1SHSA

Small heat shock protein from methanococcus jannaschii
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
115
structure length
115
Chain Sequence
TGIQISGKGFMPISIIEGDQHIKVIAWLPGVNKEDIILNAVGDTLEIRAKRSPLMITESERIIYSEIPEEEEIYRTIKLPATVKEENASAKFENGVLSVILPKAESSIKKGINIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a small heat-shock protein.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Heat shock protein
molecule keywords SMALL HEAT SHOCK PROTEIN
total genus 18
structure length 115
sequence length 115
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 1998-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17886 ArsA_HSP20 HSP20-like domain found in ArsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1shsA00
3Q9PA 3L1EA 5DS2A 3AABA 4YDZA 2CG9X 3VQLA 2WJ5A 1WH0A 3N3EA 3QORA 4YL9A 3QORB 2JKIS 3QORC 2Y1YA 4YLCA 4I88A 4JUSA 2Y22A 3IGFA 3EUDA 1EJFA 2N0KA 2CR0A 4ZJ9A 3Q9QA 2WJ7A 2MNWA 2KMWA 1X5MA 2N3JA 4ELDA 3GUFA 2XCMC 2KLRA 5DS1A 3L1GA 1WGVA 3L1FA 4RZKA 4PBDA 4JUTA 4M5SA 4YE0A 4YLBA 3J07A 1SHSA 2RH0A 1RL1A 3GLAA 3VQMA 5LUMA 2BOLA 3AACA 4MJHA 4PCKA 3W1ZA 2Y1ZA 1WFIA 2O30A 3GT6A 1GMEA 4M5TA 4FEIA 3QORD 2K8QA
chains in the Genus database with same CATH superfamily
2Q8BL 4JZNB 3NIDB 1KBGH 3BQVA 4DK3A 4MA7L 2FQEA 2PO6C 3NZSA 2CRMA 3P4OB 1QPPA 5IP4A 3Q01A 4HZLB 4XVSL 3OHXA 4S0TD 4Q6IB 3ETTA 3FN9A 1BFTA 4CDGC 5G2NA 1NAML 1R47A 1FDLL 4MA8L 1N5YL 4Y4HA 3AMLA 2DMHA 1EX0A 5BQ7A 1JVLA 2DQTL 1C1EH 3CDZA 2VQ1A 4WUUB 1A64A 5HHMB 1WA0X 2ZCHH 2VMFA 3HZVA 1BYPA 4BZ1H 4FQXA 5HDLA 5LAXA 1HJBC 1C5CL 3DK0A 1CE6A 1P9MC 4AQ8A 4OI8A 5DD5H 1SF5A 2F7PA 4IOIB 2PXYD 5KYUB 2CHXA 3IJSA 4JUSA 3L3DB 4RGNC 2BOCA 3CXFA 1ECYA 3O3AA 3HW7A 1JDCA 4RAVA 5H94B 5TFSL 3I9GH 1JZFA 3DUUA 3VXRD 5C97A 2FK9A 3ARFA 3VFRA 1Z0MA 3TURA 3IMWA 3NJIA 5DO2C 3D25B 4XNBA 2AP2A 4NZ8A 1QO3B 5DJ6B 2HJLB 1MHCB 2XV0A 4UQCA 4PB9H 4YXKL 4IBVA 2NY0C 1CJYA 1P5VA 2FL5A 4RX4A 1YJDH 3S7GA 2H0PA 2Q2LA 1USZA 2KZKA 4K7PX 4FG6C 5DRZB 2XZZA 3Q9PA 4ZFOA 2PTVA 4O5LH 3IDMB 4U3SA 1KULA 3HLAB 5ITBH 2HLEB 4N9GA 5FM5M 3WY4A 1UWEH 4TM9A 1YPZA 3FN3A 1XSJA 2VW7A 1D6EA 4ZNEE 3B2DC 2H7WA 2NR6C 3O6LL 1OHQA 1S3KH 4OZFG 5FWRA 3RX5A 5C2BL 1TU2A 4HS6B 4IW4C 4YJZL 4NN5B 2V0AA 4AIOA 3L8QA 3WD5L 1UOLA 1J9TA 3MRMB 1NSNL 3P2BA 2YGQA 4LCVA 3MUZ1 3TOPA 4U3SB 4MHHI 4RGMB 5T1MA 3O8XA 5HP5A 3ILQD 4UZGA 2G3ZA 1BJ8A 2PR4L 4XPHH 4PJ7B 3D9AH 3ZTJG 2J6EA 3DBSA 2ZAHA 5D7LA 5C0CD 2O72A 2QMKA 1EBPA 3GMPA 4TRPH 5HDBB 4M03A 1WEJH 4MQSB 2VLKE 1XL4A 1XR9B 2GJZB 1FWXA 4JQIH 1TJXA 2FX7H 2F54A 4GKZA 1KBWA 4YBLB 1QUNA 5DD6B 3KWTA 4GG6B 4Y16D 2XU9A 1NCCL 3VJ6B 3VXTB 1OAYL 1JPSH 5LBSL 1JGUH 5FYJH 5AQ0A 2EZ0C 4MNQB 4K5MA 2IGFH 2IDUA 5EFIA 5ABDE 3FU5A 3G5ZB 3PREA 4M3HA 4OD2B 3K71B 4GRWB 5B4MC 4ONHB 1UCBL 3D85D 3QEGH 3LRSB 2J8UE 4ADIA 4I48B 2W0LA 1FSKC 3LQAC 4G8GB 5GGUB 4WW1B 1AE6H 3KLAA 2V7HA 1BXXA 5K9OA 1NCAH 5C0AE 2UYLB 1SLXA 2P46B 3QGVA 5H2BB 3WEXA 3MV8E 1CD9B 5E95B 3FU7A 5AFAA 4R9HA 5IG7A 2VN4A 1LWHA 4AGNA 5EBMA 2AJYL 3I2CL 3MR9B 1M2OA 4MFHA 3OKYA 4UNVA 3SE8H 2NT0A 2FQGA 5EF2A 4HK3N 3MA9H 3MNZA 1JXGA 5HDWA 1Q9WA 2J5LB 3RVXC 1KXTA 3FJTA 3MA7A 3CZLA 4PJDA 2NPLX 4M4RB 2PWHA 3QUMA 5IB2B 1ORQB 2NW3B 2OL3H 3D33A 5MERA 1DJZA 1J9RA 3U9WA 2AXWA 2BCMA 2D3NA 4M4PA 1J5OL 4HEME 1P7KA 2K9UA 5C0DA 1O6TA 4JMNA 4AMKL 1GGBH 1R9FA 3OC5A 5E5UB 3R0NA 3QEQD 1WFTA 2PR4H 4XPHL 3E38A 4U1GB 1OOWA 3RY6C 4MD0A 3U0WL 3ECBB 4J28A 1ESOA 4HIHA 1YYML 2FE0A 1E9PB 5D1XD 4EMZA 5GS0H 5HY9A 3LKSA 3TA3B 4HIJB 5DUPL 4Q74A 4QWWD 1TYEB 5C07D 2VDQL 4P8QA 3F5WA 3REVA 1I3UA 4A38A 5J8OA 3L3OB 2XXCB 2A73A 1PCXA 2X9YA 2YEZA 3F01A 2A9MH 4G2AA 1AY1H 5ALBH 5DQJB 2C1OA 1DVZA 1UCBH 3FRUB 5F21B 2Z1PA 5CJQL 5DT1L 3CVIH 5CEZL 4RFOH 2HKAA 3NZHL 3ARZA 2P42B 3D9AL 3GSOB 1O6SA 3MRLA 3ZTDC 5E6YA 3SQRA 1L9OA 1GS7A 3A23A 4AGMA 4KK5D 3J2PA 1CICC 4F8LA 2E47A 2J8UA 4GMTH 5G55A 3L3OA 4FCHA 1TYJA 4HS3A 4U1KA 4RMSA 4HOWA 5HI5C 2FR4B 2JLPA 3FCSB 1MFUA 1BZDA 2G60L 4KHTH 3Q2LA 3T6WA 1R33A 1Z9SA 3QISA 1GC1H 4KI5D 3N44F 4X6CA 1ZY9A 2E5EA 1KCRL 1BPVA 1PZ5B 1EV2E 1PLAA 1SLUA 3UTPE 4Z7QE 1CGXA 2OULB 4LF3B 4KMQA 2ZSWB 3H3PL 5GZNC 4L1TA 2YMXL 1V54B 4GO8A 3GBMH 1UASA 3MJ9L 4ODXA 5CKGA 5IQNA 3SGDI 3VA6A 5CD5C 2EILB 4IDJL 1MHPH 1OP9A 2H32A 5GZOD 4AG4H 2XG5B 2ZKHH 5BO1H 5E9AA 5IVXF 4XP9L 2KL6A 2R4SL 1M7IB 3RDJA 3MLUL 3IGKA 2WWOA 4WI0B 1ZLSL 4ENZA 3MRIB 3BEWB 2Y36L 4ZTPL 2WGXA 4PHZA 3EJZD 3VMNA 2Y6TE 2QPEB 4PQXA 3IFOB 5GSRA 2CUHA 2VLRD 3HRZA 1KEGH 3ZOAA 4RMRA 4P5SA 3NUKA 1GSMA 3IN2A 3UBHA 3C60D 2NNRA 5EBWA 4KTEL 4R0LC 1WS8A 4N85A 2R56L 4IOSA 2WYTA 3U1SL 1VKXB 3JWNH 5DLMH 3PAYA 4WSGA 3BZ4B 4G80A 4GI9A 3OLEA 4WQOA 1M7IA 3BESR 3RFZA 1UWFA 3MBEC 4JKPL 2E4TA 1WWWX 1HHGB 4L4JA 3BH8B 2EE0A 4PRPD 4GRLA 2DQUH 1WBYA 5C08B 5F9JA 4K5OA 5KSAD 3T0DA 2I27N 4PW3A 2XYBA 1HKLL 1R3JA 5D7KE 4HSAC 5DJ6A 1VGEH 4OF8A 4U1LA 3VDCA 4Y9GA 3JTTB 4YWGL 2ZWLT 1UQSB 1XZWA 2BZ7A 4IJTA 1DUZA 5DRZA 2R15A 1PZ2A 1T04B 1I3GL 3DX6A 3QUMH 4WFEE 5FYKU 2ILLA 3ARGC 4D0CB 1QSEE 4OCWH 4DQOH 5C0AD 3DRTB 3CQQA 3LPOA 2ADYA 4OJCA 1KPVA 1S7QB 1HNFA 1XBRA 4PD4K 3MSPA 4HLZG 4ZUWB 4OV6F 4X4ME 4YZWA 2RHEA 3S5LG 3CXDH 4APXB 4Z7UA 3C8DA 2E9BA 3ML9A 5EORL 3D7PA 4DPBX 3ZQ9A 4ZSOB 3VFPA 1F2QA 2DYPD 2WP3T 1JV5B 4PS4H 5AVTB 4LP5A 2AFNA 1U3HA 3CWGA 3QORD 5E1IA 3S4SA 2DS4A 2NX5A 2BNQB 1BJMA 1U58B 2A9NH 3KHOA 5DC4B 3DOSA 5JUEL 5FUZH 2F5AH 3GJEB 4HUNB 2EC8A 1OD9A 2EO9A 2IFFH 3EDEA 2BFVL 4Y4FD 4YSUA 5MI0C 2JKSA 3BSZA 3OMZA 5DD3L 1EFXB 1ASOA 3SJVA 1ZOXA 4R7DA 3DTDA 3MJ9H 1E2ZA 2Q2EB 1T21B 1BVZA 1Z3GH 4Z1PA 2W92A 5KSBF 1OTTC 3GO1H 3RQ3A 3E8UL 3QRGL 3VXQA 4YHIA 2CDFB 1FZOB 4PFEA 5EBLA 1ZLSH 1S7UA 1HDMA 2P7TB 3NIDF 4V1DB 3UROR 4XBGA 1YZZA 4PWGA 1AZVA 4WY7H 1G87A 2J6EH 3TPKA 1DUYA 2BNQD 4IEFB 2JIXA 5CM1A 5DJDB 3RIFK 4X6DB 5IM7A 2Z1KA 1RP9A 3OWEA 5D4QA 5IOPB 1F3JA 4JQIA 4N2HA 5CP3A 5CGTA 5CILL 2JELH 1UM5H 2KMWA 1UD8A 3HS8A 4LRIC 3SGEI 4M7JL 1FFPA 3RAJL 3H7BB 2B7DT 4YXLH 1ND0A 2FZ3B 2E46A 3WFEL 1J10A 1U42A 3AMKA 2UZIH 5SV3A 1T1YA 4YHKL 4HSQA 1O5PA 1ETA1 1JDAA 4HX1A 4WU5B 4X4XA 3AVEA 4FFZH 4KH9A 1AD9B 2EIZB 1FFTB 3LKQB 3LKOB 3WJMB 5FYJD 4FQQB 5IM7B 3L1OL 2LR4A 3ARGB 1AIZA 4PRAA 4QHNB 3V6BR 1ORQA 2NW3A 1Q9OB 3TBYB 4K71B 4DH2A 5CFAA 2OP4H 5A2CA 5EU6E 3MX0B 1GZPB 2DQGH 3UJJL 1DVUA 2V5YA 3GXFA 5HGDA 3ZO9A 5HGBB 5ICYB 6TAAA 1MCDA 1I3GH 3Q3GA 4QI3A 3U0TA 4JZJC 3JVFC 3IDJB 3WIHH 1SVCP 2G0KA 5I18L 3A6CH 1T1YB 4LP8A 4TLKA 5IW3A 2WBXA 1NANI 2P5ED 5I6NA 2F7QA 3GI9H 5EA0L 2ITEA 4L18A 2AQ2A 2ZP0T 4UQEA 3PQYB 5DJCB 3FN0H 1RK1B 5E2TH 3VI4F 1NAMH 1P7HL 5D5MB 3AWEA 4W9KC 3MLYH 1WA2X 4IU2B 3MBXH 4UQ9A 2BDNH 2E9GA 4ZYKB 5D4JA 2DQTH 1TPXB 2DQFA 3U2JA 1YO4A 1MWAA 2L8AA 2W59A 3VW3L 1OCOB 2J25A 1A6AA 3F84A 1YEEH 1U3YA 3K1DA 5DQJA 3W81A 1PGRB 3SE6A 2GJ6D 3BSZH 4M5TA 3PJNA 2XV6B 3P2DA 5E99L 5B22A 3EOAA 4Z3JA 3QJVB 3R8BB 4JJOA 4X5WA 4YPGA 1U8KB 2YQBA 3O41A 2ZT9C 2LTQC 5FB8A 4ORGA 2XZQL 3F7VB 3QJZA 4YDJA 2CNYA 4F7CA 4IRSA 4PJFA 4YGVA 4ATWA 2C26A 4MXVF 1OT2A 1BBDL 2EE2A 1FHGA 4Z8FL 4R7LA 1AQKL 5INCB 3B2XA 1G0DA 1MCOH 5F3FA 4CU8A 1ZGLM 3EOYG 4DK6A 4DN3L 3H85A 1F11B 1UXLA 4J7RA 4ODUA 3FCSA 5BQ7B 2J6EL 3P4MA 4JPVL 4JX0A 2HX7A 5KBMA 2A74C 2C7FA 2ARJB 3L1OH 3QH3B 4KKLC 4QRTA 3S5ZA 3KL5A 3MRPA 4JBSA 5FM4A 3T65A 5J12C 1UG9A 1MCKA 3HNSH 5CUSH 2XFGB 5CILH 3BAIA 4GUPA 2WO4A 4AIZB 2WVUA 1SOQA 5I5MA 3O6FA 1M1XA 4AJ0A 3IU4L 3VACA 4UOZA 1BF5A 5FR3A 4YUEL 2SEBB 3VCLA 1K85A 3V52H 1ORSB 3FUMA 3ASNB 4F2EA 1OGAD 1R3LA 1AGFB 3FS9A 1XAKA 3PWPD 4MQXD 2E4FA 4PV9A 5EH1A 3F62A 4X8JA 3MR9A 2C3GA 4NO5B 2NY3B 3U7YH 4F93B 2R0ZH 4JHBA 2PPDA 3PJSB 5T5FL 2IEPA 3HI5L 2FSEA 2P5EE 4R0LB 3GPEA 1DQJA 1JD7A 2J4WH 2JB5H 2OCCB 3NJKA 3WLWC 1E6OL 3DWTA 3DA0A 5H37G 4FYTA 5D70H 1MJUL 4GBXA 2Z3FA 3AITA 1NUNB 2WUBL 3QDGE 1P4UA 3IGUA 1XB3A 3MCG1 5E9DD 3RUGF 3WGUB 3MU3A 3X1BA 4BFBD 2QEJA 3I9GL 4LEBA 1D9KA 4LSUH 4QYOB 4PM1A 3MUHL 5I1IL 1GTFA 2NCEA 4ENEC 3AQYA 1LEKB 1RHHA 4G6KH 5I2IB 2CCVA 3EDFA 4BWWA 1TUPA 1NL0H 4Z7OB 2ETWA 1BZ9B 5HHNA 1MCOL 2N59A 4KUZH 5I17A 4H1LA 4OIFA 1Z7JA 2A6IB 2ADJA 2HT2C 3AM8C 3KCPA 3SDDA 3ZRSA 3BUIA 3D4CA 3LRMA 2WWKO 4XOCA 2EDYA 3NCYP 5C0EB 4KK5C 5I30H 2P52A 5C0BE 3Q1SL 1TTAA 1IAMA 3VWJB 2EXWD 4W9LC 4MJ5A 4HLEA 1U8MA 3N1GC 4ZS7L 3HBQA 1R5VB 4K3EH 5E5MB 5HI3D 3CZUB 3D8MA 1TT6A 4QR7A 5TDPB 4OFYA 3KVDD 3THML 5KANG 5EO9A 5D2NE 3BRFA 5TQ0H 1PLGH 3CMOH 2OXHB 4AVKA 4DETA 2XTJB 3JWOH 4OCYL 4Y5VC 2JQAA 5CWSB 5I1HL 5DS8B 2AV1B 5B38B 1RZFH 4F2MA 1Q90A 1BX2B 3DX0A 1FF5A 3ZTNL 9PCYA 5JLZB 4O02L 1JUFB 2EUWA 5IG7B 3C6LA 2JXMA 3MXWH 4WKXA 5IVZA 2ZX8A 4C83A 3BLPX 4Q9RL 2QSVA 2XZCL 4QLWA 3SO5A 1RZGA 4JQVC 2JB5L 1UKSA 1GOGA 4Y4KD 1CLYH 5T8IA 3OPZL 4LHJB 3QA3B 3BXNB 4LQFH 4TNEA 4D7BA 2ITFA 4DVRH 2WZ0A 3QCUH 4LO9A 1RJYB 2Y7LA 5GZOC 5JDSA 2DBJA 3L5JA 3DO3A 4HZAA 3EOBA 3ULSA 1R3KA 3G7TA 2AEOA 2X4UB 2MTPA 1F8TL 1NDGA 5SX5K 2G2PA 3TH2T 1XGQA 1KCWA 2H32B 3CDZB 3HG5A 2NY4B 2IH9A 2YA2A 4MD5A 4O00A 1RFDH 4V33A 4WNSA 3IS1X 4NCDA 2ATPB 3FFOA 1J1XL 2YUWA 3WO4B 1P2CA 2VR4A 5EDXA 2XA8H 2QHRH 2EIBA 3HE7D 5F93C 1C5DA 5EPMA 4C4KT 1D2OA 3NIFE 3FPXA 4N9GB 1SQ2N 2P26A 4AT6A 3PS6A 3V5HA 4ODTL 2JTYA 1AXTH 3AAZB 1RERA 3SO3B 4AM0A 2VL5A 4BRVA 3H7BA 2K45A 5J4MA 2YD2A 5C0CA 4YLBA 4HKJB 3GYRA 2Y5TB 3I6GA 4CVWA 1IC5H 4NN5C 3NFSL 3L13A 3C08L 5CEZH 1CBVH 3HNVL 4OM1L 3OQRA 5E7FA 4HX1B 4M02A 4NUJB 1LO2L 5TF1L 5D8JH 2HJKB 1PY0A 5IQMA 2EIKB 1J0JA 4UQ3B 2VN3A 1HT6A 3NACH 1RUQL 4AITA 2ZUUA 5JQ6H 2AKRA 4L4VD 2VZOA 4XP5L 4UTAL 4YSCA 2XTLA 2RR3A 4MYWB 2WB7A 3CG8A 4LDCA 2I5YL 4PGZA 3T1FA 1TVHA 4N2KA 3PWLA 4Y4KC 2DEWX 1I7RA 1C5BH 5L88L 1QFPA 1MI5B 2ESVD 4WW2F 2CUIA 3MUY1 4FQPA 4JDTL 5L2JB 3BGFB 4HJ0C 4BSWA 1HZHL 1E4XI 4GS7C 7FABL 3NRFA 3QAZB 4LSTH 5I1HH 5INDA 4F5CA 1NEPA 2F19L 3FU0A 4R26L 1S7WB 3H56A 3WXVH 15C8H 5IB3A 2R56H 1HIML 2JSFA 3JBG7 1OSEA 3HLKA 3RWCB 3VRLE 4H26B 4MCZA 1LHZA 1M7UA 1AGDB 3NESA 4M8UA 1WC7A 4RGMC 1CS6A 2MNUA 2HSIA 3CN4A 3HE6B 4K3JH 4A37A 1BHGA 3LQAH 4LL4A 1CLYL 2EH8H 3FRPB 4UINH 2VUYA 2Q6WB 2Y36H 5J6SA 4N2IA 1OP3K 1LE9A 4N8VA 3QG7L 4N0YL 3GSNL 1IKFH 3WHXB 1F6AA 3G5ZA 1XR8B 43C9A 5DTFA 3X3FH 4LMQI 1D5IH 1I9RH 3HOGA 4Y16A 5IW6A 3SDXF 4WVRA 2IOIA 3VD2A 4JFDA 3RKDC 4A2MA 4WWKD 2YD3A 3O3UN 3GSRB 2XZAL 1KJMA 2MTAA 5F7HA 5FOBB 4OFKA 4P49A 5BMFL 5I0XA 2V2WB 3PGFL 3S36L 3HI1A 5A2JH 3T0ED 3T3PE 4XI5C 5IQ9A 3VRIA 5GS1B 3MJWA 2VXVL 4TSCH 1BQSA 5D72H 2XJLA 4JFDD 3VGEA 3VFUA 3I3BA 1JNHB 4LAQL 5JHDB 4G9FB 2BO0A 3RPKA 4BH7A 1ZVSB 4UANA 4TSAH 2K4AA 2CGZA 3D4YA 1NOFA 5KS9F 4ZJ9A 1JXKA 3BVVA 5SX4H 2VW6A 3ZGIA 3KPOB 3CZGA 3NA4A 4BA0A 1OTUD 1KJ2H 1CFQB 1CXIA 4LHUA 1KCVL 5SWQB 3KS0H 1NGQL 1TQSA 5GGSB 2APVA 4NKIL 4H2AA 4E9WA 3HG1B 2XBTA 2XRAL 1RIHH 4UQIM 2A9DA 2YPLE 2PNDA 3O2DL 4RAHA 4OIIL 1IT9H 2JVUA 4U1IB 4WV1A 3RDTA 5EUOF 2FIKA 2VR6A 2VUOA 3SBPA 3G04A 4IGBD 4WU5A 3CN1A 4ZXBB 5DK0A 4A63A 3INUL 3DOHA 5EORH 4YBQD 1XBDA 4GFXA 3RKDD 2CM5A 2KT6A 4UMGA 1I8KA 1U3ZA 5LQBH 3C9NA 4L8SB 4M3JA 2PO6D 1QTPA 2A4ZA 3STLB 3CNKA 4D0BB 2XT1B 4HWZA 4MJHA 1PKOA 1SDAB 3TONA 4PJ9C 3UTOA 3OWRA 4L3FA 2VGLM 2AGJL 3L6FA 4HXBH 5GZNA 3UAJA 1BZ7B 1MY5A 3N40F 1I8AA 3LRLA 1HHHA 2YWYA 5DK0B 3IYLW 2IANB 5GGRY 1QASA 1X3DA 2VQTA 4GT7A 3LX9A 1D9KC 3UYRL 4YHLL 2YARA 3A5VA 1GHFH 1CFTB 2F7IA 3T8XB 2DWDA 2HRGA 2JCCE 4JFQA 4LF3A 1BVKB 3SBQA 1MCRA 3QQ4B 3STBA 5I0VA 5D72L 3S48A 1ZCRA 4FMKA 3DX7A 3FTVA 3AREB 1F86A 4K5LA 5J3HC 3MUJA 1ADQL 3U46A 2Y5EA 4MD4B 1A1OA 4BGLA 2NW2A 5FS5A 2DM2A 3UAJC 5JPMC 4K94H 1AY1L 1PF3A 3FQNB 2XICA 3U4BH 5FF6B 3GMOB 2IANA 3GBEA 1JCVA 4LDEB 5CZVH 3T6XA 3WFCL 3IBOA 4GKNB 1G7QA 3PUUA 2AQRA 3DVFA 3OKMA 3VO0A 1AMXA 5AVSB 3UC2A 1AO7B 1X9LA 4X8CA 1NPUA 2W9DL 2NXYC 3MUUA 4YDIL 4YHML 4MXWH 2IAMB 2WLJA 3FTWA 1GRWA 4NAQA 1OGTA 1K4DB 3BIKB 4BK8A 4E9LA 4WEMB 4A7VA 3VNZA 5C7XH 1CCZA 1NKGA 1OZUA 2JKXA 4YBQC 3GZOA 2C7UB 5C70A 4MJ6B 3MLVL 4MHHG 4JO1L 4NSKB 4EVNB 3BWAA 4PJBA 2F61A 1T22A 4XO8A 1AC0A 1IIIA 2V4LA 1FGNL 4GUPB 5J0BA 1LO3L 2OSWA 3QDJE 3NJJA 4F7MA 1ZA3B 3FMGL 1PLBA 3CHOA 4P9HL 1PZDA 3ZY7A 3ALXA 5C3IA 4B5EA 1P1VA 1YG9A 1ULVA 3QYCA 2ZCLH 1ZAGA 4HOZA 5D2NB 1UQSA 1WQVT 2E8YA 4MQ7B 3FAXA 2EVJA 3IJEB 4QOKD 4F27A 3CDYA 4XB3A 4YHZL 5CN2A 1GR7A 5HHQB 3VXOA 1CDIA 2NX5D 3KBHE 4D2NA 4ZT1A 1U8OA 4R3SB 5KSUA 2IBZY 4JHZA 5T1MB 5KSVB 4UV7L 1X7TA 3KL3A 1E4XL 4O02A 2VDPL 4YHKH 5GRXG 5C08A 2NOYA 1VJSA 2NUPA 5HSFA 1IVTA 1UZ6E 3ILPB 2H6PB 3VXPB 2QGCA 1KELL 2D73A 3O9WD 5H35A 3FUIA 3CSFA 1ADQH 3HPJA 1FHNA 4E0RA 4JHAL 4X7SH 4FQ2H 3BP5A 4XX1G 5EF0A 1KEGL 3AXHA 3RTQD 1UVQB 4M1DL 3WUZA 1A7NL 3N42F 4HF5L 4Z7OE 1UH2A 2RACA 2V6HA 3EGDB 4OCXH 1HAUA 1KLFA 4IBLT 4PJIE 3DX6B 2AK1H 2WKGA 3LH9A 2OBGA 5CGYC 3VYPA 3GSWB 4TTDC 3U7WL 1TZGL 5KS9B 5AVQB 2V9RA 5DD1H 1NUGA 5IROC 3WN5C 5BS0A 3GMMA 4Q8BA 1OAJA 1MW1A 4U6VL 4Y4HD 4CNIB 2B4CC 4JPKL 3P30L 2H1PH 3QG6B 4P99A 4X9YA 2Q7NA 4JJHA 1ILSA 4MX7A 5I1GL 3DX9B 2QSQA 2UXVA 4YQXL 2QZ5A 4TS6A 4P9ML 4GNKB 3EHBC 4H20H 1QMUA 3C5ZC 4Y2OA 4Y4HB 3AG4B 1PTZA 4WHYH 1P69B 4DFIA 1VSCA 1NBVH 2ZAGA 4KMTH 5KTEL 1A1NB 4OF7A 4BWTA 1H0DA 2YAHA 3BISA 3HC3H 3CUPB 4BQBA 3IMSA 3U2IA 3U6RB 1L4IA 3S2CA 4TOYH 1F3JB 4WV1C 4KHXL 3FOLB 4PIRF 1KV3A 4P59H 1PX8A 2XKSA 1J5DA 1TSRA 1G7IA 3OKKA 3CFCL 3D25A 4HCFA 3GMLB 3L7FA 1KIPA 3CK0L 4YHNA 1WT5C 2O5ZL 2XYCA 1IE5A 4JFSA 2WN3A 4O58L 1TQUA 3M17B 4FQIL 4WTZG 1NEUA 2P7TA 3RX7A 2VSCA 4FTVA 5E94B 3JWNE 3COOA 3P2TA 3LPGA 1U8LB 1UH3A 4ZFOB 4CSTA 5GGTL 2NLJB 3VD9A 3HVDA 5DRWA 2RTTA 3VRJB 4JO4H 3BAEH 1A8ZA 1GZQA 1RIUL 4IU3A 4LOEA 3MLXH 5GIRB 4AV5A 2HXAA 4Y4HC 4PGCB 1L5GA 2BRRL 3KJ4B 4HCRA 2A5UA 4FULA 2I60H 2DLFH 3EXLA 2F0CA 4AK2A 5K9OB 4MCYB 1FZJA 2A9CA 1VCBC 4PY8I 1IAIL 2JFCA 2LLNA 4GW1A 3WDIA 3Q7JA 3KCWA 1OARL 2AHIA 1CWVA 2WKOF 4X6FA 1YECL 4HS8H 2PN5A 4HDIA 1E4XH 4OGAC 4LVNC 3HIZA 2GY7B 3F7PC 3RBSA 5J06A 1S9XB 1YEIH 2EXYD 4N5UA 5I8KL 1BM7A 4JDVA 4WEBL 5EN2A 3MGTB 5DK2B 5GS3A 1I8MB 2Z93A 3JYBA 1IM3B 3MRDA 1A6WH 5E8DL 3RIAF 3X12A 2E9WA 1WTLA 2FQFA 2P48B 2ZUYA 4PLNC 5KOMC 4I1RA 3TS8A 3K8KA 4PJCB 1YY9C 1D5BA 3U25A 4P48A 2DYRB 3UTTE 5JZ7C 5LN8A 4GW1B 1E2WA 3JXAA 5JHDD 1MNUL 4KNSA 2BHZA 5AW7B 3LNFA 2NR6A 2N56A 1QBLH 1QHOA 4LRNH 5HBBA 2A0LD 2BIIA 1SXZA 4LSVH 4DEUA 3CFCH 4C57C 1KCSH 4LHQB 5EV7A 1NAKL 1BQUA 4TUOA 3ZE0F 4IRSB 4OD1H 4PLOB 5T3XD 4TVSa 4PWJA 1T7VA 3F5WB 3PXHA 3R06A 4NENA 4JUTA 4HUCA 5C6TH 2DQCL 5F7YC 1GPOH 4XNXL 2DBLL 2PP8A 3PF2A 4JREB 1JI1A 2WVVB 4R8WH 4AI7A 1NIAA 5C0IA 1IL1B 3UIYA 1AOHA 2V2XA 1FNGA 1R1CA 3QUKA 5AEAA 4FQXC 1SXCA 5GRYA 4TUKH 4ELKA 2BWIA 1GC1C 1UKQA 3QDMA 4XWGL 4JY4B 4JRXA 4RIRA 3NJGA 2LV4A 1QWHA 2HRPH 4H8WL 5T3ZH 3B5TA 1JN6A 2P5WD 3TYFB 5JXEC 3HRZB 1EEZB 1I1AB 4X0KA 3WNNA 4YSSA 1U0QA 3CE1A 3HAEG 3RWCA 2J1ZA 3IMUA 5B3JF 1CPUA 4D9QD 2J56A 5FYKL 4ZXBC 5BQDA 2OMWB 4X9IA 2A6JB 3AFLA 3UBGA 3U6XA 2ZJSL 4GI6A 1UB5A 4M5YL 1AGCB 2WBJC 3BZ4A 4G80B 4X6DE 5EWIH 5JHAA 3V7AG 1JF5A 1O7VA 3ARDA 1RZJC 2AJZB 3HHMA 4G8AC 3TBTA 3QZOA 3WY2A 3MBEA 3T4AB 4NNYB 3Q6FA 4UU9A 4B0MB 2HTKC 3FO9B 4GRLC 3VH8B 3OR7A 4X42A 1CFVH 1ZV2A 3CGTA 3UC0L 1Q9KA 4KOBA 5DC9B 2EE9A 2YKKA 5J1AA 3IXTA 3P0GB 1MUJB 1KJ2A 3QEHB 5D5ME 2HT4C 3VGDA 3GD1C 2DIBA 4OGYH 4G1MB 4P2CG 1JWMA 4I7ZC 2IH1B 3PQYE 5DCCA 1D9KB 2MRYA 5F2FA 3TJEL 3MV9A 3FTZA 3VXRA 4YSQA 4LSVL 5C8JB 2BNQE 3ZZLA 3FRUA 3L17A 3AT8A 5KBNC 2XN9D 1DBJH 5FW8A 2YMOA 3VFUB 4EAEA 5I2IA 1NUFA 3G6JB 3EIFA 1BFVL 1HC1A 2OMNA 1I1YB 3NIGF 4X6CE 4L23A 3CVCA 5GJSH 1RUPH 3FQRB 1KDJA 2P4AB 3MV9D 1CD1A 2Y06L 5FO2A 3Q13A 4AM0Q 3BKYH 3ESNA 2HJLA 4UTBH 3BC9A 2WSPA 5HHVL 1BMZA 5KW9H 4WWOA 5KYWB 3WLBB 1DVFC 3MFFA 3EYUL 3LH8A 3FCTB 3ZL4L 1X9RA 2VABA 4IIQB 1CDUA 1SYSA 2BSTA 3F6IA 4EUPB 1QFWL 4PV1C 2VZUA 4DGIL 4GEIA 4X5XB 5FCSH 3RWHB 1RHHB 1CD8A 4R26H 3WXVL 3KPSD 2IMMA 4LLYB 1F4YH 2J12B 2ZOTA 1G0YR 2EACA 2ALAA 3MRHB 3ZE1F 2OV0A 4JRYD 4X9HA 4BE6A 1CB4A 2YC1A 3RWEA 3QXAB 5CBAB 4I3RH 3AXLA 3L16A 1B0GB 2BP8A 2B5IB 3FT3A 2DEYX 4K3GA 1IFHL 4HUMB 3DXAE 1CDJA 4O2CB 3LPFA 3P02A 3OAWA 3Q5YA 3NBNA 1EHNA 2OXGB 3BQUB 2VRKA 2XN1A 2W07B 3CHQA 5EBLB 1BXVA 1P7QB 1WDAA 4YX2H 2JJWA 4S1RH 3LVTA 1E2VA 2IH8A 3B6SB 1OEZW 5FOJA 4ZDHA 4C8XA 3IDXL 2O4EA 7PCYA 4FFTA 5E4IA 1HXMB 4PP2A 5DJZA 1TEFA 3BVNB 3E8VA 3QO0B 4Y4KB 5DVMA 3MV01 3G9VA 5K93A 5EF1A 5E2UH 4F7TA 2ICWI 3OF6D 4NZUL 2YXVA 3GMNB 3Q2CA 2N7BA 1NCDL 4UT9H 4YHYC 3F3HA 3EDDA 5DUMH 3BAYA 3MMEB 4R83A 3H53A 2DWDB 4JN2A 4A7GF 1IGIL 1X9QA 2G3MA 2J71A 1WF5A 3L3HA 3NFNA 1JK9B 2Q8AL 3BKMH 1OGAE 1MVYA 3C87A 4B9FA 5FDWB 5FDYA 3UL4A 1GYAA 3GT6A 1U8QA 4JFED 5HJBA 3V4VB 3LIZH 1GA2A 3QJRB 4EIBA 3RZCB 1SEBA 3B7TA 3ARPA 4N6QA 4U6YA 2O1AA 4XCNB 4M5ZH 6PCYA 4WW1A 3UMNA 4FNUA 5JYMA 1ECZA 1EQWA 4OZIB 4JB9L 1O6VA 5HYJB 1CFQA 5FWQA 1UD5A 2Y72A 1G9NC 3MYZA 1EO8L 3WO4C 1D7CA 1MRCH 3CFBA 3KEDA 1KJ3H 1DEDA 3QFJD 3CH1A 5DT1H 2IBZX 5E00B 1YEFL 1AQDA 4UUJA 2YEQA 3RDTB 4MMYA 4U6TA 1JHLL 2P8PB 3D1MC 4X7EC 1A6ZB 1M6UA 1NEZB 2NY5H 3V6ZA 2AJ3A 5GIRA 1I1CA 2BVPB 3V0AC 1E8ZA 3H8NA 2CCLA 2OJZL 3PDOB 3OKDB 4ZODA 2R59A 4U1HA 5DS1A 1QLEB 2L7UA 4OSUL 3WUWA 2WQSA 4IRJC 1YC8A 4KGLA 3RL1A 2QVKA 4QRUB 4C4KO 7TAAA 5IGXH 2VSKB 1YEGH 4OLZH 1KB5B 4PRHA 2ZPKL 1L0XA 4HAKA 2HUEA 4WNQA 2JI1A 5C07A 4KITB 5HDQH 1V7ML 2N7AA 3RY6A 4E9XA 1V8HA 3MNVA 1HKFA 3UTSE 3WXWL 4FHKA 4AQ1A 2XRAH 2OZNA 4HIEA 3MGAA 3NGBB 1DEEA 5C3TA 1BJ1H 4NRZB 4LNVA 3CFKA 3KM2A 1B0WA 4FFYL 4OGZA 4WTWA 4GXVL 2O5YH 4OB5H 3MLZH 4KRLB 3P11L 2VMCA 2NZIA 1AGEA 2B59A 1WK0A 4P57A 1MFAH 2BS8A 1T0NB 3SO3C 2FEDC 4Y8DC 1BDYA 4N2DA 3IJYB 4P23A 1G6RL 2CDFA 3U46B 1LTXA 1RKRA 1TZHA 1TTFA 1ZDQA 5C0GB 3QDGB 1AQHA 1YN7A 1EDHA 4UT9A 1ZS8A 1AJ7H 2DLEA 2YD8A 1BAFL 5AB0A 1X7QA 4N2CA 4MBRA 4H44C 3ELAT 1DL7H 8FABB 3NIFF 2NY4C 1TJHL 3QPXL 2HVJA 3U48A 5BS0B 5DA4A 5DJ8A 1MZZA 1VENA 2FHBA 2AXFA 4TULH 3KXFE 3IMTA 2QQQA 5GRUH 3T77B 4PRHD 4J4PA 5F9OL 4L0YA 1FFPB 1T7ZA 3SE8L 1S7TB 4NQDA 4XHQA 4ENED 2YXWA 3N1PC 3WLWD 1PG7H 3BAJA 3LNDA 5AOJA 1TJGL 1QVOB 1R5WA 3B2MA 2CMRH 2QHLA 3TO4A 4X6BB 2ODHA 1HK6A 2C4FT 5D1XB 4PUBH 3QZBA 3GC3A 4XODA 4KKBD 3DUHA 5GXBB 1CZ8L 5IHBA 2ARWA 1KNOA 5GGVH 4M8VA 2WLMA 1NJ9A 1AZUA 1AS8A 1IQDB 3GQFA 5IV2B 4X8XA 4FE9A 4EIUA 4JG5A 5LGHL 3S34H 2GJJA 2KDGA 2PO6A 5LCVL 5EZLA 2VDLL 1XIWD 4XTRC 1HZLA 1NQBA 2CO7A 3Q48A 4Z7WA 5I8OH 4OLVH 1IGJB 3OHXC 1XGTB 1WEJL 4G7YL 3KLKA 4ALAC 3VH8G 4JRWA 2A3TA 1DE4B 3D52A 3QJUB 2NY3D 3OKOA 3P30H 3SDCB 5D1QD 4ZXBA 2EYRB 3UTSD 2R0WL 5C6WH 2UZYB 2OW7A 1DCEA 3CU1A 4QCIB 5FCUH 2VLME 1VLXA 1T80A 1GYVA 1UWXH 1YY8B 2X09A 3G5WA 1RK0B 5LBGA 4E0RB 2IIJA 2JI3A 3P0VL 2SEBA 2OR7A 3B3IB 2N0MA 4FQ1L 2LVCA 4QRRE 2AITA 2IDCA 2FEEI 1WD8A 2A74B 4RMTA 2FRGP 2D7PA 3ZPDA 4OCSL 1GTNA 3TFKC 5L2KD 4PJ5A 2F5BH 3BPLB 4FKEA 3SODB 4RGOH 2E6QA 1BZ7A 1QABA 3G6JA 5DI8B 3HS9A 2APXA 3U2SB 4WGVB 5EU6D 3A0OA 1KTJA 4G1EA 4WHTA 4YNYA 5I74C 3QRGH 1P4BL 1EO5A 4IHOB 4ES8A 5HYIA 4PMEA 1JP5A 3KYAA 4TUUA 4BFNA 2BX5A 3BN9C 2BHFA 5J9PA 2A73B 5MEQB 1RPQA 4PUBL 1TQCB 5IEHB 5I28A 3GSQA 1F1AA 3HE7C 3Q8BA 4PRBA 1JPTH 5K39B 5CJ8A 3MRBA 3DTUB 3FO2A 3GB7A 1TPXC 4TL4A 1E7VA 2QELA 2EDQA 5JR1L 2ENPA 5FO9B 4NN6C 3ARRA 2C5DC 4R90L 3UPAA 3V4PA 4RWYL 2GW5A 1YYMH 2LFEA 3MVSA 5GS0L 5TQ0L 4Y4FC 2IDTA 2VLLA 2XWTA 3WJLA 4A2HA 1PDKB 2J8UB 4B6ZA 3GHEL 5CBEB 5ELIA 2WBJA 3QRBA 3VGAC 3PHAA 2NY2B 3D5OF 2W38A 3EJYC 4TNFA 5E56A 5FYJE 5C0IB 4B7LA 2XUWA 4A2LA 1K6QH 1X5KA 4X7TB 3UOAB 4AWJC 1K3ZA 2QVIA 2Y9RT 4PGDB 5HVWA 5DJXA 4PS3A 3LN4B 3VXNB 5AG8A 4HMCA 5E2WH 1I8LC 1J5IA 3HI6H 4LGRB 5CF3A 2WBJD 5I73B 3D3VD 4J3BA 2VLKB 5DFVD 4JN2B 4WFFE 5CCHE 2FBRA 1MFEH 3H9YA 4V1DE 2NUTA 2ZICA 2HKFH 1T20A 1AHKA 2Y6SD 5L9DH 4AEFA 8PAZA 4E9QA 3DARA 5JA9A 1YRKA 3TFKD 4GG6F 3WS6C 1HYSC 5I0WA 1WFMA 3GI8L 5I23A 4A04A 4XH2A 3WFDH 4TNVK 1P4LB 2BNRD 4CMHB 3GM8A 4NQEE 2H26A 1KCKA 2LU5A 3LN4A 3NP3A 4BKTC 1M7XA 3SDXA 3KDMB 1ONQB 2JJUA 4MKTA 3AQZA 3QDJD 1KIQA 2OSXA 4EI5C 2YIHA 4OZIA 4KZDL 5HYFA 1JAEA 4HJJL 3ILEA 5JOPE 3VG0L 4DZBA 4N22A 4QY8A 2X10A 2F9BT 1JYVA 4U1SA 3H0TA 4A55A 2LQRA 3N0AA 1XH3A 3KPLB 4KMLB 1XGPA 3O9WA 4XP4L 1D5BB 1OE2A 3D3VB 3MUGB 1OAYH 1XMEB 3F58H 3QZPA 5CZXC 5D7EA 1SQMA 3QW9A 1AQDB 4ZSOE 3K6DA 4KI5F 1UZ8A 1UWYA 2TRYA 3KWXA 2IWGA 1SN5A 1FAIH 4FXKB 5CJOL 1N67A 3HBGA 1OZTG 3ELQA 4FMFA 1BMGA 3K81A 1ES0B 3KS0J 3SSGA 5DUBB 3QUXD 4MKMA 3W37A 2PUQT 5E2JA 5A7BA 1I9EA 1OB1B 2RJMA 3JT0A 2WCSA 4JDEA 3VFGL 3U0PB 1WTGT 1UT9A 2TAAA 4F7PB 1MOEA 1T1XA 2ICEC 2YR3A 2A83B 2E27H 4NQCB 1MIMH 3CXHK 4DERA 2BSSB 3MUGA 3O6KL 5G4MA 1HJCA 2X9ZA 2B4CH 3FFDA 2D3JA 2BWDA 3IFNH 2KH2B 1S9VA 3SOBL 1QOKA 4EKJA 3ULUH 4F8TA 5C08E 4EUPG 4WRLA 1UXWB 4N2NA 2C4FU 4Y9CA 1KUMA 1XF3A 4H8VA 4JCLA 5I6OA 1URIA 4KKAC 4YUEH 1PY4A 2AJXH 3EYVA 3FSOA 5EBGA 5BOJA 4QF1A 3AZUA 2DI8A 1A6PA 4X50A 3WJJC 1RZQA 1FNLA 1SHSA 1W0WB 4XX1E 2UYLA 3LHAA 1AXIB 1C7TA 1TVBB 1YDPB 2ZSVA 4YHNB 5IQ9B 2F54B 4GKZB 4LB8A 5FLUA 1PAMA 4MAZA 4JM0A 4NRYB 3U36B 4FYSA 3N0PB 1C08A 5FKAA 1PIFA 3KJ6H 4C4BA 2ATAA 5DUPH 1AKJD 2MIZA 4O2FB 4LCWA 2ICWB 3ARBC 5F96L 2X4SA 3C6SA 4N20A 4Z76A 1IU1A 5E9DE 4AIXA 2FUTA 4YDJB 4I3SH 3BZFA 1FLRL 2BERA 4AKOA 4NUMA 1J9QA 3OAZK 4F15C 1D5IL 1I9RL 2YZ8A 2CKBL 3LPWA 2F1BA 5I1IH 3SGEH 4IKLA 4R6UA 5GGSA 4XMUA 3DGDA 1KLUB 4PIBA 4HW6A 4X9GA 2MNJB 4EN3B 1GMIA 2Y69B 4UM9A 1MJ8L 1Z5LB 5E8NA 3PP3K 3PWVB 4MA8H 4LPWA 2V37A 1TCMA 4FFVD 1JTPA 3JYCA 3EFFB 3WSQL 3FULA 5TE4L 2VM3A 1V3JA 4NN7B 1U3HC 3QHZH 3UZVA 1CVRA 2R4RH 2QT6A 3M1BA 1C5CH 1XO8A 4PCYA 5E1AB 3TVMB 2W81C 4JO3L 4NHCL 1GS6X 4D9RE 3U7AA 3GZQA 1F00I 4AV0A 5AW8B 1RPKA 4RDQG 2OR8A 4YR6A 5I18H 2ZYSA 3S5YA 5GGRA 4ZS7H 2HLAB 3WTTA 1T2QL 4FQHA 2Q87A 4MNGB 2IQAB 3ARFC 2WXOA 4KDTA 3S96A 4OV5B 1IV8A 1IM9B 4FQIH 4KI5E 5ANHA 1X6LA 3TVMD 5DHDA 2BZDA 1R46A 3EFOA 3L48A 4L3EE 5CXPA 5IMKA 3TZVC 3TT3L 2FSEB 4R0LA 3M46A 1PNCA 4WUKH 3RYMA 1GGIH 1ZD6A 1IT9L 5TK4A 4MCMA 3CX2A 1TZOA 5E1GA 4MVBC 4H8UA 4JFOA 3RLSA 3IXAB 4WI4A 1YVLA 1VFAB 4BELD 4AUUA 4ZFZA 3K2UH 4PRHE 1KTDA 5GISH 4YR6B 4JFDE 2QBWA 1XFPA 5EDSA 2R0LL 2NT1A 3ZKSD 1C7SA 1MDTA 4AUJA 1P7QA 1PNDA 3MV8A 4YEFA 1LE5A 3MLUH 2OQJA 1KYDA 4KXZH 3V4LA 1ZHKA 1WWCA 2R2EA 3GJFB 1AG0A 4Y8AA 4AGQA 2Z4TA 3AABA 5HPMA 3RNQA 2GK2A 5DMKB 4JFYB 1JZGA 1VDGA 4AQ1B 1XR8A 3IGAA 1YEHL 4Z78A 1I9JL 3JTSB 3LEYL 2FX9L 4JGJA 1AI1H 4Z7AA 1KEML 4PS8A 2EYSB 3C5SA 4AQ8C 3CCHB 1F3DH 1LQBC 2NNXA 1NBZB 1WGVA 1YEFH 3QZLA 3VFNB 4DGYL 4XCCL 3LKNB 4HKXA 2E74C 5D9SB 5ADPH 3MROA 3RJDA 4GP8B 1RULL 3VWJA 4W93A 1S3KL 5DFWH 5I0YA 1ZHLA 5D1XC 1GS8A 4DNLA 4PJGF 4ZUSB 4EXKA 2R2EB 3TEYA 5LKNA 3GIZL 3IJ8A 3O9WC 3MZTA 4M6MH 4GW4B 4J8RB 3BRDA 4WO0A 4POUB 1MQ8A 3BAXA 5F7LB 1EJOH 1JFQL 1GW0A 1X6NA 4LLVA 3C5SB 4B9YA 3VM5A 1T89A 4F2MB 4P2AA 1NAKH 4QXGL 4ZAKB 2HMIC 2E59A 1ODAA 5AWNH 3DHUA 1QI5A 5KEZA 2L7QA 1JWMB 2VXTL 5CAYB 1QBBA 3QUML 1I4FA 1IGIH 2IG2H 5C0AB 4WDIB 4CBZA 2KDYA 3UX9B 1HSAA 2IQ9H 2H3XC 4JS7A 3RY5A 3UYPB 2K7PA 1F1GA 1INQA 3S4SG 2VDQB 3I02B 1J0HA 3E2HB 4I2XE 2XN9A 1SHWA 4N0YH 4MAYC 2AI0H 2OK0H 3IN0A 2NUTB 3JWNC 2VH5H 2A9ML 4N0RA 2JNZA 2ZKWA 4OLZL 5T1LA 2NSMA 1I9IH 4OZHB 4WU7B 4DP5X 4RDQF 4GAGL 1NDGB 4EXPX 4G1MA 4WHYG 2PW1A 3QS2A 5FFGA 4X6EB 4X5LA 4H1LH 5HDBE 1AGFA 3HHRB 5ERWB 3U4EA 4F20A 3QJQB 4FLHA 5IF0B 2YUZA 4S0HA 4IIQA 1JNLH 1UD3A 4GAYB 4YE4L 3RGHA 5C92A 1BQLL 4XN7A 2F19H 2X2JA 4HHAA 5DHVH 4P5TD 2COVD 5F44A 1RJCA 3TA4D 3T4YA 4U2ZA 4HUKB 2Y7QA 1T83C 5F9JB 1DVSA 3FQRA 3OZ9H 4NT6B 3HR6A 4F9LA 3GXUB 4HK0A 2GITA 4DZ8B 2NY5L 3L1FA 4H40A 3RTQB 5F3BB 5LNDA 3LDBC 2P9RA 4BFKA 2H8PA 3BHBA 3RGVC 4Z0XA 2VM9A 4TQ8A 4TQPA 3TESA 1Y6KR 1ZTMA 5A2AA 2CJTA 3HE7A 3UGXA 1M7DA 3D85B 1FG9C 6FABL 3IJEA 4RFNC 1VESA 2FJGB 3MV7B 3P9WB 4XAKE 4G7QB 5D1ZC 4B97A 1N3NA 3N3EA 1PKQB 1A3ZA 4XPAL 1EZUA 2FD6L 3OKLA 2VIRB 1ZLUH 4M7KL 2DI9A 1DQLH 3GMNA 4Y1AD 3BW9A 3II2A 3WXWH 1YPZB 2H6PA 3K0WA 3VXPA 2LE9A 1UEYA 1NM4A 5T5FH 4WENB 4BZYA 1I8IB 4LLQB 2EXTA 4L1HA 4ZPTA 1MHEA 3QIWB 4KFZC 5J9PB 3VXQB 5I1JH 1N6UA 5K59F 2EEAA 1P0SE 3QP3A 1D7DA 1HINL 3GSQB 5L8LB 3HFML 5ICXA 5BW7C 2AVGA 1J1OL 2WAQA 1JWSA 3BVNA 1MAJA 2OMZB 1CZ8H 2OTPA 4MMZA 1E50A 4CN6A 4L8CA 5LB1A 1B4RA 3DC0A 3SDCC 4IOIA 2AGJH 3WHE0 4U6YB 1UH4A 3CHPA 1XV8A 5AYTA 2X6MA 2D4DA 3CN3A 4LLMB 5K9KB 1KWGA 5FUCC 5LCVH 5IV2A 4MTMA 4G42A 4XMPH 5MERB 5JZ7D 5KN5A 5KZCD 2YD1A 3L5IA 4MXQC 3ECWA 3HE6A 4HH8A 2Z8WC 3FH5A 2V9QA 3RU8H 3OKEA 1MELA 1SF3A 5TPWL 1SJEA 2PPAA 1F6AB 4XMLH 5A2BA 5JMRA 5TFSH 5C09E 3FSAA 3SDCA 5DFTA 4P3CL 3NDYE 4L8CB 2BS71 1NCNA 4Z3GA 4C55A 2QFRA 5IMOB 1OALA 1KB5H 1T4KB 3TASA 3NK4A 1NMAL 3MRNA 4PJIF 1BFOB 3PHQA 1OF2A 3B83A 2G30A 2GTZA 3CMOL 4M93C 5DVPA 5JPNB 5BZWA 2DLTA 1HQRB 3KL0A 4JG1L 4NO2A 4NWTL 2D0GA 4A68A 1HH9B 3QIUA 5L6YL 5E8NB 4ZW5A 4JLRB 5DWPA 4AY0A 5GGVY 2QV2A 1MCBA 4L4VB 2LLGA 1OANA 2EP6A 1FRGH 3VE0A 1P4LA 1OTTD 2AQSA 3JT2A 3QUXB 5A40E 5BVPL 3CXDL 3B9DA 4MS8C 5IZ7A 2XZCH 4M6OH 1YECH 3KDMA 5D71H 5C0ND 4Z3TA 2Y2WA 5F6IC 2E76C 2RCSL 4PGEB 4AT6B 1H8SA 3QUMB 1HXKA 3V0FA 2DIEA 5I5JA 1A7PH 5IMMA 4JANA 4P2RB 4Z77A 3Q8AA 3Q3GB 2P5WB 4FQHB 1XGRB 1JGLL 5IEHA 3QDAA 4LSQL 4IKKA 5D7IE 4JFZH 1WUZA 1R3IL 4UB0H 3ZGHA 4KTEH 3MLWL 3R7RA 1MLBA 2AXJA 4ZXBD 3ZE2B 3WFCH 4FXLA 3PQYA 3CUPA 5DJCA 1NWPA 4PJHB 4Y0GA 3ES6A 3GXMA 1U8IB 1WSST 2DD8L 4HC1L 3ZXAC 5D55A 3T8VA 1EHXA 3BP7B 2OZ4L 5LXGH 2AZUA 2CAKA 1R6VA 1WHOA 5A2LH 4LRIA 2OJZH 3CZEA 2ZTBA 3HMWH 2XQYA 1ZXQA 4UIMB 2ZNXA 1MVFA 1JGUL 1ZK5A 4IRJB 1UB6A 1ZA6A 5DHVB 3TN0A 4EO5A 3T4AC 1KTBA 1YN7B 1AC6A 3W39A 1A4BA 2H0JA 2IH3B 3K1KC 1S9YA 2GB2A 4YIQA 2OI9B 4Z78B 3MDJA 1QHQA 4R4ND 1AIFB 4ZUTB 3W9EA 5EO0B 5GGQL 1WZMA 4XWGH 3FTGA 2AEPH 5FO8B 4XWOC 2ZG2A 3SPJA 1YNTF 2VC2L 1A7OH 2ZWSA 1FI8C 5JHMA 5KAQG 3JV6A 2HYMA 4EEEA 4Z6AT 1N2RB 4OLYH 5SV4A 2OPCA 4N28A 1DCLA 1T83A 5F70A 4RLDA 3JV0A 3QEQE 4QXUL 2Q3AA 2EVHA 4F9PA 4FJZA 1N6VA 2ZCZA 3W9DB 3H6AA 1LE9B 4PJ5D 3VFGH 2AEQL 4HJJH 5EEXA 4N0UB 2V5RA 4LCWB 3B9VA 4CN4A 5IHUL 1FL3A 2IV8A 5CZKA 1NGQH 4HLZH 4M62L 1CF8L 2Y25A 4KTGA 1V7NL 1I8MA 5LDUA 2Q7AA 2Z0BA 5KJ7E 5E4OA 5C09D 3DK2A 1G9EA 5EO0A 4LU5H 1R17A 5D1ZA 4LHUD 1RP8A 1KPUA 4ZOBA 4L37A 5DZLA 1KB9J 1K4DA 3PUCA 4OBSA 5AL0A 5E0QA 3ORJA 5HGAB 5I26A 3RBGA 1CDHA 4WFHE 1HWHB 1QZ1A 4XP1L 2J55A 4Q4IA 3L3GA 4HPYH 3H3BC 1JYWA 4ODSH 2QPSA 3DYPA 2SODB 1KIUA 4TLUA 1XF5B 2CHZA 5BRZE 1CXHA 1OB1A 2Q86A 3BPCA 3TPUB 3VFRB 4WHTB 1HCYA 3IPBA 4YNYB 3B4NA 2IPUG 3BP6A 3QUZA 5HHOD 4BZ2A 1EHLH 4OJFH 5CCJA 4YMPA 5AZUA 5CD3B 1BFVH 2B1AL 1S7VA 5IMLA 2C9AA 4EI5A 3OXSA 4I1PA 4LCYA 5F0LB 1HXMA 4I18A 5D1QB 3GRBA 1G9MH 3DDGA 3O45A 1BD2B 4LSPH 3SKMA 4F3FA 5AB9A 3LNGA 3O6MH 2CBPA 2EDLA 4M6NH 3UG5A 5IWLA 1E5CA 1S8DB 3MOBL 3D69A 4KJPD 1QNZH 1QR1A 1ZGLA 3TO2A 4HUUB 1P1ZA 2M83A 3MLYL 4ISVB 1B0RA 4HOXA 4D0BA 2I07A 1M4KA 1WAPA 2OP4L 3VG9C 1GL4B 4F7EB 5HJDA 3C5JB 4D3CH 1BG9A 3TJPA 4B5ZA 4QDGA 2EDEA 4DP7X 1PPIA 2BNRB 4L0PB 4AEHL 1SNRA 4WI2A 4O4YH 5DU7A 2YQ3A 3QIBC 3F8UB 1S8DA 1Q8MA 3QZNA 2FBOJ 1FYTE 5K9JH 5E8OA 3W5NA 1OARH 1WD9A 3NN8A 4UWQB 2GJZA 3HR5B 1ITCA 1FVEA 1MW0A 3C6LB 3FOMA 4Y2OB 1M56B 4XNZB 3QK0A 4N86A 5IFAH 2J57A 3G5VB 2C9RA 2CLRB 4MD4A 4X6CF 1XQ4A 5B4MD 1NDMB 2MPAL 1KIRA 3RWGA 1NFDB 3B2UD 4KKCD 5KANI 4QNPE 5JQ6L 4YXHH 2ED6A 3M1OA 4OFQA 1A0QH 3P4OA 5E1AA 4Z7OF 2CDEB 4V1DD 2B1AH 2GIYA 2FJHA 3WIHA 3HMXA 4LE8A 1HZKA 3IDUA 2WOBA 4DUWA 1NCGA 3GMLA 4XO9A 4OD3H 2AANA 2AJSL 4HPYL 3K2KA 3D3VA 1U91A 4WGWB 3U1PA 3DIFB 4W6YB 4KU1A 5J89A 3MV11 4KX8A 4W9FC 1M71A 5CMAB 4JZOA 1AYRA 4WWPA 5DF0A 4NYLA 2WQRA 4UBDD 3QULA 5JTWA 3V6OA 1PLCA 4JFFB 2FEDD 1MY7A 1KYFA 1KIQB 1QSEA 5C0BA 3U7YL 1W72H 5KBDA 4G5AA 1UURA 2BOCB 3U0WH 2CDEA 3QIWD 1FG2A 3PGCA 4O51B 4P46D 2DBLH 3DMMB 3BP4B 1ZSHA 4WO4A 4HF5H 5C9JB 3OMAB 2DQFB 1PCSA 4WLCA 1FNAA 5ISZD 2BHUA 1XB6A 3GSVA 5DWUH 2BOLA 4N9OB 4W9CC 1GYCA 1BIHA 1I7RB 1CK0L 5CP3H 1QKZH 2OYMA 5A43C 4UUJB 2N01B 3RKPA 1YYLH 2HH0H 4NZDA 4JRXE 2GT9B 3B9KC 5D2NC 5TF0A 4HIJA 1FZKA 5INDB 2GY5A 1S7SA 5AZEH 4YAQB 3S35H 4L5FH 1HWGB 2ZIDA 2BC4A 3BSHA 1N6QL 2E56A 5I19H 1QEWB 2VXQA 1FN4A 3S0PA 1Y1UA 1P5UB 2WQXA 5IB5A 3MX0A 2VERN 2XOTA 3DNKA 4K55A 3IPEA 3W0WA 2YEZB 1TVBA 1YDPA 1XD0A 2Q8BH 3FMGH 2H1XA 4KJWD 1RCYA 2VLJD 3AM8A 1JFHA 2Z7ZA 5C71A 2RQ8A 3Q1SH 1MH5A 1ODUA 2QL1A 2OMTB 2F15A 1O6SB 3LZNA 3QNYB 3SBWA 2I9LB 3LH2H 3L4WA 3S3SA 4A7UA 4AIZA 5A3IC 4YDMA 3P4NB 3AY4C 3CDGA 4M1CC 1ACZA 4DUVA 5JOFB 3ULVE 1NIEA 4QXTB 4YK4C 3N2JA 3PWPB 4LKXB 1XDTT 3MCKB 5T5NF 5BO0D 1B6DA 2Z35A 2F1EA 4QMEA 2BIMA 2UWEB 1P5UA 5DDHA 5EZLB 5IB5B 1IBGL 4K2UL 3AACA 1U8HA 1F90L 4QTFA 1CI5A 4LIQL 1LQSR 4OM0H 3FUNA 3K4AA 1FLTX 2D7TL 4F8NA 5EO1A 3NQIA 5FHAH 1IJNA 4DFHA 2XG4B 4O2FA 3E1F1 4MMZB 1JNHA 2VSDA 2NY1D 1FA4A 2K4WA 5IEKA 5AB1A 1A22B 4ONHA 2A6DA 4P04A 1OAQL 1UFGA 3GUTB 3O3BA 4LNRB 5B8CA 4KZ0A 4OZGE 2ARJQ 5L8KB 1YQ2A 3MRRA 4Z7NB 3GRWA 5LG1A 1IBYA 3FOLA 4MB1A 1QKZL 3IJ9A 3DPBB 3QR2A 2OMUB 3PWPE 3ZHNA 4WFGD 3UBXI 3QQNA 4CC4C 5FX3A 1JFQH 3OB0H 1LXMA 3WHE1 3NPZB 4LK4A 1NMCC 1H9VA 3BMVA 1GYWA 2BP5M 2PYED 3EKCA 3JWNG 4JPIB 4R97C 1LDPL 1R3HA 3EFFA 3QWRD 4L5FL 4KBPA 4LSDA 1M3IA 4R2GB 2VXTH 3C2AL 1GJWA 2CH8A 3JV4A 4R96A 3VFSA 1Q9WB 2WLNA 3KJ6L 3MRFA 3QPQC 4FA7B 2GJ6B 2GSMB 4IM8A 4L4TD 2BPBA 4PGCA 5DURD 4FTVE 1VACB 1KFAH 1MPAH 5SWQA 4TVUA 1CK0H 2EDWA 1L9PA 3F05A 2XQYG 1T0NA 3HG1A 2PABA 2KZWA 3BVWA 2X4QA 1UJ3A 3OG6B 3N42B 1MAKA 3QVAA 3QDMD 4PRBB 1QLRB 4H8HA 1DVFD 4G6JH 5EN3A 2MHAB 4I89A 2BSCA 3T04D 3SB3A 3P54A 1FL5B 3STZB 4I9WD 3BH8A 4FERA 4KQ3H 3FB6A 3EF4A 4KZEL 5EU7C 1LK2A 4BQCA 1RFDL 2EQDA 4BUGA 4E9TA 4AJVA 2Z65C 4W9HC 3T3PF 5ESVA 3GSNB 4EDXA 4EKXA 4Z5RA 3VFTA 4QRPE 1I8IA 4ANVA 4RGND 4WK0B 3WE6B 5KVEE 2EKSB 3MJ8B 3CBJB 3RVWD 4JO3H 4LT7A 4NHCH 1I53A 3O4OB 3WJLC 3PIQA 5GHWH 4JRYA 3O6LH 4LCCB 1SOXA 3MLVH 1FVCA 3RWFB 2NY1C 5FHBL 3DGGA 4FXGA 2WUCH 2CGRL 5F0PB 2HJFB 3IKCB 3KZ8A 5DZ9A 2OFQA 2IALB 2CJUH 1A2YA 3SN6N 5I1EH 3W3BA 4DUXA 4KKRA 3MGOB 3I3DA 4FX5A 3TBSB 3MNDA 5AALA 3F12A 3CFUA 2WW8A 3EH4B 4P9HH 3UAFA 4Z7UB 2K1MA 3GSNA 4EDXB 4EQ3A 1N9PA 2ADJB 4WEBH 5AVYB 5F9AC 4YDVA 4ADJA 3SYPA 5FEBA 4LEXL 5C0EA 4F33B 5CSBA 2G5BB 5E9NA 1QW8A 2B9BA 4F9PC 1NFDE 4K3JL 5ID1A 2DAVA 4YOKA 2ZCKH 1Z9PA 4Q9BA 4NKDA 4BFOA 3ZTEA 4XNQA 1Q72H 4G43A 2B20A 1TNNA 3K2IA 1CDYA 1T21A 4X0KB 3OKMB 3RB5A 1ZA3A 4LSQH 2TSBA 2B2XL 5ITFA 2OYKA 2HTLD 1MHCA 2IAMC 4RETB 2XDHA 5EC2A 1A7RL 5JXAL 1ET8A 3OF6A 3PWNB 3R4RA 5D71L 5FA3A 2YPVA 2EDFA 2O5YL 4G9DB 1CGSH 3L2NA 5AVWB 1H3UA 5FECA 5K9QG 3BWAB 4PJBB 1KTLA 3DIVA 3KLQA 3DRTA 4G6AC 4N8PA 1NIFA 4APQC 1DLHA 2WQAA 2EUZA 5IB4A 3WOVA 1COBA 5DO8A 4JM2C 3CN0A 1IKFL 3N40P 3U0PA 1DDHB 3WENA 4MJIB 3VWKB 2X70B 1U4EA 1ZANL 1JGIA 2CHWA 3V4UL 3W38A 3O4LA 3L9EA 5D7KD 2F74A 1XGQB 4XT1C 1S9VB 1EO7A 2JCCA 2KPWA 4L8DA 1IQWH 1E5ZA 2R29H 1X7SA 5DJ0B 5JW4Q 3AG3B 5GGQH 5LNGA 4IKJA 3OJVC 2CKNA 3BUTA 3GSUB 2BSEA 3SJVB 2HG5A 4K4KA 1BOGB 1FFOA 2FJFB 2GITB 3KDPB 1W0VA 1GOFA 3T2QA 3VXRE 4AKPA 3LJ3A 4UAOC 1DDHA 1Z0NA 2YZ1A 3UTZA 4RNRB 4QD2E 1X5FA 3V6FB 4OF0A 2FNWA 3WLBA 4XNYL 2JXMB 1M7DB 5JQHC 4DEPB 1MKFA 4L3CA 2OL3B 3BWSA 1G7PB 3KLLA 4PGDA 3WMSA 2EE3A 4IS6B 1N8ZA 1S5IL 4FADA 1ES0A 3O2DH 3SKMB 3BW9B 1MFBH 2VC2H 4GIPD 4I48A 1MCWW 2E7MA 4QYAA 4BXSV 4HJUA 1KG0B 4CRPA 2CRIA 1L0YA 3TH3T 4Y5YB 3WEXB 4JQXA 1WFUA 1CGSL 5BRQA 4Y7MA 4XVOA 3S37X 5JW5A 4YDLB 1RZ8B 2F53B 4LSRL 4DN3H 3HRPA 4FTVB 1T1WA 4XH2B 3HKZA 5IIEB 1D5XB 3KAAA 3WNKA 3ARVA 3AGWA 4ELMA 1PMYA 1D5RA 4DESA 5E6IC 3QEQB 2F58L 1OPOA 5DEFA 1QFWH 5GRVK 4MWFB 3BUDA 3ZJAA 5CO1A 4YGVB 3X1GA 1PZBA 1YJDC 5FW7A 2Z35B 1FYTD 4PJEE 4RZKA 4JL2A 3K72B 4Y5VB 1JK9A 4RWYH 3HS0A 1SZNA 2XTJC 4HUWB 1ROCA 1HQRA 4NO2B 4Z18A 4XO4A 3T6VA 2MPVA 1XL6A 4PSRA 1UM4L 3UCQA 4FP8L 3ZDYB 4YS4A 3V79C 3CX5J 1KN4H 4G7VL 4UOW1 4Y19E 2VXSH 4AE1A 2D7OA 1I82A 4UBDC 5DEFB 4M00A 4XCNA 4TVPD 1LD9B 4MSWB 1M2VB 3VXME 4L8SA 3UG4A 2GTZB 4S10A 1NGPL 4K73A 2H0EA 5AW0B 2IXQB 2RMNA 5D7IF 5ANMA 3OGOE 4HUWA 1RVFH 4LU5L 1XGRA 3ZZSA 2Y1ZA 2YEVB 3DPDA 3B43A 3EHBD 3N41F 2D0HA 3GKWL 1RUQH 4K15A 3P11H 4XN5A 2NY7H 4YPGB 3KBFA 4XP1H 4G9FD 2WWMD 3LKSB 2J6WA 2O26U 2BSBA 4I0PD 3LXAA 4GY4A 1B3JA 1F4HA 2N0KA 2FB4H 1XIWA 1D6VH 1G6RH 4NXSA 1IAKB 5ISZE 1CXKA 4KJQD 5F9DC 2D9QB 4IRJD 1T5WA 4LHUB 1KB5L 3WUWB 3RGVA 5SWZB 1LILA 3MRQB 2UXGA 1Q0EA 1JS4A 4U6HB 2FYVA 3HC3L 5FGCE 5A16B 2WNXA 1QBMH 1HQ4B 4XMTA 3TBCA 4EJ1C 3MRPB 1OLZA 3LY6A 3KPRE 4PJXA 5IFHH 3GRWL 2KLSA 2YAOA 4ANKA 5DI8A 2W65B 4JRXB 4XXCC 3UEQA 1N10A 3GK8L 2XXFA 1VFUA 2QVFB 5C07E 1UJ3C 2XVKA 3GHBH 3PWJA 1QATA 4GQQA 3JUZA 1O9VA 2FATL 4UV7H 3WFEH 4OZGA 1AGEB 4XMKL 1LNUB 1NGWA 3GEWB 4AUYA 1REIA 4CSPA 2BW4A 4QTHB 3JWDH 4OQTL 4FABH 2NZ1A 3B2VH 4ZMVA 3NCFB 2E27L 2ZXDA 3X14A 2WSKA 2G2RB 4Z7NE 3V0GA 5J12B 4DWHA 3K6SA 5DS2A 4KZCA 1X7QB 1F18A 4J3UA 1WWBX 2OMTA 3WS3A 2L4OA 3JSSA 2DOCA 3H4HA 2WM0A 1HHHB 2C3XA 1U8KA 2Q7YA 4L3EA 1IZJA 1OGAA 1JK8B 5IHLB 5FUZL 3T8XA 4K5PA 3PWPA 2X4TA 4JO2L 1X44A 3SDAB 5JLZA 2XWTB 5D1ZB 2Y07H 1U95A 4HEMA 1WCBA 4N1HB 3MROB 2PW1B 2WY3B 4N2OA 4CVUA 3SKJL 1F4XL 1L9QA 1A7QL 2H3KA 1FIEA 1KN2L 4GIOA 3DETC 3O6FC 5GRWA 1BXUA 3L3GB 2AJZA 5J57B 1RUAL 3DGCR 3HJ0A 1FCCA 4G5ZH 5BNXD 2YK1H 1A6WL 2WIIB 3X2QB 3EZ8A 3IMVA 2IDFA 3D48R 4ODVH 3G08A 3OR7B 5EEZA 3ILPA 1BBJA 1P7QD 1J0ZA 1MCPH 4LNRA 3W5MA 3EOBB 3Q8CA 2CLZA 1NM9A 4ALAH 1KPRB 1WRFA 3H2QA 3FU6A 4U1NA 4Y5XB 4GLRI 3QNZA 3JV5A 3A6OA 4EZJA 1IARB 3VTMA 4EPSA 5JXED 1CTNA 5BZXA 1KTRL 4B3VA 5J1TC 4HKBB 3KPNA 3OC8A 3BN3B 3RURA 2M1KA 1BYOA 5DMYA 1ASQA 3UADA 5KS9A 3QNFA 4HK3J 3J7HA 2Z9TA 5AOLA 4ZFOL 2CR6A 1OW0C 3FB7B 5DZVA 1IBGH 3ATDA 1X5IA 5D96B 5EEVA 4L2LA 3S2AA 3IAQA 3QHZL 4U33A 5D2LB 4D8PA 3LEVH 1HL5A 1NMBH 1YMMA 5E03A 4PJ8D 4XP5H 4UTAH 1KBBA 2WXIA 1WBZA 4OLEA 4PLKD 4X6EA 2DLFL 1LM8V 3D12B 1HESA 2XV3A 1JOIA 1U8PA 1MCCA 3HUJA 4YHLH 4LASH 3ECVA 4PREB 5KVGL 1LK2B 4O02B 3V52L 1QSZA 3BOVA 1FFOB 1FBIL 2FJFA 3FKUS 1QR1B 1MJJA 3ZQWA 1NTDA 1F4XH 4OZHE 4U0QB 3OSKA 4JY5L 4O2CA 2R0WH 3MQIA 4X8GA 2NYKA 3SKNA 3QQ3A 4PJ8B 5LUMA 1R75A 2H8PB 1JHLH 3PIQB 3SYQA 1MFCL 4GO9A 4PTTB 1N70A 5E2VL 5EO1B 3U79A 1ICTA 1T0MB 2VQ1B 1NDMA 2BNQA 3NCXA 1SOKA 3QO0A 2ICES 1OAUH 3H42L 3UYPA 3ZMRA 4CDHA 4HXAH 4H2CA 4JFHE 5B7EA 4DKFL 1HINH 2J20A 4H0LC 4UIKL 4XAWH 1I8UA 3TIEB 4NM8H 2C9SA 4JO2H 2NNAA 4OSUH 2ZXGA 4K3DL 4XE5B 5MEND 4LSUL 3ULVF 5A7EA 2ID5A 3VNYA 1OF2B 4ZMWA 1BQHB 4QT5A 1N5AA 2XZQH 2ZSVB 3BGMA 2CLVA 1YN6B 3HG3A 3MFGB 2GCYB 1NGYA 2XI9A 4MRCA 1NAMB 3V8OA 1FYHB 1FYTB 1PW3A 4AIEA 4HAFA 2ERJC 1N0XH 4L4VA 5LBVA 2V5MA 4G6FB 4IIZA 1ETZA 4J4PC 3S3PA 4QPEA 4J12A 4GSXA 1E4JA 4ZFFB 1KFAL 2XN2A 1QLFB 3BGAA 2XLLA 3N91A 4N5EC 4RX4D 4JQXC 3QB7C 4TVPH 2NNAB 2C3VA 3ZO0A 2B1HH 3CFIC 2A2QT 1L0PA 4Q9QH 2HPOA 1GGTA 1VIWA 1P53A 3TZVD 4FHBD 3ULUD 3QEUA 2NZ9C 4QHMA 1VPOH 2X0UA 1HH6B 3DBXA 3ZHFA 2V17L 2C1OB 4ODHL 2VERA 3I50H 4Y2DA 3BI9X 5J11B 4LVOC 4UYQA 1CYWA 2LTQB 4AENB 5KYXB 3FH7A 2NR6D 4CSZA 3VRJA 3UJTL 3IM1A 4JFPA 1ONQA 3LZFH 5F9OH 3TVMC 1NMBL 1S7SB 5T1KA 1E27A 3WEMA 3HC4H 2ROXA 4IU2A 2M26A 4M7LL 3RWJB 4H0IA 3RL1B 4P46B 2AQ1A 5D93C 2HKFL 1KBGL 4MQTB 4ECNA 4WO4D 1RZPA 4GAGH 3H1ZA 5JIDA 2ZZUT 5AUMB 4M61A 4KX9A 4LCWD 3EF7A 4D7PA 1G6VK 5E5RB 4U3HA 4LMQE 3KYOA 5IQOA 3HBPA 5BRZB 3K71A 5AG9A 2XWDA 1WGOA 3M88A 4J6IA 4X5RA 4MQXC 3W57A 4CVXA 1QACA 1MF2H 1TFHA 1AVAA 3WNOA 4RAUB 2GSIA 2RQEA 4FNRA 2XFXA 3ATEA 3BJLA 4PBDA 2VDRB 3TV3H 5EIIB 2VDMB 4NQCA 2G5BA 4NIYE 3PP3H 2WWNA 4N8CH 1QSFE 1TTUA 4K71C 4ZBJA 1Q72L 3IS0X 1YA5A 4PVLA 5B3SB 1U8JB 4DAGH 5D6DC 4ETQA 3UTPD 2XXMB 2JF1A 1N8OE 1XGUA 4BH7B 4XNQB 2WVSA 4E42A 2YPLD 2VLJA 2HH0L 3PABA 5JW3H 3P0VH 4CVXB 1S7WA 2EDRA 3ISRA 2AMGA 1E8WA 1M05B 4AL8L 5BVJA 1RZKL 4LIQE 3DYMA 4WK4B 4Z7VE 1OP5H 5HJGA 4Y7OC 4QEGA 3V2AR 1EZVY 2X3CA 3WKPA 1KG0A 4BH8A 1S7RA 5HI3C 3T08A 4PV9B 1AAJA 1QVOA 1R5WB 4ZX4A 1KC5L 2V2XB 3V95A 1P7BA 5IIEA 1BM3L 1DVFA 5I6MA 1Y6MR 5FGRA 4LVHB 3WU1A 5BO1L 3FCUB 4HGMA 2IGFL 4PCSA 1UT1A 2WJ7A 4QCIA 4CBPA 3DTXB 4OT1H 5JORB 4NQTA 1QR4A 1VA9A 2E7DA 4NRXA 4FQJL 3QUZC 2VM4A 1K9TA 4OJAA 5AOZA 5JO5A 2JCWA 3OPUA 2J3SA 1P84K 3G5XA 2OA9A 2LAGB 2F5AL 5I1LB 3P3UA 1WAAF 1KB9K 2IFFL 2R9HD 4ERSH 1XT5A 3OKNB 3CVDA 4I18C 4BFEA 4PJHE 2PWEA 1T22B 4POZC 1DQJB 1OLLA 3EH2A 4B9CA 1E5BA 1KGCD 1F5WA 4FXGC 1URZA 4IBQA 4UZUA 3AXIA 1KPRA 1BVKA 2XA8L 4JRLA 1M2VA 4IQHA 3BUYA 5D7IB 1Y1DA 5D6CB 3WE6A 5C0RH 1JGEB 2DL2A 3B3IA 3D50A 1ZVNA 2WKOA 1DJXA 2QJDA 4UTCA 5C0CE 3X1EA 1IX2A 3SQBA 3HN3A 3ARFD 3UGEA 4FQ2L 2HB0A 3S35X 5DMGC 1AXSA 3SDAC 2MHAA 5JW3L 4M7LT 2Y7OA 2ZWNA 4R3SA 5KSUB 5L2KA 4ZI8A 3G04B 1MJ8H 4IRZA 1TDQA 3GB7B 3UJIL 5AYUL 1HTYA 5EU3B 1H8NA 1TEYA 1I1AA 4L4VE 4NNXB 1PG7L 2VXVH 3ULVH 1K8DA 3JTBA 3MLZL 1S6NA 3EH5B 4JM2F 2DYSB 3SHSA 3CFJB 2QLVB 4WTQA 5B1BB 5HYQA 2YXMA 4W68A 4I3GA 1M9WA 1U8MB 2CO1A 3CHSA 5IVZB 2HFGL 1B4JL 1OE3A 3CFDA 2C1PB 3WKMH 2F58H 1D5XA 2MCPL 3V5KB 3GSWA 4H7VA 1JZDC 2X89A 4Y4FB 1PZ3A 1QYGH 3N55A 4OUUB 1GGCL 5I1CH 2X2UA 1DBMH 5A6IA 2R2HB 1W16A 1EHKB 3FDWA 4LDOB 3WFHB 3VD7A 2C8NA 3VYOA 1Q94B 2ADGA 3BE1H 2JLLA 2BVYA 5F8QC 1MHEB 1KACB 2OMVA 3X1FA 4UNIA 4R4FH 5I1DB 4KHXH 3VGBA 3SOTA 1H3PH 2MOGA 4HJ0D 3ENEA 3EBAA 4PTTA 3E6HA 4NS0A 2VN7A 3B9KD 4PCTA 4TPRH 4L1LA 4ZUSA 1OQOA 4OW6A 2EEXA 4JFFA 1OVZA 3TNNA 5FAAA 2JIXD 3N50A 5HVHB 5DRXA 1J0KA 4JFEA 4FLSA 4E68A 2CGRH 3DXAD 2FWUA 5EEUA 2WSDA 3B2PA 1K5WA 1R5IB 1JK8A 1F58H 3MMEA 3FSWA 1KGWA 3MODH 3EGXA 3JZYA 1RZIB 1AZCA 2J2ZB 2X1OA 1H6UA 4Q0XL 4NPYA 5I6XB 3CD4A 4HJIA 1FIGH 3U82B 1C9SA 1NAMA 1YMME 1N0LA 3OKEB 3GF8A 2A4EA 1SN2A 5FDWA 4OLYL 4PN6A 4NZJA 2IC2A 1XMWA 5C08D 4L8DB 3RPBA 3ZIMA 1A6UH 4XVTL 2C7UA 5IESH 1DEEB 1GIGH 1HSBB 2XWJB 3O8XB 2VDRH 4J6RH 1TJIL 4M29A 1MSPA 4D0DB 1J8HA 1C16B 3OVUB 4ZYKA 2CU9A 4HQQH 1BGXH 4QO1B 3D0VA 3MBWB 5CBAA 2X70A 2YAPA 3KLDA 1YNKL 1UJTA 1DN0A 2IMNA 1EAQA 5E0FA 2GBAA 4I4WB 4L05A 4ONFL 4J27A 2K3TA 4PWKA 3TEUA 3HNSL 1KJ2L 2XN9E 4NC0B 4PCKA 3T0XA 4BCYA 1L9MA 3PNWB 2BY1A 4JKLA 5DHEA 4B0MM 2X87A 1CFMA 4AENA 4IMLB 5KYXA 4MD0B 1RVFL 1BIIA 2BCKB 4N26A 2H6OA 3C75A 4X80L 4DOHE 1BOGA 4PJFB 2YD6A 3PPEA 2UX7A 5H35B 5D7JA 4RSVA 1P4IH 3LZQA 2MQCA 2FWOB 4QXUH 2AXGB 3IDXH 1OTUC 2WBWB 1WC7B 4YHIB 2ZWZA 2X6UA 1IFRA 3QDME 1FAKT 1IAOB 3CPUA 4L2YA 1QYGL 1O7DE 4V1DA 1EVTC 4I0PB 4WCYH 5TE4H 3MLPA 3TGXA 1CGTA 3ZDZE 4KRPB 5FYLD 2Q20A 2Y2YA 1U8CB 1ITBB 3NIGB 1AR1B 1E4WL 2VKWA 2J8HA 1JPTL 4ANUA 1G9ML 4L3EB 3WIFB 3QI9B 2D31A 5IJVA 3SCMD 4MXWL 3W11D 4GJTB 2AJYH 3I2CH 1H3PL 2NYZA 3KPQB 3DX8A 5ADOL 5CSGA 1CL7I 3L95B 5BZDA 1DANT 3VA2C 5IVXB 2CO4A 4WF7A 1OSYA 1IC4H 3RRQA 3LHPH 3IU3B 5D1XE 1PZAA 1WS7A 4MLSA 3SE9L 4ODVL 1OKEA 3B1TA 5DTFB 1MCHA 1KLGA 1E9PA 3SDCD 3SIKA 1K6QL 2EYRA 3ZE1B 3MYJB 3T2PA 5DMIH 2VOTA 4JCWA 5AYQA 3WIFA 4K8RC 3ARGA 5IJVB 4KK9C 2ZX9A 5AW2B 3NSYA 3GDCA 3D18A 4QAMB 5T5NG 5C0JB 1X4XA 1XZ0B 3GSVB 4QYOA 1INEH 5CJXC 5L7XL 2XVLA 2XG5A 3Q44A 4RA3A 3F7KA 4ELME 3PWVA 5JQIB 4GQRA 4KK6C 4V2CB 1PG7X 3FQ4A 1FFQA 3ZRCC 1LEIA 3B7YA 2FO4A 1E4HA 3A24A 4Y5YC 1QNZL 2FNBA 3LZOA 3FO9A 4YSDA 1PZUB 1CFSB 1XB8A 1RUAH 5ESVB 1GCFA 4M4RA 4ZS6D 1X5JA 4JY6B 4IHBA 2EC9U 2IWEA 4LEEA 1QEWA 4E41D 1T3FA 3H7LA 5FUOH 2GEQA 1PQZB 3CBRA 4HPOL 2CKBB 3FQWB 4H88H 4DF9A 5KSBB 1RH8A 2VLRA 2ZOUA 5TE7L 2F68X 3WN6A 1TR7A 2W91A 4HEPG 3UTSB 2YKLH 4J3VA 1Z2KA 3VD1A 1DSFL 1VADA 1AP2A 2VDML 3NT0A 5DD3H 4P59L 5FGBA 1ZLEA 3GPSA 3HB3D 1S46A 3S8WA 3IGFA 3WIIH 3OJDB 4O2EB 1BCIA 3U83A 3ZTCC 2GJ6A 4URKA 4IIQC 1W6LA 2H41A 1SBSL 4JY6A 2VLLB 3KPTA 4MNGE 1HILA 1FV1B 32C2B 3BZEB 4OAWA 3RTLA 1LJMA 1U2HA 3CLWA 5EIIG 4NQCE 4DCQB 5F7AA 5B7MA 4XXWC 1OWWA 1KJVB 2PWGA 4IRSD 3V9EA 1E90A 4YFLF 1NPJA 5TJWK 2R23A 4DGVL 3US0A 1A0QL 2ICCA 1UA6L 3K6FA 3F58L 4P5RA 5DHYA 4ODTH 4M1DH 1CLZL 3M6DA 3WS6A 4B60A 5IR1A 5K9QI 2PXYC 5F7UA 2FO1A 4U3XA 3WS3B 1NCWL 4Y9FA 1RUML 3OJDA 4YHYB 2D3VA 2AW2A 4HMEA 4J8RA 3O3BB 5B8CB 3RL2A 2WCGA 4PEEA 3NFSH 1BQHA 5ECJE 3FFCE 5B38G 5BRPA 1H5BB 3OTTA 2X4TB 1KXQE 4FNPA 3SDAA 5DHMC 2MFNA 1YYCA 2VLKD 4QTHA 3D3VE 4U6VH 1YEDB 4N2AA 3SGDH 3NIGE 2Q8AH 4NLAA 2FBJH 3NZ8B 4FXGB 3INOA 4NO5A 4X4ZA 2BNRA 1TTCA 3QDMB 2WXJA 2PP9A 1NC2A 4JM4H 1WIOA 1PD6A 3QQDB 3QJFB 3WFHA 1OGAB 1NOAA 3H54A 1YY8A 3DO7B 2QR0B 5MEOA 3HS0C 1JV2B 1ZTXH 3HZMA 4MDJB 2QV4A 2XPGA 4XE0A 5LGJA 3SJVD 2LU4A 4K9EC 4Q4EA 4BDVB 2VZSA 1LEGA 2D8KA 4KXDA 4HGWA 4MQ7A 4Q6IC 3S5LB 3UJTH 2HJKA 5DRNB 4ELMF 3NA9H 3S8GB 5E2TL 3R0MA 5GS2D 3QZWG 4E36A 5KYUA 3TNMA 2WO2B 5FV2A 3SE3A 2XN9B 1TEGA 3T4AA 3BPOC 1V10A 4F1SA 2HG5B 3V0HA 1KWKA 3DUUB 4F7MB 4YDKH 4U7KA 3DLQR 1QPXA 4L29B 3KGTA 2VLKA 1ZJBA 3L9BA 3CDCA 4BFIB 2AJVL 5FFLA 3IDIB 3L9RA 1JNNL 1ZV9A 3WEAA 1BMWA 4NQSB 5AAMA 2AJUH 1UA6H 5FYJL 4HH9A 4OU3A 2Y07L 3C60B 4HGKC 1SN0A 1MJ7L 5I1LA 2HRPL 3S4SB 4ZFGH 1A4AA 3EJRA 1IAIH 4MZ3A 3ETSA 4CVZB 1UXSA 4PJGB 2OTUB 5F71A 3HNVH 5HDQL 3ESOA 3X13A 1QWUA 2A6KA 2ENQA 5FKPA 2BIPA 4GRLB 4KJWC 1FG2B 3PGCB 4O51A 5KUMA 3RE0A 1NKRA 4HEPA 5FO9A 5LN4A 3TZVA 4ANXA 4DVBA 3UAEA 1ADWA 3CSYA 3LD8B 3BUYB 5D7IA 1NUDA 2FBJL 5D70L 5DVKA 1FNSH 4YC2C 3VSQA 1FZOA 4F58H 3VB9A 2COQA 5KSAB 3JTTA 2HVKA 2WBJB 3D85A 1QSED 2R0LH 2Q6WA 3FHEA 4X0NA 2BFVH 1XF4A 1ZHBB 5KVGE 2VKXA 1U92A 2FAUA 4CGTA 4BFRA 2DKUA 4MDRA 3NCMA 2ZXCA 4WJ5A 4LLYA 2EDXA 1KCVH 3U6RA 2XBZA 2QFPA 2Y7SA 3L4XA 2YA0A 2QPUA 3BD4A 3IDNB 2OW6A 1BZOA 3I9AA 3ETBF 3VD5A 3EAKA 1I9JH 1FC1A 1MCJA 3HN8A 3K72A 4PJEA 1B3IA 3K0YA 4B9IA 1A6AB 3L7FB 4OTXH 4QRRB 2GTWA 1R24B 2LW3A 4UM9B 1TG8A 3H9HB 1TO5A 5ADPL 2ENJA 3SQOH 2VMJA 5F9WB 3V7AE 1WE5A 1UD6A