3MCYA

Crystal structure of fimh lectin domain bound to biphenyl mannoside meta-methyl ester.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Carbohydrate binding protein
molecule keywords FimH
publication title Structure-based drug design and optimization of mannoside bacterial FimH antagonists.
pubmed doi rcsb
source organism Escherichia coli
total genus 33
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 3mcyA00
3ZPDA 4ATTA 4AVKA 4AV4A 3MCYA 1N0LB 1UWFA 1PDKB 4CA4A 3BFWA 4AVIA 5FWRA 5ABZA 5LNGA 5CGBA 4XO8A 4CSTA 3JWNH 4AVHA 4X50A 4XOAA 5FS5A 2WMPB 3JWNE 5AAPA 5FX3A 5F3FA 4AV5A 4BUQA 4XOCA 3ZL1A 5IQMA 2JTYA 4J3OH 3SQBB 2W07B 4LOVA 3JWNG 3ME0B 4X5RA 1QUNB 4X5QA 4X5PA 2XG5B 4AUYA 1KLFB 4XOEA 1KIUB 5LNEA 2VCOA 3BWUF 5F2FA 5FLUA 2UY7B 2J2ZB 3ZL2A 5AB1A 5IQOA 3RFZA 4J3OG 5IQNA 4AUJA 4CSSA 4AV0A 1N12A 4XO9A 4J3OF 4XOBA 4AVJA 2XG4B 5AALA 1TR7A 2JMRA 4AUUA 2UY6B 5JQIB 1ZE3H 3BFQG 4XODA
chains in the Genus database with same CATH superfamily
1PZDA 1GC1L 3CSGA 2WO2B 3BH8A 1IFHL 3L3HB 3OXSA 5JQ6L 1NAKL 4UQEA 4Q2ZB 2J6EA 4MASA 4B9ZA 3IT8D 5AW5B 1AKPA 1J5IA 1ODAA 2DMHA 3MX0B 4KQ0A 2ZT9C 1L0PA 5GGQL 4U1SA 5D1QD 3REWA 3G6JE 2X3CA 3WHE1 3WKPA 1JVKA 4X6FB 1T0OA 2ED8A 5CD5C 1BVKA 3VI3F 1G0DA 3HAEB 4NC1C 2NY7L 3TTYA 5H4ZA 3ULUE 1MJUL 2ZPKL 3PABA 1AVAA 5IVXB 3MUHL 4CSTA 3GMRA 2W07A 2ITCB 5IY5B 2BZ7A 2HH0H 2NXYB 2R51A 4ZS7H 1LO3H 4HMDA 2B4CH 4MD5A 5CJOH 2XG5A 1ZIBA 5EU6B 2WXGA 4KY1H 1UKQA 4LP8A 4PV9B 5F9AC 5IW3A 3V4LA 2XWJB 3VAEA 2VDLB 1Q72H 3BAIA 3CLFH 2V3FA 4TNWK 2WP3O 4FYRA 2UY7A 1L6PA 3CSYB 5CP3H 4WEUD 1OSPL 4AV5A 4Z7QE 1IRAY 1UB5A 2C26A 2VXSH 3DVNA 1QSZA 4ZMYA 1B3JA 1RJCA 3CBJB 1N6VA 3D18A 4F7MB 2Z35A 2BS71 5F9DC 1KN4H 4J3OH 4YHNA 1FN4B 4Z7WA 3IJYA 3ZUCA 3F65A 1F45A 2YPLD 1AO7D 1DLFH 4GUPA 2H5UA 1A3LL 2ZUQC 2FWOB 4IOIA 4P2QD 4I1NB 4HW6A 4JN1L 1JN6B 4D9LL 1SLXA 2R29A 1MEXL 3W9DB 3SE9L 4Y9CA 4JGJA 4PLKC 2E7BA 1BVOA 1Y1DA 4N0CD 4R97B 4X42A 3IU4L 5T3ZE 4DEPC 5HHVH 5FYJE 1XGUB 3A6BL 3QUYD 5T3XL 2H1LM 1QO3B 5IBUG 3SE8L 1LP9B 5D6CA 1P5UB 2H2PC 2NY5C 4IBLT 1UA6L 3MRCB 3H9YA 4HJSA 1D5XA 2KERA 3V4UH 3L3HA 3UTTB 3QIUB 3O4OB 2HZHA 1FLRL 4MA1C 3TT1H 3VM5A 4TLKA 2VDQB 2V4LA 1CPUA 1BHGA 2QELA 3QARA 3CIAA 3O2WL 4JZOB 4LDEB 5IEHB 1TTCA 3B2MA 3C75A 3O3DB 3KLDA 3OV6A 3GRWH 3BJ91 4J4PC 2Z34A 2FQEA 4TSAH 4TM9A 3U9UA 4J3UA 4PFEA 1AQDA 4JHUA 1YEDB 4X6CE 3EADA 3WMSA 3HLKA 1WO2A 2BW4A 1OE3A 1OAYH 3K8LA 1OP3K 3EOTL 4EE2A 2ITCA 4ZJ9A 5SWQA 5JYLA 1KBVA 2A9NH 3MV01 2APBA 2EIKB 2YD1A 2ZONA 3R1GL 2CJUL 4HWEH 5CEZH 3PG2A 1TOXA 2IGFL 3RGVC 5EU6A 4G71B 4D7BA 4CGUB 4PJ6A 3SPVB 2NY2B 4PV9A 2V2WB 3DSNA 2XWJA 4N0UE 3DJRA 1KGUA 4AGQA 2VABB 3CSYA 1AI1L 1OPOA 2VWEC 2L0DA 4N8VB 2Q7NA 4WI7A 1RPQA 2I26N 1X5YA 3ETSA 4HUUA 4LDCA 3VNZA 4F7MA 3G04B 5ESQA 4JMNA 2VJ0A 5J1AB 2G2NA 1FN4A 2ICWJ 3UDWC 3ULVD 4AVHA 4OB5H 3CFQA 1KY7A 4HAFA 4PB9H 1INEH 2R83A 3WFEL 2ARWA 2XSKA 1WWBX 2F53D 4HIIB 1HXYB 3UTPD 3WNIA 1KELH 4BUGA 5JHDB 2FWOA 3OGCB 1JN6A 3W9DA 1COBA 3VGHA 4M6OH 2K8MA 1HH6B 3BESR 4HK3N 2WWNA 3MA9H 4XOCA 4Y7MA 4JBSA 1SY6A 1XGUA 1QO3A 2YAHA 3TXAA 5I1KL 4KK6C 1P5UA 1UD6A 2Y7QB 1U3JA 3MRCA 4G7SB 4MS6A 2YWYA 3ECVA 4S11A 1JS4A 1U2CA 3CX5K 1ETA1 3ARGB 3UTTA 1R5VA 3QIUA 1RULL 2WQUA 4JFUA 4LCWD 1DR9A 3B2UD 1Q1PA 3HZKB 2A0LC 5BRZD 4H25B 4J28A 4EI6B 2ZKWA 1U3HB 3UBGA 1YJDH 3CPLB 2J4WH 3UPAA 2XOTA 3O3DA 3VO0A 4XHJC 2OR9H 1KJ2L 2JKLA 4Q6IB 2CO4A 3E6HB 3GHBH 1YEDA 1OE1A 3QT2A 4Q58C 2VJXA 3EJPA 1J0YA 2F19L 2AC0A 1L0YA 2R2BA 4QHKJ 4BZ1L 2ATPB 2GSGB 4PGDB 2OPCA 2ENSA 4LAQH 2XWZA 3NJHA 2VLKD 4PGBB 3U2SB 1HFUA 1SXCA 1XIWC 4RAHA 3FTWA 43C9B 1MRDH 2COVD 3H4HA 2VABA 5SWZE 1S9VA 3PIQB 4HHWA 3EDEA 1NAMH 1S7UB 4K71B 4X7CC 3AXHA 4Z3TA 4N8VA 5GXBB 4K8RC 4ELKA 3NSFA 4LCCC 3G04A 3KXFE 3O3BB 3FPXA 1WGOA 1ADWA 1RJLB 5J1AA 2CJSA 3SE3C 5INDB 5I82A 4QO1B 5TE6L 3HHMA 3B83A 2WXRA 4P9ML 2ORBL 3MLXL 3MV9D 4HIIA 3MRHB 2F58L 4PJCF 5JHDA 3OGCA 2Y9RT 1G6VK 3WYRA 5CFHA 3F85A 4DN4L 3WE6B 2J7LA 3OWRA 4FYSA 4IMKC 5B1AB 3OR7B 4Y5YA 3NIDB 1G6RL 2N0KA 3VI4B 1CE1L 4FL4C 2G30A 4EJ1C 3O3AB 1QATA 4XO3A 1C1EL 1A4AA 1PZSA 3P73B 4LVHB 2Y7QA 3U83A 4G2AA 2NR6D 1OV8A 4WO0A 1KDIA 1OP5H 3T8XA 1JNNL 2NY0C 3FFCD 4PJXF 2Y7NA 1PYWB 3I3DA 1TQVA 3H4FA 1MRCL 1NJ9B 2P5ED 3D0VB 3HZKA 3AXIA 3QNXB 1U33A 3R0MA 2P4AB 4KROB 4AIZB 4EI6A 2EEFA 3U0TB 4NI3A 3D6GA 1JF5A 3CPLA 4QTIH 3W3BA 1F4AA 5KTEL 4P3CH 3STZB 1A4KB 4U05A 2ZUWA 1ZK5A 4PYHA 4GKSB 3QPQC 5I1EH 4LVOB 3L3DB 4GT0A 3E6HA 3SEPA 2MH4A 2NX5B 3PWNB 2DDQH 4X7TB 2J1WA 4N1HB 4G9FE 4W9CC 3UL4A 2BOLA 3WXVH 2EXSA 3T0EB 3WU1A 4CBZA 3SIKA 4KTDH 4KJPC 2ATPA 1MFDL 5HTSA 2GSGA 4DVRH 5L9DH 4ZW5A 5C0DB 4PGBA 3LNHA 3U2SA 4XOEA 4ELDA 3S3CB 2Z3FA 2GBTA 5BS0B 1WBZB 1U3ZA 2NY6D 3ZTJH 5JOEA 5B21A 4Y7OC 5T1KA 43C9A 5ADPL 2Q76B 2WXLA 3GMPA 3L1FA 2R23B 3PIQA 1TYEB 3RX5A 1S7UA 1OOAA 1GY1A 3Q9QA 1FFNB 2C9AA 2VC2L 4YSEA 1SYSB 4ALAH 2PW2A 1EGJA 1QNZL 3WEXB 2P42B 4N5ED 3PQYE 1RJLA 2CCVA 3OC5A 5INDA 4QO1A 3LKSB 4KKNA 4AGPA 2MTAA 2PWDA 4LXFA 3MA7B 3VSUA 2JKRM 5AL8A 4E9SA 1WAAE 7TAAA 2D03L 4KVCL 3JVGA 4PJFB 3DO4A 4FQLL 4QRPE 1A14L 3MV7A 3EJTA 1WFNA 3WE6A 2BNQE 1JPST 3OR7A 2EDRA 3ZKMC 3MNDA 1B2YA 1QEWB 3VI4A 2D7TL 4GQQA 1GZQB 5KSBB 4XPTH 3NFSL 3O3AA 2FQFA 2YXVA 4Q9CA 2ZKHL 3AS1A 2VMCA 3EYUL 3FB6B 5E6SB 4MA8H 3VXSD 3P9LB 3PY9A 4N68A 1PYWA 2V2XB 3R06A 1YEFH 1K6QL 1NJ9A 1EAQA 2LAGB 3D0VA 3QNXA 4FZEH 3WMQA 2Q8BH 4LOUC 4AIZA 4PJEF 4X2UA 3U0TA 3ZYOA 3BDYL 3GSWB 3BUIA 1NGPH 3STZA 1A4KA 4ZMZA 1VFMA 4GKSA 4KRPC 1EXHA 4P99A 1M6UA 4M6NL 1CVSC 3A3YB 3L3DA 1QRNB 2NX5A 3PWNA 4GXVL 4X7TA 4APQB 2EE9A 4HSQA 3T0EA 1D3CA 2AJVL 2YD8A 4L8CB 1FGVL 4F9LA 3HRZC 4EAEA 4Z3GA 2X3BA 5C0DA 3S35H 2Q7YB 3DX3A 5F0PB 1NCJA 1J5HA 2CBTA 5J0BA 5F88B 1WBZA 3CQFA 3E6FB 4L3EB 3TA4D 2YJQA 3AAZB 2Q76A 4D0DB 4I3SH 1HHGB 3OAZH 2JLPA 5AW4B 4WEEA 2R9HC 5TDPB 5CGMA 3IBOA 4ZW7A 1FFNA 2WKOA 2DLFL 1SYSA 4NC1E 3NG5A 2QSTA 1ADQH 3WEXA 1R0AL 1Z9LA 1P7KB 3PGCB 2Y5TB 1U4EA 1IJNA 1ZLWK 3LKSA 4FNPA 4DK5A 2XNAB 3MA7A 1SN5A 3BAYA 4Q0XL 4P5TA 4XP5H 4PJFA 3H56A 2LTQB 3RQ3A 1CGSH 1VKXB 5TE7L 4FQHB 4DQOL 4KU1A 1TTRA 1IAKB 3HE6C 4W9KC 1LEIB 1L6ZA 5EIVA 2VQUA 1WGVA 1QEWA 3IKCB 3PFQA 1SFDA 4L4TE 3TN0C 6PAZA 1GZQA 1LXMA 5KSBA 1DJIA 2W0KA 5CEXB 4LBAA 5DMKB 1N12A 4OCMC 3RPBA 4AT6B 4AJ0A 1LQSR 4WY7H 5ITFB 4IEFB 3FB6A 1MREH 2C7FA 3RVUC 3U48A 5SX4H 3P9LA 5D93C 5HGDA 1AQKL 2Y06H 2V2XA 1Z7JA 5B1BB 2BRRH 1ZLEA 4FFVC 4LASH 1QFWM 1JG9A 1KN4L 4G6KL 2EQDA 2HTKC 2X4NB 5C0GB 3PUCA 2V3EA 5EB9A 4NO0D 1DLFL 1KFAH 3O41B 4NB7A 1QRNA 1VENA 5DHDA 4H7VA 3UAJD 5GIRB 1HEJC 2IFFH 1JHTB 4APQA 5CCKH 4L8CA 2BVEA 2EVGA 1PLAA 4GSQA 1NFIA 1E8ZA 3CXDH 3D2UD 1T3FB 2Q7YA 2ENQA 1V8HA 4OCLC 5F88A 4YQXH 1K72A 1XEDA 3E6FA 4L3EA 5HHOE 2PCFB 3FSZA 2DWEB 1ZDSA 2AK1L 1JGLH 4D0DA 1HHGA 3PXJA 1DN2A 2BFGA 2V5SA 4XN9A 3MUZ1 4LLUB 4Y1TA 1F6AB 5C07E 4IRSC 5GS1B 4KJWD 3TBSB 4JHAH 5JLZB 4L29B 2VN7A 2EO7A 2EZ0D 1P7KA 5DK3A 3PGCA 1JJUA 2Y5TA 1M9SA 4RFOL 4TVUA 1BZQK 2IOOA 2XNAA 3CFBB 4MJ6B 1BJMA 5IMMA 1G5AA 1EFQA 3EFOB 4W9GC 4F7TB 1FL3B 5DD1H 5D7LD 3HNVL 2OR7A 4J6RH 3TVMB 1VKXA 1OPGL 4FQHA 3ZL1A 5L2JB 1IAKA 3ESUF 1R9FA 1NGXB 3EYFB 3OB0K 3RDTA 3UZEA 1LEIA 2IQ9H 3VTTA 3GWJA 5CEZL 3BLKA 2FO4B 2VWEE 3IKCA 1G7LB 1T21B 1OB0A 5EOCH 1TQCC 1H3WM 4O2EB 5CEXA 5DMKA 4R4NC 5CN1A 5ITFA 5INCB 3L9EA 1X5XA 2X4QB 3L9RB 5AQ0A 5F21B 3PGDA 1T5KA 4FFTA 4PBXA 4IKLA 1BIHA 5AAMC 4CN1A 5BV7L 4WI4A 1E4HA 4UNVA 3CVBA 4QT5B 2UWEE 1JZFA 1A7BA 2EUVA 3KXFD 2X4NA 5C0GA 3HOGA 3T3MF 1KYAA 3NIFE 4PB9L 3FU7A 1INEL 1EWHA 2JH2A 1JV2B 3O41A 3AM8C 3NRPA 1ZHNB 1ZXKA 1KUMA 1KELL 4ISVB 2L7UA 1KPRB 5GIRA 3ZN6A 1JHTA 3SCMB 1FNGA 4NZUL 4M6OL 3VXOB 5LG6A 2D7NA 3APDA 5KVDH 2VITB 3BCDA 1U91B 1YC7A 2B77A 3ZHKA 1T3FA 4F2EA 5D6DA 4C57C 1I3GL 4JGMA 1YZZA 4TVPL 2PCFA 1OKEA 2DWEA 1CS6A 4OJEH 3H6JA 4XPHH 2EEBA 4MS8C 1DO6A 4R9HA 1I8IA 3QQXA 4MJ2A 1JL8A 3LEXA 4JG9A 4ICXA 1F6AA 1BGXL 1RZIB 4BK4A 1HHJB 3K5SA 5GS1A 4RCAA 3TBSA 2J4WL 4BHUI 4L29A 5JLZA 3K81A 3LN4B 1N5AB 3CFCH 4OCNC 1MAMH 3A4DA 2J8UA 4R0LC 4YSPA 1MCFA 4MJ6A 3TBTB 3EFOA 4AGOA 4F7TA 1ID2A 1F02I 2CUIA 1MOEA 4F7KA 5CM1A 3ECBB 1S7XB 2JKWA 3CSFA 3TVMA 4DFHA 5L2JA 3JV4B 4XO8A 1NGXA 3C2AL 3EYFA 4LAQL 1GR7A 1RP9A 5EWIH 4UANA 5CMAB 2FO4A 1G7LA 1T21A 5I1JL 4KRLB 4X8JB 4O2EA 5C2BL 4KXAA 4OF6A 4Y4HD 1HL4A 5INCA 2X4QA 1TLKA 3L9RA 4YN3A 3VWKA 2IOMA 2MPAL 32C2B 1J8HA 3KWWB 1UCTA 2CA3A 4MKMA 4QT5A 5AENA 3LQZB 1EZLA 3NCXA 1E4XI 1QR1B 4FYTA 3PQYD 3LTVA 3B2PA 5D7IF 4WW1B 1JV2A 1NUGA 1JD7A 4H0LC 1Z2KA 5D4IA 2EYTB 1UADC 3KYNB 1ZHNA 4ISVA 1KPRA 2X7LB 1ASPA 4WHDA 5D1ZD 5F70A 2X2JA 1AXSB 3SCMA 1SDDA 1MFAH 2L7JA 1W9XA 3TU6A 3LHPH 3VXOA 3HVDA 4AYBA 2HKHH 1REIA 1LILA 2VITA 3BPOB 3O6FC 1U91A 2BNQD 2NYYC 2NZ1A 2MEJB 5F9WC 1IC5H 3VXRE 4UT9H 3QFJD 5BQ7B 2K9UA 4N2GA 3CZEA 4Y89A 1CWVA 4LGSB 5HYJE 3RGBA 2VZVA 2ITFA 4XPFH 1ZT1B 3FO1B 4L8SC 3MGTB 1B2WH 4JAMB 3RX9A 1BOYA 2NNAB 5T1LB 3CSBA 4M03A 3AC0A 2OJZH 1RZIA 1K2DA 2VXTL 1HHJA 3OAYK 4L1SA 1G1CA 4K7PH 4FP8H 3QC5X 1EVTC 3LN4A 3IDXH 1AZNA 1N5AA 2DLIA 5C70A 2QADB 5I1EL 4UOW1 2ESVD 2AJSH 4GAGL 1FLTX 3K0WA 4MJ5A 1AP2B 1B0WA 1DQMH 4QEGA 1YEKH 3K72B 4N9OB 3WXVL 1HINH 3PUUA 4F15C 5IT2H 5CP3A 3ZL4H 4HXAL 1AOZA 2UVFA 1MCIA 1LO2L 1QKZH 1S7XA 2WLLB 2VZTA 3ECBA 5H94B 1CFVL 4XODA 2FL5B 3JV4A 4UTAL 1ZCRA 2AZAA 4RH4A 3DO3A 5GZOC 2B3RA 3TO4B 1F3DH 5CMAA 4FTVB 4Y1SA 4L2LA 5IB1B 4X8JA 3JTSB 5EZOL 4D9QE 1AS7A 2EVIA 4HWZB 3ULSB 5ICZB 1UM6H 1JAEA 3BCFA 32C2A 4GO8A 3KJ4C 3N06B 2AQTA 3I84A 3KWWA 3U30C 5CD5D 5LNGA 4LRNL 4ALAL 1F8TH 5GRVL 3P4OB 1RZPA 3BAKA 4ERSH 1QR1A 3A22A 5KVMC 2DI8A 5FHBH 3GI9L 5E5RB 5IFHH 3T0VA 1A6UH 4WW1A 1YYMH 3BQUC 4OVUA 2WNGA 4YHYC 2A4ZA 3KYNA 3HUJF 4BDVB 4RFNB 4MNGB 1XWVA 2VB5A 1AXSA 3EH4B 1UYWH 1X5JA 1V7MH 1K8IB 1R46A 3F2LA 2O5ZL 4OBRA 2NY4B 3UEZA 1M7XA 4LQFH 2H3NB 1MFMA 3DTXA 3GRWA 5CLWA 4L4TD 5BQ7A 4XPTL 1MCQA 4L5FH 3Q8BA 4P5KB 3GZOA 3U0WH 1J5OH 3M1BB 3HC4H 1WWWX 1ACYH 4MA8L 4PJAA 1ZT1A 3FO1A 3LS5H 3MGTA 1FHGA 4JAMA 4OIAA 4CBPA 5F7KC 4MCYB 3LPPA 2I9TB 2H32H 1RU9H 3P9WB 3WFBH 1E2WA 2NNAA 4DGWC 5T1LA 4A37A 4FZEL 4GAYA 5DC2A 3UGEA 4EZJA 5ILTL 4K3JH 1KG0B 3DVGB 1JXGA 2B5IC 4OVVA 4RGNB 2GAZB 4ZSOE 1IBZA 4PLKD 3EYSH 4PJHE 5FXCH 4DP4X 2VR4A 2Y24A 3K72A 4F91B 1M1SA 1S7QB 5E6IB 1NAMB 3VI3E 4HX1B 3S98A 1SVBA 3HA0A 2WLLA 2KQNA 2WZ0A 5H94A 4K2UH 5I0ZA 5HDLA 2FL5A 5C9JB 2H2PD 3D33A 5C1MB 3EIFA 4FJ6A 1KGYE 2P3YA 1F58L 3R4RA 3TO4A 3RGHA 4FTVA 3ZYZA 3CFTA 5AVQB 5JIHA 5F7FA 3WUZA 3TASA 2HLAB 1QSEE 5IB1A 5FF6A 2C1PB 4NKQB 3CLWA 3JTSA 1J9SA 5HHOD 1PG7L 1NKRA 4RMWA 4HWZA 3ULSA 5ICZA 1SBBA 1A7PL 4AL8L 3EOBB 3U2JA 1RUPL 4LLAA 5C07D 3ZQWA 3AT8A 3P4OA 3QUXC 1IC0A 1KEGH 4RFEB 1BJ1H 2PABA 2WUCH 3CFNA 4TPRH 1E4JA 1UM4H 1CT8B 1UZ6F 4M7ZC 4UM9D 3SQOL 3ABMB 4HGKC 3FZUC 4BDVA 3KAAA 3K74B 4WU5A 2J1KA 4Y4FB 5I74B 4MNGA 2PUQT 5CN3A 4TKWA 1K8IA 4ZUTB 2YOCA 1C9SA 4JO3H 5FOBB 3EO9H 3S8WA 2C8NA 4N2DA 2BCKB 2YR3A 1CICA 3EDJA 2PPAA 2H3NA 3VTAA 1JNJA 4UQCA 2BIOA 2M1KA 4BQ9A 4XMKH 2HJLA 4P5KA 2BFVH 2QR0B 3HE7D 3CMOL 5EC2A 3EDFA 3QC6X 5H35A 3BHBA 4K23H 1NPJA 3K6NA 5CJXC 3VQMA 4MCYA 4OCYL 1O6TA 2BRRL 3T2QA 3U9PH 2ZXAA 1D5MB 1G9MC 3A21A 5JXAH 5KVEE 4YFLF 3ET9F 1KG0A 3DVGA 1HOCB 3QZWG 5CU5A 3NSDA 3V6BR 4Z3EA 1EHXA 3V0HA 1RXLA 2A3TA 2GAZA 2IFGA 1WZAA 4HCFA 1NIBA 1SJVA 3VXUD 2QPFA 1S7QA 5E6IA 1A4CA 3ESMA 5DJDB 1NAMA 3WDJA 4HX1A 4P2AA 4PU2A 3PDOA 4WSGA 2BM3A 5C9JA 1RFDL 1Q0YL 2PYEE 1LYQA 1TO5A 3BVVA 1RZ7H 4XZ4A 1X5ZA 3DBSA 3TF7C 4NGHH 2EIZA 2HLAA 4F9PC 4YQXL 4KJQC 1V54B 2C1PA 3A6OA 4CVWA 1P1ZB 2A0LD 1NCBL 3IPFA 1JGLL 4HFUL 2WQSA 3FCBA 3BYTA 3GSUB 4R7XA 1EVUA 2BZDA 3QWRD 3KVQA 2BS8A 1QEXA 5KYUB 4XHJD 4XXCA 4ODSH 1NCAH 3EOBA 2PWGA 1ZLDA 3HTLX 4DKTA 4JHAL 4RGMB 3UC2A 4G6JL 2DQIH 3I9GH 4GP4B 4WNSA 4QHMB 5E00B 1CT8A 2D2OA 1HWHB 2B0SL 5JW4M 5IHHA 3KLQA 1JYWA 5EEVA 4UUJB 4Y4FA 1NBZB 3MNWB 3MLRH 3SDXB 4UOQA 5KSVB 4ZUTA 4L4VB 1SHSA 1AC6A 4E5XB 3THML 4CJ1A 4JCLA 5FM4A 1IBGH 2BCKA 4K15A 3OKEA 3VVVA 1X3DA 3BEVB 2B9BA 5EOCL 3SGDH 1ZJAA 4F37K 1RZ8B 2R4RH 2DH3A 2QR0A 5E99H 3RWDB 4X8XA 4DP8X 2HUEA 5FUZL 1IMHC 4WO4C 1CL7H 4QJ5B 2BNUB 1H9DA 5I73B 4KZCA 2HT2D 4FAAB 1D5MA 2Y7OA 4BWUA 1OK0A 2L8AA 2FIKB 1S9KC 1BAFL 1HOCA 5LUMA 3BIKB 3OF6D 1DTUA 1WITA 4JL1A 1VHPA 3KR3H 3RKPA 2JCCB 4EVNB 2ERJB 1UWEH 4MSWB 3V0IA 4AXWA 3LKRB 1Z5LB 5DJDA 3RHWK 4H88H 4FG2A 4DTGL 3C6EA 1MI5E 2PPDA 3VA2C 1QFHA 3NRQA 4G7VH 4G8AC 4HISA 3JV5A 2XBZA 4B7IA 1CIDA 5IMKB 2NY0D 4YFLI 3V7AG 2D3NA 1P1ZA 4XPHL 2P28B 4WI5A 1ZTXH 1HE8A 2VDNB 5HYJD 3LRGA 2F61A 2MNUA 1RZGB 1YEWA 1GCYA 3C5ZB 5KYUA 3AS2A 4Z7UB 2ETWA 3O4LE 1WUNT 2KL6A 2P5WB 4XRCB 1N70A 3RJOA 4GIOA 2JV6A 3UPCA 1D6EA 3BSZA 1GS7A 3LY6A 1Q9OB 3QPKA 4NRYB 1MAML 3PDGA 3B2DC 4QHMA 2PP9A 4KJPD 3UROR 2W38A 5I1HH 3BT2H 3UEQA 4UUJA 1F41A 1NBZA 3J27A 3MNWA 5FAAA 5FO2A 1ZLVK 3SDXA 1YQVH 5KSVA 2Y2YA 4L4VA 4PJCE 3WLBB 5E1GA 5DJCA 4E5XA 3JWOH 2EUXA 1NEZG 5KVFE 4N2BA 5EWIL 4NHCL 2VE6B 3QI9B 5HVGB 3TBCA 3AG4B 1OAUL 3TV8A 5JR1L 3BEVA 2L7EA 3NIGB 4HIHB 1TQBB 1RZ8A 3OSKA 2FEEI 3RWDA 4D9QD 5IIEB 2FECL 4P3WA 2BNUA 4M7LT 4G6ML 2LOEA 3HG0A 4AVJA 1UACH 2GFBB 2RTTA 4XNYH 2KKQA 2X53A 4OI8A 4PJXE 3MTRA 3AFLA 2FIKA 4N25A 3UC0H 4IKIA 4DP9X 1F90H 3BIKA 4PS4H 5JQIB 2XETA 4FXKB 1RERA 2JCCA 4EVNA 2A9AA 4MSWA 4GSUA 1TJGH 5K93A 3T4AB 4CJ0A 3ZE2B 1Z5LA 3GBDA 4QGYA 5AYUH 3LHPL 5GSVA 3T04D 2GCYB 4X4ME 3IDUA 3E8VA 4G8GA 5DRNB 1ADQA 2DWYA 4KMTH 1IEBA 3GBNH 2GB2A 3CH8A 1M05B 5IB2A 3QQ4B 4QI3A 5IMKA 3NSJA 3O45B 4NC2B 4TNVK 4JRYB 4ES9A 1JF6A 1TZAA 1WAEA 1OP5K 2R39A 4NWUH 3V4PH 3QAQA 3QWNA 4EZMA 4XPFL 4JM2D 4HJJL 4WSJA 1B2WL 3V0WH 1RZGA 4GS7C 5D7IB 5BMFH 3DSFH 4YDNA 4NN6C 3C5ZA 4Z7UA 1BYNA 3MROB 2P5WA 3GXTA 4XRCA 3GF8A 3B3IA 2OAAA 3AROA 3F7KA 4JPIB 3DJSA 4K7PL 1UWGL 3OKYA 1Q9OA 4MXWL 1MY5A 4NRYA 1DQML 3TZVB 1GMIA 1IAIL 4C4BA 5IT2L 3PV7A 2WXPA 3NPSC 4XC1H 5GZNA 5AYQA 3D4ZA 3MZTA 3WBDA 1JHLH 4LKCB 1YEHL 2HLFC 5EBGA 2R9HD 3L6FB 4FQCL 3FO0H 1TNNA 3NSXA 4JG0H 3ECWA 1WTGT 1QBBA 3ME0B 1P2CB 4JVWA 2F6AA 4BK5A 4KY2A 2V5RA 2NW3B 5AVVB 1JYNA 3F6JA 5IIEA 1UM6L 4J2XA 1OTTC 3SO3C 3U6XA 4PGJA 4X9BA 3Q2CA 3FQ2A 2QGDA 1W6WA 1AHWB 5EF1A 4O2CB 4GPVA 2EADA 5F7BA 3WGUB 3HE6D 3MNVB 3BW9B 5A40E 3T4AA 5J6SA 1PCXA 4WK2B 3JVFC 4JG5A 1UYWL 3IGAB 5I75B 3G5ZB 2GCYA 3BAWA 5K9JH 5KVGL 1X5FA 2BPBA 4K7PY 5I6XC 9CGTA 8PAZA 4IRZH 4NM8H 1Z3GH 1M05A 2BNRB 3U1SH 4ZD3L 4OFVA 3RVUD 3NEXA 1X5LA 3NOIA 1BLNB 4KKLC 4L48A 3U0WL 4FFVD 2LVEA 3RWIA 4NKDB 4IIQA 2CMRH 4MJIE 3LS5L 5B1CA 4DKEL 1OAKL 5CLXA 2W0PA 3WFBL 1EDQA 1N64H 4GAJL 1QZ1A 3MROA 2EACA 3TFKD 1CBJA 2A74B 2KPWA 4MCMA 1IC4H 1FBIL 4UINL 2G5UA 4K5OA 5CIPH 2J88L 4CKVX 5TPWH 1UA3A 5EN2B 4BFNA 3TZVA 3CHSA 3ARYA 3GIZH 2C9SA 3BPCA 5L88L 2D3LA 4GI9A 3M7FB 1ILUA 5DFWH 2Q3AA 4PW3A 1HOEA 4LARL 5GGRB 5HGBB 5KOVC 3L6FA 4YOKA 5IBUB 3ME0A 1P2CA 2E7LC 1WFMA 3FTSA 5EUOB 4IRSD 2ED6A 4GIPD 3WNKA 3JWDH 3FRUB 4F1ZA 2IC2A 2NW3A 2Y23A 3WCYA 1CGWA 4PAZA 4TTDC 2XYBA 3FJTA 5BJTB 5HPMB 5LLIC 1BAGA 2BVOB 3GMQB 3DC0A 4XAKE 4PJBB 4Q14A 1AHWA 2I25N 3BLPX 5F3HB 4O2CA 4TPRL 3DOSB 1UM4L 3BW9A 3F7QA 1PD0A 4U4BA 3NCCB 4GW4A 4XNZB 4J6IA 2D4DA 2VDML 1SOQA 2KYIA 4N20A 1MPAL 2O26U 1R3HB 1ZSDB 1G7MB 4L0PB 3G5ZA 4R4ND 4S1SH 3NABH 4GO6B 5FO9B 2LU5A 1F2XK 3LQAC 2BNRA 3L4VA 2ZX5A 1SLVA 2OA9A 4XH2B 5EMYA 2ZP9A 5F1OB 2W59A 3SKMB 4BUHA 4XMKL 3Q06A 2F8VA 4D94A 1FNHA 4C55A 2BFVL 3ULVL 1X9UA 4Y19E 3L5JA 2QMKA 3TEXA 2EDFA 4K23L 2B2XH 4EIUA 1OF0A 2FJUB 3MJ9L 4R97C 5HI4C 1VPOL 4EQ2A 2KBGA 4PJ8B 2FBJH 3RIAF 3FB7B 2RH0A 2Q7AA 4QHNB 2HT3C 3OGOE 3SGJA 2CPCA 4EO5A 4FXGB 3QDGE 1JXKA 5EN2A 3WDHA 4TUUA 2ZCZA 1S6NA 1PNCA 5IHZB 1UXWA 1ZJBA 4WW2F 2C3GA 4UZSA 5IOKA 1IBDA 4CU8A 1NBYB 5KBMA 2Q9OA 3CV5A 1MI5D 2F8XC 3DUHA 3ZDWA 2C4FU 3BWAB 1EUUA 4MS8D 2Y6SC 2MSPA 5HGBA 2BHFA 1IE4A 3UG4A 2W0FB 1JZ3A 3FMGL 4GW1B 1TETL 3RY4A 2CBOA 3JUYA 1KOAA 4WFGE 1BQHG 2DF3A 2PCXA 2W65B 3WFHA 4PHXA 5EUOA 5HP5A 1CLZH 1W8OA 4CADB 4I1RA 3EUUA 2GJ6B 4TSCL 4WUUB 5BJTA 1NCAL 5HPMA 3ZDZB 1F42A 4GSRA 3KVPA 3LSOB 2CUMA 2CHNA 1EZSA 3F5WA 4ZFZB 4WRLA 2BVOA 2DQIL 4DPAX 4UT9A 2J8UF 5C0CB 4B60A 2ENJA 4PJBA 3CZFA 4E2OA 1W0WB 4F57H 3DOSA 1HCYA 3UG3A 1EH9A 3T3ME 1JF1B 3OMZA 5CZXD 3EYOB 2PETA 4NENB 1I8AA 2X9WA 2ZXBA 1R3HA 2YUZA 4OM1H 2H32B 3MLRL 4PP1C 1ZSDA 4FXLA 1G7MA 3BDBA 3SKOB 2YEZB 4GRWH 5I28A 3X14A 5FO9A 4JMXA 5I17B 2CALA 1KXVA 2TSAA 2WMPB 3N0PB 1LM8V 5EHFA 3T1FB 1DLHB 2K78A 2XZAH 3SKMA 2ZOUA 1GS6X 3ZKXC 4A04A 4HKZB 2ICCA 4N0RA 2CKNA 3QXAB 4CC4C 3AY2A 3TPKA 1MCSA 4B96A 1NCOA 4NNYB 1C5BL 5DJ6A 4Y5YC 4F27A 3KPRE 4WFEE 5HSFA 2EH8H 4KTEH 1JGVH 1TNMA 4PJ8A 3FB7A 4QHNA 1PKQE 1QPPA 2D7MA 2NZIA 4ZPTB 1J7VR 4WCYL 5DHVH 4HJ0C 2LU7A 4G82A 4KQ4L 4FXGA 3KR3L 4ZFGL 4O02B 5LGHL 3LIZH 3CHOA 4Y9GA 5I19L 3O8XC 5AG9A 5ICXB 3V0DA 3QJUB 5IHZA 4NQTA 2GPZA 2QQKL 1NCTA 4H88L 4K9EL 2JCWA 3P4LA 4KWUA 2AJ3B 4AEEA 1NBYA 1XZ0B 4A55A 25C8L 3MLZL 2NSXA 1H3TA 3FONB 5I8OL 4OI7A 4G7VL 3CDYA 1FYTA 3BWAA 2XKSA 3NJKA 1ZGLP 1TTFA 2W0FA 5AFAA 3ZZSA 3CDFA 4I8DA 2VSMB 2W65A 3S4SB 1DN0B 3GSXB 3P0VL 5CGYC 3PE9A 2WIMA 4ZW8A 4CADA 2X1QA 3EDKA 4ZX3A 2HTLC 2Y1ZA 4WUUA 2BP0B 2CUHA 1LEGB 3MRMB 3LV3B 2H9GB 3TBWB 3LSOA 4ZFZA 3JV6B 3S3DB 5D6CB 5C0CA 4XN5A 1ZT7B 1ORQB 1Y6NR 2FLBT 1W0WA 2YA0A 1BD2D 4IRJC 1LK2B 2W0LA 3PP4L 1KT2B 4PJ7F 5GZOD 3BT2L 4LHUB 2JELL 4IBUA 4NENA 3LRSB 4ODTH 4LDLB 5C97A 3L3OB 4Y88A 2H32A 3N04A 3WLWC 4Q6YA 1YQVL 4YGVB 5CLYA 4UQ2B 3SKOA 2YEZA 1BZOA 3HBQA 3B7YA 3LYRA 3ZDXB 5I17A 2K8QA 4UMGA 2WMPA 2G3MA 3CVHB 4BXSV 3T1FA 3TONA 4DGYL 1DLHA 3N44F 5KS9F 1QQDB 2K3HA 3JVGC 3L3KB 4PG2A 4HKZA 5FCUL 2X41A 4PB0H 3NPZB 4M1GH 3QXAA 5E5UB 1YN6B 3LRHA 1MFBH 4NNYA 2DPKA 2J1YA 4XNBA 3P4NB 4PP2B 4L4JA 2X44D 2XY2A 2V5YA 1SQMA 4XNYL 3BQUD 2FSDA 5B3JF 1D7CA 4GUQA 2BOBB 1PZ5B 4YSRA 4HUVB 1X5HA 1AS6A 2IXQB 5C0AE 4ZPTA 4POYA 4MMYB 4LVHC 3O2DH 4YZWA 2V9UA 2F18A 3QG6B 4M1CD 4O02A 4H1LG 3H2WA 1SNRA 3KPPB 1BZ8A 5ICXA 2PO6C 2X2IA 2EDHA 3DYPA 5CZVH 5GGSY 2AJ3A 4Z7IA 1MY7A 1XZ0A 3SDAB 5JTWA 3FONA 4IOSD 4XVSL 2F8OA 3BKYH 1BBDH 3EYQC 2DM7A 1XTMA 1SYVB 1FZKA 3L1EA 3KBFA 3OZ9L 1KTRL 4JFWA 4ONFL 5D2LA 3K7UA 5FO8B 3WSQH 5LXGH 1TYRA 3UZVB 1DN0A 1HEZB 4PJAF 2M26A 4KV5F 4N24A 4UQBA 1LLAA 4FC3E 1W6LA 4F9LC 6FABH 3GBML 1N10A 3V0WL 5BMFL 3DSFL 1FP5A 4MJID 1UXSB 2XDHA 1U6AH 2BP0A 3MRMA 1LEGA 1HZLA 3LV3A 3VQ2C 2UX6A 4GKZB 3FL7A 3H7LA 3JV6A 3T6XA 5I6KA 3RIFF 1LJMA 3KLSA 1ZT7A 5EZIH 1ORQA 1DHKA 5KBDA 3IE9A 4R26L 4I9XA 3WG7B 1LK2A 4JPKH 5DD0H 1E27B 4HU8A 1KT2A 4IHOB 5L7XH 5CCHE 4LHUA 4S0SD 5FM8A 1KLUB 3LRSA 4TL5A 1AMXA 4O5LH 3L3OA 2D3VA 4MMXB 3QW9A 4E0RA 3HUJE 4YGVA 3EBAA 4IMLB 5F7DB 1WV7T 3WKML 1H15B 2HWZL 1OB1B 4Q4IA 2KZWA 1JVLA 1ACXA 3CVHA 3VD1A 5JDSA 2APWA 4IOFC 4P5TC 1QQDA 4YEEA 1LDPL 3L3KA 2EXWC 5I5IA 3RFZB 2YSSB 3W56A 2EC9T 1F97A 2CM5A 4JFDA 4LIQH 3QUXD 2X88A 4TLSA 3RWFB 1G9NH 2Z4TA 4JM4L 3P4NA 4PP2A 3UIZA 5IFAL 2W91A 2HB0A 3C09C 3WN6A 2CLVA 1NCCL 5AEAA 5J56B 4ZMTA 1SHWA 2BOBA 3FZUD 4GEJA 2FEJA 1PZ5A 1QA9B 4P23B 3KJ6H 4HUVA 2FSEB 2IXQA 4P9HC 4JLRB 4KXDA 4BQ6A 2VLJE 3BIBX 4MMYA 4NZRL 3IPEA 4W4OA 1FZOA 1U30A 4W4NA 4KFMA 3QG6A 4GJTB 4Z7WE 2I60H 2VN4A 4KKCC 3KPPA 5ESAB 3KPOB 4D3CH 2AEIT 2NNCA 3JTBA 3WIHH 2YN3A 3QHFL 3D39B 4JFFA 1CDCA 4PWFA 3SDAA 5K9JL 3UACA 1EDHA 2YC1B 5DU7A 3VVWA 1AGFB 1A3QA 1FA4A 1SYVA 2GIYA 4OFDA 5FO8A 1EZVY 4B9IA 5KSUB 2ZCHH 5T1MB 2QVKA 4X9HA 2C1OB 3UZVA 4BFRA 1UD5A 2BP3A 1HEZA 3B5GA 3CSTA 5IROA 4Y19D 2AABH 4JFEE 1CI3M 3MV8B 1JZ5A 2EYSB 1UXSA 3QHZL 3MI6A 2ODHA 3PWJB 1XVSA 2P52A 4XZUB 5I15H 3G08B 1L3WA 2PXYB 2AEQL 3X3GH 5CLZA 5TPWL 4KZEH 5DMIH 3JWNG 1BVNT 3QDGD 1FPTH 1E27A 1J9QA 2CRIA 4IHOA 4B5ZA 3AREB 3MLWL 1KJ2B 1B4TA 1KLUA 1P69B 4O9HH 4U6XB 1UZ6E 4JPVL 4LPUA 2JJSA 3TBVB 4MMXA 4MDJB 1L7TH 5F7DA 1XO8A 4IMLA 5E4AA 1H15A 1KEML 1NUFA 5IEKB 1OB1A 2AEPH 4NWTL 3FFDB 4BRJA 3RLSA 1XMEB 5I6OA 3CVIH 3VU2A 1SUHA 5AB1A 5IBLC 1H6EA 1KIQB 5EU6E 3RFZA 2YSSA 3S3BB 3SGKC 5L4JA 4XWOC 4I4WB 4NFBA 2FT6A 3RDTC 3UZEC 2HLEB 1T6WA 3NSYA 4R84A 1WZMA 4P2RD 4B95C 5FGRA 12E8L 1BX2B 2CCLA 2L3BA 1QA9A 4N28A 4P23A 4RMQA 4H0HB 4JLRA 1N4XL 3E80A 2QLVB 1NWOA 4F8LA 3LZOA 4EN3C 5ESAA 1IBYA 2BHUA 2AQ2A 2H0FA 3KPOA 2EEAA 3HLAB 1RZFL 1PY9A 2BO0A 4OZFG 3SKJH 1G7JA 5CSBA 3KGRA 4QKXB 2X1XR 2KDYA 3D39A 5FWQA 1DFXA 1PEWA 2QVTA 2UUDH 3DDFA 4YBHA 4S1SL 5GGSA 2BSDA 2Y1YA 2NY1D 1QI3A 1AGFA 1X5KA 1FORL 3NABL 4NM4L 2JKJA 4HHAB 2DMKA 1SHMA 2VH5H 5KSUA 4IS6B 1TPXB 5T1MA 1CDJA 3UBXB 1JPEA 1ZXQA 2ZKXA 3CK0H 3TOPA 2QFPA 4FLHA 2B2XL 3BWUC 3HNSH 4CMMB 3BH9B 1OW0A 2CXKA 2EYSA 3PWJA 3UTTE 5JHAA 1JCKA 3KPRD 4WFED 3G08A 4XZUA 5D6DC 1IGFL 1RIVH 4UOJA 2PXYA 4AG4H 2O5YH 1F1AA 3P2TA 4R90H 1KGXA 1SBSH 2E9IA 3QA3A 2P9RA 1R5IB 3GSQB 3EHBC 5E9DE 3AREA 4N4YB 3SBWA 3HW7A 3SDDB 1IIKA 3PJSB 4U6XA 2AQSA 4OT1H 2AQ1A 5GS1C 2VXVL 4HDIA 3TBVA 3TJPA 1G9HA 3FTZA 4GSDL 3VFMB 3FUIA 5G2NA 3OG6B 5IEKA 5AAPA 3MLPA 4HUMB 4QRSB 1M7DB 3NACL 1JP5A 1WG3A 1BF8A 2VDPB 4M29A 1KIQA 1BXAA 3F12B 3TVMC 5BVPL 1CLZL 4I4WA 3I3EA 4EXPX 3FFOA 5IESH 5E6RB 4U7MA 4IGBC 4N2HA 5HHQA 3BRFA 2O6DA 3PHOB 4Y9FA 2AGJH 1TU2B 5TK2A 2PR4L 4JHVA 1BX2A 2WGXA 1UM5H 5AWNH 3LPFA 1A7RH 1LWHA 4DIXA 4OZHB 4OZIB 2RHEA 4ANWA 1VGEH 3AY4A 3V4PA 3VWKC 1HYSD 1E30A 4M02A 3CBRA 3AWEA 3N1QC 4C56B 2L7QA 3WTSA 4Q9QL 4NUPA 2DJ4A 4PWIA 1M7UA 3TGXA 4ELMF 4JY5H 4OFQA 2YD4A 4HK3J 1A21A 1JWMB 4HHAA 2EXTA 3SOTA 5HYSG 3CHQA 4IS6A 3VB9A 2LV4A 2GTZB 1LK3H 4YHOH 1I8LA 4BZ2L 5KZCB 4W1TA 5AALA 3UBXA 5D5MF 5DK0B 1XAUA 2ISDA 4HETA 2VXQA 2EC8A 4CMMA 1KB3A 3BH9A 3OAWA 4OLUH 1OARL 5FV2A 3QSKB 3PHQB 5BZWB 1E6JL 5F6IB 5FDWB 1DVFD 2OCJA 4YPGB 2WYTA 4R7NA 5LHDA 1SVZA 4YXKH 1RD6A 4BSWA 4A6YH 4KZ0A 2ZX7A 3MRIA 5C0AD 1LD9B 2IAMB 1GGCL 4ZXBC 4NQDA 3NYKA 1KPUA 4EMZA 1UGNA 2BW5A 3GSQA 1UOVA 2B1AL 1FG9C 3SDDA 5J6HB 2QVIA 4ODHH 2ZOTA 2OI9B 3PJSA 1GOFA 1WF5A 2B4CC 3CN2A 3LD8C 5D70L 5DT1L 1YMHA 3VGDA 4X83A 3VFMA 2C9UA 3SZ6A 4BM7A 3B9AA 5CSZB 1FH2A 4EQ3A 2N4IA 3L08A 4NT6B 1UWXH 4QRSA 1M7DA 1BQSA 4V11A 3TYGL 4HWUA 4YC2B 3WJJC 4NPYB 1NC2B 4H0GA 1GAFH 4Y5XB 5IKCB 2VO5A 1O75A 4FQJL 3P3SA 5F97E 2XTJD 2ZUYA 4PJ9B 3VJ6B 5M94B 4J3OC 2WXFA 4M6AA 4FULA 2APXA 4NBXB 2FX7H 3W0WB 1RCYA 4UCFA 5D7SH 3S48A 4F5CA 3PHOA 5IJVB 1TU2A 4IRZA 4PIRF 5E2VH 2EDXA 4ZX6A 5BZDB 4RQQB 1WYJA 3GXNA 1HKFA 4IJ3B 1LEKA 2P49B 3F01A 3L5WB 4OZHA 5T3XE 4OZIA 1AGCB 2W9LA 2D3JA 5FOJA 5FX3A 2UY6A 2BSSB 1H8OA 1KCRH 5FKAA 4ZMPA 2VKWA 2ENPA 1QASA 2NXZB 1Y6MR 3PPSA 3T8MA 4A2DA 4C56A 2X0UA 2DQUH 4FG6C 4J3SA 3QYMA 3H0TB 3MV7E 3X1NA 2ZTBA 2XVBA 2NY3B 3QEUA 1JZ6A 3C08H 3QQ3B 4OLYL 4AZ8B 4NEHB 1S8DB 5CIPA 2D0GA 2C3HA 5KBPA 2CDFA 3C12A 4DKAA 1OTTD 2GTZA 4TRPH 3VFWB 2CLZB 2GW5A 1WCBA 3NUKA 5DK0A 3WAJA 1CUOA 1WZ1H 3RL1B 2DQJH 4PMFA 1M1XB 4R8WH 4MHHG 1IVLA 2F54B 1LO0H 3DETC 2ZP0T 2DWDB 5FDWA 4YPGA 4C8XA 1JK9A 3C60B 5HHXL 4JKLA 2DEWX 1NANH 2X6UA 2ZE0A 4UIKH 2ZYIA 3ATFA 1LD9A 2IAMA 3BZFB 3TBBA 4CSSA 5A2IH 3OPZH 4PJDA 5ITBH 5B8CA 5JZ7C 3ALWA 2VR5A 3ZDYB 4XN7A 1T1YB 5J6HA 1AAJA 1K4DB 4QLWA 3SPJA 4E9TA 3I2CL 4N2OA 3RDJA 1KYOK 4KKLD 4FZ8H 4AH2B 3VH8B 2QADC 2OSXA 3L3JB 5LBGA 5CSZA 4EOWH 4GQRA 4NT6A 2YUXA 5TE4H 3WMPA 4OCWH 5LXGL 1RY7B 5EC1B 5IKCA 4Y5XA 4WUKL 3ECQA 1U8KB 4TN9A 1AGEB 3VJ6A 4PJ9A 4PRHB 5ADOH 2BIQA 2HG0A 2DAVA 3LOWA 3NP3A 4JFED 2FBOJ 2A6JB 3ABGA 3W0WA 3QXVA 1UWFA 2AAVA 5IJVA 3QNYB 1F3JA 1T89C 4LEXH 4DP1X 4E9XA 5T33L 1CJYA 4IU3B 3MDJA 5BZDA 2W60B 4QKTA 4LLWB 4Q9BA 4RQQA 5CWSB 2XV2A 3L5WA 4Z7NB 1AGCA 4DNLA 5L7XL 1F3DJ 4P8QA 3TCLB 3RKDD 2BSSA 3VXMB 3T0XA 4KH2A 4XMVA 3UYRH 5DDHB 4O5LL 3MUGB 3SQRA 3FRPG 2MRYA 3H0TA 1OSZA 4WKZB 5IZ7A 3QQ3A 3FB8B 5J3HC 1ANUA 1XL6A 4AZ8A 3K2UH 1S3KH 5DHVB 4JW3A 4NRZB 3VFVB 2FQDA 5GRJL 2J12B 4FABH 4TTDD 1XL4A 2X4TB 1WT5A 2CLZA 3QUMH 4BKSC 3UAFA 3ZT5A 4LIQL 5EU6D 3QS3A 4AW7A 2DQMA 3RL1A 1JWSB 1UURA 1M1XA 1W80A 2J44A 1YJDC 3QDJE 5SX4I 5BUAA 2F54A 1CICC 1P84K 5IQMA 2EVHA 4MCNA 1TVBA 3UP1A 1XR8B 2EO9A 4NO5B 5HD8D 3C60A 1DO5A 5DK2B 4PRNB 3HG4A 1PSKL 1UJ3B 4HXBH 1A6VL 3EJZD 2WXNA 3KLAA 2WVVB 2NUPB 2J1XA 1CTMA 2D0HA 5CJBA 5A1AA 1JNHB 4XHQA 1M2VB 4GKLA 3PJNA 1QRNE 1T1YA 4HIEA 1I8KA 3WIHL 1K4DA 1X9RA 1J12A 2HVKB 4AH2A 4LU5H 3VH8A 2Z8WC 3SYPA 3L3JA 3UJIH 4OIIH 1MNNA 4MDRA 1Z3RA 4RX4A 4DSYA 1QOKA 3IRCA 4ZZKA 4L3EE 1A4JB 1HNFA 1U8KA 4DEWA 1AGEA 2E7CA 2WC7A 4JPWH 3GSRA 4MAYB 3CG8A 4PRHA 3IN0A 2JI3A 1CO1A 1KBKA 2A6JA 2PCYA 3L2MA 5I15L 3UTTD 3F05A 3LVTA 3QIUD 2Z6FA 2EIJB 2NQDA 4YUEH 1CD9B 4IU3A 2W60A 4RESB 4LLWA 5CWSA 1YUKB 3GM8A 1ZGLB 4X4YB 2H4EA 3FSAA 4B27A 2VLRB 3TCLA 3VXMA 4YHIB 3CVDA 4PJGF 4XXCC 1SN2A 3CQPA 4KO6A 4LLVB 4LPYA 3UGUA 5DDHA 3MUGA 3GI8H 2EVFA 4GLRH 1MQ8A 4B9GA 1KC5H 2ZNXA 4RMUA 4NAMA 1G7HB 5MI0B 4N2FA 4WKZA 5F8RC 3D07A 3FB8A 1FCCA 1TEFA 1MKFA 4Y2NA 2K6WA 5DHVA 3ZKND 4LOEA 2EH7L 3VFVA 2QMJA 2XC8A 4OM0L 2W81C 4Y4FC 3NP4A 3LIZA 5I74C 2X4TA 4H1LH 4UV4H 1G0YR 4Z95L 2XFXB 3Q7JA 1EMTH 1BJ1J 1KPVB 1JWSA 2NY2D 1WFTA 5TFSH 1IC7L 4BKLB 3BVWA 4M48H 2G4EA 1X5MA 5HHNB 3PHSA 5DZPA 5A2KH 4E41B 1ZVSB 1XR8A 4NO5A 2O61B 2D2CC 2OJEB 2YKLL 4N8CL 5DK2A 4PRNA 4DZ8B 3M8OL 1UJ3A 5AD0A 5AG8A 2WVVA 3L9BA 2NUPA 3QEQB 4JGUA 4IBQA 1R75A 3FUFA 4XPGH 4YBQC 1A1NB 1P0SE 1JNHA 1TG8A 4RIRB 2MQ0A 4AQ1B 2DBLH 1XCWA 4UF7C 3IJSB 4LSRH 3RI5F 3UPRB 4XX5A 5IBTH 5JHDD 1WJ3A 3HMXL 4KAQH 1DBKH 5IMLB 5L2KB 2HVKA 4GP8B 3HAEG 1HH9A 4MD4B 5D1XB 1IKNA 4Z3FA 4NO2B 2YXFA 2VH5L 2JTYA 3FTVA 1GYVA 3I74A 1QRKA 1YEGH 2B39A 3TIDB 3CK0L 3LNEA 2H41A 3QH3B 1A4JA 1UCBH 4Q74A 1HNYA 1NMCC 3HNSL 2OW6A 4MAYA 4ALAC 4XNDA 3H2QA 1FC1A 4NN5C 2GJPA 1RZKH 5IF0B 4JDZB 4HLJA 4AG4L 3BAEL 3ARFC 3KGUA 5GGUA 3V0GA 1BMGA 1MVUA 3OKOB 4IQHA 4JZJB 3LHAA 4R90L 1U2HA 2EE0A 4G1MB 1A66A 3BVUA 4X4YA 3ESVF 4XN2A 1EZUA 5C0BE 2J8UE 2VLRA 3BRDA 4OLXL 5FYKE 5FA3B 1MUJA 2ZWKA 3L3GB 1FVCB 4LLVA 2AANA 4J1UA 1N0XH 3H54A 4JO5A 3V52H 1R3IH 4N85A 1S7WB 1G7HA 2RFXA 3P77B 4XO9A 3WEBA 5CGYD 1SRDA 3TH2T 3O2DA 3KBPA 2HTLD 3CN4A 3TV3L 2LFGA 3QYCA 1IQDB 3DK2A 3E8UH 1T0NB 4ONOA 4FFZL 3MOAH 2LE9A 1UXMA 2XFXA 2NOYA 4XAWH 1KPVA 1RIUL 1QFWH 1QLEB 2JSFA 4WJ5B 5T1KD 1KB5B 4BKLA 5IV2A 1R24B 1SFHA 2FECI 3ASOB 4IRJD 4Y16B 5HHNA 2AGJL 1J8HE 4P04A 1ZVSA 2OYLA 4E41A 4MX7B 3ZR5A 5I6NA 5KYWA 2OJEA 4XNQB 2LGNA 4DZ8A 5K9OB 3HC0B 1AXTH 1XF5B 1YAZA 3IDMB 3MVSA 4XP1H 4X6DA 5LAXB 3GO1H 4YK4C 3QEQA 4U1JB 3F58L 1DE4B 3VDAA 3DX8B 3DOIA 3EOAA 3VFUA 1A1NA 4RIRA 1FFQA 5I73C 1U95A 3RUGA 4AQ1A 2Z93B 1CBVL 1S9WB 3IJSA 2DICA 3IFNH 4RVBA 4AE1A 5IMLA 3UG5A 3EH5B 3MV7D 2WLJA 4MD4A 2IO5A 5D1XA 1ORSA 4OGYH 4NO2A 4F8TA 3LMJH 1E9OB 1XH3B 4G6FB 4RWYL 1LK3L 5E2TH 4KRNA 1EJ8A 3JWNH 4AOFA 2F1AA 3TIDA 4EZLA 5HYFA 3QH3A 1X6LA 4W9HC 1T2QH 2PN5A 4JKNA 1GIGH 4OF7A 2CIKA 3MLTB 4WWKB 4CVXB 3FTXA 3WGVB 2BSBA 4QR7A 1URZA 4JDZA 1B4RA 3N2JA 4YXKL 3WNJA 2EE6A 5KAQG 2HFTA 3KPSE 2EDQA 3OKOA 1A3RL 4JZJA 4WTZG 3HBZA 5FGBC 4G1MA 2ZUVA 4N8VG 3VWJA 4DUXA 1N6QL 3HN8A 1LHZA 1MWAL 3KNBA 1YRKA 3EYQD 1IAII 1NDGA 2E3VA 3HZ3A 4X0NA 5FA3A 5FIEA 1F18A 3SBPA 3L3GA 4YDLB 1YY9C 3ASWA 3Q6GH 3UBHA 3NSCA 1RVFL 5T8IA 1SEQL 2CUAA 5AZ2L 2EDDA 5GGTH 5D2LF 2WO3B 5E5MB 4XNXH 1FH5L 3PYCA 4Y1AB 5HDBF 4OV5B 2ZCKL 1BQLH 3K91A 1BA9A 2VZSA 3SDCB 1IQDA 5JW4N 1B3IA 3UJTL 1G7QB 1T0NA 2FATH 2F7PA 4YR6A 3TX4A 3O6MH 3LH8A 5GZNC 4YSOA 1QTYT 4WJ5A 3CZSA 1KB5A 2QQLL 5EORL 1R24A 4Y16A 5D7SL 3DJZA 1D2PA 4O00A 3B1TA 1SN0A 4MX7A 4NZFA 2NPLX 1UEYA 2K70A 3KM2A 5K9OA 3HC0A 2NNFA 1XF5A 3BPLC 1C7TA 4NZ8A 5LAXA 3RTLA 5B3JE 5JPNA 2AQQA 1MCLA 2H7WA 5E24E 2E46A 3Q0HA 4U1JA 2WOBA 1DE4A 3KWVA 1KCRL 3DX8A 4J3WA 5BPPA 1AC0A 2OTWB 2WBJA 3S37H 2JMRA 3UJJH 2Z93A 3QWOB 1JOIA 1S9WA 2DQUL 4IOFD 4P5TD 5DUMH 4TL4A 2EXWD 2P47B 2DJUA 4O51A 1NEZA 5DZJA 4UNIA 2DY2A 2FQGA 3KDMB 1E9OA 1XH3A 2WXKA 4LK4A 3C5SB 1DBAH 4PTTA 3FN0H 3QG7H 3RBGA 5C6TH 4ANXA 1XBRA 5AKSA 1BEYH 1E5AA 2DQJL 2AV7B 5ID1B 1JYXA 4PJAE 1KBWA 4BJLA 4CVXA 2YWZA 1YEEH 2E9GA 3QDJD 5MENA 2VJ8A 3IXAB 2X1PA 4KKCD 1IX2A 1V05A 4MAUH 5E1IA 3VD0A 2IV8A 5CEZE 1IE5A 4GYBA 4IIQC 1KYOJ 1CK0L 2OP4H 3N41B 2A6KB 3VFGH 5ITBL 2ATAA 4AYDC 3DLQR 3O11B 3SOBL 3HPJA 3MGAA 1QSFB 4PRPE 1QRND 4MRCA 1S7SB 1CZ8H 4FZ8L 4JUSA 4O58H 1CU4H 5EEUA 1NBVH 5TH2A 3CXFA 5E5MA 4KKAC 5M7QA 2IPKB 1ZV9A 4Y1AA 3TZVC 4Q8BA 2X09A 3CIQA 3JUZA 5EBMA 5TE4L 1BMWA 3GKWL 4OCWL 4MQSB 5A43C 3SDCA 5CFAA 1TFPA 1G7QA 3V9EA 2R59A 1V3KA 4L3ED 4U3HA 5ADOL 1MN4A 3PNWB 3UTZB 4AW4A 5LQBH 2OV0A 3WS6A 3MBXH 2O5XH 4LEXL 3CZGA 4F80A 3P3TA 2VZUA 2HG5B 2UXGA 4DWHA 2DMBA 4A7GA 5D72L 4GMTH 4M5TA 5DZOA 3SYCA 4TVPE 5ID0B 3B8SA 2DKMA 2OTWA 3GZPA 3UYRL 4PQXA 5CCJA 3QAZC 3QWOA 3R0NA 5GISH 2N7AA 4FQXC 3MRKB 4W70A 1OCOB 4XBEH 1S3KL 3ELAT 4MAZA 4A6YB 4XWOD 3ZE1F 3DGCR 3RDTD 3KDMA 4NIKB 3X14B 1JPFB 4Z3HA 3C5SA 3QCUH 3RG1C 2DS4A 3LX9A 4HD9A 4DN3L 3ESPA 2QVFB 1GYWA 2DIBA 1OSEA 2AV7A 5ANMB 1PJ9A 5BVJB 5ID1A 4L0YA 4HWBL 1IGMH 4XMTA 2X10A 3HG3A 3L81A 4UILL 3IXAA 2X2YA 1NL0L 2ZSWB 4EN3D 2K0RA 2AMUA 3C8DA 3DRQB 1EBAA 4NO3B 4PLNC 5FB8B 2DWXA 1LQBC 5CHNB 2XKNA 3G5VB 5EZLA 3IWUA 4M7JH 2GY5A 1IQWL 2A6KA 4RMBA 4LPCA 5HDRA 5DYOB 4WFFE 1SF5A 1WVZA 5GRXG 1QPKA 3Q2VA 2OBGA 2CLRB 1S7SA 3SGJC 1EEZB 1IAOB 1YNLH 3UCQA 4LU5L 1JZ4A 1FRGH 3UJIL 4HJTA 2IPKA 1NCGA 4BA8A 1QBML 3X1BA 1PU0A 3MRFA 5D9SB 2Q3ZA 4YHLL 4WI0B 1GSKA 1NFDB 5JO5B 2V2TB 3PCYA 1ZLSL 4GRMB 3N1MC 4B41A 1HZHH 4GFTB 1H3XA 4JPWL 5AOJA 1CXHA 2CGRH 3PNWA 4WIQA 3UTZA 1B4LA 2E6PA 3Q1SL 3QDHA 1HYRC 1MZZA 3EHBD 4YUEL 2A77H 4UNUA 2A5UA 2YFOA 2MQCA 3LZNA 5KSAB 2HG5A 4LSDA 2WUBL 3ZKSD 1GTNA 3EFDH 5FS5A 1JPSL 3TA3B 1I7ZB 3O0RL 2E86A 3CSPA 5FYKD 5GS0H 3V4VH 2EAEA 4Z7VB 3GI8L 1QACA 4JFSA 4NP4H 1H19A 1KC5L 1KYFA 3CFMA 3MRKA 1H6UA 2YA1A 3RTQB 3TVMD 1J9CT 1B6UA 3ROOB 4A6YA 1FIGH 2Z31B 1P1VA 3S88H 5DJ0B 1NC4B 4JREC 4XNZC 4PGZA 4LSUH 3TJHC 4YDIH 1HHIB 1JPFA 1PG7X 3NZSA 1BQHB 3HN3A 4IGBD 3P0YH 2WWMD 3WTWA 2Y5EA 4UV4L 2XJLA 3ZZLA 3U2IA 1PQZB 5L4MA 5BVJA 4P57B 1FCGA 2OMTB 1RJZA 4M48L 5I76B 2AI0H 4BGLA 4FG0A 1JZDC 5G55A 3VWKD 2ZSWA 2K4AA 3DRQA 4NO3A 1J8HD 5FB8A 5CHNA 1RMFL 4B9FA 2LAAA 3G5VA 5CP7B 1IGJB 1GGIH 3DA0A 5KVFL 2D8KA 3HI6L 1MHEB 5AZEH 4TQ8A 4XPGL 5DYOA 5HXMA 3VW3H 1CDBA 5E94B 4MTMA 1UWYA 1FIEA 2UUDK 2XIIA 3U4BH 5LDUA 2CLRA 3RY5A 5IBTL 4KHTL 1D9KB 1EEZA 2G3NA 1IAOA 4PMEA 5JUEL 4KHXH 1QHPA 1ZPUA 3L3IB 4FXGC 2N7BA 3SCMD 2Y7MA 3F62A 5D1QC 1GGBL 4OJDH 1UVQB 3NCMA 3KYKH 4M3JA 1GW6A 2AJZB 5D9SA 5IJDC 4WI0A 1O9VA 1NFDA 2GKIA 1EJFA 3EH3B 1OP3H 5I6LA 5JO5A 1MFEH 4GRMA 2HMIC 2MNWA 4PH8A 1CLYL 1XBDA 2P45B 3SKNB 5KBLA 2BDNH 3MTXA 1RK0B 5TDNA 4NSKB 4FNUA 2X28A 4AM0Q 5KSAA 3KPSD 1EO8L 1WC7B 4UIMB 3INUH 2ATKB 3TA3A 3QUMB 2Y1AA 2FH6A 4K3DH 1I7ZA 5IHUL 1FSKB 1IM9B 1OP9A 2WLYA 3GJEA 1RIHH 3NCEB 2R8SH 2XRAH 3OLDA 3QEGH 4OLWL 4DP7X 5GRZA 3BKMH 5HHMB 1AE6L 1FVEB 1IB5A 1R3IL 1ZD6A 4OGQC 4PTUB 4A67A 3GEFA 1JI2A 5E8DH 4F7CB 2WHVA 3QZBA 4L4VE 3FF8A 4OLZL 3ROOA 1Q94B 2WO4A 3PWPB 2Z31A 4Y5VB 3TBYB 4XMLL 4ELME 4J3OD 5DJ0A 4RLDA 1NC4A 1P4IL 3TFBA 5C3IA 1VFAA 1CYXA 4NUQA 1BQHA 2J6EH 4LE8A 1OALA 3MOAL 3FTUA 5F71A 2QQQA 5I1GH 4UT6H 5J12C 1PQZA 1DEDA 5IHLB 4P57A 1C8QA 4QUOA 4KQ3H 1TQUA 3L48A 5I76A 3D87B 4ZUSB 4KZDH 1ZAGA 2VGLM 1S5HB 2ZX8A 3DI2B 4KI5F 4PG2C 3D06A 3KG5A 2DJMA 3FCTA 5CP7A 1AXTL 1ECZA 2CO1A 3MYZA 4FG6D 1IGJA 4UAOB 4AEHH 1ROWA 5C0JA 3OWEA 1MHEA 1KWGA 1ZV2A 2JCCE 5E94A 2YGNA 3V5HB 1AGBB 2WNXA 3NJXA 5EF3A 4OQ1A 4JRXE 5F9OL 1MNUH 4HJEA 1D9KA 4ILDA 4AJVA 1SJEA 2WTOA 2ZF8A 3L3IA 3R8BB 3T09A 4G8GE 4UB0L 4PBDA 5I1CL 3FYEB 1UVQA 1NCDL 3PLYA 3ZKQD 2X87A 1TVDA 1BFTA 2AJZA 2CO2A 2ZXDA 5DS8B 3UO8B 2YMXH 5I9QB 5L0QB 2NUTB 4ZW6A 4BRVA 1WTLA 4AENB 1DBMH 3MGOB 1GIGL 1IGTB 3TNMB 3ZR6A 3SKNA 4CVUA 4MXQD 2X40A 3NZ8B 1DZ0A 5JZ7D 2ZOWA 1RK0A 1J1XH 3U7WH 2P5WE 3NZUA 2R7EB 2CO7A 1WICA 4UIMA 1WC7A 1O9ZA 2ATKA 4PJDF 5EIIB 2YA2A 5CEZD 3QUMA 3VXQB 1IKFH 1GZPA 3GS4A 2QADD 4H2CA 4HJGB 3SN6N 4XMPH 2BSTB 2YPVL 3Q6GL 3ABZA 3ARTA 2WWKT 3QZLA 4HP5A 1FVEA 1F1DA 1HJCA 1QLFB 4PTUA 5M95B 4F7CA 1FZJB 1QFPA 1UWXK 1Q94A 3CZKA 3PWPA 4WKXA 1F11B 4Y5VA 3S5YA 3L2LA 3TBYA 3V2AR 1BQLL 2OLDA 2Y1VA 5DD3H 3TO4D 1ACCA 2J21A 3NIGE 2FATL 3L3OC 1VACB 4M3HA 3H3PH 4ZTPH 4OR1A 4P2OB 3SDYH 3TJEL 3LZLA 3JZYA 1ZOXA 2BVYA 2EDWA 3NK4A 5DD5L 1U36A 1S5HA 3OC8A 5FUCC 1XX9C 3HAEH 4BV1A 3CLEH 3RNQA 4HAGA 7FABH 1CR9H 3VB8A 3QIWB 2CA4A 4QRUB 4LKXB 4LNVA 1RUKL 3COOA 5J3HD 1LE9A 3V5HA 5JW4Q 4DUVA 1AGBA 2XQBH 3DXAB 3OG4B 4P5RA 2VDMB 4W4OC 5TJWK 2IBZY 4BINA 1AY1H 3H9SB 1MH5B 1E2ZA 3J8F7 2NY4D 1A47A 1EXGA 1CICD 2VUKA 4K3EH 4BFKA 3V55A 1ZT4B 3SDAC 3ZY7A 4I2XB 2NUTA 4LOVA 4FFYH 4ODVL 4AENA 4Z23A 1IGTA 2XV3A 3TNMA 2GYSA 1Q1JH 3VGAC 4GG6A 4M5ZL 1WBYB 3CU1A 3NZ8A 5E6UB 3MKGA 3A47A 3D48R 3K2IA 4MAUL 4APXB 2R7EA 1XCXA 4XO5A 2EKSA 3HB3B 1CDHA 2JB5H 1AANA 3KPQB 3L4WA 3VXQA 1MLCB 5HBBA 4ZFQA 4RGND 4HJGA 3MCKB 5JMOC 4WFFD 1SY6H 2BSTA 2OR8A 5DA0B 1J8KA 4Z0XB 1G9ML 4PPTA 2FD6H 4JG1L 4O58L 3N1GC 2QVMA 4K94H 1SMAA 1FZJA 4G72B 5ABAA 1SM3L 1F11A 4M7LH 4IBWA 4LCWB 1HN1A 2VDQH 4MQXD 5BRZB 2JJSC 2OMBA 1CDIA 1VACA 2Y36H 3TEWA 3NH7H 1T83C 4P2OA 1NQBA 3FTYA 4GRWF 5JDJA 4XBMA 1WD9A 4G42A 4DT2A 3QUGA 1X4XA 1EXUB 1Q4NX 2NRDA 3DHPA 4FQ1L 3VTMA 5KVDE 4U1LB 1JGEB 4NQUA 4E36A 1GA2A 1YNKH 4RISH 4GMTL 3QIWA 2ARJQ 4QRUA 4LKXA 4JO4H 5C9KA 4C4UA 1P7QB 2VLKB 4Y9BA 1T1WB 3DXAA 2WXHA 1WISA 4PY7B 4U6VH 4Y4FD 1JXJA 1MLBB 1OAQH 3G3LA 1AQHA 5F0MB 2Q6WB 1D5BB 3H9SA 3KYMB 4W6WB 3S3SA 1MH5A 1M2OA 4OD3H 4LCYB 3WHXB 4JR9L 2K6YA 1CD1A 4A2MA 3QCUL 4HVBA 2NY5H 1DFBH 1TZGL 1I9JH 1DSYA 1ZT4A 2YAFA 4EBQL 4I2XA 2PWFA 4GI6A 3N43B 3ZE0B 3QJTB 1XH2A 2JXMB 3BUTA 4X50A 1HTYA 3TC9A 4NQCB 4GH7B 5C09A 4NZDA 2CD0A 4RWHA 1WBYA 4MGXA 4YBQD 1CYGA 1T7YA 3MV9B 5I1IH 4APXA 1SGKA 3RPKA 1BXUA 2NY6C 3KPQA 4Y2DB 3F7RA 2CHDA 3V6OA 2FIRT 3FK3A 1MLCA 4LGPB 1TENA 5E8PB 1J9RA 3FQUB 3MCKA 1Z9PA 4M1DH 4Z0XA 2A9DA 4LSSH 4PJGE 1JFQH 4XE5B 1RUMH 1ZLWH 1NMAH 1JUFB 4J23A 4L23A 2CXGA 4U4IA 1MF2L 4C83B 1PAMA 3FFCB 4LCWA 4PD4K 4Z3IA 4PUBH 3SBWC 1ZPLA 1HAWA 3QR1A 2P5EB 5BRZA 1H5BB 3ARFD 1M6OA 3CXHK 3APFA 2CPUA 2NMSA 3FO2A 2CGRL 4M93C 2FCBA 1XHHA 2DQTL 3BAXA 4GG8B 4Q7DA 3GEWB 4QY8B 2A77L 5DTFB 4X4ZA 4AKOA 4U1LA 5A2CA 1JGEA 4YS4A 5MERB 3FBQA 3EFDL 4KDTC 1BFVL 5DZLA 1J1PL 3E2HC 4EXKA 1UEMA 1F4XL 3BIAX 1C5CL 1P7QA 3UTSE 2I85A 4ZPVB 2VLKA 1OQXA 2J5LB 3S36L 5GS0L 1T1WA 5FGCE 1O6VA 3K1KC 4PY7A 1JGUL 4U7KA 3VFOB 1MLBA 4JQIA 1M4KA 3L5HA 3UOAB 1FL5A 2Q6WA 5LCVL 3L4CA 4HCRL 1D5BA 3AY4C 3KYMA 4L4VD 5D7JC 2BC4B 4LCYA 1C16A 3WHXA 5AOMA 3P0YL 4LT7A 3B2XA 5J8OA 1I75A 1KXTB 1EGJH 1Y6KR 4KDWA 3W2DH 4JY6B 3PWLB 1YN7B 1HVXA 1QUNA 3AG3B 4RMSA 2JXMA 5TQ2L 4NJAL 3G6JB 4NQCA 1U8NB 5GGTA 3IJHB 3EGXB 4N2AA 4M8VA 3ZO0A 4NNXA 4X6DF 3QISA 4ZUWB 1JYVA 5J1SC 5LO7A 5EEWA 4G3YL 1GSMA 2GQHA 5EUKB 4Y2DA 2CR3A 5AZEL 1R3LB 2Y07H 5E8PA 4KK8C 5D1QE 3FQUA 3RUGF 5FM5O 3NJVA 4HSAC 2WXQA 3IDIB 5CNHA 3B7UX 5A16A 1K5NB 1L9QA 4A2EA 1JUFA 4MMZB 1FYTE 4JQXC 4DUWA 4G8GD 1I1AB 4HA1A 4RMRA 3H6AA 2OM5A 4C83A 4PS7A 3SDDC 4LSPL 4Z7QB 2WNWA 1E4KA 3MO1B 2P5EA 3TURA 1H5BA 4WDIB 3VGFA 1QWHA 4QTHA 4XBGB 1OF2A 2XPZA 3TIEB 5CS7A 3FOLB 2AV1B 4AJWA 4UDUB 4GG8A 4QY8A 4PS8A 1O5DT 3RVWC 4UT7H 2P5WD 3F84A 1YY9D 3L4TA 5MERA 4ZW3A 2W9DH 3INUL 4F3FA 2AJUH 1QP1A 4WV1C 2F1BA 5KG9B 4L5FE 3N85L 1KBPA 5DQ9B 1H3PL 4YSTA 5DJ2B 4ZPVA 3CDCA 2YPLE 3BKML 1AO7E 2CIIB 2CRZA 1GRWA 3QCTH 5F1KC 2Q8AH 3ZTJG 5LNEA 3VFOA 5D7KD 4KI5C 5E8DL 2E47A 3FH8A 5GJTL 3E9UA 1MHPH 5GZND 1W91A 4L3CB 4QOKA 5FYKU 3CH1B 2BC4A 3CFKB 4K07A 2H26B 1SHXA 2J6EL 5TK4A 4HBCH 1KXTA 2YD3A 2PP8A 5I1GL 5CSGA 4POZD 4X0KB 2E59A 2KLTA 2Q5BA 3PWLA 4JY6A 1OIOA 1TQTA 1YN7A 3FSVA 5CAYB 4EF3A 1OVZA 3G6JA 1A4BA 4NBYB 5AOZA 4AMWA 1U8NA 5A2LH 3IJHA 4ZOBA 2J8OA 1ZGLM 4YLBA 4RGOH 1YQ2A 1X6NA 2VDKH 3MLVH 3OD3A 4X6CB 4ZUWA 2VDOL 6TAAA 3X17A 4NS0A 5EUKA 3VSTA 3R7RA 1R3LA 4TUKL 3MJ8A 4M8UA 1MCBA 4H20H 3IDIA 1MNUL 2BERA 4TQEH 4QXVA 2OTUA 3KLLA 1K5NA 5J11B 5C7XH 4MMZA 2IAMC 3T2OA 2BJMH 3WFCL 2EEXA 1I1AA 4NP9A 1KFGA 5B8CC 3EJRA 5D2LE 4LVNC 4E5XG 3GSOB 3MO1A 1FI8C 2WKLA 3NA9H 5HDBE 5EEXA 1KGJA 4WDIA 3QDAA 3ZJAA 5TGBB 1DSWA 3OAUL 4N2CA 5DUJA 5HGGS 3RNKB 1KULA 1DBML 5DR5H 4QLRA 3TIEA 4OQTA 4RA3A 3V4VB 3VCLB 2NNRA 4L37A 2AV1A 4QF1B 3IMWA 4I18A 2LLNA 3WD5L 1ILSA 1U58B 3U7WL 4N6QA 5D8JL 2WBKA 3MPCA 2EC9U 4KKPA 2HFGL 2R29L 4N0FB 2R0LH 1Z0MA 1BCIA 1P4BL 1VSCA 1IKFL 4OF0A 1PAZA 5KANG 5KG9A 1YNTF 2CBMA 4KKAD 5MEOB 2Q86B 3TZVD 1QFUL 3VFSB 5E2UL 2F53E 2YRPA 3UTPE 3IAPA 1II4E 2WSKA 3FQTB 1VADB 1T5WB 3HZYA 4L3CA 3ZDXE 1GYAA 3CH1A 5CILH 4OD1L 3CCHB 1WCQA 5E1QA 3CFKA 4BA0A 5JA9A 2H26A 3NEEA 4XXWA 3P11L 4G7RB 3OX8A 5FUCE 1I8MB 3BUPA 1JMXA 2V5TA 3MREB 5DGRA 3V0VB 4X0KA 4XPBL 4ZTPL 3ARDA 4JFDE 1BZEA 2NY3C 3SDYL 1RSFA 5ISZE 3U0PB 4FCHA 3B43A 3OSVA 1P5VA 1WEJH 3QHTC 4LNRB 3GXUB 2WWOA 1YPZF 3GM0A 1JZ2A 4D0CB 3CLEL 4B9PA 4X6CA 3EJUA 3HFML 5K9QG 3G6AB 3IMRA 4U33A 4WENB 5I6MA 4FQXD 3OXRB 1E4WH 2WXIA 1MFVA 1J0IA 3LS4H 4YBLB 4FQIL 3VG0H 3WNLA 2OZ4H 4N8UA 4ZNCD 3FN3A 1O0VA 3F64A 1DQLH 3L17A 2HRPL 5CKAA 3C60C 4F20A 1N8ZA 2EVJA 3T3PB 3VD2A 2KHAA 4JFFE 4LSQH 2H47C 5D4JA 5I0WA 2VDLL 4DO5A 1UC6A 5I71B 4MA7H 1ITCA 5SWZB 5IQ7H 5CR1A 3CDGB 3QZOA 3MFGB 5G4MA 5ABDE 2BNRD 1MRFL 3GSOA 5EBWB 1AKJA 4FCAA 4NX0A 3V4VA 2QKSA 2CE6A 1V10A 3VCLA 3H42H 4MZ2A 2F15A 1ZE3H 2N7SA 3LQAL 3UXFA 4EIZC 1Q1JL 3ARSA 4GW5B 1U58A 1KJ3H 4U1NB 5BO1H 2DM2A 4HQQH 3GXIA 5DEGA 3T6WA 1FFRA 1MCWM 2JB5L 1E9QB 4W9FC 2HN7A 4HZAA 3CZNA 2PP7A 1SY6L 3H55A 3L95A 1I4FB 2Q86A 2YJLA 5ESVA 3ALPA 2J43A 1EHNA 3HZVB 1AFVL 3BMWA 4R7VA 4YDKL 1JTTA 1OAZL 2AEWA 2QDWA 3TT3L 1T5WA 4M7LL 3CC5B 1R5WA 2QKIB 3CCHA 2VDQL 3W9EB 3DGDA 1NEPA 4HHGA 3ZUNC 1I8MA 1FF5A 2IDSA 2A9BA 4WF7A 3MREA 5A3ID 2VM3A 3V0VA 1WE5A 3OKMB 4UTBH 4ACPA 4WEBH 1BAWA 3U0PA 4CU6A 2FEEL 2H45A 1D6VH 2WNKA 2CHZA 5HHPB 4F33B 4QYAA 2E7HA 2VUYA 2ZWYA 4WGWB 4D0CA 3DECA 3FU0A 3KEHA 1EZVX 4G9FB 5I8CA 4DOHE 4O2FB 4RISL 3G6AA 3T0AA 2UZIL 3OXRA 4G9DB 3IWVA 4JO4L 4LSTH 5CJ5A 1XMWA 2G5BB 3ZXAC 1PVHA 1ZTXE 1EAJA 4JDTL 2VM4A 3POCA 3TJHD 1OAQL 3NCFB 4LCIH 3D39E 5CJ8A 1UJ3C 4Y4HB 3MLSH 3EO0B 3U4EB 1E40A 1U3NA 2DJSA 2ZSVB 4I88A 5SWZA 5DO2C 3UERA 4NZTH 2Z92A 3CDGA 4ODWB 3SBQA 3HZMB 3IXTA 3ZRSA 2DV6A 4TMPA 5E1HB 3A67L 2CAKA 5EBWA 2B16A 3P2BA 1XD1A 3E9TA 4JM2F 2ZP8A 3PQYB 1I1FB 3QNZB 4HT1H 2Z8RA 4CILA 4LP5A 1F2QA 2IPTL 4GBXC 4YL4A 3WJLA 5F44A 3BVDB 4GW5A 5ENWB 4U1NA 1HDMB 1NGQH 3RIKA 5I1IL 4U0RB 4PJ8D 5D1ZB 1UB6B 5AAWA 1N26A 2G60L 4QRPB 2C9VA 1AD9B 1E9QA 4K55A 2FGWH 4CC0A 4LPWA 4UT6A 4MJ4A 4PJHF 1D5IH 4N2KA 1I4FA 4M6ML 3R8QA 4PD4J 1JFQL 2EICA 4JHWH 2JKXA 5B3SB 3KYAA 1DJXA 3C9NA 1HSBB 3WN5C 4XP6H 3S2CA 1Y0LB 2P48B 4MQTB 2HMID 1ULVA 3CXHJ 4N90D 1Q9KA 4LPTA 1FYTD 2BMKA 3IDGB 1VFBA 2E9BA 2QKIA 1A7QH 3K6DA 4OZ4B 2O6CA 1HIML 2RJMA 3I02B 4R4BB 4CMHB 4YIQB 4ATTA 4XN8A 3KCWA 3B3BA 4WVRA 1HS6A 2I7OA 4IKKA 1GJIA 4U49A 5D2NA 5DVMA 4ZZFA 5FUOL 1F00I 4Z7OB 5MI0C 3RL2B 1ZA3B 2J56A 4HLZG 3TO2B 4OCXH 1KZQA 4YXHH 3O81A 5HHPA 4WUUD 1Y07A 3RAJL 3VXSE 4F33A 3C5JA 4PLOB 5DEJA 2QLYA 4JFOB 3QRGH 4G9FA 1M3IA 3V0EA 1OAJA 2W9EH 3VA6A 5CU9A 5GGVL 5LBSH 4I9WE 5C0CD 1J10A 3RU8L 2PPCA 4I3RL 5JW4R 2G5BA 5F3BB 1OCRB 1A7NH 1GGYA 1YECH 1MFCH 1L9NA 4Y4HA 3FB5B 5F7NC 2ARJB 3EO0A 3U4EA 4HFWB 1MQKH 2ZSVA 2FE0A 2ZYHA 4KVNL 5B1JA 1J1OH 4ODWA 2A6IB 5K69A 4FKHA 2FUQA 3HZMA 1WA0X 4AQ1C 2NQCA 2F5BL 2GJZB 2NSMA 1J0ZA 1EGJL 1WRFA 2Z4QB 2DIEA 3N42B 2F08A 3QNZA 1I1FA 2MCPH 4DPRA 1RJYB 4AWJC 2Q20A 3GLAA 4HJIA 5SX5H 2DBJA 2FX9L 1J0HA 1WAAA 2AP2A 3ZTDC 5DFTA 1UB6A 1I7RB 1I9RH 3HI5H 4NJ9L 4Q2ZA 2HT4C 3CFEB 4QRPA 4ENZA 1CMOA 4X9GA 4YHZL 3I6SA 4XVTH 4LEOB 1BG9A 2Y07L 4NQDE 2BSEA 3MX0A 3J07A 4UOZA 4HPYL 2P8LB 5EOQL 3SODB 4X6FA 4JZJC 4XVJL 2OMVB 1HSBA 3AGWA 2CU9A 3VWJC 1Y0LA 3HAEA 1FFOB 3FH5A 3M45A 2F8IA 5GGVY 4YWGH 5IVXA 3IDGA 4X80H 1IJ9A 3I02A 4R4BA 5I8EB 5HY9B 4YIQA 4PJIF 4OJFL 1DVXA 1F3RB 1L0XA 4HPHA 2ZUQB 2APVA 2IF7A 1VDGA 4KITB 1Z66A 3RL2A 3QQDB 1TR7A 2XN2A 3TO2A 4TVSa 4HOXA 2OSLB 5HGAB 3IYLW 2VQTA 3HS0C 5D4HA 3CMGA 3LXAA 3ZTNL 3A4EA 3ZRFC 5IHBA 1FE8L 2W9DL 3L1OL 1EO5A 5I26A 4FQPA 4KI5E 3HE7C 4HIQA 5DQJB 3ZIYA 5F3BA 4FFYA 4M5YH 4MA1B 1ZIAA 2AMGA 1QNIA 4LHUD 2Q8AL 4I0PB 3U79A 2DQ6A 3FB5A 5HHOB 2ARJA 5JPNC 3CN3A 4RRPA 2V8LA 1F4YL 1CF8L 2B59B 3VFRB 4H26B 2E6QA 2WBJC 5CBEB 2Y7LA 3FQXB 1N7ML 4A7VA 3ABKB 3BP6B 2GJZA 3DYMA 2GTWB 5C07B 1NFKA 2Z4QA 5IW1B 4FADA 3TWCL 5F1NB 2V7NB 4V33A 5ECJE 4G5ZH 4JFDD 3E38A 1LP9A 1ZK9A 2VISB 3K5RA 4OF8A 2R56L 3WXWH 5ISZD 1G1KA 1RJYA 1H8LA 4J5VA 2A1WH 3JT2A 4B9KC 1DQDL 1NCWL 3DX7B 3NAAH 4RGOL 5ACZB 4ABUA 4HF5L 3RGVB 2XN0A 3CFEA 1FG2B 2VQ4A 2QHRL 3TLRA 4LEOA 1OZUA 3AW5A 4JZOA 5IEHA 2FR4B 4NLHA 3VFTB 4PJDE 3ZQXA 1BM3H 3B7RL 2P8LA 4PJ5B 3VACA 2N3JA 4N86A 2M83A 4K0OA 3ZYJA 2OMVA 4P9HL 1UFGA 2FB4H 1TFHA 4KO5A 1P4LB 4JFFD 5KUKA 5D7LE 1FFOA 2KLSA 3SDAD 4QXUL 1XQ4A 1W2KT 2ZG1A 2VDRL 5HY9A 5I8EA 1MW1A 4YDLC 1ZLVH 3X13B 2IANB 4H8WH 1MJ7L 1L7IH 5JNYB 2VL4A 3BH4A 2UWEB 5KBKA 3MRLB 2R4SL 3RY6C 5F7HA 2G2PA 4X7SH 5IROD 1Z9OA 4LEBA 4GG6F 2OSLA 2BIHA 3NIFB 4JHZA 5HGAA 2BCMA 3SPVA 2V2WA 3W81A 1NCIA 1EHKB 2C3XA 4OY9A 3W0WE