2VO8A

Cohesin module from clostridium perfringens atcc13124 family 33 glycoside hydrolase.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
135
structure length
135
Chain Sequence
TTVGNSTIKVNDEVQVGSAFEAILGIEGLNGDTEVYSAEYLFEYNAEAFILNEITSFNDSLFVKSKEVEPGKVRILVASLGNEIEKDSDLVKVNLTPKISSELEVLGLTTALVGAGDGNTHDLELSSKEVKINEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords EXO-ALPHA-SIALIDASE
publication title Structural Basis of Clostridium Perfringens Toxin Complex Formation.
pubmed doi rcsb
source organism Clostridium perfringens
total genus 31
structure length 135
sequence length 135
ec nomenclature ec 3.2.1.-:
pdb deposition date 2008-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2vo8A00
4UYPA 4FL4B 3F2LA 1AOHA 4WI0A 1TYJA 2OZNA 4WKZB 2ZF9A 2XDHA 5AOZA 4IU2A 4DH2A 1ANUA 5LXVA 2W1NA 3L8QA 4N2OA 5G5DA 2CCLA 2VN5A 2VN6A 4UYQA 3UL4A 5K39A 1QZNA 2VO8A 2O4EA 4IU3A 2B59A 4FL4C 3KCPA 4U3SA 2Y3NA 3BWZA 3KCPB 2BM3A 3GHPA 3FNKA 1OHZA 1G1KA 1ZV9A 2JH2A 4UMSA
chains in the Genus database with same CATH superfamily
5DMGD 4YBHA 1JE6A 4TVPE 5T5NF 2XSKA 4X42A 3V5HB 5D6CB 3GBNL 3MO1B 3WKNA 4KKQA 4M4PA 1Z0MA 3AUVA 4OJFH 4AITA 3EGXB 5A40E 4HGWB 4UQ3B 4YC2B 2WUCH 3B2DC 3KM2A 4X7TA 4W9ZA 4Y19B 3LCYA 2MRYA 3NH7H 1XSIA 3GKZA 4KK5C 4B0MB 4AMKL 4UINH 2NY6B 3STZB 2GIXA 4PG9B 3TO4B 3CCHB 3F7LA 4ZX6A 1UADC 4Q6KA 5CEXB 5I8OH 2KUTA 5I18H 4PMFA 3JWDH 3AY4C 4WTWA 3RTQA 3DSFH 2OYKA 2OSXA 1YEJL 4TUOA 5CSGA 3BD5A 1U42A 4CADA 3KBPA 1U2YA 3L3GB 4V2BA 5AVSB 4HBQA 4PJ9D 1O5DT 1S2EA 5KOMC 2DWDB 3KYKH 4HLZG 2I85A 4ODUA 4ERSL 1TFPA 2M1KA 3EYOA 4LSSL 4TF4A 2L8AA 4ZUSB 5K9OB 2YGNA 3GNML 3CMOL 1IU1A 1FAIH 2GPZA 1UWEH 2GC4C 5CS7A 5BZDB 4F37K 5DWUH 3EOTL 4GO9A 2V3DA 4GSDH 4ODVL 5ENWA 1T80A 5I19L 2O6EA 4PBWD 2MPAH 2Z92A 4MA7H 1BX2B 3E2HB 2VABB 2NSMA 3CFJA 3VXPA 5FYJD 4HJTA 3HOGA 4HSCX 5DJAA 4H0IA 1QFOA 3U1PA 2HTLD 3Q8FA 3MRCA 5DA0B 3WL9A 3W3BA 2XWRA 4ELDA 2H3NA 2QDWA 3H53A 2C9XA 2QVMA 1A2YB 4DP7X 1WT5C 4BM7A 4KJPC 1RLBA 1K3ZA 5DMKA 3V95A 5IB4B 3FT2B 1RUMH 2HVKB 1YEDA 5F1NA 2AXGB 2J1KA 2C1OA 4JFEE 4E9XA 4Q58C 5HYSA 5C86A 4GRLD 3UZEC 1Z5LA 4KVNL 5GISL 2CKNA 4PHZA 2YZ8A 1E9PB 4XOBA 5FGSA 4H20L 4ZUTB 3G5YA 4FEMA 4LSTH 1WAAA 1NCCL 1V55B 5JA8B 1FH2A 2F5AL 3MRDB 4QXUL 3IS1X 3LVTA 1MIML 5IK3B 4FQXA 1VEMA 4PBDA 4B96A 2Q8AL 1MW3A 4XNUH 5IM7B 4ZMYA 1FDLH 2CO3A 2FVNA 4WK2B 4D9RD 3ZE0E 4X6FA 1M7UA 3UDWA 1SNRA 2BCMA 4G2AA 3EJZD 4JPWH 1X5IA 4S1RH 4ZMTA 4UANA 4UMSA 4LE8A 3NJNA 3TESA 1FO0H 3C8KB 3DGGB 4H88H 4OVVA 2OI9B 1P5VA 4KQ4L 4B9CA 2XU9A 4XB7A 4MD5A 5FCUH 2X44D 3FJTA 5AQ0A 3WEMA 4F91B 1OZTG 3MJ9L 3IMSA 1RAMA 2YN5A 1YECL 1RFDL 4IOSD 2XWJB 2XZZA 3ZHFA 3O2DA 4BK5C 1X4XA 2DQMA 1YNKL 5ILTL 5F0LB 3RGHA 2X1XR 2DQCH 3BUQA 1TVBA 1JPTL 1GZPA 3A22A 2CJUH 1A4KA 5TDOA 3MRBA 4CSTA 1V7NH 1WVZA 1T21B 4RAVB 1JPST 4R5VA 4EE2A 2QQLH 3VWKD 4HIQA 2I07A 1YEKL 2VR3A 1IO4C 4P2OB 4WWKC 3IWUA 3KPQB 3QQXA 1EHKB 1W0YT 4XE0A 4E36A 5L2JB 2NY5C 1ODAA 2Q2LA 2NY2B 2Z1PA 4PJDF 4QRPD 1T89C 3RFZB 2Z31C 3D85A 4KU1A 1TTCA 2J72A 4X7CC 2QFRA 4MZIA 2DV6A 1IBZA 3IDGA 1CIUA 5DI8A 1NAMB 3I50H 4NNPL 4ANXA 4PGDB 3BD3A 4LNVA 5IMKA 3LZRA 4JCWA 1MRDH 5G4NA 4M62L 5I15H 4DPBX 4P5TA 1U36A 4RMTA 1Z66A 4HUUB 3A3YB 4QCIB 5AVYB 4L3EE 3D50A 1AHKA 1Q9OB 5KYYB 4AE0A 4PD4K 4UTBH 3REWB 5I9QC 1KLUA 1BGXL 5FKAA 1MZZA 2DQIL 3NSYA 4PJ6A 3ZQ9A 1BQHG 1VACB 2DKUA 3CUPA 4JZNB 4KROC 4CN6A 4G8GA 4NM8L 4M7KH 1XCWA 1UH2A 4NO3A 3RKPA 1QO3B 4Y19E 4UQDA 5ETUA 5H37A 2DQTL 2FLRT 4BHUA 4PV8B 4IIQA 3GJFA 4Z95L 4DKTA 1XGQB 1DZBA 4K8RH 1U30A 4HX1B 5I30H 4OIBA 5E8NB 3F6IA 4OFDA 3UTZA 5B1CA 3OL2A 1ZVSA 4PS4L 1NLDH 1AHWA 1FZOA 3VFSB 2Q3XA 4GAYB 4L8SC 1HYSC 4LL9A 5ABZA 2UY6B 4P8QA 4U6HB 1PMYA 4UV4L 2ZQKA 3OWRA 3QG6A 4HBCL 4OLWL 5FGCE 1X9RA 3KNBB 1MHCA 2YUXA 4EUPH 2WCPA 5FW7A 2BDNH 3PE9A 2AS5M 4OI8A 1DJWA 3FCSB 4HMEA 2FQEA 4PJIA 4U2ZA 4DPAX 4WWID 3P9MA 4RRPG 4E0RA 4HDIB 3CQPA 1BW8A 4PRPA 3L16A 3SKNB 4NHUA 3D5OF 2OCCB 4FRWA 3GXUB 4BFRA 4BFEA 4HCIA 4PJGA 1SJEB 4KI5F 4YBLB 3EHBD 2NY5L 1CFNB 1NJ9B 4BINA 4IW4C 5J06A 3QO1B 3WLBA 2WGXA 2WWMD 1URZA 3NDYE 2VKXA 4PJAB 1EHAA 4G6KH 1Q0EA 1S7QA 3HFML 3QUGA 4IHBA 4MHHG 4OCLC 1BJ8A 3CHOA 1DSFL 3RDTD 4K2UH 4PY8I 1PG7X 2VGLM 3G9VA 1TCRA 1W6LA 1UZGA 5AKRA 4OF3A 5I8KH 2UX7A 5F7DB 4JE4B 2E8YA 3E8UH 3ETBJ 1D5RA 4PPTA 2G60H 5DZ9A 1FV1A 1DDHA 2Y5EA 4Q6YA 1AI1H 2NTSP 1HSBA 2QMKA 3BGAA 3ZT5A 2Y5TB 4JX0A 3VFGH 4JBSA 2BFGA 3QNYB 2BMKA 3JBG7 4PTUA 4YHOH 2FEJA 3DVGB 5CJQL 1UEMA 3MRPB 1AIFA 2YD3A 3TASA 5CJ8A 2X1WL 4AWJC 3IFOA 3H9YA 1AD0A 1JXDA 3Q2NA 2BVQB 2IG2H 4XVOA 3KLHC 1DBJH 4OGAD 4XGZB 3S0PA 1GYAA 2G9HA 4J3OG 4APQD 1LTXA 2Q3ZA 2A73B 3LRLA 4KJYB 1SN2A 3OKMB 1JHLL 1IM3D 5DJ8A 5D2NC 1M2VA 3RPKA 4P5KA 5KJ7E 2BCKA 3QXAB 4LNRB 4Q89A 1C12A 3UYRH 5H94B 2ARJA 1ZIAA 1IBBA 2VC2B 3L1GA 3WJJA 5ACZB 5IBLC 1B9ZA 4A38A 4YWGL 1SYVA 3MV11 1AYOA 3FU7A 4DOHB 3SYAA 1WUZA 1UCTA 4I88A 2A6IA 3R1GH 1IX2A 4OFKA 3BWUF 4XNZB 3KWWB 5K39A 1BYOA 1LO3L 4TLUA 1J11A 1T2JA 4PR5B 5ERWA 1G7HB 2X42A 3OR7B 3HB3D 5DQDL 3WNOA 4AYFB 3IJYA 1O0VA 4OV6F 5CBEA 5CEZL 4PUBL 3RKDC 1BWWA 1G43A 3INOA 3DHUA 3MV9B 3VFMA 4A7GA 5C0EB 2YRBA 3FQXA 3RVXD 1DBAH 3CDGB 5EBMB 2E7LC 3KDPB 2Y36H 5JHLL 3U1QA 2PCFB 5HHPB 4DGIH 4PJXB 43CAB 3KPNA 3AXHA 2ITCB 2DZEA 1RQ5A 2XTJC 1FP5A 2WW8A 5FO9B 3D69A 3IS0X 5IVZA 1ETZB 2YSTA 1KIPA 5BS0A 4M7ZB 4X8XA 5I23A 5IB2B 1H19A 3O6LH 3KGSA 3U4KA 4OT1L 4NN5B 1XF5A 4NP4H 1X5AA 4R97C 2IQ9H 3MRMA 3BSGA 2WTRA 4YAQA 4FXKA 1CQYA 4OM1L 1GY2A 2XWXA 1T1ZB 2HLAB 4U0RB 4QD2E 4EVNB 4PB9L 2B5IC 2WVSA 4K5MA 3F7YA 2Z9TA 1MLBB 1UWYA 4DCQA 4OLUH 1FC1A 3TVMB 2H26A 1SY6A 3AS0A 4C83B 3QARA 4XAWL 3A67H 1DJZA 4E41B 4KROB 2OCFD 3BC9A 3L13A 4G43B 4NWTH 5JIKA 3JWOC 3FFCE 3VJ6A 3H3KA 5TF1H 5I2IA 4PRAB 4LLYB 4XO9A 4N9GB 3GMPA 5FA3A 5HDQL 1ZOXA 4YQXL 4ILDA 4I0PA 4GW1A 1INEH 2K4WA 5JW4Q 1UTDA 4RX4D 3MV8A 2PO6D 1S9VA 3BLPX 1NBVL 4HWZB 3R18A 4XBMA 4OM0H 2BK8A 2WUBL 3ETBF 1TJHH 3S5ZA 3HZVA 3LV3A 4JY5H 1G1YA 4JFFE 1NBYA 5CINH 5D9SB 4BKLA 1Q1JL 1HEZB 2C7UB 3N44F 5F21B 3TBYB 1EGJA 4N2NA 2XIIA 4L8SB 4HC1L 4DK3A 2AVFA 4MNQA 2PR4L 2XHNA 4OZHA 1QRKA 3MLZL 5JQHC 4QR7A 4R4BB 4YXHH 5C6TH 1U8CA 1S5IH 4GT7A 3FFDA 5J1TC 3H3PL 1CK0H 2P52A 4Q74A 3RURA 3X11A 1PFCA 1HWWA 1B0GA 2EXWD 2R29H 5DJZA 3RJQB 1CI3M 3LIUA 4JJOA 3V9FA 2XG5B 2JKSA 1DQJB 4O5LH 4FAAB 2Y07H 3QUYC 4S1QH 3PNRB 4MQXC 2NCMA 1HT6A 4NRXB 4PJAE 1DVXA 2RJMA 4NQDB 1IKFH 3E8VA 4ANWA 4YPJA 1WSST 2D3LA 1EDHA 3HS8A 5DJXB 4BCXA 4D9LL 1JPGA 4TLSA 5DLLA 3DTUB 1BVKB 1OPGH 5D1QA 3OXSB 4GP5B 4LEXL 1CDCA 1ZT4B 4TVUA 4HUCA 2HT3C 4WI2A 3F01A 4GG8A 4TSCH 1F6AA 4IBTA 4NT6A 4BZ2A 1WCQA 1DVSA 4MA8L 3ZN6A 3ARRA 1IBGH 4P04A 4Y9EA 1Z9SB 2VDNH 5MI0B 4U1JB 3VH8B 4ELMB 2IAMC 4QGTA 4Y1SA 4S10A 3VRLE 3W5MA 2NNFA 4BH8B 5TD4A 3MGTB 3EXLA 4QHKI 3O9WC 1MFCL 3QJVB 2XPYA 4OV5B 4XBGB 4KTDL 5IJCC 5TFSL 3QR0A 1UEYA 2F8IA 3UX9B 1KMGA 3LDBC 5A3ID 1NBZA 1O9VA 4FMFA 3ABKB 4YGAB 2BY2A 4DUXA 4N0YH 4M5YL 1SEBB 3ZKND 1A0QH 3QFJB 2BFVL 1OV8A 2P8MA 4AEIL 4DOHE 1G6RL 1V3KA 1H8OA 3MCLL 2ERJC 2IAND 2VUKA 1LNUA 1LM8V 3H8NA 4AI7A 1HZKA 5I1GL 4P46C 4N1CA 3NJXA 3CSYB 1HH9B 4LXFA 1QNZH 3MRQA 1OSYA 1W72A 1UXWA 1H9DA 3X13B 3WIIH 4NO5A 1DJYA 3DI3B 2AW2A 4IU3B 4F2FA 1O7VA 1QBMH 5D8JH 2X89D 5E95B 2PCXA 1M3JA 3NCJL 1BBDL 2W0LA 3K6IA 1IQWL 2CCVA 4YNYB 4XT1C 5FF6A 5GRXG 4PRHA 5IWLC 1IKNA 4R0LC 1MKFA 3GF8A 2WPGA 3D4CA 3GHBH 5I1EH 2FT7A 4CBZA 2OMXA 3GUFA 1ZAGA 5EC1A 5I1IH 1UJ3C 3N1QC 2HPOA 1W91A 3O41B 3QORB 2WXQA 3FN0L 4HPYL 3TYFA 1RSFA 2AQNA 4NJAL 3K4DA 4KI5C 5CLZA 2P3YA 3QEQD 2Y5QA 3KHQA 1ZY9A 3ISRA 3AXIA 3SKOA 3V8CA 3QDME 2FR4B 4AYEC 5K5YA 2PPFA 3HHSA 4DF9A 4IGBD 5TGBA 3MCKB 4BFNA 2ADFL 1VADB 3MJ7A 4UT6A 2DQJL 4A7VA 3S97C 4L4VD 4UT9H 4XNBA 3IVKA 4L1SA 1O9WA 4E41E 5IB3B 4R97B 5JORA 1J8HD 1AMXA 2ZUUA 3HCVB 2J8UA 3TNMB 4G59C 5J3HC 1LO4H 4PGEA 4HIPA 4CGTA 3ZSTA 2DY2A 2B5IB 1MNUH 1ML0A 5CGMA 3GSRA 1LEGA 4YSDA 4ONHB 2Z8WC 3DX6B 5FUOH 1AP2A 2FT8A 2GUOA 1JDAA 2IFGA 3IDJA 2WLJA 3BVNA 1AYRA 1SXBA 1BCIA 1WD8A 3QIBC 2VDQB 4XMVA 2CKBA 4Z0BL 1J05A 3BSZL 1UYWL 3P2DA 5I1AA 2AXFB 2EDDA 5DJDA 4H8WC 1N4XL 2V2WB 3VVVA 2AJXL 5MEQB 4HV8A 1WEJH 3PRZA 2ZSVB 3KWVA 4FNQA 4EN3D 1EHXA 4YK4C 2YGVA 2IALA 1NMAL 4W4OC 3BH9A 5I71C 1M9WA 1CFQB 1O6SA 5DSCA 1XAUA 5AALA 1IEHA 3BWUC 2X6AA 3ECVA 1HH6B 3V4PB 1WZKA 4LPYA 5F9JA 3AW5A 2XRAL 2J4WH 4N6QA 4NQDE 1ZT7A 1FVDA 5KN5B 2ZUTA 3CFQA 1JSYA 1X5ZA 4UV7H 3BZDA 4FQ2H 2GJJA 2LU4A 1LK3H 3QUYB 4RGOL 2V17H 5ESVB 1X6LA 1NC4B 4LARL 1VFMA 4NN7B 3K6SB 1BFOA 5BRZA 1KJ3L 2EP6A 1MFMA 3BGFB 5DZVA 3U30B 4ELME 3P69A 4FFYL 4CVXA 3IMUA 3UTTA 4GUPA 5E9DD 5FR3A 1BM3H 2KKQA 4N68A 2CZNA 4XO4A 4X6EA 1AXSA 1BPVA 2DBLH 3H9SA 4WJG3 5IIEB 5FDWB 3PCYA 5AEAA 3GBNH 3UPAA 4XN9A 4MJ6B 3U36A 35C8L 2F1AA 3A4FA 4Z0XA 4K4KA 5I24A 4QF1B 4FYRA 5KJRL 1WGOA 1H5BA 2NY3B 4M61A 2QTVA 4KTYA 1XR8A 2OMZB 4U7SA 1SHSA 4LQFL 5DEGA 2UV3A 4FERA 2XWZA 4AMKH 1JRHL 2BSTB 1O6TA 2J1YA 1NA8A 1UT9A 3C08L 5F1IA 4POUB 3VW3H 1BIHA 5IUSA 1A7OL 1Z3GL 3QFJE 4LSDA 4HIXL 3CMGA 1JK8A 2CO7B 2WBKA 1XIWD 4BV1A 1YEJH 4Y9FA 4L5FE 4R2GC 4RMQA 2H7WA 1K8IB 1PZ2A 2YPLA 4H8WL 4NFDA 3HG1A 1E5BA 4N2IA 3S5LG 1KB9J 4HWBA 3WEBA 2BVUA 3CC1A 3HZ3A 1R0AL 2Y1AA 1INDL 2A6DB 3BT0A 4ISVA 1KFGA 2FEDD 2ERJB 1CVSC 3GNMH 2VUYA 3CMOH 2CLVA 2UWEF 3PABA 3EOAB 1MCWM 5INDA 1CDJA 1F3JB 3EOTH 1H8LA 1MCHA 5I6MA 2UXGA 1OARH 1YJDC 3IDYC 3QG7L 2DYPD 1PQZB 1U8MA 2MFNA 3SPCA 4HAGA 2WSPA 1BZQK 3E3QC 1RZPA 3CAFA 4J2QA 2KMWA 2GITA 3PJSB 2X6UA 1F4AA 3PF2A 3E6FB 1IBFA 3BEVB 1BA9A 3CDCA 4R0LB 1MW0A 1OO2A 1FIGL 2ZXQA 5C0DB 3HAEH 5E6UB 1EHLL 3VGGA 1UJ3B 4U4BA 3ROLA 1KPUB 5IQ9A 4XPGL 3BJLA 1BQRA 5JMOC 3LPWA 4U1MA 1T4KB 3LKPB 1XXDC 1XH0A 4N24A 2AJYL 4GKNA 4OFYA 3HFFA 4M5ZH 4PLKC 2VLRB 4X6DB 2B08A 3WS6A 3C9NB 4MSWB 1F11A 4QT5B 1I3RA 5DS8A 4KVNH 2E7DA 1HCZA 2X4SB 5GISH 5T3XE 4Z3TA 5EMYA 1UB5B 2GJ6A 4H20H 5FK9A 3OG6B 1MEXL 2PCYA 4QUOA 3L7EB 1NCCH 4AKPA 1KYOK 1ZANL 1G4MA 2F5AH 5DK2B 4GG6F 4HFUL 3V5DB 3RIFF 1JD9A 1MIMH 4NUGL 2Q8AH 4IEFA 2R23A 4PWJA 4PWHA 4A7UA 3V4VH 1OT4A 4UB0L 4TRPL 1PLBA 4C56D 3GS4A 5E6YA 2B7DT 4K3DL 1H3GA 4RFEB 3CZKA 1OKEA 2YXVA 4RDQG 3MJ9H 3MN8A 3BZ4A 1YECH 1JGIA 1OTTD 1RFDH 3VD1A 3DJ9A 3OKKA 3NPZB 5KG9A 1KUMA 1ZV2A 2DIAA 1YNKH 4LCWB 3AS2A 4G8FA 5SWSA 1UM6H 1JPTH 2XBTA 3N43F 1FFPA 2UUDK 2EH7L 4O02A 3RIAF 5JNYA 1KGCD 4IRJA 2OR8A 3S37X 2B3RA 1YJDL 3HI1B 5I71B 4NEHB 3L3OA 1FCGA 1FNSL 3FZUD 3UOAB 3PAYA 3FQWB 1XBRA 1U8JB 4DH2A 2MNUA 1TITA 1AGBB 2X28A 3RPBA 1NOAA 3KEHA 2FX8L 3U0PB 4DFHA 5IW6A 1N5AB 2P5WD 1T6VN 1OXYA 2X9YA 5ACLA 4NNPH 4BFGA 2YD4A 4ATWA 1RZGB 3KXFB 4NOBA 4CSZA 1RZIB 4M62H 3NABL 3H1ZA 2W9LA 3GFUA 5I74B 4PJFF 1U8OA 1D5XA 2LU5A 5AVUB 2NYKA 4PCTA 2VL5B 1BBJA 2F08A 2G3XA 1BGXH 3O3DB 1JV5A 5DVOA 3DNKA 4ETQB 5DMGC 3KPSB 5GGSB 1C5DA 3MNVB 3VQLA 3CLFL 1X5HA 3IJ9A 5IG7A 1I9RL 4Y5VA 1ECYA 2IO5A 1T66C 2OXHB 4I9WD 1EHNA 3GIVA 4MS6A 3FU6A 2DQTH 1P1ZB 4Z95H 1X9QA 2WC7A 2NSQA 3B7UX 3BEWB 2WQUA 3T5WA 1E4XI 1QATA 4JJHA 1QFWM 4H8PA 3WLWD 3V6ZB 2WO2B 3K2KA 5AVRB 4PS4H 4PY7B 3QCTL 4AJ0A 4CVUA 2ZXGA 4XMUA 1N68A 1OALA 5E2WL 4KXZI 4YHIB 1WA1X 2M26A 4X5WA 2KERA 3O6FB 4UV4H 4EZJA 2WNWA 5GS0D 1WC7B 2HKHL 4KTEL 3QEUB 4OLWH 4YLQT 1TF4A 3R8BB 4N28A 1U8QB 3VI4F 4PJ9C 1FO0B 3QIUA 2XVBA 4K0OA 5ACMA 4L3AA 1SJXA 4HJ0D 1VKXB 4KNUA 5B3JF 3DX7A 3ESMA 3PP3K 5JLZB 4HK3J 4OY9A 5LBGA 5DXWA 3NQKA 3N44B 3L08A 4ZX5A 5K1VA 3FN3A 5HGBA 5KSAB 2X3AA 2NUTA 1EEYB 3QZWB 1MQKL 4NOFA 1YLBB 4WV1B 3IDYB 2OPCA 5L4MA 3D2UB 4K7PL 4EOWL 4HH8A 2AJ3A 2EIBA 2GIYA 2MCAA 3HFMH 3TN0A 3VTMA 4YN3A 5A6MA 4GIPD 1DSFH 5CKGA 4GEJA 2V6HA 4LSVL 2V3FA 1J9TA 1T3FA 3IKCB 3O2WL 2CIKB 2HTLC 3TJPA 4AQEB 1S8DA 5I1LB 1KJVA 2QFPA 4EAEA 3LKRA 5GS1C 3UO8B 1QA9A 2VLRE 3BH8B 4X6DE 4YDZA 3LZLA 4PV1C 5PAZA 4Z7VF 3BPLB 4MWFB 1UXSB 3LVEA 1H15B 3OX8A 4HG4J 5ICYB 2R51A 4JFEA 4GRLC 4ZAKB 3F84A 2CBMA 1F8TL 5KBPA 5LHDA 5CJQH 1IGML 1QPKA 3NOIA 4GXFA 2I27N 1OM3L 4MQ7A 5EN2B 4YSCA 4ODHL 1GGYA 1IT9L 2IWEA 5DD3H 2IWKA 4LP5A 1WO2A 5L2KB 2COVD 4M6OL 3JWNG 4LKXA 4IYKA 1RK0B 2ZKXA 2Y4SA 5EO1A 5SWQB 4KVCL 3I6SA 2VXQA 3EJZC 4L3CA 5EV7A 3VVWA 4ZXBB 2BVEA 1IGCL 4XMKL 2DF3A 1HQ4A 2C4XA 1U93A 3CC5A 3P30L 5C0AD 3WS3A 2GJZB 2XZQL 4YWGH 4BZYA 1C5CL 4X98A 4ALAC 4LCWE 1E2ZA 4CMHC 4Y88A 4G1EB 3C60A 3VXME 4WO4A 2FJFB 1T1XB 5LGYA 2P8LA 3VXTA 1LO3H 2BHZA 3PXJA 4LKCA 5IVNA 2E7BA 3B5GA 1MCLA 4U6XA 5DQDH 5FIEA 1LO5B 2KBGA 5E2JA 5CEZH 2F8XC 3NESA 4PUBH 1R3LB 1AOZA 2OW7A 4FHJA 5LGHL 4UZUA 5L6YL 4KRMB 1S7RB 1EO8L 1BXUA 3S4SB 1C7SA 3T0AA 4ZO7A 5E1HB 4DGYL 1HNYA 5AVZB 4IRSD 1IRAY 1TQBC 1FFTB 1FNAA 3MUUA 3VNYA 1YAZA 4P2QA 4B60A 3IBOA 2EVIA 4HALA 3PQYB 4YHZL 3O4OC 4HOZA 4MX7B 1NQBA 4NAMA 2VOTA 5I1CL 5MEOA 4HUNB 5EU7E 5D7IE 3APFA 2X4RA 3Q2VA 2JJWA 4OT1H 2XA3A 3RVVD 3KPSE 2EE2A 4L3EA 5C08B 5F8QC 4CU7A 3CZEA 4HJSA 2IDCA 3U1SL 1NCDL 4X5RA 3TM6A 4PB9H 3OKLB 9CGTA 1E5YA 3BIKB 5HYQA 5DD1L 2DLIA 2HUEA 4XAWH 4TN9A 5IROA 1J12A 3ZY7A 4Y19A 4XCNB 3WDHA 1L7IL 1JUFA 3RE0A 2E86A 1DYZA 3ZKQD 2YRZA 3ZKMD 4ODXA 4PG9A 1XGPB 2WWNA 3CCHA 2YGPA 3PFUA 2VXUL 4RZCA 5HDQH 3GBEA 1BXAA 2DQEL 2BH0A 2GVYA 2MWCA 3EBIA 3HTLX 4YQXH 5DEFB 5AW9B 4D7PA 2A6JB 5E4OA 5KBKA 3GPEA 1A6UL 4Y9CA 2ZCLL 4MD0B 4E9YA 4FC3E 5AZEL 4YHML 4G7RB 3FFOA 4AVJA 4EDWL 1IGFL 3F05A 4XHQA 4ALAL 4BWWA 2PR4H 5E2TL 4ZUSA 2DQGH 2MHAB 5LGJB 4BXSV 3LKNB 5F9DC 1SN0A 3US9A 1V27A 5BZDA 3H3PH 1GGCL 1X7TA 1IAMA 4FQPA 4GIOA 2HVJB 4PJ9B 3ARXA 4F9LA 2ADIB 4LGRB 2JB6B 3RGVA 4JO3L 2BM3A 4UWQB 3V7MA 4AV5A 4NLHA 4X5QA 3UP6A 4M8QB 3SBRA 2H1PH 2V2XA 2VW6A 3EHBC 2IGLA 4DEWA 1FFOA 5ID0A 1KBWA 1SQMA 2K70A 1TOXA 3RDTC 4LEXH 2W81C 1A2YA 5C9JA 4XNMA 4MA8H 1QNIA 4RWYL 3LZFL 1EEQA 3FT2A 4QHNA 4FLRA 1ROCA 4LEOB 2IXQB 1YSOA 1HCYA 2QKSA 2YD0A 1U8IB 1CICA 1HHIB 4OZFA 4D0DB 1E9PA 4HJGB 5DZJA 4KY1H 2ZX5A 4NAQA 4MJID 1G5AA 2ZAGA 4JNXA 1ZDSA 1HQRA 2WINA 4L8BB 4C55A 4AX3A 1MFCH 3H9HB 4LPCA 5IESL 4KHTL 4KTDH 3T65A 1ZTMA 3TLRA 4DT2A 5TFSH 5IM7A 4FXGA 4ZI8A 3I9AA 5IT2H 5B4MD 5MENA 3EJRA 4OGAC 4I5BB 4WU7A 1AGEB 3G5WA 1FWXA 2AK1L 4FL4C 4L0YA 4APQC 1BSIA 4OUUA 1OE3A 1GGIL 5CGYD 1WA0X 4WFGE 1IKOP 3RDJA 2IGFH 5ANMB 3NJIA 5TDPB 4KQ3H 4LHUG 3O3BB 4NNXA 1XVSA 4TULL 4X2UA 3ZUCA 2BFVH 1MFDL 2YEZA 1U8PB 3GTVA 3IXAB 5EC2A 1G6RH 1I8KA 4FQQA 3UP1A 4BWTA 1M2OA 1FZJB 4ZFOA 1E4KA 1LDPL 5IEKB 2EUZA 3ASWA 1XV8A 4GAGL 3QEHA 4XO8A 2FJHB 1MH5A 4PJHF 4BRVA 2QELA 4PJCF 1T21A 4RAVA 1ZLUH 1ZA6A 3NIGB 4TOYL 4AEFA 3GBML 1HWGB 4FI6A 1KB5L 3QR2A 4A2FA 3NCJH 1BBDH 3NZUA 3KPQA 4Y4HA 1IQWH 3HB3C 4GMTL 5DT1L 3DC0A 2XI9A 5GXBB 1MHEB 4EO5A 3GJEA 2FBJL 5ELIA 5L2JA 1IGJA 3D4ZA 1T7YA 3RVXC 3SBWC 4V1DB 4POYA 4PWGA 3VWKB 4B50A 4RGND 4HK3N 2AEPL 1MXDA 3PQYE 2R1XB 1I7UB 4MB5A 3FK3A 1S7UB 1E0OB 3QEGH 4HPYH 1D9KD 2ARWA 4NJAH 2F68X 1PKOA 2GTZB 3BP6A 3GRGA 4P2RB 4WEEA 5MHSE 3IAGC 4WTXA 4FYQA 1G7QB 3AB0C 1OGSA 4WGKA 3DO4A 5EU6B 3WGVB 5C08E 2ICWJ 3E7JA 3FCUB 4P5RA 1WP6A 2ADFH 3FOMA 2YLHA 2Z93B 3MNZB 5JO5A 1VACA 1SDDA 2XY2A 1I1RA 3U6RB 2DQJH 2CXKA 4HEPA 5IQNA 1EFXA 3FO2A 3LHPL 4UM8A 1OGAD 1RULH 3IN2A 1P7KA 1UACL 1QO3A 1QQDA 4XZUB 3FO1A 4M43L 1WFTA 4NQVB 4PV8A 3EFDL 1QR1A 1XGQA 1DVTA 1MREL 2NW2A 3GGWB 3US1A 2JV6A 1VF5C 4NUQA 5GQBA 5E8NA 4EKXA 3FFCA 4EZKA 2BOCB 3IU3A 2BHYA 3P4NA 1IEAA 4J6RL 3JT0A 1F4YL 2XA8L 4RGMB 5T5FL 4GAYA 4AIZB 1BF2A 4OBSA 2PO6C 2MJWA 5KAQG 4Z0BH 4JFXA 3TPUA 4NAJA 3BSZH 1UYWH 1U91A 4Y5XA 4IBUA 5E9NA 4HKJA 1AE6L 3LH2H 3SDCA 5FYLD 1N4XH 1OSPL 4JFFA 4KVPA 4EIUA 2AJXH 1AQDB 2WV3A 1YRKA 2ICES 1ZTXL 4I3RL 3ZTNL 1WZ1H 3FCSA 3BP7A 1NMAH 3SIKA 3MUJA 5E5MA 1JK9A 3GI8H 1RHHA 1SHWA 3BO8A 2TRHA 3MOAL 3Q06A 2PPDA 4RMUA 1U9KA 3CZFA 4UNTA 2EXWC 1WBYB 1U95B 2H6PA 4LCYB 1NDTA 5F7UA 3PXHA 1SJEA 5HYIA 5AB1A 4TNVK 2CM6A 5FAAA 4NPYB 2LV4A 4CVZA 2A4EA 3SKMA 5ISZB 3GTNA 4AM0B 2CCWA 4F15B 2J8HA 3N43B 1J10A 1THCA 2YGOA 4H0LC 4AUUA 5LCVA 4LARH 4N2CA 4WO0A 3EHBB 4EMZA 2W59A 2HZHA 2PR9A 1KJ3H 2FD6H 3RTQD 4F8QA 2X7LB 4OJCA 5BUAA 1MQ8A 4FFYH 3LNGA 2VLJD 2X4TB 3C6LB 4FQIL 4MJ4A 1O7DC 1Z5YD 4HOMA 4KRLB 4N6RB 2FUTA 3QCVL 5EFIB 1A7QH 4H2CA 1Y6MR 1TQWA 2Y5TA 2P43B 1QR4A 2HLEB 3QNYA 4R90L 3B1UA 2YEVB 4Y7OC 3MA7A 4NQQA 5J6HB 1F00I 1JWUB 3T1FB 35C8H 1N67A 4JRWA 3T6XA 2UXVA 4JW3A 4N22A 4LLUB 5JDSA 2QVKA 4RAHA 4LQFH 4UT7L 4KJYA 2GY7B 1JRHH 1QFWL 3CXDL 3O81A 3C08H 5A3IC 1ND0A 2ZCKL 3WGUB 3IF1B 5E0QA 1Z3GH 3FKUS 3ZVVA 4F92B 4G80A 3KLDA 2NNAB 2VDRL 4FL4B 1FL6A 4IMLB 2FGZA 3ZKNC 1J9RA 4AVIA 5ACZA 1OW0C 4X4YB 2TAAA 2XACC 3CQFA 3RWDB 4H8WH 5DZOA 4AL8H 2EIEA 3AS1A 1R0AH 1T4WA 2J2ZB 1RKRA 2ZP8A 3D8MA 3NIGE 4P4KA 4E9SA 5AAWA 3RI5K 1FNFA 2XX1A 3PHQA 4YOKA 3WBDA 4ZNEE 2EVHA 1Q9LA 3BPNB 3A23A 1DFBL 1JGDB 4N2KA 4AYFA 5CP7B 5JXAL 4H0GA 3HN8A 1JWSB 5C0EA 1CL7I 4N2GA 4JRXB 2ZXBA 4F2EA 4V1DE 3QG7H 4J5VA 3G5ZA 3IBEA 1NCBL 3VI4B 2PCFA 3DMMB 2G3ZA 5BV7C 1CIDA 5HHPA 4AQAB 1OPOA 1VFAA 3HS0C 3L8QA 4XP6L 3NJHA 2ITCA 4GFXA 4JVPA 4P2RE 4Q9QL 5T1MB 1FIGH 3DTDA 5BQ7A 4ODBD 1VCAA 5FO9A 2WXGA 1ETZA 3BYTA 5EU6E 3ET9F 4Z7WA 4EXPX 5IB2A 5GSRB 4XPGH 3BXNA 4QRTA 1MAML 3QDMA 3QUZB 4IGBC 4DGUA 2AJYH 1S9WB 5LJYH 4N86A 3AB0B 3B7YA 3Q7JA 4J3WA 3ZDXE 1LO0L 4N3UA 4G8IB 4OD1H 4JQIA 3CN2A 2FX9L 3TVMA 5D7JA 3BKJL 3LZQA 4Y16D 1MEXH 5EOQL 4G43A 4U1LB 4OVUA 4XOAA 2GT9B 3OAYH 1ZANH 3WIHL 3JT2A 4HFUH 4P49A 3NZSA 1KGXA 1SHXA 3L4XA 4NI3A 4O9HL 4F7PA 4OCSL 2YMOA 5I75B 3ZTEA 1ZK9A 4MS8D 5C0FB 1FYTB 3UTSE 5EO9B 4UB0H 1XT5A 2PTVA 3RZCA 3D85D 3QHFL 3LY6A 3H54A 1PCXA 5I1DB 4K3DH 4R7VA 2NXYD 2X6BA 3OC8A 3CDZB 4LEEA 3WY3A 4DVBA 3SD2A 2WAQA 2DMBA 1EAJA 2PO6B 4PBXA 5EUOF 5AD0A 4R4BA 2JE8A 2ZWNA 4LVOB 4OKVA 4EN3C 4BFOA 1FVEA 2IWFA 3SDXF 3C09C 2XQ0A 2QPSA 4Q6IC 2WXPA 3VYPA 4DP9X 2C1PB 4G8GD 3V79C 1DVYA 1DANT 1F1AA 1FNGB 4LBAA 4N2MA 1YJDH 1F13A 1P84J 2VM4A 3HUJF 2FBRA 3EKCA 4NRXA 5ISZE 1FNSH 5BV7L 1GGTA 3DGCR 4NPJA 7PCYA 2FX8H 2OK0L 4GQ9L 1BVKA 3N41F 1F42A 1E28A 1OQOA 2G5UA 5E6IC 4KH9A 1UASA 5E00B 2W0FA 2Q7YB 2C7FA 3AWFA 3MTRA 2PWGA 2XKUA 4MMXB 3RWHA 3NABH 1VZGA 4UNVA 1MNNA 3APNA 4U1JA 2N7AA 4RRPM 2ITDB 3GHPA 1TETH 5BO0D 5ID1B 3GQFA 2VW4A 1S7TB 2NUPA 4NC1E 3F65A 4B7LA 5E94A 5HVHC 2A3TA 1G7PB 3IDNB 4BH8A 4JQXC 3MGTA 2ZPKL 4XX5A 8CGTA 3LH8A 1I9RH 3PLYA 4OV5A 4XBGA 1MCWW 4BXVA 4ONOA 2RTTA 2Q86B 1PJ9A 1J1XL 3WNKA 3GLZA 5A16A 5J4MA 5BQDA 3RWGA 3PIQA 5IF0B 3ZE2B 4LCIL 4HS6B 4ABQA 1TJGL 1FF5A 2XFXA 5FCSH 4W9LC 1IM9A 1CXKA 2G3NA 3PGDB 4YFDB 4NRYB 5J1AB 3QCTH 5EO0B 3QFJA 4H2AA 2EO1A 4Z7UB 3VXSA 4KX7A 1ZLEA 1CGUA 1XIWC 3FN9A 3GM8A 2YRPA 2YUZA 3CFBB 1GSMA 3INUL 3NN8B 3ZX1A 4X4XA 3CE1A 3RX5A 1HHKB 3V4VB 3FCTA 4ZMZA 4FQCH 4GQPH 3S8FB 2A1WH 4HUKB 3GXNA 4PJ7F 2HRHA 4ZFZB 2ZOUA 4HEME 4ZS6D 4MYPA 1SLWA 5IV2B 5KVFL 3EYQD 4H1LH 2FEDC 2IANB 4JRXE 2RQ8A 2LVCA 2OYLA 3TEXA 1ZEAL 4O51B 2XWBA 4GXVL 4NZTL 5GS2H 3VI3F 3RX8A 1MF2L 4GS7B 1X5GA 3VUAA 1RCYA 3LKOA 3RQ3A 5I73C 3O41A 3ABZA 3ZO0A 2VZSA 4XCEB 4IU2B 5HGAB 4TUUA 1CLYL 2NY1B 3V55A 4G7SB 4K55A 4EOWH 3K8KA 3QSKB 4U6VL 1KDIA 1LP9A 3K72B 1QG3A 3Q1EA 4LSVH 3W39A 2APWA 2FR4A 2IJ0C 2P26A 4O2CA 1R5VA 2FO4A 1EBPA 2BIMA 2YQBA 4I1NB 2VH5L 4KO6A 3QEQB 3D39D 1LDSA 2FYYB 2QR0B 3ARBB 4AE1A 3V0WL 2JNZA 1YMMB 3BCFA 1TTRA 1F8TH 5C09E 1B0RB 3BN9D 1THAA 5EBWA 2JK5B 1IGMH 5KSBF 5AAMC 3M1CA 1PYWB 3HMXA 1OM3H 1CFTA 2XN9E 3DBXB 1MCRA 3KL0A 4ONHA 1I75A 2LTQB 1QZ1A 1FYTE 2JI2A 3DX6A 1ZVNA 1IT9H 3FTGA 2VDML 1Y18B 2JKTM 1XD0A 4K7FB 2IPUG 1J5IA 1A3RL 2E47A 3RNQB 1M6UA 4KVCH 4KV5E 1OCZB 4PWKA 2AK4D 2IDFA 1XH2A 4NDMB 1CFVL 5LNEA 1T03H 2F9BT 1IGCH 2LR4A 4X7EC 4XMKH 3ELAT 3T4AA 2H4EA 3P30H 3TCLB 2V2WA 3BP4A 5A6LA 1IVTA 1IFRA 2XZQH 4NC2B 5BS0D 1C5CH 5B7EA 5CCKL 1RVFL 4PJEB 3MLXL 3HE6B 4UUJA 1OTTC 2F5BL 3MXVH 1P6AB 2GW5A 4QHUB 1JZ7A 1CFQA 3FBKA 2B4CC 1NUDA 4NKDB 4JANA 3V0HA 2B20A 1ORQB 3QFDA 2VAAA 5E51A 1S7SA 1Z9MA 5F96L 4G6AD 3V4PA 5CD5D 3STBA 2OMUB 3UTQA 3QNZB 2WZ6A 3VGAB 4OLEA 4IJ3C 1O6VA 1J8KA 1AY1L 5L6YH 2BXZA 1MW1A 3B2UD 3FZUC 3GLDA 3BAKA 3MRFA 3N55A 4WRLA 5C97A 1JERA 4B9FA 4DGYH 5GGUB 3QJQB 5ESVA 2UZXB 1JNNL 1UJTA 1ZXQA 1NC4A 2DH3A 2CRIA 2VN6A 3CZUB 2X4UB 4I0PD 3MLWL 1AQKL 2VXVL 3MV8D 2B1HL 5EA0L 3K8LA 3LPOA 5I1CH 1FNEA 3FO9B 4NHCL 2A77L 2CDFB 3FULA 1QD0A 4QJ5B 1AGFA 1T22B 2J57A 3TH4T 5IIEA 5IJBC 4MNQD 4IS6B 5D1ZB 2HRPL 4HJIA 2MQ0A 4WI0A 3MZTA 1NCDH 1C1EH 4XPTL 5FGBC 4NO2A 4Y1TA 3HAEG 5HDBB 2IFFL 4A2MA 4QF1A 2BC4B 2WXOA 5LAXB 5GGRY 5KSUB 5DD1H 1T5WB 3ZUNC 3ZE2E 1NDMA 3PNWA 1QLEH 3U6XA 4A7TA 3PWNA 3PDOA 2ROYA 1EAPA 2BSTA 3MA9L 3V0GA 4JY6B 1CGSL 2VXUH 2YPKA 2CUIA 2DQEH 3SGKC 5MEPA 4Z7UE 3WLWC 2FQDA 3ZYJA 3A4AA 4B3EA 1A6UH 3CIQA 2CRMA 2ZCLH 2XV0A 4Z7QB 3NIFF 4GRWF 1ZSDA 4XXWA 4W6WB 4YHMH 3R0NA 5AZEH 3O4LD 1M3IA 4AVKA 5GS0C 2CO6B 3CXHJ 1MIEL 2DQFA 1IGFH 1DBBL 2G0KA 3GSNL 4EDWH 3KJ4C 3ME0A 3HG2A 1I7TA 1XIWB 3O45A 2NY0B 1UD2A 4AT6B 1RZFH 2B4CL 3D25B 3EOAA 3T0EB 4HJ0C 1CF8L 1GGCH 2G0LA 4YDLC 3RZWA 1CDYA 4RZKA 3W11D 2DLFL 4ZFGL 5DHVH 4JO3H 5AYUL 4U7KA 5FLUA 4BELD 2FRGP 4X4ME 4YX2L 1J48A 1WFOA 2AAVA 4YVNA 1J1OL 5TK4A 3B3IA 4FFWD 3WUWG 5B8CC 1J5OH 5SV3A 4QTHA 2DYPB 5KOVC 3KYAA 4UAHA 1FBIL 3MJ6A 2YUVA 3QJFB 3B5HA 1U8LA 2ZT9C 5HYJA 3KW8A 2EYTA 4FADA 5CD3B 1EDQA 3LKPA 2DJUA 4OLZL 3RVTD 3OF6A 2EDYA 5I8CB 5ADPL 3LOWA 4DNLA 5C7XL 3MSPA 4X6DA 4DUWA 5CCGE 3VCLB 4MSWA 1YMME 3GO1L 4QT5A 2VTFA 3B2VL 5EH1A 4OSUL 1DVQA 4A68A 2BY0A 3OAZH 1UB5A 4FTVD 1ZT1A 2YXFA 4IDJL 4TYUA 3VXQB 2W38A 1GKEA 1LD9B 3BQUA 3R06B 4XN1A 3V5DA 5JYMA 1KIUA 3D3VE 5IESH 1KV3A 1KIQA 4KHTH 4JHZA 2X4OB 3ULUL 3HC0A 3ZDZE 1MCEA 3HRPA 1OCRB 4N2EA 3SKJL 2WWKO 1B88A 2AK1H 1N59B 3OQ3B 1GGIH 2ZOTA 3GK8L 3VMOA 3BWSA 5I1KH 1UA6L 1IAIM 3R4DA 4JDZB 2EVFA 2HP4A 2WM0A 4XB3A 3KDMA 3TBWB 4L1DA 4TULH 2EIZB 9PCYA 1RUKL 1MFDH 1GCFA 4LDCA 4PJEE 1OOAA 2O5NA 5GS0L 2ENQA 4YVUA 4PW4A 5DVPA 2IOIA 4XN2A 2BIIA 2KT6A 1WAEA 3UROR 1WLHA 3ZMRA 1LDPH 2MQGA 1JXJA 4W1TA 5DRZA 3V9EA 1MCOL 5CJ5A 3KPPA 4GAGH 3VXMA 2QPFA 4OZIF 2YO3A 5JOPE 4N0CD 3MMEA 4TOYH 3RP1A 4JVUA 3TO2B 1KB5H 3AREB 3ZRCC 3VFVA 4WWNA 1TU2A 4GMTH 3OVUB 5DT1H 1HK6A 4H0HB 4HIEB 3BW9B 2FBJH 2RHEA 4PLJC 2DLHA 1VEPA 5J89A 1F6FB 1S7WB 3HI5L 4IBYA 3CLEL 2YPVA 2YD8A 3QWOA 5KYXA 2C9AA 4ZMNA 2DM3A 4J6IA 1N5AA 1PZDA 2PPEA 3BGMB 5F1SA 4IRSC 2FL5B 4FNTA 1YHPA 2QPEB 2NY4D 1DCLA 1KELH 5IP4A 1CMOA 2V7NB 1RZGA 5LDUA 4ZTPL 2EYRB 3MNMA 4JJ5B 4AUJA 1YVLA 4FGMA 5IKCB 1SQ2N 4P3DB 2P5WB 2VL5A 3DDFA 5D7IA 3G6JA 3RIKA 1IC4L 1YDPB 3O3DA 3RVVC 5LN8A 4Y4KD 1I1CA 4PWEA 2R1WA 3BOVA 5HDBE 2XPZA 3UYOD 5IHZA 2TSAA 1UUSA 1NCNA 1QPXA 3KLSA 1ZA3A 3LHPH 4XP4H 1UACH 2DDQL 2I32A 4MXWL 1HXMA 2UZIL 1XCQA 4G5ZL 5D93C 5F7WC 3N42F 1P1ZA 4M43H 2ICEC 5BNXD 1OAXL 2E74C 5DQ9A 3BEWA 1MLCA 4YR6B 2APXA 3AT8A 3O3AA 1PDKB 1KENL 4Y0GA 5EEYA 3ZKMC 3BAEL 3V6ZA 4C54A 4J6RH 4DKFL 1U8NA 3V0IA 1F4YH 2DRUA 2XA8H 5T5FH 1KGWA 4Z7QE 5KBLA 3AGVA 4H5SB 3O11B 4RIRA 1TPXB 4PAZA 1GKOA 3A24A 5LBSH 3O6FA 5K1NA 1T5XB 1P9MC 1WC7A 3MGOA 1JWMB 1U4FA 1IMHC 1MCSA 5BRZD 5PCYA 1OSPH 3APMA 3K7UA 1U8QA 3MROB 3W0WB 1FO0A 1O5PA 2KZ1B 1SJHA 3GSXA 3M88A 1ZTXH 2F7IA 3T0EE 4U49A 1G4RA 1VKXA 1R75A 1I1AB 2EDMA 4GY4A 1G0YR 5JLZA 4TPRL 3TP4A 1L6ZA 2MCPH 3MOAH 3H9SD 1HL9A 2WJ7A 1QVOA 4GUCA 4WTZG 2RIKA 2MKLC 1N0LA 1NAKH 4F33B 2JKRM 4J3OC 2OMWB 1R3JA 1WE5A 3ARDA 3LXBA 3EYSL 4FMKA 5DD6B 3ZYOA 5KSAA 1USQA 2LU7A 1RJYA 2L3BA 4OCYL 4URTB 3ZGIA 1JZ2A 3GM0A 3TZVD 5FA4B 2WQVA 4J39A 3BVUA 1E8WA 1EJ8A 4H8HA 3IGUA 5DHMC 3SDXB 4N8VG 2R2EB 1A5FL 4AQEA 3IKCA 1TVHB 2OX5B 2BNUB 3AU0A 4OUOA 2ZICA 3HUJB 3OZLA 2Z64C 3E9UA 5FYKD 2R69L 4OLXL 1VGKA 5B3NA 1RMFL 1ADQL 1Q94B 4FQIH 4L8DB 3KYNB 5LKNA 1XCXA 3ML9A 1QSEB 3U2SB 4FA7B 5EORH 3HG1D 5D1ZI 4QYOB 5ICYA 5EZPA 1JYXA 3V6FB 3N41B 3D0LA 4JCMA 4R90H 3LRKA 4PJ8B 4TL4A 5AVTB 4MXVF 2JKJA 4UTBA 5GSVA 1ZSHA 4B41A 3SY6A 2H8PA 3QDGB 3VH8G 3PV7A 4LAJH 2F0CA 2XQYK 5E9AA 5ESQB 3O8XB 3ZMEA 1MVUB 3W9EA 1ETJA 2YD9A 4LHUA 5GRZA 3S34L 1V05A 5B4MC 4UT7H 2R0WL 1QFWH 3CXDH 5JPMC 2V5RA 2ZCKH 5CGYC 4Y2LA 5F9WC 4BBWA 1I8IB 4M4RB 4OIAA 1OK8A 2VDRH 2OLDA 1FJ1B 4ICXA 3T2NL 4AQ8C 5F88A 2DLEA 2KPWA 5D2NE 2PMZA 2Z3FA 2ZXDA 1SM3L 1H6TA 1HOCB 4WJ5A 5F9OL 1OSZB 3GRWL 5FW6A 4G1EA 5EF0A 2F74B 5B3SB 1D6EB 4ZSOB 3RUGA 1WWWX 2Z4QB 5CN2A 3QI9A 1PG7L 5IB5A 1S9KC 1IQDA 1INQA 3KPOB 3I75A 4KBPA 1CO1A 4EUPA 2ATAA 1JN6A 1I3VA 1DFBH 3KCPA 4E5XA 5JXAH 2ZAHA 3DA0A 2K7PA 4R8WL 1R3LA 4LOUD 3MYZA 4GOSA 2GJ6D 3DHMA 1MELA 4PRBB 3T77A 1UM5L 3JTTB 1NCBH 3K81A 3S4SA 5C0IB 3T8XB 4MMYB 4MVBD 4RGNC 4X0KA 4A04A 4XP6H 2VDLL 4CC0A 3DX8B 3PQYA 4Z7NF 2FIRT 4I48B 3FU5A 3BX7C 1D9KC 4QHLB 4J1UA 4MAYB 1KTBA 1KTLA 5C7ZA 4OH2A 3VI3B 4AEHL 4IRSB 2W65A 4G6MH 2IWGA 2IBGA 1TJMA 1K4DB 1MAMH 3CHPA 4ONGL 1YAIA 4AV0A 3X1NA 4D8PB 2CGZA 3FAXA 5J6GA 3FMGL 2SODB 3IJEB 1Q90A 1Q4NX 1FFQA 1KXQE 1AOHA 3OKLA 2FLMA 3OG4B 2WTPA 3LKSA 3RL1B 2FX9H 2Q3AA 3BKJH 5SWSD 4YSAA 2I25N 5EOQH 2FJSA 4XCNA 2H9GB 2BINA 2YXMA 3WIHH 2WXLA 4G6JL 4PJGF 2AQ2A 1K72A 4IRJD 4OFQA 3H2QA 5BUGA 4O9HH 1JPEA 1G1CA 3NFPA 4H44C 2WIIB 1FNLA 3BAYA 5DTFB 5DEFA 3V10A 2RH0A 2CNYA 3OMAB 4NN6C 4BA0A 1R47A 3N1FC 1GMEA 4IHOA 5F6HJ 2VL4A 2YAQA 3MYJA 3QHFH 1H3UA 2O26U 5T1KB 4F5CE 2IQAA 3W0WE 1AQHA 5JMRA 4LB8A 4LLVB 1SEQL 2CG9X 5TDNB 1BV8A 3VWJB 4J3SA 1C8QA 1NL0L 3EJSA 4GW5B 2Z65C 1P5UB 4UAOB 4X7FC 1BG1A 3B3BA 2WXIA 3GZKA 1ID5I 4WHTB 2JB6A 1AGDB 3ZQWA 2BWQA 2H32B 3U4AA 4AXWA 3X12B 2BP8A 4O2EB 3SYPA 4TVPD 3VFTB 1MFUA 5CCJA 4G7QB 3U46A 3IU4L 3GT6A 2MPVA 3ISWA 5AZUA 5C0RL 4GPVA 2AKRA 5BV7H 4K23L 1A6ZB 2OK0H 4EI5B 5IVXB 1UZ8A 2DQHL 3FUDA 2AZAA 4GQ9H 1GC1C 2R0LL 1U3HA 3TBSB 4BUHA 2WLKA 3DOSA 3KWXA 3RU8H 2E9GA 2VDOB 3CK0L 3PWPE 1YG9A 4H8VA 3RTQC 1QSEE 4Q0XL 3OM3B 2BZDA 5A6IA 4AQ1C 1N5YH 1U8IA 3TA3D 3DJTA 1HHIA 1X5JA 2BSEA 3D2TA 4OGYL 5EN3A 1NCHA 1GZHA 4YZFE 2WLYA 3X14B 3QIUD 1BIIB 3QDGE 2J55A 2ZPKH 4L8BA 5AG9A 5D72L 5DA4A 4A6YH 1DJIA 4WUUA 2C3WA 3GI9H 3H9HA 4GI9A 4HHWA 1HJCA 3CVHB 3IJSB 5IW1A 3OKOB 2DLTA 1J1XH 4JREC 2EDEA 1AGEA 1CFSB 4B7IA 2X9WA 12E8L 1TJGH 3VE0B 3H42L 1JP5A 1QSVA 3UBFA 5TDPA 3IJHA 4JL1A 1CF1A 1U8PA 3IEAA 5DJ2B 3TN0D 1XGTB 3INUH 5EU5B 3LHAA 1MDTA 2V5SA 5F9WB 1U21A 2CPCA 4YL4A 1FZJA 1LEKB 3QJUB 3R7RA 4KKBD 5JPNA 5ABAA 3NFNB 3QH3B 5EIIA 4LP8A 2IH3B 2F58H 3WEAA 5KVFH 4H40A 4ABUA 1N9PA 5DD0L 4BFBD 2HJFB 2FIKA 3A6BL 3LNDA 2WXFA 4HKXB 4JFED 3KH3A 4DN4H 4I2XB 1ZEAH 4HCRL 4GXVH 5DZAA 2CA3A 1MF2H 3P3YA 4LCCC 3LEVL 1EAOA 1M71A 2R29A 4ZUWB 4AK2A 2X2IA 1ZLUK 3B9DA 1M7XA 1I7UA 5T8IA 1CLYH 5CEYB 1BJ1J 3LKQA 3WNJA 4OZ4A 4P2RA 1GC1L 1A3QA 2XWDA 2E9WA 4U6VH 3UDWC 4B9KC 4OZGB 5K9QI 1BEXA 4JZJA 6TAAA 5EU6A 3B4NA 3P4LA 1EK3A 4X9GA 3EUDA 3L3HB 2IPTH 5GGRA 2VH5H 3ARFA 3MNZA 4P9HC 3GZQA 3DRTB 3HNVL 1KT2B 4NM4L 4UTAL 3HZYB 4WIQA 1JGVL 1J88A 3TTYA 3C60D 2XIBA 4PGBB 4WO4D 1GGUA 3L2MA 2CO1A 4Y16C 1FGVL 5C07A 3WKPA 1NWOA 2VDPL 3SBQA 1TSRA 2UX6A 2D31A 3T09A 2VMDA 2LE9A 3BAXA 1Z9NA 2BOCA 1PZ5B 3MCYA 3ALWA 4TNWF 1KJ2B 1R3IL 2B15A 4P2YA 4AIZA 1A3RH 4JE0A 4MS8C 5I5RA 2ED7A 2XPGB 3WFEL 3P3SA 1IAIL 3UTSA 4DVRL 1CFVH 2CLZB 2YAHA 2Z7WA 3S88L 2HJLA 4P2QD 2F8VA 3K6OA 4PRDA 3GTTA 3VFOB 2XJLA 4R5XA 5CCKH 4PJBB 1RVFH 5G4OA 4JRYA 3UBXG 1F1DA 4MNHB 3DETC 3LRMA 1FL3B 3BUYA 2VWEC 3OPZH 4L3ED 3TF4A 1HSAA 1ZGLA 5F96H 1I85A 1NEZG 4LCYA 1KXTA 1GL4B 1IL1A 1QI5A 2ZNWA 5EIQA 3QQ3B 2QJDA 1ACXA 2JFCA 3C5JB 2V2TA 3PXLA 1AY1H 4YXLL 5IROD 2FNBA 4Y19D 5IVXE 2EIJB 1KNOA 5EULV 3X2QB 2HRGA 2XV6B 4IIQC 5CIPH 1E4WL 2NY6D 1ET7A 1BYPA 1JNNH 4CJ1A 1XBDA 4U1GC 4NQEA 1XSKA 3WSQH 2VR9A 1AQKH 3AQYA 2VXVH 1KJMA 4L9LC 4X7TB 2GBUA 5EA0H 2B1HH 4UDUB 4N0FA 1AHWC 5C0CA 3T6QC 2X4TA 3C6LA 5AKVA 2A77H 3K6FA 1ET5A 4W93A 5EFIA 4CBPA 2P44B 4P9HL 1DCEA 1DL7L 4PFEA 3HNSH 3ATEA 1PG7W 2VIRA 3MJWA 2Y25A 2HRPH 3UGXA 2BOBB 1M53A 4QKTA 3O2DL 2AJUL 5J6HA 2WYIA 4XPTH 2ATPA 2IFFH 5IQ7L 1ONQA 3TC9A 2K6ZA 4CADB 3GMRB 1FH5H 2H3KA 2P47B 3LEYL 1GHFL 3MQIA 5ESAB 2GKIA 1WPCA 4S11A 4UT9A 3A4DA 4KKRA 4LLDA 3DUSA 5C3TA 5E5RB 3MA9H 3ABGA 1CGSH 2FX7L 4OF5A 4KDVA 3IF1A 2E9IA 2DM7A 1YQVL 2Z8VC 4S0HA 5ENWB 4X99A 3VD3A 4QRFA 3US0A 3IJ8A 3EDDA 2R56L 3N42B 1AJ7L 1JRHI 4G3YL 4FA6A 4HYTB 5DJ0A 2D7TL 5HHNA 1PBYA 3UJIL 3PUUA 2VR7A 3GSNH 5HHOE 1MIEH 2J88L 1DBBH 2QHRL 3CFJB 3FH8A 3VXPB 1T2XA 2VCOA 4XBEL 2P5EB 3B2XA 3EF7A 4ZS6C 1G7LB 1JGDA 3HJEA 2B4CH 1AMYA 3MRCB 4HEMA 3WL9B 1TZAA 1CF8H 3OMIB 3FH5A 4I2XE 3ZTDC 3P11L 32C2A 3MRKB 3DX2A 1CICD 3P02A 4ZFGH 5BVPL 3SO3B 3M45A 1OHZA 1E42A 2N0KA 5DMKB 4YX2H 5ITBL 5KVDL 5L8JB 3OB0H 1DEDA 1YEDB 3DMMA 5F1NB 2C1OB 4L05A 2WBJB 3THML 4DGVL 1J1OH 2Y6SD 3RHWF 4GQRA 1WISA 1BEYL 3WD5L 1RZKL 4L4JA 5IQLA 4CVWA 3KMDA 3G5YB 1F3DJ 4OZGE 4MDIB 1DO6A 1Y1UA 1OP4A 1JF1B 5KJ4A 3CX5J 3LD8B 4LPUA 1FBIH 1HILA 1OE1A 4FQXB 3QZWG 4HLZH 7PAZA 3AXLA 4HD5A 5IQMA 5JIQA 2NX5B 3QUZA 4OLZH 3VAEA 1XTMA 2AEOA 3EO9H 5ADPH 4LPWA 5C7XH 3WY2A 3WJJC 3B9AA 3QO0A 1OGTA 4RESB 2W80C 5F6IC 3B2VH 3MBWB 4OSUH 5IZ7A 4UZSA 1P5VB 4DHLA 4IDJH 2EDXA 2B0SL 3T3PF 5C2BL 1NEPA 5C09A 4HAFA 4P2OD 4JPVL 4PS8A 3VO0A 1JD7A 3ULUH 4YUEL 4TNEA 3N04A 2XN9A 1HIMH 2L4OA 1TKWB 1TVBB 5C0FA 1FYTA 2J5WA 1L9SA 3MRBB 5EO9A 2NY2D 3T6VA 3GK8H 3PG2A 3Q5TA 5TE7L 1UA6H 1QLEB 3FUKA 3LNHA 3QXTA 5HJDA 1YA5A 3OAYK 3UAEA 1RUKH 4XVTL 3BFWA 2OMBA 3CVCA 4PJBE 2HWZL 5E8PB 5GS0H 1DEEA 4XBPA 4M7LL 5I6KA 3D85B 5FYLE 1MCOH 1QTSA 3WAJA 3IDGB 1G9EA 2NXYB 5DI8B 2CU9A 1BQSA 3WU1A 2YFNA 5IMKB 2AP2A 2A9MH 1P7BA 2C1PA 4L23A 5D1XE 4MNGB 4P5TB 1EA9C 5AKTA 3WTXA 4G6AC 4GO6B 1UA7A 3ILDA 5CD5C 3VSVA 3D12B 1QI4A 5BMFL 5INCA 1KLUB 5FKAB 3HI5H 5FHAH 1ZLDA 3CLEH 4Q52A 3CUPB 4AYMC 3ARGB 3B2UC 2W91A 1AG0A 1QUNA 1AZNA 3FFCD 3CSBA 1DQIA 3TF7C 4NO3B 4K7PX 3C6SA 5ETUB 3T2OA 4GJTB 3ZKXB 2Q7YA 1ZKAA 4NIKB 1TLKA 2BSRB 1JFQL 2FATH 3H55A 3NGBC 3GJFB 4I0PC 3TT1L 3HLKA 4A2GA 3QXDB 1NLBL 2AANA 4JAMA 4W70A 1AO7B 3KPLA 1FORL 4LQ1A 3UTZB 3L9RA 1P53A 3RPIA 3NP3A 3SDCD 4FOMA 1OAZL 4JFFD 4BZ1H 3M7OA 2VKWA 1FZOB 3JTBA 3IDNA 5KYWB 2J5LB 5FOJA 2HA1A 4ZTEA 5AUMA 1NMCB 2G9KA 5E0FA 1KIRA 3HE7B 4MXWH 3QG6B 2UZIH 4G5ZH 4X4ZA 4Q14A 1MHCB 2E3VA 3V4UL 1TNMA 4JFUA 1OAXH 5KYUA 4JQVA 2PYEB 4KRPD 5SV4A 4PJIB 4E0RB 3BAEH 3P9MB 1R24A 3S37L 5J1AA 4DKFH 4PRPB 4J23A 4Z7UA 2N0MA 2Q0ZX 3FOLA 4NHUB 4XHJD 3S35X 4MCYA 3BESR 3TXAA 1HHJA 3IGFA 5BW7A 2QBWA 4PJGB 4Q9BA 3T8MA 3V4VA 3NA9L 3RY6C 3D33A 2P5EE 1JS4A 1R19A 5AW0B 4ADJA 3WLBB 4PJ5B 4ZFZA 3Q5YA 5IV2A 3VD9A 1XDTT 4N8UA 3J27A 4JM4L 3RWJA 4F7MA 5T1JA 1EJFA 3ARUA 3HZKA 3MJ9A 2OZ4A 1JVOA 2XNAA 1TCRB 5GGTL 1D2PA 4P9ML 4TPRH 1FPTH 2XX0A 3LN9A 2ENYA 2GABA 4PREA 1NGWA 1PLAA 3EYSH 3MU3A 3JWNC 1FV1B 4BIKA 3BDYL 4X4MA 1CE6A 1P4IL 2F6AA 2YBRB 1PEWA 3BAJA 4XCEA 4PEEA 1WAAE 2QQNL 4XVJH 5HGAA 2BMKB 4PTUB 2YMTA 4NSKB 4WI9A 2EXTA 3K72A 2XXCB 3NIDE 1A5FH 4X7DC 2NX5E 1AD0B 3WNMA 3HBQA 1YNTA 2IPKB 3WO4C 2G9HB 2R69H 4OLXH 2Y3NA 3AZUA 1RMFH 4JO5A 4PD4J 3Q8EA 2Q10A 1ADQH 3RVTC 3WKML 4F37F 3W56A 3DVNA 5DJ8B 4IK7A 2ZX6A 4O2FB 3TS8A 4FXLA 1M2VB 1MVYA 4P5KB 4AIEA 3UG4A 5EPMA 2BCKB 1XGRB 2FYYA 2QR0A 3ARBA 1C12B 3GDCA 1YMMA 4Z9KB 4NKIH 2JCCF 4ANVA 4Q56A 3TYGL 5IEHA 1A7PL 2JK5A 5JUEH 3GKWL 3IPBA 3SD5A 1HZHL 1SYVB 3ILQD 1DQLL 3FU7B 2A6IB 3D3VA 3IE9A 3U0WL 2CSPA 3BPOB 1D7BA 1EXUA 2QQKH 3EFFB 1Y18A 4HUXB 4K73A 3DJSA 5GGSY 3S34H 1IKNC 4PW9A 2R0WH 2WAHA 3RNQA 4CC1A 5CN3A 5ERWB 2H6UA 3V5KA 4MCNA 3O2VL 4PSPA 4NDMA 3IJYB 5CMAB 2Q9OA 5CBEB 3NSCA 4PSRA 4F1SA 1WD9A 1JXFA 1AR2A 3FQXB 3T2NH 4XC1L 3SDAA 2APBA 3KW7A 1E6OL 4M8VA 1A6VL 1U8KA 4LIQL 1SM3H 4PJEA 1NFDE 1DE4A 1R5IB 5F9OH 2WIMA 4YDJA 5HGGS 1GPOL 4ZW5A 1CT8A 2NTFA 1JNHA 3KPNB 1L0QA 3QDMD 4QHUA 4CKQA 1PG7H 3T9WA 3M07A 4NKDA 1QYGL 1AKJA 4OAWA 4MNGE 2X9XA 2ADGB 2QVTA 5LLIC 2K78A 2EC9U 3DLQR 3CHSA 1KBGL 1KIPB 3AACA 2DIEA 4N0CC 3JUZA 3DX4A 3QUML 3TTSA 2VZUA 5HYEA 3POHA 2F18A 1WHOA 4R8WH 3ZU8A 1MAKA 2F1EA 4J3OH 3TVMD 3D52A 1BD2B 3KPRA 4TV3A 1M05B 1XF5B 2CUHA 3VFPA 3RYMA 4E41D 4YDMA 3FTZA 3MRMB 1OAQL 2WTOA 1UM5H 2BXYA 4FXKB 4YAQB 2OTWA 1EV2E 1LYQA 4N3TA 3GSQA 5D7HA 4DCQB 4R4FL 2X4UA 4I13B 2VDLH 1YO4A 2H26B 3BUDA 3I9GL 2QLVB 4Q8BA 1AO7E 2NY4C 4F24A 5J13C 5I2IB 3VJ6B 5FM5M 2CAKA 4AEHH 4PY8J 3RZCD 2Z31A 4ZMLA 1IB5A 2CDFA 2OSLB 5HYFA 1Y7VA 3GMPB 4F7TA 4LBEB 1UHVA 2BS71 4I0PB 3IGLA 1Z5HA 5D1ZA 3S6CA 3FMGH 4NQUA 4Y4KC 2ZG2A 4J8QA 3MVSA 3TBCA 5T3ZE 3LV3B 5AL8A 3UZVA 2XQYA 5KSUA 4MASA 4TTGA 3IJ7A 4WI3A 5D7LA 2PYEE 4MNQB 1KCVL 4G6JH 1VFOA 4OZHB 4PJIE 5G5DB 25C8L 4M5TA 3EYVA 2HMID 4JY6A 3FT0A 1U8CB 2VJXA 3R8QA 2DKSA 3FFDB 4NBZB 4PRPE 5KUKA 4PG2C 1RD6A 1P7QB 1D5IL 1QFPA 1PX4A 4NQDD 3X11B 2Z35A 1OVZA 1B0GB 5DJZB 4DP4X 3M6DA 3WTVA 1BQUA 1IGYB 5I1JH 1ES0A 1WG3A 2YLKA 4PJ5E 4F1ZA 4O58L 4L0ZA 1SEQH 2RB8A 1QLRA 1OD7A 1J9CT 1PL3A 2D9QB 4JGUA 2V37A 1JPGB 4XMZA 3CPLA 5D1QB 3T0EA 5DQJA 3OGCA 5IR1B 3W9DA 1AD9A 1ZD6A 4UQIM 4GG8B 4YDIL 3ABLB 1F6AB 4NT6B 4UT6L 2DMKA 5DJ6B 2AEWA 2ZWKA 2ENPA 4NPKA 4IRZL 1OTUD 3KL5A 5E8DL 7TAAA 1SN5A 3IU4H 1YYCA 2QADD 1TJIL 3QWQB 3MJGX 1YUKB 4WEUD 3GBLA 1UT2A 5C0RH 2C26A 4X6CE 3OJVC 4K23H 3TZVC 3ZE0F 4B5EA 4FMVA 4B0MM 3NSDA 2EDLA 3DUUA 2J12B 3MBEB 4XCCL 2DQHH 2PPCA 2R0LH 5KS9A 1L0PA 2ZCZA 2NQDA 4PI2A 3QJFA 3WFCL 4NX0A 1SMOA 3QFJD 3CK0H 3MACL 1I9IL 3TFKD 2WQXA 2DWSA 3GJFK 4Q0XH 1B2WH 3VCLA 1NBZB 3OJ2C 3L5HA 1ZE3C 5F7MC 5SX5H 4OGYH 4NJ9H 3BRGC 5D6DA 2YFOA 2P8MB 4PM1A 4K7PY 1MCCA 5DMJB 4WLCA 3IFLL 1YYML 3MXWL 4Z5RA 4ZO8A 3QE5A 3P77A 1W72B 1UXWB 1D5ZA 2YA1A 4DO6A 1UGNA 2HKFL 4P5MB 4N5UA 4NO5B 4ZRGA 12E8H 1EZUA 1PD0A 4PP2B 4RA3A 3H42H 5B39B 1AQ8A 1U33A 2Q76A 5DZPA 2CDEA 5FF6B 2EIZA 4PRHB 3BWAA 2FAUA 2WWOA 5DK3A 2AMGA 4LEBA 2OMXB 4M6ML 4YIQA 5D2NA 1YPZE 5E03A 5EC1B 5IMLA 2V8LA 1CZ8L 3MLTA 2BP5M 5KVEL 4JPSA 1ZTXE 5DD0H 4YHLL 3HC2A 3KBHE 2OA9A 3AREA 3SKOB 3VXRB 1BD2E 3WS6C 2CBOA 3FT4A 4XMLH 1LE9B 3HHSB 4HIEA 3BW9A 2RFXB 4HCRH 4LOUC 4GEIA 1JPSL 1S7WA 3LZNA 4KPHL 5T3XD 3VM7A 5IQOA 2A9BA 5CLTA 4QO1A 4M93C 2NDFA 4LT7A 3BGMA 5SX4H 5SWZE 2XLLA 4X5PA 5B1AB 2FL5A 5JORB 1FSKC 2YWZA 3GZPA 1QX1A 4I0KA 3SCMC 2TRYA 1OY3B 2J8UB 2WD0A 5B21A 2EYRA 3CFMA 4MMZC 5FECB 4PGEB 3T0DA 5F1KC 3E9TA 2W88A 4LVNB 4OQ1A 2GJRA 1BZ7A 1N6QL 1F90L 3GSRB 5EZJB 3HC4L 1WBXA 1YDPA 4NUJA 1TQSA 4JPKH 3V6OC 1AP2B 5BVJA 2GUOB 5J13B 4B53A 3IDJB 1BJMA 2Y23A 1CD1A 3BVNB 4NM4H 5CZRA 4UTAH 4Y2NA 2HFEA 4TSAL 5F93C 3QQ4B 1A4BA 1OQXA 2CKBB 3OMNB 1KXQA 3EZ8A 2GIMA 1J05B 5I1AB 4MNQE 5DJDB 4OZHE 2D2CC 3ISYA 4UQCA 3DOHA 2VDPH 1RZJC 4HV8B 4IKIA 4QHKJ 4KK6D 4JG1L 4WW1B 5DVKA 1PDKA 3IMVA 1UXLA 4LCUA 4NCC2 4HMDA 2P5PA 3M1OA 2NW3A 3V8OA 1AR1B 2HRLA 2DN7A 1R3IH 3BH9B 4A6YB 1O6SB 1URIA 5DSCB 2CPUA 3QISA 4ABWA 3WFEH 1CFMA 3MR9A 4DVRH 1WZAA 2DPKA 1SYSA 1NC4D 2HXAA 3S88H 3CFUA 4WI8A 1FVDB 5AOMA 1YEEL 1UWXH 1E4HA 4M6AA 5D1QE 3X3FL 3SN6N 5JHDE 3NAAL 1I1AA 1MOEA 3QYMA 1OHQA 1G6RA 2DD8L 1PZAA 3ARVA 4ZW3A 5GHWL 3EDKA 2BSSA 2R27A 3IGAA 4Z3GA 5JIHA 4J7RA 1O75A 5LUMA 5A2KH 3H7BA 3CFEB 3UTTB 2BX5A 5DD6A 4FQHB 4WWPA 3WELA 2ZOWA 3S5YA 1E3XA 3BKYL 2IV9A 3GD1C 2NY3D 4GQQA 4X6EB 5T33L 1AXSB 3VD5A 1NFAA 4YXLH 2CBQA 3H9SB 3RB7A 2R2BB 5I6XC 1B6DA 4L1BA 3VMNA 2C4FT 2WVVA 4YL9A 2R2EA 3NPSB 3MV7A 4M5SA 2J6EL 3D18B 3CFTA 1J0JA 1H5BB 4M61B 1XR8B 3NSFA 2LGNA 4DP2X 3WE6B 2BNQB 3FU8A 4ATTA 1TEFA 3L5XH 3PWPA 3KYNA 2PABA 4ZMAT 3U2SA 5F1IB 3QA3B 3DK0A 1DL7H 1YEFL 2X1QA 4QYOA 4TQ8A 4PJDA 4FQJH 3TA3C 3DPDA 1LO2L 1LILA 1JK8B 3LXUX 3OTTA 3FQTA 4Z8FL 5AWNL 3UTPE 2ALAA 2X70A 1T7XA 3QIUC 2AJUH 2GFBA 2EDWA 4S0TD 3QDGA 2IAMA 2YPLB 2J43A 5IQ7H 3HG1B 2FECI 4JL2A 4GUOA 1GHFH 4MKTA 4W81A 1RZJL 2QGBA 3O8XA 1MVUA 3EF4A 2BVPB 3N91A 4B9PA 2GSIA 4FNUA 1TZHA 4ISVB 4IQHA 1RL1A 3LJ3A 2W92A 3O9WA 4XP9L 3PABB 2FX7H 1D6VL 3BZ5A 1VHPA 3OPUA 4PRHE 4TLTA 3SE9H 5I0WA 5INDB 2FSEA 1KBKA 2R56H 3QRBA 1AJ7H 1QFWI 3HW7A 4P57A 5DUPL 2D7TH 2GITB 1OSZA 2J88H 4G72B 4RSVA 5D96B 5DGRA 2VITB 4BDVA 2QHRH 2ZUXA 4KKBC 1J0YA 3OF6D 4XBEH 2A4ZA 2E8ZA 3KPOA 2VLME 3Q3GA 4P59L 3VXRE 2VLRD 5DDHB 4L4TE 4D9QE 4K5LA 1UM4L 4UM9A 4PVNA 4D2NA 4KNQA 4P46A 1CDIA 1U4EA 3ROLB 1E9QB 3UIZA 3AUWB 3P11H 5IQ9B 2ZWYA 1E2WA 5BVPH 3NJVA 4PRBA 1HVXA 4DW2L 4K3HA 3JTTA 3BQUD 2BVOA 2VE6B 3CZJA 5DHXB 1HX0A 3I74A 1HNGA 4ZD3L 3V9CA 2O6CA 3THMH 1DVZA 4DGVH 4F20A 5DS8B 2J8UE 1BEYH 5K9JL 5CM1A 1GYVA 3BZEB 1E90A 1RZKH 4N9OB 2GJ6B 2YAEA 5FK9B 4ODWA 3G6DH 4MAYA 1SJMA 3EDFA 3J7HA 1SRDA 5A2CA 4HCGA 1N10A 1BVLA 3P2TA 5CIPB 1K4DA 2R23B 3AS3A 4TSBL 4TUKL 3AWEA 5E23A 4HF5L 2DKMA 2HFTA 3IE4A 2C5DC 3VFNA 5JIMA 4FFYA 5DEZA 3QXWA 4KZCA 4LCWD 3FO0L 3SZ6A 3C60C 4WO4C 3VXMD 5ITFA 1X5YA 2B0SH 1N64L 2OL3L 5C2BH 3DIFA 2LW3A 2VDKB 4OGQC 3CFDB 4JPVH 3OKKB 2EEXA 5KG9B 4Z18A 4YUEH 2VRQA 4PJAF 4OFVA 4G8FB 5SWSB 4GI8A 3WXWL 1FFPB 1PNCA 4DKEH 4O02B 3V4LA 1PAMA 2BNRA 1ACYH 5TE7H 3TH3T 5JNYB 4IRJB 3TJHD 1TQCC 5T1KA 1KC5L 3UBXA 4DK6A 3WFBL 2HFGL 3UG3A 3L3OB 5E99L 4KRNA 4XVTH 1DVFA 3VACA 4OIFA 4FHKA 2PXYA 1N8ZA 3ESVF 4E9LA 5AAPA 3P1VA 3QGVA 3MRHA 3QIBA 2MTPA 1S7VA 1HDMA 4M7LH 3VWJA 3HMWL 2MOGA 1KV7A 5G55A 2QV4A 5E7BA 4N0RA 1EVTC 1HJBC 2A83B 2DEYX 3VRLF 3UTTE 4W6XB 1NINA 3X12A 3KPSD 1T1YA 4O2EA 4HS3A 5CSZB 1AXTL 1TQTA 2APSA 3SGDH 5C8JA 1D5XB 4W4OA 5EZLB 3UJTL 2JH2A 3L4UA 1BBJB 3L4WA 4EDXA 1FL5A 1JYVA 1JV5B 4YC2C 4QEGA 5IROC 1I1YB 1A6ZA 1C5DB 5D4IA 3GEFA 4UNUA 5IVXA 2AQ3A 3QAQA 4G6FB 5IG7B 3V0VA 4XAKE 4OFIA 1T6BX 2NY6C 4Y5VB 3TO4C 5DHEA 2YK1L 2BNQE 1S78C 3GIVB 5C3IA 3CDYA 3TT1H 1JFQH 2G3MA 2ZONA 4ZUVB 2VXQL 4PB0H 3O6FD 5AL0A 5IJDC 4WHCA 4CSSA 3K2UH 5DJYA 1U2CA 3EADA 3WHE1 1UQSB 4ZOBA 1OAZH 2X4NA 4UYPA 1ACZA 2ZOOA 1L5GA 1MZYA 5AZ2H 2DWYA 3DWTA 2YPLE 3I6KA 3MC0A 3QIWB 3VB9A 4X5WB 8FABB 3QDJE 4HIJA 5KW9H 5D5ME 4S1SL 2ADJA 3TU6A 1S5HA 1KYOJ 1K3IA 5CLWA 3OKOA 4K3JH 4U1SA 3V4UH 5HP5A 4F9LC 3D08A 4U6TA 3ARDD 2X10A 2G4EA 3VE0A 5KSAD 2NY7L 3E2HC 2XWTA 2QPDB 2WQAA 3DX7B 4MLSA 5EOCL 4UDTA 3ZZQA 1BXXA 3OJDA 1KN4H 2OBGA 1PFOA 1NBCA 3DJRA 1YUHA 4FZEL 4WUKL 5HGBB 4JG0H 3UACA 3NA9H 4AL8C 3NFNA 1ZS8B 1U6AL 3NJJA 5HHOA 4LSPL 4BGLA 1V54B 1Q0XH 3LN5A 4ZS7L 2AJ3B 3TN0B 4Y2OB 1H9VA 2BHUA 2ZX9A 2D0HA 2HJFA 1OD9A 4Q2ZA 1T3FB 1ZJAA 1W6WA 2WLLB 1S8DB 1KJVB 4UU9A 5GGTH 2ZKWA 3LKRB 1UH3A 1U2HA 4I2XA 5DUBB 5GGQL 1CICC 1QA9B 1KGIA 4FG6D 3EG9B 1J9SA 1S3KL 4ZYKA 2BVTA 2CGRL 3BDYH 4ZUWA 4R5TA 2ZP0T 1P4IH 1QW8A 3OX8B 3N0PB 3V52L 1TMCB 2Y6SC 2QQNH 4G7YL 1JZ6A 1GTFA 1II4E 4FYSA 2AEQL 2VXSL 4G11A 2FO1A 1F18A 4LRIC 4MJ5A 5E6RB 2G2NA 3TIDA 1A8JH 1NOLA 5GGVY 4ODTL 1U0QA 2MOVA 1CGTA 4MQ7B 4ZXBD 3LS4L 3CHRA 4U3SA 4OQTH 3VFWA 3T71A 3F8UB 3QJSB 3WKMH 3PWJB 1G7MA 1Y0LB 4LKXB 4FJZA 1G6VK 4HOWA 4FLOA 3HZYA 3UAJC 4L3CB 1YC8A 4F93B 1HQ4B 3AVEA 1U93B 3CC5B 3TYGH 4J2XA 1A7PH 4YO0A 2IEPA 3GKWH 1YMHA 2QHLA 3GDBA 1ZLWH 1PZCA 1HZHH 3T1WA 1DQLH 4X98B 4G9FE 3U2JA 2D3NA 4P2OC 3C60B 1RERA 3U0WH 3OLGA 4HZLA 3NUKA 1A6WH 2P8LB 2JQZA 4JN2A 1JL8A 4XXDB 2D0FA 4IOFD 4BFIA 3QQDA 2L7UA 2XPGA 3D1MC 3OXRA 2NY2C 4U6XB 2H0PA 2H1XA 1NCWH 1H8NA 1QABA 2CLZA 3RFZC 1CU4L 2HT2D 2VERN 4MDJB 4MQTB 1AC6A 3EJPA 3PQYD 5JIDA 3GHEL 3O6ML 4B27A 3MREB 3AG2B 4KNTA 4ELMF 1E6OH 1TZIA 5CGBA 1A6VH 1WDAA 4LIQH 4PJBA 2JI1A 4LU5H 3TBVB 3T08A 1GPOH 3G08A 5LB1A 5J5EA 4LVEA 4P2QB 1WF5A 4R96A 1QYGH 4WI4A 1N12A 5C08D 4QY8A 5TQ2L 4HMCA 3ZTCC 1I7RB 1BQHB 1KBGH 3QUMH 3KLKA 4XP1H 5D1XA 2YBGA 3GSVB 4G7VH 4W9GC 1EPFA 4H1LA 1BREA 4L3EB 4PS7A 3JWNH 2ETWA 3L3JA 3Q6FA 1IARB 1TYRA 1OM9A 3EYFA 4CNIA 3DIVA 2XN2A 1V7ML 1KYAA 3WO3B 1T1WA 4R4FH 4WJKB 5HYQB 3UC0L 2O72A 3I9GH 1UB6A 4YFEA 4UDUA 3F7QA 1JUFB 1Z0NA 2IF7A 1CGYA 4ODXB 4RZCB 3S2AA 2OTPA 1NSNH 3OHXA 3BE1L 3TEZA 5D55A 3SDCC 1L3WA 2BOBA 3V7AG 2DQDL 2FJUB 2APVA 3ZTJG 3GMRA 1B0IA 3F58L 5EBGA 5ESAA 2ESVE 3CX2A 4ZQTA 3JV5A 3NYKA 3Q6GL 2YD2A 1HXKA 3TA4D 1KCVH 4GB9A 3SO5A 2CRYA 5E70A 1SOKA 3UEZA 1X4YA 4HGKC 3WFDL 3WNIA 4KRPC 3L2LA 1PLCA 3NCWA 1D5IH 4YBLC 5GRUH 3ULUE 4G5AA 3RGVB 3FSOA 3QNFA 4XHJC 5F44A 4AZ8A 3JVGC 3GPSA 5ALBH 2A9NH 4JPIA 2V2XB 2W9EL 4PRIB 4KNSA 3KCWA 4NO0A 1NAML 4M1GL 3I2CL 4O58H 3X1BA 3DO3A 1FFOB 3QULA 5L88L 5ID0B 3GXIA 2OP4L 2P5EA 3REVA 1BF5A 1RJZA 2F1BA 1G7LA 3SPJA 5AB2A 5H35A 4JMNA 2VYRE 3MRKA 5I1HL 3D4GA 2BSED 5C9JB 4HUVB 1SBSL 4XNMB 2YR3A 3PAZA 2BZCA 1CYGA 4HKZA 4IRZH 3KS0J 4FNRA 1USZA 1EEZA 5E8DH 1AHMA 3KBFA 3Q13A 4QHNB 2WBJA 4RFNB 3CWGA 4D0CA 3IPFA 1CICB 2OFQA 4OZFB 2XDHA 4Q4IA 4Y4FA 3BVXA 4MDIA 4UOQA 4XC3L 5DR5H 4AYID 4DIXA 1HQRB 1JF1A 2VT0A 2WINB 4ICWA 4XCCH 3U7YH 3WFCH 3T65B 4OCWH 4FXGB 2NX5A 3OB0K 4LLAA 2AI0L 5MENB 3MACH 1I9IH 5A7EA 4WU7B 2ZD0A 4OUUB 3HLAA 3VGEA 4HAKA 3MBWA 4TQHA 3B7SA 3QUXB 4QAWA 4NNXB 4XNZC 3ILPB 2YEZB 2E27L 5EC2B 2CJ3A 3QRGL 5AAWC 5C0GA 3IFLH 1I8KB 3K4ZA 4FQQB 4ZFFA 1E3FA 3F7VB 3ILQC 3MXWH 4ZFOB 5BZWB 1DP0A 3DECA 4GRLA 4K94C 3ZKSD 4AIXA 2B3IA 1TKWA 2EIMB 3LSOA 3QEHB 4I4WB 1MH5B 2HKFH 3TBTB 4YHNB 3WI9A 1ZA6B 4V1DD 5ECGA 4U7MA 1JF6A 3ES6A 4GKSA 2E56A 3SQBB 5ADOH 2VISB 4XRCB 4GMSL 4S2SB 3RX9A 4Y4HB 5HSFA 5LXGL 1V3JA 3GJEB 4DZ8A 4P2RD 1IGJB 3S36X 5E8PA 1CLZL 1WIOA 3NJKA 5GRVK 5JTWA 1FLRL 5LCVL 2Y7MA 1NANH 4TQIA 4M6MH 1U58B 4QRUB 4P2QE 5EU6D 3QXVA 4M7ZC 2X2HA 1CZ8H 1NFDA 4E9WA 3ZHDA 4R7LA 4NN5C 5KVEH 1M9SA 3ARFD 3BP6B 3PGCB 3H85A 3WTSA 4MNGA 4YHLH 4BD4A 3RTLA 1LK2B 4U0RC 4KXBA 6PCYA 2FEEI 4P3CL 1OP9A 1GZQA 3TVMC 5JR1L 3WTUA 1OAKL 1JPSH 2YJLA 3FOMB 4KPHH 2ZKHH 5JO5B 1SDDB 1MFAL 3ARGA 3I9IA 5DHVA 2WZ0A 1C9SA 1N2RA 4OD2B 2F2HA 1AFVL 3RY4A 1EFXB 4HUWA 2V7HA 3P4OB 2OV0A 15C8L 3FDWA 3FO2B 3MUY1 4UM8B 1P7KB 1QQDB 3EJQA 1IILE 1J86A 3FO1B 2BSRA 3ULVE 1Q9WB 2PPAA 1QR1B 3UC2A 3QXDA 1MWAH 3BDBA 3F5WA 2NW2B 1DBKL 1AO7A 1HEHC 3UTSD 2D7OA 4C8XA 1N6QH 1AZRA 1BM7A 3FFCB 3RZCC 1T5KA 3HC4H 1T0OA 2AJSL 1P2CA