2VO8A

Cohesin module from clostridium perfringens atcc13124 family 33 glycoside hydrolase.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
135
structure length
135
Chain Sequence
TTVGNSTIKVNDEVQVGSAFEAILGIEGLNGDTEVYSAEYLFEYNAEAFILNEITSFNDSLFVKSKEVEPGKVRILVASLGNEIEKDSDLVKVNLTPKISSELEVLGLTTALVGAGDGNTHDLELSSKEVKINEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of Clostridium Perfringens Toxin Complex Formation.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
molecule keywords EXO-ALPHA-SIALIDASE
total genus 31
structure length 135
sequence length 135
ec nomenclature ec 3.2.1.-:
pdb deposition date 2008-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2vo8A00
1OHZA 4U3SA 4UYQA 2JH2A 2W1NA 2CCLA 4DH2A 2XDHA 3GHPA 5G5DA 3BWZA 4UYPA 4FL4B 1ZV9A 4N2OA 4UMSA 4WKZB 2BM3A 1ANUA 2Y3NA 2VO8A 3L8QA 1TYJA 2OZNA 2ZF9A 2B59A 4IU3A 5K39A 2VN6A 5LXVA 3FNKA 2O4EA 5AOZA 4WI0A 1QZNA 3KCPA 1AOHA 4IU2A 4FL4C 1G1KA 3UL4A 2VN5A 3F2LA 3KCPB
chains in the Genus database with same CATH superfamily
4A37A 1A02N 1WO2A 2Y36L 4YSCA 2WYZA 3KXFA 4TYUA 2CCLA 1N0XH 2HZHA 5AW9B 3IJHB 4NQQA 5D93C 4K3DH 3QO0A 4Z7WB 2D3NA 5DSCA 3GXNA 2UY7B 4AQOA 1R3JB 1DANT 2CWRA 3ZTJG 1UM5L 2MRYA 1SY6L 3PWPD 4UT9H 3TV3L 1X4ZA 1MFMA 3CFUA 3IYLW 4FCAA 3WE6A 2E6QA 1QPPA 1YJDH 4GSDL 3E80A 1X6NA 2X4TA 3NABL 2Z92A 1T03L 3NVQA 2BNRE 1CVRA 1KGYE 4C47A 3W2DH 2XWEA 4N90D 1XF5B 1UKSA 4FNUA 3DX6B 1GZPB 1RMFL 3IAQA 1I8KB 1EJOH 2ATKB 2ZOUA 3KPNB 1A47A 4HC1A 4LSRH 4Z7UB 5LCVH 5IP4A 2DYPA 3FT4A 3ULVH 5A2BA 1KFGA 1H3UA 3P3TA 4U1HB 5FECB 4FQJH 2K6YA 2PO6A 3A6BH 2QL1A 4IJ3B 4L5FL 4X4XB 5MEQB 1W0WB 5FFLA 4P2OA 1AXTH 2I69A 4DKFH 1RZ7L 2OXGB 1CZ8H 1NBVL 3PAVA 3HPLA 4M7KH 2LTQB 4W4OC 3BVXA 3EYQD 4QHLB 3NACL 1DVFA 5M94B 3FC8A 4WTQA 1I8MA 2PYFB 4IBSA 3VRLE 3JWDL 3GRBA 3P0YH 2ZUQB 1MRFH 3F7PC 3TZVC 1G4RA 2DQCH 1HC1A 4AIEA 4PJ6A 3OSVA 2WIIB 3ESOA 1C9SA 2P8LA 3RVWD 4EDWL 4MD5B 2K4WA 5F3BB 4OUUB 3KE0A 1JMZA 3ZZ1A 3GMQB 1O6VA 1HVXA 1KIPB 4ZDHB 3NGBC 5BS0E 4YVNA 4N0CD 4G80B 5FHBL 4RMBA 4S1RH 1IEBB 3BQVA 1TZIA 1XSIA 1EFXB 2DKMA 3GWJA 1NCTA 4OUOA 4U6XB 4Z6AT 2IWFA 2CRYA 1J88A 2CR3A 1G9HA 4DESA 1BHGA 2ZT9C 3MHZA 4QKXB 5ITBL 2ROXA 1ZLWH 3VTTA 1NGXB 2RJMA 2FECI 2IV8A 2CGRL 2D31B 2XQYA 3CN0A 3D06A 3QDGA 4QXUH 1FFNA 1JMXA 4UTBH 4D9RD 5IY5B 1IIIA 1U8LB 5JPMA 2XIDA 2HFGL 3PHAA 3Q3GA 2VJ0A 3J07A 1TCMA 4JKWA 2IEPA 3EYUL 3FU7B 1KWGA 2WWOA 2ZKWA 4O02A 3HJEA 1JCVA 1L9SA 1XSOA 3CZFA 4DVRL 1XMWA 2JK5B 1JGDB 4OGYL 1YNLL 3FTXA 5D7SH 1BOGB 4NSKA 1E9PA 4JZJA 4IK6A 4OZHA 5LGJB 3PV6B 4M29A 3WFDH 3WFHA 2BMKA 3ULUH 3QYMA 4XMVA 3MLTA 2H1LM 5LLIC 3GBMH 1UZGA 4MD0B 2AV1B 3Q8AA 4S1SH 3TWCL 5ABZA 5D1XB 5IFHL 5KVEE 3NEOA 3WY3A 2QKSA 1WG3A 5EHFA 2EYTB 1NMCC 3QDJD 4DO5A 2DLGA 3BPOB 3HI1B 1FL3A 1JN6B 2PNDA 4UTAL 1BG9A 5KYWB 3TA3B 1CGTA 4YR6A 1OGAB 5IB3A 4JDEA 4WNQA 4NQUA 2GJPA 4XVSL 4BKTC 1T22B 4B9IA 1MFCH 3HS8A 1JWSA 2JXMB 1SDDB 4BV1A 3FUDA 1UWGH 3QUKA 1XFPA 2VDRB 3T0AA 1YY8A 3QQ3B 3IDXH 2PWFA 5GSVB 3MR9B 1RHHB 4NZFA 4Z76A 4KVNH 4R4BA 4LKXA 2IV9A 1UQSA 2XJLA 1P5UA 2JLPA 3WIFA 2OLDA 1X5FA 1R5IB 1CIDA 1N7ML 4ALAC 3QCTL 2VE6B 3BWSA 4IEFA 4WCYL 1HJCA 4TOYH 4MJ6B 4MCYA 5T33L 3CCHB 5GGVL 5IG7A 1T1YB 5JIMA 2WJ5A 1I8KA 2ATKA 2Y2TA 2QKIA 3QNZB 4O2FB 4DT2A 2VQ4A 4UUJA 1BJ1H 1D7BA 4JHUA 1HWGB 3BO8B 3EH2A 1DSFL 1BQRA 1CFSA 2ENJA 3BKYL 5GGTL 3L3KB 1DLFL 3WHXB 1NAML 2P48B 1RZKH 1YG9A 2IWKA 4NWTH 4XWOC 1MCWM 1HE7A 3MBWB 2M2DA 2AKRB 1YQ2A 2X7LA 5JOFB 1SOSA 4Y4HD 3LQZA 5ISZD 5IGXL 3UJTL 4L0YA 2BIOA 1D3CA 4GW5A 2VLME 5I75B 4N5EC 1E6JL 2ZICA 5TGBA 5LBGA 3ZIYA 3CHOA 4HALA 4XOEA 5CEYB 2IGFL 3IKCA 4N0RA 4NCDA 3V55A 2CUMA 3QPQC 1P1ZA 1QSED 5BRZA 3BIKA 3S8WA 2P45B 2WTRB 4TF4A 2CBQA 1MHHA 1KY6A 2PUQT 5D4QA 3VJ6B 4M8QA 3UBHA 1OZUA 2EXTA 4J6IA 2NT1A 1XIWD 1EAJA 2IH3A 2KPWA 3EADA 3ZU8A 3U7YH 5H37H 5TDOB 3BN9D 4HQQL 1BOYA 3NCEB 4R2GB 1KLUA 4J28A 5EUOF 4W81A 2NNRA 1R3HB 3AMKA 4PREB 2OMYB 4AC4A 5I1HL 1GJWA 5F3HB 3W82A 4N86A 4PJDA 4HS6A 5CIPA 4JFDD 5DZNA 3RX7A 4P4KD 4AQAB 4YAQB 2YBGA 1YN6B 2OMZB 2EDTA 4YGAB 4QHKJ 1MJJA 1BCIA 3ZE1F 5HYQA 3OAYK 1WFJA 3HN5A 2ZOOA 3KYMA 3P11L 4I2XA 4R3SB 5IKCA 3EJYC 2ATPA 4BK5C 4IBUA 3MRQA 1YYLL 5D7LB 5SWZE 1PEWA 4AIXA 4G6MH 2JCCB 1JNLL 2AK1H 2NXYC 3G7TA 3FQ1A 3N40F 3NT0A 3H55A 3RVTD 5BQ7B 2QKIC 2JIXA 3UAJA 4AMKH 1OAQH 2NY3C 3UG4A 1BD2E 3KEHA 2VM9A 3MBXL 4FXKA 4YHYB 1JIBA 3IFOA 4HIHB 2DEXX 4FJYA 4JFFE 2APBA 2LV4A 3ZE1B 3L3DB 5I6XB 2K9UA 1I7UB 1DLHB 4X9HA 3TPUA 3VFSA 4JLRA 3AB0B 3DHUA 1MFVA 2EUZA 3WGVB 4C83B 4NX0A 3EYSH 1KBKA 1R3IL 2V33A 3UIYA 4GAGH 5T5FH 5IQOA 5AW4B 1A6UH 4M7LT 4P2QE 4P5SA 4D7BA 4D9QE 2YWYA 5D6DA 5I9QC 3K2KA 1Y18A 3V4UH 1Q9LB 3G6DL 4LCYA 3TYGL 1OAXH 4IDJL 3PJLA 5G4NA 4X7SL 2BHZA 3SQOL 2D7OA 3BKML 1DN2A 4Y4HC 3HBGA 3VRIA 1L5GA 4R4BB 1CDHA 3JWNE 2VR3A 4LE8A 2DWXA 4PB0L 4TTGA 2Y1VA 2X89A 2HUHA 3L3GB 4XMPH 4UNVA 5DD6B 2VWEE 4WEMB 2NY0D 4N2IA 1N4XL 4YLCA 2JTYA 4PWIA 5C09D 4X5WA 4Y2DC 2VAJA 3CFKB 1XGZA 3AM8A 5IB2B 2XNAA 5IG7B 1T1YA 1VFUA 2V5TA 5J3HC 2RACA 5BS0D 3WGUB 4BKLA 3S36L 2FWSA 1SVCP 3FOMA 1V27A 5DHVB 1SQ2N 2B1AH 2N4IA 3TL5A 4F2EA 5EF1A 1RZPA 4GQ9L 5TE7H 4H8PA 5ADPH 5BV7H 4KDTC 4M7ZC 2JJSA 3ERXA 3FHQA 5JIHA 4TUOB 4NQDA 3EFDL 2LABA 4WSGA 2X7LB 1SHWA 2UXGA 2DM4A 4K0OA 3W0WA 4HX1A 2QLYA 3CBRA 4LASL 1ID5I 5E7BA 5LBVA 1XF4A 1XH0A 3ARED 1WBYA 3OV6A 4LL9A 4Q0XL 4J2QA 4OV6F 2NNAB 2IDTA 3ECBA 3JWOC 4HULB 3DHMA 4YHMH 1ACXA 2IFFL 4HT1H 2X3AA 4XCNA 3MV11 2VR4A 4MXWH 4ONGH 4OJYA 2R69H 1DQLH 3ZIMA 1SGKA 4KO5A 4L8SB 5E0FA 1KBWA 3FQ2A 2Q7YB 2G75A 1YPZE 5JMRA 4PJBB 3Q8FA 4M6OL 3CFBB 3W0WE 1L0PA 1FZOB 2BM3A 4RAVA 4UQDA 3DROB 1P7QD 4WRLA 1ZSDB 5BO1H 4XAWH 4GI9A 4MZIA 3I6GB 4N2AA 5EORL 2EUWA 3BW9A 3LDBB 1Q4NX 4JG1H 1PDKA 1P84K 2PWHA 5HDRA 1HHJA 2XPZA 4JQXA 5HVWA 2R83A 3B2PA 3HLAB 5KVGE 4QAWA 4X7CC 3Q6GL 2EECA 1SYSA 4K4KA 1CGVA 3DUHA 2IXQA 4FNTA 3QXUA 1AS7A 1INDH 3IJHA 2VOTA 4PV9B 5KVFE 4PJBF 3RGHA 2NY2C 2WSPA 3G5ZA 3SBWC 4NKDA 1CGWA 3HW7A 4PTUB 3PQYE 4LSVH 4UINH 3HUJA 3U6XA 1RLWA 3ZSSA 2L3BA 5KVDH 1DEEB 2J5WA 5L2KE 4HDIB 1J5DA 1IT9L 2V17H 1P7HL 5F0LB 1AO7E 5BQ7A 3LKPA 2OMXA 1QTYT 4ZSOB 1TJXA 2KQNA 1YUHA 1Y6MR 4OCNC 3CH8A 4YX2L 2GI7A 4X8JB 4A39A 3IFOB 3H9SB 3GMQA 4UT6H 1N26A 4G5ZH 3TJEH 3A5VA 3H42H 1L0YA 2WUBH 4HIQA 4Y4FA 1OCCB 2Z65C 3DBXB 3QZLA 5KJRH 4U1HA 3N55A 2A99A 1UXLA 3MSPA 4EIZC 1NL0L 1VADA 5LG1A 1OT2A 5JMOC 4BBWA 2QQNH 4F1SA 3EUDA 1E4KC 4IBTA 2ZNXA 2V5YA 4IHOA 4H40A 4J3TA 3W39B 4BSWB 4Z77B 4OFYD 4X6DF 2AF2A 2NUTB 4N1HB 2RALA 5F7NC 1ZY9A 5DZJA 4QRPB 1D6VH 4HIIB 5JR1L 1A6ZA 2AQ2A 4WF7A 3N40P 3E8VA 1MH5B 2A0LC 4UOQA 4JFXA 3U25A 3QAZC 3OKYA 3UYRH 4HUVA 2NY4D 5KVFH 1G0XA 4PJ8C 5FR3A 1MRDL 4K2UL 5HXMA 4XP1L 3QZOA 3LN5B 5DA0B 4X5WB 3RVXD 5CP3A 3AG4B 1Q38A 5ETUB 1G9MC 1FYTA 2IH9A 1INQA 1WD9A 5H4ZA 4V2BA 2CIKB 1GSMA 1MFEL 2HFFA 1U0QA 1YCSA 3ARGB 2Z6FA 4RIRB 5DYOA 5F21B 1U41A 1KT2A 2WYHA 4N2EA 3WN5B 2APTA 5JHDB 2FYVA 2E74C 1PZ5B 3REVB 2EKSA 4LSPH 5B7EA 2V2TB 1MHEA 4JRXB 4TUOA 1NDMB 5GHWL 3RVUD 5IB3B 4H1LG 4O2CB 1OTTC 5MHSD 3S5LG 1YAZA 2R2HA 2BOBB 5E6IA 1HHIB 2NX5D 2P4AB 3MN8A 5LAXA 3S37X 1A7PL 3V2AR 1OOAA 3R4DA 4K5NA 5DEZA 5E8DL 2EXYD 4PJFB 4OIBA 5KJ4A 1IAKA 4NKOB 3BH8B 2C3VA 3O2VH 5JORB 4NQED 4GG6E 3HPJB 2XFXA 15C8H 1JD7A 5IW6B 4NSKB 2EZ0C 2ENSA 5IUSA 3DJ9A 2X4OA 1EV2E 4PUBH 3MRLB 2ZQKA 1JV5A 4X7EC 3T1WA 1KPUB 3LKRB 4HWEH 4X7DC 5DJAB 3B6SB 3HI1A 4TXVB 1FE8H 2BY3A 1WIPA 3HAEG 3ABZA 2XZCL 3H3KA 4KTGA 4KFMA 3TZVD 3LZRA 1QBAA 4HOMA 3OD3A 1BJ8A 4HXBH 1OGTA 1CXHA 2XI9A 3DX8A 2WLLB 4PJEF 3I3DA 4KMQA 3LQZB 4Z3EA 1DN0A 3F58H 2OV0A 5C0ND 5J1TC 1Q0EA 4PLOB 3TO4C 1N19A 3SKJL 3JT0A 4J3UA 4JM2A 2UUDK 3QB7C 4PRIB 5DEFA 5JIPA 1T4KB 3ZTDC 1I1FA 1WAAE 1DSWA 4HHWA 4PR5B 3VI3F 1V3KA 2F8XC 1E5YA 4FLOA 2XN9B 1NOFA 2WUCH 2YPLB 3TVMD 5SWSE 2VLRA 3AUVA 5ESQA 1JHKH 3SGKA 5H94B 1NCJA 4KH2A 3UCQA 1T5WB 1IV8A 2EDBA 1E8ZA 1DDHB 1SY6H 1XT5A 2DMKA 2VDLB 4L8DB 5IW1A 5D72H 3OJVC 1RLBA 5C0BE 3RB7A 4JFPB 5D2NB 3WNIA 1I1RA 4AWJC 1HAWA 2W8CA 1A65A 3RYMA 1ZV2A 4QT5A 2QPDB 3IDMA 1R47A 4M7LL 4TULL 3BP4A 3U83A 2NR6C 4WVRA 2PWGA 4X5PA 5DEGB 3LKOA 3IAPA 4F9PA 2NW2B 5E99L 1RK7A 4HK3N 5JUEL 4XCYA 1XTLA 1MCSA 2KKQA 4GBXA 4OCSL 4TSCH 2B1HH 4JO3H 3AY2A 5ID0B 5EPMA 3A6BL 1OTUD 4L5FH 1QNIA 4WWKD 5L2JA 4LPYA 1AXTL 4PYHA 4FABH 5EU7E 4DKFL 2W60A 3T5WA 3BPCB 3GBNH 3QDAA 6FABH 3NACH 1SJHB 1YHPA 3CDCA 1K8IA 1WBXA 1QG3A 1E2WA 1I7UA 2FT8A 2YAPA 1HL8A 2VZ1A 3GUTA 1WV7T 2ALWA 5B8CB 1NDMA 3L45A 3PL6B 4J8QA 1R0AL 2YQGA 5CBAA 4LHUD 1LEGB 2DJSA 4A66A 4DJMA 2Q8BH 4PVMA 5ID1A 4FYSA 2P5WE 5GRXG 1I8AA 2IAMD 1DVFB 2XYCA 4WLCA 4D2NA 2N56A 4U1KB 3E6FB 4UV7L 1KJMA 3DSFH 1TQCB 2BSED 2MHAB 2JCCA 1G84A 1NC4A 2C4FT 5DMKB 1HESA 1D6EA 2F54B 5DFWH 3EIFA 5AALA 1ZLEA 4L3EB 3NCBB 4CRPA 4WI7A 3ESPA 1RIVL 4BKLB 2VISA 2WTOA 4UTBL 1N70A 2JELL 1RZIB 1AMYA 3KGTA 1UD5A 4OCWH 4YHOH 4NB7A 2HFGH 4WI5A 4PS8A 1ZANH 2QDVA 2V3DA 3A47A 4L5FE 5HPMA 1XR8A 4DVRH 5FPIA 1OGPA 3L1OH 4ZTEA 4DEPB 2N01B 1T21B 1T6BX 3IN2A 1XSJA 3EHBD 3ETBF 3BGMB 1WHPA 4NNPL 1BXUA 4X6CB 4PSRA 4GPVA 4JK0D 1RJYB 5JA9A 4QWWD 3WFDL 2AXHA 4HISA 1AY1H 3BCFA 4PJEE 4ZFOB 3E6HA 4HAKA 3ULSB 3F04A 2ZX8A 2Q8AH 3C5ZC 4H2CA 2WLJA 5DRXB 4PRNA 4C56D 3PIQB 3PY9A 5BV7C 5C7XH 3GSQB 2WZPD 1A7RL 3QIBC 4B53A 2XA3A 1IQWL 2QR0A 1PEZA 2QELA 1GA2A 3HN3A 5IEHB 1F58L 3LV3B 3V4VH 2VJXA 3EJZD 4L8SA 5AAPA 1B2WL 3V6ZB 2JK5A 4M3HA 4NCC1 4HIEA 4TLSA 3MRPB 5GS1C 1OB0A 2QFRA 1CO1A 1WAAF 4W4NA 4ZFGL 2QHLA 3II2A 1MFCL 5IJKC 4XXWA 4FQIL 3WLBA 4OD2A 1X4YA 4EN3A 3K6IA 1N8ZA 5CLWA 3LQAH 4WO0A 3QDHA 3I6SA 3BW9B 3T04D 4UOZA 1LO5A 5I1AB 1WZMA 2F74A 2EIBA 1DJSA 4Q6KA 1NEUA 2CXGA 4U1IB 1F2QA 2E59A 4PS7A 3I75B 4X80L 3GSNB 5ISZA 3A4EA 1M7IB 3H3BC 3MV7E 4HVBA 1WWWX 1NGWA 2NY3D 2XN9E 3ARSA 4PP2A 4N26A 1U3HD 2IAMC 2J71A 1RHHA 2YA2A 4X42A 5H2BB 4G8EA 3ZRCC 4Z76B 1U9KA 3NCMA 4OLZL 3KCWA 4BQCA 4K9EH 5D71H 2Y23A 5E9DB 5GGTH 2W88A 3BKYH 1UWXH 2P8PB 4Y5VB 1ZE3C 3U30C 1IGYA 5CWSA 5DZPA 3HE6A 3TBWB 3FH5A 1MVFA 3EOTH 3KL5A 4OZHF 1ZHBB 3BWUC 3PP4H 4PGBB 3ATBA 4PRDB 4XPTL 3RY6A 2ARJB 5SX4I 4NUGH 3UJTH 3CVBA 4L8BA 1MHCA 4U49A 3MJ7B 1H3GA 1TJIL 1OW0C 3BAIA 2HKHH 5EC1B 4FD0A 4MJ5A 2GSIA 1KJ2B 2IGFH 2J2ZB 3CDZA 3IDNB 5CJXC 3F85A 5CN2A 3B2VH 1IMHC 3DYOA 4UBDD 4IHOB 4Z77A 4NN7B 1CDJA 2MPAH 4DP9X 4N0UE 5JOFA 4OZ4B 3I6LD 3FO0H 3IAGC 3K6NA 4KKNA 3FO1A 3Q1EA 3QDJE 5GS1A 5JA8B 3NFNB 4GMTH 3MCKA 4I3RL 5JHMA 1ZD6A 4X4KA 1R17A 2ZXQA 3MU3A 4ZW3A 4MQ7B 1O7VA 1CICC 1BMWA 3BIKB 1JCKA 2WWKT 5CJQH 1YO4A 3QS2A 3FAWA 2DWEA 1PZ2A 2GFBA 4TNGA 4N0CC 4YDKH 5I76A 4K5MA 1T83A 4MMZB 5FUZL 3L4CA 2X9YA 1J1PH 2R0KL 4ZUSA 3P11H 5K9KB 3RKDC 2NUPB 4MSWA 5B38G 3E9UA 3ETBJ 4KXZH 4F5CA 3ROLA 5LGYA 3W39A 1WTGT 3MAWA 4LQ1A 4YHIA 5F3HA 3MROB 4AV4A 2OTWA 4PIRF 4GO8A 4AMKL 1JFHA 4M43H 4HG4J 2OK0L 4DPBX 2NNXA 3MRFB 4Z23A 2CK0H 5CUSH 2BVOB 2BS8A 1P2CB 3AUWB 3WKML 3BKCL 2A6IA 4KX8A 1TUPA 3C2AH 3DUUB 3V0VB 5HHMB 5DJYA 4JY4A 1IM9A 2EC8A 3VNYA 3FSWA 3NQKA 1KC5L 3N1FC 3GSNL 5GS2D 1S4IA 3APCA 4KH9A 3LPWA 4BZYA 4N8VA 4YBLC 2UYLB 3WCYA 4G6FD 4L1HA 2ATAA 1AE6H 4HMCA 3WJMB 3RTQC 3G6DH 3TYGH 4CGTA 1HKLL 1N8ZB 4XMXA 2YIHA 4IU3A 1UASA 3ARGA 5E6ZA 2YXFA 4PB0H 5DUJA 2W38A 2G4GA 4G7VL 3SDAA 4CU8A 2MCAA 1S7WA 1DE4A 4EI6B 2OM5A 4LARH 4M4RB 1ZKAA 1FFPA 3UTTA 3VGBA 1N4XH 1ZXKA 1KGCD 1SF3A 3OB0K 4E41E 1HL9A 4K94C 4RETB 3O45B 2ZUWA 5TD4A 1KXTA 1KMGA 1J0KA 4NQVB 2VM3A 4ZFZA 1PSKL 2APXA 3SN6N 4ATWA 4ZS7H 5L6YL 7PCYA 1F97A 4C54A 1U95B 3WO3B 2F0CA 4GQ9H 2XIBA 4Y19A 1E27A 2WGXA 1RZKC 3VB8A 4HWNA 3SY0B 1ZT7B 3F6JA 3HE6B 3SPHA 2ZXGA 3HS0B 4XPFL 2ARJA 1NBYB 4L4TD 2CKBH 4C4UA 1D2OA 4C55A 1AHMA 4Q52A 5AB1A 1MFDH 4F57H 3IDIB 4RESB 1FH2A 4PG2C 5DJAA 5HBBA 4XBMA 1I4FA 1XD1A 2LU5A 2ALAA 4JG5A 4HT1L 1CGSH 4QRUA 4HMEA 4FMVA 1SLUA 1BVKB 4NO2B 3L3OC 4AEHL 3AWGA 3IT8D 4I0PB 2BSCA 2GJRA 3C6LD 1T6WA 3IDMB 4QOKA 1NWOA 3W0WB 1ES0B 1AHWA 1W72A 4GLRH 4YDVA 2WVSA 5IVXE 3GM0A 5BO1L 3OZ9H 5EO0A 2PYFA 1HIMH 4D8PA 1UZ8A 3NZ8B 4XZUA 3LKQB 3HFML 4XE5B 5HGHB 3ARFA 1VPOH 3NJMA 4MAYB 1SXBA 3TBCA 1X5ZA 3CN2A 1FCGA 1OF2B 5HYSA 4AYBA 1AOZA 2MNWA 1DTUA 2ZKHH 3IE9A 1JVKA 3LRLA 4AITA 4IBYA 3VXUB 4POUB 4GRMA 1KCRL 5B3SB 3ESUF 4NM4L 4ZD3L 1KGUA 1K8IB 1WBXB 4GUOA 3I6GA 3Q05A 3I2CH 5J57B 4PI0A 4DETA 1MFAH 3D8MA 1ZXQA 3LNGA 4JB9H 3GUTB 3LD8C 2GJ6B 4PEEA 1QSFE 3PPSA 4RGNC 3FN9A 3FCTB 2NY2B 3FQWA 3UBFA 3X13A 5EEUA 1QFOA 1XF1A 3VXMB 5IFJB 4FKEA 1BDYA 3TJEL 2BSTA 5C2UB 1YRKA 2DPKA 3FU0A 3SBQA 2WUBL 3OKKA 3I9IA 5KJRL 3LZFH 3SE6A 4HUWB 3CDYA 1WAPA 5E6UB 5EZJB 3UZQA 2BOLA 4WTZA 4KUCD 1J10A 3B7SA 1MVUB 5D2LA 1A0QL 3FSZA 1T7VA 4DFHA 2WXMA 4L3EA 4G42B 2UWEB 3WS6C 2P5WD 2WN3A 4L3ED 3N44F 2WKOA 1KCSL 3FTVA 4LLWB 4PJ9B 1ZHLB 2H1XA 3BCDA 3BUYB 4YFLF 4XMKH 4LIQL 5HHVH 3VD1A 1OCWL 3WUWG 2EKJA 5J6HA 1XH3A 4H0HB 2XN0A 4UIMA 2O61B 3EO9H 1QMUA 5FO9A 2R2BB 1EX0A 3F7YB 4JVWA 3FB7A 5FW6A 2VR8A 4ZXBB 5KVFL 2UWEE 1MRDH 4K2UH 1EZVY 4XP1H 4BEIA 3O45A 1NZRA 2JJUA 5KG9A 1RJYA 2R27A 4E41A 1LP9F 4NDMB 3DMMA 1TF4A 1R6VA 1LGVA 1A6ZB 4ZODA 3PWPE 2VSCA 2NQ3A 1BX2B 2G3MA 1PMYA 5D7LE 5EFIA 4F93B 2ZG1A 2FBOJ 4LL1A 4R96A 4LSPL 4TUJA 4FLRA 5DJXA 1N5AA 4ZO6A 2CM6A 4KK8C 1MRCH 3V6ZA 3W56A 2F19H 2XBDA 4DO6A 4QGYA 1A4KB 1E8XA 1RV6X 1WS8A 4HPOL 3POHA 1RZGA 3SDDD 2Y1YA 4ZOAA 4QTHB 4BFOA 4I4WA 4DKDC 2D7MA 2A9NL 2EUVA 1FH5H 1IVLA 2R8SH 5CD5C 4UUJB 4QRRA 3G6JB 1FP5A 2LR4A 1IZKA 2GJ6E 1A7PH 5CZRA 5ACMA 1G87A 4K15A 4P48A 1PZ5A 3KS0H 3Q13A 4F7TA 8CGTA 32C2A 3IDYB 2F08A 2QVFB 3D4ZA 2CLZA 4XBPA 5BV7B 2AKRA 3EH1A 3MGAA 4RMRA 5ISZB 3FQTA 5C0CE 3OZLA 1HEHC 2WP3O 3Q1SH 4PUBL 5DGRA 5FYLD 1ZS2A 4Q58C 2OSLB 4RGND 1UGNA 4Z95H 4CN6A 2WVVB 5MEOB 3OG6B 1FZJB 1ZLSH 2EUXA 1MKFA 5J11B 3HRZC 1AKJB 3L95B 1IGTA 5DS8B 3H9YA 2C9VA 4EBQL 2EEDA 3B3IB 2DN7A 1NEZG 4CMMB 1KGWA 1DBAH 1QBML 2XZCH 4FGMA 3VI4B 4UQIM 4X83A 4OGAD 1V3LA 2Q0ZX 3BFOA 4PFEA 5AD0B 2AJXL 1AFVL 1TG8A 2NCMA 3EJPA 4NLHA 4L1TA 3INUL 5JDJA 4EZKA 4KK5D 1J0JA 3P0VH 4IKJA 1N0LA 1GZPA 2G9HB 1G7JB 3ILQD 3D3VA 1UKQA 3FT4B 4U1IA 4UT9A 3UGEA 3UJIL 1RUML 1MF2L 4RFNB 2JV6A 2MJWA 3WFBH 3V4LA 1XCQA 1DVFC 1ONQB 2E8YA 4FQHB 5LGHL 5CP7A 3K4AA 2G2PA 1A8JH 4JHAL 4KJWD 3P30H 3PP3K 4P2YA 1RIUL 1SF5A 3FH8A 4DN3H 4PCKA 1QFWH 2Y06L 1BF2A 3O3DA 2CO4A 5FYLH 4LMQE 3NN8B 5I1CH 4WWKA 1P5VB 3LQMA 3V10A 3PWPA 3MACL 3AROA 5KSAA 2X4SA 3AWEA 5BZWA 4MQ7A 1KLFA 4URKA 1OV8A 2ARWA 2IDQA 4H5SA 4PY8I 4FTDA 2VDRH 3O2WL 4MD5A 4YWGL 2YPLA 2UV3A 1M2VA 1EO8L 2XT1B 3GJFH 4M7LH 4TULH 4HIHA 2UWEA 2JJVA 2LW3A 3AQDA 3WHE0 1C8PA 4YK4C 4WY7L 5DFVC 4JLRB 2IC2A 2OMNA 1Z5LA 1OOWA 3V7MA 2P46B 5JUEH 1YMMD 1AD0A 4OCSH 1XZ0B 5INCB 4Z78B 2AJYH 5IJBC 4M56A 2VRQA 4XTRD 3RBGA 1KIUB 2VLKA 1INEH 1TYEB 2W0KA 4WI4A 4XXCC 3SO5A 4DVBA 2CDGB 1YEIL 3B5TA 4WFFE 4NO5B 5I6MA 3RIFK 2FQGA 4IYKA 4NRXA 5KSBA 1E8WA 2OW6A 3HE6C 4KKRA 1FVDA 4HS3A 3B83A 4FQXD 5ILTL 1QTPA 5DJXB 3JT2A 2WCPA 4WHYH 1AGFA 3BZ5A 5F7FA 4P2CG 5HD8D 1R0AH 6PAZA 4JHWL 4RSVA 4P23B 1LD9B 2YA1A 3VD3A 1I7RB 1UCBH 1UWFA 2Z1PA 2XACC 2RIKA 1BGXL 2IAAC 1BVNP 4DGUA 3B7YA 2AEQL 3HLKA 3KH3A 4F7TB 4X50A 4YGVB 3CXFA 2JJTC 1WD8A 2FNWA 2XV6B 4YZWA 4NQDB 2EVFA 2HPTA 1BZDA 4OLEA 2NMSA 1M71B 4JRYD 4J3WA 4I3GA 4ZJ9A 1D2PA 2BNUA 3RKPA 5CBEB 3SHSA 1MCOL 3DVNB 4QYOA 2EIEA 2WZPA 2D7QA 2VN4A 3BUTA 4R7NA 3RY6C 1L9NA 1SXCA 3ECBB 1YY8B 1I85C 3DUUA 4LHQB 3HC2A 3QDGD 1KB5L 1CFNA 1B4LA 4XCNB 4YHOL 1IM9B 4ERSL 3E6FA 4CBZA 3T77A 1ZANL 2YAMA 2OKMA 1SUHA 4MZRA 2P26A 5L2KD 5D1XC 5G5DB 4PRHD 4YL9A 1RY7B 1PD6A 3QO1B 4LVEA 2CBMA 2NNFA 4NNPH 4Z7QF 5CU5A 3VFNB 5BXFA 2BSEA 1KXQE 3U36B 2XDHA 2Y07H 2C7FA 3CFEB 1NM4A 3OJMB 1AY1L 1D7DA 4GKZA 1O7DC 1NCAH 4L3CA 3BRDA 5KVEH 2DQIH 1UD2A 1XCTA 4ZPTB 1NDGA 1A7RH 2B59A 5DFVD 1PZ3A 2G3ZA 1Z9PA 2UX6A 4JHZA 2HG5B 4L3AA 1TNMA 5LB1A 1B2WH 3PAUA 1EFQA 4MGXA 3GGWB 1FYHB 2BWIA 5I18L 3FN3A 3H8NA 3PDOA 1FFTB 1W9XA 1VEOA 5F0JB 4MA1C 1UZ6F 2HN7A 3CVHA 3QAQA 2OS7A 2UZXB 1HEZA 1W72L 4KQ4H 3U9WA 1X5MA 3ENEA 1D9KA 4M48L 4QRTB 1AZUA 1OAUH 2QZQA 5JW5A 4WW1A 5E9DE 4U6YB 5EU6D 4JO5A 5F1OB 4AQ8A 1XL4A 4MS6A 3CX5J 4PY7A 4BM7A 4BFRA 2EE6A 1MW1A 3HE6D 4Q9QH 2WXQA 4JKPH 3FTGB 4YSDA 5T1KD 5IQ9B 2B3RA 3VD2A 5EB9A 1BEYH 2KPNA 3MRPA 4FA7B 1K4DB 4Z3HA 1G4MA 2WTRA 2OX5A 5HD8C 4AQEB 1J9QA 5C09A 1M7XA 3FDWA 5BZDA 1KELL 3RVTC 1QZ1A 2I32A 5I1KL 1CR9L 1QFPA 1NSNH 1QLFA 1AZBA 5I6PA 2OMYA 3MA7A 3RHWK 1S3RA 5E9NA 3GSNA 3GLDA 2BVYA 3DRTA 2VO8A 3DTXB 3SPVB 6TAAA 2KLRA 1BF8A 3NTCH 3MCG1 5HJ3A 5MI0C 1XIWC 3EOTL 3SEPA 3PP4L 3IU4L 4AGOA 2XRAH 2CHNA 4GW1A 4D0DA 3GIVA 4NZRH 4JM4L 5C2BH 3VXMA 3RZWA 5F1IA 4PP2B 3TFKD 3O0LA 2VR9A 1FVDB 2CA4A 4HS3B 3IFLL 4I2XB 1OVZA 4ZOBA 3RA7L 5IKCB 1TJIH 5G2NA 3DPDA 2EVHA 4WU7A 2RCSL 3I9GH 3QEQB 2JH2A 3U4EB 1AZRA 1JERA 3N44B 3VXUD 1YNKL 3RAJH 1GXEA 3B2VL 1PD0A 2IWEA 3GLZA 1V7NL 3IRCA 5H4YA 5BMFH 3K74B 2EH7H 1H3TA 3M17A 4PRAA 4OLWL 1ZHBA 1PLBA 3I85A 3KEDA 3QG7L 3WENA 5EN2B 5F7DA 4B7IA 4G42A 3L1GA 1CLYH 4OF7A 4OLUL 1A6WH 1KT2B 1DLHA 3TPUB 4NRYB 3ETTA 4WDIB 3VFSB 4HJEA 4NNXB 2ORBH 3ARDA 4NI3A 1SEBA 2H32H 2TRHA 4YXLH 3OAUH 2R29A 4XO3A 3PJSA 4MLIA 2R2EB 4JQIA 4K5OA 1LWHA 4FP8H 1TQSA 4MTMA 1J0HA 2UVFA 1AGCB 1CFVL 3VX1A 3B9DA 1UFGA 4DERA 2WQWA 4DGIH 4H20H 4I9WE 1KEGH 3UTZB 5FK9A 1KCVL 1ZA3B 1QO3B 2AV7A 5LAXB 2P9RA 4KRPB 4X6BB 2PW2A 2R0KH 5E1HB 5IOPA 3IFNH 2EVIA 1DFXA 1J0IA 4XOBA 2OI9C 4G72B 4IOFD 5ANMA 4ISVA 1JF1A 4HOWA 1MVUA 5D2LB 1U92A 4PG9B 3U36A 1IKFL 1RZGB 3N42F 1ZTXE 2FHBA 1HCFX 4RLDA 2H1PL 1VEMA 4WGKA 5LG6A 5CKAA 3VI4E 3WKMH 3S34L 3BKCH 2X1WL 3QI9B 3SDAD 3C2AL 4ZQKA 4POYA 4QRSA 4PJGF 4MA8L 5GZNA 3UTTD 4I0PD 1IC1A 4DUVA 2EADA 3RWFA 5AAMA 4Z3FA 5DLMH 3KDPB 2CDEB 3GSNH 3RNKA 5B4MC 5JHLL 2FSDA 2AQRA 4X9BA 4EN3C 4A2DA 4ZX6A 3KVQA 1OSZA 4IOIB 2DLTA 1IFRA 1UB6B 1EEQA 3T2NH 4LBEB 1CD0A 2KERA 5B1JA 3MGTA 3OLEA 1HKLH 1I3GH 1NPJA 2CGZA 5EFIB 4XP9H 1BFSA 4U6YA 5AW0B 1QSEB 3F7QA 3NFPA 2X6VA 2Q76B 4O02B 5KVGH 5EEYA 2XXFA 1BFOA 3SBRA 1JGDA 2K1MA 2X6CA 3L3HB 3QXTA 4J3OF 4LARL 1ANUA 1EDQA 4LGRB 5AVUB 1TEFA 4HZLB 4KK6D 1BOGA 1F11A 3VXQA 4M3KB 1C7SA 3UTQB 3DRQA 5HDWA 2F58H 1A4JA 2YPVL 4R0LA 1TMCB 1X7TA 4UM8B 3RRQA 5BZDB 1IFHL 4N22A 2AV1A 1CMOA 1QLEL 4PD4J 1PSKH 5JXAL 5D2NE 2W91A 4P2RE 5L6YH 4ZS7L 1BIIA 4JFOA 4KDVA 4HKJB 3QWRA 4LPVA 1UVQB 3WFEH 1JD9A 4WU5A 4R97C 4EIBA 3LZQA 5CD3B 1VFMA 2B4CH 2D9CA 3Q2CA 1A7QL 3VFUA 2ZUXA 5CSGA 3VW3L 2MQCA 5SWSB 4XCFH 3H2QA 5BJTA 2BY2A 3S35L 3J27A 2JKXA 3NSDA 2CKBL 4NKDB 1FZJA 4XN8A 4CSTA 3RILA 3VXPA 2WZ6A 2J6EA 2VDPB 3EJUA 3WIHH 1S9XB 3FSOA 2CJ3A 4OF8A 3SZKC 3WAKA 1DR9A 4J3OG 3LEXA 2Y7SA 4EUPG 2J25A 4GI8A 3GSOA 1J86A 3T0EA 1G9NL 4AEHH 3IGUA 1Z3GH 2YK1L 3OHXC 1F4WH 4IEFB 4C8XA 4Y9GA 5E5MB 3CCHA 1NBYA 4LLVB 3CHRA 1BREA 2QKIB 3ALPA 3CVHL 3IVKB 1IKNC 2ZX5A 1HIML 1JS4A 1TJHH 2FX8L 4XH2B 5DZVA 2E9WA 3WOVA 2BNRD 2BZ7A 1TZHB 1X5GA 4LAJH 4ODWA 1B0IA 3J2PA 4KI1A 3T4AB 3PU7A 3NJNA 3D25A 4GKOA 1ACZA 2DQFA 5C92A 3OGCB 1J9CT 3FSAA 4JFZH 3EG9B 3MTRA 2F5AL 3WTTA 1GOGA 4K8RD 3VXME 5T3ZH 2AZAA 4Y5YA 5CP7B 3ZYIA 1Q9OA 4HV8A 1OPOA 5CU9A 1KCRH 1XGTB 1ZVYA 4GSQA 2BP8A 4NM4H 4DP1X 4X8CA 2E9GA 4ZD3H 1NBZB 4GG6B 1E9QB 4AEFA 4LNRB 3FU9A 4LK4A 3MDJA 4Z3GA 1MFAL 4JB9L 5EU7C 3GHBH 1BV8A 4EN2A 4YS4A 1KLFB 2BERA 2XTSA 2AJUL 2O5ZL 4MAYA 3INOA 5AOZA 5TDPA 1FHGA 3QDGE 5LN4A 3FO9B 5CCKH 1UT9A 1E50A 4P23C 1C12B 2HKFL 3OXSB 5HDBB 4ONHA 3RWEB 5ICZA 3SO3C 3BP6B 3CVCA 5EF2A 4NQXA 2VLRD 3WIIH 2X6BA 2VXQL 4NZ8A 4L8CA 1QBLL 2DMGA 2H2SD 1KLUB 5CLYA 3AT9A 3NUKA 4H8WH 3UZVA 5JHDE 4JNXA 5BOZG 3LNFA 4U7MA 4WKXA 2CAKA 1XF2B 1GMEA 2ZWSA 4JMXA 2A7BA 4S10A 1U8JB 3TJHD 9PCYA 5ICXA 5CBEA 2PCPA 2ZKMX 1J05B 2OCJA 2X5PA 2E7DA 3VRJB 4X98A 1TETL 4AY0A 3QIBA 4U05A 1JNJA 4CBPA 4BFJA 5I16B 1BZQK 1JI1A 3MRQB 5GS0D 2VRKA 1HH9A 2CO7A 2XG5A 1XX9C 4BQ9A 2Q6WA 3QJFB 2JE8A 4CGUB 1EEZA 1U42A 1V5JA 4YK4B 3MNDA 3VXNA 3HJ0A 3N06B 3L3IA 2Z4QA 1PPIA 5F9AC 3ISYA 2YOAA 1RFDL 1KPUA 3DV6A 3LKRA 3V0AC 4EVNB 1QA9A 3LN4A 3BLPX 2XWJA 3K0YA 4LCWE 5I5JA 1KBGL 2XXGA 3PHSA 4UDUA 4F24A 2SEBB 1E4HA 3M6DA 1J11A 2DEYX 1NFKA 3KPPB 2AI0H 4K3JL 4XGZA 2EDDA 2YJLA 4WUUE 2F19L 4E9WA 3FB7B 1H9DA 1WIOA 3KLAA 1E2ZA 3IRPX 4HPOH 1Q72H 2YXMA 5KG9B 1YEWA 2UY7A 5A2JH 3REWA 4ZSOE 2R8SL 4CNIB 1PZUB 3D34A 1UTDA 4CSSA 4KZCA 4O5LH 3QC5X 4CMHC 2FX7H 4Y2DA 3TT1H 2Z31B 4P5MA 4PJ8B 3JWNG 5L2KB 2D8KA 4R96B 4LCWB 1SPDA 2P47B 3CN4A 1ILSA 2YA0A 1I1FB 1LTXA 2FYYA 1VZHA 1GGBL 2WXIA 3H56A 4J4PA 4MB3A 1A4KA 5HYFA 4KO9A 4LLVA 1BD2A 3DV4B 3UC0H 3JZYA 2JI1A 3VTMA 3GMLB 3OKLB 4WZ9A 4WUUB 3CSGA 2V5RA 4PV8B 4Y1TA 1WEJL 1S9WA 3RPKA 4Z3TA 2HG5A 4UQEA 2F9BT 4RMTA 1KJ2A 3CDZB 3D25B 3IDNA 4JFPA 3OL2A 4JY6A 1QBMH 3C60C 3N85H 3MRJB 4GXVL 2EDNA 5HHME 5ES4B 3MV9D 3TO4A 2ZSVA 2E56A 3U4KA 2AXGA 3BZ4B 3IWVA 1JZ2A 4QHLA 4W9HC 2R59A 2AJXH 5KYXB 1AFVH 5JW4M 3RFZC 1M9WA 4LVOC 1FLRH 5EU3B 1WFOA 4S11A 5GGRY 2J56A 2ZXBA 4YDIL 2IF7A 4QHUA 2WVVA 5MEOA 1BQHB 5J4MA 3RWHB 3S3PA 4BHUI 2LLGA 5F1IB 1PX3A 3BMVA 4BGDA 1A1OB 4QKTA 1QW8A 4N2HA 3DIVA 3CLEH 4X6EA 3D4YA 4CAGA 3RZCA 3M7FB 2BVPB 1A14H 2EDWA 3WFBL 1Q9KA 2BDNH 1KB5B 2W65B 3QE5A 4S1DC 4MB5A 1KZYA 5HDBE 1N0XL 2FSEA 2HB0A 4UAOB 4DP4X 5GRUL 4L8CB 2YQ2A 5KTEH 5C3LD 1N0LB 2G9HA 4DN3L 3LYRA 4Y5XC 4YHLH 1H6EA 2QGCA 1H8OA 1XF3B 1OSEA 2HA1A 1UM5H 1HHJB 1Z9OA 2VLJA 5DMYA 1SHMA 1QFHA 2ZOLB 3B1TA 2ERJC 2FIRT 3MACH 3QJUB 3QDJB 4F1ZA 3RGVA 3TTYA 2FEJA 3KPSA 4W6YB 4X99B 4U1MA 1DQIA 1ZV9A 1SLWA 1J05A 3KBPA 1RUQL 1KGIA 2ICWB 1EO8H 1G7QA 1X7QB 5IQNA 3HBQA 4MDJA 3EZ8A 1AS6A 4PTUA 1FNGA 4ZBJA 4GW4A 2N59A 4XAKE 4QNPF 5KSVA 2X4UB 1FBIL 5GRVK 1RMFH 1EJOL 1NUNB 2FTAA 1ZA6A 3MUJA 4FL4C 5HVGB 3TASA 4YE0A 2IIJA 3NJJA 3ULVL 2H6OA 2ED8A 3K71B 1PBYA 2AJYL 4A6YB 2X53A 1K2DA 3OQ3B 1B9KA 3MLXH 5DI8B 5CSZA 5JDSB 2WTPA 3B2XA 1INEL 3T08A 5A6LA 1RZ7H 3GBDA 5KSAD 2OZ4A 1YEIH 3H9SA 1ORQA 4KKAC 4I9WD 4KMTL 3ZO0A 3U1PA 1DBKH 3LJ3A 2JI3A 4RMQA 2Z3FA 1A4BA 4QIRA 4U4BA 2I9LA 3RGBA 1OE1A 4V2CB 4J1UA 5ILTH 3P0YL 1Z1WA 4HK3J 4I1NB 4M3JA 4WFGE 4PVNA 5LNDA 3KM2A 4GAFB 3CHPA 1V54B 3ISRA 1KIUA 4ODSH 3I50H 4U3XA 4L1LA 3UTZA 5IEKA 1KEML 1ZHKA 4X6DB 2FIKA 4NLAA 3B56A 1UCBL 3MNMA 1MAMH 5IROA 1TSRA 2PCXA 2ZZUT 1MH5A 5FHBH 4WW2B 4S1RL 1R75A 2Q76A 1T1WA 1WGOA 2IGTA 1K85A 1GY1A 4DP6X 3SDDC 3G5WA 4LKCB 1I31A 3FONA 1QOKA 4RZKA 3A22A 5DHEA 1AQHA 4PLJD 4IOSA 5CD5D 4R0LB 2H32A 2P5EE 5I0XA 4K7FB 3X3FL 1QHOA 2NPLX 4QRSB 4LCVA 4Q9BA 1PLAA 3DIFA 3BIAX 3L17A 5I9QB 1KB5H 2HX9A 4HXAH 5IHZB 1LK3H 2ITCB 4U1SB 3NSCA 4G1MA 3KAAA 2JQZA 4X7TA 1OO2A 2DD8H 1TVBA 2WQSA 1B88A 1RP9A 2O1AA 1DQVA 3UAAA 3CFJB 3HE7C 2MWCA 4A7VA 2C34A 3PNWA 3ULUL 1CURA 2R29H 4XO5A 2E9BA 3QW9A 1NCAL 2VB5A 4AE0A 2DQIL 4S1SL 3NFPB 2Z7UA 3IFPB 4F27A 1WT5C 5IFHH 2F8OA 4OZGF 2EO7A 5MENA 3L9RA 2CM5A 2CU9A 3VX0A 3X17A 4Z7QE 2XPGB 3EYOB 3B5GA 1A4JB 2A6DB 2BNQA 3DX4A 3NSYA 3BUIA 4L3EE 2E0PA 3DI2B 5E5MA 2A1WH 5A2CA 5D2LE 5CILH 3OAWA 4KQ4L 5KSAC 1TMQA 2ICES 3KHOA 2H0FA 1CWVA 1R3HA 2B20A 3TH4T 3FPYA 4KVNL 3ZTJH 1Q0XL 1OD9A 5DJCA 1KIRA 2E47A 2AJZA 2V2WB 2YLKA 1U30A 4MVBC 4EZMA 4L9DA 5B1JC 8FABB 4Q9QL 5KWYC 2X1QA 3AWFA 1GKOA 3GXFA 1YMHA 2V9QA 5G4OA 5A16A 4P2OB 3EG9A 4IOFC 3U6RB 1BEYL 3PDOB 3R0NA 4JG0H 2ICWA 4IIQC 5I6KA 4WCYH 5FOBB 2HN7B 4TOYL 2R1WA 4MRCA 1WFMA 4P57A 4YXKL 4YBQD 3DSNA 4LLQB 5KYUB 4AL8C 5J5EA 1E90A 1A22B 3H2PA 1J18A 4PJAE 1CFBA 4PY7B 1DSFH 2K45A 1K2DB 3HKZA 3HZMA 4KKBD 1DLFH 4NHCL 4IGBC 3BGFB 3Q48A 4PAZA 1YA5A 3WEBA 1SJEA 4PJ9D 1MXGA 3EGDB 3F7RA 1OGAE 4N8PA 3O41A 4NZRL 4PRPE 3FQNB 4JM4H 4RGMB 5AL8A 5E4IA 4AM0B 5C2BL 2L04A 5BVPL 2DQTH 4J1UB 2CRMA 4J3OC 3RL2B 3TH2T 4JZOA 1LO0H 1ESOA 1TYJA 1X5XA 5JPNC 2Z8RA 5TPWL 2RCSH 3DBSA 5IB5B 2QGDA 4OBRA 1LM8V 1YNKH 3NFSL 1U8KB 2Y7QB 2AVFA 3C9NA 1U58A 4WTZG 3QISA 4BXVA 2EXYC 4KK9C 4Q56A 2BFVH 1SXAA 1Q1PA 1QR4A 3L7FA 3QEQE 2DQDL 3V0VA 2OP4H 4ZAKA 3LN9A 5IOKA 4HQQH 4I2XE 3CZFB 5ABAA 2NYZA 3OAUL 2EEBA 1XD0A 1F02I 2FO1A 3D0VB 5DJ2A 2CBOA 4ES9A 3A4AA 3ARRA 3VXNB 2Q10A 3BAWA 4DGIL 2WQXA 3ISWA 3QK0A 4PWFA 2C3HA 4BCZA 1KEGL 3MLWL 4X5RA 3GTNA 5EN2A 5FGSA 2R0WL 4Z7UF 1LO4L 3UP1A 4Z7OB 5BOJA 1PY0A 5LJYH 2FECL 3K6FA 4XNZC 4ZFQA 3EZJB 4BE6A 3HAEB 4P5TA 2ZOTA 4F58L 4AXWB 1BQLL 1TZOA 4QEGA 1OE2A 3IFNL 2PKDA 2H4EA 3BPOC 4NUJA 3I02B 1AP2A 2CCVA 3S8GB 4JPVH 4FG6D 1Q94B 2FHFA 4KXBA 1JNLH 2AK1L 2MOVA 1AGCA 1GAFL 1JWUB 1A64A 1JWSB 1OAQL 3O9WD 2EDHA 3MBXH 4RRPM 4TVUA 3QQ3A 3P77B 4A7SA 1HZLA 2K70A 4K3HA 3MO1A 2LT9A 4JO2L 4EIGB 1HWHB 1S7TA 5DC0A 4B27A 1C7TA 1LWRA 2DWDB 4PP1C 3D30A 5IOPB 5FX3A 4IRSA 3IETA 2G30A 3L9RB 3QJZA 5F72S 4UIKH 5JQIB 1RZJH 1R3IH 3EYOA 5IQMA 1KXHA 5DRZA 4U1LA 1IBBA 1ZVSB 1SHXA 3ULVD 1A6UL 2VR6A 2A6DA 1NKOA 1IBGL 4PGDA 3FB6B 5IMMA 4R7VA 4MMXA 1J0ZA 3T0EC 2ZD0A 3T2NL 2FR4A 4X7SH 1I3GL 3QZWA 4KKPA 3UTSA 4A2GA 4PGJA 4MXVF 2MNJB 4FTVA 4OSUH 4XNQA 5DJCB 3WKQA 5KAQF 1OWWA 2GJZB 4PLNC 4AENB 2DMHA 1DANU 4I18C 4JY6B 1A1NB 3QORC 4NZDA 2FDBP 4XMPL 2FT6A 4IJTA 1CU4L 4WV1B 2VNCA 2YD0A 3B9KB 5LBSH 4OGXH 2YPVH 5CINL 5D6CA 5HHOD 4QHUB 4NERA 5EIIA 3S36H 5IV2B 5IW3A 4WWKC 4XVUD 4A7GF 2QR0B 1I82A 1QSEA 2OZ4H 4PJCA 5CEYA 1TVDA 3TCTA 3ARBC 2FYYB 5L9DL 2B0SL 2WN2A 5DHDA 3TA4D 3ZTEA 5B8CC 4L2YA 4QD2E 2WHVA 3MRCA 1M7DB 1QW9A 1N68A 1R4XA 3HVDA 2B4CL 1WJ3A 1A7QH 2OMBA 3ESVF 5EU5A 4U2ZA 4XCFL 2H6UA 3BD5A 3L1EA 4QJ3B 3ALXA 1ZK5A 3CMOL 3E7JA 4LASH 3WXVH 4L4VD 4TV3A 3FT0A 3ZQWA 5KJ7E 3TA3C 1TJGH 3ILEA 3N1MC 1Z5LB 2BS9A 3HG3A 4NRZA 4QRRD 1TO5A 1F1AA 5HP5A 1OSYA 1XSKA 2DH3A 4YHML 1LK2B 4MXWL 3VD5A 4PWHA 2R69L 4JFDA 3KXFB 4W9EC 4BRVA 1S7SB 4WWPA 1IAII 4HLZG 4P9HH 3TTSA 1Z3GL 2YK1H 3DX9B 4WGVB 5D8JL 1UG9A 5GS3A 1VGKB 1HXYA 5HHMD 4ANKA 4DEWA 4A7UA 4D0CA 2NNCA 2O6DA 3NCWA 5HGDB 3V4PL 3IMBA 1BFVH 5IFJA 2HJFB 4EOWL 3CVHH 2HWZL 4R3SA 3RWDA 3CLFH 4LSQL 5E00A 4G8GD 1J5IA 3EH5B 1B90A 4LDEB 2H26A 5D7LD 3Q6GH 1KB5A 2F5AH 2EIDA 4XO8A 1INDL 2FSEB 2G0LA 1X6LA 1QKZL 1TOXA 3D09A 3SQRA 1N9PA 3O3EA 4PJ7E 1ULVA 3SO3B 4E42A 4KK8D 3WN5A 5JHDA 1FFOA 1OD7A 1KJVB 3GEWB 4LLMA 4X9GA 5HYJE 3C8HA 1TVHB 3VXTA 3T0XA 1FIEA 1H6TA 3GHBL 4PRPB 1IT9H 2V17L 5E2JA 4X99A 2NZIA 1JWUA 3HC0A 4EZJA 4FXGA 2HKFH 1TJMA 3EYFA 4EMZA 2ENPA 3OAZK 3RZCC 5CEZD 1LE9A 4PVBA 4UT6L 3WIIL 4ELMF 5C8JA 3JVFC 3O2DA 2VXQH 3QRLA 3S4SB 1QBLH 4G5ZL 1OB1B 3ZJAA 3ECQA 3CVDA 3AVEA 4TL5A 1T1WB 4TUJB 1L6XA 4OIIL 2BH0A 3C5JA 3KW7A 1JE6A 3QO1A 4FDWA 5DURB 3ZHNA 2BVQA 3QZPA 1NL0H 4L29B 2CJSA 4WJG3 4R4ND 5C0EB 1T7WA 4LT7A 4W9LC 3T2LA 1RPKA 2WMPB 3GSWA 1NQBA 1TZAA 1MW3A 2H32B 2ZX9A 5DJ6A 4ANVA 1KYOJ 1G43A 1QSFA 2Q3ZA 1TETH 3VDAA 4YSUA 4N1CA 4DFIA 3MV01 5I24A 4PHZA 4U6XA 2DYPD 4BIKA 4CVXA 3K2MC 3IDGA 4NUPA 3FRPA 2ROYA 3ULUE 1NCDH 2FL5B 3RX9A 3US1A 4G9DA 2D3JA 1WWAX 2OR9H 2FWOA 1X44A 3N42B 5TE4H 3CXDH 5JZ7D 4OJEH 1G1OA 5F88B 3M1BA 1BJ1J 5IV2A 3CFDB 1BAFL 3QIBB 5EIVA 4GKNA 4JM2B 1B6UA 1MFEH 3MZGB 3LMJL 3SE4C 3S5ZA 1HH6B 4AYDC 3JTTB 5ECJE 2G2RB 1XGQA 3H4FA 5EBMA 4A7GA 4ZT1A 3WJMA 4BFBD 3O4LB 4KJYA 3OKNA 1AGEB 1YPZF 2N7BA 4KO7A 1SM3L 3ZKXC 4IU3B 1L3NA 3BEWA 3V5HA 1U91B 4XWGL 3U0PA 4HJTA 4C4KT 3APMA 1YDPA 2WQRA 5E8DH 4M5ZL 3B43A 4JEGB 3G6JE 4JZNB 1GGBH 3KWWB 3CSYB 3WHE1 2OTPA 2X2HA 3TM6A 3PFQA 4X8GA 1E4WL 3QUKB 3GZOA 4X9YA 2NW2A 1SEQL 3K6DA 2P1YA 2RR3A 1AQKH 1KPRB 3H9HB 1BQUA 4TUUA 3DO4A 1RZQA 2P24A 3N50A 3RDTA 1CG9A 5T3XD 1FL5A 2HRLA 4MNQE 4J2XA 1FE8L 3NSFA 4APQA 4QHPA 5CGYC 1YYML 4A7TA 4KJWC 3FFCA 3SODB 4F3FB 4UTCA 4Y4FD 5HHOE 1H5BA 3L3OA 2DL2A 3QH3B 1DJYA 4J4PD 3PE9A 4JKMA 3UTTE 1JHTB 3KWVA 5I19H 1SLXA 5D70L 2MKLC 3SKJH 1AD0B 2BIQA 4JZOB 8FABA 5DR5H 4AIOA 3VD9A 5BW7C 1OE3A 5D7JA 5A2LH 2WZ0A 2XKNA 1O7SA 4XNXH 5E1GA 1FNEA 4M5YH 1SN0A 5ID1B 1K5NA 4BSWA 2FJFA 1YEHH 2WYIA 3QQ4B 4PRID 2DS4A 3VYPA 1QI5A 1H6FA 4U7KA 4RCAA 5KTEL 3GXPA 1JHKL 4D8PB 5TDNA 5E7FA 4ONOA 2CR0A 5D9SA 1Z9MA 1XZWA 3VE0B 1BMZA 4JFXB 4LPTA 3FSVA 2NLJA 5D72L 3IKCB 1ZGLM 1NCNA 4JX0A 4J27A 5T1KA 3FB5B 3QUHA 1ICTA 4OJDH 4FJZA 1G5AA 3QZBA 4S1QL 3LDBC 1ZT4B 4NN6B 1F3DH 43CAA 1KN2L 4GRMB 3D2UB 5I0VA 2DF3A 1UM4L 4XVTL 3S97C 4LCCC 1A6AB 3E2HB 5CZXD 4NBXB 4F5CE 4Q89A 4R90L 4FS0A 4MQXC 2OJEA 5D1QD 3SDYH 4N2FA 4P46D 3FRPB 2B1HL 5ALCH 4JO3L 1QTSA 2ICCA 4P46A 3I9PA 3SPJA 3FJTA 3MLXL 2VLJD 2BNUB 4ZMYA 1U58B 3FCTA 4NT6B 3C5XA 2CZNA 4C4KO 1J1XH 4RFNC 1GTNA 1RJLA 4GIOA 3GBNL 4KMTH 4JAMA 1ZE3H 1DBKL 2VMJA 5CLZA 4PTTA 1VRSA 5EZOH 1TNNA 2HLAB 2BWQA 4CC4A 1B0RB 2PTTB 3P2DA 1KTCA 4KWUA 2C1PA 3EW3B 4Z9KB 4O9HH 3MNZB 4LFHD 2XV0A 3IMWA 1ZVSA 5DI8A 4ODSL 3S48A 1CLOL 4L37A 2C4XA 1FNAA 2Q8BL 3L7EB 3BX7C 2I9TB 3LIUA 4AZUA 3PV7A 2LVEA 3PL6D 3KLHC 3ULAB 4XXDB 1ZWIA 4MAZA 2I9LB 4QTIH 1MCFA 1AP2B 2EYSB 3LQAC 4L18A 1KGXA 2BHFA 2YD1A 3RJQB 2VDKB 4ZXBA 3W5NA 1R5WA 3VH8A 2WWKO 12E8L 2A74A 4LRIC 4MNGA 4Q9RH 2O6PA 5E9DD 1RIVH 1Y1UA 2VSMB 5EIIB 1T7XA 2F54D 5BCAA 4UZUA 3WNOA 4OCWL 3W9EA 2DQUH 1PTZA 3C5ZD 2KZ1B 3FBKA 4FYTA 4HXAL 4F15C 5F1SA 3Q2NA 1LK3L 2DW5A 1JZHA 1MCWW 4APQB 2ICWI 5D1XE 2VT0A 1OP3K 1QLEB 3TBWA 4PJ7B 2DD8L 2XN9A 2OTUA 4AH2B 1DJHA 1NM9A 4OD1H 3UBXA 2KI6A 2GTZA 1M2OA 5KZCD 4DQAA 1FN4B 4LLUA 2VW7A 2A4CA 3DNKA 3ARBB 4ZUTB 3B1UA 2FWUA 2R29L 2E9JA 3GHPA 3FCSB 4S0TD 1RJZA 1N67A 2AP2A 2DB8A 4HGWB 2ICEC 3LEVL 4L8DA 4X7FC 5GJTH 3T8MA 1NCBL 4JPKL 4QAMB 3AT8A 1IQWH 1G7IA 3FZUD 4DP0X 4LVHB 4XMTA 4UT7H 1F58H 5E51A 4K55A 3ABGA 3DX9A 4PS3A 2PETA 1E0OB 3ZKND 1VHPA 1CT8A 4IDLA 4FQXB 3AJ7A 4NYLA 2A1WL 3BGAA 5CILL 4FQIH 3TEZA 2JVUA 2WXNA 3VNZA 3T0DA 4M7ZB 3LQAL 1KTKE 1MSPA 3KJ4B 1CC3A 3JXAA 1Q0XH 5IBLD 5GGRB 4Y2OB 1V3MA 3MRCB 4JR9H 3APFA 3E1F1 2Q20A 1IIKA 2Q7AA 4PJBA 3DVFA 1GCFA 4M5SA 5MERB 3QUXB 4ZS6D 5ICZB 3D2UA 4FKKA 4JRFA 3VD4A 4J7RA 2GABA 4A1RA 1IAIM 3NIFF 3SD5A 4R7LA 4XPAH 5GIRA 3SDXF 1EXUA 5D1ZA 3PL6C 1DDTA 3KLHD 5F96L 3X11B 1EJ8A 4OLZH 5EBLA 1RZ8A 1RSYA 1U8JA 5C3IA 1OAZL 2PO6D 5A16B 4Q14A 2D7NA 3PQYA 1JYXA 4U3CA 2TSAA 1SJMA 4N0UB 4FQHA 3HA0A 1GJUA 4G8GA 1AJ7L 3HOGA 4M00A 4ENZA 2A3TA 3LXCA 3T2PA 1IBFA 4NO3A 5IQLA 2YKKA 4EZLA 3KDMA 1F1DA 3ARFD 4HEMA 4NKMB 3U2SA 2H41A 2HT4C 2ENQA 5F93C 2OYPA 4OKVA 1HH9B 4RBPK 3VXMD 5JOPE 1ZDQA 4H25A 1S7RA 4FC3E 3MNZA 5DMKA 4ISVB 2YLHA 5J0BA 3LKPB 1O5DT 5DRWB 4HCGA 4YSRA 5DK0B 1GL4B 3NFSH 2DTMH 4M61A 3SBWA 4YHYC 3QJHB 4HH9A 2WOBA 2R0ZL 4OFPA 1LEIB 4PM1A 2BFVL 4JMNA 2VXUH 3FO0L 3FQNA 4U4IA 4XC1L 1QATA 3SQBA 4AM0A 4HUXA 3UTPE 2DQDH 2ZAHA 3RL2A 1A3ZA 4N90E 4GMTL 4I3RH 4GMSL 3MODL 4Z78A 1F6AB 1UA3A 4FCHA 4XI5C 1OALA 3QJQB 2R9HC 1HQRB 3EJYD 5CJQL 4I18A 2QPUA 1TTGA 3N41F 2HX7A 4YDKL 5C8JB 1JUFB 2YD2A 5FA4B 4EUPB 3S3CB 1JBJA 4P5MB 1LO4H 3KR3L 3PIQA 4WI3A 1OCRB 3NCXA 1J1PL 2Z93A 1BQLH 4QY8A 5DURD 3HB3C 3V0WL 1KCWA 4OFIA 2CLRA 2Q2EB 5E2TH 2VE6A 1KWKA 1S7XB 1IM3B 3RPIA 4ZI8A 1NMCB 4JPVL 5AAWA 5E2VH 1HINH 5I30L 1GAFH 5DUML 3PF2A 4O02H 3ARBA 3MLVH 4HFUL 5DHMC 3R18A 3MV8D 2YXVA 5DYOB 4JO2H 4ZUWB 4FFTA 1LO5B 1EAOA 3WO4B 5I1AA 4P3WA 2EKSB 2YXWA 5CEXA 4DQOL 1UOKA 4FQQB 1D5MB 1WLHA 3D85A 4XC3L 5K93A 3ZKXB 1RZJL 5CD3A 1IQDA 3RBSA 4PJEB 3DGCR 3RFZA 2YUXA 2FQFA 1IBGH 2PO6C 35C8H 4N2LA 5AB2A 1BQHA 3NJKA 3T0WA 1U8OB 1SLVA 3Q7JA 1YEGH 3EBAA 2E5EA 2HJLA 2P3YA 5EIIG 3TEXA 2BCMA 5K1VA 5K9JL 4RMSA 3F2LA 3CZNA 1QSEE 3KYKL 3PGFL 2HH0L 2UY6A 2OR7A 2WP3T 1WYJA 3FT1A 3JTTA 3P9MA 4G9FD 3VFVB 5SWQB 4ODXB 4Y5VA 3GSOB 5G5DA 5DRZB 1T20A 3VMNA 3BC9A 3VD0A 3QYNA 4GO6B 1CU4H 3QJOA 1CI3M 1F56A 3MRRA 2I27N 5LBSL 1UOWA 4OGXL 3AQZA 3BWUF 3K7UA 5CINH 3CBJB 3KPNA 4QF1B 3QUZA 4I7ZC 2JSFA 2UVEA 4G8IA 4A2LA 4PGZA 1AOHA 2OZ4L 2ZF8A 4L0ZA 1SMOA 3IMUA 2FUTA 1EZVX 2B0SH 4TQ8A 5L9DH 5FYJD 2ZYHA 5GGTA 5I66A 1T80A 2K4AA 3KPRA 4Y4KC 4QRFA 1NANI 3AM8C 3HG0A 3V4PA 1MWOA 4BKSC 2HFTA 3JVGA 4XI5D 9CGTA 3DJZA 4NBYB 4W68A 1TTUA 4XPFH 3CMOH 3WXVL 2AMGA 2F54E 2ZCZA 4OQTA 5B3JE 3AGWA 1E9QA 3FHAA 5JW5B 2OPCA 4CSPA 3BZEB 2CBTA 1CDUA 4GOSA 4PPTA 3QAZB 1KF9B 2XVBA 3V9EA 1N5YL 2V8MA 2FX9H 2BOCB 3EJSA 3HB3D 3SGEH 2B39A 4PI2A 5L0QC 4NFBA 3FPXA 2P5WB 3FBQA 3FFCE 3IMVA 3SDDB 5AOMA 1LEIA 3RWEA 2EDXA 3P0GB 5FXCH 3OC5A 5GRZA 3V4PH 1BFVL 3LZPA 4C59B 1XL6A 1YUKB 3OZ9L 4EOWH 1HKFA 2HWZH 2NUPA 1NEZB 4L0PB 4D94A 4LSQH 1MWAH 5FO9B 5ABDE 5C0CD 3OKEA 4H8HA 1Y18B 2PPFA 3CGTA 1BFTA 4P46B 3WBDA 1L6ZA 2FJFB 1NGQL 4QXVA 4UTBA 1HQRA 1J8KA 2YKLL 2GIXA 4LSSL 4WEBL 3C8DA 2X6UA 1QKZH 4JUSA 5CGTA 1JUFA 1FFNB 1W91A 3OTTA 4F37F 4WJ5A 4QRPD 2K6WA 1O9VA 3LB6D 2Q9OA 4ZMNA 1N5AB 1W6WA 1B0RA 3MRIB 1RULL 3EOBB 2B77A 3RIAK 5EF3A 1H8LA 5J11C 3FONB 2Q6WB 4FLQA 3TBYB 4LMQI 1JDDA 4JZJB 1UWEH 43CAB 3M46A 3QUMH 4NQSA 4TLTA 3P9LA 5F7DB 2YOCA 5DHVA 3SKUD 3AG1B 2YMOA 2NW3A 1QBBA 2WC7A 2K6ZA 4ZNEE 4K9EC 2OJEB 4FXTA 1TQVA 3LZFL 4OIIH 4PRPA 4WHDA 1WFNA 3FQTB 2HMIC 1CF1A 2XWXA 4LU5L 4OFQA 4PB9L 4PRBA 2Q86B 5L8LB 5GS0L 4MDIA 2JKWA 3FUIA 4Y0GA 3QYCA 5CM1A 1SRDA 3C2SA 5B38A 2XHNA 4OI7A 1KCSH 4PRIE 4K5PA 3KWTA 5L8KB 2D3LA 2YD3A 2XX1A 1JPGB 2MQGA 4LIQH 1KCKA 4L4TA 1PZSA 5EDSA 4G71B 2ODIA 2XV3A 4OCXH 4GG8B 4YC2B 5B4MD 1Q9WB 1VCBC 2EJ1A 3RVVD 2EIZB 3MRNA 2OR9L 3MBEA 3CXDL 3FUJA 2J12B 3WE1A 2E46A 4PV8A 1BAFH 4ZQKB 2PXYB 2VXQA 1KIRB 2V2WA 4NPJA 1XGUB 2XQYK 3QORD 3RWFB 2V7HA 2IXQB 3EFFA 4JVUA 3T8VA 3ZDWA 4K7PH 4HHGA 3G04B 3CV5A 3UABA 5DYFA 2VUKA 5T1MB 4D9RE 1N18A 2QV2A 2LAAA 2A9NH 3BDXA 4XO4A 2XJKA 4PWGA 3WTXA 1SM3H 2WXPA 4TPRH 2IAMA 1Y7VA 5EO9A 1YY9D 4DGVL 3MXVL 5TGBB 5IROD 3QFGA 4RMUA 4XN2A 2EZ0D 3CWGA 3ZKMD 3L08A 5K9OB 1B4RA 5T3ZD 1HH6A 5C07A 4AH2A 1B0GA 3QDMD 2AK4D 3MRGA 5HPOA 3NDYE 4R7DA 3V0JA 4OI8A 3GRWA 4XPHH 3Q1SL 3T6VA 5HGAB 1E4WH 1G1CA 5CHNB 2VLLA 3ROOB 4Z95L 2FATL 4LVNC 3PG2A 1ZLSL 1JV2A 4PGCB 1AHKA 1YDPB 3FTWA 3MREB 4B7LA 3WS3A 5EBLB 3Q5TA 3FU6A 4YFDB 4QRPE 4ZMQA 1YYMH 4XXWC 2ZWLT 1WGVA 5DSCB 4HBCH 2BSRB 5A2AA 3GXIA 2NCEA 4JCMA 1WAEA 5EUOA 5SV3A 1PNCA 2LLNA 4WNSA 4OFDA 3P0VL 2IG2H 4Y16B 5I19L 4YHNA 1EERB 4XNMB 1GY2A 2VJ8A 1DBBL 5DR5L 4DIXA 4ZOEA 5MEND 1UXSA 3VGAC 1RUMH 5EZJA 1DQTA 1MF2H 1RUKH 3IM1A 3JBG7 4E68A 4ZXBC 1CDYA 4M5YL 1LD9A 5GJSL 2E7LA 5GRWA 1EO7A 5LGHH 2XG4B 3AY4C 4JHAH 2IOMA 4P2QA 3NEEA 3TURA 4P2QD 1CICB 4P2OD 1SN5A 1QFWL 2D2CC 1X5IA 1ETZB 5FYLL 3M1OA 4QMEA 5I1CL 4UIMB 2O61A 4MCMA 2XBZA 4F9PC 4PWJA 3H9SE 5I2IA 2X42A 2X05A 2BIHA 4JFFD 4U6VH 3RDJA 3T2OA 3OX8A 4LCYB 1NBCA 1AD9A 2ZG2A 1TYRA 1LO2H 1S7QB 4HCFA 4YWGH 1KN2H 3U9UB 5JNYA 4PJ5A 1UM4H 4XVTH 1IKOP 1U8QA 2QT6A 5T1DL 1F5WA 4R90H 4Y7MA 1OQOA 5K9QG 2WIIA 4UZSA 1M1XA 3TO2B 4BXSV 1M3IA 2HG0A 4BD4A 2APWA 5T1KB 4HU8A 4IIQB 3ULVE 4YPJA 2QTEA 3TJHC 2AW2A 1E5AA 3BLKA 3TYFB 3BOVA 4ZPTA 1L9TA 2VQ1A 1P7BA 3AADB 5EZOL 2J21A 1RD6A 3QXDB 1ZIBA 1L0QA 2XVLA 4URTB 4O9HL 1HL4A 4NUQA 3ZE2B 4JHWH 4NZUH 1CLOH 1ZS8A 5EU4A 4CDHA 2V9TA 2D31A 1L9PA 5AVSB 3VRJA 5DVLA 3WTWA 4MHHG 5I0DA 2NNAA 2XCMC 3KL0A 4XN5A 5ESVB 1QI3A 2QSCH 4W9CC 4KRLB 4IRJA 1U2CA 4PCSA 1IM3A 2G3XA 2R39A 3RPIB 5C0IB 1B0GB 3VI4A 2X0WA 5E03A 4KTYA 4BH8B 2P7TA 3CFBA 4KXZI 3BUPA 2D7PA 3MLTB 1FL6B 3CH1B 3FUKA 1MCOH 12E8H 5ISZE 1ZSDA 3ZHFA 4Q9RL 2H45A 1JWMA 5LHDA 2HFEA 1ZWIB 2X09A 2Y6SC 4LP5A 2BHUA 5HYEA 1JZ5A 3MLYH 2ISDA 3OJ2C 4A67A 4E9LA 1D5MA 1LQBC 3D85B 2CALA 1NMBL 3ECWA 1LDPH 3DRTB 5EZIH 4JN2B 3BWAB 1IQDB 1Y1DA 3ZMNA 2HTLC 2A9CA 2NSMA 5DEJA 2AJVL 5HJ3B 1T22A 2H8PA 2YEQA 2DL9A 1OP5K 2P80A 2OMWA 2BS71 3O9WA 3CVIL 3QA3B 5D7KE 5F9JB 3GJEB 4P57B 1W8NA 2DAVA 4G43B 4XNUL 2YHGA 5JQ6L 7TAAA 2K3TA 4PRHB 2AITA 3WSQL 5GJTL 4NPYB 5KBKA 3V0IA 2A4EA 1CN4A 1NCBH 4JPKH 3PWPB 2E76C 1M4KA 2EDFA 5K1JA 5FDWA 4IU2B 2XY2A 4ZSOA 2N0MA 1U3YA 1E65A 3U4AA 5C71A 5I18H 1PX4A 2DBLH 2WWNA 4CJ0A 4EKXA 1BD2B 2R1YB 1Z0NA 2OQJA 2HT2C 3IDIA 4JL1A 4WUUA 3ZUNC 1OK8A 2PYEE 4H0GA 1OWRM 4P06A 4MNQB 3N9GH 1WCQA 1GMIA 5F7BA 4E9TA 2ZG3A 5IMLB 2A6KB 5FYJH 1OAUL 2E4FA 3TFBA 3PQYD 3BVVA 3IJ8A 3OLGA 1WUNT 1KBVA 2AQPA 3C6SB 3GINA 5DO2C 1U8KA 1URIA 3HHMA 3B2UD 1LDSA 2AV7B 2BRRH 3U9UA 4YDVB 4FQXA 3SYQA 1J8HE 1XTMA 4Y5VC 2JCCE 4ZYKB 2DM2A 1S2EA 4FL4B 4IRZA 5K39B 2B1OA 1GRWA 4PJXA 4XPAL 1KELH 3Q2LA 3ZRSA 5F96H 1RUAL 3T65B 4BHUA 3L9BA 4NOBA 5I1KH 1UEMA 4GBXD 4Y2OA 3RZCB 1NSNL 5DJ2B 1OAZH 2VDNH 1AZCA 2ZP0T 5EEVA 2WNKA 1V8HA 2FAUA 5M95B 3EYVB 2GBVA 1QSFB 2IH3B 3IU4H 1UB5A 2XRAL 4Z1PA 2X2YA 1QWUA 3D2UD 1B3JA 4P5KA 1U4EA 4X0KA 4CN4A 2AHIA 1N6UA 4MMXC 3NPSC 3GI9L 2Y25A 3WEAA 3L8QA 5AKTA 1Z5YD 3EGSA 3X14A 4OT1L 4W70A 3O2DH 3EDFA 2DWYA 3RAJL 3HN8A 3KPLB 1V7NH 4QYOB 2EH7L 2WQUA 1YEJH 3X13B 1K9TA 4UF7C 3GSQA 5KS9F 2VH5L 1MFBH 2VXUL 5B38B 5J13B 3KDMB 4NKMA 4OLUH 3U2SB 1A6WL 1QABA 4CU7A 4ANUA 3MRIA 4ABUA 1EDYA 2AERT 2IFGA 4TS6A 2ORBL 3LH2H 2C3VB 4YXLL 2WNGA 1WZLA 3TBYA 1L7TL 4HF5L 4F7KA 3K71A 3PWVA 2OMTA 5AG9A 4RFOL 2G3NA 3D39D 5DD1L 2CHDA 4XT1C 2KDYA 5GS2H 4LP4A 2HVKB 4H20L 3KPMA 1KV3A 2GK2A 3V5HB 2H5UA 4MMXB 2F7RA 1KCVH 1S46A 5T5NG 4XX1E 3S3SA 2NY4C 4YMPA 4YUEL 1AR1D 1XBDA 3TBBA 2AANA 5T8IA 1JRHH 5E2TL 1M7IA 3UMNA 4LXFA 2ETWA 3NZSA 3CU1A 5EBWA 3AU1B 4ZTOH 1MJ8L 2EQDA 1J5CA 4MDIB 1HINL 1UXMA 5DO2D 1QFWI 3DUSB 4UCFA 5FV1L 5I30H 1D5ZA 2FZ3B 1ZGLP 5A40E 2RFXB 3F62A 2HAZA 4N25A 4UAHA 4BUGA 4NN5B 2H1PH 4RWYH 1BX2A 4XN4A 4GKLA 1NC2B 4JGNA 5F7UA 2Z31C 4NGHH 4GIPD 4MA8H 3JYCA 5CF3A 3N6YA 3NZHL 1X9QA 1T04A 2P8MB 4LZKA 5F6HJ 3KS0J 3OJDB 1JZ3A 3RPBA 4JVPA 5E24E 4H4NA 5I74C 4ABWA 1TCRA 4TQEL 4LBAA 3BJLA 3KVPA 2R1YA 2D0HA 3FMGH 3QORA 3BEVB 5H94A 4LOVA 3HMWL 3AQXA 1C5DA 1KG0A 5DS1A 3T4AA 1IEAA 1DDHA 2EDMA 3ARBD 3FTSA 4XP9L 1GZQA 3KYKH 3PGFH 2FH8A 5D2NA 3ZK0A 4PJGB 4U1SA 1F6FB 4XOAA 5KVGL 3IPBA 1NIAA 1TVBB 1WT5A 3L54A 4GP4B 4BQ6A 2VZSA 1XHHA 3BPNC 2DMBA 4WFFD 3CFJA 4IBLT 3FO1B 1HXKA 5DC9B 3F7LA 4MX7B 1GGTA 3CFTA 3IXAA 3QP3A 4HKXA 4JDVA 5BVJA 4MFHA 1IFHH 1BYPA 2VLJE 2YS4A 3QFJA 1VACA 3PNRB 4TM9A 2AK4A 1QLEH 3RWDB 2UY6B 4P3DB 3IK2A 2VXSH 1G1YA 5AOIA 4L9LC 2XPGA 1ZRUA 1BYOA 3WFEL 4Z7WF 1N12A 5B39B 4ZDHA 2DKUA 2W9DH 3RJDA 1BEXA 1Z5HA 1G0YR 3DROA 3S35H 1UB5B 2EDKA 4O4YL 4AGPA 3LIZA 1SY6A 3MV9A 3BVUA 4PGCA 1HU8A 4NC2B 2EE0A 4FQ1L 1P4IH 3GD1C 1QD0A 1C1EH 2W9EH 1E30A 1N5YH 4MJHA 3VFGL 3BYTA 2X3CA 2GJ6D 1TZGH 3Q8CA 4JFYB 1IGJB 3EHBC 4FKHA 1CQYA 4FFVD 5FWQA 4H13C 4DO4A 3EYFB 3BT2L 4PHXA 5B3JF 1ODUA 3BVNB 2FEDC 3BUBA 2X9XA 2G4EA 2D0FA 4X6BA 3S4SA 4YHNB 5I71B 3GKZA 4B5ZA 1KJMB 2FX8H 4N5UA 3D18A 2ZYRA 5CJ8A 43C9A 2HLFD 2XSKA 2JQAA 3VACA 1MWAL 5E08L 2NR6D 3QNYB 4ZK8A 4E0RA 4TVSa 4X5QA 3PV6A 4IMKC 4U0QB 2B15A 2JCWA 1EEUA 5LVEA 2YKLH 2XG4A 4LSSH 2ZKYA 4WEBH 1HCVA 3BQUA 2Y7OA 1HCYA 1GSKA 3LN4B 3WAJA 1RZIA 4UDTA 5F7KC 4M9PA 1N59B 4L3FA 5E95B 4Q6YA 2IOOA 1XGYL 3U2JA 3HG1E 5KYWA 4XGZB 1NIBA 3KPOA 1PY9A 2CHXA 1UURA 1VADB 4P3CH 3WKNA 3MVSA 1T4WA 2NYYD 3AU1A 4PJIF 2O5ZH 2R9HD 5DC2A 1VSCA 4H1LB 4LL4A 4G9DB 1UWEL 1S7QA 2YC1B 3C9NB 2VZ3A 3ESMA 3QUML 5AW7B 1QRNB 3DJTA 2BZCA 4LBEA 4U2YA 4F8QA 4NO5A 3IDJB 2DIJA 4F7PA 1I1AD 2XQ0A 4LCWD 2ZAGA 4FG4A 3IGKA 3QZWG 3T1FA 1CFMA 3DVIA 4GP5B 3NEXA 1E9OA 1MVYA 4Z7OE 2R4SH 2CRZA 4J3XA 3H9SD 4XXCA 2GTZB 1F11B 4AV0A 4LU5H 3GSUA 4PB9H 4ZMAT 2WO3B 3GMLA 1G1KA 2F7OA 5GS0H 1HOCB 5F7LB 3O4LD 4OFKA 2VQ1B 2C9XA 1KNOB 4YDNA 5IF0A 4AXWA 4YSPA 1FO0A 3DXAD 3V6FB 1XB8A 4N8VG 4HKJA 4YSOA 2X1XR 4NUJB 3M1CA 1YMMA 5IMKB 3W0WD 2AXGB 3BZ4A 3V6OA 4JZNA 1XR9B 2HJKA 3GZKA 4TNVF 2YUWA 3HEIB 4OZFH 2BOBA 4HJ0C 5E6IB 5CJXA 1KCLA 4N0FA 4NPKA 5EO0B 5DQ9A 2OMWB 3C60A 2WKLA 5D7JC 1RFDH 1BZ7A 1KPRA 1JZIA 2B7DT 1CTMA 2C26A 4JPQA 3T0ED 3TN0D 2Z35B 2P24B 2D4FA 3W38A 1KBGH 1RUPL 1E5BA 2B8OT 3UOAB 5IW6A 4K7PL 1ITCA 1LXMA 4WFHE 1MHHB 5E4EC 4JO8A 4JFEE 1ED3B 2YD8A 4X6CE 1Q72L 4HKBB 2KH2B 4NM8L 4OF3A 4UQAA 4FQCL 4Y1AD 4B95C 3S3DB 3MXVH 1EXUB 4O5LL 4GXUN 2HTKD 2FX7L 3LSOB 4PJAB 4F15B 4YDLC 4AMXA 4LPWA 1YC7A 4QR7A 2XKNB 3VFOB 3G04A 5F0MB 5FHAL 4YAQA 3Q8EA 3ATAA 4GIAA 3QS3A 4H0IA 4XP4L 3E0GA 5T1MA 1BVZA 2BP8B 2ZTBA 4G43A 4L4TE 3UC0L 5IREA 2YAHA 3DKHA 3LNEA 4RSYA 4OKVB 5E8PB 1Z9SA 1OP3H 4HUWA 1UXWB 4LOUC 5HVHC 5LXVA 2YMTA 1T4KA 3ECUA 2HUEA 1TDQA 1YEDB 4GXVH 2R2CA 3WEOA 4M61B 2RAMA 2OX5B 4FG2A 4N2CA 4GY4A 4ONHB 1DJXA 4HBCL 3ZHLA 3ZDXB 1FLRL 4HIXH 2XKSA 4Z7QB 1T5WA 1MQKH 5HHQB 4K5LA 3ZOAA 5J6HB 5DFAA 1JZ7A 4GEJA 2AAAA 4P5KB 5F1KC 5E8OB 1JXGA 1NGZB 1I3UA 1DBBH 2Z7YA 3C6SA 3O9WC 1NBQA 3DC0A 3MA7B 4JFFA 1HSAA 2I25N 3CLEL 1LMIA 4GT7A 1AG0A 5TQ2L 3BVDB 3BP5A 4JFSA 3MCLH 1KZQA 1JF5A 1A14L 3DMMB 1ZHKB 3EDDA 3UBGA 2PCPB 5BQDA 2BDNL 1KGJA 5C0CB 1G7PA 2IWGA 1L5GB 1P2CA 5D7EA 1QPKA 1S7UA 5FO8A 5L0QB 3OR6A 1R33A 5EUOB 5FYJU 1A4AA 5GRUH 1B4JL 4U0RC 3QEGL 4Y16A 4YHLL 2MOQA 1E9OB 2PTTA 3FS9A 4DZ8B 3C12A 5AVWB 4KROB 4LCCB 1PG7H 4BFIB 2RTTA 3QJFA 4WFEE 3ZDZE 1OXYA 2YPKB 1VB9A 3N41B 4LP8A 5LKNA 5C0DB 4R2GC 4I4WB 1K3IA 5DZ9A 3BE1H 5MI0B 4LDCA 5G4MA 4CVZB 4M8VA 4U6VL 1EHLL 1AKPA 4YSSA 1L9OA 2VLKE 1RUQH 2WV3A 4PYGA 3SYAA 3KYNA 3O3EB 1VKXA 2V6HA 3MUUA 1YJDC 5IUCA 1KNOA 2NY1B 3C09B 1SQMA 1MCRA 1SNRA 3TV8A 5AOKA 5SX5K 2WBJB 5C0BB 5L4IA 1FO0B 2EXWC 4KI5E 1FBIH 3CHSA 7PAZA 3FUFA 4MASA 1H3VA 4NQCB 4MJ2A 3NZUA 4QXGH 3K3QA 1JN6A 3KPPA 5M7QA 2WVTA 4HH8A 4ZRGA 1PCSA 4WNQB 2IQ9L 2X10A 3F65A 4X6DE 4KDWA 1PAZA 3PGDA 4XN9A 1Q90A 2YPLE 4N0FB 3FQRA 5EV7A 4JDTL 2O6CA 2GEEA 4G83A 1AD9B 1NFIB 1CPUA 4HJ1A 2RFXA 1XQ4A 4RBPH 5A6IA 3S98A 5E9AA 3WV0A 3ZE0F 5B3NA 3ZVVA 2IPTH 3DA0A 1NUGA 2VLMD 1P5UB 1O0VA 3QIWA 3ALWA 2IH1B 2G75B 1BD2D 4UANA 3OJDA 2BVQB 5DRNA 1NCWL 1FZOA 3JSSA 2LU3A 3MRRB 4J3SA 3H54A 4F91B 2YRLA 4NZUL 5SWZD 3I50L 2D03H 4NKQB 4ZUTA 2VISB 2W95A 2LAGB 1KEMH 1IVTA 4YO0A 1EGJH 4G8IB 2F61A 1IAMA 5I74B 1MAML 2OJ1A 4B9FA 4BK5A 2VN6A 5I71C 3KD4A 2W5PA 5LUMA 5FF6B 1QASA 4I87A 4FFZL 4PJGA 1JPTL 2O5YL 3Q44A 5ADOL 1I8IA 1ZGLB 5A3ID 5BZZA 4KJQC 1MQ8A