAMA 4WUUA 1ID2A 4NRYB 5L4IA 2O5YL 4M02A 4JJ5A 3SN6N 3UGEA 1XF3A 3UTTA 4F20A 2JE8A 1XSIA 2MQGA 4KK8C 1B4JH 3N1MC 1NJ9A 5E2UH 3FFCB 5IHBA 4NQQA 3OAWA 4XVTL 1IARB 4ZFZB 1Q1JH 5T1DL 3T2NH 1RZ7L 5GSRA 2AK4B 1ZLWH 2MTAA 1OW0C 4B53A 2DM7A 3IMWA 4N68A 5F0PB 4MXVF 3HTLX 3OB0K 3OAZH 5CWSB 3T65A 3T6WA 5JHDE 1T6WA 2FEEL 2Y2TA 5JQ6L 1FAIL 4TTDC 4WSKA 3O3AB 1N26A 1PG7H 3LMJL 4YXHL 2BRQA 2XVKA 3O2DL 5FA3A 4L8BA 4DT2A 1YEEH 4PJCA 4Y1AE 3BVXA 2F1AA 1PLCA 4TLTA 2BNRD 3FYEB 3HZ3A 5J11C 2XN9E 1UOWA 1A7PL 1X5YA 2QSQA 2XPZA 3VA6A 1WITA 4Q8BA 4XO4A 5SX5K 4H25B 2C4XA 4FXGA 4JDZA 3VNYA 2VH5L 2WUBH 4QXGL 1PJ9A 3JWOH 4HUXB 2WPGA 4LDOB 3JV4A 1WYJA 3ARGC 3KPOB 5DD3L 3L3KA 3MJ9L 4S10A 4X9FA 4OGYH 5B1JC 1B88A 5F88B 2EDYA 1IC5H 3HUJA 3HB3C 3DOIA 5E1AB 3S5YA 1NFDF 5JHDA 1RSFA 1ND0B 2Z31D 2B59A 1UXMA 2H41A 4F8TA 1AY1L 4X80H 3GS0A 5BVJB 4NOBA 2ADIB 1S5HA 3VXUA 3VD3A 1E9QA 3ULVL 2H1PL 5J5EA 3OXRA 2ZSWA 3MV7E 4KQ3L 1RUAH 2ZF9A 3UZEA 1XCQB 2J88H 4FFTA 4E9RA 5FEBA 4JRXA 1LO2H 3IDYB 5LGHH 1KNOB 2ESVB 2L7JA 2NQCA 5IHZB 2X3BA 4DQOH 3QQNA 4D9LL 3MV01 2QVTA 4D94A 1I85C 4HJ1A 1INEL 1KBBA 3D2UB 3HVDA 4P5TB 4RLDA 3FPXA 4BH8A 3QNZB 3V7AG 4PGCB 1HILA 3SBWC 1FNLA 4JFED 2EH7L 3QDAA 1MIEH 5TDNB 2HPTA 2CGRH 3NZ8B 3EAKA 3L48A 3FQ2A 3L5WA 2VC2H 3UOAB 1TKWB 2H6OA 5KAQG 1IIKA 2WYIA 2VLKE 2JK5B 3I02A 2FNBA 4N25A 1U8NB 4BJLA 1BVNT 1GS6X 1QRND 4N24A 4Z6AT 1FFPA 4LL9A 2O5NA 1EJOL 2VITA 4OTXH 2FLRT 1KENL 2GC4C 5DD0H 1JF5A 4A38A 3VGGA 1I82A 1IGFH 3KBEA 3CVHL 5C0AB 5DVPA 2DZEA 3PE9A 4GEJA 4PJ5A 3ATEA 2G3XA 3MZTA 4PJBF 3VFSB 1M6UA 1I8AA 3NJJA 4HKXA 5CFHA 2VAJA 2AGJH 2YGQA 3IK2A 4PRNB 4PG2A 4XP1L 5HHPB 4NQVA 2VM9A 1T2QL 4AUJA 1T2JA 2W1NA 1JK9B 4XBPA 2ZP8A 3RB7A 5ETUA 1G43A 1KG0B 2Y24A 1P7QD 3CN4A 1KN2H 4OLYL 5DJDA 1DVZA 5FDYA 4RBPK 4G9DA 1OK0A 1BYOA 1W72L 4JKPH 4ZD3L 5EBWB 2V37A 3FPYA 1A7QL 5GZNA 1H3VA 5CJBA 1IGJB 1AKJD 2J3SA 3K2MC 4GQ9L 4JW3A 4ODTL 4BA8A 5C9JA 1N5AB 2HXAA 1RK1B 3K4DA 4WNQA 2HJKA 2AQSA 4HGKC 3QDGD 4GKOA 4O2FB 3EGSB 5LN8A 1VKXB 4F2MA 3CTTA 4TKWA 1ZT4A 1EXUA 4QPEA 4V1DD 2AQ3A 3MRRB 4GBXC 2C8NA 4HU2A 3NGBC 1SHSA 4O5LL 1T0NA 1YA5A 4FHBD 3V5HB 5C7XL 3OR7B 1SVCP 4TPRL 1CGXA 3HMXL 3D0VA 4Q6IA 2DW5A 4HFWA 1HI6A 1QO3B 2YQ2A 4F7MB 5C3IA 1GJUA 3Q06A 2ZONA 4A7SA 4H8HA 1GTFA 3PABA 3KWWB 1W72B 2MMXA 3RVUC 3IYLW 5KVGH 4IBWA 1F4AA 1Z7JA 2B20A 1B0RA 2NY0C 2P45B 3KW8A 4HJSA 3VU2A 2BNQD 4Y89A 1SZNA 1M1SA 5FGBC 5AB1A 1YSOA 1EJ8A 3H6JA 2LAAA 4EVNA 5C0CD 1GH7A 4XCNB 2CU9A 2RACA 3DROA 3VI4E 2QBWA 3P40A 3DO3A 3NJVA 4WWID 3HS8A 1NBQA 4ZW7A 2VDNL 2ZX9A 1PAZA 4HS8L 5E0QA 1ZEAL 3M07A 5INCB 1YEFL 2R23A 1O6TA 1D7CA 2O5XH 3JWNE 2WXJA 1B6DA 3ZL4H 3VB8A 3QUYB 4JAMB 4O58H 1XGRA 1RUPL 4Z7UF 3AY4A 4MLIA 4BXVA 4F7EB 5J89A 2LU5A 3BSGA 3P2TA 3Q1EA 4UYPA 2CHZA 2E7MA 1NMBL 1C7TA 1I7TA 4KKZA 2ICEC 1EHKB 3BGFB 2G9HB 2F19L 5BV7B 4XZ4A 4LOUC 5FYJE 4B27A 3LN5B 1CDBA 2H3KA 1A2YB 1T20A 1JWSA 2UY7A 3NDZE 3O9WB 4XWGL 4YBLB 4NQSB 2YKKA 1VACB 2IV9A 4E2OA 4CADB 4JDEA 2EDHA 4XN2A 2OX5B 3PF2A 2V9QA 2K9FB 2M26A 1KBPA 4DVRL 2WKOA 3DURB 5D1QB 1M56B 5A7BA 4KAQL 1VEMA 3B8SA 3ZTNH 3KLDA 4V2CB 3VX1A 4LPUA 3CWGA 1ES0B 3FQTB 4PQXA 1BWWA 1XMEB 3BCFA 3EJQA 3PWPB 2Z93A 4JB9L 2Y1ZA 5I1LB 4Q6IC 4AG4L 3VXME 1D7BA 1VADA 5F21B 4Z0XA 1NMAL 4PJCF 2DQCL 4DK5A 3P77A 1N3NB 3GSNB 5D7LA 5JIKA 1OL0A 3T3MB 1XMWA 4E5XB 3EBGA 3LKQB 2HT3C 2CLRA 3BMVA 1NL0L 3HC2A 3F00A 3IDGA 1PCXA 1IFHL 3PGCA 3U6XA 3AU1A 3HPLB 2FB4L 2OMUB 1TOXA 1DVFD 3DK2A 3C09C 3OC5A 5DURD 2E7DA 1NIFA 4WHDA 5DMGD 3H9HB 3U79A 2AJYH 3P4OA 1Q9WA 4PBVC 2AAVA 5AOLA 5B3JE 3FCSB 2WVTA 1B9ZA 1E5UI 1LE5A 4PJ8C 5F44A 4LPWA 1MRDL 3UX9B 4L8SB 2J5WA 4R96A 1KFAH 4UT6H 5GGRB 1ZKAA 5C1MB 5AZ2L 1W8EA 3Q2NA 3GRBA 4G6KL 3E9UA 4N8VB 4PS3A 4LSSL 3M86A 4PG2C 5B21A 5JUEL 3STZB 3MNZB 2XDHA 2M2DA 5ICZB 2FR4B 4FLQA 4Y19A 5GRXG 4Y2DC 2ITCB 2NQDA 5IJCC 3I6SA 4U3HA 1ACZA 1IKNC 1U6AL 4Y4FA 4DK6A 5I74B 3PV6B 2WQWA 4PJGA 2NT1A 2W9DL 5HDQL 3WENA 4L3FA 4MD4A 4DN4L 3GI8H 4PGBA 1M05A 4KK6C 4R83A 3IMTA 4XP9L 1E4WH 2LTQC 1BHGA 3MLSH 3WJLA 4OI8A 1LP9B 3DJRA 3V4LA 4L1LA 3RFZB 4XMWA 3N06B 5CJOL 5D72H 3GDCA 3MACL 4ZPTB 5B22A 3QXDB 3NT0A 4Z7VF 5D4IA 2EXSA 1NCUA 3KPSA 4H8WH 3T3MF 4ZMWA 2Z6FA 3OF6D 3B2VH 1NCJA 1XH0A 3V9FA 2D7NA 5CEZE 2DF3A 3DA0A 4Y1TA 2C9RA 1QLRA 2X2JA 1YQ2A 4DN3H 3I3BA 1SXBA 2MCPH 3DNKA 4WY7H 2IFFH 1X5FA 3FQ4A 2AJVL 1ETZA 3WTYA 1MRFL 1K8DA 1MAJA 4I9WD 2XTJB 4M3JA 4JRWA 1D5RA 4C4KT 3NPZB 3OKDB 4HZLB 4M61B 4YE4L 5I6LA 3ARWA 2FT7A 3GEWB 3TFKC 2WB7A 3LZPA 1EHNA 2BDNH 3UMTA 2X1XR 4C56E 5L8KB 3WTSA 2JKSA 1I3UA 2OW7A 2JLLA 2K7PA 5TH2A 4CVZA 4FHJA 3LN5A 5CP3H 4LMQI 1GYAA 4J3OF 2H6PA 3TH3T 4FQJH 2AP2A 4BFIA 4DIXA 1HSAB 2DLGA 2OTUA 4P2RB 4JQVC 4UQIM 5M95B 4PJ8D 5JOEA 1NMCC 3L3GA 4FERA 4FNLL 5BW7C 1GJIA 1CTNA 3LSOB 2YSTA 4QMEA 2EQDA 4OJCA 2CH8A 3C5ZB 1XF4A 3TZVA 5H4ZA 1EJ6A 3AQZA 3LEXB 4H0GA 4X5XA 1TSHA 4TQ8A 2GFBB 4KJYB 1KTBA 2CKBL 4M5YH 4WUKH 1OOAA 3OJ2C 5IKCB 4HOWA 1PPIA 2BCMA 2MPAH 4YEEA 1BZ7B 4R97B 1PMYA 4AQ8C 1BOGB 4U1KB 3F58H 4K0OA 4MAUL 3L4YA 2AAAA 3CFEB 4QXTA 5ALBL 3VG9B 1NJ9B 2VDKB 4RMSA 5T3XH 2VDMB 2XWJB 3SSGA 2VLRA 2EIZB 2RFXA 1YPZA 4MNQB 4CU8A 2D7PA 5C2BL 1MCCA 2K7QA 4GMSL 5FYJH 4AGNA 3D0LB 4X7SL 1N4XL 2IG2L 4WEBH 4ZG1A 1AS8A 3DI3B 5KSUA 1O9VA 5JMOC 2W59A 3UAJC 4UMSA 2MPAL 3DUSA 1MNUH 3H3KA 4EO5A 4XTRD 3G9AB 3CCHB 5C2UB 2CA4A 3D85A 3MSPA 2Z65C 1CBJA 3RAJH 3M17A 4QO1A 3HI1A 3DRTB 4X99A 4HUKB 4FQIH 4X4YB 4WDIA 2ZPKL 4E9WA 3CU1A 1CDIA 3HB3D 1JGDB 3QIWD 4ZMQA 1T83C 4XO3A 4DP9X 4AJVA 5CCGE 1ND0A 1OAZL 1EK3A 2BIQA 1O5DT 1U36A 1CU4H 1M71B 3S97C 2Z93B 1YEGH 1LMKA 2ZWLT 1YN7B 4ZODA 2OQJA 2HTKD 3C6LC 4LSTL 3E2HC 4TQIA 1AXTL 3KG5A 1MRCH 4AQEA 1W0WB 1RK1A 1OAKL 5FO2A 3ULUC 2LW3A 1UOLA 3FB7A 3MRBB 3EH4B 3KPNA 4LARH 3FU0A 2GSGB 4M7LH 5ANMB 5I76B 1DQKA 1QSFA 1GGCL 3LYRA 4MMYA 4KJQD 5G5DB 5IHZA 5F1NA 4KXZH 4N28A 1HS6A 4HJGB 4P23D 1SDDB 2P52A 2QELA 3QWOB 2DH2A 3DSFL 4H1LA 5F3FA 4XN8A 3V4VA 5DO2C 1X7TA 1N64L 1MWOA 5AW7B 1BBJB 1KCVH 1M3JA 3KCPA 3P0YL 4AL8L 3FBKA 4LF3B 1QFWH 2A6IB 4LLQA 3WNIA 5SX5H 2VXSH 1SN5A 2J72A 5HYQB 1BQHA 4HXAH 2DTSA 1TVDA 4UDTA 3BUQA 3OAYH 2H2SD 3T4AA 3VCLA 4PGZA 1DUYA 3QG7H 2FH6A 3VRIA 3F84A 1GAFL 3JV4B 2NX5A 5B4MD 5L0QB 1UXWA 3H9SE 2W5PA 2WN2A 4WCYL 2J8UF 5ILTL 3BD3A 2VDPH 4NNPH 2Q7YB 1WJ3A 2A3TA 2GT9A 3PL6A 3O2VL 1H3TA 2DQFB 4GAGH 1FNSL 3CUPA 3RZCD 3P9MA 4LEBA 4NQSA 1P5UA 3BKYH 1ROWA 1PG7X 4UM9B 2CR6A 4HIHB 3PLYA 4FFZL 2BHYA 5JZ7D 2YQ3A 4NUGH 4CA4A 5DHXB 1IQDA 2G5BA 4GJTB 1UCBL 4OAWA 4RMVA 4X0KB 3FTXA 1I3GL 1E3XA 4MD5B 1SFDA 2BSED 3ETSA 3QG6A 5AVSB 4BQBA 2AITA 3ESPA 2PW2B 1BFVL 4AEIH 2ETWA 3RFRA 2NR6A 1KB5H 3EYOB 3K74B 5IVXF 1L0PA 4OFYA 4H7VA 3LZFH 1MDAA 2QZQA 1NL0H 4MB1A 3VNZA 4AMKL 4GG8B 4ODVL 1SY6A 1WQVT 4YPGB 4GKSA 4UT9H 5I8KL 3F7YB 4N0FA 3D05A 3F7YA 4N0FB 3CHXA 1H3PH 3U7YH 3WLBA 3ZKNC 3BOVA 4C4UA 2OMXB 3N1FC 3RBSA 2BIMA 2WYZA 2XACC 3UBXA 2YUVA 1NCNA 3MCKB 1CG9A 5DEGA 3RUGE 1FL5B 2EO9A 4J6IA 2ORBL 1AQMA 1EUTA 2QGCA 2PWEA 4GUCA 1O0VA 4BFGA 2AXGA 4K3EH 2M83A 2OL3B 2BVPB 4GRLB 4X6EA 5GS2D 5KBMA 1DLFL 3T0WA 3WEBA 4QOKB 1PX3A 4ODUB 2X1WL 1KIUB 2N1TE 3B3IB 3MNVA 3TO2B 1TZHA 3ECBB 1ACYL 3W56A 5B39A 2H5UA 2A9AA 4LCIL 3L5HA 3RZCA 3KPMB 2IANB 3S36L 1PL3A 3FN9A 3S8FB 1S7XA 2AEIT 2J8UE 5K9OA 1XGYH 5DUMH 4YDIH 7FABL 3V6BR 4JFOB 4WWKA 2A9CA 3HRZB 2VKXA 4HT1L 1BEXA 4N8VA 3L4VA 3QIUA 4HHGA 3LD8C 3VH8A 5IJDC 1ZS2A 5FC9A 2R0LL 4WSGA 1H0DB 1M1XA 4L8CA 1PZUB 3ZZQA 4BE5A 1TQBB 1WBXB 4PSPA 3VXPB 4UQCA 3QA3B 4K8RH 1Y6NR 1S3KL 3ZW3A 2B1HH 1J0YA 1EZVY 3QZWB 4JPWH 1ET8A 2L3BA 1F2QA 1SDDA 4WFHD 1JOIA 5I2IA 3S4SA 4HIEB 4Z7UA 2WTPA 2ZXGA 3WEXA 3PHQA 2DN7A 1INDL 2PYFB 4YK4C 2NDGA 1S9YA 1G9MH 1MF2L 1G0DA 1DLHA 4P5RA 5DZLA 5DJYB 4KZEL 2WMPA 1JXFA 2WTRA 3LB6D 4PLOB 3ABGA 2QQQA 2CUIA 2G0KA 3FTYA 1TZIB 3OL2A 2GK0B 5AOKA 4BZ2A 2FQFA 2O4EA 2YR3A 3A0OA 4Y19E 3FQUA 1BF8A 1I9IH 1RVFH 2ZSVB 5G55A 3WY4A 4IIQC 3BIAX 3P69A 5JYLA 4DP2X 1C7SA 4YSDA 4HZAA 5DVNA 2BDNL 1A6ZA 3FAXA 3V0EA 4E41E 1UA3A 4QRPA 4PUBH 2XTJC 2HWZH 3DOSA 1UB5B 2XQYA 5IWLC 5EO9B 1P4IH 2Z8VC 1VACA 4FXKA 2MCAA 2V7HA 2NRDA 3WAKA 4KH9A 2MKWA 5GGQL 3F7PC 4PYGA 3CDYA 5E4EB 3G5XA 5TDNA 2CBPA 3NJKA 2ZOLB 4UYQA 3T0ED 3DOHA 5TQ2H 1SMDA 4B9FA 1E5CA 1FFNA 5D1XE 3U6XS 4OSUL 5E08L 2BCKB 4UZUA 5A2BA 2MRYA 2O61B 2WLIB 3MUUA 3MV9A 2XN9A 1NGPH 4XMZA 3NSCA 1BAGA 3PHSA 4YGAB 4IU2B 3DBSA 5CJOH 3ZXAC 5DLMH 3U30B 1CQKA 1YYCA 3WFCL 3QJXA 4NZ8A 5IB4A 4ZMXA 2X4NB 2OR8A 3IE4A 4MSWB 1JXDA 3IDGB 4RAVA 3JV6A 4MKM