3MCYA

Crystal structure of fimh lectin domain bound to biphenyl mannoside meta-methyl ester.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FimH
publication title Structure-based drug design and optimization of mannoside bacterial FimH antagonists.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Carbohydrate binding protein
total genus 33
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 3mcyA00
2J2ZB 4AVKA 4XOCA 5ABZA 4CSTA 4BUQA 4AUJA 4AV4A 5F3FA 3ZL1A 4AVHA 1TR7A 4CA4A 4X5QA 1N0LB 4J3OH 3RFZA 4CSSA 3BFQG 5FS5A 4XOAA 4XO9A 2WMPB 4X50A 1KLFB 5AALA 5JQIB 2XG5B 3SQBB 2W07B 1UWFA 1N12A 5LNEA 5AB1A 4XO8A 2UY6B 4X5PA 4XOBA 5FX3A 4XOEA 2JTYA 4AV0A 5F2FA 4J3OF 4J3OG 4AVJA 1QUNB 1KIUB 3BWUF 5IQMA 4AUYA 2VCOA 4XODA 3MCYA 4X5RA 2UY7B 5IQNA 3JWNH 3ZPDA 4ATTA 4AVIA 2JMRA 4LOVA 5CGBA 3ME0B 4AV5A 5IQOA 2XG4B 3ZL2A 1ZE3H 5AAPA 3JWNE 1PDKB 4AUUA 3JWNG 3BFWA 5LNGA 5FWRA 5FLUA
chains in the Genus database with same CATH superfamily
4EVNB 3MJ8A 2R56L 2CR0A 1T3FA 5CBEB 3OGOE 1LM8V 4TTDC 4WU7B 4HZLB 3GM0A 1D7DA 3NACH 3O4OB 3UBXI 3QI9B 5E2TL 1AXTL 3B2UD 4CMHB 2D3NA 4E2OA 4UDTB 3IGFA 2BNQE 4FXTA 1J5OH 4TVPD 3F7YA 4LEOB 2HT3C 3PHSA 1MPAH 2YC1A 1ZLWK 1GAFH 4OJFH 1ZA6A 4UU9A 2B15A 5T1LB 2EVHA 3FUNA 2ZP9A 5B8CA 3O4OC 3D9AH 1RZ7H 3QI9C 3E8UH 4CMHC 1RK1A 3D2TA 3HLAB 2UXGA 3AG1B 1R3LB 4JFFA 1JVKA 2OXHB 4J1UB 5A7EA 1MJ8L 1BMZA 3SQBB 1TQCC 1CR9H 3LQAH 4BGDA 3BEVA 4XP4L 2OL3B 3CFDB 1AGCA 4PJHB 4I3SH 3WJJA 5FGCB 3DJRA 5ICUA 2YA0A 5D1ZI 2EEBA 1L6XA 4XOEA 3BP6A 2CRMA 2CK0H 4J28A 1KUMA 3BWUC 5JPNB 4BSWA 3C08H 3TN0C 2QSCL 3ZR6A 5MERA 1B0IA 1MREH 4L3EA 3ZE2F 5IFAL 1KCWA 4O9HH 4LQFL 2JCCA 1BYPA 3JWOC 3BCFA 1JZ3A 4WI2A 5L7XH 5KYYB 2YRPA 3GLAA 2WLIB 3KWUA 3ZDYE 5BZXA 4ZMXA 1P0SE 3LKQB 2G9KA 3NCYS 2NSQA 5DZNA 5T3XH 4E42B 4EIBA 5JPNC 2E4TA 3IJ7A 4L5FE 5DLLA 5GZOC 1OAQL 1X5XA 2ZUYA 2OYKA 4OJCA 5EBWB 4R96A 4KZDH 2R69L 5CKAA 1MCPL 1E8ZA 3MCG1 4CSPA 5DURD 1CK0H 3BMVA 1JSYA 3W3BA 2G30A 2W81C 5BV7H 4N2CA 3RTQA 2I69A 1O9VA 3ZXAC 3ZZSA 2X12A 3L5IA 3K72B 2XOTA 1A6VH 3DSFL 4L4TD 4Z7UB 3AXLB 3P11H 1ESOA 3VFWB 1A4JB 2F8IA 2E56A 1GS6X 2ITCA 3B5HA 3V6BR 1TIUA 1RCYA 5HD8C 4TRPH 3SN6N 5J6HB 4TNVF 5BS0E 1D5XA 1GGCH 5LBSA 3L1GA 3VXRD 4BHUA 4BK5C 4I9XA 1IV8A 4G6AD 3DMMB 3Q6FB 2MKWA 4F80A 2VIRA 3NIDF 4E9WA 1G7IB 1QSVA 2JKWA 5D1QB 1Z3RA 3DX9A 5E1HB 2EECA 4E9XA 2VZ1A 5C7ZA 4PW3A 4Y4KB 2MPVA 4GQRA 4HLJA 4AXWB 3DJ9A 2BP0A 1AG6A 4EZKA 5KN5B 1JF1B 3KPNB 2A7BA 3MRDB 3DMMC 1P6WA 2QPDB 3VH8B 3MA7A 4PJCB 1QX1A 4OZGB 2P28B 4JN2A 2D7PA 4M00A 2VWEC 4Z7QB 1GH7A 3AY2A 4QRRB 4BGLA 2FJSA 5MENA 4X6CA 4Y4KC 1B4LA 2OSLA 4YHMH 2Y5EA 4O2EA 3DWTA 4GKSB 1QSFE 3ZE1B 5IVNA 1HEZB 4PG2C 4CRPA 4XP6L 1NMBL 2W07B 2F8OA 4G6KL 4F91B 1HAUA 5EZOH 3GUFA 2GJZA 1JWSA 3QO1A 1MAJA 4WVRA 5E9NA 4LRIC 3H6JA 3U0PB 3QHFL 5EU6D 9PCYA 4PV8B 1FJ1B 1TDQA 2WK2A 4KDTA 2VR4A 3PABB 1DBBH 1RV6X 1FUNA 3D4ZA 2J56A 3QFGA 4NRXB 3UZQA 1NEPA 1QVOB 1BQLL 3LKNB 3PFUA 1E2WA 3VA6A 3MLTA 3EYSL 4JN1L 5TH2A 4FA7B 5CF3A 3T4YA 2BY1A 5I1CL 4EAEA 4ELDA 3M7OA 1I1YB 3CX5J 3WIHL 2W65B 2EYTA 3JXAA 1BG9A 2WQUA 1DVUA 1ZT1B 3G6JB 1FZMB 3WJLA 4L2YA 5CLYA 4X6DB 3WEXB 1BHGA 4Y19B 5IB2A 3Q8EA 1TJGL 5IFJB 4D0BA 3WGVB 4F8QA 2Q7YA 3QG6A 4RFEA 1RFDH 5FFOA 5FGBA 4FQ2H 3LQMA 2JKTM 4U1LB 3U2SA 1RJCA 4PJ9B 2GJPA 3PJSA 1YNKL 2AQ3A 3TA3D 1WFNA 4KXCA 5I5RA 2WVVB 2J12B 1JCVA 1JGEA 3DROA 3VXMB 3MV9E 5KBLA 5G5DA 1MQKH 4FL4B 2R29A 4NRYB 1U6AH 3IYLW 4TQEL 2CLVB 2YJQA 3OZ9L 1IFHH 3M6DA 2E9WA 4YDLB 2EVJA 2WBJD 4AIOA 3JVGA 3Q8FA 3CMGA 2DQGH 5EO1A 1GMIA 5KANI 5GRJH 4HAGA 3FQRB 2V5YA 2EINB 3C6SA 4Q6YA 2Y6SC 1RUAL 1RZPA 3GZPA 3HAEH 5K33A 5A3ID 2ZX7A 1WUNT 4FL4C 7CGTA 3NTCL 4PY7A 1NUGA 3D69A 3HR5B 4LIQH 3ZTEA 2FX9L 5FW6A 4YDLC 3I3BA 5EU3B 4XRCB 4XAWH 4WI4A 4NKDB 3IMTA 1W9XA 2R56H 5HYJA 3HN3A 4U1SB 3P3UA 4NUGH 2JKRM 4L4TA 2EDFA 3MRHB 4RAVB 1U91A 1AXTH 4TUKL 4QRSB 3L4CA 3CGTA 5FYKE 3H9ZA 4X4YB 2X4SB 4PRBA 3MX0B 5DJYA 3TBBA 3O9WA 1S9XA 1OAXH 1R33A 2Y69B 3EG9B 3MLRH 3VXRA 4LAQH 4PJDE 3G5XB 1YEIL 3LZPA 1C8QA 4R7LA 3DLQR 2CNYA 4KRPD 3E9UA 2G75B 3NPZB 5C97A 1SYVB 2ICEB 1WCQA 1HXYB 2MQ0A 4POZD 2G2RA 3BT2H 4JFZH 1A4KB 3US1A 3GHPA 4MXQC 3CFEB 4RFNB 3ATFA 3NIFF 3VTAA 1NC4B 5CLXA 2DYPD 2ICEC 2D9CA 5CZXD 3AG2B 3ZHKA 4XODA 2ZXWB 5C0CB 3IWUA 4F27A 5I0YA 1KTRL 3LVTA 3VSVA 4XH2B 2OK0L 5IVZA 4DN4H 3BKCH 3UEQA 3U1PA 3APNA 5E8OA 4XAKE 2F53B 3ENEA 4RGMB 4XX1G 4O4YH 3I02B 3LRMA 3A0OA 4H8WC 5HPMA 4KZEH 3KPQA 4RMSA 1YYML 4BA0A 1S3KH 5J89A 1CXHA 1IAKA 3DJTA 5FUZH 1UGNA 3ZTCC 2D8KA 1KIPA 2I7OA 4HYTB 1TZGL 4EUPA 3DPDA 1NCCH 4J6RL 3KDMA 3QK0A 3MRQA 1BM3H 1OB1B 2XBZA 3H56A 4RGMC 1E5AA 1B4TA 4TYUA 5D70H 4DFIA 1A3ZA 2XYCA 4WUUE 4UQBA 5DSCA 4HAKA 4FN0A 1I3GL 2CPCA 1W0WB 2BNQB 5CZKA 1NFIA 2BX5A 4UOZA 1UZ6F 4XI5D 2J3SA 3B1TA 4FERA 3Q48A 4JM2F 2G9HB 1ZHNB 4HU8A 1N8ZB 1HKLL 1J1OH 3TJPA 3BJ91 4QHMA 2Z31D 5ESAA 4ZG1A 4GEIA 3U1QA 3GC3A 1EEUA 3QNFA 1RULL 4NQSA 4FA8A 3IGKA 3MBXH 2EYSB 4Y16C 2JCCF 2V7NB 2CJTA 2Y4SA 3TA3A 1YYLL 3TJHC 1SHWA 2YAEA 3HG1E 1GYUA 4IS6A 4YDZA 2VZUA 1NINA 2XC8A 3ARVA 4I3GA 5CN2A 3TA4D 1I8LA 3P3TA 3EOYG 1V8HA 4OIFA 1N6QL 4XVUC 3U7AA 1ZD6A 3EGSA 1JXDA 3TEXA 4EN3D 1BM7A 3MNZB 2D7OA 2KZWA 1KLFB 2J7LA 2QZQA 4LP4A 5DQJA 3QNZA 2V6HA 3RVWD 1I7TA 4PP1C 1BF2A 1CF8H 1NC2B 2NNRA 1CD1A 3AROA 3PWNB 4RMRA 5EPMB 1MW3A 1TVHA 1X7TA 3UTSB 3ARED 5JR1H 4UBDD 4KK5C 2X9WA 4NENB 4ZFOL 3IDYC 4OUUB 4G8FB 4N8UA 2GG1A 4EQ3A 2DWEA 4MD0A 1Q9WB 4JO4L 3T3MF 5EIIA 4XP6H 2FDBP 2I60L 5GJSH 4ZI8A 3IMRA 4LCCB 2P9RA 3CDGA 1U93A 1SHMA 2Q9OA 2ZPKL 2CCLA 4LPVA 1KB5H 2WOBA 3WD5H 2VMEA 3NCFB 3F2LA 4OZHA 4X4MA 5CP7A 3EFFA 3KLHD 1VEPA 2O6CA 5CXPA 4N8VA 3DI3B 4LCCC 1F90L 1JZIA 3VM5A 2AXJA 2KL6A 4ATTA 5LXVA 1LEGA 2C9SA 2H3NA 1MCIA 4M8VA 1QSEB 4JN1H 4BQ8A 5EN3A 5B3JF 4JJ5A 2B1HH 3WTTA 3P9LA 5D4HA 5F97E 2WVSA 3GEFA 1U3HB 1R3HB 4MMXB 3RBSA 1BVZA 2D3LA 5E2UH 3X14A 3HJ0A 5DJ2A 2VC2B 3WJMA 1XT5A 1I8IA 2A4EA 5C0GB 2HN7A 3IJSB 4X6CF 3TASA 5D72H 3IU4L 1CU4L 2DYPA 1MHHA 1R3IH 3U36A 2LU5A 1AKJD 2GT9B 3L5WA 2HRHA 5FDWB 3O3EA 5FK9B 2FT7A 1AR1B 3ARGB 3UP6A 3DO4A 3UZVB 4P2AA 1U3HC 3VDAA 4MMXC 2QPEB 3JWNG 3A23A 4L1BA 5B1JC 3ARBD 4CU7A 2R4SL 4EKXA 4P5KA 3KPPA 3PV6B 4TQEH 1A9BB 4XMKL 4PG9B 1RJLA 2WLLA 2VKWA 5D93B 1AR1C 4A7UA 2RH0A 3BGFB 1OWRM 3ARGC 4R4NC 1QSFB 3M46A 4ZTEA 4LCVA 2B08A 3C5ZD 3ARZA 2DAVA 2KI6A 5I30L 3QFJD 3QWNA 4LLWA 5HHPB 3S98A 3EYOB 3GMNA 3CN3A 4RISL 4JUTA 5HHNA 2WNKA 4M1GH 2FX9H 1QNIA 3DRTB 2EO1A 4K3JL 5D93C 5JQ6L 3BGFC 2I7SA 5C08D 5F93C 1KCLA 1G7LA 5DRWA 5FYKU 3BISA 4N0RA 5F1NB 1JZHA 3MBWB 3JT0A 4L0YA 1G1KA 4P2RD 1LD9B 3ALXA 1NAMB 4YSOA 2Z31A 3FQ1A 1FRGL 1GOGA 1QLFA 5TDNA 1XXDC 1I7UA 3G9AB 4Y5XC 4NUPA 4KNTA 3AU1A 4FXLA 4OF5A 1DQIA 3HUJF 3FQTA 4P49A 4PAZA 5TDPA 4QIRA 1DTUA 1J1PL 4JLRB 2FT8A 2YN3A 5C9JA 3SZKC 2BSTB 1UCTA 3MJGX 3X3GL 1YEIH 3IXAA 1NCBH 2CIKA 3LKOA 4W9DC 5IB5B 3SCMD 4BXVA 3ABKB 2J8UA 2X4QA 1OAZL 2A6JA 1DP0A 4L18A 3NSDA 1KLGB 1LGVA 3MR9A 2O72A 4BA8A 2AEPH 5BXFB 1K8DA 2F8XC 2F74A 5CWSB 3ZSSA 4EN3A 5EO9B 3C9NA 4DZ8B 5BRZE 1PZSA 4YVUA 1N64H 1AGBA 2X7LB 4YWGH 3WMSA 2ESVE 3MV9B 3HG2A 3QDGB 2FQEA 3S4SB 1BWWA 1QLRB 5I8CB 2J1KA 2NTFB 2R0ZH 3AREA 3FTSA 3IBOA 4NUJA 3HRZA 2DQFB 1LQSR 3TWCL 1NJ9B 3OHXA 5DHEA 3ULUF 4HJTA 3UPAA 3I9PA 2EACA 4FJYA 4XBPA 1O9WA 4R3SA 4F9LA 4HDIA 1MJ7H 3VWJB 2Z1KA 1ZKAA 4F8NA 1ZE3C 3CBKB 2PP8A 4OZ4A 1QI3A 2YQ3A 1JV2B 1HQ4B 2WB7A 2CHZA 1YYMH 4X5LA 2GAZA 4NO5B 4ALAH 2Z8RA 4JQIH 2HAZA 1HHGA 5KG9B 1R4XA 3UC0H 1KJ3L 4J6RH 2F18A 2F7OA 4A6YB 4NQED 3VWJC 5E6YA 3PDDA 3TO4A 5HJGA 1JYVA 4LLYA 2XT1B 4YSAA 4X80H 2IOOA 4WU5A 2I25N 5HGBB 5B38A 5D2NA 2NSXA 4AEEA 5IJKA 2WKOF 4Y2NA 3FFDB 1YY8B 3BRDA 1E27A 1OW0C 3MTRA 4IRJD 1FI8C 2GKIA 4PJDB 4CSTA 1QRKA 2VZTA 3AXHA 1HKLH 5I76A 3O6KL 4KJQD 2LU4A 3SKOA 1AKJA 2WQSA 1ET7A 4KY2A 3SE3A 5FO9B 2H1XA 3E1ZA 3GMQB 3Q06A 3MRKB 3MV7B 4D7PA 4XNYL 3UBXB 1TU2A 3CK0L 1YYLH 3QEQE 3QZWA 2HRPL 1XGUA 4LARH 3T6VA 3ARBA 4J3BA 2BVOB 2ZKMX 3JSSA 4XE5B 3GS0A 3OHMB 5EDSA 5L88L 1BVLB 2GSGA 4GMTH 5AENA 4F20A 1RP8A 3V7AE 4YK4B 1F6FB 3BIKA 3PJNA 4AGPA 5KVDL 2XUWA 3LKPA 2C3WA 2JLPA 3C5ZA 3GSNL 3QPKA 5LG1A 4PRNA 1G94A 1JG9A 2VXVL 2YAOA 4ZX3A 4N5ED 5IMLA 1TPXB 2XFXB 1MH5A 4BHUI 1BFSA 1XB8A 4HT1L 2WSKA 3KNBB 4G11A 2PYED 3E38A 4PJXF 5LUMA 1I1CA 5C08A 3S8GB 5AB9A 3BKYH 1SBBA 3TJEH 4XVOA 5D1ZB 2UZPA 3O3UN 1B0WA 4JO4H 1MIEH 1MY7A 2RD0A 3LV3A 3SKJL 1TPXC 5AZUA 3RGBA 4PGJA 4JCWA 3A6BH 5BQ7B 4LSVL 4WUUB 4WFHD 3BH9B 3NABH 2YD6A 4JKWA 4U1KB 1YNTB 1KELL 3H42H 5JDSA 1CBVH 2CO7B 2FUTA 4NQDD 4UT6A 4JK0D 3N44F 5D1ZC 4AH2B 4UILL 4OGYH 5LBVA 3F05A 4OJAA 3RVXC 3SCMA 1WPCA 1KYUA 3VXOB 3FO9A 2X9XA 1BOYA 1KPUB 2YJLA 4I4WB 3TEUA 4KKQA 3NRFA 4PS4L 3X1NA 5D7LB 1SY6H 3HNSH 2XZCL 4ODWB 4X0NA 5B7MA 1IGTB 4KTDL 4JGJA 1HH6B 4AEIH 1D5ZA 1DUYA 3GJFB 3HG1B 4FNTA 1IGYA 2XA8H 3QO0B 4E9QA 5FAAA 3UJIL 1JGIA 3OG6B 4LESA 4YSRA 3DYPA 1ET5A 4XXCA 3MRNB 2PCYA 3DVGA 4JO5A 2HCZX 4LU5L 4YQXL 1KEGL 2EXYC 2W0LA 4YLCA 4P99A 3S5YA 1RD6A 3BUPA 2CHNA 3KPRD 4Z7NE 5F1IA 5F9OL 3H4FA 4R8WL 1MFEH 3A4DA 2R4SH 1AOZA 4KUZH 1FZJA 5SV4A 1CUOA 3FO2A 1LTXA 1DDHB 1FNHA 3BYYA 5IR1A 3CU7A 3JVFC 1A6ZB 1WBYA 2XSKA 3N41B 5I1HL 3MCLL 1ZRUA 2C7UA 1D5BB 4PP2A 4NI6A 3T0AA 1YEHL 4ONFL 2A74A 4QTHB 1UJTA 5KZCD 5EMYA 3THMH 4NQEA 4QAWA 2WXGA 5FHBH 5BVPL 5D7IA 3P1VA 1CCZA 4AEHL 2Y2YA 1K2DA 3TBWA 2ZKHL 4P59L 1GC1L 1H3TA 3ZK0A 1XF4B 4FDWA 4K3JH 5DS2A 4DN3H 4ILDA 1W0YT 4MQSB 2NSMA 5A6MA 1QBMH 4IRJA 1YNLH 1IBBA 3VRLF 2LLNA 43CAB 3ZDZF 4TQPA 4PLOB 1DVYA 2E7LA 3COOA 4PTTA 4YHNB 5E8EB 4JFQB 3KYAA 3NCCB 5T33H 1CFVL 2BHFA 3DTUB 4G6JH 3PRZA 5I6LA 1KPRB 1DFXA 2FGWL 1AXSB 2CNZA 2WINB 1TQVA 3L6FA 1T0PB 5D7HA 1HTYA 4P0DA 5AOLA 2I32A 1D7BA 4XPAL 1SXNA 4XWGH 5KBNC 1JGUH 2JH2A 5ID1A 4O2FA 3VXTB 2G5RA 4ZQTA 3C6LD 3MJ9H 4X8XA 5CJOH 2ZCLH 2G0KA 3U4AA 5JW4R 1PZ5A 1KLUA 1T2XA 2ENQA 4A7SA 1UB6A 3B8YA 5H2BB 5AUMA 2ADJB 1H9VA 3WUZA 4QHPA 4UI2A 5M7QA 1JZ2A 4ZPTA 4ZUWB 3UX9B 2PYEA 1F8TH 4MRCA 2CRYA 4BZYA 3DKHA 4PUBH 2P47B 1SFHA 1NICA 2JKLA 4MWFA 3N42B 3RJQB 1QEWA 1QSZA 3H8NA 3DGGA 5ILTL 3Q8CA 2VQ1A 4F7TA 1INDL 3QUMB 4BH7A 3HB3D 5TD4A 3ZDXF 1KXVC 1TYEB 2QLYA 1NDTA 3GMLB 4AUUA 5JXED 3GS7A 1HL5A 3D05A 3QNXB 2OL3L 5E5MA 3JWOL 3OWRA 4UIKL 1JHLL 3F04A 3BSGA 3U4BH 3QULB 3K74B 2FIKB 1M4KA 3GDCA 3IKCB 5IMMA 5ABZA 4LB8A 4DO5A 5ADPL 4KJPD 2B4CC 2AV1B 2X6MA 1MVUB 2CHDA 4YXHH 1HN1A 3VCLB 1U41A 1OP3H 1LNUA 3LPFA 5AOKA 5IGXH 1E5BA 1A6WL 4FZ8H 1F3RB 2GC4C 5F3FA 4F8LA 4AZ8B 1UOKA 2M1KA 1U4EA 4HXAL 2WGNB 2IADA 4LVNB 4RMTA 2DMGA 4ZUVA 2E7HA 5HDLA 4DCQA 3O6KH 1MIMH 3R06B 2F7PA 4FLRA 5D6CA 5IEKA 5LGKA 4F7MA 2ITDA 3HG5A 1TQBB 5HJ3A 3NEOA 4C55A 2EZ0C 2EADA 4LO9A 5BRZB 5FW7A 4XNYH 3NPSC 3CK0H 3NH7L 3KPRA 2FHFA 2ZXGA 4ODXB 2JCCE 3I6LD 5IVXF 1PIGA 2ESVB 3SBWC 1SN0A 2VM4A 3GNMH 5L88H 3L3GB 4K55A 2NY3C 5HY9B 3EO0A 1QTPA 1BZ9B 2IGFH 5I8EB 1TQBC 4DPAX 1AS8A 1H0DB 1OTSD 2CR3A 2VDPB 3HC3H 4FQJL 4X7SH 2Q1EA 5LGYA 3WFHB 4B3VA 4IMLA 3SODB 1A65A 4LSRH 4QRTA 3UTPD 1VCAA 4PH8A 5GGSA 4YDMA 4AKPA 4TXVB 1GCFA 2KDYA 3DOSB 4XMWA 3VB8A 2CIIB 2KLTA 3EF7A 1OGAD 5DYFA 4PGBB 1PF3A 3K4AA 4UCFA 3M1OA 2FJHB 1WFOA 2EDDA 4ZXBC 4LP8A 1UXSA 4KKNA 3PIQA 3VI3F 4DO6A 2NNXA 4EJ1C 4Z7OE 4ZW5A 2DM2A 4GUQA 1YQVH 3JQOB 3HG4A 4TKWA 2FATL 2ZAIA 3KBPA 3PNWB 2WW8A 2HVJA 1JDDA 4WIQA 2D2CC 1BV8A 3GIVB 5I1DB 4JR9L 1H6EA 1RZKC 3ZHLA 1OTTC 3DYMA 4G8IB 2BIOA 2UZYA 3C8DA 1JE6A 3OWEA 2VDLH 1ZA3A 3C6LA 4M7LL 4JDZA 4PS4H 2VMJA 4PWJA 2J4WL 1Z5YD 2QQNL 4M6ML 2HPTA 2EYRA 2ZYRA 5B3JE 1JXKA 1QLEB 2Z4QB 4DTGH 2BP8A 1V7NH 2VSCA 3KWXA 2OXGB 4K0OA 5GGTL 3QC6X 3IK2A 5BCAA 5I23A 5FUOH 2P4AB 4UT7L 5K39A 2J71A 5E2JA 1XGTB 4OSUH 5MENE 1A7PH 4X6CE 5I6XB 3D0LB 3FKUS 2BDNH 4W68A 3L1EA 5I9QB 4B7LA 1BQHA 1C1EH 2X3BA 4M62L 2JQZA 5CILH 5ETUB 4A2DA 4KBPA 1S7TA 4UQCA 5C0RL 1BZDA 2VDOB 4MJ5B 4DP6X 5JXEA 3IMSA 4A55A 5I6XC 2FRGP 1MZYA 4TVPE 4GG6B 1CFTA 1MWAH 3A5VA 4U7SA 4NSKA 4N0FA 5I9QC 3S88H 3T09A 4MNQA 5DHYA 4J8QA 5FYLL 4N6RB 3OLGA 5DD6A 5DEGB 1FO0H 5JNYB 1GYVA 1PYWA 2DQTH 5C3IA 5E6IA 3QRGH 2ZTBA 5HI4D 2NT1A 4PGDA 3RZWA 1E4KC 1TITA 3BWSA 2NY6D 5BS0D 4YDVA 1IGMH 3KL3A 3K6SB 4Z76A 4OCNC 2OS7A 4DGVL 2YWZA 4U2ZA 2IH3B 2XV6B 2LU7A 2NOYA 2E9JA 3H7BA 4AVJA 1A7QH 3UYRL 2OJZL 4QI3A 4GBXD 2Q76A 3M1BB 1CFVH 2VLRA 2D7QA 1U8KB 2HZHA 1L0QA 2AJ3B 4DUWA 4CKVX 1S7UA 1OQXA 2FGWH 5I5JA 3ARFB 1N19A 1WTGT 3R19A 4GRLC 4XPAH 4ODSL 3D1MC 3PDGA 3CMOH 4G3YL 4MKTA 5DYOA 4WLCA 4AQ8A 1HXMB 4AZUA 3ZW3A 3GIZL 5TQ2L 5E8PB 1BQKA 2OP4L 4HS6B 3ZDWA 5D55A 2BRRL 1T5XA 1QHQA 5TJWK 5A6IA 5F0LB 2Z4TA 4KJYB 1ERNA 3QJQB 2PXYD 1URZA 3ARFC 3JTBA 2AW2A 2X09A 4NNXA 1DQDH 4Z7NB 2EH8L 4MB4A 5ERWB 3P3SA 1R1CA 3N1MC 1PL3A 2Q3AA 2R27A 3WXVL 4XPTL 1OAUH 1ANUA 3MUHL 4NHUA 5K9OA 4S1QH 5E24E 3KXFD 3AT8A 3M88A 5DQ9B 4AQ1C 5KSUB 1O0VA 3L7EA 2EXTA 1T0NB 2I9LB 4XNXL 2HJKB 1CBJA 4FLOA 1S9VB 4GPVA 4R5VA 4JO8A 1FA4A 5EOTA 1INDH 4U49A 2OMTB 3OZLA 4NKIH 3B1UA 1NMAH 1KGCD 3JUZA 4K15A 2AQ2A 5LCVH 4K3HA 3RFRA 4XNQB 1SZNA 2WWOA 2X4RA 2B16A 3MJ6A 3VXRE 3D18A 4UIKH 2F1EA 2JIXD 5I8KH 3VFVA 1ZLSL 2BNUB 4H8WL 1U3JA 5C70A 2WUBH 4XNAA 2DBLH 4W9FC 3DX7B 2R9HD 5LXGH 4QR7A 1OSYA 1CI5A 2EXSA 2XQYK 2FH8A 3RILA 5JA8B 2IWGA 4K8RH 2UWEF 3ZIMA 1QTSA 4YPGA 2ICWA 3QZPA 1DQJB 1OWWA 1VRSA 4V33A 5I1JH 2SEBB 3AWFA 4PV1C 4FEMA 2DI7A 3TO2A 3LEYL 3PGCA 4HCIA 5I66A 2CA4A 4EEEA 1JNNL 1A7RH 2P8PB 5T1DH 2SODB 4PIBA 3GXIA 1AHKA 1U92B 4IU3B 5E5RB 3GF8A 4J3OC 4AE1A 3VI4A 2ENSA 2X5PA 4KDVA 4YZFE 3MKKA 4BKTC 3ZIYA 5DJDB 2Y7MA 4ZSOA 2CKBH 4P48A 4BRJA 2R2CA 2FCBA 3B37A 3H3PH 4XCYA 4LHUB 1Q0XH 3FH8A 2WZ0A 3CFBB 5C0BD 3B9VA 3DSNA 3QDAA 4Y4HD 4DOHB 1TNMA 3LYRA 3SDAD 1D6EA 1MRDH 4W9IC 3UZEA 2Q87A 5H94A 3MCYA 3MJ8B 5FUCE 3WFCH 1T3FB 1IGJA 3V0GA 2QGEA 1FNLA 4OD2A 1T1YA 2Z8WC 3FRUA 1CXIA 2Q8AL 1TQSA 4EN2A 1I7RA 2LR4A 4JNXA 3I9AA 3L13A 1MY5A 5KBKA 2BK8A 1Q72L 3Q13A 1OCRB 4HVBA 2HX7A 3F7YB 4Z95L 3S6CA 1CVRA 2YC1B 4M7LT 1ZA6B 4O02H 4P5TC 4UU9B 2RMNA 4XHQA 3RU8L 4LCIL 3ZHDA 2DQHL 1ZWIA 2GITA 1KXTA 1HCYA 3ETBF 5B8CB 4GBXA 4DKFL 1CGTA 4ZBJA 4I87A 3FNKA 4HKXA 1RK1B 3L4WA 1KJ2H 4JFFB 1HAWA 2BSED 2EE3A 2HWZL 2P26A 3JBG7 5CJ8A 2OX5A 4B53A 2FATH 3ARDD 4KRNA 2LLLA 3BEVB 4WEMB 4WEEA 1AGCB 3RX8A 3WDIA 1KN2L 3HC4H 4OQ1A 5B8CC 3NJLA 3CPLA 3UYPA 1Y6KR 3CSGA 4F57L 1YEFL 3SGDH 4KQ4H 4Y89A 1SRDA 3BP6B 4Y1AD 3RYMA 3KS0J 1HL4A 4K3EH 4L5FL 3BE1H 3AQDA 3OMNB 4M43L 4BSWB 1S5IH 2WTRA 4M6MH 4NZUL 5MERB 12E8L 4L3EB 3B5GA 4LCWA 1EIBA 4HPHA 2ETWA 5LHDA 2JCCB 3WJJC 4C8XA 3KLQA 1G9MC 2TRYA 4UT7H 2I85A 4UV4L 1UT1A 4BZ2H 2B59A 5I1IH 4D0DA 1G6RA 3CUPA 3O0RH 4DQOL 3W0WD 4XTRC 3KXFA 3WEAA 4NNYA 4F24A 4U7MA 1ZHLA 1NGYA 3LH9A 5FM8A 1TZAA 4KC3B 3WN5C 2FSDA 2QFRA 3ZQ9A 5DZOA 3ZJAA 5C0EA 4YE4L 4G8GD 5A40E 4JKPH 4WNJA 4TPRH 5C7XH 3BUQA 5HDRA 2XU9A 4OQTL 4R96B 2BRQA 5E2VL 2DTML 4X4ME 1SLVA 2YKLH 4KU1A 5BVJA 1HINH 2A1WL 3JYCA 3MROA 4L1SA 3VG0H 4BE5A 1DQLH 2IMMA 1G0DA 1Q90A 1IILE 4OM0L 5C0AD 3RTQB 1VZHA 3HAEA 1AANA 4KKAD 4OFIA 2FX8H 3A4FA 5EEYA 2LGNA 4G82A 4P2CG 4PD4K 3RDJA 3II3A 3K8LA 2JKNA 5KSBA 2ITCB 4GNKB 3MODL 3P73B 5JOPD 4Z7OB 4NWTH 4CW1A 1D5XB 2WYZA 5DFAA 2IBZX 2MTAA 1OCZB 2MHAA 1VEMA 4PJEF 3TVMD 3D4GA 3RTQC 2VIRB 3DTXA 1BEXA 4JPVH 5HI5C 1TJMA 4ZD3H 3JTTA 3H9YA 1E4WH 4IIZA 4FTVD 3UYRH 1DQTA 3CLEL 2OJZH 3VRLE 3ARSA 3DX9B 1AIZA 2E27H 1F1GA 3B3BA 2XNAA 2BP3A 1OT4A 4X83A 1NCWH 3OD3A 1MFDL 5F7EL 5FECA 4QGTA 2BP0B 3PWPD 1MCWM 4CL7A 1P2CA 5KEZA 5GHWL 2WBXA 3DTDA 3MA7B 2IQAA 3V5DA 4JN2B 3NCJL 3S35H 4CKQA 1BXVA 1RURL 5F0PB 4Y4HA 4RDQF 5MENB 1OOWA 2PABA 3ILDA 4X6CB 3EUUA 2OSLB 4OJYA 3SDAA 4ORZC 4O2EB 3EW3B 4ZUUA 4WJKB 3J8F7 4PWKA 4TSAH 7TAAA 5MHSE 2OLDA 4YFEA 1GGUA 4R84A 5TE4H 5IBLC 3VFOA 1B9KA 2GJZB 3QCVL 1JWSB 4A38A 3QO1B 4DERA 2EEFA 2BSBA 3LZOA 2VB5A 1WICA 4NFDA 2V9QA 4AGNA 5JHDD 1JTOA 1YVLA 4LGRB 4RETB 4JFXA 3U2JA 4UNTA 1TG8A 3SJVD 3UZQB 3O45A 4JDTL 3FO1A 4XCEA 1FBIH 2FZ3A 4HD5A 3B2UC 4W9EC 3TH3T 3CD4A 2BSEA 3MLTB 2IGLA 4Z7VF 1AYRA 5TH2B 4EBQL 4PYHA 3T4YB 3W39A 5I1KH 2K1MA 4KDTC 4OF0A 1F1AA 2VLJD 3M7FB 4NGHL 3ARDA 4BFOA 4FFYH 1Z1WA 4KXZI 2VDML 1BZOA 4NZ8A 4WI8A 2EYTB 5FS5A 1ZLSH 5EG6C 2OZ4H 1VCBC 3SB3A 3CSTA 5AZ2L 1BWMA 2ZUWA 4AC2A 4HQQH 1UWYA 1FV1A 4LEXH 2J8UE 2WXPA 1JGVL 4NZRH 3F65A 5IB2B 4GW1A 2R69A 4D0BB 4GT7A 3QG6B 1REIA 1PPIA 1RJYA 4MDRA 4RFEB 2HXAA 2Q7YB 2CXKA 4GFTB 3OKDA 4TULH 3ZL4L 4JDVA 3U2SB 3KPLA 1WTLA 1S3RA 3PJSB 3LMJH 4G6FB 2KMWA 4IGBD 1SDDA 4N2LA 1UCBH 4WK4B 3CWGA 1JGEB 3DROB 3W82A 5GZND 2EP6A 5G5DB 3VH8G 1TZOA 1JGLL 4LK4A 5EC1A 1CXLA 3W0WA 3WFBH 5FGBC 3V0AC 1PZAA 4Z0XA 1YMHA 3K7UA 1N70A 2E3VA 4NJ9L 3LPGA 2J6EH 5EO1B 1XBRA 3TPUA 4G8GA 3VMNA 2AGJL 3C6SB 4QRFA 1RHHA 1UA6H 4L4VD 2ZJSL 2CDEA 4I7ZC 1T7WA 5FYKL 4PY7B 3D69B 3WNJA 4LKCA 1OT2A 2NY0B 5IY5B 3OBAA 2PW2A 3IAGC 3HLKA 2F1AA 3WKML 1DQQA 4OT1H 3D07A 3LPWA 2R4RL 5DURB 4E68A 1TJHH 3JVGC 3EGXA 1RUKL 3VDCA 3QXVA 2NX5D 1F13A 5EWIH 5CGBA 1J18A 4JFEE 2XKSA 1S7WA 2AXFA 3K4ZA 2XX0A 3M45A 2ZCHL 4L4TB 3VTTA 1YEJL 2WXQA 4YO0A 2Q8AH 1U91B 1NGZA 2NY0C 1KYDA 3A6CL 4BFJA 3RBGA 5F9WB 3FTWA 5DVPA 5D2NE 2AV7A 3W5NA 1BBDL 2IO5A 1Q72H 4F8TA 4PRBB 1MRFH 5HGDA 5DJYB 1OOAA 3O9WB 1S9XB 3VXRB 3HMXH 1A6UL 3CVDA 2A73A 3TVMA 4ABQA 4NQCD 1BDYA 3O8XA 2MCAA 4ZFGL 4FTVA 2DQHH 1FLTX 1D7FA 3HBZA 4PRIA 4PWGA 5I6KA 2K3HA 2ZSVA 1WVZA 3QQNA 1G9EA 1VFAA 5F9WC 1L7IL 5FA3A 3BVXA 1EH9A 1P4BL 2HWZH 1BD2D 3O9WC 1USQA 3PP4L 3PWPA 5JIMA 1GHFL 4JPKL 5J56B 2G2RB 4ENED 3WIIH 2KZBA 1VERA 2ZYIA 5BOZG 2VM3A 2W91A 2YGNA 2IDUA 1MHPH 3LD8C 3M8OH 1DVXA 3O3DA 3MOBL 5F21B 1E6JL 3RWCA 1UD5A 4UZGA 1RUPL 3RWJA 2EEXA 1OANA 4JZOA 1CZ8H 3AW5A 3WIHA 1KMGA 5IVZB 1Q9OA 5E8OB 2FBJH 3G5YA 1G1CA 3IE9A 3V6OA 5HDBF 4IBVA 3HOGA 2P5EE 4JKLA 4KKBD 5JPMA 2R2BA 5TDOA 5GRVK 4UV4H 5HPMB 1W72L 4YL9A 3KPQB 4QO1A 3LVEA 4JHUA 2IV9A 4KROD 1CN4A 1HNGA 4PS3A 5T5FL 5C08E 3CC5A 1IAKB 4J4PC 3ZYIA 1KIPB 5LKNA 4EUPB 2QR0A 2W0FA 4A7GF 1IVTA 5JIDA 3KDMB 1SMDA 3KYKH 3SJVA 2WWKO 3MRQB 1PZCA 4H7VA 4CMMA 5ELIA 4Q9QL 5FX3A 5EORH 1D6VL 4UV7H 5KS9A 4WHCA 3NFNA 2YN5A 2HUEA 5DSCB 2ZAHA 5AYUH 1NFIB 2VLJA 3SE8L 2A1WH 3NJJA 3TM6A 4FABL 1M9WA 3W56A 1DANU 3AGWA 4OM0H 5FUCC 4LOFA 2GJRA 3RNQA 4AY0A 3H3BC 4QHMB 4UANA 5ESAB 2VYRE 3R4RA 4Z8FH 5GRYA 1FC1A 4JW3A 4NQSB 3CFUA 4PB9L 4OIBA 1WSST 1JPGA 2B9BA 3TCTA 5E6UB 2WMPA 1E3FA 3TA3B 3TC9A 2CBPA 2GIMA 4AGLA 4IS6B 1N7MH 1TETL 2IPTL 1CL7I 4KTEL 5GZNA 4LLQA 5DA0B 4FYRA 2WZ6A 2WUCH 3T04D 2W0PA 1QWNA 3AU0A 5LGJB 3F83A 1PLGL 1QBLH 2DIAA 4KNQA 3EGSB 1RU9L 2OTWA 2UUDH 1RZFL 3TA3C 2V5SA 5DQJB 3WY1A 3B9AA 3QNZB 4L4VA 5D7JD 2C9RA 3FMGL 2ZAGA 2KZKA 2K0RA 3QWOA 1I8LC 2COVD 1ECZA 5EEXA 1FNGA 2R23A 1I7TB 3AWEA 3Q6GL 1CD1B 3U6XS 2PPCA 1RZJH 1TVHB 2VXUH 3AT9A 2QZ5A 4L3CA 2WAHA 5FCUL 2DWEB 4WY7L 2NY5C 4MD0B 2NX5A 4MKMA 5EULV 4G80A 5EIIB 4CVZA 3QJXA 1YMME 1L5GA 5D7IE 3AAZA 1KCRL 2PR4L 3CDGB 4HMEA 1U93B 3U1SL 3H0TA 3O6MH 3MZTA 3GPSA 3X12A 5FLVA 3PWVA 1FC2D 2QTEA 3SYQA 4OZHB 2XXGA 4TF4A 5CP7B 3EFFB 4AVHA 3QZMA 2NYZA 4NQCA 3UACA 1R0AL 3BWAA 4N8VB 3H6AA 2XXFA 5C6TL 2QELA 4KRPB 4KUCD 4XR8C 3GTTA 4JDTH 1P84J 4FKHA 3MRRA 2E86A 1LEGB 2H3NB 3CN4A 2OMXA 1NGWA 2C8NA 4ZAKD 3V0WH 1AI1L 2FECL 3MREA 1AS7A 1BD2A 3BUTA 4JJ5B 5CINL 2AXGA 5GISL 3MXVH 3KDPB 4CILA 1PKQA 1RIVL 1K4CA 3UTTD 4GW4A 1WWBX 3P9MA 4RMUA 3X14B 2J1ZA 4E9LA 1M7DA 1EVUA 5DJ2B 4KK8D 3WJMB 3SPJA 1ULVA 1I8IB 2HN7B 1ETZA 2BZCA 2DYPB 5D8JL 1MHHB 3CCHA 1KXQA 3U36B 4ZZFA 4NC2B 3L5WB 2ATPA 3VNZA 3O3EB 15C8L 4C4BA 5JYMA 1EPFA 3QZOA 1FE8H 1DBAH 4ZW7A 5C8JA 2WXJA 2EH7L 3HE6A 2IBZY 3B2VL 4LKXA 3QH3A 1MCKA 3S0PA 1TLKA 2DF3A 4FQLL 4P5KB 3KPPB 4PU2A 2FQFA 3SKMA 1JGLH 3QCTH 5C0NC 2RGSA 1VFMA 3S2AA 1RJLB 2R8SL 2WLLB 1X6NA 1F4XH 1DBKH 3C5JA 1MAML 2BY2A 5PAZA 3NIGF 4XZUA 2AKRA 3FTYA 3AXIA 1CIUA 3QWQB 4FXKA 1EMTH 1G1OA 2UVFA 4UOJA 2PPEA 3V4PL 2ICWI 1NOAA 1XIWD 2YQGA 4ODHH 3QXWA 4MD5A 3ASOB 3GMNB 4OZIF 5E1QA 4XVJL 5HHNB 5ICXA 3UO8B 3WKMH 4JHVA 5C0DA 1L4IA 3H53A 3SYCA 5IUSA 4H26A 4P5RA 1G7LB 3KWVA 5DRWB 1RUKH 4GS7C 1J0KA 1DVFD 5L0QB 1M2OA 2Z31B 1YC7A 3EJZC 1QLFB 1G9NC 1ZTXE 5TDNB 1I7UB 1PMYA 1HXKA 1RP9A 4B27A 3AU1B 4IK7A 5CU9A 4Z18A 3FQTB 4OCSL 1PSKH 4S1DC 4X8JA 5KSAD 4OM1H 3BFWA 5TDPB 3QG7H 5GRUH 1FL5A 4EDWL 3JT2A 5L0QC 3CH1A 3IXAB 2WO4A 2CIKB 2VH5L 3LKOB 2Z31C 2J8UB 2X4QB 1E5ZA 2A6JB 2QJDA 3MBEA 2QHRH 4DEPB 3MR9B 1K8DB 2P5WE 2F74B 1P4BH 3IMUA 4XMVA 4EN3B 1SOQA 3C9NB 4HF5H 5CMAA 5GIRA 4POYA 1ZPUA 2QSTA 4MA7L 3KPRE 4FHKA 1AGBB 1A4AA 3V6ZA 2LVEA 3J2PA 3MRCA 4EOWH 3QJTB 5D7JA 2PWFA 4MXVF 2XY1A 3PAYA 2RHEA 4GH7B 1GIGL 4DEPC 1S7VA 1MJJA 3O2VH 4YSDA 3AREB 1SY6A 4NUJB 3HRZB 4EN3C 2XTLA 3OHXB 2OTPA 1XSIA 1N0XL 3F84A 3F7VA 1RZKL 4TSBL 4XBPB 4R3SB 3OXSA 4FG2A 4HDIB 1R5IA 2VKXA 2BSSA 3RVWC 1Q1PA 1I9RH 4OZ4B 4PJBF 4UB0H 1W72H 5D2LF 1HE7A 4JFHE 4X99A 5T5FH 2MKLC 4ZUSA 2GAZB 3OHXC 3RVTD 2HUHA 1XL4A 1U36A 1HHGB 2KYIA 2XWCA 1AY1L 4HWZA 4Y5YA 2HFEA 5CO1A 3BIAX 2IDTA 4UOQA 1UZ8A 1JYXA 4L8CA 3BAEH 4LLYB 3T5WA 4MYWB 4WU5B 3S3CB 2YRBA 5B38B 5D2NB 4DWHA 2FEDD 3BZ4A 2HVBA 3QBTB 4JHWH 2GBVA 5K9QI 1E27B 3QPQC 1CGSL 4JFOA 4CU6A 3US0A 1GMEA 1K4DA 2CBQA 4OW6A 4AVIA 2B1AH 5K59F 4MNHA 5I76B 2Z34A 1JI1A 3OB0K 3TO4C 4Z7WF 4F37K 3VO0A 1AFVL 3R7RA 2FNBA 3SE9H 3MACL 2R2EA 3SKOB 1AKJB 5IFHL 3NK4A 5D2NC 4AL8L 1B4JH 5IJKC 3WE1A 2MCPH 4V2BA 1VJSA 2X87A 1RUQH 1ZLEA 1JVOA 2XWTA 1TU2B 3S5LA 2R2HA 1ICTA 2KLRA 3QZWB 1XGUB 3ARBB 3LSOA 1TETH 1U30A 2FLRT 2UXFA 3TIDA 4F2FA 2GSGB 3CNKA 1NBYA 1BXXA 3S4SG 2MIZA 1PLGH 4KDWA 4ACTA 3SE3C 3BIKB 4DO4A 5IROD 1OB0A 1UYWH 3LKPB 2QQKL 3C5ZB 2AJVL 4PRNB 4NYLB 3ARBC 1C08A 5IMLB 5DK0A 1XIWA 3ESPA 1G7JA 4KPHL 5DWUL 4TUJA 3RNKA 1MH5B 4XVTL 4TSCH 3K2MC 4W81A 3GGWA 1TVBA 4Q6IA 5C08B 3TV3L 5FCUH 4MNQE 1OPGL 1YJDH 5E5UB 3C5ZC 4GMSL 3BRFA 4GO9A 4MX7A 1DVFA 2NCMA 3MYJA 1MW1A 5AVXB 4PBWD 1HZHH 2C9XA 1AHWC 2V0AA 3LV3B 5GJTL 1RUMH 4M3JA 1EAJA 1JMXA 3UPCA 1OCWL 1HC1A 3HEIB 4HXBH 3IETA 4YMPA 5EBLA 5EZJA 3INOA 3NQKA 2X42A 3Q2CA 3BXNA 1T5WA 3EOAA 3UYOD 3I75A 5JDSB 2QKIA 5KSAA 3IGLA 5EZPA 2Z7UA 4GLRI 1AXIB 3S3DB 3O2DH 3NFSH 3OX8A 4JFWA 4RFOH 2AZAA 4L0PB 4P23D 5C6TH 4AIEA 3SCMB 2KH2B 1HHIA 3RPBA 3FO9B 4HK0A 4QY8A 1HOEA 2J5LB 2VLRE 1ZOXA 4KFMA 2JJWA 2WSPA 1AI1H 2IC2A 4JG1L 4BK8A 5INCA 3FU8A 4JY5H 1BF8A 5GISH 1K3IA 3FFOA 1YLBB 3I6LE 3LPPA 1Z6JT 4HWBL 4OLYL 3RI5K 1D5ZB 3UBXG 3TBVA 3QZNA 1JTPA 2V8MA 3SCMC 4L1TA 3EO1A 1IGYB 2JJSA 2XWEA 3KS0H 2F19H 2J5LC 4P4KD 3L3DA 2VDRB 5D8JH 3RA7L 3DHUA 3MRJA 3KWTA 4FLQA 2YLHA 3CX2A 4AUYA 5LDSA 15C8H 3DVGB 2W9EL 2WTPA 4YS4A 5IT2L 4ZTPH 2BWQA 5EZIL 4HJGA 3K91A 3ZN6A 5IOPA 1L9QA 3MRIA 4DP7X 5F1IB 4YN3A 1IUZA 3B2VH 3RUGA 1BGXH 3KD4A 3X11A 1FZJB 3FO2B 3QXDA 3GQFA 5IR1B 1KCUL 4L1HA 4KOCA 1WYJA 3GRGA 5G4MA 3GLDA 1WBYB 3GK8H 4FFZH 4XXCC 3TFKD 2R8SH 3T6QC 4TTDD 1JZDC 3IFLH 2X6UA 1CQKA 2C7UB 4PP2B 2A74B 4Q52A 1I7ZA 4NQEB 4U0QB 1ETB1 1T04A 3KJ6H 3NDYE 4RESB 5D7IB 3V4PH 2VXTL 1K2DB 1G87A 3R4DA 3TBWB 1XR8A 3BSZL 3BZDA 4OD1H 5T3XE 6CGTA 5IQLA 4K4KA 2AEQH 5TTRA 5F9DC 2NZ1A 2WNWA 4BJLA 3GSNA 4NQVA 1A9EA 1QR4A 4IRJB 2K6YA 2XA3A 4GXFA 4ELMA 2AEIT 5IV2A 4OTXL 3L9BA 1M1XA 5F7MC 3GXFA 4PTTB 2QMKA 4OCXH 4XP5H 1IIIA 5I1GL 1EA9C 3HI1A 3AY4A 3HPLA 5T3ZH 3DX1A 2Q20A 1RKRA 3Q8AA 5KOMC 3L6FB 4BINA 1MVFA 3HHMA 3EYVA 3VXUD 2CZNA 4FG0A 1KCVH 4KVNH 5CIPH 1YHPA 2NQDA 5FV2A 5IREA 5BQDA 2CGRL 4LHQB 4IDJL 3TN0D 2Q2EB 3V4VH 1IVLA 1S9WA 3LEXA 4O2FB 5ID1B 3IVKA 2VZSA 5E00A 4XWOC 1QFUH 4RMWA 5IROA 3A67H 3EFOA 1PZ5B 1KLUB 1MXGA 4PRPA 4KX8A 1WIPA 5BNXD 2PYFA 1PLCA 2X6BA 5AUMB 4F37F 3LTVA 3WHE0 2P52A 2ROXA 4ZPTB 3IGAA 2XHNA 5CHNA 2PYEB 5EA0L 3FQNA 3GMMA 3TT1H 2WNXA 1NUNB 4N8CH 4MWFB 1WQVT 3D3VD 4ZT1A 1QEWB 4FXGA 1NLBH 3DGGB 3BP4A 5JHAA 2VQ1B 4GXVH 4FOMA 4N5EC 5AB0A 4F7TB 3NGBB 4BH7B 3LZQA 4W6YB 4IBUA 5KTEH 5AW4B 4NT6A 1OP3K 2BJML 3GXPA 2GTWA 1HL9A 1NWOA 5DTFA 5EUOA 2YBGA 5E5MB 2XVLA 1YN6A 3MRBA 1IM3A 2VCOA 3KH3A 3GXDA 5CSBA 3QT2A 3QCUH 3NGBC 4HSCX 2BINA 5IMMB 3L3IA 5IBUB 2UX7A 3NJVA 4KWUA 2CK2A 1FLRL 1OSZA 2O6DA 4PBXA 4MJ6A 2F5BH 1MWAA 1WZ1L 4CC4A 5E6ZA 1LNUB 2RALA 3NP4A 5EHFA 3RVVC 3VD3A 5I0XA 2WCGA 3MXWL 3RAJH 1IRAY 1ZSDA 4ZUVB 4RMVA 2IADB 4DCQB 2WJ5A 3KEHA 3AVEA 3L4XA 4P4KA 4TM9A 5D6CB 5GRWA 3FQ2A 2JE8A 5DD5H 4CBZA 4F7MB 2ITDB 5ICZA 4F7PA 5HJ3B 1W80A 3BAWA 1KFAL 3RTLA 4OH2A 1WF5A 3VA2C 1TMQA 2QQLL 4NAQA 2Y7LA 3NQIA 4H0IA 1T2JA 4LCWE 4G1EA 3KPRB 4LLAA 1KXHA 3O81A 4TLSA 2Z6FA 4QYOA 3EO9L 4N2KA 2COQA 5IHUL 2BPBA 1MCOH 4BSVA 4Q14A 5DC4B 3EH3B 4MS6A 1JPSH 3EO0B 3U25A 1NCAH 2C9QA 3KXFE 3ZSTA 5HYSG 3KYNA 1L6ZA 4XNUL 4JKMA 2FE0A 4RZCA 1D5MA 4WWID 4FCAA 3RI5F 2QQKH 3OGCA 5KZCB 4H13C 2WQVA 3N85L 4IMLB 2R15A 3ES6A 2WM0A 1WEJL 3BKMH 4M5YH 4QRTB 4KPHH 3I6KA 5GGSB 2G0LA 5DWUH 3NYKA 4LE8A 4WCYL 1KZYA 2HRLA 4I1RA 1EJ8A 3ME0A 1UQSA 3HE7A 3DXAA 5KVGH 2K3TA 4MHHI 4YBHA 4LIQE 1AHMA 1ORQA 4GIPD 1UXSB 4CJ0A 3PIQB 4ZUTA 2VDNB 3E2HB 2QMJA 1YDPA 1N68A 3J07A 3LZFH 4M7ZC 1CE1L 4OLUL 5DDHA 5KANG 5DWPA 2RQEA 5DRZA 1YEEL 4DP2X 4U6VH 1KBKA 3K0YA 5ID0A 4BQ9A 2Y24A 3VXUA 1DQKA 5DF0A 3FB6A 2NUTA 3NSFA 5FCSH 2HVJB 5GGUA 5B7FA 1NL0L 4Z6AT 3TN0A 4Y88A 2P43B 1UFUA 1NCGA 3QAQA 2UZYB 3EGDA 4FI7A 2EKJA 3DX3A 3E2HC 1ZA3B 3C6LB 3F7QA 3H55A 4FQQA 4JDZB 1ZLWH 5HYJD 1D2PA 5FYLD 5J7CC 2EYRB 3QIWD 1AQHA 2XQYG 3Q1EA 3ARTA 4Y19D 5C07D 2BP8B 3NSXA 4JFDA 2YAMA 2X4TA 4JHBA 2VUKA 5K39B 1ADQL 3K2IA 3P2TA 1E7UA 5LO7A 3RA7H 2R0WL 1X9UA 3C6LC 4XE0A 2E8YA 2YD5A 4D9RE 4WFED 3RIAK 2W9EH 2BVTA 2Y6SD 4JO1H 3D3VA 1BQHB 4O58L 5DK3A 4GSUA 3PQYD 3MLWH 4ZO6A 4K9EC 1WA2X 1S7TB 3HB3B 2G4GA 3CHRA 3STLA 1XH2A 2OSYA 5MI0C 3FS9A 5KOVC 1QKZL 2AJZA 3HNTH 1ML0A 1H3UA 3HN5A 2VRQA 1CFTB 4NSKB 4N0FB 3UJJL 3L4ZA 2BOCA 4MNQB 1RHFA 5DHYB 4JL1A 5AAPA 2AITA 4KY1H 3NIGE 1NDMA 1FH5H 5DD6B 4CDGC 1PYWB 4Z7IA 3SDCD 4HLEA 5L9DL 5CCKL 3TWYA 4PGDB 5JXEC 1S5HA 3DC0A 3BSZH 4YDVB 1TNNA 2DQIL 3I50H 4WEUD 4QLWA 4Z76B 5AQ0A 5EEWA 3H1ZA 4KMTH 2OA9A 2VDKL 2GUYA 4NQXA 4RA3A 3H7BB 2PN5A 4OTXH 5E6IC 4PHXA 3TTSA 1JFQL 4HA1A 2Q76B 1UKQA 3EOTL 1FWXA 3W5MA 5I1GH 2APFA 1ZMYA 2VLRB 3ULVH 5BUGA 2V5RA 4HHWA 2GK2A 1S7UB 5LWYH 3EZJB 3RUGF 5F6HJ 3U2IA 3NG5A 3LS4L 5DRXA 3APMA 1IJNA 1MUJA 5DYOB 2H1PL 4UINL 5ALCL 2GI0A 1KJ2A 4IDJH 1IJ9A 4DPCX 3TIEA 4ZTOL 5JQIB 2DYRB 1T5XB 3UO1L 3FT0A 5CP3H 4HKBA 3D50A 3ULUL 3V7AG 3EUDA 1EZVX 3R1GL 1Y6MR 3AC0A 4JVUA 1NIFA 1JYWA 1FFNA 1DBJH 3HFML 2W59A 2KQMA 3QDJD 4G8GE 4NNXB 5K93A 4LRIA 4TNEA 1OAYH 3AG3B 4AQ8C 2FK9A 3MVSA 1YYCA 5K9OB 3D6GA 4NHUB 3WIAA 5GGQH 1OV8A 2F53D 3WHE1 3WKPA 2DICA 3L1OH 3L7EB 3LQAC 3W2DH 3CZEA 1PJ9A 3CFMA 1BIIA 2QL1A 4DGWC 3KH4A 3O41A 1J0JA 1DJXA 4NHCL 4R7DA 5EOTB 3MRPA 2DM3A 4K94H 5AYTA 4BZ2A 1QPPA 2DKSA 3CFQA 1A7OL 4C47A 2N59A 3L2NA 5DU7A 2B2XL 3QQ4A 2BJMH 3KPSA 1FZKA 4PJBE 5JOPE 2X4RB 1ES0A 1VB9A 1EBAA 1XQ4A 3D18B 4XO5A 3WU1A 4WFFD 5TF1H 1S9KC 3VFVB 1ZS8A 2O6FA 4KOBA 3BVTA 1MDAA 3FN9A 3FUKA 4FTVE 1SEBA 4N86A 2BNQD 2DH3A 4PRIE 4Y16D 4CGTA 1JWMA 3EYFA 5EF2A 3TJHD 1NGPH 2DIJA 3GLZA 1JK8A 4YPGB 2ICWB 2XQBH 4C4UA 2EO9A 4NB7A 4KVCH 3QIWA 3VU2A 4B5EA 1H5BA 3TO2B 4MJIE 5C07A 1A1OA 3PGCB 2ZXQA 5I66B 1XGPA 2EC9T 2X0UA 1O7VA 2JKSA 1MFUA 3OKOA 1KDJA 4NPKA 4JM4L 1INEL 3SDYL 4NO3A 4FX5A 3LZRA 2OMBA 5A2FA 4WAFA 5AEAA 3VI4B 3KCWA 3HG3A 1S46A 4L05A 3RKPA 3OM3B 3EDDA 4MZRA 3PQYA 2W5PA 4HBCL 4PP1D 3TURA 4ZSOB 3RQ3A 1V27A 4ICWA 4EKJA 4XPBL 4XCYB 4QRUA 1FORH 2DQCL 5DD1H 1U8HA 3DSNB 1XMWA 1LWHA 1D6EB 1IBDA 4F92B 5DR5H 5C1MB 3OG4B 4NKOA 4QRAA 5H94B 4B9IA 5E8NA 1FFOA 4ONGL 1IGJB 3SJVE 3TT3H 1MCCA 2HKHL 3SDCA 1FVEA 4OD2B 1T1YB 2IOIA 4IBQA 5KS9E 3FRUB 1HJCA 1A1MA 2AQRA 1T1XA 1KZQA 1I7RB 2VRAA 2WZPD 1KGWA 2NY6B 3RIAF 1HU8A 1ZDSA 2H4EA 3QJRB 2VLJE 2IFFH 4OKDA 3HVDA 1PVHA 3ZE0F 2AJUH 1R75A 5LNEA 1CO1A 2H9GA 5LVEA 2H8PA 5A1AA 3OLEA 1FAIL 1FL6A 3UCRA 1ZWIB 2GITB 1KXTB 5HI4C 3BAKA 4GBXB 1GOHA 5BO1H 4HKXB 2DL2A 2NY5L 2NY6C 4OU3A 4XN4A 3S9DB 3C5XA 5JIQA 5CEZH 1CE1H 2X28A 2K8QA 2OX5B 1GPOL 4J3OG 3T65A 4F2ME 2DTSA 3W1ZA 1BVNP 1GZPB 1K72A 2NY4B 4J27A 1BYOA 1T83A 3K6IA 3N91A 3JV5A 4NN6B 3ILPA 5I8OL 3APFA 1FG9C 5IQMA 4GBXC 1NKRA 3CPLB 4MNGA 2IANA 4NNPL 2ENPA 2K4AA 3TBTA 3UYPB 1PS3A 4HUVA 1JRHL 5I1EL 3U6XA 1MXDA 2VLLA 1ONQA 3GSRA 5IESH 3Q43A 1KIQA 3RDTA 5FO8A 4WI6A 2NY2C 2O61A 2BCMA 2WTRB 4GYBA 3WY4A 3QDJA 4LCWB 5DRNA 5I6OA 2NY4C 4UOW0 5I5MA 1MZZA 1DLHA 2G60H 3NJHA 4L4VE 4NN6C 1KC5L 2ZXAA 5DA4A 4K7PH 1RIUL 4LHUG 4R4ND 1PX8A 2B59B 2VISA 4D0DB 1G6RB 3CUPB 2WXKA 2D2OA 3EZ8A 2YAPA 3KXFB 1A7BA 4NNYB 3BVVA 1ZHLB 2Q7AA 4WUKH 2FB4H 4IRZH 4CN4A 2ZP0T 1TZIA 2I9TA 4AI7A 4OZFH 5IWLA 2BSCA 5C0EB 4U3XA 5IJBC 3FL7A 2O26U 4HCGA 3NA9H 4ZMTA 4FYQA 4GIOA 3NP3A 6PAZA 3LH2H 3UDWA 1OM9A 3RB5A 2DKUA 1GA2A 1DE4A 2X70A 5D5MA 4Y9EA 2J6EA 4J2QA 4WWKD 4KKCC 3UJJH 5BVJB 2N0MA 3MROB 1EO8L 4NQCE 4TQIA 3HAEB 4QXUL 3PAUA 4A2LA 1ROCA 5AKRA 2EDJA 4P05A 4Y16A 2NZ9C 5CCKH 3ETBJ 1JAEA 4XMUA 5KSBB 3BT0A 4L37A 1XHHA 4X98A 4CW1B 1NANI 2CALA 3O4LA 3MLSH 2MHAB 1GVIA 1PKQE 4JG0L 3WUWA 4E36A 1TTFA 3DTXB 1E9PA 3JTTB 4YUEL 1IKFH 1URIA 2R9HC 5DFWH 4FRWA 1YECH 2XNAB 1TFPA 3HMXA 4R9HA 1B0RA 5AALA 1FSKB 4WHYG 5FECB 1SBSH 4FQXD 2VJ0A 1IC7H 1P2CB 1PX3A 1G9NL 4DUVA 1UWFA 3LS4H 3N55A 4QXVA 2IQAB 1VACA 1SQMA 3CSYA 2CA3A 4MZ3A 3V5DB 3VUAA 2H1PH 3WE6A 2A5UA 5ALCH 5A16A 2EUVA 3I9GL 4Y4HB 4YHPA 3BOVA 2F58L 4ZTOH 3SDAB 3C6EA 3T6WA 4FNSA 2ZXEB 4ZUUB 1AMYA 1FSKC 3MV9D 3CVHH 4HHAA 2ARJQ 2DD8H 4ADIA 3HFMH 5KWYC 1XFPA 4HJ1A 1QO3A 4ZS7H 3TS8A 5J1SC 4KX9A 1V3MA 3FUFA 1IGIL 1HFUA 3VFOB 1Y0LA 5ESQA 3NA4A 2WZPA 4PJ7A 1AGEA 1XO8A 2Z1PA 3MLYL 3Q1SH 3ASWA 3STZA 3VWJD 4N20A 1DN2A 2XPYA 2Y0SA 2QLVB 3H3KA 1BVNT 4DKEL 4JFXB 4YSEA 2CO3A 3O45B 3FO1B 4XCEB 2FZ3B 5FF6A 2DRUA 3P0YH 1U4FA 3PPSA 3RX9A 2ZXDA 3MUY1 2MQGA 3W39B 2Y07L 3ARDB 2VR7A 3RGVD 5JW4Q 1L9NA 3WS6A 1EZSA 1MW0A 4UQAA 1FV1B 3ZT5A 4JEGB 4OCRL 4XMLL 5FYKD 1NPJA 3NZ8A 5BS0A 2PWDA 1HHHA 4HSQA 4GSDH 4DKAA 5AZEL 4MA8H 1RJYB 2N0KA 5B1JA 3OKDB 1BOGA 4E5XA 2F2HA 4JDVB 3KPLB 3Q44A 5GS2D 5SV3A 3ARDC 3EH2A 1SDDB 3F12A 2KPNA 5I15H 1U8PB 1EJFA 3HBQA 1ZK9A 3DGCR 4JM4H 5AFAA 3VXQA 4H20L 2VXQH 1NM9A 5EC1B 5EV7A 1LK2A 3W0WB 1TEFA 2DQEL 4Z0XB 4P2QA 1YMHB 3O2WH 1CWVA 2W60A 3BKJH 2ED6A 3EYQD 5G55A 4LSTH 2Y36L 3B5TA 4MSWA 4GAGH 5HTSA 3TPUB 4GO8A 2PKDA 1YPZA 3CZFA 4G8GB 4K5PA 2DMKA 2XJKA 1RHHB 2J88L 4AOFA 2CDEB 4OCMC 5D7KD 4LKCB 1AJ7H 1ZEAH 3UG3A 2PW2B 3BDYL 1DQQB 1VADA 3V0VA 1EDQA 3B2MA 4WWKA 4XAKD 4IBWA 3CSFA 4AITA 3EGXB 4F58H 1HI6A 2VR6A 1JYNA 2OAAA 4Y5XA 3GBLA 4YDIL 1BAFH 3CHSA 1S7WB 2AXFB 4RGOL 4ZMWA 1QNZL 1SF3A 2IALA 2XN9D 1BP3B 4Q58C 4YO0B 1NGZB 4YC2B 1J5CA 4H2AA 3FN0H 5GQBA 2AV7B 2BIMA 3RVUC 5HGDB 1NIEA 3DIVA 2A73B 3TVMB 1T22A 3SDXA 5AW7B 2OMUA 2ZSWA 4JY6A 4KKAC 1JOIA 3VGFA 4FTVB 4M1CD 4I85A 3T6XA 3WOVA 4PRIB 2ZSVB 4YC2C 5EU7E 1VFAB 5FA3B 2ZOLA 5GS0L 1W6WA 4A7TA 1PX4A 1CLYL 1OO2A 2YRZA 3VGHA 1FFPA 4M8QA 1YA5A 3PWPB 1P53A 4H4NA 4FQXA 3TVMC 3O8XC 3EOBA 4WK2B 3DI2B 1VLXA 1VZIA 4N28A 3WLWD 3RJOA 4F7EA 5I8OH 3N40F 3N04A 3N43F 4CUCA 3MUJA 2DQUH 2NXYD 3VMOA 2IBBA 4KJWD 3RWCB 1Y6NR 2G3MA 4HCRL 1UD3A 4JZOB 1FHGA 1O7SA 1SNRA 4QXGH 5LGHH 3RWJB 4QXTA 3U9PH 4NAJA 1DANT 1ZJBA 3JV6A 4M8RA 4BD4A 4UYPA 1Q9OB 5TE7H 4Z0BH 3G5YB 3QXTA 5EOCH 4PCSA 5JPMB 1SXBA 5TDOB 1U3ZA 1RIUH 3BDBA 2J1WA 4XVSL 4QO1B 1YG9A 4UOW1 3ZT7A 4OGXL 5DT1H 1DFBL 5ANHA 3CC5B 2YA1A 3C12A 3CXDL 2WXIA 5IUCA 1A14L 4IEFA 2QR0B 2W0FB 1XF2A 1M3IA 2I27N 3OAZK 3OR7A 3SJVB 4CMMB 4X2UA 4LP5A 1T0MA 4LXFA 4X7EC 3SYOA 5JPMC 3C87A 5F1KC 5KS9B 1EFQA 3UROR 3NFNB 2OJEA 3IM1A 4M7KL 2GB2A 4N2AA 3MC0A 1TMCB 2VLJB 4A2HA 3B7YA 5JUEL 4DVBA 4AUJA 1EEQA 1BW8A 1KJVA 5DVKA 5EIQA 1NBCA 3RGVA 3V5HA 2ZCKH 5EOQL 3RNQB 4CADA 1BX2A 4WW2F 4JMNA 1SPDA 2AXWA 2Y5TA 2LVCA 4FMKA 1XTLA 2UUDK 2H32A 3QORD 1DBMH 2DM4A 2O4EA 3OKNA 2AJSL 1YEGH 4MBOA 1JPGB 2X89D 2Z7ZA 2WMPB 4I0KA 1IBZA 2WB1A 1U8IA 5IK3A 4WI3A 5F72S 2KS0A 3MOAL 1N67A 4R6UA 5BPPA 5CJXC 2XV0A 3T2NL 4PD4J 3ROOA 5D7EA 2XWXA 5F96H 5C0JA 4KVPA 1O6VA 4FNLL 1N5YL 2OTWB 2D4FA 1QZNA 3OC5A 4L0ZA 3SOBL 4NJAL 4KXDA 5JW3H 4DK5A 4J23A 2ADFH 4L9DA 1I1AD 1JNLH 3KHOA 4MQTB 4N2HA 1CVSC 4TOYH 4PJIF 3RUGE 1BZ8A 1BLIA 4L4VB 1F1DA 3MJ7A 3FHAA 5AVTB 1DLFL 4FI6A 1KTBA 3D34A 1FNGB 2R23B 1XCQA 2WKLA 4XCNA 4TV3A 2XJLA 4PSPA 5KSVA 3AB0B 1OALA 5DVOA 2XWBA 4L3CB 2RCSH 3FQWA 2N4IA 4C83A 2M26A 1Q0EA 2NX5B 3CXHK 1NGXA 4G80B 4NIKB 4OCWL 2YRLA 3FAXA 4BFFA 4CVZB 4EUPG 4HJSA 5C0IA 2CO6A 1L5GB 1HT6A 2Q2LA 3AAZB 3DDFA 3T0VA 1JI2A 1BJ1H 2XN9A 4DHLA 1IGIH 1A7NL 3H0TB 1T5KA 3NZUA 5DHDA 1HK6A 2BLFA 3GXTA 3AB0C 3DUSA 1UVQA 35C8H 4UZSA 5ISZA 3X12B 4OLVH 3PWVB 2O5XH 3U7YL 5DLML 5I24A 3WAJA 4NERA 4WNSA 4NQCB 5HHMD 3BWAB 3JV4A 2XI9A 2UZXA 5LQBL 3MO1B 4DKEH 1MFCL 3BUIA 2RR3A 1W72A 5E5LA 5IW3A 1K6QL 3MRRB 1MELA 4FULA 5TQ0L 1LP9A 5T5FA 2OMXB 1NGWB 2YFNA 3MREB 1BD2B 4B9GA 5TFSL 1GGBH 1ZPLA 2ZOOA 2AXGB 1LDPH 1KNOA 4CC0A 2BHUA 5E9AA 1PKQB 1K4CB 1OGSA 4GW4B 3P9MB 4ZMAT 4TQHA 1M7DB 1RPKA 4OCRH 1ETZB 4LPXA 2VZVA 4LRNL 3CCHB 4KQ3H 3KG5A 4GJTB 1U8LA 4APQA 4ALAC 2ATPB 2VC2H 2XRAH 2A9ML 2F68X 5C8JB 3ZOAA 5JO5A 3HE6B 4Z3JA 4FQCH 4PRPE 5FM4A 4ABWA 4ENEC 2NY3D 3L5HA 4JPQA 4LKXB 3QH3B 2Y72A 1SEQL 2MJWA 5D1XD 4AJVA 3LQZA 3SKMB 1EGJH 3OQ3B 4KROB 4PMFA 3W11C 4WFGE 2HYMA 4FAAB 3C5JB 2AQPA 3V0EA 3BFQG 2Y36H 1FNFA 3HE6C 1C7SA 2AKRB 4XZUB 5E0QA 4OB5L 3VW3H 3PLYA 4J3WA 4FXKB 2BW5A 4N2IA 4RX4D 2YPLE 5EIIG 4KKBC 1URLA 4PS8A 4MD5B 3GYRA 5ICXB 4KROC 4LSDA 4NPJA 3DOIA 5FC9A 5EUOE 5C0DB 3GSQA 5AAMA 4H26B 3BFOA 1GS8A 2ICES 3WTXA 4ZXBD 1RAMA 3A24A 1GL4B 1LE5A 4YSPA 3SE6A 5HGGS 2OMVA 1X9LA 4GQ9H 4HP5A 1LEKA 3OMZA 3IXTA 3QORA 2MOQA 3L16A 1NAMH 1R17A 4JFPA 2WQXA 4M48L 5IB4A 2HJFA 4X8JB 4IIQA 2X89A 3LDBB 2JJTA 1RVFH 1FL5B 1OTTD 4LASH 4ZMPA 5JXAL 3CH1B 5C09E 5H37H 1HSBA 2LHAA 1JXGA 1T4KA 2Y1ZA 3S8WA 1UEYA 3MBEB 5TGBA 2JMRA 3S96A 1FVCA 2Y7NA 1I85A 3SHSA 2V37A 1YPZF 5ENWA 5GIRB 2ROYA 1NGQH 3LDBC 3O2DA 5CMAB 3VGDA 1I1AA 1BSIA 1R24A 1NFAA 3NMEA 4LGSB 1M7IA 3V6ZB 1RMFH 3MRCB 4FKEA 2V9TA 5D4IA 5I0VA 3OF6A 5IHWA 5D7JB 1ZAGA 4K5NA 1MHEA 3MBEC 1CB4A 1S7VB 4FG6D 1MJJB 1A3LL 3QEQD 5DMYA 2DLFH 3CLWA 4RWYL 4N9GA 3OPZL 3LZLA 4XMZA 2LABA 4HCRH 3TLRA 1ZE3H 1QYGH 3F7VB 3L9YA 3NN8A 1IAIL 1S7XA 3UAFA 3OXSB 1SXZA 1KPVA 5D7JC 1R5IB 1TYRA 2AXHA 4P07A 4JRXE 2BSSB 1ZK5A 2ZE0A 1T7ZA 3L3HA 2FIRT 5C2BH 4X99B 4O00A 3QZLA 4ZUSB 1U33A 3CXDH 3DGDA 1O6SA 2B14A 3FYEB 3DXAE 3J27A 1A14H 4M3HA 5MEQA 5SWQB 3UAJA 4HWZB 4BCZA 4Y5YB 2HFEB 1F2QA 1HHJA 4HPYL 4JB9L 4NIYE 3RL2A 4X5XA 1UZ8B 4L8CB 1Q94A 3LXBA 4ZAKB 4NP4H 4FFZA 4YHKL 2BVUA 4YXLH 4A6YH 5AWNL 4ZDHA 3BZ4B 4K9EL 1MI5A 2L7JA 2WLNA 1MRCL 3HA0A 1O5PA 3NCYP 4X6BA 3ECUA 2H6PA 3VXUE 4JFOB 4Y5YC 1K4DB 1SJMA 4LPCA 3UL4A 4FZEH 3V4PA 4MNHB 3NEEA 1VENA 1PIFA 4HUMB 4PREB 2B0SH 2R2EB 5E4AA 2OYLA 5AAWA 1R9FA 4O5LL 2CUMA 4R4FH 4H0GA 5FM5M 4GRLD 2X44D 5KVEH 2XWTB 4JKKA 4HWNA 5I16A 2R2HB 3HW7A 3CLFL 3C60D 3LSOB 5KVFH 4JFDE 2WYTA 4KK8C 4P3CL 5D1XA 4DEUA 5I1LA 3TIDB 2JKIS 2MNWA 2Z93B 3Q5YA 1NBYB 3AG4B 3GO1L 4X0KA 3UXFA 2ZUXA 1FDLH 3P4OA 3K8MA 1N5YH 1AP2A 3D3VE 1MFAH 1PGRB 3MRFA 4AQAA 4NJAH 2YD1A 3EYUL 3SKUD 5CIPA 2D03H 1WS7A 3G5VA 2O6EA 4RX4A 1C08B 2HFFA 3CHOA 1AQMA 3GLEA 2IH9A 3V8CA 1CGVA 5DK0B 1XIWB 3JZYA 1G7JB 2IBGA 3V4VA 5KW9H 1HHKA 3FT1A 2AK4D 4ETYA 4PIRF 1GGTA 4TUJB 3RNKB 3IJ8A 1UB5A 2ZUUA 3UG5A 1XCWA 1XH1A 2LFGA 3FJTA 3FN3A 1R47A 3GGWB 2OQJA 1TVBB 4Q6IB 5J9PA 3NACL 4PJGF 3K2UH 4ZXBA 2CCVA 5AW5B 3SZ6A 2B5IB 4MX7B 3T3PF 1DVFB 5CLZA 2NQCA 2PO6A 1XIWC 4WHDA 3IETB 5EBLB 1MPAL 5EZJB 4HWEH 1GAFL 2OCCB 4OJFL 1A3QA 1GJUA 3BXNB 1T5WB 3U48A 2X2JA 3EOAB 3I75B 4Q6IC 2QKIB 5KSAB 4PJFA 4FGMA 4X6EA 2WKGA 4WHTA 4OFYD 3D9AL 1HSAA 1RZ7L 3E8UL 5BZWA 1QA9B 4UQ9A 1AO7A 1DVFC 3OX8B 1SUJA 3ETSA 1NFKA 1LJMA 3GBNH 1OGTA 5J5EA 2V8LA 3SO5A 3X1FA 1KENH 3U46A 1K6QH 1NFDF 1UWEH 4HK0B 4JFYA 4QY8B 1CR9L 3LQAL 3SKNA 5TQ0H 3VFNA 3KGRA 3QXUA 4Q9RL 2JNZA 1TF4A 5L4MA 3OAUH 1BFVH 3Q3GA 2QKIC 4I3SL 5DC9B 5KSAC 1WZKA 4N3UA 5INCB 2YS4A 3QJSB 3D4CA 3T2QA 2UY7A 3KAAA 3TBVB 5ABAA 3TBCA 4CNIA 1I8MA 3QZWG 3FH7A 3EO1B 5E0FA 3LRLA 4PVLA 2X3AA 3C08L 2FNWA 3WG7B 2JSFA 3L3DB 2H45A 4PTUA 3GT6A 4O9HL 3QEQA 3MRJB 3PHAA 5E2WH 2A9MH 4EI5A 5L7XL 1IL1A 3CHPA 2BFVL 1NCOA 3OMIB 2JB6A 3BVDB 5JHBA 3QQDA 4HJGB 4MASA 3B7SA 5IOPB 3MRIB 2ZUQB 3EDFA 3RUGB 1KYOK 3RWGA 4YVNA 3X11B 3N9GL 5T3XL 2JJSC 1SEQH 4LNRA 4WF7A 5DEFA 2EVFA 3QXDB 1EQWA 4H25A 4B0MB 5T1KD 3ARQA 5F88A 4Q74A 1NCIA 4WV1A 2WQ8A 1J7VR 4QMEA 1E5CA 3S37L 2YKKA 1Z0MA 4BV1A 1I7ZB 2ZUQC 4KZDL 1J8KA 4S1SH 2YIHA 3NZHH 1NUFA 1T04B 3FF7A 2OR7A 3FW6A 1CK0L 1SM3L 3QDMD 1N18A 4PRDA 4WTWA 3ZTJG 1IBGH 1NBZA 4XP9H 4J5VA 1XR8B 2XLLA 5BV7L 3KPSE 1SHXA 4UAOB 4P5TD 3BIBX 4QT5A 1A6VL 1AAJA 3FUMA 4JAMA 4JANA 3RVTC 3GSNB 4NQVB 3P11L 4CC1A 3ROLA 4BXSV 1A9EB 4JRYD 1NCTA 1ZGLA 2H26A 4N2DA 3L17A 3G5ZA 4TRPL 3UC2A 4ELMB 1DQMH 3RPIA 2VSMB 3KPMA 2YARA 4W4NA 5IV2B 1M1XB 1UGKA 2ZONA 2BS9A 2C4XA 3QQ9D 4UAOC 1GYWA 4QDGA 4Y9GA 3HI1B 4N1HB 2FEDC 3HPLB 1DYZA 4OGQC 3VYPA 1CGXA 4GRLA 4DESA 5FYLE 2NNAA 3QUZA 5DS8A 4HIHA 1UXMA 3EYVB 4RNRA 2MRYA 2VLKD 3C60A 1LDSA 5HBBA 5FV1L 1HJBC 2ZIDA 1GW0A 4DPBX 2YAQA 3ZHNA 2J43A 4GKZA 3L3KA 1S9WB 3LEXB 3IVKB 4LOUD 1EAPA 2UY6A 3AY4C 5E00B 4WFEE 4N3TA 2GK0A 2OTUA 5L2KA 4BM7A 1AZUA 3EFOB 4JM2D 1N6UA 2YGOA 3PQYE 4PRPB 5SWSD 2PYFB 2E0PA 1MCJA 4JCMA 2IIJA 4YHML 5K9JL 4XTRD 4AQ1A 2AK4A 2WWMC 1HCVA 3ATAA 4L8BA 5J6SA 3OKEA 3IGAB 5IKCA 1WIUA 2WY3B 5CHNB 2NW3A 3K6NA 3FQNB 1HKFA 4M6NH 1V05A 4UTBH 4ZRGA 3GMMB 2DI9A 5EZOL 5IROC 4BQBA 3FTVA 4HWBA 3GM8A 2J1YA 1UM6L 4FXGB 3BP4B 4OI9A 5LJYH 1HQRA 4MB5A 2V3DA 2DLHA 1GZHA 4TTGA 4NOBA 2VERA 2GSMB 4MD4A 2N7SA 4KKLD 1FQ9C 4NT6B 4IOIA 2P24A 1DBBL 3LKRA 1B6DA 2GTWB 1D9KD 1WFMA 3QUMH 5DTFB 5EUOB 1YN6B 3MRBB 2DYSB 1IM3B 4OFYA 2B7DT 3ZLQC 4WW1A 4FXGC 2B4CH 4GP5B 2NLJA 3N1FC 3X3FH 1ZT4A 4B9YA 2Q7NA 4MMYA 4WSKA 4ANWA 3DUUA 4JB9H 3TBSA 2HLAA 4HS8H 4CSSA 3L3IB 1Z32X 1A4CA 2N1KA 1SJVA 4Y5VA 1OSZB 4ERSH 4DFHA 4MJ6B 3JTSA 4X50A 1CGWA 1MWAB 3RTQD 5HHOE 3DV6A 5HI5D 1WRFA 1MCDA 4IHOA 4DK6A 3ZKNC 4GW5A 1SMAA 1D7CA 4G6MH 1RFDL 1ZSDB 2C1OA 2BZDA 4FQ2L 3FQXA 4FP8L 1UXLA 1MEXH 4MNGE 2IANE 4V1DD 3IMBA 2VJXA 4P4KB 5ICZB 3BSZA 1KB9K 5DC2A 1DL7H 4F7PB 3N0AA 3QPXH 4O5LH 5E1GA 5K1JA 4J3VA 4CC4C 1MQKL 1UOWA 5MEOA 2GC7C 3PGFH 1U6AL 3FT9A 3CVCA 3QDJE 4G1EB 4LPWA 1IFHL 2G2PA 4QYOB 5B4MD 3UGUA 1PTZA 3MYZA 5CCJA 1EAQA 2QKSA 4AM0Q 4P3CH 2DQGL 4BSVB 1GC1C 4P4KC 3EJSA 4XX5A 4HV8A 4E41D 3APDA 3GO1H 5GRJL 1E3XA 5T1KA 1LE9A 1ASOA 1XSKA 5F7LB 3E0GA 2X1QA 3KYNB 2EDTA 1FAKT 1QWUA 1R5WA 4QOKD 4FADA 5IQNA 4LIQL 4RZCB 1D5MB 1WZAA 3OGCB 2H5UA 4OV5A 1CD8A 4N0YH 5MEND 3ES6B 2Q0ZX 3QDMA 1GJWA 4UT9H 1OQOA 3IDNA 3I6KB 3TFKC 5CP3A 2I24N 3LIZH 4HWUA 4P5TA 5D5ME 3VD0A 4NKQB 2A77H 2KHAA 3ME0B 4NUGL 3FZUC 5CLTA 4BFEA 1WS8A 1UQSB 3HE7B 4WFFE 2AVGA 1YCSA 3TEYA 4JRYA 4MVBC 3DXAB 4PEEA 8CGTA 4U3CA 3G6AA 1R19A 2L4OA 3V52H 5L2JA 1U8CA 2NNFA 3WL9A 2YD4A 1ORQB 1OAXL 3MLRL 2E7DA 5F3BA 1IFGA 3AM8A 3OXRA 4LAQL 1TQCB 4ZUTB 4G9DA 5M95B 1YDPB 5DDHB 3WO4B 3OLDA 3TP4A 5DRZB 3O4LE 5ID0B 3HE7C 4R7NA 4F1ZA 3VXUB 1H3XA 2NUTB 3FB6B 2VLKA 3IRCA 2GFBA 5GGUB 3ULAB 2WZ5A 1UEMA 5ITFA 1OF0A 5GGSY 5I6NA 4GRWB 3TN0B 3S36L 3VGBA 1NIAA 4K23H 3EGDB 5FKAA 3BT2L 4K5OA 4JFZL 2JJUA 4YFLF 1MNUH 5DO2C 3WO4C 4Q9RH 3SGKA 4FQQB 3PG2A 4J3TA 1MQ8A 4JM2A 2R0KL 4ZMLA 5SWSA 1F11A 2EE9A 2LQRA 3CFKA 2A99A 4PCYA 2ZOKA 4FF9A 4JFDB 1JXFA 2X4TB 2WBWB 4X6FA 3PXJA 3WN5A 4HULB 3FCUB 2DJMA 3TESA 1XEDA 4G6FD 5EUKA 1GY2A 3BKCL 3QIBD 4JHZA 5A2LH 4DN4L 5E08H 3GB7A 3ZQXA 1IKNA 1L0PA 4WI5A 4F1SA 3LX9A 4O4YL 4LEEA 3D3VB 2IAMA 4WI0A 3WIFA 5F9AC 4KZEL 2BFVH 3VGEA 2DDQH 1W8OA 5MP6H 1S3KL 1QW9A 5FUZL 3N9GH 4AQEA 3STLB 1E42A 4K8RC 3ZZ1A 1NM4A 4PJFF 1NCCL 1D9KA 2HTLC 4PJ7E 2AJZB 4HUWA 1S7QA 1BM3L 5D70L 4YX2L 4QNPE 2VDOH 3SE4A 2BOCB 1SVCP 3DVFA 3BLBA 3S37H 5E8DH 1NDMB 2NY0D 3KPOA 4APXA 3UIZA 5GRVL 4FQ1H 3D85D 4U1GB 1SM3H 2EILB 4FYTA 1ZDQA 2APTA 1Z9LA 3GBMH 3MLVH 4XC3H 5FOJA 3U9UA 1S5HB 1NPNA 2IH8A 4TUOA 2WSDA 4HMDA 2E6QA 1KWGA 3ULUD 2NYYC 3D30A 4KUCF 1J1OL 5GGRY 4CVWA 5GSVA 1TLMA 3QVAA 5CU5A 3G08A 4NQXB 4AYFA 4I1PA 1VGKA 2E47A 1CD0A 3MBXL 3QS3A 4ODTH 4U1GC 1G7PA 3SEPA 4V1DA 3PWUA 3WFDH 3AZUA 2AJXL 3MPCA 3O9WD 2YD0A 3L5XH 2N01B 2GTZA 2FEEL 3LH8A 3CBJB 5LB1A 3ZMNA 5A2BA 4NZTH 1BZ7A 4JM0A 4IJTA 4FFVD 4K73A 2ZNXA 3QJHA 5DRXB 2KUTA 2EIJB 1MUJB 3EADA 4PWFA 4Y2OA 1GR7A 2HPOA 4H2CA 1II4E 2X0WA 3BAIA 3V0FA 3FSOA 3NEXA 1KJ2B 4E41A 3TIEB 2VO8A 3U6RA 4BDVA 3QB7C 4ANUA 3ECVA 2NW2A 4GO6B 4P2QE 4P9HH 4HKBB 4QOKA 2ED8A 2XV3A 5BUAA 1NOLA 1CF8L 3CH8A 2HJLA 1BQHG 1FFNB 1FG2A 1YPZE 3NAAL 3GUTA 3JUYA 4KHXL 5JR1L 1T89C 5K9JH 1MCBA 5JIPA 4J4PD 5EIVA 1F4WL 1RJZA 3PUCA 3D12B 4ZFZA 3F58L 5GJSL 1OP5H 1T7XA 1EHKB 1QWHA 1P84K 2BIQA 1BIIB 3V9FA 4Q9CA 3N6YA 3V8OA 3S5ZA 4X9IA 1UM6H 3INUH 3O41B 3T2LA 1KB5L 4R7DB 3WD5L 3MRPB 4KH9A 4Y0GA 1J1XL 1ADQA 4HC1H 3OPUA 2P80D 4YDKH 3QQ4B 3KPSB 1FZKB 2JB5H 4YHOH 4GAJH 1ES0B 2DQJH 2FX7H 1FYTE 3AS0A 4IRZA 3BH8A 8PAZA 1IC5H 3I3EA 4OZFA 2ZKXA 1NKGA 3SDXE 2XN2A 3BMWA 3B56A