3MCYA

Crystal structure of fimh lectin domain bound to biphenyl mannoside meta-methyl ester.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based drug design and optimization of mannoside bacterial FimH antagonists.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Carbohydrate binding protein
molecule keywords FimH
total genus 33
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 3mcyA00
3ZL1A 5AAPA 5JQIB 4X5QA 5FLUA 4AVIA 5AALA 3ME0B 2J2ZB 3JWNG 5FS5A 1PDKB 1N0LB 4AVJA 4BUQA 5LNEA 5ABZA 4XOCA 5AB1A 1QUNB 3JWNE 4AUJA 4AV0A 4AVKA 5LNGA 3BWUF 4ATTA 4AVHA 2UY6B 4J3OG 4LOVA 4XOAA 5CGBA 4CA4A 3ZPDA 3MCYA 4J3OF 4AV4A 4X5RA 4XO9A 5F2FA 5IQMA 1TR7A 2XG4B 4J3OH 2JTYA 4X50A 4AV5A 1ZE3H 3RFZA 4XODA 4CSSA 5F3FA 2W07B 5FWRA 2JMRA 2VCOA 1N12A 2UY7B 4X5PA 1UWFA 2XG5B 4XO8A 5FX3A 5IQNA 4XOEA 4XOBA 3BFQG 4AUUA 1KIUB 1KLFB 3SQBB 4CSTA 3BFWA 4AUYA 3JWNH 3ZL2A 2WMPB 5IQOA
chains in the Genus database with same CATH superfamily
4LGPB 3FQWB 4LBEB 5D72H 3HE6B 3LPFA 1JGUL 1KCSL 3OM3B 4MZ2A 4R7DB 1SHWA 4DUVA 4LSSL 5FGCE 2ZWZA 3TVMA 2GFBA 3CHQA 5LDUA 4U0RC 3TBWA 5HD8D 5I1JL 2ODIA 2F6AA 1BOGA 1KB5H 4Z6AT 4K3EL 2X38A 5CUSL 4AZ8A 1G6RL 2C7FA 3HB3C 2XBDA 2H9GA 1LM8V 4JFFD 4JHBA 4NO5A 5E1HB 3M7OA 4D0CA 1DVFD 4TVPD 2X4RB 3EYUH 3HBPA 4JKNA 2XPGA 2ZUSA 4JFHE 1AQDB 1D5ZB 2QPUA 4M7ZC 2CRIA 4R7DA 1KXTA 2CRZA 1S7QA 3VX1A 1XCXA 4HJIA 3LH2H 3ATBA 4M7ZB 2EZ0C 3F6JA 3L9BA 4JKWA 1CG9B 1S78C 4LCWB 2P5EB 2FHBA 5AAWC 4W81A 4OI7A 2UZPA 3UMNA 4KKPA 3KPOA 4XPTH 2YWZA 3RGBA 3AG2B 1U8JB 1Z9PA 4LIQH 4NWTL 1JVOA 1HNYA 2ZJSH 1BHGA 4ZFZB 1Q9LA 1JZ8A 1S3RA 4PJDF 1OCZB 1HJCA 3CZGA 1ZRUA 3C08L 1A7QL 5F7DA 1PYWA 2VW4A 4FTVD 4IBSA 4F7EA 5DHYB 4CW1A 4KY1L 5L0QB 4Y1AD 4QDGA 3PJSA 4NZFA 5IHUH 3VGGA 2WSPA 3P40A 4U1IA 1M2OA 3EKCA 2VLJB 5DXWA 2XG4A 2ICEB 2ETWA 1RZFH 4RMRA 1MFAL 4UZGA 5FYLL 1BSIA 4MCMA 3AREB 3DX7B 3UTPE 4KY1H 4L5FE 2F53D 5DRZB 3VVWA 1E90A 1MHPH 3ZO9A 2W0FB 4RMVA 5ABAA 5IBLD 1L9TA 5EU6B 2VCOA 3NUKA 2A0LD 4Z76A 5KWYC 1OCRB 1XH0A 3HI5H 4CVZB 5I0DA 3QZWA 4MRBA 5IVZB 1ZGLM 2XVGA 2ZCLH 5EZJB 3SOBH 2Z3FA 3BN9D 3A21A 1CL7H 4OV5A 2ADFL 2OJ1A 3A23A 1ODUA 3L13A 3REWA 4OLEA 4A04A 3KBHE 4DP6X 1EVUA 4LOUC 5D1XB 4ODVL 3QUXB 4UAOB 1KYUA 3CFJA 1FH5H 3GO1H 1V5JA 3QHFH 4V1DB 4OGYL 4D0BA 3SDAA 3WFZA 5EU6E 5ADPH 5K39A 2K8QA 3RFRA 5D7JD 1KV3A 2VE6A 4JHUA 4JR9L 3UC0L 3WL9A 3T2QA 5E8DL 2W95A 3J27A 4JRXA 3VWJA 2IOIA 2BIMA 5CD5C 4L0ZA 3PWNA 2OQJA 4AH2A 1J9TA 4ZUTA 4Y1TA 3DETD 3BCDA 3QHZL 2XRAL 3RVVC 4Z77A 1SLVA 2JH2A 1TLKA 2WGXA 3VXTA 3ZOAA 4BKLA 1HQRB 1QLFB 4XMXA 4DOHE 3JZ7A 3V0AC 4S0SD 3KDMB 2CK2A 4J7RA 4WK2B 4NLHA 4ZNCD 2P7TA 2GY7B 4XBGA 1R47A 5BQ7A 3PQYA 3LIZA 1ZLWK 1LMKA 4JJOA 2V9TA 1PG7X 1SQMA 3MUJA 2D7QA 1DFBH 2VDLL 4DKFH 2JVUA 5G4NA 4UAHA 3T6WA 1S9WB 3EJQA 5IF0B 4H8HA 1PD1A 5TQ2H 1W80A 3ZE0F 3MJ8B 2WKLA 3KPNA 4IMKA 2Z7WA 3U0WL 4U6YB 4RWYH 2Z8RA 2JI3A 1JF5A 1DLFH 2IC2A 2TSAA 2DJSA 3MJGX 2YAOA 2A7BA 1WWCA 2QR0A 4RZKA 4W93A 1MEXL 4HJJH 1UTDA 3DVNB 1ZLDA 5KJRL 3ZW3A 2EDNA 1I1CA 1SDDA 4Z7UB 1RPKA 1Q0XL 3LXAA 4JRYD 2Y7QB 3RPBA 5D6CA 2YA2A 2NZ1A 1NINA 4YLCA 3U36B 4ABUA 3ZMRA 3U9PH 1ZLVK 4YSEA 3BKJL 1GVIA 4H8PA 5E8EA 2O4EA 2EEBA 4G1MA 5KYUA 1RJLB 1A4CA 1NCIA 5A43C 2B4CC 1ZANL 3ALXA 2I60L 1N59A 1BZ7B 2WN3A 1R3JA 3ELAT 5HGDA 4FP8L 1QR1A 3FZUC 2WXLA 3QJFA 4Q7DA 5C07A 4K8RL 1JHTA 2FK9A 3CFUA 5J13C 1E3ZA 4AUYA 1K4CB 3LVEA 1NOAA 1IT9H 1QR4A 3CSFA 3MV11 4MD5B 3WELA 3NEEA 1CXEA 5FYJL 3CCHA 2A9AA 2ZG3A 1UACL 5K1VA 1E9PB 4PIBA 5E5RB 3S35L 2UZYB 4QPEA 1F18A 4IKIA 3GBNH 2BSBA 2BY1A 3LRGA 1T03L 3APMA 5FV1L 5IHZB 4XNAA 5IV2A 2BS8A 1AR1B 3SGEI 1QR1B 3C5ZC 3K6SB 1P4IL 5DFTA 5T8IA 1DQML 3M1BB 4WNQA 3UDWC 3KPSA 3Q9PA 1F3RB 2K4WA 4WU7B 3OWEA 1ES0A 3BQVA 3PE9A 3EYOB 3FFCE 1RFDH 2X2IA 4PCKA 2MQ3A 1BD2D 3FH8A 3HMXH 5IZ7A 4F57H 3FRUB 3TBVA 2UZYA 4IGBA 2CDFA 4Z5RA 1Z0NA 4XCYA 5EU6A 1CFTA 5CM1A 1BZOA 3BFOA 3IU4L 3PWPA 2IXQB 3QAQA 2BVPA 3RVXC 2X1XR 2GABA 1PAZA 1WZMA 1L7TL 1BBJB 2AEIT 3FUKA 1XAUA 4XWGH 2GHZA 4KO5A 1N12A 3JTSB 3KR3H 3MRIB 1OCOB 4NZDA 1UB5B 3KLKA 2Y36L 4EO5A 2DWTA 3GUTA 2ARJB 5C97A 4QOKB 5DFVC 4LKCB 4MA1C 3F12A 4WFHE 1EXGA 4IDJH 4AWJC 5JHAA 1H3PL 2B7DT 1SVZA 3BRDA 5F7HA 4GSRA 5FW8A 2FJFB 2PETA 2R4RL 2OMXB 3MLZL 2BX5A 4PP2B 1SXSA 2P24A 3UZEA 5IREA 7PAZA 4YPGA 4F37F 1QBML 3SDCA 2H5UA 2X4OA 4N0UE 3ARZA 2Q8AL 4RZCA 3VXTB 4BKLB 1KENL 1OD7A 4QRUB 5I1CH 4HETA 2YA1A 3GJFB 4NEHB 4HSAC 3T0EB 4L8DB 4Z8FH 5I1DB 3IGUA 3SPGA 1TO5A 4NO3B 1JMZA 3CSBA 4PFEA 1LJMA 4W70A 2JKWA 3Q2NA 4MCZB 5DJ0B 3LB6D 4CSZA 5HYFA 5CLWA 5IKCB 1BVLA 3J7HA 2YARA 4GUCA 2P5WA 2AF2A 5BRZA 1MWAA 3HMWL 3MJ9H 4P57B 4JG1L 3M7FB 3RAJH 5BZDB 4QXGH 2XZQH 5DJDB 2ZPKL 3LSOB 1J12A 1EZUA 5CBEB 4BFEA 4OFKA 3O6LL 3FC8A 3T0EE 4ZT1A 3FB7A 1GPOL 4LKXA 1N6VA 4EIUA 3IDXH 5T1MA 3K5RA 3SGEH 4N2HA 1F5WA 2GITB 2BOLA 5IKCA 1VEMA 2VERA 2EEXA 3WTUA 2Q7YA 1JF1A 2CLVB 1XGTB 3K91A 3ARDB 3LS4H 4PJBA 3D85A 4JFYB 1QQDB 5JW5B 4LL1A 1FV1A 5FHBL 5J3HC 3PIQB 1OP9A 4PCSA 3IMVA 4EI5A 5IMLA 4FC3E 4Q4IA 5B8CB 2VNCA 1KXHA 3G3LA 3RIAK 5C8JA 2QQQA 4OLZH 2X9ZA 3MHZA 5BW7C 3FNKA 4CRPA 3SDXB 2CKBH 3CSYB 2LLLA 1P7BA 1Z9MA 3FTGA 5F8RC 1TJMA 4YR6A 4G1EB 4XMVA 2DWDA 1JCKA 3O2DL 2H45A 1IGCL 1WC7A 1MLCA 4ORGB 4FD0A 2AQ3A 1N67A 4PB0H 4C83A 3OR6A 2X6BA 2NCMA 1Q4NX 1TU2A 3E2HC 1VESA 1OSZA 4IU2A 4XZUA 3E6FA 3SBQA 1QWUA 3S36H 4JPSA 1AP2B 4RSVA 4HUUB 3F5WB 3BP6B 2QPFA 2YC1B 4K5MA 4HUXB 3B7RL 1RULL 4RAHA 5DQDL 1AIFB 3BWUC 4AYFA 3FTGB 5LDSA 2ADYA 4NRXA 1N3NB 1OSEA 3SY0A 4DQOL 5ESAA 2BSRA 3T77A 3EGDB 2BMKA 3M17B 3BX7C 3U9UB 3C5SA 3MA9L 3S88L 1A14H 4D9RD 2H6UA 1RP9A 1U41A 4Z3EA 4PJDE 2N4IA 2AQTA 4MA8H 2R7EA 4MNQB 3DV6B 4DQOH 3N44F 1NMAH 3U4BH 4ZUVA 4OB5L 1A4JA 1BMGA 1P4BH 1K5NB 2A4ZA 3QDGB 3FCTA 1Q9KA 1CF1A 3RWDA 4IQHA 3X3GH 4PJEA 3SY0B 3FB5A 2XTLA 3TCTA 2R15A 3UC2A 1GH7A 3G5VA 4N1EA 4QWWD 3DX1A 4M1DH 4BH7A 1ACXA 3OKOB 2HFEA 3GK8L 4NZUH 4D7PA 4X9IA 2VN4A 3VRLF 3WFDH 2IIJA 4LLVB 4AEHL 2XV2A 4HBCL 3G6DL 4UQBA 1E28A 4NO2B 5DURB 4ADJA 3MRRA 1NJ9A 3CVHB 4U3SA 3SOTA 4BFJA 3NP4A 4IIQA 3UYOD 4FXGB 2QGCA 1NBVH 2UWEB 2HWZL 5FWQA 1TZGL 1M6OA 3V0WL 3Q43A 4TVPL 2C4FU 4OCRH 4OZ4B 2CUMA 4PS7A 5I1EH 4HUVB 2X42A 5DFVD 2CBQA 2L7EA 3ZXAC 3IGLA 4JRYA 3DARA 2NDFA 1ML0A 3KEHA 4YBLC 4S1RH 3T0EA 2EH7L 2CIKA 1YEEH 3GHEL 3U83A 4X4XB 5D7IA 1BVNT 1F6LL 3AQXA 1NLDH 1ZT4A 4L9LB 4DP2X 2UWEE 2EDTA 4TSCL 4NQEB 4WEEA 1IBGH 1L9PA 4PJAF 4R0LC 2XKUA 2BHZA 4MDIA 2BXZA 3GJEA 1N0LB 1OGAE 4JO2L 2WKOA 4PV9B 4CMHB 1J5CA 4JQIH 4Y4FA 3HNSL 4DO6A 2DJUA 2GBAA 5J6GB 2YEVB 3NZ8B 5FKAA 2QL1A 4RH4A 3NIDB 4Y88A 2WHVA 3P4LA 2YUZA 1DJGA 4HJSA 3UGUA 4MA8L 1AD9B 3LB6C 3OKNB 4WI5A 2BINA 4IHOA 2NY3B 3WLWD 2FO8A 1NM4A 3ATFA 4JM2D 2GG1A 2WP3T 4HK0A 2EE3A 2O6DA 1GGCH 4FQCL 3WFCL 4NQDD 3L3HA 3L4XA 4H1LH 1B6DA 1XAKA 4J3OC 2CPCA 1KPVB 4PIRF 5E8NB 3JT0A 1A7PL 4XC3L 3GBNL 2VLJE 2FEDD 5E00B 3WNIA 5DUBA 2XV3A 4TOYH 1CD1A 5JHMA 4GFTB 3TBCA 2HKAA 4LLDB 3IDXL 4NS0A 5AVVB 1VEPA 1PKQB 2JKXA 3QUGA 4FCHA 3LKOB 4TLTA 3E38A 5ITBL 1UD6A 2OMVA 4JGNA 3MLTB 4GIAA 4JQXC 5EF2A 4FN0A 4JFQA 1I9RH 1S5HA 5G5DA 4DGIH 3RY5A 5IBUB 2D0FA 4JB9H 1J0JA 3REWB 1WBZB 3BUYB 4TUOB 1S78D 2AS5M 3HRPA 5ALBH 2YKLL 2F54B 4YN3A 1U8PA 2DIAA 4R3SA 4H1LA 4JPIA 4ZMAT 4DSYA 1B2YA 4LLMA 3TBSB 4V1DE 4W68A 4ZMVA 2OXGA 3VW3L 3QJOA 4XVJL 5D2LF 1ZHBB 2C9VA 4MTMA 3VXMD 4GIOA 3JV0A 5BXFA 3P69A 3RBGA 1I3GL 3DOHA 5D1ZB 2CKBB 4W9EC 1HOCA 4MJ5B 4IJ3B 5DS8B 2FBRA 4XH2B 3S2AA 1F56A 1JN6B 3MXWH 3AQZA 4YL9A 4BZ1A 2D9QB 4UIKL 4PD4J 2Z8SA 4AXWB 3ZE2F 3MMEA 1HN1A 1BCIA 1HHIB 1WGVA 2N7BA 4OFVA 2ROYA 5FYJH 2ORBH 1LL1A 1G7QB 4KNTA 1DEDA 3T65B 4JZJB 4BKTC 2DICA 3LQAC 5CFHA 1RMFL 1FDLH 4LZKA 3JV4B 4L4TA 1TTFA 2NNAA 4XN8A 4PJ7F 4I8DA 5D7IE 1KJ3H 1CFQB 3ELQA 3G08B 4K8RC 1SLXA 4WI9A 5CJXA 4PJ8C 4HWEH 2OL3A 4GAGH 3LX9A 2ADIB 3PWJB 3ZHLA 4CADB 2Q3ZA 2WGNB 1AANA 3DGGA 1LO3H 3LEXB 4QWWC 2AVFA 2EICA 4B9KC 1INEH 5AW2B 4N8VG 2N7SA 4RNRA 1FL3B 5CWSA 4JPWL 1P7QD 4WK0B 1X5JA 2OA9A 3LD8C 4Y89A 1RSYA 5ICUA 4N86A 3ZE0E 2NY6C 1NFDB 3V6OE 2J12B 2AEQH 4Z7WE 2OYKA 3AUWB 2NX5B 5D7IB 2WXRA 3CAFA 2XYCA 5HDQH 3VSTA 3V10A 3E6HA 3MCG1 4PWKA 1PNCA 2VW7A 2ICEA 3SE4C 3S8WA 2B1OA 4YIQA 4Y9BA 4JRXD 4PJ5D 5H2BA 2AJVL 4R6UA 4LT7A 4XE0A 3DIFB 5FC9A 2VR5A 3MXVL 4F7MA 1RSFA 2FAUA 5IBTH 3CDCA 4I5BA 1BECA 4U6HB 1S8DA 1PFOA 5I24A 1JK9A 4ONGL 2NX5E 1G7JB 2P44B 5DLML 2Y5TA 1KMGA 2DH3A 4YXKL 3MRPA 4CU8A 4JFHD 4RDQF 4XO9A 4G8GB 1T7XA 1AZCA 2PCYA 4D9QD 5FYKD 4NOFA 1RD6A 4UT9L 4S1QH 5A2AA 3MZTA 1KXVA 1MAMH 1S2EA 4G3YL 3BKJH 4TUKL 5JDJA 2WZ6A 1WA0X 4AVHA 1QLEL 2GQHA 4Z7NE 2ZSWA 3UP1A 3IEAA 4W6WB 2N1TE 4CU7A 2B0SL 3GSOA 1JJUA 4KNUA 3OKLA 3QAZC 3W0WB 5H35B 5F89A 4WCYH 3ZKND 2DYPA 4YC2B 4LIQE 3RGVC 4GSXA 1N5YL 3WLWC 1F8TL 2X6VA 3KYMA 4GKZB 3FQTA 4XNBA 5F9OH 4LLWB 1TQBC 2JKSA 4WI0A 3K2UH 1UB6B 3GFUA 3PCYA 5FGBA 2F8IA 5LGHH 2XPYA 4GRMA 4JCMA 4FCAA 5TK4A 4UILL 5CZXC 5DD6A 1JS4A 1AO7E 1YG9A 3PJLA 4PAZA 1CFMA 2MQ0A 1I8MB 5DJ2B 5FKPA 4C58B 1TSHA 3K2UL 1XF3A 1A7PH 2BC4B 1KPUA 1CGUA 1JHKL 1MAJA 1UKTA 2J72A 1XBDA 2F5BL 2IH9A 5IUSA 3UTTE 5KYXA 2NXYB 3ESPA 3FO2B 4CC1A 3UL4A 1KBGL 4FQLL 4WFFD 4XODA 4B97A 1NGXB 1YY9D 1D7BA 4HIJA 4X6EA 5AKVA 4CBZA 1CF8L 4FULA 1S7QB 3S5LB 2YSSB 1G94A 4OLUH 5ABDE 2WXOA 2DTSA 3MBEA 4GAJL 4L18A 1QD0A 3CDYA 2P5EA 4GJTB 2DIJA 2I32A 3V7AG 5FS5A 3NIDE 3UTSD 5KTEL 1X44A 4YHKH 2VZSA 1EBAA 1DQJA 2WLLA 4W9DC 3Q0HA 4U1SA 3W81A 2NTSP 2I25N 4GP4B 4A2EA 1WZAA 5D9SB 1UC6A 2YMXH 3NSDA 3ZIMA 3LHAA 1RUAL 5T5NG 5D1ZD 3SBPA 1B4TA 4MNGA 3HNSH 5K9QG 2CGRL 1T1ZB 4K7FB 3NGBC 1SF5A 1ZAGA 3SN6N 5MEQB 2OZNA 1JYVA 1QBBA 4F5CE 3VFPA 5ANME 1D3CA 1TENA 3QRGL 2GEEA 3SQOL 4JFXB 4KO7A 1RAMA 3UJJL 2ICWI 3EFDH 3BVVA 4QTIL 3WEXA 2CJTA 1EGJA 3KXFD 4TTDD 1HX0A 3LSOA 3NPSB 1J05A 2GCYB 3D9AL 3F62A 5E6IC 4AE1A 4DO4A 2IAMC 4KK8C 4ZFGH 3V5KB 4JREB 3Q8BA 3VWKC 2XNAB 5BQDA 2GITA 3V6FB 3IMRA 1F4YL 1G9ML 3PWLB 3R7RA 3HBZA 4BSJA 2G9KA 1XGTA 1LGVA 3DXAD 3PWVA 5CEYB 3GIVA 4DT2A 1YNKH 3VFRB 2A83B 2OM5A 5D7LA 3CFMA 1VCBC 1RI8A 1FNEB 4JVUA 2VDRL 1P7QB 1NCUA 2QPDB 2CJ3A 5E9AA 2OXHB 3DIDA 2J71A 3GSRB 4N22A 5DHMC 5JW3H 4PRAB 5IV2B 5ISZD 4MMXB 2CGZA 2FQFA 3O3UN 2WZ0A 4ZFFA 2VDMH 2ZX5A 1DFBL 3QJVB 4CBPA 5GPRA 5JNYB 4NQCE 3A0OA 5IB3A 1GGIL 2P9RA 4UNIA 5DU7A 5KJ4A 3W11D 1JWSA 1M6UA 4KFMA 4X7SH 5FYKH 2KLRA 1G7IB 1EEQA 3BN3B 1B0RA 1OP5H 1CI3M 4FXKA 1XGYL 3NCWA 3UJTH 1BXUA 5D7SH 2AEPH 4NNXB 4HUWA 4JM0A 4K71B 3OKEB 3SCMD 3LIUA 3SOBL 2HXAA 3S3JA 3RWJB 1IBYA 2FT8A 1G9NH 1D5MB 2V37A 1VZHA 2AANA 2APBA 5I1KH 1E2VA 1JPTL 2CRMA 4WGVB 5GRXG 3WDJA 3ULVF 1P0SE 2W0KA 1LILA 3GMQB 1TTRA 2NTFA 1G7LB 3L3GB 1PBYA 5D7EA 3A24A 2OMXA 2J6EH 3H53A 4HLZH 3VFMB 1G9EA 1E3FA 4DEWA 2XJKA 1LWJA 3T6ZA 4CJ0A 1OT1A 5HSFA 5I66A 4QJ5B 1HILB 4WWPA 2QSTA 1NIDA 1YMMD 2HLFC 5C3TA 4UQEA 5AENA 4D2NA 3DHJA 2D0HA 3SEPA 3RNQB 3CVHL 2J5WA 5DEGA 3QWQB 5TK2A 1OE2A 4FQQA 1GZQB 4KK9C 2IFGA 2DWEA 5DMKB 5IFJB 1E27B 1CK0H 3X13B 2GIYA 5KS9B 1E6OL 1AZRA 2VKWA 1EMTL 2VDPB 2EP6A 5TF1L 1SDDB 2BERA 2IMMA 2WMPB 5D93C 5JOPE 3ARVA 3UBXG 2BRRL 3N41B 4E5XB 3OHMB 4PGCA 3S2CA 5CLXA 4C57C 2E9BA 4L3EE 5TDOB 3EO1A 4RMSA 2UY7A 3HNVH 3WFCH 1T5KA 5F93C 4FQQB 2YGPA 3HE6C 3SGJC 3SQBA 4HCRL 1FG9C 2Z8WC 3ISWA 2JE8A 1DVFA 2Z0BA 3DRTA 4EDXA 1PZ5A 5IFJA 2AZUA 5L2JB 1JZHA 1MG3C 2IADA 4Z23A 3MBEC 2O26U 1S7RA 2NR6C 2V9UA 2VDOH 1SEBA 2VDNL 4IIQC 5EPMB 3CN1A 2KQNA 3TGXA 1IVLA 1IGMH 2CPUA 2DTMH 1BZQK 1DVFC 1OALA 3VFNB 5C08B 4DP5X 4JDEB 3VNYA 3ZZSA 4OCSL 2LW3A 1DBKL 1UCBL 4TULL 2HJLA 3AB0B 2V5RA 5HPMB 4XNMB 2IALA 5ADOL 5I1IL 5H94B 3NSXA 4TQ8A 5DK2B 4XNYH 4ODHH 2IH3A 5EOCL 2HT4D 1ZOXA 1F00I 2JCCF 3UBFA 3GSVB 2WVVA 5AL0A 1IAIH 4OJEH 5LCVL 1KN4L 4O5LL 2D2OA 5J6HB 3QJHA 1XIWA 1Q9OB 3P77B 4BFKA 4MD4A 4OIAA 1A8JH 5IESL 4K5LA 4PRDA 4CN1A 4QOKE 3VQMA 2CDFB 1LO2H 1NANH 4HUUA 2BNQA 2BO0A 1MJUH 2IQ9L 2R2BA 5KVEH 1JAEA 1I1FA 3E9TA 4HH9B 4NCC1 5D8JH 2OTUA 4OCXH 4N6RA 2YN3A 1YEKL 4D3CL 2H3KA 2MEJB 4K7PY 5CNHA 3ZQWA 2GBUA 3CVBA 4F7PB 2PYEA 1GYVA 5HGHB 2OXHA 1T66C 2BNQD 3VWKD 5JHLA 3LXCA 5IMKB 4NZRH 2VN7A 4A7SA 2DMKA 1XF4A 4LSRL 1RZIB 3CH1A 1CLOL 4FGMA 2QKIA 4AQZA 2A0LC 3ZTJH 5JQ6H 2M83A 3KCPA 1S9VB 32C2B 4PJEB 2E3VA 1S3KH 4G7YL 4BBWA 2VXSL 3BN9C 3X3FL 3F7LA 2ARJQ 2LU5A 2Z7ZA 1N5AB 4FNLL 5AVWB 3G5VB 4NZRL 4X4YA 3BAIA 4AEHH 1C16A 1AFVL 1X9UA 4LSPH 2VDPL 3L45A 4LHUA 3NCMA 4DCQA 2OMNA 1RZ7L 3OKKB 4YUEH 1WFMA 2A2QT 2CAKA 5J1TC 1DUZB 1YUHB 4UMGA 3ESNA 3Q8FA 1L4IA 1MUJB 3IPBA 2WZPA 1A1OB 2E56A 4K15A 1R9FA 1UWEL 3FRPG 3IRCA 4NRYA 2X87A 3MOBL 4MYPA 1DANU 3MRCA 4K23L 5K5YA 1RQ5A 2RH0A 2YEZA 3TU6A 3IJ8A 3KPSE 5FYKL 9CGTA 4L3EA 4FQ1L 2PCPB 4GSUA 5HI5C 2X6UA 3AWEA 4YWGH 3U30B 1A1OA 5DR5L 1UWYA 3RB7A 1UT9A 2EDYA 5ISZE 4PCYA 1BFVH 5IK3A 3IMWA 3MNVB 3O3AB 3V0DA 3IGAB 3P11L 3WIIH 2H2PC 2FATL 4A2MA 5KW9L 4NQEA 5TE4L 1LNUB 1HXYB 4FQXB 1LP9B 3F7YB 4PRPD 5SWQA 4PLOB 4WWKB 4MB5A 4F2EA 3R06B 5E8OA 4IU3A 3TN0A 4QHNA 2HLFD 4FG2A 3GI8L 3DMMB 3FO1A 3BD5A 1HCVA 4RGNE 1BYNA 3BKCL 3TWCH 1NANI 1A66A 2WWKT 1F4YH 1G9MH 1WD8A 2VLMD 4PG2C 4R8WL 4Y7MA 4LOFA 3MJ7A 1SMOA 3I6LD 4JHVA 1YY8A 4LCCA 4OLXL 5ERWB 1U58A 1WCBA 3HZYA 1CL7I 2F7PA 3ARRA 3L3KB 1Y07A 4LCIL 5DRWA 5JW4M 4OF5A 3K1DA 3KS0H 4EVNB 2B4CL 2XICA 4PHXA 3P9MA 1VLXA 4BXSV 2KLSA 3IB4A 1IARB 1KCLA 2PP9A 1KWKA 2BSEA 2VABA 2WN2A 1WHOA 3FRPB 2B77A 4ZXBC 2YZ8A 2ZIDA 1M2VB 3V9EA 3KVDD 1CWVA 3X1GA 2WXFA 3CE1A 4Q6YA 1BF5A 1YC8A 4YBHA 5LN4A 4EIGB 1EEUA 1JIBA 2IGFL 2LT9A 4QRSA 4E68A 1UADC 1RJYB 3CNKA 3QUYA 4I1PA 5E6ZA 3F3HA 3GD1C 4M5ZL 5KN5A 4ODSL 4HUXA 1EAPB 3WTXA 1CXFA 3AXLA 2OZ4L 3VD3A 4GI8A 1GZPB 3IU4H 4QHLB 1AKJB 1BQHG 4QXGL 3MSPA 1B4LA 5EB9A 2WXGA 1JGVH 3TH4T 4RA3A 2ZZUT 3HZKB 4OJDH 4F5CA 1F6AA 3IYLW 2MNJB 1ET7A 3ETBF 4QRSB 2YFNA 4H88L 1AS8A 3M45A 4FFYA 4OBRA 1G7JA 1P5UA 5DJYA 3WYRA 3K0WA 5F0JB 5B8CC 2DPKA 2R2BB 3NJIA 1IGML 3T71A 1CF8H 2M26A 5JW3L 3OTTA 2PXYD 3BT0A 4HWNA 5C9KA 1JNJA 5F1KC 2F7OA 4LB8A 5B7EA 5F3HA 3UJIL 4K8RD 3OX8A 4PJ8D 4R3SB 5KZCB 3S3SA 3FCSB 1KYOJ 1KJMB 3RP1A 4Y9FA 2PYEB 2CNZA 4LDLB 4WHTA 1AY1H 3NABH 4QRTB 4YXLL 4JPVH 4KOCA 3QUHA 2EUXA 4L4VB 4P46D 1IT9L 4YQXH 2A6JB 1SXCA 4UUJA 3I6KA 1WA2X 3BAEL 4PH8A 4KKAD 2NY6D 4F2MB 4GXUN 2AGJH 3K1KC 5C0RH 3HZVB 4U1MA 4AZ8B 3CN2A 4LLMB 3EW3B 4WGWB 4HSCX 1LE5B 1XL4A 3UJJH 4G6KH 2HT2D 2CCWA 2ZYRA 3AW5A 1XSIA 1JSYA 4MSWA 4JO1L 1G7QA 1DL7H 1J0HA 3T2OA 3DVIA 4LU5H 2EE2A 2PCXA 5DWUH 5DJZB 4U7KA 3BVNA 1UD8A 2CQVA 1KACB 5AW7B 5EO9A 1IO4C 1BG1A 1UH2A 2WTRB 3IDJB 1RK1A 5GQBA 2YD3A 4QRPE 4HD5A 3P4MB 4RISH 3CSGA 2EE9A 5SX5H 1CYWA 5FA4B 3L3OC 2PKDA 3MYZA 2V7HB 4K3JH 3WJLC 3EOAA 4C4KO 4JGMA 4IOIB 2NLJB 2GJ6B 2ZUWA 4CVXB 4OZIB 3HZ3A 3LNEA 5IGXH 3RIAF 4Q2ZA 4O02B 5KYNA 1NL0H 8FABB 3UZQB 4ZDHB 1HHJA 5D2LA 5IHWA 3WUZA 1UOWA 1WZ1L 3MFFB 2Q20A 1IX2A 2D03H 1NCNA 1K3IA 3KGUA 2VZ1A 2AK4A 1U3HD 3L5IA 4FKKA 4XMKL 2X0UA 1CLYL 3D2UA 1UZ8A 5EEUA 2X89D 4KTYA 2VLJA 3P9LB 4CGTA 1QP1A 3GNML 5B1KA 2ZOLA 1OAQL 3F7VB 3JWNH 3L5JA 1AHWA 3L2NA 4M7KH 1D7DA 1A2YB 2R56H 1YNLH 5A6IA 1RUAH 1VIWA 5DC2A 3V8CA 3WI9A 2AXWA 4FQJL 4F80A 2B9AA 1CE1L 4FHJA 3VRIA 2NNXA 3FUHA 4QRRA 3X1NA 3PDOA 4YBLB 4BCZA 3Q2VA 1G7MA 4R96A 4E42A 2JKNA 5J11C 4GMTH 1ZHKA 3WMQA 5E00A 4YIQB 1DSYA 2H2PD 4FNTA 1URLA 5CEZL 1QPXA 1UATA 3N1PC 5I6XB 3SDDB 4PY8I 4U31A 2QADB 2V7NA 2PW1A 5F70A 5C09D 5KYWB 1NTDA 4RFEA 1B2WH 3IF1A 3RZCC 1UH3A 4I5BB 3PWUA 3EFOA 4M03A 5SWZA 3GSQA 2J55A 3GDBA 3WFHA 2ZCZA 1JV2A 1GS7A 5ADPL 1TZIA 4X9FA 1U8NA 5I76B 4QNPF 3TS8A 2JB6A 4X9BA 4MLIA 3L7EB 4NWTH 2ZWLT 2A77L 2HFTA 4M3HA 4I1NB 4W4OC 1XO8A 2EYSA 2G30A 3LJ3A 1PZUB 4FFZL 1SPDA 5C07D 4XB8A 3CK0L 3QZWB 5ICXA 5IVZA 4HZLB 3WNNA 1HS6A 1S6NA 3H3PH 1HSBA 3TT3L 1OAUH 3QORA 4PJAA 5GSVA 3JT2A 1KIQB 4IRZH 3ZE2B 3WO4C 4H8QA 3ROOA 4BD4A 1RLBA 2YPLB 4PGEA 1AKJD 5AVQB 2BFVL 1O6SB 3RWJA 3VG0H 5E56A 3WNMA 1RXLA 4D0BB 1MFAH 1L3NA 2WLIA 3VXRE 1BW8A 1MFDH 4TTDC 4HS6B 3V4PA 4OIIL 3RUGE 2FEEL 3BOVA 4R4BA 2X4PB 5J1SC 4LRNL 2J1YA 3DUUA 4FQ2H 1MPAH 5HJ3B 1YNTF 2WM0A 3ZU8A 4UNUA 3R8BB 2X2UA 4LNRA 1WWBX 1NWOA 3O9WA 2PXYC 1H6EA 2X9XA 2YK1H 1YO4A 4PJ8B 3D39E 3APDA 1BVZA 3CZEA 4G2AA 2WLIB 1R5VB 4C56A 3BHBA 2Z7UA 3LRLA 2WTPA 1MN4A 5ESVA 4ODVH 4K2UH 1H3VA 4UZUA 2Y9RT 1AR2A 4RETB 5FO8A 1EHLH 2YSSA 4P46C 2R69A 3ESOA 1GGYA 4MFHA 4L5FL 5DHVA 3CHSA 1NCDH 3PAYA 3CN4A 5IHBA 4N9GA 1ZHNB 4ZUSA 4FEIA 3NACL 4PJBB 3GJFH 3W11C 4AYBA 5DD0L 3LQMA 2VZTA 1TUPA 2H1XA 1HE8A 2FJSA 4E36A 1NCHA 4XCEB 4XN1A 3LTVA 1KTDB 1NCAL 2RA1A 2DQMA 3V0JA 2Q10A 2F53B 1QTSA 1PZ5B 5FB8B 5SV4A 2FBJH 1T22B 1HQ4B 5ACZB 4GI9A 3OGCB 2X1QA 4P59L 4OD3H 3F85A 1T0NA 3GI9L 1WIUA 4FQHA 1T89A 2VH5H 4LPYA 4YMPA 3AT8A 3DHPA 4KJWD 5HHQB 2X2HA 3VFRA 2R69L 3QQDA 4Q9QH 1ONQB 1R19A 3L4CA 4YDJA 3OR6B 3L2LA 1MJ7H 2A9CA 4HIXH 4HUNB 3E7JA 3U4EA 3T3PE 4BWTA 2AJYH 4XPGH 1DEEA 4NQED 3SDAC 3PWPD 2P5WD 4WSGA 1T1WA 4Q6IC 1ZDQA 2QZ5A 4YDMA 3ARGB 4ICXA 2ZSWB 4IKKA 4AQ8A 2H6PB 2WBKA 5KTEH 3S3PA 1WVZA 1QZNA 4PJXB 3VXMA 3JVFC 1UT2A 1E3XA 3H9SD 4ZFOB 3BZDA 5ILTL 5I30H 3BZEA 3T3PB 2NY3C 3D39A 3LOWA 5IHZA 4YDKL 1I8UA 1NBVL 1DJXA 2VSCA 4G7VH 1SJHB 1EZSA 1IAOA 4NM8L 1RZPA 4WRLA 4YHZH 1YQVL 3F65A 3KYMB 4GKZA 5GISL 5FWRA 4JVPA 5AL8A 3CWGA 1P5VA 1WBYA 3KJ6H 2XWDA 2R0ZL 4OFYD 4AGLA 2DQCL 3FTYA 3HE6D 4NENA 1OLZA 3ZMEA 4J3OD 1BFVL 1I3RA 1WICA 4B9FA 1NC2D 1R1CA 4KFZC 2G2RB 2L7JA 4AK1A 4Z7IA 3BUBA 1E5BA 1LDPL 2FEDC 4FLSA 2WVTA 1FGNH 4FZEH 1OVZA 4L37A 3OQRA 4QRPB 2DIEA 3SDCD 3JYCA 1VFAA 2VC2H 2E4FA 4FMVA 1NDTA 2CO7B 2E7BA 4FFWC 4LFHG 4N8PA 3GBMH 4PJIF 1NJ9B 3CVHA 2OMUB 4FTVE 1S9VA 1IQDB 1FNHA 4OCMC 4NUGL 4BCYA 1CFTB 4JPVL 4JY5L 3OSKA 3GHBH 2VB5A 3I75A 3BIKB 3JTBA 4YHIA 5L6YL 1RJZB 5B1AB 1W16A 3QAZB 4BRJA 4RGMC 3KL3A 1IM3B 5ANMB 4O9HL 3ZZ1A 4ETQA 2A9MH 4Q9RL 2AABL 1D5BB 2HT4C 1KDJA 1EV2E 1MWAB 2BH0A 2ODHA 2ZXEB 3EH4B 3FQXB 3OKKA 4HEPA 4XAWH 4Z9KB 2HG5A 1O9WA 3GZOA 3QFGA 4MXWL 3KYKH 5GJSH 1KIPB 1KT2A 4K5PA 1SVBA 3QYMA 4BWUA 1QWHA 4YAQA 4GAGL 2BLFA 1FIEA 3GTVA 4DPAX 3CVIL 4GBXB 2GSMB 5TGBB 3Q13A 4FAAB 5FYKE 1S9WA 5IF0A 5FUOL 2CLVA 3RY6C 2FJFA 3L1OL 3LNHA 3GRGA 1FIGL 1NZRA 1YAZA 3EDJA 4MQXD 2BOCB 1IC5L 3KWXA 3MRHA 3QXDA 1JGIA 4PS4H 3F83A 1JNHB 4FTDA 2AJXL 3ZSTA 4ONHB 1WE5A 4CKVX 2EIKB 4D9RE 5MENA 5FGRA 1UA6L 3EYVA 2C7UB 2Z92A 4DN3H 5B3SB 2VDKB 2NY2B 3FUEA 3KWWB 3P73A 4YPGB 5I8KL 3IVKA 4WJG3 2DW5A 5GGVH 1KV7A 4NC0B 2NY1B 1NMCB 2J1ZA 2EVJA 3NMEA 4N2LA 1YEEL 4NJAL 4FF9A 1XGZA 4QLWA 1PY0A 1F4WH 3FSAA 3ECWA 3VXOB 1A14L 4XRCB 1HCFX 4Z95H 3R7QA 1KN2H 4NHCL 2AZAA 2YC1A 1KDIA 3QUKA 4D94A 5BZDA 2AXJA 4UM9B 5H94A 2WCSA 4PJ5A 1A3QA 1XH2A 1WBXA 2ENJA 4Y8AA 2CO1A 5GS1C 5I0XA 4FI7A 4IKJA 2VABB 1UWFA 1F90H 1L9MA 1YMME 4GB9A 1J9SA 1SUHA 4M61B 4MD4B 5E2JA 3VI3B 3RVWD 1AZUA 1SBBA 5L7XH 4JFUA 2ZG1A 2HYMA 1XGQB 4NUMA 3TN0C 3WFBH 1F90L 4PJ5B 5HI5D 4YHLH 1XB8A 2GC7C 3D3VB 4ZUWB 4IOSD 1T5WA 2DBLH 4AL8H 4YSUA 1BD2E 1O7DE 3L7FB 1KELL 2AXFB 1INQB 2W38A 4MJ4A 4LEOB 3UIZA 2XIBA 2R0LL 1LEKA 4C59B 3TV3H 1I8KB 1XSJA 4QYOA 2VDPH 5FYJD 2B4CH 3FFOA 1TZGH 3GXFA 3NTCH 2XKNB 3SODB 3T8XA 3MGTB 3LH8A 2F0CA 2JB5H 4HWBH 3S4SB 2J25A 3CXHK 5CJBA 2PPCA 4RMBA 4UV7H 1A4KB 3GS4A 1U8QB 4G9FD 1CVRA 2WPGA 4ZMPA 5C70A 3WE1A 1Z1WA 2UVFA 1OF0A 2LABA 2W9DL 3KLLA 5DQ9B 3HNTH 1Q9WB 4WHTB 5KAQG 4JB9L 3LS5L 1RZJL 4YC2C 4NJ9L 1PDKA 4RIRB 4XNZC 1CLCA 4UV7L 5KS9F 4I9WD 4HKBB 3ZYJA 3RGVD 1U6AH 3NZUA 5CLYA 5AW1B 2D4DA 1RCYA 1AAJA 2ZNWA 2O30A 2HLAA 3O6FA 4L1HA 3HC4L 4ODWB 1NAMB 3ZDWA 4N2DA 1Q8MA 4ZMYA 4JM4H 5A6MA 5CZRA 5DQ9A 5CBAA 5T3ZE 5CN3A 3GEWB 3VDBA 4JN1H 5GGSA 1IGTB 1M1XB 1PLGH 2IOMA 3CIQA 4MJ6B 5FYLD 5HGAB 2X7LA 5AZ2L 1T1YA 1G43A 3FFCD 1FORH 4ELME 5A2IH 3TCLA 3VXSB 2Y07H 1MCPH 4IS6A 1PD6A 1PTZA 4JJHA 4JPKH 4KK5C 2WLHA 1IC7L 1IM9B 2BSCA 4OM1L 2V2WB 4PR5B 4RFOH 4IIQB 4PS8A 5KVEL 3IE4A 1GC1L 1V3JA 1F4XH 1QO3A 1XR8A 4LRIC 2C26A 4LVOC 2AC0A 3NIGB 3DO7B 1IVTA 1QSEE 2R51A 1Y0LB 4N24A 3S98A 3JWNE 1A9BB 1CGSH 5ECGA 4ZS7H 1YHPA 4NUGH 4ODUA 3VXUD 4ELMB 1KB9K 2DQTH 3OR7B 3CZJA 5CN2A 3L1OH 4QJ3B 1TCRA 4ZTEA 3BUIA 4Z78A 3LRHA 2Y2YA 7FABL 4ZS7L 3UTSB 3DX6B 1E4XL 2BSSA 5EZPA 1RIUH 5T1KB 5F9WC 4P5MA 4OLWL 2OFQA 3DECA 5KN5B 1TKWA 2N3JA 2MRYA 2YPKB 4P06A 4AEIH 4E2OA 5BO1H 3T9WA 1P4BL 4KKAC 4A37A 1J11A 1KCUH 5F0PB 4HOZA 3MLWH 4FLHA 4HCIA 4MQXC 4NKMA 4TYUA 5IFHL 4Z78B 5F3BA 4H26A 4LCWE 4XXDA 2QVFB 4BZ2H 4YXHH 1MI5B 2NQCA 3NPSC 4DTGH 1H3PH 2Y7OA 4HPOL 1MCLA 3TF4A 3QUKB 4PS4L 4JG0H 4KK8D 3RX7A 2AJYL 3WIAA 4L8BA 4TN9A 3HW7A 1JI1A 5IMMB 1N64L 1PAMA 1IEBB 5GGUA 5E08H 2XN0A 3G5YA 4GAYB 3SO3C 3GB7A 5I1KL 4C83B 3EFFA 3EH1A 1AZZC 2YJQA 5AQ0A 1J87A 4TUJB 4PJFF 1KCVH 4HGWA 3BWZA 3QH3A 1QSFA 4QNPE 4Q56A 4OBSA 5K33A 3LKPA 1JGLL 2CG9X 2EXYC 3Q7JA 4NZJA 4CDHA 3FT3B 2ZP8A 4IMLB 5JZ7C 2YUXA 3QUXC 4UAOC 4LOUD 4XX1E 4ZUWA 1BIHA 2DWYA 3QBTB 2YR3A 4ZZKA 3WIFA 2BSRB 3T77B 4LSQH 1HHGA 4KKQA 4O4YH 3GS0A 3HLKA 3GS7A 3NH7H 3IFOB 4G70B 4NNPH 4CC0A 4DN4H 2BS71 2AJZA 5D7JC 3F01A 3WO3B 3L1GA 3MLSH 2Y25A 1QSFD 3ESMA 2ERJC 2VE6B 3D69B 4KPHL 3IDGB 1P5UC 2JKJA 2NY5C 2XSKA 4N8VB 1P9MA 4JZNA 3OJDB 2PCPA 1B9ZA 1BJ8A 2EABA 2VYRE 3B5TA 3QFDA 5KS9E 2J3SA 3TVMB 4L4TD 1FNLA 1UUSA 3I2CL 4RGNB 1HHGB 4M93C 2DDQH 4KVCL 1BGXL 2NUTA 3U30C 5IW6B 1FO0A 5FFOA 3ULUH 3CPLB 3ZMNA 2XN9E 2DQIH 3S9DB 1OPGH 3TXAA 4AUJA 5C6TL 2HN7B 1KUMA 3EF7A 3WNKA 2XQYA 1E9QB 1NCBL 3P02A 5KAQF 3TBWB 4M6AA 1L7TH 1QFWH 4IK6A 4WW2C 1AJ7H 4X7DC 3EJZC 2VDRH 1PCSA 1WS7A 3QORC 1TJIL 3QXUA 1UOKA 1Q94A 2VMJA 3DOSB 3KL0A 1CI5A 3FS9A 2LGNA 4AQOA 1GYWA 3A6BL 2ZOLB 3F7VA 5C08E 3RBSA 1KEGH 1JXFA 1ROWA 1ZTXL 1M42A 1BXAA 4FHKA 1KTKE 1T4KB 3G9AB 4ODTH 3D0VB 1GZHC 1GOFA 3ALWA 1AMXA 3GHPA 3PP4H 4AKQA 3NYKA 1RUQH 1Z0MA 4N28A 2E47A 3QDMA 3H0TA 2NQ3A 1PVHA 1MCNA 3MRLB 4ZD3H 3LN5B 4LK4A 3A4DA 1JK9B 1M7DA 4HCRA 4U1LB 2QGDA 5IJCC 4GRLB 4L1SA 3D6GA 3U2IA 4CNIB 2A6IB 3FFCB 3ZJAA 3PHQA 4BKSC 8CGTA 3FO0L 5IVXA 1G9MC 3MBED 3JVGC 3V0VA 2F53E 3UZVB 1RZGB 4RLDA 4IBUA 3KDPB 4KK5D 2GYSA 1FSKB 3N1MC 2WQWA 4BQBA 3CDZA 5AKSA 4OGXH 2YLHA 3GI9H 4M4PA 4RMQA 2XN2A 2D3NA 4BYHA 4P5TA 5LWYH 4QY8B 2YQBA 3O4LA 3L1EA 4L3CB 4YFDB 3DX7A 3VXUB 2CBMA 1XGPA 3ARFB 4UV4H 5E4OA 4OM0H 2F54D 5C0FA 4JANB 5E4EC 1U42A 2VGLM 4KQ3H 1SQ2N 3OHXA 3D05A 3B2DC 4MD0B 3VXMB 1RVFH 2WXIA 3P3SA 2EXSA 1F13A 5JPMB 2Q76B 2UWEF 4G9DA 1FN4B 2HFFA 3L5HA 2K70A 4L3ED 3PUUA 2Q6WB 2DRUA 2GJRA 2YAMA 3L7EA 3VFUA 3L3DA 5B3NA 2YD4A 3MRBB 3UADA 1CFSA 4S1DD 5C0CA 3MRQA 3WUWA 5D2NC 5J5EA 4FOMA 1DQQA 1G6RB 1OIOA 2L4OA 1QHOA 5CSZA 2FTAA 3KGSA 2WQSA 4UNVA 5T5FH 3WJLA 5HVGB 2R0ZH 1ZEAL 1UENA 4YGVB 1QFWI 4YDLC 5L9DH 5ICYB 5DD3H 3G6JF 2EDOA 1H3WM 1G6VK 2JIXB 3ARBC 4UQ3B 2EDDA 4E9RA 2J56A 2CHZA 2I24N 2H9GB 4D0CB 1HWWA 3LZNA 3RDTB 4M48L 3MV8A 1MCBA 4N1CA 5SWSA 3WIHA 1TPXB 4HMEA 4R4BB 3LMJL 3RUGA 1ID5I 3DX3A 4J1UB 5D1ZA 1A8ZA 1KTBA 1PIFA 2EXYD 3VVVA 2QR0B 4YEEA 1QLEH 3NCYP 5E2TH 1OP4A 1E5YA 2Y4SA 4ZPVB 5EH1A 5IBTL 2AK4B 4Z7VB 4HF5L 1JGUH 1KCSH 3GZQA 3I50H 4L8SA 4OGZA 4DF9A 3SE9L 3ET9F 1OW0C 1I9IL 3EJUA 5DWUL 1VAHA 4ELKA 3U36A 2R2CA 3HN8A 1GGBL 4NZTH 3UC0H 3WS6C 5EF3A 2PCFB 3TBBA 4KDTA 3VI3F 1AHWB 3FU6A 4YO0B 4AJWA 5KYUB 1BAGA 3B3IA 3O8XA 1BQKA 1E43A 1OGAD 1VZIA 5DUJA 2VR4A 4KHTL 1XFPA 3F64A 1R3JB 1ID2A 2XRAH 2HZHA 4TVSa 2X3BA 4ES8A 1BVOA 3V6ZB 3VE0B 4I48A 3UERA 1MHEB 1JTTA 3HVNA 2EDEA 3QQ3B 2XX0A 4O02L 3THMH 1LK3L 2EDFA 3D1MC 3E8UH 4KVCH 4AMXA 1YNKL 2G4EA 4EUPA 1INEL 1T83C 4JFVA 4JFPA 2C9XA 4N2BA 2XVKA 4XXCC 1D9KC 4FQLH 4M4RA 2CLRB 3ZR5A 4M7LT 5MERB 3NCBB 4CVZA 3IJEA 3QQ9C 1JZDC 3EBIA 1T1ZA 2RCSL 4O2CB 1CQKA 1JGVL 4U1LA 1A9EA 4MD5A 2Y6TE 3C60B 4XPHL 5EBLB 1X4XA 4K2UL 4GKSB 1VFOA 4PUBH 5J6SA 4NPKA 4AEIL 4KUCD 3UAEA 3DGDA 3ARPA 1HH6A 2YPLE 1WWWX 3ABLB 3O2VH 4TL4A 4B96A 1IGJB 4N0FB 3LZQA 1BDYA 3B9AA 1P9MC 3WGVB 3QE5A 1IBBA 4UOW1 4BQ6A 5TE4H 1CVSC 1KIUB 3LV3B 1EHXA 4Y16A 1KGJA 1E2WA 1QW9A 1Z3GL 1UJ3B 2BSDA 4HKXB 4OGQC 4PJ9D 5ECJE 4B9IA 3QEHB 1JFQL 1X5YA 1A9EB 1A3RL 4RRPG 5J11B 2G75B 3VWKA 3VMPA 2Z65C 1S9XA 3VWJB 3FRUA 3TBVB 1A4AA 1MG2C 3FU7A 1WEJH 3NEXA 3VWJC 3FB8A 3D39B 4NC1C 4PRAA 3DSFL 3H4HA 4X6DB 1VFAB 4NN5B 1G6RH 3C9NB 3D18B 1AG6A 4X6CE 2X4NB 5JIDA 5FAAA 3TIDB 4ANXA 4ZW8A 4H20L 2JF1A 2P48B 3V4VH 4HKJA 4F3FB 3A6CL 5T1LD 1JNNL 3Q6GL 4NSKB 4WO4C 2DKUA 1F2QA 4FFZA 4KTDL 1GL4B 1TJGH 1ZA6B 2W60B 2DM7A 4KROB 4H8WC 1AQ8A 4TNWF 1FFPB 1CC3A 1XEUA 4ACPA 3HS0A 2DQTL 4Y2LA 5PAZA 1HEZA 3WTTA 3BP5B 3OXSA 4P23A 3MV8E 4B9GA 3S5LG 2WLZA 4TV3A 4HC1H 3CFCH 3GXIA 2TRHA 4HWEL 5ICYA 12E8H 1Z5HA 2EECA 4GUOA 1EFQA 5LNDA 2BWQA 1LYQA 4JFTA 4TNVK 3S8GB 2LU7A 2Z34A 4RZCB 2TSBA 5I66B 3H6JA 3QEGH 2Q2EB 4AQAB 2CMRL 3UAJA 5JXAL 5JDSA 3JWDL 5EWIH 2AV1A 4ADIA 2J21A 2LOEA 3QEQE 1KZQA 5FOBB 4Z7WA 3CQPA 4I2XB 3WY3A 5MENB 3AG3B 1OF2B 2ED7A 1BIIA 5HHME 4LSTL 3T2NL 3MCLL 3BSGA 4JM4L 2BNQE 4N2OA 1YY8B 2A4EA 3TN0D 3IJSA 3KJ4C 1GYAA 5EEYA 2Q7YB 2CXKA 3WEOA 1I1RA 1FORL 4DH2A 4H88H 3MRHB 3DBXB 3QXDB 4FYTA 2WIIA 2ZWSA 2R8SL 5I1AA 2FGWL 4WTZA 3EYSL 2FATH 2COVD 1FGVL 2A73B 5LVEA 1T3FA 5F0MB 2E86A 3QCTH 1L0PA 4GNKB 4TNGA 5CCJA 1TJXA 3DC0A 2GHWB 5EZLB 3FTWA 4JY4B 3FQNB 2X3CA 2X9YA 4PJCF 3WDIA 4NT6B 2VM3A 3FTXA 3HC0A 4JQVC 1N26A 1E4HA 3OQ3B 2FGWH 2ZYIA 2HAZA 4N90D 3RL1B 1THAA 4IBVA 1SOKA 1FFTB 5GRWA 3IDNB 3QUYD 2D7TL 4OGAD 5JA9A 2G5UA 2OMZB 1KG0A 3CSYA 4XMPH 5C0AB 1X5GA 4IU2B 5CLZA 2ZKMX 1XIWC 1EFXA 4NKIH 5K59E 3T2PA 3SCMB 4L8CB 3BP6A 3EZJB 1T04A 1TQVA 2YD2A 5I5IA 3T3ME 3X1BA 1NGQL 3FAXA 3ABKB 3IJHB 1U8LB 3O2WL 1KLUA 1DUYA 1HEJC 1SF3A 3EG9B 3KCPB 1LDSA 1H6UA 1JDAA 2WTOA 3JSSA 3X11B 1HNGA 1RHHA 5HP5A 3ENEA 2A9NH 2YA0A 4FG0A 4A63A 4HP5A 4EZKA 2VISB 4MAUL 3BH8B 1HXKA 4HFUL 5E24E 1LWRA 3JWNG 1IE5A 1R24B 3GSVA 4JKKA 4IM8A 2NY5L 2O5ZL 4J6RL 3H7BB 1UG9A 1JERA 3AS0A 4FQ1H 3VTTA 4A2FA 1G0XA 4HC1A 2E59A 3L7FA 4LAQH 2V8MA 4N6RB 1ZS8B 4AI7A 2F74A 4PJIB 1L0YA 4U1HB 5BV7H 2XQ0A 3BP7A 5ENWA 1F02I 2W65B 1S9KC 1JPSH 2WXNA 3C09B 2Y2WA 2E9GA 1QKZH 2MMXA 1WTGT 1YQVH 2AQSA 2OTUB 4MMZA 4OF0A 1CBVH 3VFVB 1ECZA 2IBZX 1J1OL 4D0DA 5K9OB 1AH1A 4Z7VE 3HN5A 2ALWA 3ZRFC 1NCOA 4Z7QE 4Y4FD 3ZT5A 1D5IL 5AVRB 25C8L 3V55A 3VGEA 5AVYB 1NAKL 4G11A 4X5WB 3TO4D 2GI7A 2KERA 4R2GB 1NFIA 1I31A 4FHBD 1FL6B 4KRMB 4LPCA 5EEVA 1C16B 1PG7H 1OCCB 5BXFB 3TFKD 3IDGA 1NICA 3QZPA 3U1SL 3QWOA 4ZO6A 1HILA 1FFPA 3IMUA 3P11H 3ZRSA 1CJYA 2ZCKH 4EI6A 4E0RB 5KANI 5DJCA 1AC0A 2D7TH 3NA9H 4G6MH 4YSPA 1WZKA 4OJAA 3Q1SH 2NUTB 1IL1A 5IW6A 4YX2H 3K4ZA 3F7PC 4LL4A 4B7LA 1M1XA 5I1LA 4D9LL 3BW9B 2ITCA 1A9BA 1HWGB 4P46A 1TEYA 1YMHB 2OKMA 2UZXA 4XNQB 2BP8A 4Z0BH 4MAYB 4YOKA 3TCLB 1A0QH 3SKMB 1ZLSH 1NMAL 5BUAA 3LKSA 1MFVA 1QTYT 4FL4B 2SEBB 2NY1C 2BW5A 5DJCB 1PW3A 1CICB 2V2WA 1IKFL 3HI1B 2OI9B 3T6VA 4QHPA 3DRQB 4GQ9H 1VEOA 2DKMA 2QPSA 4A55A 1CB4A 4CC4C 1KPRA 4FTVA 5DEJA 4XPBH 5HTSA 5C0CE 3QUMH 3UX9B 4BSWB 1KCWA 5DQJA 2J8UE 4OAWB 3CDGA 3QXWA 4YEFA 4PV9A 4LAQL 2B15A 5DYOA 4JQVA 4BSVA 4OFYA 3B9KB 3BEVA 3PUCA 5C7XH 1RLWA 1OWWA 4S2SA 3DRQA 1CGXA 3GSNH 2GC4C 4K4KA 2E27H 3KL5A 2JKIS 5JMOC 3CXDH 4KRPB 1J1XL 1DYZA 3AWFA 2QVMA 2VXUL 5DK0B 2PPFA 3ATAA 4FS0A 4GT7A 4PJGB 4S0TD 4TULH 3UBXI 2QKIC 2IH3B 3AABA 5BMFH 4GG8B 1NMCC 1BMWA 2OJEB 1WA1X 3HR5A 4I0PA 4IEFA 3FF8A 4FQ2L 2EYSB 4CL7A 1J5DA 5ETUA 1UYWH 2NY4C 2NPLX 4X50A 5FM4A 2EIJB 4KJWC 4QXWA 2VTFA 1T1XA 1PMYA 1U95B 2DQCH 2DS4A 5T1DL 4WJ5A 4QTFA 3NCYS 3QO0A 3HRZC 4JUTA 4WWID 1VCAA 4TS6A 5F9AC 5GS0L 5HYJB 1A6TA 2OMTB 5TE6H 3O4LE 5DZPA 1F11B 3IBOA 4N2CA 5E9DE 1QHQA 3X11A 4OZFG 4Q9BA 5D8JL 4LXFA 3EJZD 5MP6H 3ZUNC 1MFNA 4YDIL 1ETB1 3QXAA 1HQRA 1QLFA 4GS7C 3FU0A 2OW6A 4OGAC 5C07E 4RIRA 2FSDA 3D48R 3HMXL 1E30A 1CDGA 5KEZA 1ZJBA 1AKJA 1WEJL 1QACA 4GW4A 4Z0XA 4OU3A 1KLFB 5C92A 3OF6A 2HA1A 2UXGA 3C6LA 5DJZA 4MJ5A 5D6DC 2E7CA 1BBDL 4U1KA 1M05A 4WW2A 1Q0YL 2UYLA 3KHQA 1KYAA 1WAPA 3QFJB 5GGQH 3KPRB 4LLYA 5E2UH 4JG9A 4W9IC 5ABZA 3KYOB 4BQ9A 1P2CB 2VDNH 3B7SA 3HPJB 3WUWB 5TF0A 4PRHB 4Z7NB 4FI8A 1YRKA 4OJFL 1YPZA 3A6OA 1JYNA 4JFEA 1ZXQA 1NGPL 4XP6H 2HN7A 3HTLX 2GUYA 4GQRA 1NC2B 3SDCC 1VFMA 3FQUA 3L95A 4PBXA 3NZSA 4W6XB 4BEIA 2HVJA 3BGAA 4TLSA 2JJTC 3H9HA 2BRQA 4FFWD 1INDH 3BCFA 5EF0A 4LSTH 4YNYA 2P46B 2XZZA 4LL9A 1AOHA 5E1AB 2X09A 1U93B 4BZ1L 4X4XA 4HQQH 4MA7H 3KVQA 5HJBA 4D9QE 1JHKH 2XY1A 1MF2L 4PQXA 1CDIA 1TLMA 1MAKA 2RR3A 1KN4H 1MCEA 2YXVA 4HUKB 4O5LH 3R1GL 2A1WL 1SXAA 1THCA 4UANA 4XNZB 1L9RA 1VACA 2QVKA 3FT2B 5CMAA 3T8VA 5T1LA 3U0TA 1E9QA 4LEXL 2ED8A 5HI3C 3NAAH 5D5MA 2OMBA 2VITB 3TNNB 5BRZE 4Y4FC 3QVAA 3G08A 1E7UA 3WSQL 1T7VA 2BCMA 3MACL 4M29A 1WD9A 1Q94B 1QAWA 2WLLB 3DOSA 3VSVA 3KNBB 4WUUB 5DLLA 1LTXA 3VXPB 4G6JH 3FO0H 4ZOBA 3HEIB 3PFUA 4ELMF 5F9WB 1Z5LB 5TE7H 2D9CA 2FLBT 3E3QE 4JBSA 1MCOL 3X1FA 4HA1A 2CBOA 3HN3A 4WW2F 3KJ6L 2OCFD 3HB3B 5IROD 3U7WH 4JY6A 2GTWA 3K46A 1U8IB 2YGOA 3HG1D 1A7BA 1S7SA 2R23B 4YS4A 1UZ8B 3TO2A 2AERT 2NY2C 5CP7B 5DJXB 4HEME 4F9LC 1SJXA 2F5AH 3PHQB 3KYAA 4WVRA 3L9YA 2PO6A 4R84A 3PP3H 5DRNA 3RIFF 1IU1A 2EVGA 1RFDL 1DZBA 1GZHA 2ZUVA 4DEPB 2NY1D 4GFXA 4F9PA 3MRPB 1JZ5A 4W9CC 3SPJA 4P9ML 4QHUB 2XG4B 3W3BA 1Y18B 1XGYH 4QY8A 4X98B 3T0BA 1R3LA 1WQVT 3WN6A 4CKQA 2F5BH 3EDKA 3OKLB 5JPMA 4UQ9A 3AREA 1F42A 2OJZH 3EDFA 2DQIL 3LRMA 4P4KA 3IMSA 1WIOA 3GSRA 5BS0D 1KB9J 1G7PA 2APWA 4LMQI 3RWFB 4I4WA 2VR6A 3ZTNH 4FQIH 4GO8A 5LGHL 1JD9A 3Q8EA 2NW3A 4KRPD 1OGTB 2XWRA 2I9LB 3L2MA 3RVWC 5TPWH 3VRJA 4B3VA 1F58H 2YS4A 2ADFH 1O6VA 4W4OA 5CAYB 4AJ0A 4LRNH 5EUOF 2W07B 3QZNA 5SWZB 4X6CF 2YRZA 4FQIL 2APTA 2E7LC 2VXQL 3NN8A 4U4BA 4YFLF 3ZE1B 3SD2A 4F7CB 5J1AB 1MW2A 2Q7NA 3GMMA 4ZPTB 3CZKA 4GG6B 1URZA 4YFLI 2VZOA 1HSAA 3TIEA 2FNBA 1SN5A 5HVWA 2EDQA 4XGZA 3CZFA 1T4WA 4L4JA 1K85A 1W72H 1ZA6A 2W60A 2VT0A 3ZGIA 5DUMH 3O6FC 4ODXA 3D07A 4M5SA 3QORB 4PJAB 1K8IA 3EO9L 3QC5X 2FWUA 1KFGA 3OAWA 4NZTL 4PJXF 4U1SB 5D7JB 2EUVA 4X7CC 5DJ6B 3LH2L 4IRZA 2PCFA 3DBSA 1JV5B 4YDIH 3MODL 2ICWJ 5DD0H 3MV7B 5GGRY 3T1WA 3FQUB 3L95B 2DD8L 3GSXA 2VLKD 3HLAA 1PLCA 1Z9LA 3QW9A 4R9HA 1MCSA 1Y7VA 2L04A 3NFPA 2FIKA 2O5YH 4HUMB 3KLDA 2GW5A 3QO1B 2NX5A 3VE0A 2CO6B 4JFYA 4G8EA 5DYFA 2X4RA 5EO1B 2G0KA 4KJPC 4C4BA 2YZ1A 3O9WB 3D9AH 2XKSA 5D9SA 2UY7B 5IBUG 2W1NA 1NIAA 1HI6A 3QB7C 4RQQA 3AQDA 3CUPB 1B90A 1DBJH 1A6VL 1L9NA 4PRPE 2HRHA 3V0VB 2ZXAA 3SDXA 1ZIBA 1KLGB 2OP4H 5ESVB 4PMEA 4PRIB 3JVGA 2E7DA 1N7ML 1D2OA 4KQ0A 43C9A 3PGDA 4UBDD 3IKKA 3O3DB 1B0WA 1V7NH 5DMJB 4K07A 4NUJB 2IANA 1TOXA 1KNOA 5DMYA 5E9DB 2JWYA 1BEYL 4XT1C 5D1QA 4YHNB 4QO1B 1CGWA 3UAJC 5ACZA 4ZO9A 4LLUB 5KZCD 1MFCL 1E4XI 3G5ZA 3W5NA 3GIVB 2LHAA 5GGSY 3CU1A 5C07B 3RB5A 4W1TA 3FT4B 5E4EB 1EXHA 4QAMB 3OMAB 2EXTA 3KPLA 1MAML 4TUKH 3D4ZA 2VUYA 4AVKA 1N59B 2NZIA 4S1RL 1I7ZB 2Q76A 3EO0A 3NIGF 3WKMH 1J0ZA 5IWLC 3QJFB 3RWCA 2CM5A 2XI9A 4PLNC 4N0FA 1CU4H 1DEEB 1KXVC 3LNGA 4NQUA 4RWHA 3RYMA 3PP4L 4PJHA 1DL7L 5D96B 3BE1H 2O5NA 5DC4B 3G5ZB 5EDXA 2UY6A 2OR9L 1UYWL 3RWDB 4O4YL 3WFHB 2VLJD 3OL2A 1B4JH 1JWSB 4JE4B 2VR9A 5E7BA 4HOMA 2E6QA 2GBTA 3MNWB 1AYRA 4LMQE 4I3RL 4K7PH 3U46B 5K59F 4JKPL 1DVTA 4HV8A 5HGHA 5E2UL 4HVBA 3QUXA 5IGXL 1HWHB 1U8MA 3KPSB 1D5MA 3O41B 4NZUL 5MP6L 2HG5B 1E5AA 1FFQA 2VDOB 2WAQA 1HEZB 3I2CH 3RIKA 3JTTA 3ZTCC 1B4RA 3DYPA 5AUMB 4CJ1A 4XCNA 3FQRA 3SPHA 1T80A 5CHNB 5FR3A 5I1DA 3VFWA 3NFNA 1GY2A 2X6AA 3I9IA 5HI4C 3VXRD 1U8KB 3QUXD 5AOIA 1U8MB 4AMWA 3TPKA 2AMGA 5IQ7L 2V5MA 3KHOA 3L5WB 4ZI8A 5CILH 43CAA 1ESOA 3J07A 4LSVL 1TQWA 2FX8L 5DMKA 2NSXA 3BYYA 1OARH 2WBJB 5F7MC 2ERJB 5DHVH 2ZF9A 3HUJA 1CFVH 1YEIH 2R83A 5I5MA 5IR1B 5IW3A 5KBLA 1SOXA 2Z4TA 3B3IB 3SGDI 2O1AA 3H7LA 3TLRA 1J0YA 3CXDL 4DKDC 2E76C 3IN2A 4GOSA 3VFPB 5CR8A 4NQSA 4NUQA 5DEZA 3UTZB 3GO1L 4DGIL 5IUCA 4L1DA 3O3BA 1HAWA 4AV0A 1QQDA 5JW5A 4UIKH 4X4MA 3RDTC 4HISA 4YDVB 3VI4A 3V8OA 3SE3C 2FUQA 1A1MB 3WKQA 3K71B 4YQXL 4AQ1C 1TJHH 3W9EB 2ORBL 2JLLA 5HHOE 4A1RA 4WEBH 4ZRGA 1E8ZA 3BZFB 5IB1A 1HHHB 4LASH 3P3RA 2I07B 4LCIH 4AENB 5AOZA 4XCCH 5E2WL 3EYUL 2NYYC 5TE6L 1FJ1A 1IGFH 1KC5H 2ROXA 3HI6H 4ANVA 1FZJA 3O3BB 2E9IA 3O6FD 4P57A 4OLYH 3WCYA 2Z93A 3HC3L 4WI7A 4M61A 4NYLB 3QJHB 1MH5A 1AGEA 2EIZA 1D5RA 1WUZA 3MX0B 3MDJA 1QTPA 2FYYB 2XWTB 2OYMA 3P73B 1HYSD 2Z64C 1IGFL 3HI6L 2W80C 5SWSE 1KLGA 2VR3A 4XPFL 5DQJB 2JSFA 2X53A 3GIZH 3WKYA 4YDZA 2VUOA 2J8UB 2V9RA 5IB5B 2R2HA 1YVLA 4A38A 5EC1A 1RERA 5GGQL 4Y5XA 3TO4C 2VSKB 4NRZB 3O2DA 2G75A 3CCHB 1OHZA 2VMCA 3HAEH 4GRLC 5FUOH 3NSJA 1WISA 4B7IA 4E41A 4B0MM 4M1DL 2PTUA 3HIZA 5KOMC 3HMWH 4P2OD 3QIUC 3D85B 1BJ1J 3ARDC 3FTSA 3TASA 1I9JL 3WO4B 5EOCJ 1IC0A 1CE6B 4PRID 3K6OA 1OAYH 4X6DF 1WBZA 3BUYA 4TUOA 5DZ9A 3GF8A 3RIFK 4R90L 3FT4A 4ZX6A 3FTZA 1MCQA 1A3LH 1OTSC 3GXTA 4I0PB 3INUL 3V0HA 3OHXC 2LR4A 3MRJB 2NT0A 1CXHA 1DJZA 1EJ6A 5DMGC 3MRNA 4XNDA 4IGBB 4GRWB 2QQNH 4PWFA 3WJMB 3BAJA 1E65A 1ZVSB 3MYJB 1WO2A 3F05A 4H0GA 5T1DH 1A3LL 3ZHDA 2UY6B 3B5GA 3MCLH 3S35X 3BPOB 2BCKA 4U3SB 2Q0ZX 2VDQL 3J8F7 3SDYL 5ESAB 3TA3D 3LYRA 1BVKB 1QPKA 3IKCA 3B8SA 3FULA 2P80A 4Z7OE 1JE6A 4O58L 5AYUL 4C56E 1X9LA 1MIMH 3R19A 5C0CD 1FO0B 3TA4D 3CFBA 3RWHB 4H7VA 3B3BA 3EJRA 5C0IA 2CH8A 4DGVH 3O3EA 3QCUL 4F1ZA 2NUPB 3DJSA 3EOBA 4J3SA 4L3EB 4MNQE 2OMUA 1BXVA 4TXVB 4ALAC 2DQDH 4S1DC 2NW2B 3Q1SL 3MRCB 4E9XA 1XCTA 2IBZY 4AM0Q 3ZDYE 3UO1H 1MQKL 5KYYA 4OQTH 4Z7OF 3GPSA 1EERB 2WD0A 1MW3A 3O11A 4JZJC 4URKA 3CSPA 2UUDH 4CSTA 3RPIB 4UB0H 5EU3B 4PJEE 1C12B 2MTPA 1UJTA 2R0LH 2ZQKA 5CWSB 2A9ML 4ZODA 5CSBA 3ARBD 5L2KD 5F7NC 4QXTB 3H9HB 1TZOA 2NY4D 2W0LA 2Y23A 4P04A 2BWDA 3V4VL 4R8WH 1TO4A 2VDMB 1QSED 2J5LC 2I69A 3DUHA 3BSZL 3MKKA 3NA4A 1P4IH 1HJBC 3SGJA 5C0GB 2V3EA 4U4IA 5ESQA 3WXVL 3BRFA 3TFBA 2WQ8A 1LNUA 2XVBA 2B16A 2RAMA 5HI4D 2P5WB 3IXAB 1RIUL 5JIPA 3DDGA 3QDMD 4OAWA 3WBDA 3OD3A 2J8HA 5DURD 5AAWA 1M3IA 4AE0A 2Y06H 1U3HC 1VKXB 5F7LB 1DVXA 1NOFA 4X6BB 1BMZA 2MKLC 1XIWB 5C0AA 1EBPA 3Q8CA 4S2SB 3HJEA 4UT7L 3BAXA 3VXSA 3QJTB 1ZVHA 4K3GA 2MJWA 4WTQA 1PGRB 2VIRA 5E8NA 3H85A 1OARL 4GP5B 1OXYA 2C9QA 2BZ7A 5DTFA 3CC5A 2VN3A 3C6LD 4K94C 1AXSB 4Y2DB 5DD1L 4EVNA 3TF7C 5EUOB 1OGAB 1ITCA 3K6FA 5D5MF 1GGUA 4QHKI 2OK0H 4IYKA 3DWTA 1AGBB 4OCRL 1RK7A 3EOTH 3LRKA 2J6EL 3I02B 3MUY1 4DGYL 4TUJA 2V2TA 2GI0A 3NCEB 3B83A 2CUHA 4Z8FL 1G7HB 4MWFB 4WWOA 5EZOL 3TWYA 1FPTL 1GYUA 5E95B 2IDQA 4WJ5B 2J6WA 1EDHA 3FT3A 3EJYD 4HMDA 3C12A 3GMOA 5LNEA 4N2FA 1XVSA 1U8OA 3QC6X 4JMNA 2A6KB 5L6YH 1UKSA 5LCVH 1U3YA 4X8CA 1ZLWH 1D9KD 2D7MA 2J8UA 1SBSH 1QBMH 4JE0A 4ZW7A 4UTAH 3TYFA 1N5AA 2JQZA 3SDXE 2XY2A 4M8VA 5IQNA 2YPVL 5B7MA 4I87A 1E6OH 2QLVB 5HYJA 3GXMA 3KVPA 1HYRC 3SBWC 1UA3A 4P3DB 1NMBL 2WUBL 1YEKH 4PYHA 1UXWA 4Y8DC 4P59H 4NRXB 4WI2A 1MI5A 4C56D 1MJJB 4JM2B 5GRJL 1ZVNA 1INQA 4KI1A 1JN6A 4DUXA 4GKNA 4V1DA 3I3EA 3MRJA 4PJ9C 4E9TA 4PTUB 2ZKYA 3MMEB 1WF5A 2YXFA 1CD9B 2DLHA 3FO2A 2PO6C 3QCVH 2BM3A 1FZMA 1TZ8A 3LKPB 4AC4A 2LLNA 2MCG1 4XO4A 3BWSA 3NTCL 1RY7B 3HHMA 4KKNA 4N8CL 4MXWH 2KLTA 3VWJD 2PTTB 4F8LA 1KBGH 2UVEA 4G80B 3RZCA 3VYPA 3ZTJG 1U8QA 1RU9H 1Y6KR 4H8WL 1NC4A 4HXAH 4C4KT 1PQZA 3VGBA 4FEMA 4PJDB 4RWYL 2IWEA 1BPLB 1T2QL 2CM6A 4XN4A 4ONFH 3BVNB 1QZ1A 4P2OA 2ITCB 1XD0A 4CA4A 3QDGE 1V7NL 1NUFA 2P5ED 3H1ZA 4DETA 3RL2B 4XNYL 1CXKA 4KROC 4L5FH 2V17H 3D87B 2AJVH 3P2TA 1HHJB 4NN6C 4B9CA 3VMOA 3HOGA 2GTZA 5DMIH 3NFSL 2HUHA 3ZYOA 4FYSA 4NFCA 5HBBA 1W0VA 3UTPD 4XWGL 1DVYA 3INOA 4Z3JA 1USZA 3VJ6A 1ZA3B 3BSZA 3DVGB 2X70A 3AGWA 4XC1H 1MSPA 1XXDC 4UM9D 2QQLH 4P9HL 2F68X 2ZXCA 1NUNB 4BK5C 3G6JE 1IAII 3IGKA 1GYCA 3FH7A 3JV4A 1BQSA 4HS3B 4LHQB 3II3A 4R97C 1U8IA 3TBYB 2AKRB 4PV8B 3HJ0A 3C2AL 3D08A 3QNZA 2K3TA 1BLIA 4QHMA 4WY7H 4DFIA 4KRPC 4Q14A 1A2YA 3DYOA 5JLZB 2VXTH 5LAPA 2G3NA 4JHZA 2OAAA 3O4LB 3PNWA 2XZQL 2XFXA 4P5KA 4A6YB 4I3RH 4X80H 2CU9A 4H5SB 4CILA 2R2EA 3LCYA 2R1XB 3G6JB 1U8HB 1JMXA 1QOKA 1VHPA 3NEOA 4E42B 4AKPA 4KZDL 2GJZA 4UQ2A 3TT3H 5J6GA 4OZGB 3EFDL 4WHDA 5FUCE 3PDOB 3VTMA 3RE0A 2MCMA 4TPRH 4ZUUB 3UDWA 4OCWL 4Y1AE 3LZRA 3N6YA 4LSDA 3VDAA 3E9UA 5E5MB 1CUOA 2ZUTA 3OZ9H 3MRFA 3VG0L 4PLKC 4E9YA 1NEPA 1B0RB 3FPXA 4R0LA 1E9PA 3AS1A 4YSCA 3F7QA 5BRQA 1EGJH 1F11A 2P49B 4IHOB 4YJZL 4YHNA 5JO5B 1YSOA 2FZ3B 2WW8A 3CFEA 1MEXH 2VZUA 4Z7QF 1GA2A 3UIYA 3LQZB 5IJBC 3CFQA 3MLUH 1E42A 2N01B 3CDZB 1T20B 2YWYA 3GRBA 5KJ7E 1E4WH 4GS7B 4HIIB 2D8KA 4U7SA 4MS8C 1DSWA 2FRGP 4OSUH 5LGJB 4MJIA 4CMMB 4JRXB 4XX5A 4F2ME 4HIPA 4YK4C 1AGDA 2AJUH 4P2QB 2NY3D 5I73C 3H42H 2BOBA 5F88B 4YK4B 2D3VA 2R9HD 1GCFA 4U1MB 3KPRA 3OAZK 1TJIH 1TXKA 3ARTA 5I6MA 2XWEA 3H9ZA 1XMWA 1G1OA 3S3BB 5CGMA 4K9EC 5EIVA 1FRGH 1CDUA 3N40F 1J0KA 1B4JL 1U4EA 4P2RA 1YMMA 1TQSA 4NQXB 2JTDA 1CN4A 2YPLA 3KDMA 3IRZA 2L7QA 1NBQA 3U9PL 4P2QE 3MNMA 3UTTA 2QJDA 4Z7WF 4GKNB 3US0A 4J8QA 4U6TA 2ADGB 1CFSB 5IMOB 1EHKB 3KPNB 3C09C 1F8TH 2I60H 4NQEE 4XB3A 1YC7A 1UB6A 4K3EH 1G6RA 3VFUB 1DJYA 1ET5A 1A21A 4ZFQA 3ATDA 4PU2A 3NFNB 2Y1VA 4UTAA 2P24B 1N6QL 4XI5C 3TTYA 3GMRA 4WQOA 2XN9D 2IADB 3QJSB 3U6XA 4ODXB 3GMNB 3FO9A 1A25A 1BYPA 4JFXA 4S0HA 1VDGA 1BWWA 1PL3A 3MZGB 2WQUA 5AAMC 5H37G 5D7JA 4F58L 1E5UI 5LWYL 1I8IA 1M9SA 2ZTBA 1JV5A 1OO2A 4IRSC 3FK3A 4J6IA 5EUOE 1J8SA 3KLSA 5FO9A 3UO8B 3L3IB 1UD4A 1G87A 3MBEB 5L0QC 1JZ4A 4JY4A 3CV5A 3U0WH 2BIQA 2Q3AA 1OP3K 3QA3B 3UACA 1OAJA 3ILQC 3BVUA 2BJML 2YAHA 3ASOB 5EO1A 4U1GB 4U1JA 3VSQA 4K5NA 2GFBB 2AEOA 4MNHB 1U30A 4GUPB 1XCQB 2ZSVB 5AZEH 1WCQA 2K8MA 2KYIA 4XVTH 1IFHH 4MZIA 3FYIB 5BW7A 4ALAH 5DK3A 1T22A 2CK0H 3IFPA 4G72B 4AVJA 4ES9A 3EOYG 4ODTL 2C9RA 1T0NB 3MVSA 5DHEA 4D7BA 1LE9B 3L3JA 4NQVB 4HWBA 2HT3D 5CJXC 4PY8J 4PJFE 3A22A 2HWZH 4BUHA 3QPXH 4ZAKC 2R39A 3KWTA 1E2ZA 4LSQL 1MW1A 1YNLL 3DUSB 3QQDB 3Q44A 3UYPB 4YZWA 1W8EA 1R3LB 5J06A 4HKZA 1KNOB 2ZAGA 1S9XB 4KXDA 3U7WL 5LO7A 3U48A 2ZXQA 4N0YL 4AMKL 5C8JB 3NG5A 3QRLA 4MMXC 5JIKA 2AJSL 2RHEA 2F9BT 2ENSA 2CDEB 1ZMYA 2IDUA 4UQDA 2IFFH 4MGXA 2VJ8A 5FK9A 5KBDA 2F15A 3OG4B 1WFUA 3PWVB 3ULUL 1KXQE 2BVPB 3TEWA 4LLQB 1YECH 3BIBX 4PVMA 4X8JB 5JO5A 4N2KA 3OXRB 3JQOB 4IRJA 4KHXH 4LKCA 4A2DA 3MO1B 3TJEH 5JIQA 3LXUX 3RDTD 3BPCA 4Y16B 2FR4A 4ANKA 1FNEA 5HHXH 5JHLH 3B1UA 5A2CA 3DIVA 3QG7H 1KCRH 4P07A 3RFZB 3PQYD 5CZVH 1QSVA 5B1CA 2WXJA 4DKAA 5CEZE 4FADA 2W9LA 5F7WC 4ZQKB 1UOLA 1JCVA 4QAWA 1RZ8A 2QQKL 4U3XA 3FB8B 5T33H 3O81A 4HS8L 2X4OB 4FERA 4M6OH 2G9HB 3VXSE 4ONFL 1EJOL 1I9RL 5C6TH 1PZ2A 2FEJA 3GJFA 1ORSA 5DEFB 4ONGH 2EYTA 1ECYA 2ZAIA 3IAPA 4MJ2A 2WJ5A 3FUMA 1HYSC 1UHVA 5IR1A 3RA7H 5DR5H 2GT9B 5C1MB 3R1GH 1NA8A 2JCCA 2LVEA 4FFYH 5DHVB 1TVHA 1E8YA 1K6QL 1A7OH 3W39B 3PABB 5KSUB 5A2KH 2EIMB 3PL6D 1FG2B 1AGFA 3G9VA 4XP4L 4GRLD 1QFUH 5KSBA 3HS8A 1XDTT 1XCTB 3ISYA 5CBEA 4WNJA 4MDJA 1T83A 4EOWH 2XBZA 3QIUD 4Q6KA 3M07A 3ARDD 2W9EH 3RY4A 3G5XA 1MNUH 2I07A 3OMZA 3KCWA 2IWKA 5HGDB 1R0AL 4LQFL 5L4MA 4LF3A 3QZWG 3ULVL 2VXVL 3ERXA 1KB5L 3QS2A 1OM9A 1OTSD 3V4PH 3FQ1A 5MHSE 1I85C 3BAEH 3PL6A 2HRPH 4NBZB 4YE4H 4ERSH 3KLHD 2G5RA 4ZMZA 1DN0A 3AC0A 5IP4A 4D9LH 4KJYB 4QXVA 1UFUA 1SMDA 2K4AA 4FXTA 2ZP0T 2DBLL 3QUZB 3ORJA 5C0GA 5KG9B 1WGOA 4QGTA 3KWVA 2OBGA 3DPDA 5FDWA 4MCYA 4U6VL 1WS8A 3A67H 4XI5D 5HY9A 5HI3D 2ZXWB 3EF4A 3LDBB 2F1EA 4PBWD 3S97C 2D7PA 1TEFA 1BGXH 4M00A 5LCVA 5MI0B 5SWSD 3TH2T 4B95C 3LDBC 4FQCH 1TFHA 1QUNB 2BP3A 2VXSH 4NBXB 3ZDXE 5M94B 1ES0B 5ETUB 5FKAB 4A6YL 1N6UA 2FNWA 4TUUA 1BA9A 4ISVB 3LKQA 1I7TB 4XP5H 2WV3A 1SEBB 4FLRA 4RAVA 3CMOH 4KAQL 3KE0A 1E6JH 4ZO8A 5DDHB 1NWPA 4Q6IA 2HPTA 4FE9A 5I5JA 3C8HA 5AKTA 4UDTB 1R3IL 3BZ4B 3LN4A 1XB6A 3L3JB 4NQVA 2VC2B 3BFWA 1T5WB 2BNRB 3IAQA 2OR7A 3ILQD 4HJGB 2ED6A 4N9OB 2C1PB 1U6AL 4QTHB 5D2NB 3QWRA 3BO8A 1F3JA 3FFDA 1OPOA 4PRDB 5DA0B 4WEBL 5F7FA 1VADB 4J3OG 1IGIH 4L2YA 1JDDA 1I3VA 5GGVL 3LPOA 3U7AA 4BH8B 3UCQA 1U8OB 2Y36H 4IDLA 3P2DA 1R75A 3DX9B 3OPUA 3C5ZB 4XO3A 2BCKB 1W8NA 3HG5A 3S34H 1X7QB 4KXZH 2CBPA 1XMEB 3LQAH 5AYUH 4G6ML 2JQMA 4ZAKD 2QTEA 5J7CC 3LS5H 2J1XA 3KYOA 4D3CH 4DKTA 1ETJA 4K3DL 1UWGL 2I9TB 1ETZA 5KBNC 2WJ7A 2K7QA 3D12B 1QG3A 2GUOB 4G5AA 4XP9L 3OXRA 5JZ7D 4M8QB 1AC6A 4NQCB 3T08A 1ZXKA 3VD4A 3ULVH 4OZHF 2ZKHH 4BFRA 2P52A 2H6OA 2X4NA 2ZOOA 5IESH 3WEAA 2G5BA 3OKOA 2ISDA 1IKFH 1N18A 1OGPA 2H0PA 2HH0H 2WBJA 3BDBA 1SUJA 4XCCL 4X9YA 2D73A 3BMVA 3RFZA 2K7PA 1RIHH 2ENYA 4TQIA 4S10A 4AUUA 2UWEA 4WW1A 4MA3A 4JAMB 2FE0A 3LEYH 1CFNB 3E3QC 2NLJA 1AHWC 2PPEA 5EU3A 1I9JH 1HHKA 1J9QA 1Q1PA 4W9KC 1MHCA 3JYBA 3K80A 3CU7A 3MKGA 4AIXA 4C54A 7CGTA 4Q4EA 1AO7A 2PW2B 3RTQA 4YHLL 2E5EA 1AG0A 3NSFA 1HNFA 5D4QA 5HYQB 2YMOA 4HH8A 1HCZA 1JL8A 1I1AB 2H32H 3W9DB 4QRQB 4X5WA 1WFTA 4LPVA 2MPAH 3D2TA 1TPXC 3EIFA 3WXVH 3KPOB 2OTWA 3ZN6A 2WWKO 3NOIA 2WNWA 1A6AA 2EADA 3V5HA 4FYQA 2J20A 4N85A 3KYNB 2GK2A 4Y5VC 4Q74A 1UA6H 5EO0A 5ERWA 3VG9B 1S3KL 3WTVA 4PD4K 3IS0X 3OKDB 2WY3B 4Y5VB 3O2WH 2JI1A 2XPZA 4N5ED 3H54A 5J9PA 5FYLE 4FFTA 5IQLA 2DTML 4BDVB 2ZF8A 1OTUC 4H8VA 4QRRB 4X4KA 4AEFA 3ECUA 5L4IA 5CEZD 2FL5B 4G43A 1YNTA 4X6BA 4ZYKB 2P5PA 1TTAA 3QORD 1QFUL 1TTUA 1FL5B 3G5WA 5L8LB 5ESQB 5FUZH 1SYSA 1NDMA 1A6AB 3NIFB 2VIRB 4YSQA 1TCRB 4YDKH 2XZAL 2AJ3B 2W9EL 3H3BC 5G55A 4A2LA 1P84J 3W2DH 1NAKH 3FTVA 4ODUB 1LP9F 4ELMA 5IQ7H 2AJXH 1DFXA 1EUTA 3APCA 5IK3B 3PL6B 3RA7L 1TJHL 4PGJA 1BYOA 4P5MB 3BVWA 4PRBB 1D7FA 3BDYL 2ZX9A 3G6AA 5KOVC 1QNIA