2VO8A

Cohesin module from clostridium perfringens atcc13124 family 33 glycoside hydrolase.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
135
structure length
135
Chain Sequence
TTVGNSTIKVNDEVQVGSAFEAILGIEGLNGDTEVYSAEYLFEYNAEAFILNEITSFNDSLFVKSKEVEPGKVRILVASLGNEIEKDSDLVKVNLTPKISSELEVLGLTTALVGAGDGNTHDLELSSKEVKINEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EXO-ALPHA-SIALIDASE
publication title Structural Basis of Clostridium Perfringens Toxin Complex Formation.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
total genus 31
structure length 135
sequence length 135
ec nomenclature ec 3.2.1.-:
pdb deposition date 2008-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2vo8A00
4N2OA 3BWZA 2VN5A 3L8QA 1G1KA 2B59A 2O4EA 1QZNA 3F2LA 5AOZA 4WI0A 5LXVA 3UL4A 2VO8A 2VN6A 4UYQA 4UMSA 4FL4B 4WKZB 1ANUA 4U3SA 1AOHA 4UYPA 3FNKA 1OHZA 2ZF9A 2W1NA 2CCLA 3GHPA 2Y3NA 3KCPA 1TYJA 4IU2A 4FL4C 1ZV9A 2JH2A 5G5DA 2XDHA 4DH2A 2OZNA 2BM3A 5K39A 3KCPB 4IU3A
chains in the Genus database with same CATH superfamily
3O6FC 1IE4A 5EEXA 1T0MB 4AEIH 1J10A 2XX1A 4GMSH 3QZWB 3UTTE 5A2JH 1SLUA 2ICCA 1KB5L 1EEUA 2BHYA 1L0YA 2IXQA 3HNTH 4Y9GA 4EKXA 4QXGL 5DD3L 5EUOE 1I1AD 3REWA 2EDQA 3HE6A 4XTRC 4ODHL 1YQ2A 4NN7B 5DEJA 4XP6L 1DBML 1E9QB 3QWRA 4WHDA 3EFOA 1TG8A 2YPKB 4L9DA 1ZK9A 4IOSA 5HYIA 3P0YL 1TTFA 3ZL4L 1BIHA 2J55A 1KB9J 2YHGA 4PRIB 1RY7B 3F83A 4OM0L 3IBOA 5IJVB 3FO1B 4U33A 5MEQB 4M7JL 4XMUA 1NPJA 2F8VA 2GJRA 4G8GB 4XX1G 5TQ0H 3EO9H 4PJEF 4Y19D 5EOCJ 4OGZA 2ZIDA 4JPKH 1EERB 3GXNA 4F7MA 4L3EA 3IMWA 4E0RB 5EZLB 3SDYL 3ZSSA 5DMGC 4DEWA 4LLVB 1ODAA 4FULA 2EDJA 1WFUA 4NQSA 1ZAGA 1E6OL 5FR3A 4DP8X 1J0ZA 1K6QL 4PJAA 1CDUA 2GW5A 2K4WA 4YSEA 4ZD3H 2X9YA 1C16A 2X3AA 1XF3B 3HZKA 2ZOLA 4M6AA 2W59A 3KDMA 3BZ4A 3MRKA 5BO1H 1PGRB 4YSSA 1F4HA 4I0KA 3MQIA 2OR9L 1IVTA 5IJDC 3DECA 1EZVX 4HCRA 4GKOA 4K5MA 4TSAH 1HYSD 1V55B 1BFVH 3SO3C 5A7EA 1J0HA 1KWKA 3WFHB 1KTKE 1FL3B 3I9GH 2GEQA 3NDYE 2F53E 4H13C 3BCFA 5C0RH 2NY5H 2EXWC 4EBQL 3NP3A 3KPSE 2EICA 1OV8A 3HC0A 2FNWA 5GGVY 5I0VA 1OGTB 1U95B 2KDGA 1CS6A 1L6PA 3QFDB 1KGYE 3CUPB 2GFBB 1WWBX 4M1GH 4CC4C 3NZHH 5KAQG 3LIUA 1JGEA 4H2AA 2FJHB 4L4TB 2EIJB 5D1QE 3VDBA 2APXA 5ETUA 5SWZD 5FO8A 3V5HA 2UYLA 2UVFA 3O4LA 4DO4A 4AQ8C 3QI9A 2X6VA 2R4SH 3BLKA 1KXVA 3BAYA 3OV6A 3HAEA 4TM9A 5C3IA 5F7UA 2WIIA 1XCWA 2Y7QA 2Q76A 2R4RL 4FP8L 4A7GF 4WI9A 1RD6A 4BFEA 5JDSA 4GSRA 1X5KA 5HDBE 3BH8B 2XQBL 2V7NA 2GHZA 1OPGL 1F97A 1DE4A 5D1ZD 2NY1D 4YDJB 1X5GA 3OKEA 3O6LH 4M48L 2AI0L 5TF0A 4FG2A 2EDXA 4GUPA 4NQEA 4PMFA 1W72H 3D48R 4GP4B 3KWUA 1UT1A 2YUVA 4O58L 2J8UA 4A2FA 1ZLEA 4DGYL 1XX9C 4GSQA 2K6ZA 2DLFH 4AG4L 3SE8H 3N41B 4MLIA 2H47C 2P43B 3PDDA 2CIKB 2EIDA 1BYNA 4YC2C 4B53A 1DQTA 2KERA 5A3IC 1CI5A 3AGVA 2E9IA 2VXQL 1S9XA 3KPOB 4LB8A 4EJ1C 3LJ3A 4FQJL 3HMXA 4RVBA 1YEDA 2X4PB 3DIDA 1TJGH 3VXNA 4AQ1C 3KLAB 3ES6A 5LXGL 5DRXA 5BZWB 1D6EB 4Q56A 5IJVA 3RZCA 2DMCA 1R3HB 2D9CA 3T0DA 3GRWL 2FYVA 4FZ8L 3EHBD 1CPUA 4P05A 4JDTH 3L9RA 3QIWD 4TQPA 1G7MA 3E2HC 1MW0A 4G80B 4K2UL 2BNRD 3OAYH 2XWDA 1CLZH 5HVGB 4ENZA 2JELH 2Z1KA 3Q5TA 4N2OA 4JFDB 5D71H 1LDPH 3IDYB 2DOCA 1JMZA 3QDMA 3EUUA 2VDQB 5PAZA 4H40A 2DTSA 4HIEA 1AXSA 2AXHA 3A6CL 1FDLH 4KNTA 3I75A 1I8IB 3T4YB 3ZN6A 4U0RC 5CZRA 1YAIA 2CUHA 3ZZ1A 4PB0L 4I3RL 4Z7UE 1G6RL 4Y19E 2FJGA 2C7FA 2V37A 4LXFA 3U9WA 5IB4B 4NM4H 3B9KA 3G6JB 4HWBL 1LNUA 4Z7WB 4ZMVA 3MV9A 3ZXAC 3TIEA 3KL5A 2UX6A 3GEWB 4GKLA 2YJQA 1SEQL 1KY7A 4KOCA 4PQXA 4M4RA 4E5XG 4NRZA 3C5JA 4HMCA 1R5WB 3EAKA 4LCCA 4QRPA 2CM6A 2G9HA 2IQAB 4R8WL 5DF0A 3WDHA 5F7HA 3HUJE 1AHMA 1UZGA 2GHWB 1M3IA 4M7LT 4PY8I 3CXFA 4UYPA 1QSZA 4YBLC 4TLKA 2XPZA 2VIRA 4M93B 5HYSA 5AAWA 2FT8A 2JJTA 3WY4A 2ZKYA 1R5VB 2MQGA 2YR3A 3LNDA 3WL9B 4AXWB 1GOFA 4WW2B 4F5CA 4QRUA 3WEMA 1XFPA 4JFVA 1T1YA 4N5UA 5D4HA 1USZA 1Y18A 2IOOA 4LEXL 2EUZA 3BVXA 4PY8J 4A2GA 3QUXA 1BQSA 2O5XL 4G11A 2VT0A 5SWZE 3D09A 5IMLA 3NPZB 3FDWA 2ED7A 2PP8A 3NJVA 4ZS6D 3BFQG 1F1AA 2YD3A 1ZJBA 4MAYC 3WGVB 1A6WH 1P1ZB 1MJJB 1Z9SB 2XPYA 5EF1A 5C6WH 1NIDA 2CKBL 4JDVB 4FTVB 1FYTA 3MJ7B 3FRPA 5D5MA 3MNMA 3BWZA 4TNEA 4PJ5A 2WINA 4JZOA 5I17B 3I6GA 4HJTA 4HKXA 1CIUA 4N8PA 2GSIA 4R4FH 1QFWH 3H55A 4ELME 2MPVA 4X7SL 4H1LA 4S1RL 2WBJD 4U7SA 4QOKB 3FUIA 2VDLH 3DX4A 5K9QG 3BLBA 4CBPA 2BP8A 4KFZC 3S5LA 1NCWL 2GT9A 3FQYA 4PVLA 7FABL 2R2CA 2EDKA 2EXYC 3ILQD 1LEGB 2CQVA 3ULVC 1CK0L 4QRRA 1BBJA 5CEZL 3OD3A 3WY3A 5DA0B 3F85A 4KUCD 4ES9A 2P24A 5I9QB 2DQCH 4PGJA 1ZA3B 2X4UB 2AC0A 4JFYB 1A6UH 1P7KB 3DVNA 3VI4F 5CD5C 4HP5A 5INCA 1KFAH 4H7VA 1TTGA 4K55A 1M1XB 1BF2A 4JW3A 3DBXB 2BS9A 2MCG1 4PP2A 3SPGA 2CLRB 4N8VA 2ZWSA 4TXVB 4GSUA 3BPLC 4EUPH 3VXQA 4QNPE 1ZGLP 4M6NL 5ITFB 3SBWA 4D9RD 5JPNC 1QLEH 1X7QA 5TD4A 3ATEA 3B3IA 1J7VR 2BNRE 3G6DH 2N0MA 1XGRB 1HTYA 3DURB 3I74A 4WUUA 5J13C 3FT2A 5J6GB 1JF1A 4XWGL 3O4OB 5GGQH 4PGDA 4EN3B 1JPGA 1T0PB 3OKKA 3D30A 3LEXA 4YSAA 1ZD6A 5LJYH 3NIDF 4CVXA 1YJDH 4OJCA 2YO3A 3MN8A 3TEYA 1E3XA 2ZT9C 4FQQB 4H8PA 2BJML 4OCXH 5HI3D 1YYMH 3EJPA 1LXMA 4X6CA 2EUXA 4LVNB 2XETA 2Z31C 5C0CD 4WWKC 2ISDA 2L3BA 2AAVA 1MW1A 1MY5A 4G8IA 2DMKA 3AQXA 3ZMEA 43CAA 4Y5VC 2QQKL 4KROD 1I9JH 3VCLA 1FL6A 5CBAA 3CFTA 1MJ8H 1FRGH 1XF5A 2MNUA 3UTSD 5EEWA 5IFHH 3R0NA 4L1SA 1FQ9C 4TQEL 2ZCLL 4FHJA 1BAGA 3H9ZA 2VLLB 3HTLX 1DZ0A 4DAGH 5B38B 3DK0A 2ROXA 3CJJA 4UWQB 2H0FA 4GXFA 3UOAB 2WVTA 3P2BA 3KGUA 4NN7C 1UGNA 1B0IA 1A9BB 2K3TA 1FORL 3BQVA 3Q1EA 3QCVH 3BVTA 4UUJB 1IGMH 1ZWIB 1J1PH 4LDCA 3RWCA 1BZDA 3APNA 3JVGA 5D8JL 4XO5A 2G2NA 1HINL 5KVFE 3QCTL 1AIFB 2K7QA 4IRSB 4GUOA 2PYFB 1KB5B 2BVQA 4FKEA 4L5FL 3H85A 1SXCA 2Y22A 4HA1A 3T77B 1QFPA 4HZAA 3THMH 3ZRCC 2YPLB 3PP4L 2P5EB 4KQ4L 3NJKA 3AY2A 4X83A 2JNZA 4X7TA 1NCUA 5AW1B 2C4FU 1ZLSL 2H32A 1EZLA 3QZWG 4ZTPL 4HUVA 5ALCL 1D6VL 2QQNL 4JZJA 5DLML 4YE4L 4P9HC 5HVHC 1NGWA 3IRPX 4JFQB 5J11B 4RWYH 4HV8B 4G9FD 2UV3A 5LGHL 4GI9A 3L2MA 1H8LA 3CFBB 3G6AB 4PJ8B 1IAOA 1A1NA 1DLHA 2CBPA 1TQUA 4K23L 2RHEA 1OWWA 3QEUA 2OTWB 5T3ZD 4GO6B 2Z92A 1KLUA 4N1EA 3IDJB 1OQOA 1I7TB 2AQNA 3PAYA 5EDXA 2KHAA 2IDCA 2Q8AL 4Z77A 2WZ5A 5IREA 3OKLB 2FHFA 1Y6KR 5CGYD 4LARL 5IFAH 4KKZA 4YSTA 3APFA 3MNVB 1S7UB 2Z35B 2WTRB 2AXGA 3K2UH 1KBPA 4OCYH 4FABH 3CX5J 1F4WL 4PR5A 4X4KA 5EO9B 5BO0D 4EDWH 3MZTA 2ZUYA 3BKCL 2XJKA 1A6ZA 2EKSB 1GYVA 1GGCH 2J8OA 1EJOH 2VAAB 3DHJA 1X4ZA 2ITFA 3IDMB 4PS4H 4TNVF 3X13B 1BD2D 4XOEA 4UOZA 1CGXA 1T89C 4B9YA 1Z3GL 4AJWA 4D9RE 1UA3A 2A83B 5I1JH 1FNGA 1W16A 5I1LB 3DOHA 4LSPL 1J12A 1YMMD 4M1DL 4UCFA 5FKAA 5DSCA 3ZDZB 4MA3B 4PHXA 4FFWD 1KIRB 3TU6A 4BQCA 2OMVA 1J5OH 1XHHA 2VW6A 3QB7C 1CU4H 1XIWD 1RCYA 5KJ4A 3P0GB 4IGBA 4HK0B 4FERA 5A2AA 3FBKA 2QADD 3ARZA 3LRMA 4IBSA 2DTMH 5L9DH 2NX5D 3PQYD 4JHBA 32C2B 4YE0A 2JXMB 3QZLA 4JN1L 4RAVB 1B0GB 2XN1A 5I1EH 1R0AL 5FGCB 5HHPB 1NZRA 3U4EA 4ADIA 3ESVF 3ZMRA 5CUSL 2C4XA 2AQPA 3EF7A 4L4VD 4UDTB 1OE1A 3ORJA 4X80L 4M43L 5C0CE 3R06A 5CJOH 3V0FA 4OFYD 3WGUB 2AV1B 5IIEA 4WFFD 5EU7C 3NIFF 2O5ZH 3VX0A 4PJ9D 4KZEL 4C4KO 1TZAA 3UYPB 5ESQA 3MHZA 1T5WA 3NRQA 3WU1A 3WKYA 3C6LD 4N0YH 4XNZB 3UTSE 4L48A 1PZCA 4KI1A 1A6TA 3IAQA 1UCBL 1FVDB 3TEWA 1QWNA 4LOUC 1NUFA 2BVUA 2IQ9L 4JFZH 2OXHB 2C34A 2YBRA 1ZVSB 1XD1A 2IGFH 2Z9TA 1PSKH 3LIZH 4H20L 1PLBA 3AMKA 3UBFA 1S7QA 3FMGL 1CT8A 4ABWA 1M7IB 4RRPA 1Q1JL 1OSYA 4X42A 1QBBA 1ULVA 1JHLH 3IDYC 4BFGA 3IB4A 4AIZA 2Y5TA 2PXYA 4J4PD 3WMPA 2XG4A 4OBRA 5EU6B 2EABA 4EOWL 5D70L 4G5AA 1PX4A 5JHBA 3LQZB 3HI6H 5JQ6L 3Q8EA 2P5WB 3L9EA 2VZ3A 5BS0A 4FYRA 1S3RA 4Q6IB 1CR9L 2FECL 5FM5O 4AUJA 1W72A 5EOCH 3LMJL 4G8FA 1KN2H 4ZUUA 4KZDH 4I2XA 4IOIB 4HUNB 4X4XA 4G9FE 1YEKL 3BZFA 4Z7VB 4HH9A 1JBJA 2XVBA 2HLAA 5ADOH 1MHPH 2YPVA 2Z4QA 3TX4A 1AO7D 5FGRA 1DLFL 2QQLL 2UUDH 4EI5C 5T3ZE 4AZUA 4ZYKA 3ARFB 5KJ7E 5IVNA 4YH6A 3GNML 5CILH 4FFYL 5JOFB 4LESA 2FVNA 3WNIA 4PY7B 4Z78B 2B77A 2E86A 3UBXI 3HW7A 1ADWA 1RULH 2ALAA 4WW2C 3MMEA 1IQDA 3K72A 1S7RA 3M17B 2Y1ZA 3T6VA 1SYVB 5AVTB 2DQHL 3W39A 3BN3B 4Z7QB 1BFSA 5EBWA 2OA9A 1KSRA 1BD2E 2H1PL 2NR6C 4WSGA 4P4RB 3P77A 1CBJA 2HXAA 2ZJSL 3KL3A 4RFOH 3C8KA 3RA7H 2G60L 2MCPL 2DBLH 5CS7A 2JB6B 2A2QT 1YMME 1LWJA 2HFFB 3L45A 2VDNL 4KHXH 4PWEA 4WTXA 1JV5A 1XWVA 1SDDB 1NFDE 5LAPA 1NCTA 5KVFH 3UZEC 2XHNA 3MRRA 1B3IA 2VLKA 2X2HA 3VXRD 5AZEL 1PZ3A 3QQ9D 3ELAT 4QJ3B 3WE1A 2NX5E 2MWCA 4YHML 4X7DC 3PQYE 4WGWB 2BCKB 1GZHC 4JKNA 1FFTB 1P5VA 1UA6L 2CLZA 4I8DA 4JNXA 1G7LA 5ESVB 3KLSA 3HG5A 2V2XA 1DJYA 4OSUH 1CCZA 2DWDA 5GHWH 4QAWA 3WY1A 5IK3A 4R7DA 2Q7YA 2DMGA 3EG9B 4LNRA 3QJOA 4L4VE 1VFAA 3MLYH 1RUPL 4P3WA 2F74B 3D18A 4DGWC 3OB0K 5ICZB 1MPAH 3WS3B 3ZDXB 1U8QA 1NIFA 4LHUA 1PQZB 5EU3B 4PTUB 4EN2A 2CKBB 4XRCB 4F2ME 5I9QC 4OJYA 1M2VB 3QWOA 3UTTA 3T6ZA 4WU5B 3FCTB 4ZMYA 1U2CA 3FB8A 5J4MA 5IT2H 4K8RD 3LD8B 4ALAC 3GHPA 1QUNA 1XCQA 5EUOA 5TH2B 4G6JH 5JUEH 1WBZB 4HHAA 4IBLT 5DFWH 5F9AC 1OP3K 4DUXA 2EO7A 2CHZA 4U1NA 1EMTH 1K4DA 1HQ4A 4GLRH 2A6JA 4JDEB 4N5EC 3CH8A 3QAQA 5I1GL 1RZPA 4LEOA 5DJCA 3QAZB 3K2IA 5J89A 5CIPH 1FO0A 4NNPH 4BSVB 3PHQB 3RJQB 3CAFA 4NXSA 1EHNA 1G9EA 3F12A 1C08A 1OHZA 4UOW1 1ZTXE 2DQDH 4ADGA 3KMDA 1FVCA 3O4OC 5GRWA 4MXWL 1QX1A 3GKZA 3WXWL 4Z0XA 4EN3C 4Q89A 5K5YA 2AANA 4AC2A 1S7WA 2PTVA 2ZUXA 3DSNA 4J12A 4PSPA 1PCSA 4WZ9A 2R2HA 2AGJL 4IJ3B 1DBJH 25C8L 4OGAD 4DP7X 3GSRB 3V4UH 1F2QA 3B83A 2F54B 4JREB 3OX8A 5E94B 3D12B 4FGMA 5EV7A 2YA1A 4LVNC 5F7FA 4B27A 1IT9L 1MHEB 1OL0A 2Q3ZA 4FL4B 4LDLB 4YHZL 2WLHA 2JIXB 1S4IA 3TZVD 3IVKA 3O0RH 3MLWL 5FLUA 3AFLA 4QI3A 5CO1A 4CBZA 1IGYB 5DLLA 1IZKA 4HC1H 5K1NA 3RIFF 1V3MA 4R3SA 5T5FL 1AO7E 5CHNA 2XWTA 3H9SD 2DQUL 5C0BB 3SKMB 5IEHA 1RZFL 1PD6A 3BAIA 3IT8D 2AKRB 2B2XH 2JJSA 3BKYH 1YEWA 3K6DA 2Y9RT 2BSBA 4S11A 2YD8A 4I0PA 2WOBA 2FEEI 3QYMA 1MFMA 3AREA 1AIZA 1IBFA 2F53A 2D7NA 3VFTB 3ENEA 4OIIL 3TO2B 4UYQA 3HI5L 1SHMA 5AVYB 3KPSA 3GMNB 3R19A 2CHNA 2GJ6D 4JANB 4ANKA 4MZ3A 4NNXB 4WU7B 5KSBE 5D1QA 3LXBA 4MMZC 1J8HD 4MMYA 4HDIA 4JHAH 1FFPA 1KNOB 5D6CB 5TK2A 4KITB 3FHQA 5EO0B 3TVMC 4F37F 1OP5K 5IQMA 3I3EA 2LVCA 5JXED 4F9PC 1XB3A 3NP4A 4XXCC 4HUKB 1PZDA 3ZIMA 5GZOD 3MO1B 4JJOA 2Q9OA 4HSAC 1RZKH 4IK6A 4DJMA 1E8YA 1NDTA 4NDMA 5K1VA 3VXRE 3WO3B 2R39A 4OLZL 4LT7A 1KCUL 2MQ3A 5J11C 1WFTA 1MFBL 1TYJA 2FYYB 3NZ8B 1YEJH 3RAJL 3T08A 4C56A 5D96C 1YQVL 5C0AD 5E9DB 2B8OT 4PJ8C 4ZMZA 4KHTH 3H9YA 3UYOD 1K8DA 5D2NB 3C5SB 3UGEA 4I1RA 1M53A 4OF6A 4V1DE 4NBZB 4TSCL 4JL1A 3BRGC 3MRBA 1Q0YH 1T1XB 1CE6A 5DMKB 1KGXA 2FR4B 3WFDH 1IBZA 1LO0L 4XMLH 4BQ6A 5LNDA 1QTPA 1A7QL 2H0PA 4XAWH 3GI9H 4IHOA 2QVKA 3REVB 5GRUL 2XX0A 5CINH 5T3ZH 3U48A 1QPKA 2YD6A 3BT0A 4R9HA 1ZHKA 3HNSL 5ANMB 2YZ1A 3TEXA 4BKLA 2H2PD 1MCEA 4GO9A 2NT1A 2ZTBA 1VB9A 3E7JA 3ULSA 3Q8AA 4LMQE 2Y2TA 3CHSA 3OPZH 2M83A 4XHJC 5IHWA 3WJJC 5GRVL 1RUQH 2F8OA 3AG3B 1KIQA 4KVNL 3FU3A 4G43A 1URIA 1BVZA 1AP2B 1YA5A 1QEWA 4DK6A 3K4AA 1I3GH 3BGAA 3GBNL 1JGLL 3LH8A 3VFNA 2FB4L 5DTFA 5K59E 4G1MB 3X1NA 2WLJA 5EU4B 1ML0A 5AYUH 4G6AD 5B7EA 3BDBA 4Z7UA 4PJIB 4Y19A 1QI4A 3B2UC 4JFWA 2A4EA 4YHOL 1RK0B 2X70B 4UNVA 1EO7A 1FN4A 5L2KD 2BXZA 2J8UF 4NAMA 4ONGL 4CSSA 3DRTB 1JK9A 1TZGL 3CZSA 1OGAD 3OQ3B 3P9LA 3S3BB 4DP6X 5JW4N 2K3HA 2G5UA 5BZDA 1TDQA 1ZMYA 4UQ3B 3CFMA 1RUAL 5E08L 3BSHA 1AE6L 3HUJA 4L2YA 3W0WD 2ITCA 2WKOA 3EGSA 2PTUA 1JGVL 3RGVB 3ZKSD 1Q4NX 3H9SE 1HESA 4XNZC 1QWUA 3GBEA 3S8FB 1KTRL 3V4PH 4OLUL 5FA4B 1RJYA 2XI9A 1WRFA 1S7VB 5FA3A 3ROOB 1V3JA 5BVJA 4UTBH 3JZYA 5CXPA 4PG2C 4Z1PA 4H5SB 5HPMA 3RI5K 3QXWA 1V7NL 3GD1C 4WCYH 2WXHA 2GJ6E 1G7JB 4KRLB 4P06A 1N7MH 5BVPH 2KH2B 2NY2D 2W9EH 5IG7B 2QJDA 3VXMD 2VXUL 4DGIH 1J8HE 5SWZA 3AABA 3CE1A 1NKGA 4F7TB 4NRYA 4Y5XB 1FBIH 1AY1L 1Z7JA 3AT0A 4JZNB 3ME0B 1MRFH 4HAKA 2XN2A 4NKIH 2OMYA 2F5BH 1SDYA 4Q6IC 3DGDA 1EAPB 1U36A 4D9LH 5BV7B 3I2CL 1X9UA 3KLKA 4AKOA 3V9CA 1XCTA 5B1BB 1MUJA 5D1ZA 5DMIL 4KKCD 2ZCKH 3LRHA 4MHHG 3EO1A 1RUKL 3OXRB 5SWSE 3CD4A 5E95B 5L2JA 3NSXA 4DEUA 3OLGA 2BXYA 4ODTH 2B39A 4ORGA 4UOQA 5C0AE 4LPVA 1ZHBA 4DPCX 4KX9A 4HPYH 1P4LA 5EUKA 3GBML 2VLJD 3PHSA 2Z8VC 3L13A 4JN2B 4EPSA 2E7LA 1N26A 3L1OL 4DGUA 4PVMA 2EINB 1JRHL 3ARFC 2BCMA 1GGIL 4ZO8A 2WP3T 3VI3B 4NQTA 4PRNA 4OIAA 1WJ3A 1TUPA 1KG0A 4OZFA 4AITA 4LIQH 1CGSL 5BNXD 4EEEA 1UB5B 1OZUA 3BUYA 5FDWA 5C6TL 3MXVH 1YYCA 5TDNA 5D7SL 4IRJD 3LIZA 3STBA 1FZOA 5E23A 4UU9A 3RURA 1A6AA 3IS1X 4ONOA 5LN4A 4MNQD 2AJXL 3PWLA 1ZGLM 1R3KA 3GMPA 3M1BB 4N2KA 1QHPA 3K6SB 3QIWA 5FOBB 5GS0L 1AGDB 1FNHA 1YNTF 2OKMA 1GGBH 4MWFA 4KXBA 5C9KA 4F7CB 1UKTA 2HH0H 2A4CA 4XPFH 3CLEH 3VFWB 1UYWH 2BDNH 2OSXA 2V7HB 1PL3A 1F6AA 5DO8A 5KJRH 3WKQA 4OGXH 3F7YB 2VDKL 1DL7H 1F0LA 3K8LA 2X05A 4EIUA 1WVZA 3D6GA 3LH2H 1ZT4B 5DJZB 2XXGA 1WGOA 3ISRA 3RWEB 4RSYA 1ETZA 3G5ZA 4O51A 5CNHA 3VFSA 3H7BB 4FMKA 1IBHA 5B3NA 4D0BA 5AG8A 1QR1A 2BOCA 1OF0A 3FSOA 4Y16B 2CO3A 4S1DD 4TMPA 4X8CA 5KSUA 1T6WA 5L2KE 3WFEL 4X7FC 4F57H 4YK4C 1HXMA 1OGAE 3D9AL 2P26A 3L5IA 4LBEB 4XPBH 1A4JB 2C3VB 5IW6B 2FD6L 2X1OA 1MFEH 4OLWH 2DKMA 3W0WE 2DJMA 1QZ1A 2YEZB 4GQRA 4POUB 1I53A 2HVJB 5C8JA 4UV4H 4P8QA 2A9CA 3GKWH 2VNCA 5I66A 3LD8C 4A67A 1T7XA 4U6VH 1EHKB 4IDJL 1UD8A 4JFPB 2PWFA 3QPQC 3NJNA 3MLZL 1OAYH 1U4FA 4K8RH 1H3XA 1AD0B 3H4HA 1EEYA 5CEXA 2IALB 1NCCL 2F58H 5F3FA 2P8LB 1KUMA 1XGTA 2UXFA 4O02L 5F7EL 5J1AA 3F62A 3QAZC 2WXPA 1SY6H 2FSDA 3V6OE 1P2CB 4NZRL 5FYLD 5GGRB 1P0SE 4NFCA 4QXWA 3UZQA 2C9VA 3ARGB 3LDBB 3S96A 4LSVH 2E27H 2AJSL 3QO1A 5LB1A 3U30B 2V2WB 4XVTH 3JT0A 4GJTB 4B9FA 4DP0X 4MS8D 2P8PA 3GK8H 2R9HD 4I9WD 3KLQA 3G5YB 4P99A 1NICA 2AJVH 4MCZB 2F1AA 5KYWB 1N3NA 1HWWA 3N1PC 3SDXB 3NESA 4R5XA 3U79A 1IBGH 4KXAA 5T1JA 3L7EB 4JREC 4N2GA 5DDHB 2XKNB 3RL2B 5M95B 1UOWA 1AZVA 3QS2A 3T3ME 3ZVVA 4B9ZA 5BMFL 3ULUD 3QDGD 2PPCA 4FL4C 4M61A 2WBJA 1R24A 2CJUH 2ESVB 3CLWA 1UQSB 1C8QA 2OMUB 2BX5A 2ZAHA 3IJHA 4WQOA 4W9HC 4P46B 3FT0A 3NIDB 4ZAKB 4GOSA 4WNQA 4APXB 2Z3FA 5BCAA 1FZKB 1U8JA 3RIFK 3VGAB 2JCCF 2VLJE 1EGJL 3GYRA 3NH7L 4ETYA 3FTZA 5IB3B 1MNUH 4W6XB 4QCIA 4C58B 3VFPB 1H19A 2W0FB 4LQFH 4RCAA 1QP1A 2Y7NA 4P2RB 4LRIA 3RPIA 4PEEA 4CSZA 3L3GA 4DT2A 2XKSA 4ZOBA 3WEAA 3KYMB 4PGBB 2B1HH 2X89D 3QZMA 1KLFB 1RJZA 1ECZA 3QR0A 1MVUA 2X09A 2HX9A 1TKWA 3EJQA 3JWNE 4GBXB 5JHAA 4AMXA 5CIPA 4BK5C 3H0TB 4MNQE 4LLUB 1JV2A 3CLFH 4JFXB 4JO5A 4XWOC 1AGFB 3BMVA 4GRWB 5CN3A 3X1GA 1A8ZA 5GPRA 1M7DB 3QR2A 4EZKA 4BZ1L 4F37K 4U4BA 5E8EB 2NUTA 1U8OB 1NWOA 4FNRA 6PAZA 4PAZA 5E8DH 4I7ZC 1WZAA 5D7EA 4GRLD 3DPBA 3VU2A 3O3AA 1ZEAL 1RUML 1WA0X 3MLUH 3TASA 4NB7A 1PS3A 2BNUB 2WJ5A 2EDHA 3D05A 4L1BA 4ZK8A 3BVWA 3K4ZA 1PZBA 3IBEA 4LVOB 5JMOC 4GG6A 2VC2L 4NKOA 1KTLB 2R0ZH 3HRZB 1AG6A 4DN4H 3TPKA 3I02B 4HCRL 4W4OA 5I18L 4KDWA 2N7BA 3DROB 3ZTNH 2E4FA 1NBYA 2CALA 4HC1A 5D2NC 5FUCE 5BJTB 2VZ1A 1Z9LA 3MV8B 3WN6A 5C0CA 4AEHH 5IMMA 3AROA 5KVEE 2F5AH 3SKNB 1NAKL 1SNRA 4AL8L 4EO5A 2VM4A 1HAUA 1KV7A 1QO3B 2OS7A 4TUKL 2EYTB 4Z7AA 3QARA 2BIMA 2PR4L 2WJ7A 4NZDA 3FAWA 3GXDA 3UTSA 4R0LC 3OKNB 4APQB 2F7RA 4GKSB 1OEZW 4OIBA 1AZUA 2I9LA 4WDIB 5AW8B 5FUZH 1B4RA 3D0LB 2X0WA 4L8SA 4MQSB 1A64A 1U8HB 4JX0A 4NUJA 4R6UA 5AW2B 5HGGS 4PJGB 1NCOA 4OGYL 1SJXA 3T8VA 4DQOH 1HKFA 2W65B 5F71A 4G59C 4Z76A 2D7TH 3QFJB 3U0PA 1QVOA 2YGQA 1EDHA 1H3GA 4J39A 3E8VA 2FGWH 4FX5A 3TGXA 4KZ0A 4P2YA 15C8H 4QF1B 4OCWL 5FYLE 4I9XA 3BQUB 2LTQB 3G3LA 3WKMH 1FNFA 4FKKA 2D2OA 3TP4A 3CSYA 5DHDA 2QKIB 1DN2A 1E4XI 2XOTA 4YIQA 5FO7B 4TQHA 4TVUA 4XPHL 1DEDA 3QDJD 2JE8A 4I9WE 4PJXE 1R4XA 1G84A 1A6PA 4MHHI 4TOYH 1KPUB 4N90D 3BT2L 4OF0A 2VDPH 3ARBD 3M1OA 3QDAA 4G6KL 4UT9H 2HRPH 5I1CH 1QFUH 1QFOA 4PJDB 2P42B 3EJYC 3MXWL 3FYIB 4N9OB 3U2SA 1RJLA 4WTZA 2A6IB 3HMXL 3ULUE 4OM1H 4G9FA 3QDGE 4QT5A 1FG2B 1UM6L 5DWPA 4MNGB 4M5YH 1W2KT 4HJ0C 2VCOA 2WXOA 4FQXB 5I8KL 1YYLH 1ZV2A 2VAJA 1ET5A 3TFBA 1BGXH 3ZHFA 1FE8L 3DDFA 3K5SA 4TULL 2WWKT 3RGVC 1EUTA 4YBQD 3BWSA 1DBBH 3I50L 3QJFB 3TT1H 4KI5C 3U7AA 2GBTA 1WITA 2Z93B 3I3DA 3MGOB 3PF2A 3IGKA 2DDQL 2P44B 5A2KH 5KANG 3EFFB 4HEPA 4PJ7B 5CSZB 2EKJA 3WSQH 3DOSA 3RBSA 3VVWA 1JPFB 1G9HA 1HSAA 3F05A 3HG1D 4LGRB 3TNNB 4JGJA 4GXVH 1S78C 4D8PB 4K15A 4XOBA 4U3HA 5B1KA 4UM9B 3RFRA 1BD2A 2VDOL 4LF3A 1OARL 1WG3A 2QFRA 3O45B 3VSQA 1TF4A 3UH8A 4BZ2H 4TUJA 1TOXA 5BRZD 4XNXH 3OJDA 1AR1D 1XL6A 1YMMA 3QRGL 3SGKA 1I8AA 2DQ6A 4RISH 1RZGA 2G4GA 1E4JA 1NFDA 4FEMA 1G0YR 5KSAB 1VEMA 3U6XS 1G6VK 1PTZA 3S35L 1XIWA 4QUOA 4UIKL 4XVSH 1GZPB 2O61B 5BV7C 2XZCH 4YSCA 2NX5A 3LZLA 4DZBA 3PQYA 1HH9A 3ZO9A 3Q3GB 5HGBB 4NRXB 5F21B 4A2HA 5BXFA 3MUUA 3LN4A 3OM3B 5T3XD 2YSSB 1F41A 1A8JH 1JZ5A 4HU8A 1MLBB 5F3BB 3SQRA 3H42H 5KYYB 4L4VA 1F02I 4PGCB 2E3VA 4MS6A 2VMCA 2XU9A 2CJSA 1N4XH 1SVCP 1MCRA 1MVYA 4QTIH 4OFYA 5B7MA 3T6XA 4PJ9A 3V4PA 3QZNA 4A37A 4F2MA 2D7QA 5H4YA 5KVGE 1S46A 2APFA 3C6LA 4JUSA 3H3KA 4NM8L 4PWJA 3OPUA 4LOEA 4YEEA 5F1SA 3KH4A 3N1FC 4FNLH 1RKRA 2ZKHL 1K2DB 4PCSA 1JDAA 4NP4L 4O4YH 4PN6A 2Q2EB 1NFIB 1YVLA 4BJLA 3QRFM 3IETA 2AXFA 4IS6B 3MA7B 2FUTA 4CVUA 2OMBA 3QNYA 2ATPB 1DJWA 2QMKA 2IDFA 1HHGB 4KY2A 5IBTH 3ECVA 3GFUA 4GIAA 1JVKA 1BCIA 1G9MH 1TQBC 1CLOH 1CZ8L 1VFBB 3MNDA 4I77H 2FH6A 1IFGA 1U3NA 1WP6A 1YPZE 4NC2B 4WK4B 4CJ0A 4R7NB 5E1HB 2I5YL 3F7VA 2LABA 1DDHB 3EOTH 3ZPDA 1DJZA 1MH5A 4HJGB 3CPLB 3HE7B 3PNRB 3BH9B 4WFGD 3TFKC 3MOBH 1QRNB 2NY0B 1D2PA 2HJFB 5C0FB 1NTDA 3QDJE 1NC4D 5E7BA 3EO0B 3MX0B 2X0UA 1HDMB 2HKAA 2QGDA 3ZE1F 3SB3A 5IKCA 3FUNA 4N90E 1ZANL 4K7PX 3QUYB 1CGYA 1RHHA 4WO4B 2VJ0A 3GRBA 4XN1A 3QA3B 5HYJB 4NQDB 2H1XA 5E6ID 3AG4B 5CJQL 1MHCA 1QLFB 2X6UA 1L9PA 1F4AA 1PDKA 2Y24A 3BP5B 4L8DA 4URTB 4F7PA 3VRIB 2JLLA 1HQRA 3BLPX 3O11B 4NKMB 4Z95H 1PLGL 1LO4L 1KLGA 2VO5A 4LLQA 4M9PA 2ITDB 1U8PA 2XA8H 1TJHL 1AO7A 3OVUB 3MYJB 4GEIA 1T5XA 3W5MA 4TNWF 3SDDB 2KMWA 3TN0B 1FZMA 4EDXA 1I8MB 2LAAA 4HG4K 5IQ7L 3B7TA 3IMBA 3K6FA 5CN2A 1NGPH 4P07A 4RMTA 1KELH 3V0WH 1YAZA 4ISVA 5H2BA 3QEQB 4JFFB 3SYPA 2E9GA 3QJHA 5JNYB 5I1HL 3PL6D 5JW5A 4GINA 1ORQA 3Q2WA 4PJCE 4FQCH 3HG1E 3DX3A 4WEBH 2VR7A 4ZUWA 4W9KC 2E4TA 1W8EA 3DMMB 5KSBA 2D3NA 3ASWA 5C0EA 2X3BA 1YLBB 3LDBC 4XCEA 1IM3B 1R47A 1KJ3H 5CCKL 3ZYJA 3DK2A 4G5ZH 4LSUH 4OQTH 3FFCB 3U30C 4BQ9A 5BRZE 5KYXA 5C1MB 4UM8B 3EXLA 3RVWD 5CLYA 4N0UE 1DVZA 1LP9B 5FYLH 3OSVA 4JO1L 4HPOL 1AR2A 4GAJH 1J8RA 3LPOA 4U0QB 3SPHA 4N1HB 3FCSB 5JXAL 2QZQA 3Q2LA 3VXRA 2OXGB 1JI1A 3RY4A 3QXAA 5BW7A 2EDMA 3KGRA 4O5LH 2ICES 4BUHA 3TYFA 1BZ7B 4PYHA 2EVHA 4HQQH 3N42F 4O02B 3D50A 4G7QB 2BIQA 1GCFA 4XBEL 5T3XE 1DVXA 2X4NB 1N67A 2CO7B 3CZFB 3HKZA 1G7QA 1DQLL 4MMXA 4P46C 4ZAKC 3KBFA 2HG5A 3QFGA 4D7BA 3VGAC 4BFKA 4DVBB 2WLIB 3ULUH 4ELKA 1ROCA 4XGZB 4PB9H 3FUFA 3DGCR 3GIZH 2CSPA 4Z8FH 4FQIH 2YN3A 2B20A 4U1LA 3GSUA 3OMAB 3OR7A 1NDMB 3CBKB 4U3CA 5DR5H 2YKKA 2Q86B 3GUTB 1OLZA 1KCRH 2YRBA 1HJCA 1BW8A 4GB9A 5KS9F 2CR6A 2XXFA 2C9AA 1HL4A 3D25A 3OKDB 5CBEA 3QPKA 2R23A 3LRKA 1OE3A 1SUJA 3O2WL 1BBDH 5DD5L 2X4TB 1H5BA 2G0LA 3FZUD 4KRPD 3KPMA 5EA0L 5E5UB 1G5AA 4K94L 4PLJD 3PJNA 5I1KL 4GBXC 1XGYH 1AVAA 4GYBA 3UAJC 1WBYA 2Y3AA 2IXQB 2QMJA 1BWMA 1GA2A 3NRPA 3REWB 1FHGA 3UXFA 1IFHH 2NYYC 1NUGA 3HB3D 3AQDA 5D7LB 4UILH 2DH2A 5EWIH 3T0ED 5GRXG 1FAIL 5IHZA 4PLKC 2W92A 4GRMA 3RY5A 1ZRUA 4KKBC 3OG6B 2XT1B 3VRLE 2G3ZA 4JLRA 4WFGE 5DEFA 1T66C 5HDBF 2HPTA 1UURA 1WD9A 5EEVA 3W5NA 1NCDL 4LVOC 4AEIL 2PABA 1YMHB 3MRDA 4GMSL 3BAJA 1UXMA 3HNTL 3K8KA 5B39A 3BEVA 1BSIA 1BM3H 1XGUB 4AYEC 3HRZC 4Y4HD 3EOAA 3T0WA 3GJFB 3EOBA 3MNZB 5DJYB 4LPXA 3FFOA 4GXUM 3F6LA 4L3EB 5JOPD 1S5HA 4Q6YA 1OF2A 2ZF8A 2WP3O 3K74B 2LT9A 3LSOB 3ZDYB 4XN5A 1JOIA 2FDBP 2ZONA 5TE4H 5HY9B 4OZHF 4PJAB 2EXTA 3BHBA 4ABQA 5MEPA 5IGXH 1Z3RA 1FVEA 2QVIA 3H9SA 2ZOLB 5I6NA 1E8ZA 5GGSA 4APQC 5KANI 3BZ4B 3MRKB 3HOGA 3L95A 3FH8A 1S5IH 1IC5H 5JO5A 3FW6A 4F7KA 2VC2B 5KVGH 5E6UB 3NEXA 5TDPA 5TQ0L 3EO9L 2NQ3A 5FHAH 4J3OG 4KGJA 3UEZA 4U7MA 3DETC 4JPKL 2ZX8A 1DR9A 2GJ6A 2VL5A 3QG7H 2J56A 4P23D 1KPRA 2YQBA 3GSOA 3EJRA 4JFTA 4ZT1A 3T8XA 1JF5A 2BMKB 3MI6A 2EVGA 4AEFA 1J8HA 5IZ7A 1JTPA 3BVDB 3BQUC 3ILPA 3UBXA 3FB5A 1BIIA 2JKSA 3CFUA 4KKPA 4ZD3L 4AENA 1M71B 5JXEA 5GGRY 2IWGA 1JGEB 4X6EA 4A2MA 2FQEA 4DP5X 5AB2A 5BO1L 4QLWA 5ETUB 1UD4A 5FO8B 3V5HB 2VZOA 4JHUA 4Z7UF 3ZKXB 5LQBH 5GZOA 3O4LB 4HALA 3QI9B 1VGEH 3VFMA 1UHVA 3WNPA 3L4XA 3KYAA 3UBHA 1KV3A 4J3XA 4QRQB 4TSAL 3BSGA 4KUZH 1HZHL 3B2VH 3V0IA 3ZGHA 1MCBA 1BFVL 2Y7QB 2Q76B 3LVTA 5JR1H 2N3JA 3I9GL 3H3BC 5LG6A 3RPBA 1PCXA 3IWUA 4JG0L 4IRZH 4WI0A 2V7NB 2NY5L 5FX3A 3VSUA 5IROC 1DE4B 5C0AA 5C0RL 3Q8FA 3HC4H 4FQXC 1D5MA 3FKUS 3OKEB 4H88H 4UIMA 4JM2D 2BP5M 1TMQA 2GCYA 3HUJF 2WKOF 4M1GL 1HJBC 4NQEB 3NZHL 4FZEL 5EOQH 4KGLA 4BXVA 1NGZA 4EVNA 3U0WH 3HS8A 4LL4A 4RMUA 2R4SL 1D3CA 5AWNH 3HZYA 2F18A 1D9KD 3D7PA 3D85D 3RB5A 3KYOA 4UZUA 2NNRA 1H9DA 3C5ZB 1V3LA 1P6FA 1S9XB 3T1FA 1QZNA 3TIDA 4AOFA 4ENED 2LVEA 4PW4A 5HHQA 1YEDB 4GW5A 4OZGB 4L1TA 4AC4A 3NN8A 1GYCA 4X5LA 2FX7H 3SE3C 3RZCB 2AFNA 3O6LL 2V2TB 2YXVA 4RGMB 5AZUA 3UAFA 5DC0A 3KCPA 4YZWA 2HCZX 4GW4A 1W72L 2I07B 2QSVA 3L9RB 3T0EE 5KSAC 3IDGA 1SZNA 5EIVA 2DLFL 2G4EA 2OMXA 3GXTA 4XCCH 3SE8L 2LHAA 3J7HA 4XP9H 4LE8A 2NZ9C 4LLDB 4QTHA 4UT9A 1SQ2N 3N40P 5DVPA 4J1UA 3KGSA 2E0PA 1OZTG 3T65B 1P6AB 2AHIA 4FLQA 4ELMF 1F11A 4CU7A 4Q74A 4JL2A 5DUJA 4GSXA 1JNJA 1TJGL 5DYOA 3ZL2A 4EQ3A 2VDOB 2QTEA 3RWIA 4O2CB 3UG4A 2WWMC 4AGQA 3U0TA 5L2KA 2XNAA 1U3HD 2FJGB 4ACTA 4H8WH 1OGAA 4HJJH 2NDGA 4JDTL 3B9KB 2FAUA 4EI0A 5T3XH 1AQKH 3BIKA 1QMUA 4OGQC 3MV9B 3KS0H 2GG1A 3QRBA 3G5WA 3W0WA 5AOMA 1J5CA 2JELL 2COVD 4M4RB 2MSPA 2EO1A 5E56A 1LDPL 2NUPB 1HHHA 5LUMA 4Q58C 1BP3B 5DFTA 4RGND 2ARJQ 3SDCC 3OAYK 1FDLL 3WUWB 4HBQA 1JFQH 3W3BA 1RVFL 4FQ2H 2OCCB 4OUUB 5MERA 3QORD 2VIRB 3L3JA 4AVKA 5CZXC 5ECGA 4HUUB 4QNPF 4UNIA 5HYSB 4PV9A 1DJSA 2L7JA 1GHFH 2QPDB 1YY9C 3EYUL 4ICWA 4NM4L 4WY7H 8FABB 5F0JB 2NPLX 1KYDA 3VXMA 4QRUB 1N10A 4GKZA 3TPUA 1T1YB 2CO6A 1TLKA 3RUGE 3HE7C 4AIXA 1ZTMA 4YJZL 5EOTA 3QUXB 2JQAA 1J1OH 4K3EH 3L4UA 1ZPUA 2VQ4A 1S9WA 3CZLA 5IB2A 5IMLB 3OXSB 1IBBA 2N56A 3GLZA 1TTBA 1AQDB 2EAEA 1YCSA 2YK1H 3S88H 1AQMA 1IAMA 2Y6SC 4RQQB 3QUYC 4WO4C 4W9GC 5GS0C 4NGHH 3VDCA 1D5BB 4P48A 3V0DA 3FRPB 5D5MB 5DJXA 4ONHA 2WINB 4RX4D 3I6GB 3A5VA 4FNQA 2GSIB 3COOA 2GSMB 4N2FA 1E4XH 4TNWK 3N2JA 4J6IA 1B0RA 2BWIA 2UXTA 3NCJH 1KBKA 2NYZA 3SDDC 3TF4A 5F1KC 3S5LB 2GT9B 4PU2A 5D93B 4DH2A 4QAMB 2MFNA 5C0JA 4JRXB 5ESAA 1R5IA 3MCLH 4H26A 5E24E 1OSPH 4NI3A 1BBJB 3PYCA 2XICA 4IRJA 1A6WL 3KH3A 3P4LA 4DCQB 2VSMB 2H0JA 1PNCA 4KJWD 4E9SA 4HWEH 1Q9OA 4FDWA 1E27B 1AKJB 4MNQA 4K07A 3DMMC 5INCB 4R4FL 2XIBA 1QFWL 2ATKA 2Q2LA 3L1FA 5C86A 5ILTH 3QULB 3CH1A 3HLAA 2VDLL 1J87A 1TCRA 4N8VB 5LNEA 3BP7A 3VXUD 5C97A 5KUKA 5AB1A 3VXQB 5I75C 3C09B 5EN2A 1X7QB 1XB8A 1DFBH 3MVSA 2DM7A 5GS1A 1F56A 3N43B 1QQDA 4WUUB 1JFHA 3NZUA 3TS8A 2DQCL 3GO1H 3D2UD 2VMFA 4DP1X 5JQHC 2J88H 4U6XA 2DYRB 2XA3A 1A6UL 5DJ8A 4Z3FA 1JPGB 3DRQA 4DKEL 2X2UA 1U41A 3L3DB 3TBYA 3VD4A 1ZA6A 1J5IA 4KJPC 3LEXB 1KFAL 1FV1A 5FGBC 3UO1H 2NQDA 2WWKO 4HUWA 1AG0A 4ZBJA 2EXWD 4X6CB 3RVUC 5IJKC 4QHKJ 1QLEL 4KUCF 1DJHA 4KJYA 3B7RL 5F72S 3G6DL 4B9KC 2IDTA 4F27A 4W68A 3RNQA 1RPQA 4O9HH 3VCLB 1FL6B 1WD8A 4RGNE 2DB8A 5GGQL 2GC4C 1BQHA 2WCPA 5GJTH 1PY0A 2X7LA 1JXDA 3LHAA 1PG7W 3IFOA 1YJDL 1DJGA 2WV3A 1U2YA 4OQTA 5BOPA 2MQCA 4G7SB 3NUKA 1G7HA 4U6TA 3OLDA 1IFRA 4OCXL 5F1OB 1YYML 2GYSA 4ZFFA 2CIIB 1U58B 2JI3A 5C3LD 4IOFC 1TSRA 2G5BA 3VFVA 5JYLA 2IAMC 4QXTB 4RNRA 5A2CA 3RWCB 1VZHA 2LFEA 5JA8B 1I9JL 5I8EA 3PAUA 3SCMC 3ZMNA 2GK0B 4AMWA 1H6EA 4PJXA 1Q72H 1FRGL 4J3UA 3ARPA 3R4DA 3A47A 4R4NC 5IFHL 2BVQB 2C9SA 1CQYA 3IU4H 3PY9A 5EH1A 4YWGH 5C0IA 2V9TA 4RMSA 4DAGL 4X9GA 4ZI8A 2DH3A 5T1LD 5CWSA 4X7TB 3QDGA 5J8OA 2H32B 1INEH 4L0PB 1TVBA 2WYIA 4HUVB 2VN6A 1UB6A 4JZJB 3P54A 1FJ1A 1QBMH 1B2YA 3QCVL 1CLCA 4K3JH 1N5AB 3J27A 3QZBA 1A3RH 1IGML 1J1PL 4PRPB 3ZU8A 3BPCA 2WAHA 3LHPH 5EZOH 2B0SH 1UD5A 3MLVH 1DLHB 4I48A 1M7XA 4JRYE 1U92A 4V2BA 1GTNA 1RHFA 3AXHA 3QEUB 3DJTA 1DANU 4UBDC 4PI2A 1KLUB 3THML 4DF9A 1AZNA 2X89A 3LN9A 2C4FT 4AGOA 2Q1EA 5DZPA 4F24A 1B90A 2K9UA 1RLBA 5E8OB 1EHLH 1KXTB 3SO5A 1E5BA 1MEXH 1U21A 2IDQA 4NO5A 1BVOA 2BVOA 5E8PB 4PR5B 2M2DA 2D73A 3P69A 5ENWA 3TJPA 2PWGA 1YEFH 3VFUA 4RWYL 1EZSA 4PJFB 3UX9B 3U4BH 2FHCA 1YUHA 2XWEA 2X2IA 4XODA 3VXUE 4BA8A 2VR8A 2AQRA 4GAFB 1F3JB 2HMIC 1UADC 3LKQA 2JV6A 4KO5A 3ZKXC 4B9GA 4F3FB 2NLJA 1G94A 4U6YA 1EDYA 2WVSA 4N0CC 4GI6A 1RK7A 4P2QB 5FKAB 1EX0A 4ZFOA 2OMVB 4J5VA 1BFOA 5DJDA 3UBGA 5IFAL 3D39B 1N6QH 3KXFD 5H35A 3PU7A 3K2UL 4AT6A 4OCYL 1OCOB 5D7HA 4GG8A 4FABL 4AX3A 4EDWL 2NSXA 2Q3XA 4QHMA 1DBAH 2C1OB 1GGCL 1GGUA 1EJOL 3MGAA 1I8KA 3WNNA 4B5ZA 3B9DA 3U4EB 4PS4L 3P9MA 3EJCA 3JTBA 5F6IB 2Y1YA 4OJFH 1I3RA 4RZCA 1MW2A 2NW2A 5I1JL 5A16B 2FLBT 1OB0A 5AAMC 3R06B 5C0GA 2WKLA 5HGDA 5IIEB 1T7ZA 3KZ8A 2F7IA 1M6OB 1J5OL 4BCXA 3C5ZC 4CVWA 2Y06L 4POYA 1CU4L 1T5WB 3RNKB 3POHA 2Y5QA 3S36X 5IUCA 4MAYD 3MRCB 3BD4A 1MCKA 2DTML 5L9DL 3RZCC 3EH3B 4HCGA 5I1EL 4ODUA 3UJIL 5ISZD 2W60B 4LCWD 5F7LB 1OAXH 4LSTH 1FLRH 2NTFA 4HWUA 3OJ2C 2F9BT 1HIMH 3SE4A 1OVZA 5CJOL 5EIIA 5EPMB 1CT8B 4IK7A 2O5ZL 5AKRA 2XXMB 3Q9QA 1WF5A 3QDJA 1A6VL 1BMWA 2FWUA 4GAYB 3TTYA 4AIZB 2Y5TB 2PXYB 2EXYD 4N0YL 1X5AA 2IPKB 1ND0B 2PN5A 4NJ9H 4ZQKA 3ARBA 4MDIA 1J18A 2RCSH 2QGBA 5BQDA 2ZUWA 4U1IA 4JFZL 1U2HA 2CDFB 1O0VA 4IKJA 1M3JA 4OKVB 4YUEH 1CQKA 3GSWB 3B9KC 4RFEA 4G9DB 2IGFL 3FQUB 4G8FB 3V0HA 5CD5D 4ZUUB 1PSKL 3LIZL 5HI5D 3W9DA 1FSKB 2K6WA 1BVKA 4AWJC 5F1NA 4LKCA 4JFED 2C9RA 3VD9A 1ES0A 4DGVH 5JIDA 3S37X 4BH8A 2KZ1B 4ANUA 1CFSA 1JHLL 5I2IA 1X5ZA 2E7BA 1K72A 2Z4QB 2VWEC 4LEBA 1QBLH 4ZYKB 1MXGA 3HI6L 4UNUA 1IC4H 5HYQA 2QQQA 5AAWC 4PJCA 3HG1A 4WHTA 5H37H 4LCVA 3DI2B 5EOCL 3RX5A 4DWHA 5C9JA 1KGJA 3MMEB 1IQDB 5LKNA 4KZDL 3DOIA 1S7RB 3UDWC 5DFVC 4JQXA 1E3ZA 3WHXA 1A2YB 2DF3A 3RZWA 4JO2L 5BRZA 3W39B 1UENA 3MBEB 5EBWB 4QPEA 5F70A 3QUXC 4N0UA 1CFQB 2QELA 3BSZH 4QHPA 5ADOL 3BEWB 1MHPL 3P77B 2RFXB 2CMRH 2Z7UA 4WWKD 5LBSH 4PREB 3VXOA 5C3TA 3IJ8A 2ZSVB 5BQ7A 1JV5B 1A1OB 5E2JA 5CILL 1CYWA 3ECQA 2X9XA 4J3BA 5AZ2H 1UACH 1W8NA 3HJ0A 3WTUA 4OZ4B 2UUDK 4HFUH 3KXFE 1RERA 2BZ7A 1O6SB 2Z8RA 4GFTB 1RULL 3G5VA 3MRRB 4R2GB 2VLKB 4UQCA 3MCG1 3BISA 4KK6C 3WUWG 1YSOA 2A9AA 6PCYA 3CPUA 4PV8A 1GXEA 2XXCB 4KX7A 5GISH 1P5VB 2CLZB 1GW6A 4Y8AA 3P3RA 3RDTD 4DP2X 1UWGH 5HYSG 1G7LB 3MRHB 4NO0D 2WZPD 3P30L 4X6FB 1A7OH 3ZT6A 4QYAA 3TCXA 4QD2E 5D93C 1VFAB 4RFOL 3RA7L 2DBLL 3EYQD 2AK4D 5F89B 3X3GH 1U8QB 4LHUB 2WD0A 4K3GA 4GFXA 3VE0B 1VCAA 3UIZA 4NWTH 5DHXB 4UTAL 5KVFL 4YR6A 5JDJA 1VCBC 3QWOB 4MXVF 4K7FA 3UTTB 1BVLA 3BW9A 3OC5A 3GMOA 4IBTA 3OZKA 5FF6A 2BW5A 1KIUA 1QUNB 4G8GD 3LKNA 5EUOB 1IGCH 5EZPA 4HHAB 2V3DA 1IC7L 4MD4A 3CBRA 5D7KD 5ISZE 4LCWE 3NJHA 1AYOA 4TL4A 1OAKH 3FRPG 4OSUL 5GHWL 1UD3A 4U1NB 2VQUA 1HQ4B 2ZWZA 4MNHA 1RXLA 2A6JB 2XPGA 4NENA 1JERA 1G7PA 3MLYL 3C09C 5DO2C 4PRBB 5ERWA 1DQKA 2WHVA 1MPAL 1UWFA 4LEOB 2E75C 4YFEA 4HOXA 4H1LG 2F2HA 2IH1A 4U1JA 5DMYA 3V7MA 3FU9A 2CUIA 3F12B 2EC8A 3SYCA 3PGDA 1NC4A 1C08B 4TSBH 5DQJB 1ZE3H 3MOAH 3S5LG 1FVCB 3WI9A 2XC8A 2FATH 1IL1A 3ULVE 2CCVA 4Z0XB 5IT2L 2BRRH 2CNZA 4ODSH 3X14A 3DSNB 3SPCA 1A3QA 1E2ZA 2VOTA 3DV4B 4PD4K 4CVZA 4G6JL 5JUEL 2R2HB 3MRMA 1FF5A 43C9A 5E6IA 4LU5H 5LCVA 1G1KA 2DQMA 2VN3A 3AVEA 3OKOA 1BF8A 2BSDA 1TENA 2VDLB 3GZPA 3HVNA 3CMGA 3OX8B 2P3YA 4TNGA 2FO1A 1EMTL 2Q7NA 4AJVA 1GY1A 3A23A 4GQQA 2WKGA 2C26A 3MREA 3TV3H 2WYTA 1DFXA 2HWZH 4JFEE 2ZXQA 2J6EH 3CN2A 2YFOA 4XE0A 1T04B 4NNPL 4TVPD 4Y8DC 2AEIT 2K78A 4N8VG 5SWQB 2O30A 4OZIB 1GJUA 2DQDL 4DP9X 1J9CT 1VDGA 4R3SB 4R97C 4RFNC 4MSWB 3NVQA 5FO9A 3RLSA 1F6FB 1CG9A 1OQXA 1ORSB 4PBXA 5J3HD 3PL6A 2GTZA 1DBJL 3GTTA 4NN5B 4OCMC 2HRGA 3MKKA 3V4UL 1IM9D 1CD1A 3LYRA 2F53B 5F7DA 3WN5B 3NIGB 4EUPB 2UX7A 4AYDC 1QLEB 3N1MC 1CTMA 2J1KA 4AE1A 5LGJA 1WEJH 1IKNA 3MUGA 2AV7A 3LKPA 1R3IH 1ZLVH 4MQTB 2A9BA 3LCYA 5K59F 3O0RL 1UATA 4MMYB 4HDIB 4K94C 1FYHB 4HC1L 4NO3A 3PGFH 1MFVA 2WTPA 1HWGB 3OZ9H 1MNNA 4KDVA 4LVHC 4H8VA 2B2XL 3BKYL 3LNIA 2BSRB 5KBNC 5DVKA 2ZNXA 4WJKB 1G9NC 1ED3B 1TJIH 4LCUA 4NDMB 1JD9A 4KXDA 1V3KA 3HG3A 4LOUD 4Y88A 4AZ8A 1NL0H 3LQMA 3JWDC 1DBKH 1ZS8A 4KXZI 5SX4H 2GJZB 3DO4A 4C56B 2CU9A 4JHAL 1DQJA 4X5QA 5F96H 3TNMB 5F88A 4ODWB 1HKLH 1K8DB 3ARTA 2HZHA 2AK4E 3OB0H 4FA7B 1E4WL 2DQEH 1DQDH 3FO9B 5EZJA 2MTAA 4DSYA 1RZKL 4PLOB 1N5YH 1OT1A 1PZUB 2WXFA 4X4YA 4JKKA 4MTMA 5D1XB 2ZSWB 4G8GE 1N59A 1JMXA 4KK5C 4A6YH 3TONA 2AVFA 4DKTA 4BKLB 1MVFA 5D7KE 2MEJB 1N0XH 1MI5D 4KHTL 3T0EA 3ULSB 1QUPA 2ARJB 3OR6A 1KZYA 1OSEA 4AIEA 1Q0YL 3MRJB 5D2LA 1NANI 4WFHD 1KIQB 4G43B 2CAKA 3WFDL 3BP6A 4XMLL 3O9WB 2EVIA 3LKSB 3GI9L 4XAWL 3L4CA 5D4QA 3VFNB 4EI5D 5CINL 5T3ZL 5K1JA 5DTFB 4DKAA 5IW3A 1WWWX 4Y4HA 4RESB 5DK0A 5I26A 3KCWA 3WMQA 2JCWA 4Z3GA 2H0EA 3RX9A 4WWPA 1QWHA 3C60B 1IGTB 4FTDA 1TTRA 4M8QA 3WJMA 1AFVH 5F6IC 1FN4B 4UZSA 3TF7C 3NABH 5JW4Q 2R29H 3OPZL 1JK9B 3U2IA 3VWJB 5CJXA 1RUQL 5BZDB 2DEYX 3FT4A 5IVOA 2Y36H 3MLSH 4YPGA 2NR6D 4JG5A 1NMBH 4YVNA 1I3GL 1AGEA 2J12B 2ITCB 3EGSB 2HLEB 3GXUB 3L9BA 1JVOA 2J5LC 4LLWA 4P57A 3K8MA 4IMKA 5AYUL 1A7NH 2NY5C 2OCJA 2X4QA 3FH7A 1OOWA 1RJYB 3ASOB 4HS3A 1IUZA 2EO9A 5FA3B 1A22B 4P23A 3MAWA 1X5IA 5FW8A 3IKCA 1T20A 4KDTA 5ACZA 4OY9A 1JS4A 5HPMB 5E6YA 1HEZB 2DIEA 3RUGA 1BMZA 3W57A 3N1QC 2J4WH 3SZKC 4JM4H 1FL5B 1NC2D 2Y2WA 4QOKD 3BGMA 2FCBA 3P4OA 4JK0D 3RWFA 5SWZB 1VPOH 4F20A 5FB8A 2VISB 2PXYC 1YNLH 4NRYB 2SEBB 4ZS7H 2R1WA 4KNQA 3APMA 3PHOB 1KN4H 1AI1H 1OP5H 5EU7E 2DLEA 5HHMB 4N8UA 3V4PL 2OMYB 1V05A 4E41D 5HVWA 5F7YC 2YIHA 1I1FB 3POCA 4ATTA 2AW2A 4PBWD 3WBDA 4R96A 4UTBL 5FFOA 5IW1B 3VJ6B 1FSKC 2NY1B 4I88A 4EI6A 3EO1B 3BN9C 4JM2A 1N7ML 4F15B 5BVPL 4FQLH 2W9EL 4RWHA 4DGIL 4OFPA 2YWZA 4L05A 4XBGA 4N5ED 3AQZA 5CR8A 1C5BH 1D5XA 1FBIL 2J6WA 4FC3E 3BZEB 4G7YH 4BGLA 1D9KA 1MRFL 3HI1A 2P9RA 1YUKB 1XTLA 3D85A 3GXIA 4KX8A 4Z9KB 1M9SA 4RRPG 4NKIL 1FH2A 4OB5H 4PRAB 1FGVH 2F5BL 1F6LL 5KBDA 1KG0B 2VDRH 1J0KA 4JFOA 3FT3B 4D9LL 1TZIA 4CKVX 5TDNB 2LLNA 4M62H 2ZCKL 1KJMB 1A6AB 4ZTEA 3BWAB 3HPJA 3NCBB 3O3DA 4MZ2A 3V6BR 2VB5A 5CR1A 1WQVT 4Q9RH 2C9PA 3CN1A 1R3KB 4ODTL 3MBEC 3G6JE 1SLWA 1OLLA 3QIWB 3HHMA 4HIIA 4HPYL 3DVFA 3K6OA 3WFCH 3KW7A 3KEDA 1IAII 5FLVA 1NUDA 3NA9H 2UZIH 1L3WA 4WFHE 5F9JA 3CFCH 2Y0SA 2VW7A 1F6AB 3ZKMC 4LSQL 1DN0A 4LIQL 5IVZA 1AYRA 5DK2A 3DUUA 3MXVL 2E7MA 4R2GC 3VQLA 4E36A 2W07A 4N86A 1TQSA 1ETZB 3G5ZB 1PFCA 4O51B 3GC3A 3JT2A 3VFSB 1DDTA 1U3HA 2AMUA 4PJBE 4D0BB 3JV0A 4ZUSA 1QR1B 4JMXA 2OMWA 2C7UA 4AM0A 5KSUB 4JKLA 1DQIA 1GGBL 1LTXA 3CHXA 2WLLA 2ZF9A 2HH0L 4XPFL 2CXKA 3CLEL 1UYWL 4N4YB 1F90H 2H1LM 4N87A 5T1KD 1OT2A 2ZOUA 5KJRL 1HU8A 4OGXL 4NO2B 3LH2L 4ZX3A 5H37A 4ETQA 1I4FB 3FUJA 3MUZ1 4ZDHA 3TVMD 5C8JB 3LZQA 4JRWA 5DWUH 1MSPA 1EHAA 2GY7B 1MAKA 5I0YA 2AAAA 1DSFL 3ARQA 3QORA 1MJUH 4XP1H 4HG4J 5I66B 3ALWA 2P5ED 1PW3A 3NFPA 2NZIA 2D9QB 3SBQA 2RD0A 1WTLA 3L08A 5I16A 1MCPH 3EGDB 3QHZH 3FU7B 3N06B 2ZOWA 2W9LA 3GJEA 4F57L 4S0SD 5LBSA 1XGTB 3R18A 4XPBL 3QP3A 1RZ8A 3S9DB 4QOKE 5HSFA 5DS1A 2EH8H 4PJ8D 4MASA 2V8MA 1TQTA 1MFEL 3FQRB 4IBQA 4OLWL 4A7GA 2X6CA 5JHDD 4P9HH 4UV4L 4DP4X 1JNNH 2WO3B 2PO6D 4A2DA 2EEBA 4LHUG 3SDAB 4U6VL 5FCUH 4Q7DA 4J6RH 1K5NA 3SQOL 1REIA 2VRAA 1OCZB 4E41E 1PPIA 4XX5A 4EQ2A 3FQWB 4MB3A 1ZT1A 3KD4A 2Q6WA 5EULV 1OAYL 1UTDA 4JPIA 4K8RL 4RX4A 3VM5A 2A73A 2F58L 3AWFA 2BSTA 1GGTA 3CDGA 4R7LA 2WBJB 1R24B 4UANA 2VM9A 1SY6L 3CIQA 1P4BH 3QIBC 1FFOA 3JWOH 4CC1A 2DLIA 2H8PA 2BPBA 4X2UA 4WNQB 2E27L 5HTSA 1KGUA 1U8JB 5BZXA 1JK8A 3F84A 2HN7B 2VO8A 3CHPA 4XVTL 4XHJD 5FV1L 5HHVH 1OTUC 3GK8L 2BNQB 2DMHA 2FWSA 1EA9C 2JB5H 1U8KB 2AJVL 4TVPH 4XVUC 4W70A 1JDDA 4NN5C 2OZ4H 1CD8A 4LOFA 1IBGL 2ZX5A 3EFDH 3L3GB 3ALPA 3NFSH 1TSHA 2GPZA 1XR9A 4ONFH 3WN5C 4QHNA 2D0HA 3OMIB 1RJZB 2IADA 3LZOA 1TKWB 4TQ8A 2CJUL 3UIYA 5CIPB 5EORH 5FK9B 5CP3H 1PZAA 2ICWA 1JV2B 1NMAH 3D33A 3GSQA 3QZPA 4OFDA 3VXUA 1PYWA 2YOCA 3O3EA 3P4MA 1PIGA 2DM4A 4XHQA 5E51A 1MNUL 5TPWH 4DOHB 2I85A 2WQWA 1CGUA 3GEFA 1M6UA 4M8VA 2NUTB 1UXSA 2AQTA 1T7YA 1RIHH 3U83A 4LQFL 1YJDC 2H5UA 1MZZA 2PW2B 3X11A 3D2UA 1ADQH 3BVNA 2NNXA 3ZQWA 2ZYRA 3W9EA 4JG1H 3V55A 3VA2C 4A04A 5BOZG 4G8AC 2B1HL 4WI5A 1D5ZA 3IDIA 2XQYG 1Q9KA 4OF5A 1GZQA 5D7IF 3QH3B 2IPUG 2J6EA 4ZUVB 5EFIB 4GG6B 4NKOB 4E9WA 4HD5A 3CLFL 1QSEB 4P2OC 3D52A 2J8HA 1CICB 4EUPG 3BP4B 3AZUA 5GSVA 5E4OA 5IMMB 4YSOA 2WMPB 2OL3L 3OJMB 3N0AA 1H0DA 1NFKA 3FHEA 4JM0A 2DL2A 1ZT7A 1LO5B 5E8DL 2DJ4A 1SMAA 1WH0A 3K0WA 4AQ8A 1ZHNB 4ZW6A 3KVQA 3MLUL 5CCHE 3PABA 1K8IA 4MJHA 2QSQA 5D1XC 2I9LB 1E5YA 3C08H 1YG9A 2P5EE 2RB8A 5B21A 2R0ZL 5GQBA 4UTCA 3FT9A 4DN4L 5IB5B 1SUHA 4HKJA 2YZ8A 3ZTNL 3UP6A 4NC1E 4LLYA 4AEHL 3V2AR 2VR5A 2F5AL 4MYPA 3U0PB 4I89A 2E59A 2WXNA 3SEPA 3QVAA 1BEYH 3PJSA 5F7KC 3U6XA 1UZ8A 3O9WC 2NY4B 4ADJA 3BVUA 3HZMA 2YA2A 4N25A 2O5YH 2WBKA 2CDGA 4QO1A 3ARFD 4AJ0A 3LEYH 3CU1A 1T0NB 5FUZL 3G08A 3O81A 4HFWA 3LPFA 4NT6A 4ZPVA 5ITBH 5C07D 3TTSA 3C60C 3BUBA 1EANA 1X9QA 4AQ1A 3OF6D 5D4JA 3AXIA 2JKTM 1MW3A 4Y5YB 4DQOL 1RJLB 3S4SA 1LK3H 3L17A 3QC5X 2D7TL 3NTCH 4G9FB 4QT5B 4YHPB 3VWJC 1KDIA 2FGWL 4E5XA 4P5MB 3WTTA 3WKML 3I9PA 1XCXA 3IDNA 1C5DA 4LSSH 1QNZH 3ML9A 3QWQB 3ABZA 2ED8A 3CSFA 3IF1B 3WS6C 4G70B 3PWPD 1E28A 1E9OA 4HXAL 2XWBA 5GZND 4G42A 4A6YA 3ECWA 1XAUA 2V9UA 3MRFB 2K1MA 4TOYL 2VDPL 1SOSA 4E9XA 4OD1H 1N0LA 4NHCH 1QFUL 4UT9L 5I1CL 1KB3A 2VITB 5GXBB 3MBWB 1HSAB 1H8SA 1YPZF 3ZRSA 3K71A 4IDLA 3GTNA 4OM1L 1OTTC 2R69H 5FGCE 5JORB 4M5YL 3T6WA 4HZLB 4LF3B 1F5WA 1N64L 3FJTA 2NY3C 4XN7A 1YYLL 5FDYA 4X50A 1BGXL 1SJEB 2ODHA 4WUKH 4TUJB 1FGNH 3B9AA 1YMMB 2WK2A 2YXMA 1U3ZA 3GMQA 1ZLDA 1DBBL 3TT1L 1NFDB 1PZ5A 4C83A 1Q9WA 1ILUA 3SY0A 5M7QA 1LEIA 5FW7A 1XIWB 1PG7H 3UAEA 1WFJA 2MHAB 1B4TA 3UZVA 2QADB 4IMLB 3VVVA 4Y0GA 3WSQL 1TFPA 5IVXE 1I8UA 3U1QA 2R29A 5DJAA 2NY1C 4Z3IA 4ZW3A 4GXVL 2H9GB 2DM2A 3QPQD 3TCLA 4WAFA 4F15C 1HI6B 1LILA 3SOTA 4N2NA 1HH6A 2OW6A 3GLEA 1T2XA 4RIRA 3BFWA 4DK5A 4URKA 5E7FA 4AMKL 2IWKA 4L4VB 4MQXC 4TQIA 2NQCA 3UTPD 4BZ2L 2E7LC 4JVPA 4XNXL 3MLRH 4FI7A 4JUTA 2CO2A 2EE2A 4RGOH 4XPAH 4M9OA 4PJ9B 3V4PB 2FEEL 1UFGA 1FIGH 4F2MB 1EEZB 4PJCF 5E8NA 4D7PA 4XVSL 2XV6B 1MHHA 1RZ7H 5EU6E 4MAYA 2XZCL 2CBOA 2OTPA 3CDZB 4Q2ZA 2P5WE 4KXZH 4NQCB 4HJIA 5ISZA 4LCWA 1QEXA 1R19A 3LS4H 4L4JA 5ACMA 3D87B 1WZLA 3MRQB 3PFUA 3QNYB 3ZE2F 2EC9U 2BO0A 2MCAA 5KG9A 1N4XL 1VACB 4UINH 4IKIA 5FHBH 4QTIL 4JJHA 2JIXD 1Z9PA 4R4BB 4GW1A 4Z7VE 4P5TB 1QLRA 2K6YA 3HAEH 4FHKA 2DWYA 3F7VB 4XBMA 1BFTA 3LPPA 5L0QB 5C2BH 1MH5B 2X53A 1T3FA 4FNTA 3E8UH 1K3ZA 3F01A 5C0BD 4FI6A 3EDFA 1JUFA 4FNLL 2WVVA 1N8ZA 1AHKA 2ICEA 1WFNA 3DX2A 3FFDA 3OJVC 2CCWA 4O4YL 3ZKNC 2IV8A 2ZQKA 2IWEA 5AL8A 1DP0A 1XF4A 3ZHNA 1KJVA 3RX7A 5A2IH 3T0BA 1R6VA 4ZZKA 5IBTL 3CSBA 4QKXB 4WFED 2JCCE 4JFEA 1NANH 2BC4A 1IQWH 3N44F 1G9ML 4JKWA 4M5SA 1CLOL 4NQQA 3CK0H 4I77L 3ZR6A 4F7PB 4Z7QE 2NSMA 2N1TE 4I5BA 2VMJA 4XWOD 3FU0A 3EOTL 3B7UX 1CTOA 3LOWA 4KVPA 4LLQB 2J73A 3IWVA 1AO7B 4RBPH 3SZ6A 4NX0A 4H8QA 1L9RA 2YXFA 2WGXA 2VE6A 4EDXB 1EHXA 5DRWA 3CIAA 5E1GA 5IF0B 4K5OA 1QFWI 2C8NA 3K7UA 3KBPA 1UFUA 1J88A 2WLNA 5H2BB 3KPLA 2QV4A 2HKFH 4O2EB 5JW5B 3ET9F 3HS0C 4QXGH 1ORQB 4UQ2A 5DD3H 4Z3HA 3DPDA 3PAVA 2EDWA 5GSRB 2BP0A 2PPEA 2N7AA 4XCYA 2AVGA 4K4KA 3VRLF 5KSBB 3UL4A 1WPCA 4Z95L 5E9DD 4HT1H 4XCEB 5I19H 2YEVB 5TE7H 2XA8L 4QWWC 4PJ6A 1B88A 4WWKA 4S2SA 5KYXB 1KEGH 1BZOA 3ZDXE 1DUZA 4Y5VA 3SDAC 1SN5A 1AC6A 1E4HA 4B3EA 4NQXB 4AW4A 2LFGA 1NGPL 3MYZA 5GRJH 5DZOA 1KELL 2HJKB 2J7LA 3V0WL 1NBZA 2X4SA 4JEGB 1PMYA 4EIGB 3EYSH 3GSXA 4FQCL 2QSTA 4WEBL 5DJ6B 1O5PA 3TYFB 3FTGB 3RDTA 1F00I 3AT9A 2VXVH 2WBJC 1HCFX 3RTQD 3SPVA 1XR8A 4CADA 4NO0A 2WZPA 1MCDA 4MMXB 1G7QB 1KJ3L 3Q13A 4PBDA 3NFNA 1UT2A 2HG5B 4G5ZL 4CGTA 1E9QA 1X5JA 3G9AB 1MRCH 4GP5B 3DX1A 4LSUL 4OQTL 3UTPE 5I8CB 4G6MH 2P8MA 2AK4A 1SF3A 4HGKC 4UV7H 4XNDA 2X6BA 5FYLL 3O3BB 4U1LB 3GSUB 2A1WH 4GAJL 4XPGH 4LPWA 5IB1A 2V8LA 3JVFC 4N3UA 4LRIC 4ZFGH 1QRKA 3QWNA 2YQGA 3A6BH 3D25B 1TNNA 2E47A 5CBEB 2R23B 1L0PA 35C8H 1H5BB 3B7YA 4G8GA 3KPMB 3UMNA 1A7PH 1ZXQA 1NCIA 4O5LL 4HIPA 1RU9H 4HQQL 4MLSA 1ZJAA 3WEXA 1WISA 3QNZA 1DJXA 3US0A 2F54E 5F7BA 3AWEA 1EQWA 4LLVA 2O6FA 3EJYD 4RDQF 4AUUA 2YGPA 3DX0A 2WQSA 4GAGH 1JGIA 4MAUH 4MDRA 1YC7A 4WK0B 2K0RA 4F8LA 4ZNCD 1R9FA 3TA3C 3ZRFC 3ULUL 5DEZA 1AGBA 4PB9L 3TURA 3GIZL 4Z8FL 4FQIL 4XO3A 2JMRA 1HHKB 2RACA 4HJ0D 5DR5L 4CN4A 1T0OA 4YXHH 3B56A 2D2CC 2Y4SA 2J25A 4JLRB 3IE9A 1Y7VA 4LCYB 5C0BE 3SY6A 1E5CA 1KTJA 1BBDL 2XY1A 4IIQA 1XT5A 3CQQA 5HDWA 5HHOD 3I3BA 2ENPA 3R1GH 1JNLH 2VMDA 3MRDB 3EJZC 3OHXA 4PLNC 1XGYL 4XN8A 2W88A 2R4RH 5B39B 3KPNA 4LEEA 2FIKA 3WKNA 3KYKH 3EOAB 1J0YA 3NCYP 2XDHA 4N2AA 3EOBB 1NBVH 5HI3C 1B3JA 5J12C 4W4OC 3TLRA 1CICC 3LNGA 2APWA 1IFHL 1IAIH 1TETH 2VRQA 4WFEE 4X9BA 2B9AA 2X87A 4M6OH 1S78D 4OCSH 1OF2B 4UILL 5EWIL 3CUPA 2O26U 4KJQD 1T1WA 5DI8A 4XVJH 3UGXA 2W81C 3M45A 1T89A 2WQVA 5IR1A 4QHLA 2OZ4A 3BHBB 3Q7JA 5IEKA 5LAXB 4D94A 3HPLA 5MEPB 4CW1B 4F8TA 1AAJA 1FVEB 2DKSA 3TT3H 2DIBA 3H9SB 5GGSB 5FPIA 1HCVA 2LLGA 5A6MA 4WI8A 4KNSA 2G5RA 3MRLB 2UY7A 1IM9A 1BM3L 5CP3A 5HGHA 5TDPB 3US9A 4V33A 2MPAH 1A4KA 4ZFOL 1VEPA 1YDPB 4HUXA 5HHXH 2VL5B 1CDYA 3O2DH 2OL3B 3ETBF 3JTTB 2YGNA 1DSWA 1KPRB 3GSOB 3U36A 2Z91A 4JB9H 5TE4L 5E9DE 4W1TA 2WXGA 3D4GA 3ILPB 4J8RA 3UBXB 3VA6A 1ANUA 1BIIB 1PEZA 2G2PA 2NY4C 1RZKC 5D2NE 5IGXL 2GITB 1BQKA 3U1PA 4AENB 1WCBA 2JKNA 2E7CA 4L5FE 3EH5B 4X6EB 5T1MA 3BGFB 2WZ6A 2UY6B 3N85H 1S5IL 1IC5L 1IKFH 1ESOA 5ID0A 2EE0A 3KPOA 2IH9A 4AYID 4Z7OB 2JK5A 3PWJB 1MQKH 4LGSB 3VFMB 5KVGL 1D5RA 2XFXA 3IGUA 2WBWB 3DJRA 5FHAL 3CC1A 4GEJA 2B15A 5L4JA 4X6DB 1D6EA 4Y5YC 1S9YA 2XWJA 4HGWA 5LGYA 1R3HA 3WLBA 3QG7L 3VG9B 2HYMA 3Q06A 4JJ5A 3T6QC 3F00A 5C0AB 5A6IA 5ES4B 1VADB 4D3CH 4RA0C 1D5MB 1CC3A 5JMRA 2JJUA 4EXPX 1NGXA 5C6PB 3RVXD 4G80A 3QUZC 5IQNA 2OZNA 3WLWD 1U91B 4FOMA 1YY8A 1JPTH 1H8OA 5DCCA 4EVNB 5LQBL 5TGBA 4TVSa 2G2RA 4R8WH 4CU6A 1GJWA 2B14A 3RWDA 3EKCA 4F7EA 3X1EA 3TFKD 1WS8A 1J9RA 2FJFA 3A3YB 3T4YA 4KUZL 3B2VL 5CGBA 5KVDH 1W8OA 1TZHB 3NEOA 3T1FB 5JR1L 4PJIE 5HHQB 4GW5B 3RUGF 5D1ZI 2YA0A 4IRZL 3T09A 3G6JA 1MI5A 5INDB 2RMNA 3HC4L 2YLHA 3P0VH 3TO4D 2A3TA 3QQ3A 1AC0A 1GSMA 3KCPB 1CFBA 4WTZG 4GW4B 5EOQL 1H3WM 2VLMD 4NQVA 4MYWB 3ZK0A 1DCEA 4FFWC 3U0WL 3IDGB 4N1CA 3E9TA 2IQAA 1EFQA 3ERXA 1XIWC 5AWNL 1IJNA 4PJHB 2VDPB 1U0QA 5TDOA 4QTHB 4EI5A 4E9RA 1KIPB 2QADC 4J1UB 4U31A 4CSPA 5HHOE 3Q6GH 1C12A 1P7QB 4F93B 1F11B 4PJBA 4KI5E 4KTEH 4OQ1A 3WIFB 4U7KA 1R5VA 4FAAB 1XXDC 5DYOB 3RWIB 2J72A 3U0TB 3C87A 3DX9B 2R1XA 4IU2B 3UACA 2E56A 1AXIB 4NC0B 1L7IL 4I3GA 4BE5A 1NH6A 4D0DB 1DVFA 5I74B 3SYQA 2PWHA 3AUWB 1T5KA 2VXTH 3BIKB 4TLTA 2JI2A 4PJ9C 2NR6A 4Y2DB 1BYOA 2L7UA 3AADB 2QEJA 1F1GA 2N59A 2R2EB 3W0WB 4XCCL 3DARA 4JQVC 1RJCA 4XP9L 3O2VH 5I5JA 1CURA 3MRGA 3T0AA 2IMNA 3FO2A 4HIQA 3MRPA 3WD5H 2FBJH 3DVGB 1P1ZA 1MJJA 5IBLC 4JDVA 2R69A 3V9EA 4LOVA 3MJ7A 5DZNA 3UZEA 1OO2A 1T83C 1E50A 3GUFA 5MERB 3L3JB 3PNWA 4UAOB 3SQBA 5I17A 3BD5A 4FD0A 3R7QA 3VXME 2X0VA 4PV9B 3C6EA 5KSVA 3JZ7A 4MXQD 1B9KA 4H8WL 1GZHA 4HJJL 2ZPKH 5ICUA 4R5TA 5T3XL 4M5TA 1AQKL 1NC2A 1CB4A 3QRLA 4QOKA 4AQAA 1AH1A 4D9QD 1Y6NR 3PWUA 1JAEA 4P46D 4P5TC 5DQDH 4TNFA 3TESA 2CO6B 4D0CB 2PMZA 1RURL 3MODH 1PBYA 1LEGA 3Q6FB 2ZX9A 3F64A 3L2LA 2X6AA 5FM8A 1NOFA 4MJ5A 5JW3H 1VIWA 4FJZA 3VI3E 4E41A 4P2RD 1JFQL 3IRCA 4FQ2L 2EDEA 2X4UA 1P7KA 2KZKA 2A77H 5EU5A 4OI8A 5JLZB 3T3MB 5DD1H 1Z9OA 3VTAA 1GHFL 1M1XA 5IOKA 2YLKA 5FW6A 4WY7L 3UAJD 4ONHB 3VNYA 5CEYB 1C9SA 4UOJA 1W9XA 1TYRA 2LQRA 2CLRA 5KTEH 4DTGH 1NKRA 4HZ1A 5KS9E 4BFRA 1WIOA 3FBQA 3VXPA 3HR5A 4M7ZB 1J1OL 1XGRA 2Z64C 4HBCH 4CMMA 3DURA 4PLKD 2KYIA 2O6DA 2AQ3A 1FNSH 1JVLA 4K9EH 3SODB 5J6GA 5AW3B 1BDYA 5C0JB 4KKBD 3WAKA 4QLRA 5ESAB 4DO5A 1EJ6A 2FL5B 2YK1L 1HL9A 1T66D 5H94A 3S88L 1QI3A 1BMGA 2NSQA 4NGHL 3S3JA 4PGEA 4LKXB 4CNIB 1Q9OB 1EJFA 2NDFA 4FQQA 4PVNA 1UA7A 4WRLA 3OB8A 3B9EA 1JZ6A 1L9OA 3O8XB 3VQ2C 4LP5A 5ID1A 1E4XL 2KI6A 3MV8D 4YX2H 3CH1B 3HLAB 3P3TA 1BOGB 4AQEA 2VLME 3BP7B 4G82A 1ACYH 2HFEB 3BDYH 2B4CC 5EN2B 1IV8A 3MCLL 2PW1A 1OSPL 1HHJA 3PE9A 4Y4FC 5GS1B 2V5TA 1QQDB 1Q8MA 4PIBA 3TBWB 3PCYA 4I3SH 3IJ7A 1MKFA 3GSVB 4HWEL 4U6XB 4KQ4H 4GLRI 2VSCA 5DJ8B 4ZXBC 5B38A 3EYOB 3DRQB 4PD4J 5ELIA 1ZLSH 2OMTB 1Q9LA 1X7TA 2C5DC 1XSJA 3ARDB 4IM8A 4MMXC 3TOPA 4OZHE 3UC2A 5CCJA 1TJMA 1YHPA 4HUWB 4CMHB 2IF7A 2YPVH 5ILTL 4BIKA 3QFJD 4UUJA 3AU1B 1MCNA 4HKZB 4JKPH 5CMAA 1ZIBA 4MMZA 5T1KA 2ERJB 5I6MA 1NGYA 2GBVA 4KJYB 1DFBL 5J6HA 4K23H 3TWYA 3TVMA 3AQYA 1OK0A 4F9PA 4K8RC 3T77A 3RRQA 3GO1L 4XBPB 4NCC2 4XXCA 2EH7H 2OAAA 2J88L 2Q8AH 2MKWA 2P5EA 4EZMA 2OPCA 3BO8A 4YL4A 4OT1H 1WUZA 3SDXE 4XXWC 1BQHB 4ODVL 3WNJA 4R5VA 2X7LB 1Z66A 3IFOB 3V7AE 4RAUA 2DS4A 3UO1L 4JFQA 4ZODA 3BKCH 1X6NA 2QFPA 4OI7A 1KF9B 4HV8A 1OAZH 4PI0A 4QGTA 1F4XH 5IROD 3G6AA 4PJ8A 4D9QE 1C7TA 1QD0A 2R1YB 4FQXD 3LB6C 1OM9A 5JHDA 3HRPA 3QQXA 1RZIA 5IM7A 3VFVB 2QZ5A 2BIOA 3FUMA 1FC1A 3MA9H 1NBQA 2HB0A 2PO6A 3QISA 4KVCH 3IDJA 4O9HL 1I7TA 5G5DA 4PJXB 2EDRA 5MEND 4N2LA 2OYKA 1MCOH 4LP8A 4AM0Q 4WI4A 2GUOA 4P2RE 4M6MH 4OGAC 2I9TB 2Z35A 5GJTL 5ANHA 5HDRA 6FABH 2WTRA 3VFOA 1Z9NA 4S0HA 2N1KA 5C0IB 3IYLW 2OP4H 2OMZA 3II2A 3P02A 3QDGB 3TYGH 3FL7A 1XZWA 2VR4A 3TH3T 1MFCL 1XB6A 3IDMA 3X13A 3FNKA 1UB6B 4XP5H 2YC1A 2QBWA 4QY8A 4GRWE 5AW4B 4EKJA 2UZXB 3SSGA 1KYFA 3WJJA 4PBVC 4FE9A 1QACA 3BPCB 1SHSA 3CHRA 3GLAA 4MA3A 1Q72L 4WNJA 4HW6A 3DVIA 2DL9A 4IIZA 1HHIA 5AYQA 1ODUA 5KWYC 1X6LA 1KENH 2AEQH 3IU4L 1KDJA 1ACZA 4YWGL 1MCCA 1F18A 1YNTA 1LO2H 4G7RB 32C2A 3TBTA 1ET7A 4HXBH 3SE9H 3LV3A 2GBUA 3FU5A 7PCYA 1INEL 4NO5B 2BVOB 5B39G 3V52L 1FO0H 3B2PA 5ENWB