2VO8A

Cohesin module from clostridium perfringens atcc13124 family 33 glycoside hydrolase.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
135
structure length
135
Chain Sequence
b'TTVGNSTIKVNDEVQVGSAFEAILGIEGLNGDTEVYSAEYLFEYNAEAFILNEITSFNDSLFVKSKEVEPGKVRILVASLGNEIEKDSDLVKVNLTPKISSELEVLGLTTALVGAGDGNTHDLELSSKEVKINEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EXO-ALPHA-SIALIDASE
publication title Structural Basis of Clostridium Perfringens Toxin Complex Formation.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
total genus 31
structure length 135
sequence length 135
ec nomenclature ec 3.2.1.-:
pdb deposition date 2008-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2vo8A00
3KCPA 1TYJA 1OHZA 3UL4A 4U3SA 2CCLA 4FL4B 4UYQA 4WI0A 3FNKA 3F2LA 4FL4C 2XDHA 4WKZB 4IU3A 1QZNA 2JH2A 1ZV9A 2OZNA 1ANUA 5G5DA 4UMSA 1G1KA 2VN5A 2VN6A 2O4EA 3KCPB 2VO8A 2W1NA 2ZF9A 5LXVA 3L8QA 2B59A 2Y3NA 4N2OA 5AOZA 4DH2A 3BWZA 5K39A 4IU2A 1AOHA 2BM3A 4UYPA 3GHPA
chains in the Genus database with same CATH superfamily
2H0EA 5GHWH 1NCCL 1XAUA 4U3HA 1R5IA 4GBXA 4TSCH 2EH8L 3L9RA 4HIHB 4ZW3A 1FL5A 3GMRA 4DPBX 1W72L 2YEZA 3EDJA 1QX1A 3ULUE 2QSCH 3ZE1B 4KI1A 4Y19B 3CN3A 4HKBB 4U1IA 1QVOA 1ITCA 5DDHA 4XNMB 2X9YA 2F9BT 4QIRA 3LN9A 5J6SA 5GS0D 2KPWA 1EO8H 4HCRL 4MA7L 4S0TD 2DM3A 5FYLE 4KZEH 1XGUA 4AE0A 4XHJC 3HFMH 5FFLA 3UX9B 4JREC 2X0WA 5ISZA 4OZFH 4YDJB 3HB3D 1U30A 1IILE 2CLZB 3MMEB 3UO1L 5C0GB 1QR1A 2GCYB 3LZQA 3EOAB 1MIEH 4KX7A 4WI0A 4FG6D 2GG1A 3SN6N 2ADJA 2RACA 4OZIE 3W0WE 2HXAA 1KIRA 1IQDB 4PGDA 3VNZA 4DW2L 1DR9A 1E2ZA 2NTSP 3JV6B 4K07A 3HE7C 4NPJA 3FTYA 4E5XB 4UIMA 5IWLC 2OK0H 4P3DA 1B90A 4JMXA 4ZQKB 1G7QA 3PABA 3F85A 1FFQA 2VW7A 4LVEA 2FEDD 5F7KC 3SCMA 3VWJA 3L8QA 3PNRB 4P48A 1AGBB 1EZUA 3U36B 3V0JA 3U4AA 4MA8H 4JCMA 2DPKA 1OCOB 4MDJA 3PDGA 5JNYB 1WGVA 1I85A 1ZV2A 5TGBA 3VYPA 2A9AA 1VGKA 5J4MA 3NSCA 4XBEL 4DP6X 2F6AA 3ZTNL 4LDLB 3IMBA 3IDNB 4MKMA 5I1LA 4AQZA 2ZWLT 1NCBL 3M1CA 4WU7A 1MZYA 2E7MA 4BFOA 2BCKB 5D2NC 5KSVB 3QIUD 4YLCA 3SKUD 2PWHA 2QMKA 2IH9A 2YPLE 1BJ1H 3GK8H 2AJSH 5AVSB 1CO1A 4X6CA 1J87A 1NGWB 2VR8A 4QHNB 4BE6A 2ZUTA 4X4ZA 5L4FA 1F41A 3I3DA 3G6JA 2WYHA 3QH3A 1YYML 1MLBB 2ZUWA 2QHRH 2KT6A 1KV7A 5E1AB 4UYQA 4JFOB 2Q8AL 4Y4FC 3I02A 3QXDB 5SX5K 2X4NA 3PU7A 2YWZA 1U8PA 1J9QA 4HKXA 2CO1A 1BD2A 1MEXL 1B0WA 1L9RA 2P8PB 1C5DB 2I27N 1N5YL 1FO0L 2G9HA 2GJ6D 1VFAB 3NIGE 3MCG1 3QUZB 5I1AB 1ED3A 1CDHA 3OKMA 1TUPA 2YBRB 1SHSA 4FS0A 5IF0A 3BKJH 1LNUB 5IM7B 3WUWB 5B8CC 4LVNC 2KH2B 3SGKC 3KGSA 4DZ8B 4QF1B 4GW4B 1NDMB 1FYTA 1I3VA 5FUOH 3AREB 4NKMB 3MJ9A 4BFEA 3BGAA 3RTLA 1IGCH 2J88H 3QUXB 4BKLB 2CO6B 3TEWA 3UBFA 4DEPB 4IIQA 5SWZE 1P0SE 4TNVK 5B38B 4E9RA 1SYSB 4PLOB 1T22B 1Z9OA 3EBHA 2LAAA 2BP0A 3GS0A 4WKZA 4XP5L 2O93L 1P5VB 1DN2A 1L9PA 1XF5A 2NZ9C 4DPCX 3C09B 5TD4A 4CU7A 3C08H 4KXDA 1NCGA 2FUTA 1KACB 4HS3B 4K9EL 4YL4A 5LJYH 2VUKA 2GT9B 5DUMH 4ODXB 1XGPB 2X70A 3KPRE 5DZLA 3G6DL 4GRMB 3MLWH 1F4AA 1R3LB 3BP5A 1PIGA 1W16A 3KJ6L 5I1KL 1TEFA 4S1RL 3U9UB 3RY4A 3NJXA 1HINH 3NK4A 2ZG2A 3ZL4L 1IJNA 3D39E 3O3EA 3OJDB 4X9GA 2L7QA 1HILB 2IGLA 3NRQA 3BWUC 4XPHL 1B0GB 4Y4HC 1ZVSB 4YE4L 1HZHH 5J0BA 5KSBE 1C8QA 2ICWA 1ZSDA 5CHNA 5B22A 4HPOH 1KTBA 4XNUL 2A5UA 4KKZA 3CN0A 1WIPA 5MEPB 1P1VA 3MLSL 3N9GL 5IMMA 1QRND 3HLKA 3V9CA 3TESA 4JFED 5LGJB 4MXWH 5EWIL 1HHKA 3B8SA 4GAYB 5FWRA 4XOEA 2GBVA 1M7IB 4LFHG 4YDVA 3KR3H 2LHAA 4TL4A 4CKQA 2GFBB 3IDJB 1YMMA 3FT1A 1COBA 3HB3C 4WCYL 1KJ2A 3MODL 4XB7A 5HYJE 4R83A 3BQUD 1FZOB 3VWKA 5H35B 3IAQA 3KM1A 4UNUA 2Z34A 2EEAA 1D5BA 2B2XL 3PAVA 4XX1G 5IESL 4EAEA 1U3HB 1BFTA 8FABA 3GHPA 5KYWB 2BRQA 2FEDC 2IXQA 3C2AL 1DVFD 1WUZA 1AXSB 3GTVA 4X5XA 5F88A 2IWFA 4G82A 4L1DA 2TSAA 1XBDA 3V6OE 1HZKA 4R90L 4Z78B 2VXQA 2QSVA 4HIQA 5CMAB 1RJLB 1VJSA 3F58L 3MV7E 2VLJA 4D94A 1CE1H 4L3ED 3VXTA 3K6OA 2A73A 4R8WH 5JOEA 2JCWA 1WZMA 4GKZA 4I3RH 2DKUA 5JIIA 1TVBB 3MQIA 1EGJH 4KK5D 2NY1B 4G1EA 1U8LB 1DTUA 3QIUC 1X5YA 4GRLA 4P2RE 1UGNA 4PJ8B 2GUYA 1NH6A 4RDQG 1SBSH 5IQOA 2NTFA 1YPZF 5E1HB 4N8CH 5AKVA 3IFLL 1SXZA 5DO2C 3DGCR 1XCWA 4TSAL 4XMTA 3T4AC 4GKNA 4JRFA 1HQ4A 2DJ4A 4MQ7A 3X14A 2G60L 4U1LA 3TTYA 4OZGB 4MLSA 3JQOB 4H8WH 1N9PA 2AJ3A 2NXZD 4PI0A 4TUKH 5TQ0L 4LVOB 4WTXA 3RA7L 4GFXA 3MLPA 3KH3A 1CD8A 3JV5A 4DN4L 4H1LA 4IRZA 4UINH 5HPMA 5CU9A 4CGUB 2NNAB 4TSBH 3Q8CA 3ULSA 4YDLB 1NANH 2D73A 4Z7OF 4MDIA 3BLPX 4CVWA 3EFFB 2YK1H 3VD5A 3WLBB 5CN3A 1EQWA 3ARRA 1GYWA 1HQRA 1OK0A 3WNJA 2YGQA 2VRKA 2IPTH 1UM5L 3REVA 4BQ9A 2JKIS 1G7HA 4MVBC 3KPQA 2Z7YA 4ICWA 2E9JA 5AVTB 1LO3H 1BF8A 2BCMA 1KIPA 1NBVL 4DAGL 3RHWF 1M56B 1DN0B 1P6WA 3TNMA 3BP6B 3FO0L 2Y3AA 1XGTA 1I1AD 1I1YA 1JZ8A 5SV3A 1K5WA 4XAKD 3F7VA 1M1XB 2O5ZH 3H2QA 3ILQD 2PP7A 4XCFH 3GXIA 1CDYA 5T1LA 4HIEB 2JKSA 5JDJA 2NUPA 4R0LA 2JI3A 3NACL 5AW8B 2E9IA 5CU5A 3G5YA 1KBGL 4I3SH 4ZO7A 5KS9E 4M5YH 4AK2A 3KW8A 2YN3A 3B2UC 3TN0B 3ZYIA 4GMSH 3ARVA 1H6UA 1F8TL 2GHZA 4W6WB 5T3ZH 4AENB 1AH1A 1E4XH 5C0CB 4HXAH 2CNYA 5E23A 3RY6C 4E9TA 1TITA 1SF3A 3FQXA 5HJ3A 5CN2A 3RWCB 4LOUD 3HC2A 3FQRA 4MMXC 1DBKL 4JN2B 2AXJA 3NQKA 4P5SA 4RSVA 4WI4A 3OBAA 4OLUL 3SKJL 3R7RA 1IVLA 3WIAA 1OXYA 5C0BE 2R0LH 4NBYB 4WGWB 1LILA 5ALBL 3VFUA 5FC9A 4YHYC 4WU5A 5HHMD 4Y9FA 3QI9D 3GXUB 2OYPA 3BVUA 5EC1B 5LBSA 4MZ2A 4JKPL 4KI5C 3Q3GA 4WUUE 2BNUB 3R1GH 5JR1H 4GW1A 2R51A 4ABVA 2VM9A 2CBPA 1HHIB 2IG2H 3BQUC 4XCNB 1EFXB 5AKRA 2K0RA 1G7IB 3MCKA 5GHWL 3IMSA 1LO4H 3HLAA 5AW9B 3V7MA 4TSCL 3VI4A 2Z1PA 3WHE0 5E0QA 4PYHA 3UZQB 3QQDB 1BVLB 4R4BA 4HEPA 4FEIA 2QSCL 3GDCA 1IAKA 1F6AA 2KI6A 4IS6A 4BDVB 1TVDA 1KJMB 1QOKA 2FGWL 1SY6A 1T4KA 5SV4A 1WYJA 3MBWB 5B39A 1EO8L 1TTBA 2J8UB 2LLGA 3GIVA 5I24A 1R5IB 2C34A 2D4FA 4KZEL 4TKWA 3HFML 3L9RB 1FL5B 3GMRB 5CZKA 3H3PH 2UVFA 1R3HB 1Z7JA 2PXYA 1MIEL 2Y1ZA 4U1IB 1QVOB 1OT4A 2DH3A 3SHSA 2QPSA 2EYSA 2PPDA 4X99A 4ZUWA 4OR1A 3BOVA 1O7DC 1AXTH 2OK0L 1XGUB 1OPOA 2EIKB 4JZJA 4P5KA 2GVYA 3CH1A 4IRSA 5DYOB 1MY5A 1TQBC 3C60B 3RFRA 1DO5A 1KEMH 3FK3A 3PWPD 4K94H 4TTDC 1QR1B 4MA8L 1MCNA 3QZNA 4R5TA 2G5BA 3ZTCC 1IL1A 4RMQA 2ADJB 1C5CH 4QO1A 4M1CD 4NX0A 2DS4A 1KIRB 4P3CH 4C8XA 2LU7A 1YZZA 3L5WB 5AZUA 1GGTA 2AQ1A 3DURA 3F12B 4UIMB 4P3DB 4CC4A 4YSEA 3ZRFC 1G7QB 2J20A 3SCMB 3D07A 1ID2A 1G7JB 1C12A 3MRPA 3MJWA 5CSZA 1G9NC 4MDJB 3M8OH 1K5NA 2DLTA 4WIQA 1KBVA 3GK8L 2AJSL 1VGKB 2NMSA 5I74C 3FPXA 4LLYA 3EAKA 1GOGA 4N0FB 3ISYA 1G9HA 4R3SB 4UM9D 3WY1A 3QNFA 1CT8A 3JT2A 4MAYD 1DO6A 2ZJSH 5A6MA 3HA0A 3MOBH 4HIIB 4WU7B 2MQ3A 2WXQA 2Z31D 5AOKA 1E4KC 4FHKA 2QHRL 3U7AA 5HYSG 5E51A 3KG5A 1JGLH 1OTTC 2EDTA 1JTTA 3EGDA 1FG9C 1I1AC 4PJAA 1KMGA 4WQOA 1QSED 4LLDB 1GIGH 1WICA 4QOKE 5EBWA 5CLZA 4R2GC 2DQDH 1N3NA 3CLFH 3REWA 3NRFA 4JMNA 1J0IA 3QIBD 3I02B 1XGZA 2K4AA 1BX2A 1O6SB 3BKJL 2X4NB 2EYTA 4NQEE 4W9DC 3FCBA 3RPBA 3ZZQA 1R0AH 1BD2B 4AVKA 1DQLH 2ZTBA 4WK2B 3RZWA 1NIEA 2G9HB 3P69A 1IGMH 4J3BA 2O5NA 3V7AG 5FUOL 1DJSA 4L1BA 4XT1C 2X4UA 2YUXA 1IGCL 4EQ3A 1ED3B 4B5EA 2J88L 4KC3B 2OMYB 3EJPA 3SE3C 3RZCD 4KPHH 1CF8H 5IF0B 3BGMB 1DYZA 1IGYA 3E9TA 5T3ZE 5JOFA 4B9IA 1HHGA 1UD6A 2JQMA 4KKBC 3C08L 4IBWA 3SE4C 1U6AH 1HYSC 2X9ZA 4P5TD 5DUML 3ZZ1A 4BJLA 2W92A 3MLWL 4ORGB 3DX9A 2FL5A 3GSWA 1HINL 4WKZB 4MZRA 2BP0B 3L6FA 1RJZA 4XODA 2C3VB 2CJTA 2Q2EB 3M07A 3SPIA 3B8YA 1WT5C 3VFGH 1NFAA 1SVBA 1I8LA 2C7UA 4I9WD 4AZ8A 1HZHL 5MHSD 3JTSA 2FLBT 4NRXA 5C08D 5C0ND 2X70B 4HPOL 4HFWB 3WFBL 1IC4H 1C7SA 1KZYA 3BP5B 2QPDB 4K9JA 4NKDA 2N7BA 5KOVC 5HDBF 1J8HB 1TTGA 3BSHA 1EV2E 2COQA 3QQ9C 1F45A 2OQJA 4K3DH 4MXWL 4NB7A 4F3FB 1GGBH 2MCPH 3ZO0A 1BVZA 2HG5B 1JI2A 3KR3L 2MOQA 3WO4C 4U1KB 3OV6A 4KU1A 4Z7UE 4BWTA 1ZSDB 3OVUB 4P57A 2GAZB 3Q43A 3US9A 4XXCC 1ESOA 3VD4A 2WOBA 3LVEA 1SJHA 1ZLSH 3VH8A 3INOA 4FHJA 3BPCA 4NAQA 4I2XB 3AM8C 5IP4A 1OP3H 1ZLVH 1E65A 4J3OG 1KJ2B 1XF3B 3GMQB 3QDJE 2WBJB 1X5MA 4WNSA 2FHBA 3AS2A 3QQNA 1LWRA 3VWKB 1U2YA 3K4AA 3CJJA 4NOBA 4WI7A 5EU6E 3GBEA 4FXKA 4RBPH 3MV9A 2FJUB 4ZSOB 1A66A 1CE1L 2Y6TE 4LEOB 8CGTA 3K8MA 1UXMA 4R8WL 8FABB 2ZD0A 4I3RL 5AG9A 4FNTA 1BZ7B 1EGJL 3ZKMD 2IXQB 3CZSA 3QUYA 4JFFE 5D8JH 4MNHA 3M7OA 5F88B 3T3PF 3WE6A 1FG2B 4OV5B 1SBSL 3Q5YA 4IK6A 1LM8V 1T7WA 4PRHA 1OK8A 2XIIA 1IV8A 4N8CL 4LSPH 4PJBA 2R1YA 2CGZA 5KSAA 3WNIA 3U30B 2BY0A 1U8OA 4IHOA 4GKZB 4N86A 5ES4B 2CPUA 4Y9GA 4G1EB 4HUVA 4GRLB 4TUKL 4JQIA 3X1GA 4IEFA 1WP6A 3K7UA 2PTTA 4TXVB 3ZMNA 1M7DA 3PP3K 4O9HH 2FAUA 4UINL 1KXQA 4V1DB 1F2XK 4YFEA 3IMTA 1HQ4B 4WFEE 4J3VA 4IQHA 3S48A 1MFMA 2BSEA 3APMA 3EKCA 4TSBL 4AI7A 2TSBA 2WAQA 3CZFA 2AJ3B 2YK1L 3ZMRA 1K4CB 4BM7A 4M7ZC 5E0FA 3IDXH 3KWWA 2ZPKH 2IPTL 5AVRB 5CIPH 3B2XA 5E9DD 2GTZA 5CZXC 2XACC 2BNRA 4X7FC 1LO3L 4PJHE 4H8WC 3KBHE 1M05B 2CRMA 5FYJD 3QBTB 3UADA 1A6WL 2Z9TA 3JVGC 1MZZA 4JKLA 1IBHA 3ULSB 4AGQA 4RAUB 1CUOA 1PS3A 4WV1C 1BQHG 5C0AB 3DPBB 1HQRB 3AY4C 4JFHE 3EBGA 1G7HB 2YO3A 3F5WA 3FU8A 5HGBA 2F5AH 3LNGA 1Q72H 4HX1A 4XCFL 2X44D 5D1XD 3SGEI 1FN4A 4LHUG 4DIXA 4I3SL 4IKJA 2A6IA 2WN3A 4FI7A 2R0ZH 4HZLB 4M5YL 1XGTB 3CC1A 1I1YB 5BVJA 2W91A 1H3PH 4G6MH 4GMSL 4JG5A 5T3ZL 2VM3A 3TH4T 4ONFH 1E4XL 3F7VB 4HXAL 4HA1A 5IVXA 3MLTA 2YEQA 2W60A 3D87B 2NUPB 1P4UA 3BCDA 2RD0A 4QXTA 3G5YB 3EF4A 3L3DA 5FLUA 1Q0XH 3WIFB 1JV2A 3CHQA 4N5EC 1UA7A 3MLUH 3TASA 2R0LL 3IJSA 4MHHG 2ZONA 2C9RA 3FNKA 3IJ9A 5FOBA 1LMIA 1T2QH 3H3KA 1EPFA 3LDBC 3FO2A 3VXSA 3PXLA 2KZ1B 2OYLA 3D2UA 2X4PB 4EN3D 3QYCA 2J71A 2VLRD 3CDFA 5AKSA 2DWSA 2J44A 3IWUA 2QKSA 3FQRB 4PS3A 4ZI8A 3HNSH 3R1GL 3S2AA 5JR1L 1Z2KA 1U8NA 1NMBH 2WUBH 2XFXA 2KMWA 3VXMA 4B9KC 5IW6A 3OXSA 2IG2L 3VFPB 2QTEA 4HJUA 4YGAB 1HAWA 1LO4L 4M61A 1G94A 1ZRUA 2X4QA 3VFUB 2H1PH 2GPZA 3IS0X 4A7TA 2NX5A 2YAEA 1CFTB 4QRFA 1OAQH 3Q3GB 1E5ZA 3GSRB 1S5IH 5EA0H 4HAKA 3VFWA 5C07B 5I1HH 5DHEA 2AQTA 1G7PA 2G4GA 3MCKB 4K7PH 2HJLA 1SQMA 4KO6A 4YDIH 4GG6F 1W91A 4V11A 3VI4B 3L1OH 5E6IB 3H3PL 4R4BB 2PN5A 3RUGF 5IIEB 4PGBB 1IAKB 1F6AB 3BZ4A 4IMKA 4FLRA 2F2HA 2ITDB 4GNKB 3P2DA 1T4KB 2BH0A 2YAFA 1WZLA 5DQ9B 5BRZE 5I17A 1KTLB 3HS0B 1AXTL 3PAYA 4MYWB 1TTAA 3AAZA 3T2NH 3ZDZF 2Y72A 2DMGA 1O7VA 2FSEA 4QHMA 5DS1A 1KEML 5I8CA 4K94L 2ZYSA 4FQQB 4ZMQA 1OTUD 2PWEA 1T5WB 4J3OF 2WZ5A 4FFZH 2DMCA 3BFQG 3EBAA 4OZHF 2EYSB 3AMLA 1C5CL 3KCWA 3VD0A 4X99B 4HWZB 4P3CL 5HGDB 2WNGA 2OP4H 1VACB 4BEIA 4P5KB 4JZJB 3CFKA 3ARBD 1A1MB 1AJ7H 2OXHA 1RIHH 1XDTT 4WDIA 5DFVD 3DX1A 3KL3A 4L4VE 3M8OL 3GSUB 1EH9A 2G5BB 3ZY7A 2DIBA 1IL1B 1EUTA 5LUMA 2LABA 3BAJA 4WWID 2C4FU 2P5WA 2MWCA 3DURB 2A83A 2ZJSL 4UOJA 3KXFE 3MOBL 1MCWW 3CFEB 1EANA 1S46A 5AVQB 1RI8A 3L7EB 1C12B 3FUJA 1JGLL 3BEWA 4QTHA 5LAXA 1K5NB 3HJ0A 1W2KT 2BIQA 4JDZA 3JTTB 4NQTA 2BSDA 1KLUA 4LLYB 5LQBH 3N3EA 3WMQA 5IOPB 2EDOA 4XOAA 1A21A 1WCBA 1AKJA 4K3EH 1GIGL 4JGNA 1PEZA 4ZUVA 4NI6A 2WN2A 2DQDL 1ZE3H 5D1XC 2DYSB 3CLFL 3KL5A 5HDWA 1ZGLM 4F7CA 4OFYD 4N0CC 3TT1H 1THCA 3X1EA 3EGDB 4Z3HA 2OCJA 3QFDA 4QY8A 1R0AL 3SDAA 4GI9A 3HR5A 1DQLL 2GEQA 3QCTH 1IGML 5EN2B 2YEVB 1R34A 3QHZH 1D9KA 3KPOB 3QNYA 3MUJA 3ZW3A 1N3NB 2APXA 4Y2DD 4B9ZA 4KPHL 4WHTA 1CF8L 1Z5LA 2J43A 2ADFH 2BC4B 3P3SA 2AJXH 1DJIA 1BX2B 5DZAA 2EYTB 3II3A 3KDMA 4G8GA 4PLJD 1MHHB 2X6AA 5BXFA 2WCSA 2CIKA 1U6AL 3QORB 1RY7B 2V2WA 2X4UB 2ZOTA 3E6HA 3IGFA 5MENA 5CEZD 5F1KC 5BZDA 2MHAB 1F58H 1IGYB 1YEGH 2XIDA 3FC8A 3FAXA 2B3RA 1HHGB 3S96A 4NQVA 2YSSA 5KYUA 4G3YH 1CWVA 1R75A 4YBQD 3VFGL 4F20A 2ARJQ 1MRFH 5HYJB 5A2LH 1KFAH 2NQ3A 4F93B 2V7NA 3GXDA 4D3CH 2ZNWA 1IC4L 4K5NA 3FF7A 5B3JE 3EGSB 1UJ3C 2YA1A 5FGRA 3WNKA 3DNKA 1RHHA 3WTSA 1TTUA 5H37H 5ACMA 3GSWB 3VXOB 4MWFA 4OFKA 4K3DL 2FNBA 1X7QA 5IHZB 2Z92A 4ZW8A 3VX0A 1ZVNA 1GGBL 2MCPL 1EO7A 3WENA 4B9FA 1VSCA 3U0PB 5GGVH 4PJEE 4AZ8B 4LRIA 1KXTB 2C7UB 4LLUA 3UAJD 2RQEA 4FA8A 4JZOA 4NRXB 4PY8I 5EU4A 3NSYA 3OKLA 3F7YA 4U1HA 2CGYA 1VF5C 1CB4A 3X3FH 2EH7H 4J27A 1P5UB 4YDZA 2OQJB 3SQBB 3ZQXA 5ICZA 2DLGA 5KVEH 4QHLB 5I8OH 1YG9A 4KBPA 3VI3A 1M1SA 1ZLSL 3LN4A 4Q0XH 5D55A 2CGRH 3PIQB 3NEOA 4MRBA 3T6QC 3B6SA 2ZWKA 4O4YH 3RBGA 3TVMC 2BXZA 2WLKA 4P57B 3ZBMA 4F24A 1H6TA 4TQEH 2VLKE 2YGNA 3GZOA 5I1GH 3I84A 1IBBA 3QJXA 4ZTPH 2WZ6A 4AYEC 1QNZH 1OSZA 3ARBC 3A3YB 2R29A 5ESAB 5D8JL 4Z7VF 4O2FA 5AWNH 1EEZB 4I7ZC 3T0VA 4R5VA 4V2BA 3ISWA 4LSPL 4FKHA 1I82A 5TE4H 3VX1A 5C09A 1P7QA 4P2OA 4HPYH 4ZOEA 4W70A 2X6BA 4RDBA 1RXLA 3LN5B 2VAAA 5D1QD 5FCSH 4FJ6A 5IBUB 2A9DA 3O6MH 2AXFB 1MAMH 4MNHB 3SSGA 3WE6B 4QRPE 4JM2D 3WFCH 4IMLA 1AY1H 3WLWC 2NDGA 2D03H 4JRYA 3K1KC 4PJBB 2R1YB 4O9HL 3ZRCC 3O6KH 5CSBA 1UB5B 2D7QA 2AMUA 1U8OB 4LCIH 2JJVA 4R7NA 4UM8A 3P9LA 3FO9A 2PF6A 3FL7A 5E00B 1UB6A 4JHAH 2E6JA 2FHCA 2WB7A 3CLWA 5EORH 1HI6B 2BVTA 4HUVB 1XSKA 5KVMC 4ONHA 1OWRM 4IEFB 1AS6A 1GJUA 4KFZC 4OVUA 1OALA 3IDXL 5JMOC 2ZPKL 2PTTB 1ZHKA 2Q3AA 1M7DB 3HBPA 4PN6A 3EYSH 1USZA 3H6AA 1OAZH 1HC1A 3ZIMA 1A1OA 4MJ6B 5G2NA 1N68A 2MKWA 1DCLA 4GIAA 3N1FC 5ECJE 5GIRB 1MRCH 2ADIA 3QW9A 4Y2DC 5LO7A 3EF7A 1QFOA 3S36X 3KWWB 2JTDA 2ETWA 3E6FB 1BDYA 4JQVC 3S3CB 1AR1D 2F5AL 2WQ8A 1O5DT 2VW4A 1WPCA 2BNRB 4PIBA 1NCWH 1HJBC 1FJ1B 1WA1X 1BQRA 3S5ZA 4ZDHA 5KBMA 3ZDXB 2WLIB 1S7SB 4LQ1A 4JFDA 3ATEA 2R0ZL 3EHBB 5EO9A 3P3TA 4PEEA 4O00A 1H3PL 4G6ML 4JFTA 1ZT7A 1D6EA 4ONFL 3F5WB 4DEWA 2IANA 1SRDA 2V3DA 3FZUD 3S4SA 2Z1KA 3OC8A 4IGBA 4PB9H 5JHDA 4YBQC 4NZUH 4OJYA 2N3JA 2QADC 3ET9F 3HAEG 5SWSE 3HBQA 1UHVA 1TCMA 1Q0XL 4MB1A 5GS0H 4G9FD 1H19A 3MLUL 1PQZB 4BA0A 4YSTA 5AZ2H 3QDGE 4FQCH 4DCQA 2F53A 5HBBA 1T2QL 1AYOA 1PU0A 1XD0A 3STBA 1JGEA 4HHAB 3L3KA 1SF5A 4R7XA 4YQXH 5D7SH 1F4WH 2J3SA 2RCSH 5IVXB 3MLTB 2R1WB 5EFIA 1S9KC 3ZYOA 3UDWA 3VB8A 1KCVH 5DEGB 4RRPA 1Y1UA 3LXCA 3WAJA 1F11B 1PZDA 5I6NA 4OI7A 4QXTB 3LB6C 3HNSL 3VE0B 1D2PA 4Z76B 3U0WH 3EO9H 1NMBL 2WUBL 1WAAA 3MUY1 4LOVA 3IJSB 1MCOH 1LXMA 1S8DA 5FOBB 2V17H 2EIMB 4F7MA 3FO2B 5BO1H 4ZFQA 2HT3D 1E27B 5JIHA 2H1PL 4HOZA 3D2UB 4NFDA 3CFUA 4X6DE 2VZSA 1PLGH 3BVVA 3PXJA 1AZCA 1GZHA 3H54A 2AANA 1OAQL 1S5IL 5EA0L 5I1HL 2CBOA 2GSGB 5ANME 5L2KE 2F8OA 5TK4A 5F0JB 2XFXB 4J4PD 5GSRA 4P4KA 3OXSB 4OCLC 2BK8A 2HP4A 4MCNA 5L4IA 5KVEE 4K7PL 1RZGA 1V55B 2AKRA 1QABA 4M61B 4YDIL 4EVNA 5IFJB 1LO5A 4LNRA 1BAGA 2I7SA 3L1OL 2AK4D 1FNGA 2DIJA 5I8KH 2PPEA 3B9KD 3L4VA 2FECI 3H9HA 5D2LA 1RZ7H 2ZUUA 5C0RH 4Q8BA 2EABA 4V33A 6PAZA 2Y36H 3UEQA 4MXVE 3EIFA 5D2NE 4HALA 4YHIB 3IVKB 3RDTB 1G7PB 1QWUA 1ZGLA 4F27A 2HJLB 1A9EA 2WJ5A 3HG1B 1FAKT 5CBAA 3T2NL 2Y4SA 2G3MA 2P47B 3A23A 4NKOA 1DVZA 4I0PD 2BERA 1NC4D 3C6LA 5D1QC 3BZ4B 4FFZL 5BJTA 1TVHB 4P06A 1QSFD 2VLMD 3GEWB 2F0CA 3RL1B 4OZGF 2EO1A 5I17B 4XRCB 5DTFA 3UTZA 3EO1A 2OP4L 4PTUA 4RNRA 2FSEB 1AJ7L 3C5ZD 4QHMB 1RIHL 4GAGH 3UG3A 3O6FD 1MHCA 5D1ZA 3RPIA 4NC0B 5EZJA 4IJ3C 1S5HA 2B3IA 3D3VE 2HFEA 1L9QA 3SD2A 4YHZH 5J12B 3P4NA 3FULA 4BFJA 3RGVD 3DUSB 4Y5YC 3V4VH 4KZ0A 2JB5H 3ARQA 2YMTA 4H4NA 1DVQA 3SDXE 1OV8A 2APVA 4AQAA 4WDIB 3GNMH 5AVUB 4B6ZA 3SZ6A 3OAWA 3VMPA 2AV7B 1AHMA 4UNIA 5LQBL 1TYEB 12E8H 2P5WB 3GZKA 3IRCA 2EVGA 4K3EL 2Y5TA 1VCBC 2A83B 1NWPA 4IOSD 2RALA 4OD2A 5ABDE 3LKSB 1XH1A 3VXPA 3I3EA 2EXYD 3LZLA 1H9DA 1NCAH 4Q6KA 1MCEA 5E5LA 3BUIA 2HCZX 4M6AA 3BEWB 3ES6A 3TT1L 3Q48A 4LLMA 1KDJA 3E8UH 4ENZA 3Q05A 1FFOA 1KLUB 1MFCH 3QCTL 1WCBB 1RZIA 3UH8A 4PJFE 3IPEA 3LH2H 4ZUVB 3QHZL 5F7HA 3ZR6A 4UQ3B 2XDHA 1IARB 4OF7A 4F7CB 4PFEA 4UMGA 2ADFL 4I88A 1MHEB 1UC6A 2CUIA 3IXAA 2AZAA 2AJXL 3TJEH 5L8LB 5LGKA 3SDAB 5E1GA 4NUQA 2AV1A 3HR5B 4BH7A 1UOWA 4YL9A 3HUJE 4LGRB 4KKAD 3RKDC 2SEBB 1V3KA 3QRBA 3V5HA 4X5LA 4DGWC 2FYYB 3C8KA 5EHFA 1E3XA 4LARH 3QNYB 3WS6A 4FQIH 1T83C 1A6ZB 1DVYA 4WHTB 1Z5LB 5D96C 4EIBA 3CXFA 3DUHA 1F58L 1YEGL 5CJOH 1C16B 4ELMB 3F8UB 2IAMD 4CC0A 3TBWA 2DWXA 3OX8A 1RP9A 3ZYJA 2CDGB 5BXFB 4G3YL 2VUYA 3SDDD 5F9OH 4QD2E 1MRFL 2B16A 3E6HB 1KFAL 1X5JA 2HSIA 4Y1AA 1RHFA 4D3CL 5BZDB 1TO4A 4KJYA 2BHZA 1JRHL 2J8HA 2JKJA 5D7JA 4AYGA 2NY6C 5GGTA 1HIMH 3BSZH 3D4CA 4JFPA 4TVPD 3WOVA 5HSFA 5KYUB 2BS8A 3UBXB 4RMUA 5EC2B 5GGVL 3G5VA 3N40F 1NGZA 4ODHH 3QDJB 5FYKD 1FNSH 1QFWI 1NEZA 4HU2A 1OHQA 4S1DC 2V7NB 1AO7B 1B3IA 4ZMZA 4X6FA 3BH8B 5KBKA 3QZWG 1UZ6E 2WTRA 4UT6A 1RHHB 3X3FL 4G5ZH 2EH7L 1PCSA 4QYAA 4MWFB 2WLMA 1OAJA 4KTEH 4ONGH 2R15A 3GXNA 5KVEL 5I8OL 3ML8A 4ENED 2ZXWB 4Q0XL 2A6KB 4L8BA 2CGRL 3VTMA 4HAFA 1A6TA 3FU7B 4JG9A 2NLJB 4LLUB 1TQTA 4GRWE 4JZOB 3CFDA 4O4YL 4XVUD 3FQWA 5EU4B 2Y1VA 4TQEL 1BAWA 3ARGD 3AW5A 5J11C 1W15A 2V2TA 5I1GL 4PJ5B 4ZTPL 5ICZB 3FTXA 1QNZL 4AEIH 3LN4B 3C5ZC 3H55A 1U36A 1S9YB 1ZSHA 4MMZB 4X7TA 1LK3L 4NO3B 5AOLA 3SGDH 1WVZA 3LXUX 2HWZH 1E0OB 5AWNL 1HXYA 1ZHBB 3H56A 4LBEA 4ZFOL 4GSQA 4F57H 2GJ6E 2IH1A 1G9MC 5TE4L 5IOKA 3QDMA 4HPYL 2BVYA 1H15A 1Z6JT 1HS6A 3ZKQD 1OSZB 1U93A 1DFBH 3O6ML 1MAML 3VFOA 1WZAA 4H1LG 4U3XA 2A4CA 3WFCL 4HJGA 1RK0B 1AY1L 1BQUA 2D03L 3KE0A 2QJDA 1CFQB 2UX7A 5LNDA 3L81A 1KGCD 4UMSA 2NZIA 5F7DB 4AH2A 3FQNA 1J5CA 2VMFA 3O6KL 2KUTA 5C09B 4LCIL 4MBRA 2HRHA 1MCLA 5EV7A 5IZ7A 2O5YH 4KO9A 5CKGA 3WEXA 3A6OA 4X6CF 3PJLA 4JHAL 5EORL 2EXYC 3CFMA 4IU2A 1PDKA 2JCCF 2LAGB 4PIRF 4PGZA 1NFDA 2YKLH 2VDKH 4XXWC 2HT2D 4M4RB 4ODWA 1ZJBA 2DWYA 3WN5C 3G6JF 5D5MA 1BJMA 5TPWH 2VO5A 3UL4A 4JRYB 1CBVH 3MRMB 2BOLA 3UBHA 1I7RA 4ETYA 3T8XA 3EYSL 4J3OC 5I19H 5J6GB 1E8ZA 4C4UA 1OAZL 4P05A 4R7NB 4NOFA 4DGYL 1UOLA 4LNVA 1PZCA 1Q94B 2CCWA 2EEXA 5CJXC 1MRCL 4ZG1A 3ARSA 4YSRA 3R0NA 2Z3FA 3GMNA 3QA3B 2NNXA 1JYXA 4PV9A 1ZHKB 5I23A 2V37A 4L23A 3K0YA 3TO4B 2FO4A 4QJ4B 4S2SA 1IC0A 3U6XA 3ZE2E 1NCWL 4KKAC 4U4IA 3UGUA 1DSWA 1AD9B 1A1OB 2V2XA 1IVTA 2UZPA 3CBRA 1QRNE 1T21A 4OBRA 5GS1C 1TLMA 3FUDA 3IBOA 5B7MA 4P9HC 4QRTA 3QEGH 1VIWA 1SHXA 3U83A 1MAJA 4KI5E 1RP8A 3EJYD 2A4EA 4Y5XA 1UUSA 4PB9L 3SDDC 4NZUL 2CXGA 3EZ8A 1W72A 4ZDHB 3N41F 1NPUA 1WHPA 4LLQA 1J05A 5DLMH 3A4EA 5GS0L 2X2JA 5AZ2L 4FQCL 3H9SD 1FGVH 4AITA 3IDMA 1D6EB 2AEWA 4HCRA 5D7SL 4YQXL 1F4WL 2RCSL 3S4SB 2GTWA 5JPNA 3CPLA 4F91B 2H2PC 3TZVA 1AQMA 5JHDB 1KCVL 5IEHA 3QUZD 3LV3B 4AWJC 2UVEA 1T7VA 3H7BA 3S37X 3U0WL 3EO9L 4NYLA 3VQLA 3BPLC 3NIFF 3MNWA 1OGSA 1MCOL 3SKMA 1S7VA 4NPKA 4Z77B 4L3EE 2F53B 2V17L 4HEPG 2K3TA 3WFEH 5BO1L 4ADJA 2EVHA 2E6PA 1A9BA 1RJYB 3EOTH 1PLGL 3ARED 3ZUNC 2Q6WA 3F00A 2ZOOA 1GOHA 5B39G 3L4TA 1IZJA 2BRRH 3CHRA 4FNQA 3U6RA 3QUXD 3V0IA 1EJ6A 2GC7C 3TYGH 2Q3XA 4XWOD 4XVSH 2UUDH 4WJKB 1S8DB 5E99H 4LASH 4GLRH 3QQ3A 3LRGA 4RZCA 2CM5A 3UAEA 4Y1TA 4KKLC 1IU1A 5DJ2B 5I8KL 1HHJB 4FYTA 1R4XA 1RZ7L 4I18B 5C0RL 3L1FA 2KDGA 1ZIAA 2EZ0D 3ME0A 3QXUA 2Y36L 2QPFA 2P5EA 1MCHA 3AB0C 3WS3A 4AXWB 4XNXH 4X5WA 5A2KH 1RZGB 1IGTA 4LZKA 5C6WH 4RLDA 4EVNB 2LFEA 4LNRB 3BAWA 4IRJA 4PJDE 4AQ8A 1CS6A 2VDLL 5E24E 3AWFA 3RI5F 1R47A 4MS8D 2V9QA 5HJDA 2Z4QA 2P26A 3PPSA 4HMEA 2EDQA 5I0VA 2P8LA 1JZEA 3O0RH 2CUHA 5F7AA 4I5BA 1ZGLB 5F1IB 1QD0A 1A9EB 4K71B 1J8RA 4MCYB 1FO0A 4D9QD 4NKOB 2V9RA 5BCAA 4GAGL 3DTXA 2BSRA 2N59A 3OHMB 5E2UH 4ZFZB 3QWRA 2HFFA 2IBBA 3C6LB 4WNJA 2WYIA 5BJTB 5ACLA 3CSPA 4YHZL 1JTPA 3LNEA 5AYTA 2W65A 5DTFB 1JNHA 3UTZB 4QHPA 3V4VL 5EU7E 1ACZA 3V8OA 1U3HD 2JB5L 4RNRB 1CN4A 3KLLA 5E94B 1UZ8A 4CN6A 2R2CA 2YHGA 3GNML 1CIUA 4GP4B 3H9ZA 3IBEA 1AMXA 1BYPA 3RPIB 2BINA 5C8JB 2EUZA 1S5HB 4WFFD 1M4KA 3MNZA 3MYJA 4AL8H 2AMGA 4POZD 3DHMA 1YLBB 12E8L 2YBGA 4BFIA 3EYOA 5IR1A 2XFGB 3M46A 1KTRL 2ARJA 3VJ6A 1JXGA 2EYRB 1K4DB 1NCAL 2NY1D 2D7NA 4PJ8D 4DK5A 4CVXB 4IIZA 5DFTA 5ECGA 2LGNA 2OI9C 5HHME 2IH3A 2R27A 3E8UL 3MX0A 2Q5BA 1MFCL 5IQNA 3EXLA 2H3XC 4HSQA 2G9KA 4H0IA 2QTVA 2Y5TB 3DGDA 4PY7A 3EJYC 3BN9C 3LH2L 4OD2B 1IGIH 4YSDA 4F1SA 3QJFB 5CR8A 3D7PA 4TNFA 1ZOXA 3T5WA 3IDYB 2ZWYA 3CV5A 4JVUA 4FA6A 2GITA 1BBJA 3F2LA 3HE6A 3VA2C 3ES6B 1WFNA 3TJEL 3EW3B 4S10A 4J6IA 2ZYHA 5JW4M 2Q7NA 3FUHA 1UT1A 2YZ8A 5I5JA 1G6RH 2DM2A 4PJGB 4XE0A 5AB1A 4CC1A 2ALAA 3SGDI 4W81A 3OD3A 4LARL 2WXNA 3BGFB 2VMCA 1TNNA 4HJTA 4P4RB 4FQIL 4NZDA 4YOKA 2IOMA 4J8QA 5CJOL 4JJ5A 4NNXB 3BVTA 3FCUB 3GMLA 2AV1B 5E6SB 5D93B 1J1PH 1USQA 2ITEA 1AHKA 3UOAB 5F9OL 5FIEA 2XPGA 3W11C 4XN4A 1GA2A 2NY3B 2FQDA 5GISH 5KVDH 5JXEA 4XWOC 3STLA 3VO0A 4JHVA 3W0WA 3PWPE 2P9RA 1HIML 3BSZL 3OX8B 2K6YA 5K39A 5TDPA 3ZJAA 4XE5B 3VFMA 4PBWD 4ODHL 4U0QB 1FNSL 2ATPA 3A0OA 4NPYA 2QKIB 3L3HB 4HBCH 5LDSA 4IDJH 2IQ9H 4KJYB 3VH8G 3TN0D 1R17A 2JIXA 4G5ZL 5D7JB 4OGZA 2H32B 1VAHA 2SODB 4FTVB 3LVTA 3OWEA 4KAQH 4KTEL 4ONGL 2QVFB 4NRZB 5C0CD 1SFDA 3DETC 1OE1A 3EOBA 3T1FA 4XXDA 5SX4H 4KUZH 2L7EA 3VD9A 3G5VB 1NGZB 4ISVA 4TF4A 2J25A 1NGPH 3RKPA 3T77A 3MRKA 4U1GC 3QIWA 4MS8C 1IIKA 2WTRB 3TBCA 1T1WB 4P04A 1NBQA 4WO4C 3NPSB 5JORA 1ACCA 1MCPH 4AEIL 1LEGA 4FQJH 4ZOBA 1NCUA 4L8BB 3W39A 4YHMH 1J5DA 3WDHA 2DMHA 2Z8WC 5A3ID 1E9PA 4AYFA 1JZFA 5FM5O 1SN5A 4A7VA 3FQWB 4BK8A 1N26A 3P4MA 3PV6B 1QSEE 1WK0A 4F57L 1Q90A 4KVNH 5B7EA 2V2TB 2H0PA 1VKXA 3MJ7B 1O7SA 2QV2A 3I2CH 5EEZA 5MERA 1UWXK 5FYJH 4OGXH 2JVUA 5EULV 3UTSA 3IU3A 2WO4A 1DFBL 2XY2A 3ARZA 4X7TB 4QWWD 1EHXA 2WQUA 4P9MH 4D0BA 4LBEB 2VJXA 1BREA 2E6QA 4XTRD 2IH1B 3NTCL 1XF1A 1ILUA 2ZZUT 4HH8A 1MCDA 1ASOA 3QDMB 1H15B 4WWPA 2O5YL 5EUOF 4NKQB 1JCVA 4FZ8H 2FEEI 1U93B 3TS8A 4X83A 5KEZA 2Y5QA 2I9LA 2YKLL 2VDKL 3U2SA 4PJ8C 1DSFH 2PO6C 5K93A 1M71A 2A6DA 1CBVL 5TPWL 1JYNA 2K9UA 4GOSA 2AHIA 2OMNA 4AE1A 4AH2B 1L0QA 3FQNB 3H0TA 5I19L 1T0MA 1UH3A 1MI5D 1SDAB 1TENA 1U8MB 3C60D 2YXMA 3K6DA 3GI9H 4PJAF 5HI5D 1QFHA 3NJKA 4U6HA 1B0IA 3BP7B 5F9JB 2Q3ZA 4IU2B 1PDKB 4DP4X 1CCZA 1GHFH 4MGXA 3VRIB 3M86A 2G5RA 5FOJA 5D5MB 3RVWD 1DJYA 1D5IH 3DV6A 3KPRA 3PV7A 4LP8A 4I9WE 3KHQA 5K1JA 3VFRA 1I7RB 1LL1A 5EH1A 5MHSE 4AEHH 1BFOB 2OSXA 3T8XB 3UC2A 3IFPB 1JZ5A 1IKNC 3SCMD 4QRQA 4O58H 3DX7A 3JUYA 3I75B 4YDLC 4LDEB 1OB1A 3BUTA 3T65A 1TPXB 5CJ5A 4XMWA 2VLLB 5D4HA 3GMNB 4PV9B 3QEGL 1VENA 2AP2A 3KNBA 1EHNA 3T3ME 2FO4B 4OFVA 3T2PA 4QKXB 4W9LC 1AGEA 3DIDA 2RGSA 1X6NA 25C8H 1N0LB 4JREB 1T21B 4L4TA 2BDNH 5DLML 4CSTA 1F6LL 1GGCH 2ORBH 2PTUA 1KBPA 4MFHA 3HHSA 4QRTB 1D7FA 1FGVL 3AXLB 1F1DA 1I8UA 5EF0A 5IW1A 4JRXA 4DQOH 3OAZH 3CVHH 2KLRA 3LKQB 3VGHA 5EEUA 4OZFA 4WNQB 1E9QA 1W72B 4OI9A 1I8KA 2XV2A 4FULA 2WLZA 4QRBA 4Z7WA 4FNRA 4BUQA 4B60A 4P23A 1J9TA 3MO1B 2CG9X 2E9WA 3DHJA 4OW6A 4LIQE 4Z7NB 5JOPD 3LKOA 4GQPH 2CKBL 4N8VB 3WFEL 3PQYE 2PR4H 2X09A 2Y9RT 3EYFA 3LH9A 2GTWB 4ZAKA 2AQRA 3EOTL 3MV7A 3CPLB 3TZVB 5AQ0A 4KK6C 3H7BB 2BRRL 1DQMH 2OR9H 1J9CT 1QLRA 2XN1A 3FYEB 4MYPA 5D2NB 4EKXA 1F86A 4O2EA 3TYGL 1X5ZA 2DEXX 3MNWB 4P2RA 4XVSL 2VISA 3SKMB 1X4ZA 1Z0NA 5E99L 4IKLA 1RIVH 3NQIA 4LASL 2W0PA 5AB0A 1JSYA 1A9BB 4M8QA 3KEDA 2JJSA 3QQ4A 4D0CA 1LWJA 3QJSB 3PS6A 3SZKC 2HX7A 3TGXA 1YDPB 3KWVA 3PDOA 4XNXL 4Y4FB 3BFOA 2JKLA 1X5HA 5I9QC 2D2OA 4RZCB 3QQ3B 1II4E 3F84A 3L3OC 4DF9A 1JHTA 4ZS6C 1BP3B 3IGLA 4D9LH 1T1YA 4NM8H 2ZUXA 2W9EH 4QWWC 1TNMA 5DQDH 5E9DE 1WFOA 4QTFA 3WS3B 5GGSA 1J8HD 2BWQA 3O0RL 2XBZA 1U8HA 4X5WB 4DP5X 5JTWA 5FYJE 3FT2A 4GBXC 4TTGA 1K2DA 1MN4A 2GK2A 3FUEA 5B8CB 1WLHA 2XUWA 4LVNB 1RZQA 3NJJA 4LOFA 5E2UL 5AVWB 5B1BB 4HVBA 3FTUA 2KBGA 4FL4B 5DRNA 4N6RA 3SPHA 3CDCA 2Z4QB 1U3NA 4J3TA 2AI0H 3PHQA 2P8LB 5EBGA 4BFRA 5D1XE 2J56A 3Q2VA 2YGVA 4WTZA 3S5LA 3MBEA 3BUYA 1PBYA 1FO0B 1LDPH 4U2YA 3DTXB 2BSRB 2EUXA 3VGFA 4QR7A 1SJMA 2X4TA 5FUCC 4GI8A 2WBJD 4AL8L 2I25N 3VWKD 3O3BA 5FGBA 4XAWH 3VMNA 4OIAA 2W65B 3RVWC 1XL6A 2XV3A 1JNHB 2YJQA 4LPTA 1SZNA 2LT9A 5F21B 4Y2LA 4UZUA 1K3IA 3B1TA 3FU3A 3QJHB 4TULH 1F2QA 3MRRA 3VWJC 5E4OA 3SCMC 2UXVA 2WXLA 3ZE0E 5CEZH 5INDB 2K6ZA 3ARUA 3BEVB 2ICWI 5D9SA 3WHXA 5B1AB 4Y4HB 1PFCA 3MNZB 3MYJB 1I85C 1BZOA 1OP5K 3FFDB 1RZKC 1BYOA 5A2JH 1RFDH 2RIKA 4EPSA 5C0BA 1MHPH 1NAKH 4BFIB 5IR1B 4NP9A 4QRRA 4YHNB 1IGIL 3VJ6B 2ZX7A 1C8PA 4G7VH 5GXBB 2E74C 3OAYK 4GRLD 3DIFA 3SE9H 3PAZA 4OCMC 1R6VA 3H2PA 1XZ0A 4WI9A 3BHBA 3OKNA 4OUOA 4FFYH 3MX0B 5F7LB 1BYNA 4V1DD 4N28A 4LEXH 3ZHNA 1G6RL 1QATA 3Q5OA 1HL9A 2I5YH 5K9JH 1MIMH 3TF4A 3CC5A 2FD6H 3KYNA 3E80A 3AT9A 4YXKH 2TAAA 5BQ7A 1BBJB 4XP6H 3ZHFA 5IVXF 4XZUA 3FB7B 4GXVH 4W9EC 2QL1A 3S36H 1IBGH 3JV0A 2JMRA 1R3KA 2KDYA 1ZTMA 2A3TA 2XCMC 3IGAA 1J1PL 3D5OF 2EDLA 3OPZH 4ILDA 4MXQD 5E08H 2AFNA 3AACA 1VERA 3RIFF 2IPUG 5GISL 5KVDL 5C0AD 3GXMA 3F64A 2Z8VC 4JJ5B 3BD3A 3ARYA 4LCWB 5C71A 3GMLB 4CN4A 1IAMA 1TZGH 5JPMA 1FHNA 4KV5F 3J27A 2XPGB 4X7SH 4CADA 2ZX9A 1JGDB 5EU5A 4HBCL 1EGJA 4X8CA 1XGRA 3QO1A 2ZUSA 4IDJL 2IQ9L 2GTQA 2X87A 4IIQC 1WBZA 2JSFA 4TLUA 3TO2A 3ZO9A 1F42A 4KAQL 1GZQA 2UZXA 5TDPB 1MCKA 3A21A 3DBXB 3T9WA 3P73A 4KUZL 2B8OT 4UBDD 4U7MA 5FHAH 4JPVL 3AU1B 3GYRA 3VFNA 4E41D 1NGPL 2FSDA 4NPYB 5JW4N 2EICA 4HLJA 3LZOA 1DUYA 4DJMA 3CWGA 2JIXB 4HIXH 2FIRT 4N20A 2DRUA 2OJEB 3HC0A 3D8MA 1SOQA 3ULUD 5HHOE 1MCPL 4IK7A 1JZ7A 3ARTA 3EOBB 4FQJL 3ECBB 4YHML 3HKZA 4ISVB 3VM5A 4CDHA 1B6DA 1FIGH 3LKRA 3T77B 4ECNA 5K59E 1XF2B 4PS8A 3MRKB 4UB0H 5FHBH 3AUWB 4ZBJA 2NZ1A 4KVNL 5FPIA 1MELA 3TV3H 4Z0XB 5BV7H 3CVBA 3I2CL 3CK0H 4G6AC 4PJ7F 2YFOA 1JMXA 3D6GA 5FYJL 2XIBA 3RAJH 4OGXL 1F3DH 3W39B 5IJVB 4WUKH 4KK8C 4KKNA 1E9PB 4PJCE 5C07D 3O8XD 4AYFB 1I1CA 1AAJA 4P9ML 2XVGA 1ZLWK 3P4MB 1WCQA 3SD5A 1BG1A 3VWKC 4L18A 3TBSB 4GAAA 4NQEA 5BS0B 2P42B 2HKAA 3WMSA 1B4JH 3KPTA 3NP4A 5BRQA 5E6ID 3QJUB 3HMWH 5FDYA 3CH8A 4FZ8L 4WFGE 3IU3B 1MREH 1GKEA 5DO8A 3MZTA 3Q1EA 4OJEH 1DSFL 4D0BB 2NSMA 1TU2A 1CD1A 4J3SA 5AW0B 5LXGH 1WF5A 3SDCD 1A7NH 1NMCB 1NAMB 2UYLA 3GI9L 4OFIA 2H1LM 3RWIA 1EDYA 1O0VA 3B2PA 3TIEA 1Y18A 1ORSB 4GRLC 1GHFL 3U2SB 1X5IA 1Q9OA 1D5RA 5GGRA 3UG4A 4ALAH 3JWDH 2FWUA 4Y4KD 1D5IL 1SDDA 3CVCA 2EC9T 1N6QH 1TKWA 2DEWX 4GUPA 4HWBH 4AEHL 4JPWH 1T0MB 5AAWC 4IOIA 1QBLH 1IM9D 4O58L 4U6HB 2YZ1A 2K6WA 3VRJA 3O45A 3OKEA 3H7LA 2APSA 3MGOA 5EIIB 1ASPA 1HKFA 2YD5A 5IB3A 2TRHA 3QFJA 2R8SH 1T66D 1ZGLP 1NCNA 2VL5A 1UWEH 3MR9B 3WTWA 3B43A 3EZJB 3IMUA 4K2UH 25C8L 3UJTH 4PLKD 2BDNL 3DBSA 1OB1B 1GGCL 2QGBA 2ORBL 3D9AL 3DDGA 3D0VA 1I31A 4HETA 4LCUA 3T65B 4BK4A 2CBMA 5MEOB 4JUTA 5HDRA 2FDBP 2H6UA 4RRPG 4C47A 2E9BA 1K8DA 2WP3O 4PS7A 4DQOL 3CVHL 4UQ9A 4XI5C 4G43B 1AGEB 5HP5A 3W5MA 4AQ1A 4K23L 1I9EA 1J0HA 1QMUA 3CG8A 4X6BA 4L4TB 2Y7QA 5AD0B 5G4NA 3L4WA 1T5XA 1Q38A 1WGOA 3V4PH 4QNPE 4JE0A 2GY5A 3AG1B 4J1UA 4YPGA 5IW1B 1LVEA 5K69A 4JRXB 5DVOA 2PR4L 4OFQA 4AUYA 4DNLA 3ZIYA 3O3AA 4YBLC 1P69B 5HY9A 4R0LC 4NUPA 2UWEE 4OZFB 3JUZA 4UBDC 1OM3H 3GJFH 3DX8A 4UOW1 1DQML 1I8KB 4NERA 2OR9L 3I6GB 2E5EA 5DRZB 4Z7WB 4D8PA 2VYRE 2OL3H 2ISDA 2X1OA 1WFJA 3FBQA 1TTRA 4HUNB 3KVQA 1D5ZA 5AALA 1RIVL 5HDBE 4BQ6A 4IU3A 2X2YA 5A16B 5D1QE 3QZLA 1UYWH 4MDRA 1I7ZA 2QLYA 3EJZC 2OMWA 4ZAKB 1CZ8L 3VU1A 5I1DA 3QORD 5A43C 1OOAA 3CSBA 3FFCB 3FH8A 5BQDA 3HZVA 3B3IA 3OF6A 4OKVA 5DHXB 1QLRB 2XZZA 3ZZLA 1RVFH 3VI3F 1YPZA 4ZXBA 1TQCC 3MFGB 4LP4A 4YN3A 4YAQA 3NCMA 3BSGA 3FOLA 2CCLA 4M8QB 5J3HD 4Z23A 5HYJD 1X4XA 4NFBA 1HE7A 4H2CA 3JWNE 4D9LL 1NLDH 2OR8A 4NM8L 5E4AA 1XSOA 2W9EL 2XKSA 5C97A 4R2GB 2WXRA 5DQDL 4KTGA 4BD4A 5MI0B 3WJLA 1U2HA 3D69A 3UP1A 3PDOB 2BNQE 4I8DA 1CYGA 3WD5H 4HUXA 4HSCX 1OAYH 5LAPA 3LPOA 4H20H 3PG2A 2MFNA 3SO3B 4NC1C 2P24A 1EBAA 1JHTB 4F37F 3BW9A 5HVFB 4H13C 1WRFA 2H4EA 5FKAB 1MCQA 4PJHA 3RIKA 1OAUH 2BO0A 4OY9A 4MTMA 3E0GA 2R9HD 3PWVA 1SEBA 1GC1H 4KJPD 5EO0A 3SKOB 1K85A 2AI0L 4MLIA 3QISA 4GQZA 2DBLH 5GGSB 4GMTH 5BVPH 2NYZA 4IBTA 4B7IA 3HPJA 1I8MA 4M3HA 2QV4A 2H47C 4HUUB 1K2DB 1LDPL 3BAIA 5I75B 4N68A 3MBXH 3DROB 3J07A 2QPUA 2H3KA 2PXYC 4N6RB 4JNXA 3HVNA 3D51A 3G04A 3PHQB 4ZFFB 2YS4A 1HKLH 4XAWL 2F54E 1IO4C 2FJFA 5EZOH 2KL6A 1ORQA 3DWTA 3S5LB 4LPWA 3ARPA 3MBEB 3DUUB 4O2CA 4U6YA 4JZJC 4IRSC 1CK0H 2VQTA 2H5UA 5CEZL 5T5NG 1CVRA 1REIA 3HEIB 5F7EH 2EIJB 3FB6B 1N8ZA 4JG1H 4BH8B 1PF3A 2X4TB 3F7QA 2WXOA 3B9DA 4GQRA 2BOBA 2W07A 2YLKA 1WWCA 1B3JA 1RFDL 2ADGA 1MHPL 1NAKL 3M1OA 1U8CA 4CC4C 2B4CH 1BF5A 3DJZA 4G7VL 1CGTA 3GM0A 1URIA 2FRGP 2PYFA 1HXMA 3VD2A 3WY2A 3SE9L 3CFBB 3DRQA 5DHYA 1RZJC 5D9SB 3WHXB 1E2WA 3VXRA 1H6FA 3IKCA 1MCSA 2D9QB 4FFYL 1MKFA 2RB8A 4TVPH 2UZIH 4Y8AA 3CLEH 3RWDB 1DDTA 4LEXL 5FYKH 3AQDA 3LHAA 2L3BA 4X8JB 5K9JL 4NO0A 2I5YL 4NQDB 1MIML 2FD6L 4O5LH 4YXKL 1XVSA 4CDGC 5IFHH 4DOHB 4XP6L 3DIFB 4RMSA 5EEVA 5GRJH 4HISA 1FL6A 2OS7A 4GXVL 2NOYA 4G42B 3S36L 1CDJA 4ZUUB 1IBGL 2AK4E 1NC2B 4L9DA 4A67A 1HSBA 4DKEH 5D7IE 4NRYA 4K73A 1WBXA 4H7VA 1LP9B 3OPZL 1TZOA 4PJIF 5B3NA 3KPNB 1ULVA 1C7TA 4JO8A 5E08L 1B9KA 5BQ7B 1TMQA 3BESR 4XZUB 2GIMA 2PW2A 4KNSA 5DGRA 1BVKA 5DMKA 1T0NB 2CLVA 4PPTA 5KYYA 43C9A 2HMIC 3EJQA 2XVBA 4BZYA 3B3BA 1EMTH 5BRZA 1TZGL 2QVTA 4I1RA 2VLME 4X7SL 3UZVB 2A1WH 3DGGA 2FBJH 2O61A 2QT6A 3Q01A 2ITCB 2X5PA 3E7JA 3EHBD 4PRBA 4AVJA 5KBDA 2X6MA 2ZCHH 4F58H 3P4OA 3SBRA 2BVQB 4W9HC 3BFWA 1AS8A 3QSKB 2BWIA 1UTDA 3N0PB 4JCLA 5ICYA 2C9PA 2GK0A 1JZDC 5FHAL 1NPNA 4JVPA 5DCCA 2IALB 4PY8J 5EU5B 1U4FA 5IKCA 5E8EA 1SVCP 1RLWA 1XGRB 3NFSH 3NIDE 3QO1B 5E95B 3S37H 1JWSA 3P2BA 4HV8B 5IREA 5GS3A 1U8KB 1JPSH 1MNNA 1FC2D 4HIXL 1WBZB 5D2LF 5GZNA 3WEOA 3MSPA 1JFQH 1U42A 1AGFA 2XA3A 4M7ZB 1F00I 2UZXB 2DM4A 1NGYA 1XAKA 3QWQB 4EF3A 1NFIA 3P73B 1QBMH 5FO2A 1I8LC 3NA9H 1FIGL 1NUDA 4XBMA 3VFNB 3RUGE 4HPHA 4EDXB 4UB0L 5FHBL 4Y5VA 4WJ5A 2JE8A 2BVOA 2R9HC 3B7SA 1OLZA 3F6LA 3IF1A 1WC7A 1KPRB 2YGOA 4GO8A 4I77H 3SBWA 1PZUB 1F4HA 2CJUH 3WO3B 1CICA 3TV3L 3DXAE 4HKZA 4JCWA 4K5PA 4NQXB 5CIPA 5BV7L 3CK0L 4YZWA 3D2UD 3RAJL 1CI3M 1JZ2A 1EK3A 3ZDZE 4I87A 4AMKH 3OR6A 4WUKL 2YD8A 1ZIBA 5DFAA 1UG9A 2OMXA 2GI0A 1N67A 3LKRB 3CU1A 1QI4A 1U8IA 3BO8A 2AXGA 1IT9H 4OZHE 1KBWA 3DX3A 1DQJA 4TQ8A 5F3BA 2HJKB 3FMGH 1QFPA 3MUZ1 4M8UA 5EIVA 1B4JL 1I8AA 4NWUH 3HMWL 4EQ2A 1C1EH 1N12A 2I07B 2R56H 1MREL 1MCCA 1NGXA 4B96A 4FQXA 1TZIB 3QXTA 1WE5A 4OIIH 3U4EA 5AB2A 5E1QA 5CEXA 3RDTD 2CDEA 1AZBA 3LX9A 3HG1D 1WFUA 2B9AA 5L7XH 5LXGL 3Q7JA 2KPNA 1QW8A 4FXKC 4YZFE 4KHXH 1A7NL 2HUHA 3ZL2A 3LDBB 2QQQA 3BUBA 3KGTA 4X8XA 4WLCA 1OEZW 3QUYC 2RHEA 4F2FA 4ALAL 3QPQC 3JWDL 1LTXA 2IVFC 2PCXA 4M03A 1N6QL 4HWBL 1XEUA 5KSAC 4JPWL 4NLHA 1LEKA 3OMNB 1QBLL 3LYRA 2UYLB 1QRKA 3HNVH 1T04B 2ZXGA 3QCVH 5DEFA 2UXGA 5T5NF 4PVMA 3RWIB 2C3GA 2PLTA 3P9MA 3TIEB 1Y18B 2PETA 4X4MA 3VG0H 1Q9OB 5GGRB 2FJHA 4TVPE 4XMUA 1Q0EA 3QR2A 4FG0A 4JO1H 5E03A 2WLNA 1QTYT 4JO2H 5IUSA 5JHLH 2R8SL 4GUPB 5A2AA 5FYKE 4NP4H 1KIQA 3O4LA 1CDCA 2H9GA 1UWEL 2YUWA 5E2WH 5K1VA 1GS6X 3MLZH 4KVCH 5JO5B 4K2UL 3RWFA 3UJTL 2I7OA 5BO0D 2B7DT 2CR0A 2APWA 4PJEA 3VRJB 1IIIA 5T33H 4Q9BA 5CUSH 5DJDA 1HU8A 4K8RD 4UQCA 3D0LA 3NJVA 1PZAA 3PQYB 3QEUA 4W68A 4N2AA 1QI3A 5IB3B 1BLIA 3QFJB 3EDKA 4LT7A 5D7KD 1QTSA 1PLCA 1BMZA 1M9WA 2OSLA 2P1YA 4I0CC 3X12A 1XFPA 2WIIA 5CCKH 5BZWA 1YN6A 3WTVA 2FQEA 4FXTA 1PKQE 2NY4B 5EOTA 5FA3B 4GKOA 4YHPA 3V4PL 5E4EB 4LCUB 3D0VB 3MNDA 5HD8D 1DVXA 2QQLH 1XB3A 5DRXB 4LL1A 1K8DB 3OGOE 1F90H 4JM4H 4ZNEA 1S7TA 1OM3L 4ZPTA 5HVWA 3N1PC 3MRBB 4AV5A 2Y7QB 4FFZA 1T5XB 2OL3L 1M2OA 1XIWA 2QMJA 1CBJA 3HHRB 3LQMA 4DGVH 1PY4A 4MA3A 2YAQA 4J1UB 3GB7A 1A4KA 3SJVB 3SDAD 2NY7H 1YJDC 2CR6A 4CU8A 5JHMA 3ZE1E 4Y19E 1UYWL 4RGNB 4KJQC 3D25A 5CD5D 3O3AB 4GUQA 5IVOA 4OF5A 5HY9B 3EJTA 4L8SA 4J2XA 1KTDB 4XCEA 2HG0A 3U9PH 1RVFL 1KYOJ 3BMVA 5EUKA 3X1BA 4A2GA 2VABA 5FO9A 3JTBA 3FCGA 2X41A 1CFNA 3ZKNC 6FABH 6CGTA 4IU3B 5AVZB 3QULA 2OMWB 2L7UA 3ULVF 2VB5A 3BRFA 5HGAA 1NLDL 2J4WH 3B3IB 4OKVB 3MRFA 1XR8A 5EEYA 3RNQB 3MRHB 3E1F1 3FOMA 1DQQA 3FT0A 1YPZB 1S7RB 1ONQA 2IWGA 4ZXBB 4NQCA 3VGDA 3WD5L 1ZJAA 4LQFH 3HJEA 1TJIH 4YAQB 3W37A 1OAYL 4LKXA 1FBIH 4H20L 4KK9C 5EU3A 2YD6A 5D70H 3QDJD 3KPSA 4PP1D 3FN3A 1DE4B 4XO5A 5IROA 1KYFA 1OAUL 1AO7D 1YEEH 1QP1A 5EU6D 4Z7VE 3DYPA 3GBLA 4UNTA 4XOCA 4FDWA 2YJLA 2DBLL 4XVOA 4GMTL 5BVPL 4X9FA 2ZE0A 4JDVA 3MU3A 5PAZA 4JFFD 3J8F7 4JDEA 5HYSA 3RVXD 4MNGB 5IMOB 1LEIA 3ASOB 3MBXL 4K55A 4Z7OB 1FVCB 2CAKA 2X1QA 3BW9B 1F3JB 4OT1H 1N2RA 4IMKC 2YAHA 2YUVA 2WQWA 5FW6A 3T2OA 4BCXA 1I1RA 2AJUH 1HKLL 4PJ5D 1Z0MA 2CLRA 4KRPD 5EZOL 3W1ZA 3DJRA 2C1PA 1S7WA 2AZUA 4AJVA 1NFDF 1I8MB 3TIDA 2OV0A 4U6XA 2K9FB 2A74A 1TTFA 1CK0L 3RVTC 1IM3B 3BZFA 3SY0A 4NCDA 5F7EL 1GC1C 2NSXA 1X3DA 4JG1L 1R5VA 1KCLA 2XG5A 3D12B 4ZD3H 3TNNA 3MV8B 4PJXA 5FGCB 5J12C 3G04B 1DJZA 3KPMA 4ES8A 2C9XA 2FJFB 4WFED 1IEHA 1IEBA 4Z0BH 3QDGA 1ORQB 2WV3A 4Q7DA 4QT5A 2CMRH 1KTJA 4O2CB 1JN6A 2B4CL 3ELAT 3G5ZB 4GKSB 4W9GC 5T3XD 1KGYE 3O41B 2ALWA 1R9FA 4PRPB 5DK0B 3OB8A 1AHWA 1N8ZB 3FPYA 4L05A 4OQTH 2XNAA 1AE6H 4TVPL 1Y1DA 2UZIL 4KNUA 5H37A 2XN9A 2EO7A 1CD0A 3CLEL 1U91A 3CSFA 1U8CB 5HHNB 3GFUA 5DS8A 5FYKL 1LK2A 2WO2B 3UPCA 2ZG3A 3RNKA 2PYEA 4O5LL 5IFHL 4MB3A 1HXMB 3DRQB 2Y0SA 5DHYB 5GRJL 4QLWA 3OMAB 3VXRB 4MNQA 3FSWA 5C1MB 2XYBA 4FYRA 3BISA 3TVMB 4FYQA 2NR6A 1SJEA 1N5AA 4UI2A 2BIPA 4DKEL 4JFXA 2XU9A 1KWKA 4N2MA 4CJ1A 2ENJA 3DOHA 3ZYZA 2CIIA 4QLRA 2XSKA 2M1KA 2ZP0T 1EVTC 1FL6B 3S8GB 1KCUH 1G7MA 2FX9H 3O4OB 2WVSA 3PL6A 3SDAC 3TO4D 1MH5A 1S78D 1G84A 1E9OB 1EMTL 2C5DC 3HZYB 4UQ2B 2G2PA 4QRSA 1WBXB 1RULH 5ACZA 4LSTH 2A1WL 1KELH 2FH8A 1D9KC 2FBJL 2NRDA 3MA7A 1O9ZA 1QO3A 5CINH 3FO1B 2PW2B 2JKNA 2ZCHL 1BVKB 3QK0A 4F58L 2J2ZB 3IJYA 4ZFOA 5HHOB 5EF2A 1OOWA 1W8OA 3CZGA 3K8LA 4D9QE 5C0EA 2B0SH 4FNLH 5E2JA 1TMCB 1KWGA 1QSZA 2Y25A 4CKVX 3KMDA 5CEYA 4HOWA 3F7KA 1IB5A 5D7EA 4RFNB 1N64H 1JDDA 3L9BA 4YGVA 3T2QA 3NFSL 3S37L 4PRBB 2ZUYA 3FTSA 3KLHC 2EECA 4UV4H 1MFBH 1JPSL 4A2LA 1ETZA 4NN5B 1JFQL 4HC1H 4UWQB 5J1AA 3TJHC 1URZA 4XGZA 3KCPA 5H8DA 5ICYB 3U1SH 5JHDD 1QBML 3FONA 2QR0B 2VN4A 1E5AA 2DJSA 3NA9L 5E7BA 3W9EA 5IKCB 5E8EB 4ABWA 2DJMA 3NA4A 4NWTL 4I77L 4NUJA 2F53D 2EDXA 2CJUL 1VZHA 1AGFB 5DMGD 5I0YA 4MQXD 1NFIB 2QFPA 4AMKL 1ECYA 2Y1AA 2DQEH 4LRIC 3AVEA 3PJSA 1NTDA 4OB5H 3I74A 4R96A 1IT9L 4Y5VB 3ABZA 1N0XH 4WJ5B 2BVOB 3IF1B 1XT5A 4G80B 1VFBB 5IQMA 4OZGE 3FMGL 3KJ4C 4KDWA 1J1XH 3OLEA 5CIPB 5GGUA 5I1CH 3NYKA 3FW6A 4WENB 5JLZB 3C6SB 4NWUL 1BMWA 4NT6B 4UNVA 1C1EL 3JWOH 4NIYE 1E28B 2R56L 4Z9KB 4MCZA 2OMXB 3HZ3A 3RFZA 4LAQH 5GJTH 3AROA 5DJCA 3BO8B 2QADB 1MFAH 1NCJA 4OIIL 3AGWA 3NT0A 3Q2WA 1TT6A 2YXWA 1DQJB 4EI6B 4XBPA 2BZ7A 4LHQB 5L7XL 4Z8FH 4I3GA 3HG4A 4KHXL 4NJAH 5DU7A 5B4MC 3QUKB 3C5JA 1J11A 4FFWC 2PP8A 4PAZA 1MJ8H 1K8IA 1BQHA 1ODUA 1EHKB 3ORJA 3UXFA 2WSPA 1VDGA 3U4EB 4AM0Q 3F6IA 1MG2C 2YXFA 1ZV9A 4OIBA 3IDIB 3OKDB 3V0GA 4C83A 2CDEB 4MX7A 2EUVA 5DC0A 4EI0A 4P2OC 3GMPB 4KRNA 1ZK5A 3M17A 5DJ0B 3HNVL 3QCVL 4HKJA 1UUNA 3C6LD 3T0EA 5JYMA 3Q5TA 5I8EB 4G71B 4NN6C 3VG0L 4MJIA 2MQCA 2G4EA 3L2MA 4M93C 1YVLA 4HJ0D 4JO1L 4G11A 5JHLL 4JO2L 1JZ6A 4PRAA 4KXCA 1MAKA 1IRAY 3ATBA 3MRNA 4NP4L 3RIAF 2DWDA 5JXAH 3E38A 1LEKB 2P45B 4YJZL 5E2WL 4ODTH 1PAZA 3MLZL 4KVCL 5GRWA 5D72H 3US1A 2YAMA 1E7UA 1CMOA 3P9MB 4R4FH 1F3RB 5T33L 1PW3A 5CUSL 5C0CE 1QFUH 2APTA 3INUH 4QHUA 1CGUA 3ZK0A 5C6TH 1ZA6A 1KIQB 3O4LB 1S9XA 2H9GB 1MFVA 4AQEA 2HTLD 4TLTA 1T20A 5CP3H 5CCKL 3NJLA 3RWFB 3P4LA 4ZRGA 4F9PA 2X53A 1JPST 3G6AB 1MDAA 5HDBB 1AC0A 1HNFA 3FUIA 1RK1A 1J9RA 3D0LB 5TQ2H 2QQLL 5LDUA 4CJ0A 3VSTA 4HULB 1F90L 4JM4L 5C7ZA 1ND0A 4GIOA 4F5CA 2WIIB 3QXAB 1UZGA 2X4RA 5LG6A 1YN6B 1FFTB 2F68X 3ELQA 4HLEA 1SN0A 3N50A 5D1ZI 3KLAA 4L8CA 4MJ2A 5EOTB 5F7NC 4FEMA 4DGVL 2GB2A 4YEEA 5KBNC 4AT6B 1LD9B 4JRLA 2NY7L 2NYYC 4IJ3B 3VXNB 3IXTA 3R0MA 3L17A 1DL7H 2GJ6A 2Z8RA 1U95A 1XXFC 4H26B 4IGBC 2DW5A 4JG0L 3PWNA 4K3HA 3UERA 5F93C 4N26A 4TQHA 4QUOA 3RJQB 2X2IA 2C9VA 4OQ1A 4HGMA 3U9PL 3WNMA 4KKCD 1H3TA 5F71A 4MA3B 2LU5A 5F9DC 4HUWB 1O6VA 3EDDA 2CH8A 3GB7B 6FABL 4TM9A 1S7QA 3V4VA 3D25B 1S7XA 5CZRA 5CLTA 3UDWC 1A6AA 1G6VK 2VDPB 3T3PB 1IAII 2J4WL 3PJNA 2NY3D 2MRYA 3APDA 4G6FD 4XCYA 4JKMA 4C57C 2C1OA 2WQRA 4LQFL 1TJIL 4YSSA 1EZVX 4U6TA 1FBIL 3QULB 5FUCE 1E4WH 4JJOA 5D70L 4TMPA 2Y6SD 1GZHC 4X42A 1XGQB 2VLKD 3MRFB 1YEEL 3RWGA 1DQQB 1O5PA 3KD4A 4IJTA 1ONQB 3TM6A 4NQCB 5D7JD 4P4KC 4FTVD 2V5MA 3RHWK 1V5JA 3L4ZA 1HK6A 2WOYA 1KPVA 1YRKA 4LKXB 3CDZB 1F0LA 4P49A 3MKKA 5CNHA 3KPSB 1DVTA 4JY4B 4OT1L 1KBBA 4WWKA 1ZHLA 2Y5EA 1ADWA 1XTMA 4K0OA 4ABQA 5E1IA 4JFEA 2AJUL 5D96B 2R7EB 4R7LA 4CNIA 3UZEA 5GRVL 1MXDA 1BPLB 4F7PA 5H4YA 2Z0BA 1G7LB 2HRPH 5HYSB 4QRPD 4RVBA 3AJ7A 1GH7A 3LTVA 3TFKC 1N2RB 3C6LC 2JJTA 4ZD3L 3DX2A 1X6LA 1H0DA 3U0TB 4XP1H 2TRYA 2LVCA 4YH6A 4XN8A 2E4TA 3IKKA 2CLRB 1QI5A 3K72B 3CSYA 4LLWB 1MPAH 4P46A 4XBGA 3ISRA 4LCYA 4OCWH 1S7WB 3I6LE 2CMRL 3TF7C 3TIDB 1SPDA 4U3SB 2NY6B 4U6XB 3LD8B 2A74B 3V6ZB 2EE9A 1DVFA 2VR9A 5JOPE 1LGVA 3BZFB 1ZPLA 1BD2E 1M53A 2CHZA 5D1ZC 4HZAA 5DJYA 4OQTL 4EBQH 2XG5B 3TNNB 1AE6L 3DVGA 5GS2H 4AG4H 4PJXB 3KS0J 4XC1H 2WLLA 1JF1A 1EX0A 4GS7C 4YFDB 4KUCF 1HE8A 3FQUA 5D4JA 5KBPA 3SBPA 5I1KH 4JPKH 4TYUA 3BSZA 4Y9BA 2ZXCA 1FFPA 3FU6A 5FDWB 1E90A 3L95B 2EIBA 2QFRA 3KL0A 4IW4C 3F05A 1O9WA 5ILTH 3NFPB 5IEKA 5DJZA 5CXPA 5EF3A 1AHWB 2APFA 3BDYH 5C0IA 5IQLA 4ZMXA 3BCFA 1BWMA 4FLQA 2P4AB 2ESVB 4L3CA 2XN9B 4ICXA 2DV6A 1U91B 3DLQR 1OP3K 1LK2B 1ZDSA 4RMVA 5KYNA 5K9QG 1CLZH 1ETB1 2PYEB 3FCTB 3N5AA 5IGXH 3C5SB 4PRDB 4NKIH 2VH5H 3UBGA 3NZUA 4MNQB 1KCUL 4R4ND 1SUJA 2FBRA 2FX9L 3T8VA 3ULUH 3NCYS 1SJEB 1N5AB 2F8VA 4JFXB 4HUCA 1RULL 4LSTL 2DL9A 1KELL 3MLYH 4PJDA 5FYLH 3DJTA 5CINL 1OL0A 1WAPA 1UH4A 3FU9A 3HI1A 1KNOB 4R7DA 3H6JA 1FNFA 5FAAA 4XNQA 1HL8A 2EAEA 1G7MB 3CGTA 3A6CH 2XVKA 4GG6B 2FE0A 3Q8FA 2B0SL 4PYGA 1ID5I 3PL6B 4FNLL 4IBSA 1MH5B 4ADGA 2H6PB 5LWYH 2XOTA 1KXVA 4QRSB 3VSVA 2XT1B 3BAYA 5ACZB 2IFGA 1GOFA 1KTCA 1N64L 1GKOA 2BY1A 2G5UA 3MA7B 3SE6A 2ZOKB 3WS6C 1RURH 4XMXA 3DXAB 4UV4L 5FW8A 1MFBL 2F1BA 3IJYB 4M7JH 4YDNA 4FQLH 2Q8BH 4I2XE 5C0EB 3ZDZB 3WTXA 4HC1L 3WY4A 1M7XA 3WEAA 3U1SL 3S3JA 3B2VH 4XP9H 5FK9B 5CEYB 4I9XA 4XO9A 2EADA 4OZHB 1IKNA 2IPKA 2Y1YA 4KQ3H 4YGVB 2FZ3A 1GCFA 3MOAH 2VM4A 4FQHA 3UTTB 1DUZA 5E4IA 4FADA 3O11A 1JF6A 5H94A 2E76C 1GS7A 4L1TA 2DLEA 5TQ0H 5J1AB 3DVIA 2HPOA 3IFNH 4GJTB 4RETB 4XGZB 3RY5A 3ZX1A 3ZT5A 1AIZA 4WW2A 2ZG1A 2X4SA 3AITA 3FONB 3NH7H 3RWJB 3GUFA 2DQEL 1JK9B 4WHYH 4J6RH 5F7FA 4OB5L 2XX0A 2VLJE 3MREA 2JELH 3BIKA 1N0XL 2O6CA 3ECWA 4YO0A 2E4FA 2DZEA 5AAPA 3QWNA 1MFEH 3CDGA 1J1XL 3NZSA 3DOIA 5EBLA 3QI9A 5I1CL 1CR9H 3LQZA 2D7PA 1MQ8A 3JWOL 2NCEA 1BZEA 2WMPA 4LAQL 5GJTL 1HFUA 2YRPA 2NUTB 1P7KA 1MFAL 4LESA 4R96B 4V1DE 3ULVC 4Y4FD 3DKHA 4Z8FL 2AQPA 1QHPA 2IV8A 4M5ZH 4NJAL 5GGUB 1YEJH 5FKPA 4A04A 4L3AA 2X3BA 2ZWZA 1MJ8L 1IAOB 3ALXA 3D3VD 4TNWF 5KS9F 4MCZB 4M1DH 3RYMA 5JW5A 4HH9A 1A3ZA 2OYMA 4M48H 4CBPA 1JDCA 5DJCB 2BS9A 4GY4A 1Q1PA 1YSOA 3O6LH 3IFOB 1TCRB 4M9OA 2BSTA 4XBPB 4NENA 5ITBH 2EVFA 1JP5A 4TUOB 2VR6A 3SGJA 2HTKC 2XWDA 3THMH 4NQSA 5BUAA 4DH2A 1K6QH 1K8IB 1BQHB 3B9AA 3P11H 3N1MC 1CPUA 3C6EA 4PGEA 4TUUA 4LBAA 1PY0A 4C83B 2LU4A 4ODSH 4ZMTA 3ZZSA 5JXAL 2NW2B 2WTPA 4LHUB 1JWMA 1OSPL 3PWPA 3M17B 4ODTL 5D4QA 3QWRD 1WWBX 4HKJB 2P48B 2GBTA 4R4FL 1SHWA 1UXWA 1QFUL 2LOEA 3CHPA 3EOYG 1DBMH 4TQPA 3T0EB 2CNZA 2J6EH 1T4WA 1F4XH 3INUL 4MJIB 3C9NA 3K71A 3LQAH 5C6TL 3MHZA 4YMPA 1A6PA 3TU6A 2DWDB 3ALWA 3PCYA 2ZCZA 4DO6A 1VFMA 3QO0A 4AJWA 4JFZH 3GSQB 5DD5H 1P9MA 4Y4HD 3ZTJH 2VNCA 5TQ2L 1TPXC 4U49A 4JR9H 4MAYA 2E0PA 2FGWH 5IV2A 2GUOA 1S9XB 2Z31A 4UT7H 3CN1A 3P9WB 2XZQH 2FJGA 1T20B 4YPJA 4ERSH 4UOQA 5IJCC 1XCTA 3ZQWA 2R2HA 3NJFA 1KYAA 2EKSA 3MROA 5A2BA 1JZHA 4W6YB 1AQ8A 3F7LA 1NM4A 4R7VA 1RK1B 3O9WA 1AYRA 3K2MC 3ASNB 2FT8A 2K7PA 1HEZA 1QSEA 2V7HB 4DN3H 5L4MA 3UYPA 1DL7L 5HJBA 4YSUA 5C07E 3ZLQC 1EXUB 2A4ZA 4Y5XC 3QG7L 4Q4IA 1L5GB 3NSDA 1LQSR 4OM1H 1YAZA 2Z35A 3QNXA 5SWQA 3QIBA 3V5DA 3BX7C 3N1GC 3KLAB 3AQZA 5FV2A 4L8CB 3VI4E 3L7FA 3EH2A 4GKLA 1ZDQA 1ZD6A 4A39A 3DX0A 2A77H 5T8IA 3IXTB 1PD1A 1J88A 1VCAA 2BSSA 5JPNC 4NCC1 3ZHLA 1MWAB 3TZVC 3PGCA 2WZAA 3PWNB 4FKEA 4Z7VB 1LLAA 4LLVA 1GGIH 5CLXA 2CO2A 1ZVHA 3R4RA 3IETA 3CNKA 4OCYH 1ICTA 4YHOH 3EGXA 1KYOK 1MSPA 4WTWA 2IGFH 4LCWD 2B9BA 3ECVA 1YNKH 2R2BA 2BWDA 1Z3GH 2WUCH 3VQ2C 2OI9B 1A65A 3MRQA 3HW7A 4HGKC 1KOAA 1S7QB 3UP6A 1S7XB 1E4WL 3C8HA 5DO2D 1L9SA 2JCCA 2Y3NA 1A6AB 1UVQA 3PUCA 4FKKA 4GW5A 4P5TA 1LE5B 3FT3A 3RWEB 2PPAA 4PHXA 2DQMA 2G75A 3LRHA 4J39A 2C1OB 3QAQA 1HT6A 3Q0HA 2BP5M 3Q6FA 5IB4A 1LDSA 3DO7B 2Q0ZX 2N7AA 2GIXA 4DHLA 3VXQA 4DP2X 3KZ8A 1V7MH 1FPTH 5FS5A 5C08A 1T3FA 4Q2ZA 3RWGB 3TYFB 3CDYA 4YSAA 2BVUA 3V9EA 1XF4A 4KOBA 1TDQA 4WEMB 5E9NA 4MVBD 1C5BH 4IRJC 2C3XA 3F65A 2HRPL 4AQ8C 1G6RA 1H5BA 1KGIA 4WWKB 1PZ5A 2WLJA 2WQAA 2YD7A 3R8QA 4FL4C 4PVBA 1GVIA 5GRXG 1M3JA 3UGXA 4XP1L 5FFOA 4CNIB 3V0AC 1MPAL 3N43F 4OCWL 4EE2A 3V52H 1DLHA 5I6PA 3T6ZA 4F7PB 4E68A 2J5LB 4U1NA 4UTCA 3HN5A 3UTPD 3ZHKA 3NJIA 4PJAE 5BMFH 6PCYA 1FP5A 2ICWJ 3KHOA 3MRGA 3DVNA 1INQA 4EBQL 3JT0A 1YY8A 3QC5X 4NNYA 1QA9A 4AG4L 3UEZA 4XC1L 4R5XA 3AUVA 1YUHA 5BS0D 4P46B 3CSYB 5MENB 3B2UD 4JPKL 3WKMH 1TJMA 4PJ9A 5DJAA 5AVVB 2Y7LA 3RQ3A 4PRIB 5ILTL 4F7TA 4MJ5B 2HFTA 3BDYL 5DJYB 2DWEB 1WBYA 2IJ0C 3ETBF 4IBYA 4WZ9A 3DVGB 4HD9A 4QCIB 3PHAA 4U1GB 3FQUB 3WFBH 5EOQH 3BPOC 4LK4A 1C08A 1T7XA 2CRZA 5A2IH 2F74B 4Z7UF 2PWFA 2NPLX 4WO4B 1FFPB 1AIFA 3O2WL 1CLZL 4RWYH 2VIRA 5IGXL 5K9OA 4K9EC 1FF5A 4ZX4A 5DJZB 4NKIL 2VH5L 4ODBD 3AXIA 4KI5D 3FQ4A 2HLAA 2JI2A 4YS4A 1V05A 5KUMA 3ULUL 2OMZA 1R33A 3Q8BA 4DK6A 4YXHH 1E3FA 1N7MH 5J7CC 2V3EA 2EE3A 3ZKSD 4AGMA 5I66A 3MLYL 2XQYG 2A9CA 2YKKA 5DMYA 5FYLL 3MC0A 3QZWA 5JHAA 3HE6C 4WW1A 2ILLA 3LEVH 1KCKA 3ZT7A 5A7BA 3N44F 2WJ7A 3A6CL 5FUZH 1OHZA 3QR1A 1E42A 2Y2YA 4JGUA 1OW0A 5LWYL 4B9GA 3GQFA 2CA4A 3LZPA 4U7SA 1SDYA 2C3HA 4BUGA 2V0AA 1XXDC 4N90E 4XPTH 4APXA 1RURL 3GHEH 2G3NA 4GXUM 3ESVF 3V0WH 3HI1B 4R7DB 4XNQB 4M7JL 4F33A 2XJLA 4FQLL 2Q8BL 3U6XS 3NUKA 2PO6B 2AQ2A 4E36A 4Q89A 4DVRH 1FFNA 4WGKA 4MMYA 3ZN6A 1A1NA 4F2MB 3B2VL 4XP9L 3N04A 1XCQB 4BBWA 1U8JA 2A9NH 4KQ3L 5AAWA 4L4TD 2I32A 3MOAL 3MV01 1CG9A 4YFLF 2Q7YA 4AM0A 1NCHA 4TTDD 1K72A 1ES0A 1MCWM 2LQRA 4K3GA 1FE8H 3JSSA 4UOZA 5IMLA 5JXEC 2OAAA 1E3ZA 2JKRM 2HKHH 3GGWB 3IFNL 5G5DA 5DVLA 3WKPA 3NH7L 1IFGA 5CM1A 2D0HA 1SM3H 2EDDA 2XVLA 4J6RL 4WVRA 1GCYA 1QEXA 2IPKB 4EUPB 2WINA 2FZ3B 3TPUB 3FFOA 4OLWH 2JELL