3MCYA

Crystal structure of fimh lectin domain bound to biphenyl mannoside meta-methyl ester.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FimH
publication title Structure-based drug design and optimization of mannoside bacterial FimH antagonists.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Carbohydrate binding protein
total genus 33
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 3mcyA00
2UY7B 1N12A 3ZL1A 5FWRA 4AUYA 2XG4B 4X5QA 5CGBA 5LNGA 5JQIB 1N0LB 2J2ZB 3BFWA 5F2FA 4XO9A 1PDKB 4AV5A 4CA4A 1KLFB 4AV0A 2WMPB 4AVKA 4XOCA 2JTYA 1TR7A 4J3OG 5AAPA 5LNEA 4X50A 5IQMA 4J3OH 4CSSA 1KIUB 4X5RA 1UWFA 4XODA 4AVIA 3JWNE 3ZPDA 3JWNG 5FS5A 4XOAA 4AUJA 1ZE3H 3JWNH 2VCOA 3BFQG 2XG5B 5ABZA 3MCYA 5AALA 4X5PA 4XOBA 3ME0B 4LOVA 1QUNB 2W07B 3BWUF 5FLUA 5FX3A 5AB1A 3ZL2A 4AVHA 3RFZA 4AUUA 2JMRA 4AV4A 4XO8A 5IQOA 4XOEA 4BUQA 5IQNA 4AVJA 4ATTA 3SQBB 4CSTA 2UY6B 4J3OF 5F3FA
chains in the Genus database with same CATH superfamily
4L0ZA 1U8PA 4MDIB 5D1ZI 1OM3L 3MRIA 2IANA 2YARA 3CLWA 4NXSA 2VQ1A 4HKXA 4PR5A 1RZ8A 2OQJB 3DUUB 3U46B 1G0YR 4GB9A 1PKOA 1P4BH 3P77A 2X1WL 3CLEH 2VDPH 5C0CD 1BSIA 3ARGA 3GMRA 3K4AA 3SY0A 2FQDA 2VXUL 1OZUA 5HI5D 1E4WL 1MAMH 1JGEA 3GBEA 3GI8H 3SDXA 5I15L 5JO5B 2VIRB 4JANA 4MJ5A 1ZHLB 1OARH 4UT7L 1T7VA 3HZVB 1LEKB 1OAZL 4NUPA 4O02H 1RJYA 3ESUF 3MGAA 2FIKA 4LRNH 1WBZA 2WZ6A 5FV2A 5HDBF 3V7AG 1KTCA 5JPNB 2OYPA 5DD0L 3PAVA 3BAWA 4HKZA 2Q8AL 1JUFA 5KVEL 1XCTB 1FFPB 2P5WD 3D0VB 3C08L 1RPUA 2V6HA 1I8MA 2EH7H 5IFHL 4TOYL 4F3FB 2A6KB 4AJ0A 4Q4IA 4LLUA 4NQXB 4PRAB 3C6LD 3ASWA 2XQYA 3VA6A 3VMOA 4FA6A 5MEPA 1ZANL 3ELAT 4JRFA 1NMCC 2MH4A 1LJMA 4FA7B 3GJFH 2CCLA 4IBZA 4G9FB 4QYOA 1M7DA 2DYSB 5IEHA 1BP3B 1QNZL 4AJYV 1NCDH 2NTSP 2I25N 3GBLA 4U6TA 1LGVA 4XVJH 3HC3L 4UDTA 2OA9A 3VFTA 4L3EE 3MLRH 1G9NH 1HQ4A 3RHWK 4OB5L 4HUXB 4IIZA 4NUQA 1P1ZB 1EUUA 1G1KA 2YO3A 3G5XA 1XXDC 1BYPA 1CWVA 4UINH 5E4OA 1BQUA 3ECBB 3UP1A 1IGFH 3AZUA 3FT4B 3CVIL 4ZSOA 3T0ED 1R1CA 5AL0A 4Y4HB 2J8OA 2AEWA 2Q20A 1CFVL 1OP3K 2D2OA 4Q6IB 3ERXA 1L7TH 2BMKA 1KLGB 3MXVH 2XWBB 3L5HA 3FQ4A 4MAYC 4LRIA 3IXTA 4AKPA 2HRPH 4LVOB 4JZOB 2OX5B 1NMAL 1Z9SB 3UTTD 2WWOA 3EBAA 4A2LA 5IJBC 1MOEA 3MRFB 1IGYB 4WO4C 2AJ3B 3BFOA 1FGVL 3CN3A 3LX9A 4PEEA 3QA3B 2B59B 1QFWH 5KOMC 4FMVA 5T33H 1MCPH 2QLYA 3U4AA 1IV8A 3I85A 3B83A 1MXDA 3LH8A 3F85A 2UZIL 1QW9A 2OYKA 5T1DL 1HDMA 3L4YA 1QBML 3KXFB 4LOFA 4BUHA 4FFYH 4YAQA 2O6CA 2VMDA 1PX3A 4YBHA 4AT6B 1QSFA 3P2TA 4P2RA 4C56D 4KH2A 2WCPA 4UU9B 4X8GA 4N28A 5C6TL 3CDZA 4C4BA 2P24B 1NGXA 1X5AA 3D34A 4MDRA 4NN6C 4KI5F 5BZZA 4PVLA 4ODWA 5KVFH 4P5MB 3G6JF 1OW0C 4KKNA 1LK3L 1OSEA 4PJCE 2YWYA 2KI6A 2Y4SA 3ARDA 2A73B 2NX5A 2UWEF 3BPNC 4HCRL 4YJZL 1L6XA 3IDYC 1CBVL 4OGXH 2V2XA 4Q9RH 4RQQA 3MX0B 3U36A 2OMWA 3FHAA 4L1BA 2CE6A 4HVBA 4W9CC 5EU5A 4UV4H 5EBLA 4PJ7F 1J05B 2EXSA 2DLFL 2J8HA 4BFRA 4S1RH 4JO3H 1FBIH 3PWJA 3O8XA 4QHUA 1MF2H 2OL3L 5JUEH 3DX3A 4Y5YB 4RESB 3ZE2F 1VFBB 4KVNH 4QAWA 1NCCH 2ZXEB 3OAWA 1NTDA 2VQUA 1NL0L 4Z7WB 5DJ6A 2DIBA 2AQPA 4FQ1H 5TJWK 3DOIA 1S9WB 1NQBA 2IH3B 4FYSA 43CAB 5D1XD 2GBAA 1CICB 5C0AE 3MV9E 2XKUA 5KBDA 1IBYA 3RNKB 3FUMA 3ABMB 4P23D 1BAWA 4WWKA 1WT5C 3QDGD 4YHNA 4F5CE 4PJGE 3NIFE 2BRRL 1BEYL 3QRGH 4QOKB 3GXPA 2WOYA 4NOBA 3VFWB 4H13C 4M3KB 1MNNA 1VPOH 4J23A 2G4EA 5TDNB 3JV6B 3FSZA 3L17A 1OT2A 1XF3A 4XH2B 4FDWA 4NEHB 4UZGA 5DMIL 1QR1B 1FIGL 1GH7A 2VAAA 5LAXB 4QT5A 3HG4A 4JFEA 1UT9A 3OLIA 1U58A 4HUCA 3QJHB 4IGBD 5D93B 2VDOH 4XNAA 2OTWA 5DU7A 3TESA 4PTTA 5DHYB 2VRQA 1GY2A 5IB1A 4MB1A 1BHGA 2JMRA 2XRAL 4ZMXA 1R34A 3GPEA 5DRXA 1JJUA 3TBBA 1WPCA 3WDJA 1J1XH 4S0SD 3WJJA 3UPRB 1M71B 4HF5L 4LHUB 4HCRA 2EDDA 4KI5D 4TUKL 1XH0A 4YQXH 3FUNA 5DJCB 1QFHA 3M8OH 5AW2B 3KL3A 2IH1B 4PJXA 3CSYB 3NDYE 4N0UB 3MRMA 4OGYL 1NLBH 4N2CA 3MRLB 3FH7A 1T0NA 3NIDB 3ULUL 1PG7X 1ZTXE 2B3RA 2OL3A 3ZL4L 1XZWA 2XUWA 4MCYA 2D4FA 1C12A 3Q8CA 1V7NH 4I1RA 1DQKA 2EDOA 2Y1ZA 4TUJB 4QRRA 2CJ3A 3KLAA 1T5WB 2ZX9A 4U4IA 4X99A 3ZU8A 2XXMB 1ASQA 2YMTA 4FS0A 4R0LB 3VMNA 1NGQL 5D9SB 2GC4C 1QLRA 1PCXA 3RNQA 5J8OA 1FNFA 3GB7A 2XV2A 3FRUA 3PQYD 5K9JL 1A0QH 5E51A 4P2OB 4LCCA 4N2EA 2I69A 2F74A 2BW5A 1BFVH 3H7BB 3F6JA 4JG1L 3KWWA 3BOVA 3PS6A 4JPQA 5F1NB 5GRVK 5LO7A 1ZLUH 4MNGE 1MFDL 1FL3A 1SVZA 4KZEH 1NFIA 1WGOA 4XAKE 1IM9B 3HG3A 5EMYA 3IJ9A 4L29B 4PJFE 2YOCA 2J20A 3D25A 3PWLA 5A2JH 4YDLB 4RA0C 5IIEA 4FNQA 3QDMA 4XZUB 1EHAA 3UBFA 3QS3A 2ZXDA 1OCRB 2QHRH 4XPFL 3DXAE 5GGVH 3DPBA 3ML8A 4LZKA 4P4RA 4PJ9A 2OPCA 5I28A 4JLRA 3RX8A 3WEOA 4WHYH 2CO3A 1OCWL 2R4SH 5JNYB 1T6VN 3V6ZB 2DBLH 2EDXA 5EULV 4D9QD 4M6ML 1BOGA 3VD3A 1YYML 5FV1L 4X4YB 1S5HB 2PO6A 5CN2A 4YS4A 1A14H 4XP6H 4XAWH 3B5GA 4XCYB 5FO9B 1A3RH 2J4WL 1CLYH 4OQTH 3O9WB 1LP9A 2P5EB 2UZYA 1XGPB 4MNQB 3WTVA 4AEIL 2EDFA 3QIUB 2ICCA 2PTTB 2I26N 1RSFA 1AS8A 4M5ZL 4M1GH 4OZGE 4NKOB 2YR3A 3D85B 3FOMB 3GZPA 2AJVL 4WI0A 3CZLA 3JT2A 1S9YB 1ACCA 1WBXB 1HOCA 3EZJB 3TP4A 1QEXA 5AZEL 2EDBA 3ARFB 2W07B 3G04B 3SDXF 3KCWA 4FADA 1CF1A 3BHBA 5MHSD 2GJ6A 4P57B 4PM1A 3ZXAC 5IK3B 5JIKA 1AD9B 4LLVB 3SDDC 4GRWB 2VRKA 3OPUA 4P5KA 2RTTA 3HHMA 1UOWA 4R7LA 1N5AB 1S7RA 1YEDA 2ERJC 5C07B 1BQ5A 3RIKA 4FMKA 1Q9OA 1M2VA 2DAVA 4MD0B 4FN0A 4ISVA 4A66A 3ARBD 4OCWL 1P5VA 1U91B 3TNNB 3FPYA 1ZPUA 4MJHA 4UILH 1BGXH 1MRCL 4BSWB 3OC8A 1YEHH 2WV3A 2OI9C 1NEZA 1WISA 1XGTB 3SDCA 3SGEH 4DESA 1W8EA 4UBDD 1RK1B 4X6EA 4F8PA 3TTYA 4FG0A 3EYOB 3MOBL 4GIAA 3VXRD 5C0RL 4HSCX 3BP4A 1FHNA 3R18A 1BZ9B 1W16A 1E4JA 4H4NA 2H1PL 5I1LA 5DD1L 1U8QA 3F04A 1U42A 5D72L 1Q9WA 1HU8A 1WFMA 1BVNP 1EJ6A 1UT2A 5FF6A 4L0YA 2FYYA 3DROB 3TBCA 4RFEB 5AG9A 2IAND 2FEDD 1MCLA 2HFGH 2ZF8A 3BE1H 4HSAC 4JZJA 5KSVA 3VD4A 2VRAA 4X7EC 3GWJA 1B2YA 2A83B 2UZXB 3QW9A 1C08A 2I60L 3ARGD 1NCWH 3PWNA 4DN4H 1QPXA 3MACH 2J72A 4JGJA 4RGOH 4PB9H 3U2JA 3HZKB 4PWKA 3EOBA 5KYUA 4MMZA 3BDYH 1I8AA 3N1PC 4UANA 1LD9B 3VSTA 4ZXBA 5HYJB 3AQXA 4URTB 3QDJB 5DUBB 1U8LA 1URIA 5FK9B 1DQIA 3L7FB 3R06B 2VH5L 2HJKB 4P9HH 1BJ1H 4XMKL 5G55A 5TE6L 4BQBA 1CFNA 3QR0A 4NENA 4QXUH 2B5IC 4YXLH 3QWQB 3E0GA 3T77A 4D3CH 2XWTB 3TL5A 3RPKA 3S3DB 4LT7A 3GHPA 1R3IL 4HIJA 5TK2A 5EU7C 3MRCB 1QFWI 2WLKA 2FH8A 3QIWB 1K8IB 4HUWB 1RURL 4KOBA 4NO0D 1EA9C 1NGZB 1PDKA 5A6LA 2NYKA 4XB3A 3MLPA 4JFQA 4B9JA 4LVHC 5DYFA 4AYFB 5GRUH 5DGRA 1E0OB 1UM6H 3MKKA 1CGSL 1GJWA 3BESR 3NA4A 4BWUA 4KK6C 3DHUA 1A2YB 2JCCB 4K73A 5IR1B 4GKLA 1A9VA 4N6QA 1SDDA 4MJ6B 1A6ZA 3UTOA 3JTTA 2P46B 4Z7WE 2VDKL 3SE3C 3WTUA 4C55A 4LB8A 5D55A 1ZGLB 1UYWL 2Q76B 4G7VH 5JW4M 4U0QB 3V0WH 4BK5C 2R23B 5E4IA 4F24A 2EDKA 3QQ9C 1XSOA 5EN2B 1O5DT 1RY7B 1LTXA 2APBA 4BZYA 4UQBA 2MHAB 4QOKE 1KACB 1ORSA 5F93C 3WLBA 1GPOL 5JW4R 4KZ0A 5EO1A 3FQTA 2HH0L 1ZTXH 2QKIC 3GO1H 4MXWL 4XCNB 4A55A 2X42A 2ATPA 1KCKA 5BZXA 4B97A 5HPMB 1CF8H 2KPWA 2I24N 3MGOA 2OM5A 4OZIA 3VFPA 1Y18A 1IAIL 4LPVA 4N0CC 5GS1B 1JWMA 3UMTA 2CO7B 4EJ1C 1HINH 4JRXA 5J4MA 1E7UA 4H20H 4X5WA 1Q0XL 4EZMA 5JW5A 4MRBA 1ADQH 4TNEA 3U1QA 4KRPB 4PB0H 1RJZA 1WDAA 4FEMA 2NNXA 5F9JA 1QG3A 4WNSA 4NZTH 1J0ZA 2QQKL 3ZDZF 3TURA 3HMWH 2XG4A 3FOLA 4JJOA 1TUPA 3BPLB 3L3DB 2E9BA 4NWTH 3EYFB 4OJFL 2F7IA 4KH9A 1DUYB 3ESMA 1MCOL 1ML0A 1QSFD 2VABA 4FLSA 4N0UE 4P2RD 3DIFB 2RCSL 2JJSA 5HHPB 4U1MB 2F7PA 3RGVB 3T3MB 5I6KA 2WY3B 2X0VA 3CU7A 4AK1A 4O9HL 2B15A 1JWUB 3B1UA 2KT6A 3PWVA 2P3YA 1YN7A 2Q0ZX 4XXDA 4Z6AT 3DI2B 3C09B 2JH2A 3GMLB 4KO9A 4PJXF 2NLJB 3PJLA 3ARDD 2NX5D 1BXVA 3LPOA 4J4PC 4GP5B 1GC1C 3OKOB 1F11A 2QADC 4LXFA 1F3JB 5JHBA 1I9IH 5ISZB 3KWVA 3TIDA 1UXWA 1D5BA 1IBFA 4ZD3L 4A37A 3ROLB 3T08A 3EF7A 3OKKB 1I8KA 3HNVH 5KYWB 2V7NA 2MCAA 5ABZA 1WICA 4QRUA 3U2IA 4L3CA 1GIGH 2VC2L 2AMGA 2BZCA 3O8XD 5HDQL 1EQWA 3FO2A 4JQXC 3U0TA 3SYOA 1NCIA 2XA8H 4JPSA 2OFQA 2CDGB 3EXLA 3WDIA 2P52A 1GL4B 2EIMB 4FQIH 3OXSB 1QO3A 1U92A 1MVUA 4OH2A 1XGYH 3LNIA 4AGOA 1CQYA 1F8TH 35C8L 4Y9FA 1X44A 2GSGA 3QUZA 4MCNA 5D96C 4PV8B 4B9IA 5HI5C 4WWKD 4PRPB 5EU4A 5GRYA 1RJCA 5DC9B 5B38A 4ZUSB 2XN9E 3MZTA 5CP7A 5DJYA 1YAIA 1CDYA 4H8WH 3CBJB 5E00A 3T4YB 1LM8V 4OQ1A 1AHWB 5KVDE 3UYOD 1LEGA 4UIKH 3O45B 3HC0A 2FHFA 3S4SA 4IBYA 4JFED 2P5EE 1KEGL 2YEZB 3K8KA 1C8PA 4KMLB 4BFOA 4G72B 2IOMA 5IOPA 1RIHH 4WW2C 3NABH 3BWUC 3DETC 4QUOA 3B9KA 1N0LB 3C6LC 5AKVA 4E0RA 1LP9F 2EH8H 3ULUF 2BSTB 3LSOB 2DD8L 2YHGA 4JKWA 2WWKO 3DARA 1VRSA 2F19L 3ABGA 4H5SA 4GRWE 5DYOA 1KB5B 5LG1A 1BD2A 1CD9B 2AW2A 4UT6A 5I74C 4NCDA 5C07E 4EZKA 1QLFA 4QRRD 1MREH 2F61A 4F15B 1H8LA 4TYUA 5E9NA 2HXAA 4H8HA 2ZIDA 1U21A 2C3VB 5GIRA 4J3OH 3T0EC 4F1ZA 1SF3A 1YO4A 1E4HA 4G8AC 3IB4A 3EO0A 2CIKA 1NCUA 3P3RA 4AQEB 3A6BH 1H5BA 4WFFE 4GBXB 4AM0B 1KB9K 4OF7A 2WJ5A 4YLQT 4EDXB 4LLYA 5LCVH 1R3KA 4XODA 4OVUA 2YKKA 2HYMA 4JFFB 2D31B 1NLDH 5DC2A 2WUBH 2IGFL 4RGNB 2VN3A 2DZEA 4I4WA 5FCUL 4ICXA 1IC7H 3F7VA 4AUJA 4K3GA 1YEIH 1AZVA 1KCVH 1GCFA 2Z4TA 3QDMD 1WITA 4HH9A 4K2UL 1BZOA 2R51A 5I1IL 5F96H 4OCMC 4PJ9D 3RILA 4UMGA 3ARVA 5MI0B 5LGYA 5CJXC 3E6FA 3TCTA 3N55A 3S3CB 5CJ8A 4C4KT 4M7LH 1HHGA 2NNAA 3PRZA 2Y3AA 3M1BA 2PN5A 3RWGA 4L8CB 3TBVB 3L2NA 3II2A 2PO6D 3S37X 1T21B 3GINA 2RACA 2QSCL 1JN6B 4FI7A 1UWYA 1G7QB 3NESA 3D7PA 1IEAB 2VT0A 3ULUD 3KDMA 4B9YA 3WY3A 5EZOH 3UO1L 4XE0A 5HYJE 3GFUA 2IADA 3LKNB 1B3JA 1CIUA 1U8HA 4GAFB 5B4MD 1R3JA 3RDTB 2F8OA 3BZ4A 5HHXH 3WN5A 4U3SB 4OAWA 1ZHKA 4IDJL 4A7TA 4GS7C 1QRNA 3UJJL 3BKJH 3CCHB 2E56A 4JDEA 3JZ7A 3L3GB 4S10A 3TJEL 2NQCA 2GJ6D 4WV1C 2J3SA 1URLA 2V5TA 3WFEL 2HFTA 3SE8H 3JUYA 2NY5L 4IEFA 2VR4A 1O6SB 4IRZH 4JHAL 4YR6B 2APTA 1HXKA 5EWIH 1H3PH 4TSAH 1WHOA 3IGFA 3V4PB 3SBWA 2FIRT 1HH6B 4NZUL 3O0RH 5MEQA 1TYRA 2I32A 3SDYH 3WIIL 3D0AA 1AACA 4M03A 2JI2A 5D1XC 3VXOB 2VGLM 5C09A 3KYMB 4MMXC 3B6SB 1C5DB 2AC0A 3CFKA 4P23C 4IBSA 4L1TA 2JCCE 2Y36H 3SDCD 4NPYA 2JF1A 2NY3B 1YEJH 5DFTA 3W39A 4JB9L 2JTYA 1FNGA 4LDEB 4BCXA 4FD0A 2FBJH 3SO5A 2HWZL 2JKTM 2YQ2A 2XKSA 3FB6A 2XZCH 2XZAH 4WJG3 5IUSA 3LOWA 3I6LE 2IV8A 1OP5H 3C60B 4G42B 3HI5H 2PCPB 4IGBC 1ZHNA 2I7OA 2X9YA 3LZRA 2BP0A 1JZDC 4JFYB 2B08A 4QEGA 5TE7H 2EXYD 2J7LA 4Q4EA 5GPRA 4F2MB 4GKSB 3KHOA 2X38A 3AREB 3LKSB 5PCYA 2PNDA 5GS0H 1DDTA 4JFZH 4FHKA 5DURB 4KI5C 5EIQA 1CLCA 3DOHA 4YXKL 2WQUA 4KNTA 1AYOA 4NO3B 2QPFA 1RZ7H 3CAFA 4PWEA 3GMNB 3GLDA 4NKIH 3MLYH 4RWYL 4OKVA 2BOBB 1CR9L 2DTMH 4N8CH 3U0PA 4HX1B 5JOFB 1D7CA 2CCVA 3QZPA 5TPWH 4NPKA 4OZFA 2OSLB 4AQ1C 1SYSB 1MUJA 3IDIA 4OZIF 1KBVA 1J5OL 1TCMA 3FF7A 4TQEL 4ZXBD 3D48R 4LOUD 4OV6F 2X4TB 3O4LA 5FYLH 3R7QA 3D2UA 5L2JA 3QG6B 1UD4A 5J12B 1UVQB 1WUZA 1I3RA 4YK4C 2A3TA 3CHQA 1SJXA 1WFJA 1CYXA 3HB3B 4UQ9A 5I5RA 2ZKMX 5JHLL 1S7SB 2BVQA 1GCYA 1TPXC 4L0PB 4PJIF 4XGZB 4JDVB 3T3ME 4FF9A 1NBZB 3I9IA 5FUZH 5FUOH 2EADA 1OLZA 1BIIA 5CM1A 3E2HC 3ULSB 3OAZK 1YNKH 2LU5A 3H6AA 4M4RA 3CFJB 2DM3A 3LY6A 3SY6A 3UDWC 1CT8A 3TZVB 3VFRA 4U7SA 1UD8A 1CZ8L 2HVJB 2XKNB 2J44A 1I7RB 1OM9A 2I07A 2VWEC 3GZOA 4UB0L 2ZNWA 2OMXB 3W0WA 4U0RC 5F1SA 3MLVL 1SEQL 4LFHG 5HI3D 3BKMH 1MDAA 3PNWA 4XB7A 5F3HB 4L1HA 5KVDH 1ND0A 5EOQH 3U4EB 5CGYD 1T22A 3QEUB 5KANI 3MLZH 1ZMYA 4QMEA 3AQZA 3M86A 1QKZL 2DF3A 3CFCH 5E8OA 1UACH 4JPVH 3VQ2C 4EN3C 2ODIA 5HVGB 1OAQL 4NN7B 3V0VA 1XF2B 2BIQA 1VB9A 1BVZA 1K2DB 3MJ7B 3AAZB 3MRBA 1C5BH 4JO1L 4LSSL 2J2ZB 1A3ZA 1TETL 3BW9A 3R0NA 5IBTL 5JXEA 1Z1WA 2GCYB 1MFBH 2H45A 2YGVA 2VR3A 5BO1L 1SN2A 5TFSL 3SPGA 3T3PF 1KLFB 3OKLA 4QHKJ 4PRPE 5LBGA 4RAUB 5TDPA 3U4KA 3FUEA 3VXQB 4LCVA 4AM0Q 3K71A 3QXAA 1VFAB 4E41D 5HY9B 4QKXB 2EVIA 1LMKA 4L5FE 4R4FH 1D5IH 3MA7B 4QGYA 2BHUA 2FJGB 3B1TA 3QUXA 1CL7I 4LIQH 4BA0A 4B53A 2FNWA 1UD5A 4B27A 2X70A 3IPFA 3QORB 5DJDA 3WE1A 4ZT1A 2R2CA 4JRXD 5JW4N 5F7FA 1LO5A 3DI3B 2Q8BL 3NYKA 5ID0A 2XXFA 1OSZA 2V17L 4K0OA 3BO8B 3ARRA 4LVNC 3ABZA 2OCFD 3L6FB 3L4XA 1N10A 2X9WA 2EKJA 5E4EB 2GK2A 3JWNE 5DRZA 1RK7A 3BVWA 3ARBC 5BVJA 4GH7B 4P3DA 2Z31D 4YE0A 4ELKA 5IHHA 1EO8L 1LK2A 2EKSA 5DR5L 4GRLD 4LKXA 1D2PA 2JK5A 2X88A 3W5MA 2E9IA 4Y2DA 2PW2B 3IE4A 4JO4H 5IBLD 5FR3A 3VX0A 5J3HD 5HHME 4G6JL 1RUQH 1WFOA 3MCKB 4UBDC 2C3GA 4PS4L 1DQMH 4ONHB 5F6HI 4X6DE 2IBZX 5FX3A 4EPSA 1CO1A 3WUWA 2VSMB 2EIDA 3CZKA 4CADB 1Q72L 4L4TA 4JHWL 5L9DH 4NUGL 3JBG7 3QO0A 1MIML 2FZ3B 1XGQB 5TD4A 4X5XA 5CINH 4L9LB 5CGTA 2E9WA 4R7DA 2FEDC 2JB6A 1TCRA 2QVKA 3OZLA 4G80A 4JFFE 2X3BA 1FL6B 2F7OA 2UY6B 4R96A 4RGNE 5MENA 1JGUL 2ZSWA 2FGWH 1JXJA 5J6SA 3VJ6A 4XC1L 2WWNA 3B7TA 4K7PH 4ODTL 4TUOB 1OF2A 2B4CL 3ARGC 4KK9D 1GOHA 2XCMC 4N4YB 5FWRA 3ZHKA 2YN5A 3UTPD 4U6VL 1RUML 2AXGA 1MFAH 2WB7A 3GI9H 4Z0XA 3ZGIA 4LSTL 3SGJA 3ZTEA 4DKEH 4W6YB 4PJ8B 3JTSB 2FUTA 1TU2B 1DN0B 2UYLA 4G7YL 3B7UX 2A1WH 3IF1A 2WZ0A 2Q9OA 1AI1L 5BRZD 1P84J 3VXSE 2ETWA 2WIIA 3MREB 5FGRA 4EI6A 2XTJB 3OKDB 1EO5A 3NSXA 3BAXA 5KJ4A 1K6QH 5F1IA 4S1SH 2WCSA 2QGBA 3B8YA 4DW2H 2BFVL 2QSTA 1AYRA 2X4UB 5TE4H 1O5PA 5JYLA 3MO1B 4YNYA 3CU1A 1A1NB 3EFOA 1C5CL 5H35B 4H1LA 2ZOWA 3B9KD 2LHAA 4HJJL 5FYJU 5E8EA 4N2KA 3N0PB 1OCCB 3UJTH 3ISYA 3L2LA 3QPXH 4WI8A 1HL4A 1AZNA 1BV8A 4F57L 5D4HA 2ZOLB 5H37A 3X13A 4ACTA 3O2VL 1FNSL 3SQBA 4MMYB 2VQ4A 3UC0H 1BD2D 4X4XB 2QV2A 1OGAD 4NGHH 3T2LA 1RUAH 1KN2H 2EYTA 4RGMB 3WFDH 3RWEB 2IALA 3K6SB 1ZIBA 3EOTH 4N9GB 2H8PB 3GSWB 3APMA 4YUEL 5D6CB 1YQ2A 1OWWA 3EOYG 5F1KC 2PW1A 2X2YA 3NH7H 3WE6A 2RJMA 4CC0A 3ZZQA 1N19A 4EUPA 4ANVA 5FO8B 2IOOA 2WLLB 5CR1A 4M43L 5EEXA 3S35L 2N59A 3LHAA 3K2UL 4QNPE 2GITB 3D4GA 1RZPA 2X05A 1FZMB 4LRIC 4OCXL 1ZT7B 3SPVB 1X7QA 1X5XA 2YEQA 2NXYB 3CZEA 4MFHA 5CJOH 3NGBB 2FECI 3WJMB 1AR2A 3BWAA 1EZSA 4E5XA 4OGZA 5E6IB 3FCUB 2BJMH 3UP6A 5JA9A 4RZCB 1NM9A 1PEWA 5DEFA 9CGTA 4WI3A 4N25A 4H0HB 3DSNA 4JK0D 4KQ3L 4F2ME 1IGCL 4JFOA 2J8UB 5HVFB 3NZUA 1ASPA 1CFSB 1QX1A 3VFSB 2A9ML 1UURA 3DVGB 3K8LA 1JAEA 1OAUH 2X44D 3Q6GH 5G2NA 1CI5A 4HKBB 4XE5B 2ZOTA 4P06A 1FN4A 3HFFA 2O5ZL 2ZUSA 5K59E 5FM5M 3O0LA 1BZ7B 4F9PA 1NBCA 1O7DE 3ZDYB 3ZDWA 2GJRA 4G43A 2FATH 5DK3A 4K8RD 2WIMA 2XXCB 1XCWA 4NLAA 1AHKA 1PIFA 3AY4A 1JRHH 4HWBL 3N6YA 4G1MB 1M7IA 1QRND 1E65A 1EAQA 3ARDC 4JRYB 4TSCL 3HR6A 4FQLL 3UAJA 4AMKL 1QW8A 1FZJB 2ZWSA 4DPRA 4K9EL 3AMLA 3NA9L 3U9PH 3CHSA 1L9MA 4C83B 2G5BB 5DSCB 2NUPA 3PJSB 1AY1H 2H4EA 4AJVA 2ADFH 1CB4A 5FHAL 3O8XC 3DECA 3N1QC 5E1QA 2YOAA 1O9ZA 3WJLA 1A4BA 3CMGA 5EUKA 2YIHA 3ES6B 3LPFA 4XWGH 1JZJA 4X4MA 1J11A 4ZMTA 1AQHA 1NWOA 2EYSA 3GXUB 5FA3B 3ZHNA 4G8GB 1EO7A 3SKNB 3TO4A 4PGDA 5EEZA 5C09D 3N3EA 4CU8A 4KY1L 1PIGA 3BH9A 1P7BA 1DQQB 4PRBA 2WO3B 4WWKC 4GUCA 5AVRB 1OHZA 5E56A 3T1WA 5JQ6L 2HG5B 2YXFA 1EEYA 1Q0YH 1D7DA 1E6OH 3B2MA 5J6GB 4XPHH 3DJSA 1NBVL 3JWNH 5HHOA 4B9ZA 1Y7VA 5JHDB 2EXWD 1MJ8L 4N2LA 4X8XA 5FFGA 4XMLL 4R5VA 1BZQK 4J2XA 2DBJA 3IDGA 5IM7B 2ZKXA 4F7MA 3F58H 4PLNC 1KB5H 4NIKB 5T5FL 2VM9A 5C71A 3HS0B 4J8RB 3IKCB 4HWBA 1EZVX 4P4KA 4E9LA 3NMEA 3WJJC 1FORH 1AGEB 3BEVB 1M57B 4LSPH 4FLQA 3WIHH 4Z7VA 2HA1A 5IFAL 2ALAA 2DQJL 3INUL 1U3HA 1KCUL 3P4OB 4PY8I 3RJQB 1PZ2A 2E27L 3RA7L 4BGLA 1NJ9A 3GTVA 3U48A 2YN3A 4J6RH 1J0KA 5CBEA 4F8LA 2K3TA 1JF1B 3OHXA 3DX8B 3DPDA 4J3UA 3HCVA 2C34A 3DSFH 3O4LD 4CSTA 1I9JH 4UZUA 1LWHA 3TWCH 2WK2A 4B0MM 1PD6A 4RRPG 4U1IB 1BREA 2D0GA 2BXZA 4TRPH 5E94B 4G6ML 1J87A 3ZY7A 3ZDXF 4IU2B 4JQIH 2WLMA 5KG9A 1PKQA 2TAAA 4U31A 5ENWB 3FT3B 4YSSA 4LCCC 3CFEB 4YBLB 5DS2A 1UKTA 2VXVL 4CC1A 4MXVE 3L4VA 3RZCA 2Y7LA 1AO7B 3GC3A 1WSST 2I7SA 3W0WD 5F7YC 3HS9A 2KLTA 4HWNA 4OCRL 4EI5B 4QPEA 4W9IC 3O6FA 4NKMA 3F7YB 2PP8A 3BVNB 3MNVB 4B7IA 4ZMPA 1SMDA 3LS4H 4YHPB 4CMMA 4D9RD 5KN5A 2DWDA 3GHBH 6FABL 3R8BB 5T5FA 5CSBA 3OX8B 5JDSA 2IWEA 4POYA 1QBBA 2CO1A 4PJ9C 3IVKA 2A74B 2OMTB 4WFGD 5I17A 1GHFL 2CKBB 4WI4A 3RWHB 3P0VL 1QWUA 3CDGB 4DERA 2VTFA 1SMOA 2X28A 1XF4A 2L8AA 2C4FU 3F05A 4B5EA 5D7IB 5ALCL 3TT3H 3ZUCA 3GYRA 2PO6C 4Z95H 1E9QA 1WF5A 2CUIA 2B1HH 5AB2A 4R7NA 4KQ0A 1KV7A 3MRRA 4LPTA 4AC2A 1E6JL 5HYSG 1JV2B 2XV0A 2CMRH 5ID1A 3ULUC 3WTTA 2W9LA 2FJUB 3DWTA 4HXAH 5SWSE 5AB0A 3PPSA 4ODUA 4UTBH 3D2TA 4KKLD 2CHDA 2Z8WC 1DVSA 4BQCA 2QPDB 5BOJA 5B4MC 4JKPH 3BGMB 1P4BL 3QUXD 2XTJE 43C9A 4HGMA 3CLEL 2BOCB 2VDPL 3D9AH 3FONB 4X9IA 5DQDH 5GZOA 3OKMA 5JIQA 1ITBB 2LVEA 2XJKA 1BW8A 2UXVA 2ICWB 1MAML 3MOQA 3GI8L 3EJJX 5DS8B 1K4DA 2R15A 1KZQA 1W15A 3L9RB 2EDQA 3EDDA 1R24B 1S7TB 1OARL 3LDBC 5I16A 4MCMA 3L3IA 4LE8A 5GQBA 3KMDA 4O02L 3UTZA 3PDOB 4LRNL 5K9KA 4NC1E 2BS8A 3SYCA 4NQDA 3BZDA 5HGDA 3FSAA 1L5GB 1KBPA 1TIUA 4M1DH 4WEUD 5JHAA 3IE9A 1SLWA 4NI3A 2YD7A 4CNIB 4P48A 3F12A 2F54B 4Y2DD 2EH7L 5KSUA 2X6CA 2LVCA 3SDCC 5FPIA 1MLBB 5TH2A 1YG9A 2GTWA 2UZPA 4M9PA 3WKNA 4XNQB 1HL9A 1PX4A 2DQEH 1WE5A 3NPZB 3TBTA 3OQ3B 4GUOA 5DUJA 4S11A 1N70A 3OAYK 4LCYB 3D4YA 1CK0H 1TMQA 5E6UB 3B7YA 3T71A 4NDMB 1ZXKA 4KMTH 4L4TD 4G6FD 2EE3A 5DD6A 1HHIA 3BUDA 1NCDL 4XVJL 4IHOB 1KBBA 5I82A 3MLRL 1G9NL 2H9GB 1X7SA 3ZQ9A 4NLHA 1T7ZA 3HLKA 3QO1B 4JM2A 1ES0B 3IDNA 2EXYC 2J43A 4JZJC 4YHKH 1DVTA 4UINL 1RQ5A 4B6ZA 1I31A 2YAMA 5MEND 1IGFL 4LU5H 2OSWA 3EFDH 3K1DA 1X5MA 3BP7B 4W9DC 4AI7A 2BOLA 3GXIA 5F7AA 1Z0NA 4WU7B 4DGWC 4W9EC 5I9QC 5TDOA 1L7TL 3STBA 4UOQA 3MXVL 4IOIB 1U36A 5GGRB 5HDOA 1G7MB 2ICWJ 4MMZC 1FJ1A 4WWNA 4J1UA 1LO0H 4FKEA 4LKCB 3MRDB 5DHEA 4OV5B 4ZXBC 2J8UE 4YSQA 4LOUC 4O02A 3V5KA 2HRPL 5AVUB 3IYLW 2GVYA 5EUOA 5CFHA 4GW5A 3UZVB 3II1A 4LCUB 1P7KB 5I0ZA 1QZNA 4AOFA 2DJUA 1NUNB 4LHQB 4G8FA 4Z9KB 3Q1EA 3GLAA 1X5ZA 3QEQB 1MDTA 4JPKH 3SE9H 3BVDB 5T33L 1MCPL 1RJLB 2DY2A 3QEGH 5D1QB 5D6DA 1RZKH 3BX7C 2PCYA 5FUCC 1NOFA 4XN5A 5AW0B 4JRYE 2WVVB 4FFYL 4BK4A 2H1XA 3GJFA 4XNZB 5HI3C 4ZMQA 4PCSA 3BVXA 2V2TB 5CGYC 2K6WA 4CVZA 2X53A 3FYIB 3D33A 3MRJA 4HS6A 5KVFL 1E5ZA 3EUUA 1A6VH 1S6NA 1WFTA 3CZGA 1NMBH 2VW4A 3LIUA 1GZQA 2EJ1A 2MNJB 3MBXH 4LCWB 3ZTNH 3PGFH 4WI9A 4OGXL 2PPFA 3STZB 4Q9RL 1EDQA 1OSYA 4Y5XA 1JRHI 4G8GE 4Z3IA 1GGTA 4E2OA 3FSVA 3P1VA 1G6VK 5CEZE 4HC1H 4UV4L 2XG5A 3QB7C 4FNRA 2X3CA 4S1RL 4JO3L 4XC3H 4I48B 1FBIL 3NJKA 1P5UA 2ARJQ 1MF2L 5JUEL 4BUGA 7FABH 4KVNL 4Z7QF 4DIXA 1NCCL 4ATTA 4BWTA 3N41B 4X6BB 3B2VH 2WXRA 4IK6A 5D7LB 4U6XA 3DBSA 2QFRA 4FQ1L 5MERA 4WK0B 4WAFA 2NY4B 1DVZA 5JHDE 1XF5B 2YMXH 3F7KA 2Q7NA 3S36H 4KDVA 2DL9A 3WFCH 4JDZB 1B0RB 1ZAGA 4N2GA 1RZQA 4Z7OB 1P6AB 4NC0B 3B2UD 4R97C 3QRGL 2QPEB 3SCMB 3K3QA 4GQQA 1VPOL 2R27A 5IB4A 2Z7ZA 1ONQB 2X1PA 5I6NA 5T3XH 1R5IA 2PR4H 1C7TA 4FFYA 3SHSA 5ITBH 4PJDE 5BQDA 3BDBA 1IEBB 4U05A 4DOHB 2VL5B 4OI7A 5DZJA 3S8FB 1U9KA 4NHCL 4YHYB 1MHEB 1WHPA 2JJSC 3O6KH 2LE9A 3V7AE 2HFEB 1HEZA 2VDOL 5E9AA 1MCDA 4U1HB 1FAIH 3EFFA 5IBLC 4FAAB 2Y72A 3DIDA 4Z7VF 3NQIA 5I1KL 4W4OA 3M17B 3SIKA 3TWYA 1J1XL 1KJ2B 3AC0A 4DKFL 1XCQA 2X9XA 5DS1A 3ZKQD 1GZPB 3ARYA 4YQXL 2MPAH 3GLZA 5KJRH 2HN7A 2ZXBA 4R5TA 3UAJD 3M8OL 1XD1A 4UM8A 4L37B 3VFOB 4A2FA 2W65A 2BSEA 2DLGA 1NLBL 4PP1D 2CQVA 3JWDH 4XO5A 1OP9A 4JN2B 1Q9KB 1H8OA 2AXWA 1V7NL 2EACA 3UACA 3UTSA 1UJ3A 4D0DB 1AO7E 3OB0H 5B8CA 2QEJA 1CC3A 3HPJA 1DJZA 2GK0A 2ZOUA 1AGBB 3AU0A 3KPOA 4FFTA 4HISA 3FF8A 4NO2B 1ZXQA 2XQYG 3MV7B 4KK9C 4OD1H 1MWAH 1PSKH 4XX5A 1WZ1H 1A0QL 2OULB 2VLME 3QUZC 4AW7A 5DUPH 5I1AB 4KNQA 5CWSB 1ZD6A 1BFVL 2CALA 5IEKA 3OXRB 4HOXA 2F9BT 2ITFA 4QLWA 4KZEL 2CIIA 2APSA 3MRQB 2FRGP 4R2GD 4CMHB 1QSEA 5D7IE 3CVHB 3FK3A 3NP4A 1MVYA 2NXZD 4XNBA 4BDVB 2Y7QB 2QVMA 4EKJA 2B1AH 5FW7A 3CQPA 4A2GA 1D6EB 2QHRL 1AD0A 4DGYH 1DL7H 1GS6X 5GGVL 4F37K 4ZMAT 1C16A 1UB6A 1KXTB 4HV8B 3H9HB 4Q74A 2R4SL 3VFNB 2DBLL 3HFMH 4HZLB 3B9KC 4Y1AB 1B0GA 1X5JA 1Y1DA 3LCYA 2V7HA 4IIQB 2J21A 1IAKB 3MFGB 1A14L 5D2NB 4XP6L 4XAWL 4F93B 5EA0H 2W9EH 1A3RL 1CLYL 5HDLA 4OQTL 3FQXB 1R3HB 5BPPA 2OW7A 4YDMA 1U3HD 3CQQA 3VFUB 1ID5I 3BN9D 1H3GA 3L4TA 3DVFA 3MA9H 3KPPB 2QMKA 1E4KA 1FV1B 5BJTA 4B5ZA 2UUDK 2Y6TE 2B77A 4UT9H 1YRKA 3IWUA 1NAKH 3CC5A 3FQRA 2DDQH 2VKWA 4WNQA 3L4CA 1INQA 4QHMB 4WY7H 3I6KA 4QHLA 1IQDB 4FI8A 1RIUH 5AG8A 4L48A 2F54E 4G7SB 2BSDA 4G2AA 3IGAB 1DR9A 1H5BC 2PWGA 1Z32X 1JHKH 4P9MH 3W2DH 1CD8A 1K5NA 4XBPA 1JWSA 2P45B 1BA9A 3C5ZA 4R4BB 1NINA 1RP8A 1T3FA 3U2SB 1CI3M 5JA8B 3BRGC 1MCEA 5ADOH 3VRIB 4L1SA 4MBRA 4UILL 2QL1A 1BGXL 1ZWIA 3N40F 5E95B 4P5RA 3KPTA 4IM8A 4WCYH 2Q7YB 1YEHL 4AQAA 4KK8D 2EQDA 3IMRA 4OTXH 3F83A 4KXBA 2Z4QB 4J3XA 5I1EH 3Q8EA 4PD4K 3DJ9A 1GMEA 8CGTA 1I8LA 1NCAH 4N5UA 1R5WB 4KZDH 3DV4A 3N40P 3PHQA 4I0PB 2ADGB 3A6CH 3CFBA 2X2JA 4OQTA 4YOKA 1YHPA 3RAJH 1SXZA 1FPTH 3GDBA 4OJEH 3MRHA 5KSAB 3FQWA 5K5YA 3DX0A 3PDDA 4JM2F 1JD7A 2AMUA 2DQGH 4WHTB 4HFWB 4L3EA 3VCLB 3FQNA 3BE1L 2HFGL 4QHKI 3UTQB 4K8RC 1KJVB 1SHXA 4ZDHB 1B4LA 3IN2A 3IMUA 1TZHA 2BC4B 3CVDA 3FH8A 1NCWL 4DN4L 5C0FA 4AG4H 3MACL 2NCMA 4YC2C 4XRCA 1K85A 2RIKA 2ZZUT 4RGOL 4PB9L 3TPUB 4NKQB 1FZOB 1JZHA 3D18B 1EANA 3QEQE 1DBAH 1JGIA 4Q56A 4XOEA 3BDYL 4YDVB 4MHHI 4AGMA 2ENYA 1R3LB 5D1QE 1A6TB 4NJ9H 2EDHA 3W3BA 5EF1A 4R26H 3V7MA 5J1AA 1EXHA 3HZMA 4P9HL 1F6FB 1QFOA 1E8ZA 4WDIB 3NEXA 3SBWC 4Y4KA 4LNRB 1YEFH 2Q1EA 4NQDD 4QXUL 2A5UA 3N85H 3NPSB 1ZTMA 4HETA 4YXLL 1FGNH 3IXAA 4D3CL 2CJTA 4TULH 4XCEA 2R1WB 3RUGA 4X8JB 1UQSB 3ZSSA 3CN2A 5LAPA 3EBHA 4KV5E 3F7LA 4LCWE 2GT9A 1I85A 4ILDA 4U1KB 3BKYH 3QUYB 5GRUL 1A4CA 4N2IA 4XTRD 3FU9A 3UJIH 3D0LB 2EXWC 3LZOA 1ETZA 1P4LA 2VDQB 1UM6L 3AB0C 5M7QA 4WLCA 1EEUA 4ZFOB 4J3WA 5SV4A 5IWLA 4JM2D 3CUPB 1ECYA 3VRJA 5GSRA 2OTPA 5C6WH 3TFKD 1KIRB 3QWNA 4PJCA 4AGPA 2ITDA 1HL5A 5SWQA 4G7VL 3V0WL 3LEXA 2KL6A 1S7UA 4Q2ZA 4ETQA 1HH9A 1GGBH 3E9TA 5J0BA 4XVSH 4BQ6A 2P48B 4MD5B 3N04A 1KJMB 1YMMB 1KYAA 1HK6A 1HJCA 1ZTXL 3GO1L 1G6RB 4PGBA 1UH2A 1CF8L 3EO1B 3NFPA 4YLCA 3EYUH 4KTDH 1HILB 4TQIA 3HVNA 3LV3B 4I2XA 2XTLA 1G7IA 1HINL 1ZGLM 4H20L 3S2AA 5C0AA 3MV9A 1ADQL 4FL4B 1M7XA 4A7QA 4PMEA 4PB0L 4HHAA 4YEEA 1CFTB 4F5CA 4NJAL 4PJGA 4NZTL 5C0IA 1UOKA 2OJEB 2FLRT 3U7WH 1OD9A 3HMWL 2VITB 2FX7H 2CKBH 4MS8D 4NWTL 3BP5A 4ZMZA 2WBJB 2ORBH 1LVEA 2BVPB 1TJIH 1ZOXA 3ETSA 3C5XA 3MJ8A 4B41A 3NACH 4JVPA 4UQAA 3RIFF 4E9YA 2Z0UA 5CJ5A 3MV8B 5FOBA 4UTAH 1DJYA 3B37A 5DO2D 4DP9X 4LL1A 4LLDB 4WSKA 3DX7A 1I9EA 4LO9A 5EC2A 2FJFB 3D3VB 1KGCE 2G9HA 1QR4A 1S7VA 1YQVH 2Y07H 3D69B 2VDNB 5HGBB 3ZKXC 1PYWA 1I9IL 3MV7E 5SX4I 3KPSB 4ZAKA 2ZCHH 3VXME 3HUJB 3V4VB 3GIVB 3HNVL 2P8PA 2BP8A 3DX1A 3FB8B 3ECUA 1GIGL 1J1PH 3MZGB 5CD3A 4ZUTA 3IFPB 3A23A 5CEYA 5GS2H 1BX2A 1FNEB 2XA8L 3Q6FA 1WP6A 4KKLC 3BPNB 4FQIL 3QUXC 2VLJB 3KVPA 3ZQWA 4ZUWB 1XGYL 1G84A 1OE3A 2E7BA 3RI5K 3VGGA 4HCIA 5EIIA 1F8TL 5JLZA 3G5ZB 1U2CA 1ADQA 2E46A 2IWGA 4JPIA 4IBVA 3P73A 2A6IB 1OEZW 3KS0J 3MJGX 4LEOA 1OVZA 1DLFH 1Y6MR 4X50A 4BSJA 3LB6D 4H8WL 4IU3A 4JZNB 4Y1AE 2PCFB 4OUUA 5D2NE 5E1AB 4G82A 1BVOA 1FL5B 2MQGA 3BAEH 4UIKL 4ZBJA 1TNNA 3WHE1 2YGPA 3ARZA 3FQYA 4NSKA 2AJZB 3GJEB 3GSVB 3NCEB 2VE6A 1NIEA 4MX7A 1D5MB 4HBQA 3JWOC 4PRHE 1FVDB 4DO6A 2WUCH 1FFRA 4RMWA 1YY8B 3UBXA 4TVPE 3SO3C 1A7BA 1MN4A 4MDIA 4Y2DC 1RIHL 1X9UA 2GSIB 2G3ZA 3NABL 4OIFA 3LVEA 4JBSA 2IQ9H 5F97E 3S9DB 5DVKA 2OQJA 3DUUA 3U46A 3GMQB 4HOZA 3P40A 4IMKA 2EH8L 2YPLB 4MD4B 3Q44A 4NERA 1H0DA 1S9XA 2OSXA 1IQWH 1KPVB 3JSSA 3QFJB 2ZXGA 3FCTB 5IESH 1SOXA 1XB3A 1O6TA 4AIZB 4MZRA 1FFQA 1AG6A 2NCEA 3SN6N 5JO5A 3OLEA 1WRFA 4A7UA 4CVUA 3UTSD 1ZHLA 1MREL 3HZVA 5DEGB 1LEKA 3L45A 3PL6B 2QQLH 5JPNA 3CVBA 1NGYB 5F7BA 4G3YH 1IEHA 4AV4A 5HI4D 2L7EA 3ZE1E 1FFPA 3D0VA 5D4JA 3A6BL 3U25A 1TTAA 5FWQA 5LCVL 3TH2T 4F3FA 2A6KA 3SGJC 2O61B 2FB4H 4R4ND 4PU2A 4NQXA 4PRAA 2K78A 5JORB 3T4AC 5L4MA 1NLDL 1EH9A 1GW6A 2WUBL 3N43F 2M1KA 1V8HA 1J8RA 1CTNA 4BKLB 1QSED 1IC7L 5KYXB 1BG1A 3G5VB 1YEIL 1VGKA 1UD2A 4G9FA 4O51B 1KCVL 1G7JA 3HRZB 3K6NA 2ZWZA 1WH0A 2X0WA 1WA0X 5F96L 3EH5B 2WTRB 1ZLWH 4K3HA 1PEZA 3EDKA 4HUXA 1N64H 2UV3A 4DPAX 1P1ZA 4K71C 4M7LL 2ALWA 4P49A 3ISWA 4QDGA 5LJYH 1ZEAH 2ZUWA 2XQBH 3B56A 3CFMA 4JKMA 3UIZA 3ECBA 4G11A 1IGJB 4RLDA 5IMKB 3FT4A 5C7XH 5DJ2B 1QHPA 2VM4A 5J89A 5DC0A 3IAGC 4Y4HA 1NANI 1DSFH 5AAMA 1YEGH 3QAZB 4FXKB 4HAKA 2QLVB 4Q6IA 2WLIB 1WAEA 5EZOL 1KLGA 2XA3A 2H0EA 2XWBA 3NCFB 5ES4B 5C6PB 3MFFB 5HHXL 4LSVH 1VACB 2P47B 5IW6B 3BKJL 1N3NB 1LLAA 1S9VB 1WIOA 4UAOC 3FCSA 3KM2A 3WFZA 4WUKH 2WXGA 2VJXA 1NPJA 5CR8A 3MRFA 1IGYA 1A7RH 1B4JH 1NDGB 2AJ3A 2B4CC 5E2WH 5E7BA 1GS7A 1L4IA 1WJ3A 4OFYA 3QA3A 2HT4D 4TPRH 5A2FA 5LCVA 4BD4A 4POZD 3SE8L 1DJIA 2A9CA 3ELQA 2FECL 5EWIL 1H3PL 2TSBA 3C5ZD 4TSAL 5BV7H 3O41B 2FR4B 5FO7B 3C6SB 2VCOA 3X12B 4N85A 5L7XH 3OM3B 4QXTB 2FYVA 3KXFA 3O0RL 3SDYL 4YSDA 4AT6A 3L3JA 5F88B 2W92A 5F71A 2O5YH 4UU9A 3SDDB 4AYEC 5DZVA 3RUGF 4C58B 2P24A 1JIBA 2UXGA 1BVLB 3UPCA 3LZNA 3B2UC 1YEJL 4LCIH 2FT7A 1YNTB 4P5MA 2OR8A 1AQ8A 1K8DB 1T2QH 3MBWB 4PBDA 2A73A 2FBJL 2LLLA 2VZUA 6TAAA 4LDOB 3EHBD 5DJ0B 4AUUA 4DP2X 5DWUH 1XF1A 3U7AA 2XZCL 2XZAL 3MX0A 1KOAA 5C2UB 3AWGA 3OTTA 3HI5L 1OV8A 1J05A 1WQVT 4MAZA 1YMME 4F9PC 4I3GA 1MFCH 5KBKA 1G0DA 3IPBA 4L3ED 4PJCF 4U3HA 5TE7L 4D2NA 1VFBA 3FTGA 3GSNB 1DQTA 1HN1A 1J8HB 1M3IA 5EZJB 2DLEA 4Z7WA 3AY4C 5GS0L 4JY5H 1OPGH 4JFZL 4RIRB 2Y7OA 4S0HA 1TKWB 4KROB 5B38G 1S9WA 2A0LD 3MR9B 1RZ7L 2F6AA 3UAJC 43CAA 4NKIL 1MSPA 1JXKA 3MLYL 2VZSA 3O3EB 3RNKA 3B9AA 5ERWB 4KXZI 2DTML 2V2WB 4MLIA 4N8CL 4PLKD 1CE6B 4PP1C 5J1TC 3Q06A 5DQJB 2NPLX 1QTPA 5TPWL 3UC2A 2W1NA 2I9TA 1Z9NA 4QOKA 4IRZA 3VFWA 3AXHA 3I75B 5ETUA 1PZDA 1ZA3B 5FYLL 5TDNA 1KY7A 2CLVB 4XH2A 1V55B 5HGGS 2D03H 2VW6A 5A7EA 1S3RA 2WP3T 1DN2A 3DX2A 3V0AC 5LAXA 3WJLC 1AKPA 3RBGA 5KBNC 3FN9A 5FB8B 4HG4J 4Y4KD 3TPKA 3CVHH 3QHZH 1XDTT 2DWYA 4PJGF 5FUZL 5FUOL 3NIFF 4O2CB 3QJHA 3EH4B 3TO4C 1YNKL 3TBYB 3QUKB 1JYXA 1QABA 3DUSB 4EBQH 5DHYA 1ET7A 3VWJB 3G7TA 2Z3FA 3D3VE 1A7QH 4X7SH 2E47A 4G9DB 3UPRA 1M71A 2VXQH 4LHUA 5DVPA 2YD9A 3X1NA 1MW3A 3BSGA 4R2GC 1P2CB 3BKML 4YIQB 3KPSE 1M6OA 5KVDL 2GUYA 1PNDA 2NXZC 5DJCA 3HUJE 5EOQL 1ASOA 4JE0A 3CSYA 4N0UA 3MLZL 4N0YH 1H15B 1H8SA 3CFCL 4OFVA 5LNDA 1UACL 3DNKA 3QJOA 4JPVL 4GAAA 2JJTA 3MLXH 3BYTA 3SKMB 3LNHA 4ATWA 4TVPH 4TUJA 1C5BL 2WYIA 1T5WA 4TXVB 4YZFF 4YDJA 4DK5A 4IS6B 4P4KC 2VLJE 2ZG1A 2XYBA 5FDWA 2YPVH 4DO5A 5T1JA 2PTVA 1MFBL 4K9EC 4XN1A 4RNRB 5I6XB 1U3HC 4LEXH 2MOQA 1EEQA 3BN9C 4P2OA 2VUKA 1GYWA 5AQ0A 1JZ3A 2ED7A 5F1NA 3H7BA 2SEBB 5HHQB 3QXVA 3OHXC 1D5IL 3AT9A 3HW7A 4R4FL 3ZTJH 3KH3A 3CWGA 4MASA 4XVUD 4XXWA 5IJVB 4PGCB 1LILA 3FDWA 1BMZA 2ICWI 4LIQL 1IM9A 4F7TB 5FHBH 2RALA 2HB0A 4RFNC 4ES9A 2IEPA 3D06A 2YD8A 4L29A 1KTRL 1H6UA 2DQFB 1A5FH 3VG9B 1DBKH 4K3JH 5B3JE 1LDPH 2VMJA 3O3DB 4XZUA 3DOSB 3LN5B 3MV9D 5C0AD 4NCC1 5L8JB 2AVFA 2P42B 3ATAA 3L9YA 5A2AA 3L5JA 3DV6B 3PV6B 1SUHA 1F6AB 5JNYA 1WV7T 3FO0L 2YPLE 3V6ZA 4YPGA 3PP4H 3FFCB 1RP9A 4X4YA 4XCYA 4M48H 3QFJE 2AJXH 1IBBA 4HCGA 2K7PA 3O9WA 2YMOA 4K7FB 2P5EA 3SSGA 5BMFH 5CKGA 1XGPA 3TIEB 4MNQA 4JO4L 2D9CA 3ILEA 3Q5TA 4KK8C 1RUQL 2ISDA 3V6FA 4NKOA 4YWGH 2W38A 1DQML 3D85A 5EBWB 3FOMA 2AEPH 1KULA 1ETJA 2R1YB 1J18A 3G5YB 2C7UB 1WBXA 1DVFB 2NY1B 3ARSA 1HAWA 3LXBA 3ARFA 4C4UA 4Z7NB 5LDUA 4ZAKD 5L9DL 2HCZX 4P57A 1XT5A 5IK3A 2ENQA 1KYUA 1AD9A 4LLVA 2DQHH 2R0ZH 5CINL 2P9RA 4IBTA 1N5AA 1W0YT 1DSYA 4ES8A 3BMWA 1HHJB 1DDHB 3BD5A 3MTRA 4MD0A 4HD5A 3SQOH 5DD3H 1GOGA 4FXGA 2FGWL 1U91A 4Y19B 4K7PL 6CGTA 4RAHA 1EFXD 4DZBB 1ESOA 5GZOC 1V3KA 2DQCH 2YFOA 1UT1A 4BSWA 3CFNA 3HG0A 2WLJA 1MFAL 3GI9L 4PV9B 3BC9A 1GYVA 1NC2B 1XGTA 4DKEL 2AK4A 1QAWA 3QI9B 3SJVB 1RK1A 1U3NA 1QATA 3EYOA 2RA1A 5A2LH 2C9PA 3B7SA 4XAKD 1BZ9A 1UJTA 1KT2B 3MSPA 5J1SC 4RX4D 3EJPA 1CXFA 4B9CA 2BSCA 1TENA 4HBCH 3TN0B 1K6QL 1OKEA 4S1SL 3PE9A 1OIOA 2VDQH 4LOVA 1TQSA 4FI6A 2PWFA 4TQ8A 5TE4L 3ZKMD 4DW2L 3DROA 2L0DA 2C4XA 3HBZA 2VDLB 3R4DA 4LSUH 3RIAF 5ILTH 1OL0A 1TJMA 2PUQT 2BS9A 3UJTL 2JFCA 3QPXL 4WK2B 3NZ8A 2FL5B 1TOXA 4ELDA 5CN1A 3QIBB 1ET5A 4Q9CA 4XTRC 3VNYA 3HZKA 4Y0GA 1LNUB 4MQXD 4I9WE 4WW2B 3UC0L 4H7VA 4NGHL 4QLRA 1LD9A 1RUAL 2WD0A 1KN2L 2BCKB 4HEPG 4J3OF 5HYJA 2DMBA 3EH3B 3QDJA 3WFDL 5DUBA 5FK9A 3EOTL 4JM2C 4CILA 3L7FA 1G6RH 1KGXA 3FNKA 5E08H 2HJKA 4JO8A 3TFKC 3BPCA 3NIGB 3NH7L 1TNMA 4DPCX 1FC1A 4UI2A 1IL1B 2QPSA 4JFXB 5DJZB 5LN4A 1O75A 4EIUA 5PAZA 1PLAA 3KS0H 3ASNB 3ROOB 2XWTA 4FRWA 1KG0B 4YPJA 1PZ5B 5L6YH 3MRCA 4NBZB 5ESVB 4MKMA 3O6LH 1A4KA 2R0LH 1HWGB 1NGZA 2CLZB 4QGTA 4WHDA 3LAFA 3ZMNA 1T20B 4YBQD 5SWZB 5CJOL 4XCFH 3FU8A 3MYJB 3ZT5A 5I1JH 4CC4A 4AYFA 4ZNEE 1XGUA 2GKIA 3BCDA 4G9FD 2YUWA 3EBGA 2BJML 1H3UA 2X4SA 5TQ2H 1HWHB 3MC0A 3UCQA 1A2YA 2JCCA 4NAQA 5IR1A 2E4FA 1JNHB 2C26A 5D6DC 2X0UA 4MJ6A 2JQAA 1KIUB 2QFPA 3OF6A 3H42H 4V1DB 5DK0B 5JIPA 1OAUL 3Q6GL 4MS8C 2VDNH 3VNZA 3OJVC 1ZGLA 2NDGA 2WQXA 2Q76A 4Y4HD 1RK0A 2R23A 2C9XA 3OGCB 1OGPA 3V4VH 3N91A 5EN2A 3WNMA 4BQ8A 2MHAA 2FATL 1G9NC 4W93A 4Z7WF 2ED9A 4OI9A 2RQ8A 3DDGA 3CXDH 5D1ZB 2BRQA 3A4DA 3P30H 3QNZB 4J3BA 1ACZA 1JRHL 3WHXB 1CCZA 3TYFB 5HPMA 2DM7A 4GG6B 3QQXA 3QSKB 1WC7B 4Q52A 4J3OD 5H2BB 4HEME 4XBGB 5AYQA 4ACPA 3KYKH 2NR6A 2CO7A 5HVHC 3U9PL 4Y5XC 1IJNA 4OFYD 1LE9B 3ZR5A 1DFXA 1AY1L 3DO3A 4JY4A 5FGCB 2ADFL 1P5UC 4EF3A 3GM8A 3AQYA 2JTDA 3VGAC 3L3DA 2ITCB 4XWGL 4E9RA 3IDMB 4U7KA 1DUYA 3KXFD 1VCAA 3MMEB 1KGWA 3DIFA 1J0JA 4WU5B 5CZXC 5HHPA 2K3HA 4U1MA 3RGVA 1S5IH 2NYYD 4W9GC 3WUWG 1TQCC 3ZX1A 1JWUA 5I73C 1SY6H 2K1MA 5I23A 1MW0A 3LB6C 1YJDH 1Q0YL 5HYSB 2NLJA 1E6OL 2DYRB 2X4OB 3FFDB 4BE6A 3D07A 1JZFA 4QWWD 4XPHL 3O81A 3NIDF 2JELH 1F3JA 4JQVA 2YGOA 4JUTA 5ISZA 1X5FA 3SE6A 1BQHA 2R0KH 4PG2A 1IUZA 3OB8A 5KYWA 3KPRB 4XZ4A 2E3VA 2R39A 3F58L 3ZYJA 1KB5L 1UUSA 2X1OA 2Y5EA 4LHJB 5F8QC 3CSFA 4QJ3B 5FFLA 2FLMA 2WQAA 4IK7A 5LG6A 1IAOB 2CDGA 4W4OC 5AOJA 1FORL 4LSPL 3WIHL 5BOPA 5IFJB 5GRXG 3OXSA 4JG0H 3Q2VA 3VD0A 2G2PA 4BFBD 4G1EB 4PREB 1JK8B 1CICD 2JKLA 3UIYA 3UZQA 2D8KA 3QWOA 2BVOB 4PV8A 4K55A 4MCZA 1OHQA 1E2WA 4PRPA 4J6RL 3V2AR 4P2AA 4PGEB 3UMNA 4ZG1A 4QOKD 2BNQB 1VJSA 3U7YH 1M7UA 3DGGB 4QCIB 3DSFL 2BNRB 3J27A 3VI3E 1I9JL 2M26A 1UJ3C 3L08A 1JZ4A 3TWCL 3FFCE 5B8CC 3T4YA 1AHWA 1MCWM 1YDPA 3APCA 5AYUH 3LRGA 5JMOC 1Q4NX 5BRPA 4TRPL 2J57A 4H1LG 5HI4C 4EVNA 25C8H 2YEZA 4KJQD 4JQIL 4WWOA 1J0YA 1VIWA 3ZZ1A 3EJRA 2UVFA 1WFUA 2X10A 5EZIH 4AZ8B 4KOCA 4ZTPH 3NJIA 2OMVB 2ZNXA 3WTWA 1N7MH 4QAMB 4R4NC 2W60B 1N0LA 4Z78A 4UCFA 4GJTB 5CXPA 4OY9A 4WUUB 1TXKA 2FEEI 4LHUD 3CIQA 5AALA 4MZ2A 1OCOB 2O5XH 5AVQB 2BSTA 3LSOA 1XQ4A 2GTQA 1NCTA 3O3BB 3LS4L 3K0WA 2VLRA 3TH3T 1JDAA 5C0ND 3GHBL 3IJSB 1KB5A 1XFPA 4CBPA 3I3DA 2GYSA 5SX5H 4AL8H 5HYFA 1NPNA 1E8YA 2EDTA 4MJIB 2ZKWA 3P4MB 2BNUA 2X1QA 3LN9A 4EUPG 5CJQH 1WEJH 2C3VA 4Y19E 3VFMB 3TT3L 2ICES 4Z95L 4GRWF 1BAGA 2B1HL 3CX5J 4EN3B 4DAGH 4AQEA 4FQXB 2CMRL 4HU8A 2PPDA 1G7PB 1B2WH 1R33A 4GBXA 4P2OD 4AM0A 4EDXA 2ARWA 4HXAL 1E4KC 3SJVE 1EHXA 4UTBL 3RY4A 5JOPD 1KPRB 1PG7H 4PIRF 1H3TA 3VH8G 3DA0A 1IKFH 4JKPL 4JFFA 2ZE0A 4HPYH 3AXLB 5C0CE 5EU6B 3D9AL 1IM9D 3QR1A 5J6HA 2CGYA 5DQDL 5F7WC 3FTVA 1KFAH 4JQIA 3HG1B 3LD8C 4O00A 5D7KE 1JK9A 2HT4C 4JFDB 1WYJA 5K69A 3D09A 4AXWB 3BUYB 1HQRB 4M7JH 4QTFA 5F6IC 5IB2B 3QE5A 2H3KA 3C5ZC 1KCBA 2AV1B 2H41A 1AVAA 2DEWX 3FU3A 5AW1B 3TBVA 4L8CA 4WNJA 4I5BB 5C2BH 1U8NA 1XWVA 1J5IA 1T21A 3NCJH 2EINB 4M1DL 2OZ4H 4LGPB 3O9WD 1G7QA 2DWTA 4HIIB 2P5ED 1L0XA 1IEAA 3I9GH 3CJJA 4S1QH 1ZVHA 1NAMB 2Y5TB 4MNQD 1A66A 4M3JA 3MNZA 2YLHA 3QIUD 5T1KB 1RUPH 1KCLA 3F7PC 5J13C 3QQ4A 1AQDB 2Z8SA 4X98A 2JIXB 3HE6B 2YD1A 2DQEL 3D85D 3RDTA 5I2IB 3OLDA 4U3SA 2MCG1 2M83A 4OCNC 1I8LC 1MZZA 3NIGE 2YUXA 4ZMYA 1EXGA 2IDFA 1CK0L 3CCHA 2IWFA 3EHBC 3ARFD 9PCYA 2GW5A 3L3GA 5E6ZA 4KMTL 3IGLA 1MFVA 1X9RA 1KWGA 4FQJH 1OB0A 1HZLA 1F45A 4K8RH 1CFBA 2AQ1A 1EVUA 4UTBA 4L9DA 1U8OB 3OJ2C 1O6SA 5C86A 3JT0A 4HLJA 4YR6A 3PY9A 5C07D 1JDCA 4OT1H 4YHKL 4NQTA 5I6LA 1J8KA 2P44B 5FECB 3PXHA 4LU5L 1RPKA 1HH6A 3EFDL 3CK0H 1BECA 2A0LC 3DRQA 4A7GA 1RLBA 2EDJA 3VXOA 1WVZA 5I0XA 3KYMA 3B6SA 3QISA 5ADPH 5DMKB 3BRFA 4HMDA 3E6HB 5EIVA 2G0LA 2VQ1B 1LO0L 1J9CT 2OMUB 2NNFA 2YLKA 4WFED 3RZWA 4PR5B 4V1DE 3UTTE 3P77B 1HKFA 3T5WA 5GS3A 2VDMB 1ODAA 5F3BB 3GMRB 1Q94B 4FABH 4EQ2A 1UA6H 1B9ZA 4Y4KC 5HDBE 1UB5A 4PJHA 2JCCF 1KPUB 3C60A 4G42A 2WZ5A 2HTLD 3SE9L 3ECQA 2PCPA 4PI2A 3VTAA 3VWKB 5AAWA 3G6DH 4JFYA 4NAJA 5A7BA 4PCKA 1TQBB 3NZHH 3QEGL 1RZKL 4K3EH 1BXAA 4QHNB 4GFXA 4F2MA 1DO6A 1CGVA 3LZLA 4GKSA 1RJYB 4Y8DC 3AREA 3LKSA 5D7SH 1K72A 2QPUA 1QVOB 3GBNH 1Y0LB 5EU3B 5CCHE 3T6QC 4HKZB 4QXVA 3LPWA 4Q14A 1D5ZA 1I85C 1V3JA 5JIHA 5IJCC 4NO3A 2DLTA 5LN8A 4HIEB 1UGNA 2BOBA 1I8MB 4HX1A 5JOFA 3MV11 5FGCE 4K15A 1KYFA 5F9WB 1ZGLP 3BIKB 2IGLA 4L8BB 2OSLA 1SYSA 2I27N 1T0MB 3C2AH 4NAMA 5HYJD 3QDJD 2X4TA 1JPEA 3B3IA 5MEPB 1A6VL 4KRLB 5DUMH 2CGZA 3EJSA 5HGAB 3QG6A 2BXYA 2WQSA 4S2SB 5IWLC 2F53B 1BDYA 1NMBL 1UVQA 4GSRA 3MBXL 4RDQG 2BERA 4PPTA 3ZTNL 4AITA 3GMPB 3PGFL 2XETA 2EC9T 3CZNA 1S7SA 2PXYB 3OAUH 4OCSL 4QYOB 3WO4C 4XGZA 4JDVA 5IEHB 1NBZA 4Z77B 2HAZA 4HC1L 4HCFA 5L0QC 3Q8AA 3VFTB 3ULSA 5CP3A 3OVUB 4JAMB 2ATKB 1HQ4B 4XC3L 3CFJA 4D9LL 3TZVA 1DJWA 7FABL 2HVJA 2NUTB 3CNKA 1N5YH 1YVLA 2XKNA 3G5XB 1I7RA 2QGDA 4MSWB 2J5LC 1M1SA 2QQNH 1DE4B 2HLAB 3B2VL 3KJ4C 1W72B 3QIWD 1PY0A 3HZYA 4XVUC 2XZZA 4P9HC 4PJ5A 2XY2A 3DYOA 3T3MF 5D1XE 2AANA 4AGNA 1NCBH 4ZOAA 5F3HA 1F42A 2YMXL 3S36L 5T1LB 4OVVA 1G1OA 1YEKH 5E4AA 5FYJE 3U4EA 3VVWA 3WFCL 2XPGA 3QEUA 4JO2H 4F80A 5EFIB 4IRJB 3KPRE 4PSRA 3MAWA 1X5GA 3H53A 1L3NA 4WW1A 5F0LB 5F0MB 1UUNA 1XF2A 1F97A 3WKPA 3NTCH 4OF3A 3MJ7A 2CUHA 1F4YL 2FD6H 5T3XL 2PR4L 3OF6D 2BM3A 5MP6H 3Q5YA 5ITBL 3VW3H 3ARQA 4WKZB 4LL9A 1Q1PA 5FIEA 1UG9A 2GCYA 1GMIA 4CKVX 1L9QA 1KLFA 4FG6D 4DEUA 3I6LD 3O6KL 4NFCA 3RX7A 2LFGA 2C8NA 1A1MB 4RAUA 1HI6B 3VXQA 1W0WB 1FAIL 3HC2A 2DQMA 2BNQE 1VFAA 4Y2OB 1Z6JT 5HY9A 1A1OA 2BNRE 3TVMB 2Q86B 3MA7A 2FJGA 4KI5E 1U33A 4M6OH 3OMZA 4HK0B 1BVKB 1N6UA 1PY9A 2MPAL 5C08A 2VERN 5IQOA 3DJZA 3GZKA 5AW6B 1QRKA 3QORA 3EG9A 2NR6D 3NCYP 3KJ6H 4HC1A 2HJFA 4ZAKC 1E2VA 1ZCRA 3JWDL 1NGXB 3QG7H 4JJ5B 4MB3A 1KBGH 1LEIB 4F8TA 3PWPB 3KWTA 1MCHA 2HSIA 4KRPD 3BO8A 4ODWB 3U6RB 3L6FA 3UABA 5KS9B 3ARTA 1KIQB 3LEVH 2XBDA 4AX3A 1FNAA 1KYOJ 3ZE2E 2CK0H 4DGIH 3HI1B 4WTZG 5CILH 2COVD 5JQIB 4FG4A 5B21A 2V5YA 3VGDA 5IT2H 1KSRA 2OMWB 4FTDA 4O58H 1MWAL 1PSKL 1BAFH 3RGVD 1WZ1L 4ZYKB 2PW2A 4NX0A 5DUPL 5J11C 4MJIE 3EF4A 3PWJB 4JFPA 1SF5A 3D52A 3ZQXA 2KQMA 2L7JA 3U4BH 1M2OA 2EDYA 3MCKA 4ONHA 5IROA 8FABB 3AUVA 4FE9A 5FXCH 3H9ZA 3JWOH 2ZWNA 4K5NA 5E5RB 4CADA 2B1AL 5ISZD 1CYGA 3C9NB 1YEWA 2GEEA 2V9TA 2AQ2A 4JHVA 5E1HB 4DGYL 1DL7L 2NT0A 2UXFA 2FZ3A 2L7QA 1XGQA 3B9VA 5I1KH 3U6XS 2E76C 3ZKMC 3L3OB 4L9LA 1G4RA 2YK1H 2HT2D 4OM1L 3HFML 5EU6E 3VXPA 1FL6A 3QZWG 4QRBA 4ZOCA 2PLTA 2UY6A 5JQHC 4IMKC 1U93B 3I3EA 5EA0L 2W9EL 1X5HA 4TUOA 1FDLH 3RYMA 4XMPH 5C0EB 1VF5C 1T4KB 3HG1E 1SJMA 2VAJA 4A38A 3QS2A 3TC9A 3MA9L 4JFDE 4MQXC 4PRPD 1ZE3H 5SX5K 4UT9L 1J7VR 4BRJA 3JTSA 4LQ1A 4UDUB 5F9AC 1NAKL 4P99A 4RZKA 2DDQL 4N86A 2XI9A 2H26B 1QFUH 3MREA 4JM0A 4BFFA 3OKDA 4WY7L 4JEGB 1KCWA 1HS6A 3N42B 5JPNC 5KSBB 1RIUL 2BHZA 5FM4A 1MWAA 1WTGT 1T0NB 3RTQB 1DANU 1WD9A 2OL3B 4U1GB 2X4UA 1GSMA 2XZQH 1JHKL 3GS4A 4P9ML 3W2DL 3W9EB 3MO1A 5B39G 1X7TA 1A1NA 3JVFC 3KR3H 1E2ZA 5H35A 1T5XB 4CU7A 4H8WC 3I6SA 4X4KA 2P5WA 4XO8A 1DBJH 5ADOL 3OWRA 4YBQC 2YD6A 1SJHB 5E8DH 4MHHG 3U0WH 2DS4A 2D3JA 2P43B 2ZOLA 4WQOA 4WCYL 5C7ZA 2R2BB 3BP6B 4HJ0C 1FE8H 4MMYA 4OTXL 3I02A 5KWYC 4YHIB 3BUBA 4PLJD 1NCNA 2VB5A 4Y2NA 2G3MA 5I1EL 1KZYA 4QXGH 3K6SA 1NFIB 1NCAL 4EIBA 4N9GA 1DTUA 4KZDL 3GSWA 5D6CA 3A6CL 2A9NH 3RAJL 3PWLB 1FPTL 5IIEB 3X1BA 3MUY1 3BT2H 3IT8D 4Y4HC 3P2BA 3D4CA 5AAMC 5FO8A 2WLLA 3T8VA 4P4RB 3AG3B 4L3FA 4Q6IC 4XN8A 4UT9A 4GBXD 2DQGL 2XWEA 2VLLB 2XOTA 3WNKA 1YEEH 2A4EA 3T0EA 5IJKA 2VERA 2DI8A 2DQDH 1FZMA 4Z3JA 1V5JA 4GOSA 4JFFD 1ZT7A 3SPVA 4A7GF 1XH3B 4QRFA 4U49A 4LVOC 4ZUVB 4N2FA 5DI8A 4RGND 4Z18A 1JHLH 3AWFA 3QYCA 4GRMB 4J3OC 4AG4L 5BZDA 2FO1A 3WJMA 2UZYB 3IWVA 4ZS7H 1IO4C 4OFPA 2O72A 3F64A 1DBAL 1KWKA 3SDXE 4N6RB 5E6IA 1FH5H 2AFNA 4YL9A 3U9WA 3BQUB 4YDZA 3VGBA 1UM5H 4NJ9L 2KYIA 1CGTA 2J1XA 4YSTA 3HE7B 4APQB 2J8UA 4PH8A 2DEYX 1CFSA 4R26L 1AFVH 3VFSA 4J27A 3DVGA 1AQKH 1F02I 1R6VA 4HKBA 4OKDA 1YEFL 1ITCA 2QT6A 3RBSA 4M1CD 4GT7A 3N85L 1JZIA 3HHSB 1FGNL 3EOAB 1BZ7A 5FYJH 5KAQF 1J88A 2HRGA 2NYYC 2W94A 4TULL 5FLVA 1S7RB 1YEDB 3D4ZA 3BFQG 2P1YA 4N2DA 1VZIA 2Y24A 2F53E 3RDTD 1KTKE 3OJMB 8PAZA 4G1MA 1PAZA 2OXHA 3CXHK 1V54B 1OB1B 4YMPA 3T04D 4BHUI 3BKYL 3GK8H 4JRYA 3AADB 4QWWC 3QWRA 2WBWB 1SOSA 3RE0A 1FZJA 3UJIL 1KLUA 1C8QA 4ORZC 1UZGA 3S37H 5T3ZE 3QUHA 4C83A 3GS7A 4D7BA 2G5BA 2ZAIA 4RMSA 2NQDA 2EEBA 3PJSA 1CVSC 1JGVH 1BQLH 5JXAH 1SM3H 4Y5YC 4NC2B 4N1CA 2NSMA 3ES6A 5EV7A 2UVEA 3APDA 3SGDI 4AJWA 1U8QB 3O11B 3JYCA 4G8GA 3SKNA 4TLTA 1CICC 1GGBL 1N67A 4UOJA 5L2KB 4XVSL 2F8XC 1LO3H 4TNVF 5CU5A 1DQQA 1IIIA 4UOW1 4YSAA 4JZJB 2CHZA 2ZUQB 5KSVB 3P0YH 2NY3D 4PJEB 3QNFA 2VO5A 2HG5A 1JOIA 3U30B 4NP9A 3DTXA 3BYYA 1DCEA 3EYUL 4FQHB 4HQQH 2Z93B 5JR1H 5J6GA 1H8NA 4KTDL 4WEBH 1PZ3A 4QRTB 3NAAH 4J6IA 1QYGH 4WFHE 5JHDA 3VYPA 4KGLA 4KXAA 4TVSa 3LVTA 2VUOA 3C60D 4XB8A 4KJQC 4R7XA 4MMZB 5IM7A 2DWEA 5D93C 1TSRA 4DFHA 4L8SB 2VZOA 1CTMA 3HS0A 3U7WL 3IKCA 2N0MA 5E2VH 4XHQA 2FX7L 2EILB 2CKBL 2IOIA 1PF3A 3BAYA 3FKUS 3ARED 1AGEA 3BEVA 4M93B 5JIMA 2ORBL 1TJIL 5DURD 4NENB 2EYRB 2G30A 3NACL 3DMMB 5DFVD 3UCRA 1CG9B 3P4OA 3TA3B 4UTAL 3T77B 1S7QA 5C0NC 4KGJA 2Z1PA 4XP1H 4BH8B 2JJTC 3GEWB 1JF1A 1SQ2N 3F62A 3VDBA 5DEZA 4NT6A 3EYSH 2Y07L 1YQVL 3GMOA 4U1IA 2QGEA 5DO8A 3HB3D 2A77H 2ZCHL 3KW8A 3QZBA 3B7RL 4R0LC 1XR8B 5HYQA 4D7PA 4IU2A 4WO0A 1ILSA 4RMTA 1J1PL 5ENWA 3FT3A 4P2OC 3DK0A 3N0AA 1XB8A 3CFEA 3TZVD 3CPUA 4CDHA 1AO7A 3UGEA 4YSEA 3DLQR 4KKAD 4KAQH 3HNTH 4EI5A 2OCJA 5M95B 5AW3B 4AKQA 2VKXA 4HIPA 5FC9A 3UDWA 4NNPH 1NIDA 3MNVA 3BVNA 1JPST 4YDLC 4YHPA 4YDKH 1MRFH 4ORGB 4MXVF 3EUDA 2YUZA 1E43A 4HT1H 1ORSB 2P28B 1NAMH 2Y23A 3OX8A 2ROYA 4AY0A 5EO1B 3UBXG 1DLFL 2A74A 2QR0B 2OMTA 4FFZH 4H2AA 4OF5A 2CKBA 1LWRA 3QVAA 3RWHA 3CDGA 2H5UA 3ZDZE 4KKRA 1N68A 3FH5A 4ONGH 3BAEL 1Y18B 3CHOA 2AEQH 4RFOH 1BZEA 3LKRB 3NCWA 4UTAA 1T03L 5JW5B 3O9WC 4X0KA 2WUCL 1JV2A 4RBPK 5F9JB 1QSZA 1AZCA 2WLNA 4FYRA 3QIUC 3MRPA 2IQ9L 2XG4B 1I7TB 1W8OA 4ZO8A 2W59A 3KLHC 3BGMA 3KPNB 5CU9A 1XSJA 2ENPA 3LPPA 3AJ7A 2BOCA 3T2PA 2IGTA 3WAKA 4YFLF 1KGUA 4UUJB 3DK2A 1IQWL 2IMNA 3QORD 3ARFC 2OMYB 3ZKND 3BFWA 2Z34A 5IESL 4AZUA 1C9SA 4GXVH 2ICWA 5F2FA 4E42B 5DS8A 2O5NA 3L9RA 4ZQKB 3VQ1C 1R24A 1S7TA 2VDKB 3CZUB 3NCXA 1T4WA 1A21A 4L3AA 3PDOA 2QQLL 3KL5A 3GSQB 1JBJA 5LQBH 1UEMA 1F11B 2XVLA 2FWOB 4FXGC 4KJWD 4TQHA 3SKOB 5I8CB 4G3YL 1L5GA 1D5BB 3THMH 1WUNT 4X9BA 4PV1C 3BLKA 2HP4A 4CNIA 3A3YB 4QRUB 2F54A 2KDYA 4L3CB 4ZX6A 3RWIB 2XX1A 5IVNA 2FB4L 4DP0X 5ICYA 4KRNA 3LS5H 4MB4A 5T3XD 2ZICA 2O1AA 2BLFA 5IROD 1ZVSB 1MVUB 1A9BA 4LCYA 3ZE0B 4Z0BH 1QMUA 3QDME 4NDMA 2IH8A 4HWUA 1A64A 3STLB 3QUZB 4TNWF 4XP4H 2HTLC 4O4YL 5G5DB 4IHOA 4MNGB 3VXRA 3RGBA 5B38B 3FT0A 3N9GH 1OF0A 1WWCA 5DZAA 1N64L 3QO1A 3X3GH 2X2HA 4TLSA 3VE0B 1ES0A 1ZEAL 4X42A 4PJFB 2XQBL 4X7TB 2CA4A 3LKQB 1MY7A 3LRHA 4M8UA 4UF7C 3HC0B 5C7XL 2IDQA 1DSFL 3BP7A 3DXAB 1J9QA 1YEGL 4N3UA 4YXHH 2OSYA 1IGTB 4WU7A 4GMTH 5IOPB 2C9QA 3HG2A 3FFOA 5T3ZH 1FC2D 4IOIA 1OGSA 5GGRA 1G7MA 2NY6B 4PJ8D 4EXPX 4FKKA 1NOAA 2YJQA 4LKCA 4PRDB 3MRDA 4OV5A 4LSVL 1DFBH 1NZRA 1RHHA 4OW6A 1W72H 2XHNA 3US9A 2XTJD 1WFNA 3AM8A 4BUQA 4LSDA 4WUKL 3UZVA 1PNCA 4LCUA 4PGJA 1P7KA 1YN6B 1A7RL 1B4JL 5E2WL 3KYOB 4HMCA 2EVFA 2ESVB 5DYOB 3C5JB 4N90E 4TPRL 4WGKA 4OZGB 3MJ9A 3QAQA 4Z7UB 2J8UF 2LT9A 3MOAH 4JGNA 1N12A 1RJLA 1FFNA 4GMSH 1QFPA 1MCFA 4R83A 5D1QA 3UYRH 4TTDD 5BV7L 4DVRH 3IDXH 2AV7B 5L7XL 3VTMA 2VJ0A 2WVVA 3QXWA 3NJGA 3ZDYF 3H56A 3S8WA 1SYVB 3OBAA 2O5YL 1PG7W 4NYLB 4CC4C 3GXMA 1YECH 5KBMA 3U83A 2X12A 1E8WA 4LLYB 4CN6A 2YC1B 1R3KB 4NO0A 1MNUH 4LCIL 2LAGB 3ATEA 3WEXB 1T2QL 2RFXB 4ZI8A 1I1YB 3LQZB 2IDTA 3MNMA 2VNCA 3FSOA 5DWUL 3STZA 2X89A 1I1AB 3DVNB 3UG5A 2VSCA 4G7RB 5F44A 5L2KE 5AVXB 5AL8A 3X11A 4FG6C 3WLWD 4EN2A 3P4NB 5CCKH 4I48A 1MFCL 3E6FB 4PJEE 2NNAB 4O2FB 1AXIB 5DF0A 5D7LA 2H0FA 1V3LA 4JY5L 1OPGL 3QYNA 2QZQA 5I5IA 2ENSA 4JVWA 4H40A 2D7TH 1NSNH 5GJTH 2NXYD 3H8NA 1XF5A 3LXUX 4DHLA 5BUPA 1N9PA 1M4KA 3LKPB 4JDZA 1B0RA 2NR6C 4L05A 2KC0A 3KDMB 3BVVA 5E6ID 3VFVA 2RD0A 4G8EB 5D5MB 1BQRA 5DJXB 5KUMA 4B96A 4KRPC 4XX1G 3H3BC 4EIGB 1ONQA 2D03L 1DSWA 4JHZA 2HUEA 3WN5B 4A2HA 3NSDA 2RB8A 4DP4X 2BW4A 3BPLC 4PUBH 2K9UA 3LZFH 3K5RA 1IEBA 4XVTH 2VL5A 3CVHL 1QUNB 3QHZL 4YSOA 2CCWA 1VEMA 3IRCA 4U2ZA 3OG6B 1ACXA 5DD5H 5AW4B 1MHEA 4BZ2H 3IRPX 2EVGA 5GRJH 3RGVC 3SODB 2HFEA 2BY2A 3HJ0A 1Q90A 4EBQL 4U1HA 4FA8A 5A1AA 3GIZH 3PAYA 1REIA 3G6AB 1AXTH 5I75B 1A7QL 3M17A 4CJ1A 1AP2B 2MWCA 2VXQL 2Y25A 2W9DH 3C09C 4ODSH 3N1FC 1GZPA 2SODB 4JRYD 1E4XI 3QWRD 3I2CH 2GFBB 5F21B 3J07A 5F6HJ 4L37A 4JQVC 4N0YL 2ZUXA 2PYFA 1FVEB 2DN7A 5D71H 3WMPA 3O2DH 4PG2C 3OMIB 3MLXL 4JN2A 4LPCA 4NPYB 1ZA6B 1Q9KA 4PJBB 4TVPL 3W39B 3TV3H 4D0DA 3OR6B 1AGBA 1SBSH 4JG5A 1XBDA 2YPVL 2YA1A 1E50A 4NO2A 2MFNA 3FB6B 4ENED 5C9JA 3MV7A 3DGDA 1MCNA 3PGDB 3AITA 4KHXH 3I9AA 1TLMA 4G8GD 4LEXL 2ED8A 5CEZD 5I1AA 1HCVA 1UM4H 2WMPB 2VLKB 3FO9A 5CWSA 1EDYA 2X40A 3OXRA 1HXMB 7PCYA 4OZIE 4AMXA 4GUPB 3PP3K 3BZEB 3WY1A 3RFZB 3MRQA 5FHBL 1CFQB 3CVHA 2FJHA 1AHWC 2FO4A 1LE5B 4PS8A 4IKLA 4BDVA 1A5FL 1NWPA 1DBKL 2Y7QA 3JUZA 4K3JL 1LDPL 1U3ZA 3RTLA 3L95A 5JHDD 4IMLB 1SUJA 5TGBB 3CXFA 1D6EA 1RCYA 3WOVA 5DLLA 5T5NG 1GJIA 4YVUA 1KXTA 1LL1A 1MCRA 4U6YB 4HV8A 1FG2A 2JI3A 3KLLA 3D2UB 2VXQA 5D7IF 4KX9A 3VFNA 4ONOA 5F7MC