1SHSA

Small heat shock protein from methanococcus jannaschii
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
115
structure length
115
Chain Sequence
b'TGIQISGKGFMPISIIEGDQHIKVIAWLPGVNKEDIILNAVGDTLEIRAKRSPLMITESERIIYSEIPEEEEIYRTIKLPATVKEENASAKFENGVLSVILPKAESSIKKGINIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SMALL HEAT SHOCK PROTEIN
publication title Crystal structure of a small heat-shock protein.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Heat shock protein
total genus 18
structure length 115
sequence length 115
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 1998-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17886 ArsA_HSP20 HSP20-like domain found in ArsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1shsA00
2WJ7A 4ELDA 3QORA 5LUMA 3L1FA 2BOLA 1WGVA 3W1ZA 3AABA 4PCKA 4YDZA 4M5TA 1WFIA 3J07A 3VQMA 2JKIS 4YL9A 3QORD 2RH0A 2Y1YA 4I88A 4JUTA 3GLAA 4YLBA 2Y1ZA 2XCMC 3N3EA 1EJFA 1WH0A 5DS2A 1X5MA 3GUFA 1GMEA 3QORB 4YE0A 5DS1A 4MJHA 3VQLA 2CG9X 4FEIA 3GT6A 3QORC 2K8QA 1SHSA 3Q9QA 2Y22A 3EUDA 2WJ5A 3L1GA 2MNWA 4RZKA 3L1EA 3AACA 2N0KA 2KLRA 2N3JA 2O30A 3IGFA 2CR0A 2KMWA 1RL1A 4JUSA 4M5SA 4PBDA 4YLCA 3Q9PA 4ZJ9A
chains in the Genus database with same CATH superfamily
2BPBA 3RNKA 1E42A 5EN3A 1JBJA 4MJ2A 1FZOB 3WUZA 3S4SA 1FRGL 3D09A 3ULVF 3QFDA 1LNUA 2PTTB 3D5OF 4YHIB 2VT0A 5EV7A 3KPPB 4P3WA 1X9RA 5INCA 3DURB 2BNRA 4HZ1A 4FNQA 5L9DL 3WJJA 4K23L 1UQSB 4OGAD 1LTXA 1Z5YD 1RJCA 5EDXA 5DFWH 2X9ZA 3HNTH 4MJHA 4HUVB 1JFQH 1CL7H 1FNAA 4PP1C 2P5WD 5I9QB 2I9TB 3MOBH 5EHFA 1L6ZA 2KERA 2MKWA 3EO9H 4XNMB 5KS9A 2DL9A 5DSCA 4NUPA 5FYJH 3U0WH 2XTJE 1U8OB 4PP2B 4U6HA 2P46B 4MQ7A 4Y19E 4DKDC 3VA6A 4CC0A 1S7VB 3DV4A 4JRXA 4U3XA 3TLRA 3WBDA 1QW9A 1RUQL 3A23A 4BIKA 4P2YA 3D69B 2UWEF 3CFBB 1TSHA 3ZSSA 4OFIA 4X7FC 3RVWC 3CIAA 5F6HJ 1PQZA 2YGPA 3GBNL 4ZD3H 3GI9H 3L5XL 3PGDA 4MDRA 1RPUA 1T3FB 2HLFD 3N40F 2ZUQB 3RUGB 2O4EA 2VERN 1OT4A 1LMKA 1OWWA 3EOAA 4HWZB 1HSAB 1NWOA 1KYOK 3TBVA 3TBTB 2F54E 2P5WB 5FB8A 5ID1A 1LQSR 3AM8A 2X6AA 1EGJA 1W8NA 2VLRD 4NN6C 5DJ6B 2FD6H 4N2NA 5DUML 5IB2B 1EJOH 3BQUA 2VDPH 3BAJA 3PIQB 4H0IA 2XTJC 5ADOL 2JJSC 1MFAH 5JPNA 2LU5A 3HG5A 4XO4A 2LAAA 3G6JF 1RUPH 4RESB 4RRPM 1HKLL 2R23A 5KSUB 5CJBA 1DBKL 4Z7QE 2JJTA 4WFHE 4AZ8A 4WWID 1OCWL 2NY3D 2YWYA 3IJEA 2OMTB 4LL9A 1Z0NA 4JFZL 3SGEI 3MRIB 5EZLB 2ENYA 1T0MA 1YMMA 1UM4H 3U82B 5GS0H 1KNOB 4GRLC 3C2SA 3HKZA 3V4LA 4B9JA 2V3DA 2W80C 3MLVL 3DOSB 3IJHB 2DQ6A 2N56A 3T3MB 3OKLA 2EDBA 2VLRB 1SOKA 1J1XL 1I1FA 5J1AA 4XMZA 5A2LH 5EBLB 4XPTH 5G5DB 2E56A 4HCIA 4R90L 1XGRA 4XTRD 1DDTA 1K5NB 3NTCH 3OJ2C 4FI7A 3ZKND 2HVJB 4L9DA 4MA7H 4KRPD 3D3VD 2H8PB 4G9DB 3BLBA 3F6IA 3T3PE 2MHAA 3BPOB 3JTTB 4NLAA 4XNUH 4JFXA 2ZYSA 1JUFA 3JV4B 4WK4B 2EEBA 2NY3B 2PYED 2NXYD 4Y2DC 3IPFA 2HT4C 4LKXA 3CX5K 3CFIC 2YC1B 2YD3A 3BGFB 4HCRA 4JM2C 4NFDA 5I6LA 4XMLH 3S97C 4JO4H 3I6LD 3V7MA 5E03A 1QVOB 2WYZA 1HYSC 1XH1A 1SOSA 1U8LA 4FXKC 3WNIA 4S1QL 5KSVB 4JY6B 1COBA 4PRIE 1WBXB 1S8DA 3T6VA 3QJHA 4KRPB 3D3VB 1QRNA 4MNQB 2OX5A 4A2DA 1RZFL 1AGDB 3V4UL 2YAQA 3AWEA 2VDNH 1RZKC 2B59A 2XXGA 4PV8A 2OJEB 3OZ9L 3L5WB 1IGIH 1AQMA 3P0YL 3MLUH 2ZKWA 2PYEB 5INDA 2V33A 2NXYB 1F11B 3SY0B 3F7QA 2C3VA 3SJVD 5C1MB 3CPLB 4EIGB 4LF3A 5AL0A 1JRHI 1C08A 3D52A 3MNZB 1T1WB 1J0ZA 1V7ML 3I9IA 3WXWH 4IOSD 3G5ZB 4LLYB 3U2IA 4U0QB 3VSVA 2F5BH 1NQBA 3UTPD 5KUKA 2AW2A 4LASL 1UT2A 4PEEA 1CFNB 2APTA 5CBAA 4IBTA 1KGCD 5D1ZC 5C0EA 2KT6A 3N43F 1N67A 2IPTL 2VO5A 3HFML 1IC7H 5K9KA 3RDJA 3UGUA 1QLEL 2CGZA 4XAKD 5DQJA 5EUKB 2VCOA 2AEPL 1YA5A 4QTIL 1NCGA 3A6BL 3RKDD 5TF1H 4Y9GA 4U49A 4XP5L 2BVPA 3VFSA 2HUEA 3SJVB 3TN0C 4NO5A 5K1JA 5EORL 3MJ6A 3V0EA 3V6BR 1FG9C 3NN8A 3ZRFC 3RWFB 4W9DC 5CCKL 1MW1A 4O00A 4FQXD 3RLSA 4WWKC 4OTXL 5CZXD 3DIDA 4KMLB 4DTGL 5DD6A 1RIUH 5KOVC 4F7TA 5D2LB 3QUYC 1Q9WA 1O6SB 2C9SA 3FAXA 4M93B 4ORGA 5J06A 2LAGB 4MQXC 4JFDE 4OJDH 2VNCA 5ITBL 1DVFD 4YDIL 3IEAA 5CR1A 4RFEA 1Q9OA 5MI0C 3RY6A 2XIDA 2FJHB 2PNDA 1T83A 2ZXQA 2ZOOA 5D7JD 3L16A 4P05A 1WFMA 5I19L 4G8IA 2VQ1A 4HDIA 4WGVB 3BP4B 2F1AA 3EYVB 4OKVA 3HN3A 3EF4A 3SDAA 3SSGA 1EEQA 5DMKA 3WHXA 3JTSB 1MLCB 2EIZB 5DU7A 1QFWH 2HKHL 3PP4H 4QYOA 1G7PA 1IQWL 2CLZB 1ED3A 3VM5A 2OKMA 3BH9A 3L17A 4LSVH 4IHOA 5GIRB 4DO4A 1Z9OA 2QQKL 2OJ1A 2RHEA 1MFDH 4XHQA 1KIRA 2VR8A 4J4PD 4RNRA 4LSQH 3QEUB 5D7JB 3OGCB 3O3EA 3CNKA 4N22A 3QAZC 3VMPA 4P48A 1KPVB 1OL0A 3KJ6L 4ZO8A 3BWSA 2X1XR 5D71H 1S9WB 1MNNA 1INEH 3GTTA 1ANUA 4PBDA 1KTLB 2GIXA 3OC5A 1AYRA 5CJOL 1OAXL 4LLQA 4YC2C 4XMWA 3SDXF 3UO1L 4DVRH 4EXPX 1NFKA 1YEIH 2A4CA 1Q38A 3FSOA 3KXFA 3MSPA 5ANMA 3B9KD 4K8RC 1AGEA 1P7KB 2Y5EA 3MUGA 1HOEA 1TPXB 1B0RB 5JMOC 3ARBD 4BA0A 5DJ0B 2DQIH 5IMKB 5CJQL 4EI5D 1SM3H 3QZBA 4U1LA 2YEZA 2PO6B 4Q97A 3B5GA 3DUHA 1A8JH 1YDPB 2DLHA 3BPCA 3WUWG 4GG6E 1AIFA 1ZHNA 3U46B 2DH2A 3NIFB 1NCDL 4WZ9A 2YA2A 1NAKH 1KSRA 3SO5A 4TULH 2IWKA 2JKWA 4AE1A 4G7QB 3NZUA 5F9WC 4OLZL 5GRJL 3DTUB 3S88H 1Z3RA 5EWIL 2ZOTA 1FDLL 3NCWA 5DHVH 3GWJA 4EVNB 2WBXA 3R06B 1MAMH 2HJLB 2YPLD 3V5KA 4EEEA 1HXYB 4PS3A 3EADA 3DTXB 2BJMH 1IZJA 1XGQA 4DUWA 2VW4A 1NGYA 3SDYL 3V0WL 2OMWA 4YO0A 5GS3A 1VAHA 2D2OA 1P6WA 3ARVA 3GSRA 3QP3A 1C5CL 3KPSE 3X11B 4ZX6A 1OGAA 3VI3F 1KB5H 1D9KC 2Z4TA 3NPSB 4GW4A 2Y23A 3H9SD 4FNLH 1UXWA 1MLBB 4ZUUA 3W9EB 3VI4B 4AM0B 4L9LB 1R3HA 4B53A 4I87A 1IU1A 3HA0A 4HUXA 3QW9A 4OCMC 5D1QA 4C58B 3BDYL 3FRPA 4PJIA 1DVXA 3VTMA 3I3EA 2B9AA 4ZW7A 2Y7SA 3VXUA 3US0A 1ETA1 2YPLB 4S1RL 1R3LB 1IKNC 4LLDB 5C07E 1BG9A 3ECVA 1ODAA 2Z91B 3GJFH 5I6XB 1IC0A 4HFWB 3ABMB 5HDBE 1YVLA 4YE4L 3U0TA 1J87A 3KLHD 3ZGHA 4Z7OF 4NO0D 3H9SB 1KJ2A 5EU6D 5D7IA 2UY6A 2Y7QA 4G11A 5T5NF 3S37L 3QDMB 4DQOH 2VUYA 1KTKE 1EFXA 4ZSOB 4DZ8B 3CDYA 5DJZB 1LDSA 1RZPA 1UWXH 2IV9A 4JDVB 5KVGH 4TSCH 3VDCA 4I18B 2CNYA 3RL1A 1XMEB 4HCRL 3RVXC 1XZ0B 4IW4C 5FO9B 3M17A 3DBSA 3F5WB 1JWMB 4UV7L 3AAZB 4ZUWB 1E8ZA 3E6FA 4KI5F 5FCUL 2BNQB 5FX3A 2H4EA 1N10A 2QMKA 2W1NA 4OCRH 4YDLC 4B5EA 2MPAH 1H15A 4LGRB 3X12A 1K3ZA 1WG3A 5IFAH 3QIWA 1E3XA 4NO0B 1TQVA 4YX2L 5IQOA 1HQ4B 5EU6B 2NDGA 1BEYH 3CHQA 1BVLA 4GBXA 3RPKA 1FAIH 5ELIA 4BZ1A 4YHLL 1G4MA 5DRXA 5H4ZA 2ODIA 1L3WA 4OZ4A 1WPCA 2X4OB 5J12B 3VD1A 2OP4L 5AW0B 4W9ZA 1XVSA 4AKOA 3BD3A 5E94A 2BRRH 5GSVA 1J9CT 4L8CB 2HH0H 5CBEA 4JFFB 4AIEA 4OCWH 3ZT5A 3FCBA 4IRJC 3OR7B 5IJDC 5IVZB 3CU1A 4P9MH 1KENL 2LU7A 1RI8A 5A16B 3WMSA 5F6IB 1MG3C 2KQNA 4LOUD 3IK2A 3V4VB 1I8AA 1EZVX 4NHUA 3RWJB 3JWOH 1RUKH 3STZA 5DUJA 3MCG1 2EC8A 3AT9A 3BRFA 1BDYA 1HILB 2ID5A 2X10A 3O3BB 5EBWB 4I9XA 3GK8L 3GZQA 5FHAH 2EDDA 5E2UL 2BLFA 1LO3H 4QHMA 1UWFA 3VWJD 4OZFB 3ECBA 4GAFB 4CU6A 1CDIA 3R8BB 3O3DA 2GITA 4JJOA 4LAQL 4QRSA 5CMAA 4F9PC 1R0AL 5GGSB 2FO8A 2PTVA 4QRRA 3LXUX 4PAZA 4Z77A 4UQAA 3SGKA 4C56A 5A2JH 2JSFA 3S34H 2H1XA 4FQHB 1KYAA 3KS0J 1OM3H 3DGDA 3F85A 3V0GA 4KKCC 3PDOB 3MR9A 4PJAB 3BH4A 1OGTA 5C6PB 5B8CA 1RJYB 2Q2LA 2JB5L 3QQDB 1XGPB 3UXFA 2M8XA 3GMMA 3DBXB 2PKDA 1E9OA 1OLZA 3DHJA 1IM3D 2J6WA 1NCJA 3FCGA 4X9IA 5HYJA 1Q94B 3ZT6A 5JHLA 1PKQB 4BQCA 3VWJB 3BZEB 3MLYL 2FO4B 1YPZE 4LP5A 5D8JH 2D9QB 4HUWA 4X5LA 5CILL 1SJHB 4I89A 4XVTL 5D1XD 2ATKA 3GDCA 1RZGB 4XCFH 4WEEA 4DO5A 1I7RA 3EJRA 3I3DA 4FHKA 4R3SA 4JN1H 3LYRA 1AZVA 1NMCC 4L1SA 1N70A 2ITFA 1T03H 1BFVH 2X6MA 1PG7W 5HI4C 4WI7A 1QSFE 5IHUL 5KSBF 3A6CL 2J21A 2TAAA 3D0VA 4V2CB 2YZ1A 2DYPD 4MJIE 5AG9A 1O5PA 1M53A 5FKPA 2WNXA 4OFKA 2QKIB 2NY5L 3SY6A 1JGLH 3D30A 4HGWB 2NX5E 1A7PH 4W4NA 3N42F 3UTSA 3ZMEA 2LU4A 3CX5J 1GY2A 2X4QA 2CLVB 5EU4A 4OD2A 3QJSB 3QUZC 2IWEA 1OY3B 1DSFL 4TVPD 4Q6IC 1Z0MA 4FRWA 1IL1A 1TENA 3BUYA 5DJCA 1GMIA 4JMNA 1G7QB 1DUYB 3FNKA 3PP3K 1F90L 3J7HA 4Y1SA 4YSQA 5DVNA 4RGMB 3ISRA 3SKUD 1NCTA 2V4LA 3FQ1A 4PU2A 3RAJH 5FLUA 2PPEA 2Y1YA 4KXDA 1KTDA 1A2YA 4G6AD 4LDOB 1E67A 3PJNA 4NKOA 5ABDE 1KJ3H 3AWGA 2QHRH 1SF5A 4RFNC 1TLKA 2YPVA 1JPST 1WTGT 1AD0A 4N2EA 4ZMAT 5I73C 2Q5BA 1I9IH 2Z6FA 2AEWA 2JCCE 5DQ9A 1SGKA 3QZWG 5ID0B 1O6VA 4DGUA 5LBGA 3FUEA 1FFQA 5SWSD 2R4SH 1OB1B 2FBJL 5LXGL 4QHKJ 2K9UA 1QWHA 5DT1L 4HQQH 4P5KA 2HVKA 4N2BA 3V0IA 5L7XH 1EHAA 4DEPC 5ITFA 4JQVA 4Z6AT 5IR1B 5MENE 3FU7B 4WRLA 3SCMD 5JHDD 5BJTB 4BEIA 1MRCL 4N87A 1RZJL 2Y5TB 1D5MB 1AIZA 3HZMA 4WNJA 3EYSL 5CP3A 3PAZA 4Y1TA 3F83A 2BSRA 1X5FA 3G5XA 1CWVA 3F7VB 1RHHB 1CS6A 5JW4Q 2IAND 5E8OA 3SPVB 3RVVC 2DMHA 4M5ZH 4BHUI 1MXGA 5ISZD 3KL0A 1ADQA 3NZSA 4OM1L 2K0RA 3P2BA 5SWSB 3T0XA 1KJMB 4CMMB 5JW4N 1S78C 5BRZA 1OCCB 4YHMH 1ACYL 1Q72H 2CKBB 3TC9A 4CL7A 3VFRA 4APQD 5DZVA 5H4YA 3MNWB 4N90E 2EXYD 4L8BB 4W81A 4XHJC 2AHIA 4JQIL 1Y6MR 3L4VA 1FYTE 4UOZA 2Q7NA 3SCMB 2K3TA 5JHDB 1FFNA 4Z5RB 1KJ2L 1E5YA 1PDKA 3KPOB 4BDVA 4NNXA 2TSAA 4MXWL 2VR7A 1OB0A 3L9YA 2Z1KA 1MJ8H 2P8MA 4CMHB 3S96A 4F37K 3KL5A 3WNJA 2DJSA 2WO3B 3D2UA 4GJTB 1EANA 3ZTNL 3BWAA 4ES9A 2YWZA 5BZDB 3QFJA 5ISZB 4M4RA 2YSSB 3A4DA 1JCVA 1CN4A 1SEBB 2K9FB 1KBPA 3LDBC 3VXTB 5I8OL 2GI0A 2IH8A 4NI6A 3MRRB 5JIIA 4XN7A 3OKDB 2W07B 1I75A 4Z7OB 3KE0A 4ZOBA 4X4YA 3BKYL 5AAMA 3AWFA 1JYVA 4XPGL 3VFWB 1A1MA 4AM0Q 2VKXA 2VR5A 1E4XI 3FBQA 5I0XA 1W8OA 4JO2H 5TQ0L 3H9YA 3ARQA 4KKAC 4QWWD 3QG6A 4AX3A 4X4ZA 3MNVB 4AG4H 5BOPA 5BS0E 3NCJL 4BZ1L 4UNVA 2C4FT 2OJZH 4JKKA 1A4AA 1YG9A 5DJ8B 1J9TA 2DWTA 2W5PA 2CO7A 3MCLL 3O2WL 3U9WA 4K7PH 1R33A 1JZ2A 4IU2A 2XN1A 4LCCB 5KJ4A 2VZTA 2QR0B 5GRYA 4AYMC 4JFHE 5L4IA 1PZ5A 3REVA 1KCUL 1U2YA 4KHTL 3CN4A 3X1BA 3HVDA 4GXVL 4G43A 3UCRA 1WBYA 4BJLA 4JGJA 5FGCB 2HLAB 1QATA 5I15H 3UJIH 3TBSA 4JFEE 1Y1DA 4NM8L 1T7ZA 1B4JH 4TQEH 4XH2B 3WHE0 4HIHA 1HIMH 1JZIA 1NFDE 3PGFH 2EC9T 4S1SH 4L4TB 1IGCH 5HHOA 5G4MA 4ABWA 1F8TL 3PHOA 4WFGD 3V2AR 4GS7B 2FRGP 2DQCL 4ZAKD 3HC4L 4LLMB 2Q8BH 3S2CA 4QOKA 5E70A 3ZE1E 2Z8WC 4QLRA 1BAGA 3MXVH 4UQBA 2ITCB 3W9DA 5IEKA 5DHYB 1CDGA 1R46A 4H26A 3NTCL 4NZFA 2BIMA 5JA9A 1XR8A 5FR3A 3UAAA 4KY1L 4AEHL 4PSRA 3L3JA 4PCKA 4WI4A 1R3JA 1GHFH 4EXKA 4XWOD 3CIQA 3NIDE 2WXHA 4M9OA 3OXSA 4W9HC 2ESVA 3IJSA 1FQ9C 4NQED 2HTLD 1ZTXH 2IIJA 3TEUA 2FYVA 3K2UL 3CE1A 3PHQB 4ZDHA 5JORA 3GZPA 1HYRC 3WXVL 1IEAA 4KXAA 4XMLL 4ZAKB 4OH2A 3FB5B 4GO9A 1R5VB 2AJ3A 5T3ZD 2YGQA 5JHLL 3IN0A 3RGHA 4R0LB 1HH6B 3MKKA 4Y2OA 2XV2A 5EB9A 1J5IA 3LN5B 4JRYE 4QR7A 5CGTA 1ADWA 3UJJL 2DQMA 3MGAA 5ECJE 1KBWA 2G9KA 1JZHA 5H8DA 1FN4B 3LKRA 4QXTA 3GDBA 1C7TA 4JANA 5I1EH 1TFPA 3X3FL 3W11C 5I0WA 4MLIA 4XN9A 1AXIB 3GSXB 3C5JA 4ADGA 1ODUA 1QSED 1P4LB 4AUUA 4Z78A 2VR4A 1E9QB 4G1EB 3GLZA 5KVFH 1ZGLA 2NY1C 4QO1B 1U8CA 4MDIB 1U91B 2D7MA 1H8LA 1RK1A 1OWRM 4LEXH 1FLRH 3AITA 2E7DA 4UOJA 1G4RA 4R6UA 3VW3H 2EIEA 3T4AC 5F3BB 4K55A 2WWMD 3Q2VA 2I69A 5ICYB 1FL5A 4MMZB 4CGTA 3QIBA 5GGRB 3TT1H 1J8HA 3S8WA 4PJDA 5EC1B 2WBWB 4DK5A 3IU4L 1DYZA 3MMEA 1J12A 4EKJA 5TF1L 3Q6GH 5EOCJ 5DC2A 3RPIB 4R8WH 3QJXA 1AVAA 4NZ8A 4M3KB 2OK0L 2G9HB 4WUKL 4GUQA 1GW6A 3UYPA 3KVQA 2X2UA 2YXMA 4LESA 5CJ8A 3SE6A 4N5ED 2M1KA 5I1CL 4TSAH 2N7SA 2R4RH 3K3QA 4XI5D 2KDYA 1UD2A 3R19A 3MGOA 2BIQA 2ZXDA 4IKJA 3GKZA 2KZBA 4Y4FA 5B7MA 1JAEA 1RPKA 4WI8A 1CU4H 5AAWA 5MERB 4LMQI 3RTQC 4UTAA 3UGXA 1IC1A 4RH4A 3C6LA 1PZAA 2WNKA 1ZA6B 2OCFD 4QRPA 3QUMB 5FA4B 2F53E 4RRPG 4ELMA 2FLMA 5E51A 5C92A 1WBZB 3NMEA 4EN3C 4HPOL 4AYGA 2DM7A 2FSDA 3IWVA 3FL7A 3JBG7 5DK0A 2XZAH 1JGDB 5DVOA 1VACB 1NC2D 1B6UA 2VDRH 3VGAC 2QPEB 4IMLB 4ODUA 5C08D 1X5MA 1QSZA 2W95A 5IB5B 3RHWK 5J6GA 2A9AA 2FBOJ 5LAXA 3KJ4C 3LHAA 5T1MB 2XC8A 3PP4L 5TFSL 2B4CL 4OZHA 3M1OA 1N59A 1NGPL 3JYCA 3S98A 2P80D 2X9XA 4HUCA 1PYWB 1WZKA 1LDPH 3FB7B 2EVGA 3BVUA 3T0EB 2R69H 4LSQL 5I1IH 3LD8C 1TVBA 4F58H 1G9HA 5C8JA 2P28B 4JO1L 3LRSA 4KK8C 3OAWA 3LEVH 1JF5A 3WEXA 4HIIB 1NC2B 2F7IA 5D71L 4QLWA 2H9GA 1KY7A 4DVRL 1OAYH 5C08B 1K8DB 1E4KA 1DSYA 5EU7E 3HNVL 1J7VR 2JIXD 4RBPH 1BQLL 3ZE2B 2Y7MA 1NMBH 4JDEA 1KPRB 2B5IC 2OMXB 2LLNA 4B41A 1SM3L 3NIGB 5CSBA 4Y5XA 1WFIA 4A6YA 4K5LA 3JWDH 3WD5H 5B3JF 2GBUA 5CD5D 2FJGB 1YY9D 2UWEA 1A4JA 2YD1A 3EF7A 3NJFA 1ET8A 2XXFA 4P49A 1KBGH 5EPMB 1C9SA 2RCSL 4M02A 5DVKA 4ZMXA 3EUDA 3VG0L 3S88L 4U1IB 1IBYA 3DOHA 3FB6A 5JQIB 4X7DC 3H54A 5EU7C 4FQLL 4NKMA 1MAML 1SJXA 1VFBB 1G9MH 2GEQA 2J57A 2LFEA 2BJML 3ARGD 2DJ4A 1FCGA 2PXYA 4W6YB 3WUWB 5GS1C 4ATTA 5TTRA 1WZ1L 5SWZE 4PYGA 3UBXI 3D33A 3I75B 4XP4L 4LLVB 2NUTB 4ZMZA 1G1KA 1JFHA 4PJFE 2B1OA 1OAKH 3G6JA 4JNXA 4APXA 4FNLL 4LHQB 4TNVF 4L8DB 1G6RH 2GK2A 1G9EA 3CSTA 2Z7UA 3AUWB 3FK3A 2VLLB 4FMFA 1FH5H 1NUDA 2ZUXA 1BREA 5A43C 2K7PA 3HE6A 2GUYA 4M1DH 3CGTA 3RWGA 1JK9A 1CFTA 5BVJA 3C9NB 3V5DB 3ETBJ 3ARGB 1M05B 5HY9A 4PJ7E 3MV9D 2HWZL 1RHFA 4JS7A 4YXHH 2JI1A 4YHYC 2GB2A 4PJHB 1FP5A 4MA8L 1DJXA 4DERA 3UROR 4F7MA 4NOBA 5PAZA 1JPFA 4AQAB 1PZBA 2JKLA 2D9CA 1YQ2A 3IF1B 3TP4A 4M29A 1R75A 5BO1H 4F57H 3LRLA 4W9LC 3G6DH 2FGWL 1S7QA 4TSCL 3TVMC 1SRDA 3SPIA 3GSUB 1GGUA 2DWDB 1NEZA 2IXQA 2XX1A 3BAXA 5EA0H 4L3AA 1PJWA 3C08H 3EGDA 2D0HA 1SXNA 4NENA 5DYOB 3MV9B 1RP8A 4OQTH 5JW3H 5A3ID 3I9AA 1KJVB 3QO0B 1JNLH 3WLWC 1BOGB 2CUAA 2YQ2A 3F05A 4GQ9H 3VYOA 4D0DB 4ELKB 1OPGL 4LCYA 4PGCB 2KMWA 1BMWA 2QDVA 3D1MC 4HXBH 1WZLA 4M6NL 2BWQA 2XXMB 2H32H 1BEYL 3F00A 3FS9A 3GSNH 1RZ8B 1THAA 1E65A 3VXQA 2HYMA 2BHFA 4X7TB 2E0PA 4X8JA 4KKNA 5BMFL 1DJZA 2CDEA 3JVGA 4RAVB 5JR1H 2QQNL 5GZNA 1LEGB 3SBRA 1RIHL 4Z0BL 2UY7A 2CDGB 4O2EB 4CVXB 4YDKH 5B39B 4A2MA 4MAYA 2VLMD 4J6RL 4XXCA 2BRRL 1A1OB 4XZUA 3V9FA 1AGCB 4E41A 1KIPA 5JOFA 5LDSA 2NTFB 3KPLB 3BJLA 3HC0B 2FT7A 5I71C 4OCWL 2NR6D 4P9ML 4JPVL 2HXAA 3KGSA 2X42A 3Q2CA 5HGBB 4F80A 1YEHH 2B7DT 3HHSB 3N44F 4D94A 1HN1A 4N8UA 3I50H 4MX7A 1KYDA 2VIRB 1RUKL 1TT6A 4TV3A 3MLTB 1CICA 3QQ9C 4TKWA 2OR7A 1VZHA 1CLZL 2VITA 3FO2B 2VMFA 3DBXA 4H0HB 4DT2A 4P2OC 3E0GA 4KTEH 4O5LH 1N4XH 3R7QA 2WUBH 4OGQC 1N19A 1E43A 5GGUA 4CSZA 3ZHLA 3LKPA 5BXFB 4E9SA 1ZMYA 1V3MA 2NNXA 2QQLH 3L1OL 4U3SA 1GGTA 2DWYA 1INQB 2QVMA 4YQXH 3W38A 5EEVA 1NGWB 3ILQD 4XNYH 3OGOE 5IFJB 4D2NA 3LKSA 4AUYA 4ZZKA 3AU0A 4JN2A 2ERJB 2DBLH 1OM3L 5EO0A 1VCBC 4QHNA 1TEGA 1MAJA 2J6EH 5SV3A 3S37X 3IGAB 3PCYA 3CG8A 1ZHBB 1UXSA 4LZKA 1JE6A 3EJZC 2IQAB 5F88B 3VVVA 5BZWB 4JREB 4I2XB 1F41A 4O02H 4W1TA 4GKSA 2HJKA 1QUPA 3L1GA 2ZTBA 4JX0A 4H1LG 1KXTB 4L3ED 3CVBA 4ABQA 1YQVH 5C7XH 1MFUA 4K7FA 3C60D 4P3DB 3HB3C 5J6SA 3KDMB 3ZTCC 1W0WA 1GS6X 1CGVA 2L4OA 5B1BB 3ME0B 4XCFL 3L7FA 4F2ME 5L4FA 4HUUA 1D7CA 5AVTB 3T0VA 1QG3A 2K78A 5F89A 5GRVL 3FZUC 2MWCA 3CFKB 4MJ5A 1KT2A 4QI3A 4JZNA 1FIEA 3IDUA 1IKOP 1H6FA 2R1YB 4UTBH 1OZUA 4C83A 4LEOA 2E9WA 4HKJB 4YXLH 5I76B 4FZ8H 3FQ2A 3MV8D 1HX0A 1CBJA 2CPUA 4KUZL 3IGLA 5L8LB 4QHUB 5KEZA 3TWYA 3SPJA 4IGBA 3RX9A 1GZQB 4GKLA 5FIEA 3Q8AA 3FSWA 3SDXA 1A7RL 4L3EB 4Q89A 2FX7H 3FJTA 1OT2A 4JO8A 4PRHA 3S2AA 5C3IA 3CQPA 1ZHKA 1J0JA 2WLYA 2KZKA 4ZFOA 1A4CA 5CGBA 4ERSH 5E56A 2G0LA 4OCYH 1UD6A 4PRPB 4LMQE 5IJVA 5JZ7D 4DKAA 3UX9B 4B0MM 1DVYA 4DVBA 1U8NA 4IIQB 4A6YL 1NCIA 3BZ4A 4C8XA 3GXMA 4NQSB 4M1CC 4Z7QF 4C59B 3MV8B 5CD3A 5HBBA 4ABUA 1C5BH 2NTSP 2VR9A 4BSWA 3ZYZA 1ZHLB 1KJ3L 3VFOB 4A7SA 2P8LB 4ZUSB 1N8OE 4PRAB 1ORSA 3H4HA 4WK2B 4P2RE 4M03A 2QQQA 4PB0H 2CUIA 4PY8J 1I9IL 3MA7B 4CSSA 4QRTA 1MJ7H 3HZYA 4RX4D 2AK4A 5DDHA 1P1ZB 2I9LA 4Y16C 4JQXC 4M7JH 4PJCE 3FONB 4XP6H 4N26A 3ZSTA 3QCVH 3O9WA 3IDJA 1DZ0A 3VVWA 4HQQL 3W2DH 2RQ8A 2WIIA 3VI3A 1FI8C 4JO3H 4CSPA 3CMGA 3TJPA 2TRYA 5CN3A 4Z7WE 5E6YA 3IDIB 2ZWYA 3MROA 5CSZB 3TOPA 1BV8A 3NCBB 4IJ3C 4XO3A 1YYLL 4P3CH 4R7NA 4YVUA 3QZWB 3GUFA 2B16A 3VD9A 3SE9H 4NC1E 1P7BA 2FCBA 3UTQA 4G42B 5B38G 3IFLL 3PLYA 3MLXL 3D85A 4OSUH 4WEMB 4M5ZL 5HYEA 4H8WL 2Y9RT 2ICES 3D6GA 4LNVA 4HHGA 4NNPH 4YHML 4KRLB 1L9RA 2YXWA 3LKOB 3O11A 3X2QB 1PD0A 2J5LC 4HD9A 2QL1A 3L2NA 2EDMA 2HSIA 3RU8L 4P23A 2AJVL 3UG3A 1ORQB 4N0CC 1VADA 2P5EB 1A3RL 1F02I 1TTRA 2RIKA 2YA0A 3LQMA 5JLZB 1Q0YL 4WTZA 3HZKA 4KFZC 4CGUB 3L3GB 1MREH 4F7PB 1SLUA 3OKNB 4PREB 4EJ1C 4ZO9A 4I0CC 3LZFH 4FP8H 3QEHB 5D55A 3A6OA 2PP7A 3CZLA 4EZJA 5I8CA 4NC1C 3FTWA 4MCNA 4PW4A 2N01B 4L29A 4BFNA 2I85A 4OLVH 2O61A 1M6OA 1XEUA 1XHHA 4OM0H 4PI0A 4PJ5E 4U6TA 3MC0A 4FABL 1WSST 1BPVA 3LEXA 1GZPA 4JRXE 4J3OC 3QUKB 1MCJA 4X6DB 3M88A 4ADIA 1TUPA 2IPUK 2P26A 3AG3B 4JO2L 3DIFA 1BPLB 1DEEA 2VZSA 3L6FB 3HG1E 1AHKA 2WNGA 4JFPA 2BY2A 3ALXA 3U48A 4HHAA 5ETUB 1P4BH 4AG4L 1SDDA 5JA8B 1AP2B 1ZSDA 3Q9PA 1ZLUK 4H20L 3WJJC 1FGNL 1KFAH 4XBPB 1CL7I 1I8MA 3QHTC 4ZMVA 1I1AD 2XWCA 2IADA 1USQA 2WWKT 2X3CA 4IDLA 3CLFH 1KEGH 1J5CA 2AJXH 3MV7E 1HHJA 4FL4C 5CKAA 4XO9A 1FF5A 4MXQC 2FJFA 2JK5B 3KM2A 2V37A 4YBHA 2OAAA 3D4CA 5HI5D 4AQEB 3NFNB 2DI7A 4YHNA 1PZSA 3T77B 2BOBA 2H5UA 3HUJF 3FUMA 1JYXA 4BRJA 1YSOA 2B2XH 5ICZA 4Y5VA 2F8OA 2A0LD 3PGFL 1A3LL 2ZD0A 5LCVH 4B9KC 3SGDH 4BE5A 5I17B 2GHWB 4LOVA 1QLRB 2WXLA 3PAYA 1P7QD 4KO9A 5HGHB 3ETBF 2RFXA 2V5TA 3AM8C 1HH9B 1QR4A 4UZUA 5KBKA 1WAAE 3ZYOA 2HX9A 3MREA 4HC1A 3OR6B 4TUUA 1DUZA 3CBJB 3HI1A 4LKCA 1ASQA 4XOBA 3U4KA 3VXSA 1QWUA 2P8PB 2ED7A 4N25A 2E5EA 3L7EB 3PFQA 3F2LA 5CWSB 5BZZA 4PJ5D 1HCZA 1UB5A 3IXTA 3RVWD 2O5YH 2JJTC 2ZP0T 1RFDL 1ERNA 4G6JH 1Q4NX 1ZTXL 2EDTA 2V7NA 4IKLA 4NOFA 4WTQA 2F8XC 2NY0C 2HRHA 4FQQB 1E2VA 5L2KA 4P5SA 1R3KA 5EZJB 2XPZA 2H2SD 2GCYB 1SXCA 4JFSA 3TO4A 3KYAA 1P7QB 5AZ2H 4X9YA 3IDNB 1U8PA 4IMKA 4KTYA 1RURH 1M7IB 4NPJA 2OCJA 5KANG 2AITA 2R29H 1SHWA 3IBOA 3RDTD 4FQJH 4L1DA 3O41B 1DQDL 1OOWA 1BECA 5IG7A 1QRNE 5I1HL 9CGTA 2DF3A 5C2UB 2CO3A 5IVXB 1T80A 5DGRA 4GG6F 2XWBA 3PQYD 4HWBH 5KSBA 3LY6A 4ODXA 5IQLA 5I1KH 3TIEA 3LV3A 4JHWH 2X1WL 3X1FA 2I7SA 2WD0A 2W60A 4WHTB 2BOCB 4K71C 3TBWB 3N85L 5KVFL 5ICXA 3EKCA 1MWOA 1JI1A 1ZV5A 4F37F 2H26A 1H5BA 1K2DA 4WHYH 4CDHA 4ODHL 3HNSH 3DGGA 1O7VA 4X6EA 1LO4H 3B8SA 5EO9B 5FV2A 3II3A 2XTJB 2G75B 4PHXA 3F7YA 4PRDB 4AYEC 1OTUC 2EDRA 5FGRA 2D7PA 5H37A 4RA0C 3CFEB 5EN2B 4AY0A 1H3PH 1K6QH 3CQFA 5AKSA 1S4IA 2FWOB 4KKLC 1JZFA 1D6VH 4K3EL 3ZDWA 3Q8CA 3WENA 2ENJA 5KSAA 1ACCA 3BN9C 2Z65C 3B9EA 1EJ8A 3AQYA 5EC2B 3RX5A 1IAOA 4FC3E 4R8WL 4J8QA 2FTAA 4JM2D 1IKFH 3IDMA 5K5YA 1AFVH 4GRLB 3D25B 4KFMA 3VFGH 4RVBA 4G82A 4ICXA 1U6AH 4KZEH 2YN3A 3ES6A 2QSCL 1OAQL 4LCWE 3AG4B 1HZLA 3DI2B 5DFVC 1F3JB 1IEBB 1EBAA 1R34A 4OUOA 2ATPB 3KYMB 5FK9B 5HDBF 1A6WH 5F9OH 4MMXC 3GB7B 4EAEA 1VERA 1EJFA 3DMMA 3V6OE 1AQKH 4HMDA 2DQDL 1YYMH 2EYTA 2ICWI 4X7SH 1RZIA 5EOTB 3CFDA 1M42A 3NCYP 1FE8H 4Y2DB 4WO4A 5EOQL 1BBDH 5FHBL 3IN2A 2LQRA 2DMGA 4D9LL 1VDGA 4JM2B 2XZAL 3TT3L 4ZTEA 1ETZB 3GIZH 2X2IA 3MCKA 2AABL 3QK0A 4HEPA 3DJZA 1BZ9B 4MSWA 1U8JA 4ZUTA 3WGUB 4ZS7L 2WXOA 4N2OA 2EEXA 4WW2B 3G7TA 2OTPA 2XY2A 1KLFA 3MX0A 3P77B 4Y89A 3UZEA 1B4RA 1SLWA 5AZEH 3I3BA 1URIA 5EZOH 3EW3B 3IRZA 3BFWA 1H8OA 1TVHB 5IB1A 4RQQB 1CD0A 3T3PB 3DOIA 3MLZL 3TL5A 1B2WH 2F5AL 3NESA 4NCC2 4KQ3H 3F58L 4X2UA 3MBEA 4LHUA 3H2QA 1WWCA 3RY6C 3CDZA 1T83C 3KPQB 2BSED 4OLYH 2HCZX 4GQPH 4UQ2B 3MCYA 3TN0D 2XBTA 1E5ZA 1NAMB 5C0CE 1S7UA 2GC4C 3LEVL 4FFYA 2Q8AH 3QCUL 3SDAC 1ONQA 2ENQA 4UCFA 4DWHA 4PVBA 5KYWB 2A1WH 4M61B 2BH0A 4YGVA 3BIBX 5KYNA 4I0PC 1CK0H 2XUWA 3P9MA 2FEJA 4N0YH 4Q9BA 2E46A 1QFWI 4NHCL 4F2EA 5D1ZB 2B77A 3LN4B 1BVZA 3TYFA 2BNUB 3NZ8A 4GP8B 3L95B 3QNXA 5T1LA 2DIEA 1JXGA 3FOMB 3QWOB 4MDJB 2VR3A 3Q1SH 3AS0A 5AYUL 2JKSA 5J3HC 3K4AA 4ISVB 3VSQA 1Z5LB 2P47B 4R2GD 4F27A 5FF6A 4PLNC 3TN0B 3GO1H 4TL4A 3O8XD 4XX1G 4JM4H 3ZL4H 1KBGL 3QJVB 2NY5C 1UD8A 5EIIA 5IJKA 3GUTB 1TETL 2ED9A 3H42H 4Y4HA 4HSAC 3W0WA 4WUUA 2R56H 1E6JL 4PVMA 1I82A 3NUKA 4WWKB 4NSKA 2ORBL 4MCZB 3EH3B 4TMPA 3VDAA 2W9DH 2YD0A 3QUYB 4A04A 3D87B 3K7UA 1HCYA 1M1XB 3FCTB 3F7PC 4Q7DA 1JHTA 4U1KB 4YDMA 3F7KA 2QPDB 1PVHA 1QSVA 2HVBA 1OGAE 1KPUB 2BVQB 1OKEA 3TESA 1P84J 4R2GB 1F6AA 5F1IA 5C7ZA 1WIPA 4NWTH 1CFBA 3O8XB 2QPSA 4FAAB 1E28B 1G1OA 5DQDH 2FWLB 5C09A 4PJIE 3TTSA 3NJMA 1D5IL 3W5MA 4K8RD 1MAKA 2HFFB 1QUNB 1KB3A 5C6TH 1YPZF 2BC4B 3LRKA 1AS8A 1YUKB 5ESQA 5HD8C 1MCFA 3K71A 1CE6A 2VQUA 3CVIH 1HJBC 4WDIA 5HP5A 1F45A 1INDL 2DQJH 4CJ1A 3WIHA 1SBSH 2ZZUT 4HC1L 4NQDE 4NZRH 1T4KA 4H25A 3STLA 1F3DH 1HHKB 2J55A 2UYLA 3K1KC 2F19L 2DEXX 4O4YH 1T0PB 3D06A 4WI0B 4GW1B 5DO2C 2AQPA 5IK3B 4F7KA 2J1ZA 3QAZB 5D7IE 1RZJC 3GBDA 4NDMB 4QXWA 5FOBB 5CN1A 5EH1A 4G6KH 2K45A 3U0PB 4YC2B 1IM9B 1ASOA 1SYSB 3O45A 4LIQH 2WMPA 4R4FL 4H5SA 3GSOA 3OAYK 4UYQA 2X4NA 2Y6SC 4Z7VE 3GJEA 5EA0L 3WFCH 4B3EA 3C08L 5BOZG 5JO5A 4TRPH 3RYMA 3K6NA 3QXWA 1MJUH 4ZMNA 4OQTL 3BAYA 4CRPA 4OT1L 2IDSA 2X7LA 3VFNB 2AXFA 3CZEA 4GQ9L 1PCSA 5F96H 1U2HA 1K85A 5CEZL 3BGMB 1JGIA 2IC2A 3ARDA 4KMQA 15C8H 1MHEB 3S9DB 2E9BA 3FQRA 3KGTA 1OTSD 2NPLX 4P4KA 1ZXKA 3BFQG 2AJSL 2CRIA 2XFXB 5TDPB 4DP6X 1ZWIA 3QI9A 4P59L 4ZFGH 4UWQB 2N7BA 2WOBA 2CD0A 4KX8A 3I2CH 4FDWA 3SB3A 3MOAH 2JCCF 1KDIA 1FFPA 2YBRA 4JK0D 4WKZB 1N3NB 4YDKL 2VXUH 1FAKT 5EU3B 3BSZH 1J9QA 1KCLA 5M95B 5I2IA 1JWUA 2VISA 3ULUD 2ZX7A 4LNRA 2DL2A 9PCYA 3QIWC 4JEGB 3V0VB 4IU3A 3OB0H 1RLBA 4DETA 1I8UA 43C9B 2VN4A 5L6YL 1LHZA 1Z9SB 2BS71 3BC9A 3K2IA 4PTTB 4R4BB 3BP6A 1HK6A 5T5FH 1MFCL 4GBXC 5DRWB 4XOEA 2FUQA 2E86A 2XQ0A 5GGVH 3WFDH 2AQ2A 5IEHA 3RVXD 2EO1A 4PJGE 4G9FD 4I85A 5IW6A 5BQ7A 4KTEL 2IPUG 3IB4A 3NCXA 4L37B 3D51A 2WUBL 3DSNB 1GZHA 4GAGL 2A9ML 4FG4A 2XCMC 5E2TH 4UT9H 4M62H 1SJMA 3N5AA 1RCYA 3IXAA 4MLSA 3W37A 2ZUUA 2HKFL 3JYBA 4XNYL 4AE0A 3KPSB 4QKTA 4C56E 3ATFA 1BIIA 1AY1L 2FX8L 2J20A 1OP3H 1XEDA 1YRKA 1F58L 2NSQA 3H6AA 4N0RA 1NLDH 3GYRA 3HRZB 3T1FB 3UTZB 4OLWL 4N5UA 3X14A 1NOAA 2J6EL 4G6ML 5D6CB 5FYJD 1OGPA 4WWOA 5BQDA 1U4FA 3V55A 1BFOA 1J1PL 1NC4B 1WZMA 5CU5A 1AJ7L 1WE5A 2ZOLB 1ETB1 2ZCKH 3LPWA 4XPBL 1U95B 1DEDA 2W92A 5C0DB 3U6XA 5IM7B 4UTAH 3EYFA 1NGQH 2D7QA 5CHNA 3GSWA 2BP5M 3NCFB 1K9TA 1A9BB 3VD5A 2R1XA 4YDLB 3TCTA 2NUPA 1CLCA 1V5JA 4WI9A 1TXKA 3G04B 1BLNA 5HDQH 4I4WA 1PPIA 3SGKC 3WY3A 4KUCD 5AEAA 2GJZB 3T9WA 3GGWA 2VC2B 3AS2A 4W93A 5H94A 1DN2A 4XCNA 3F12B 5HJDA 4ZOEA 4GOSA 2AV7A 4FZ8L 4H1LB 1JXJA 1A6AA 1BW8A 1WA0X 3I6SA 4NJ9L 4PG2A 3RI5K 4U1MB 3UAJC 4OI7A 2VDQL 5B8CC 1IX2A 1YMHB 4FFYL 1VFUA 2F8IA 4HH9A 5EO1A 1LO5A 1A7NL 1SHMA 2FIKB 1OD9A 5KYYA 1BCIA 5IV2A 1CXHA 4FYTA 4O2FA 4PJ9D 3MBXH 4RZCA 1ZVSB 4FNPA 3FF8A 4K15A 1R19A 3GMPB 4MRBA 2PCFB 4IRJB 3VXRA 2J8UB 1J5DA 4MB3A 1GC1L 4F8LA 3VXPB 8FABB 4KOBA 4AIZB 1NWPA 2EKSA 3N9GH 3T2PA 3ULVH 1T20A 1UFUA 2YOCA 4QYAA 4NQCE 3PGCA 4L3CB 2VLKE 1C5BL 1OSPH 4NZJA 1E27B 1HC1A 2FR4A 1MDAA 1NFDF 1J10A 1X5ZA 3TZVA 4YUEH 4WNSA 3RFZA 4FQPA 2Q3ZA 4HAGA 2WPGA 2VSCA 2XVGA 4PB0L 5TPWH 3ZE1F 3LZQA 3QHFH 3WN5B 1MCHA 1MCPH 4RAUA 3KR3H 4PJ9B 1MW2A 1NIEA 3FB8B 3DV6A 3KGUA 1U93B 1UZ8B 4ODTL 5B21A 3I6KA 1Q8MA 2D03L 4IOFC 4PJ8A 2BK8A 2X4RB 1WV7T 4HCGA 2HG5B 3AREA 3FF7A 4M7JL 5F0JB 2YGVA 3H85A 1JXFA 1GVIA 5FEBA 4HJGB 2VOTA 3UTTA 3W2DL 5DD0L 1BG1A 2C1OA 1E3ZA 1C5DB 1HE8A 2GUOB 2H6UA 1MCOL 3NIDF 1FORH 4JFYA 1WCBB 3FOLA 4ODWB 4OZGE 3GMLA 5DD1L 2EXSA 1HXMA 4MA1C 3FQUA 2AJZB 1Q90A 3MRCA 4ZMWA 3P73B 3UFIA 1Y6KR 5DZOA 2QGCA 5D7LD 5GGTH 4Z7NB 1I8KB 2LR4A 2DKUA 3UBFA 4AYID 2BZ7A 4J27A 2VQ4A 3ZN6A 2JKIS 1OOAA 2YAFA 3V95A 2WXIA 3WIFA 1VEMA 2P49B 1MUJB 3QDGD 2CK0H 1FNEB 4I48B 4MS8C 4UQDA 3RY4A 5FO7A 3ZGIA 5BRZE 1BF8A 4N20A 4ACTA 3OXRB 2VDLB 3UDWC 4Y9BA 3UPAA 5AENA 1JPTH 2W0LA 3MRFA 2VXQA 5HYQA 3VTAA 3D4YA 1MWAB 5JOPE 5K9OA 2X9YA 1KCRH 4JQVC 5C0RH 2X70B 2IH9A 1NCBH 4EI6A 4MXVF 2E7MA 3MRDA 5IBLD 3R18A 2R0WH 1XSOA 1DCEA 5J6HA 1ZV9A 5D7LB 3N41B 3EOBA 5IBTH 1TIUA 3LZFL 2DQGH 1WICA 3APDA 3BWUF 3OWEA 4I5BB 1WHPA 2EECA 3QUZB 4V2BA 2FDBP 1AZUA 5DMIH 3VFVB 4IEFB 4LBEB 2DQUH 3QDGB 4OJYA 2XPGA 1MG2C 1QEWB 2B4CC 4U3HA 3VDBA 3QYMA 3Q2LA 1AQHA 3P1VA 5DA4A 3ZBMA 3HG0A 2OMNA 4OM0L 4L4VD 1GYVA 2CDFB 4J3XA 5FKAB 4YLCA 5E2VH 1BQRA 4QUOA 3WIAA 1A4KB 3TYGH 3R4DA 5DEFA 1RAMA 4N2HA 2YS4A 1CBVL 4M8QA 3GSQB 5E5MB 4E0RB 1ZT7B 2GSIB 4GUPB 1P69B 4X0KA 5I82A 1A9VA 2FLBT 1R5WB 5HHPA 1SY6L 5I73B 5KN5A 3LHPH 2YAOA 1CI5A 3HHMA 3WN6A 3H3PL 1I4FA 3AMLA 3FO9A 5CCJA 1PLAA 5E5RB 5C86A 5FYJU 3AACA 3GI8L 1GPOH 5I75C 3CLFL 3SYOA 1S78D 4JFUA 3X1EA 3N1FC 1EHLH 3VH8G 3M7OA 5BW7A 4P57A 1AMYA 2PW2B 5AZUA 4L4VB 4Q4IA 1FO0A 2XKNB 5E7FA 4LLWA 4QNPF 4DEPB 2Y07L 1IBFA 4XVJL 3V4VH 2EUXA 4LB8A 4S11A 5JXAH 4LPUA 2VXTH 4YHKL 3O4LE 3P11H 5E0QA 5AAMC 1D7DA 3WY1A 5I8EA 1I3GH 1S9VB 1TCMA 3GBMH 2DQFB 1FUNA 2OI9C 2WOYA 1BZ7B 1NANH 4OZFH 3EDDA 3VXMD 2YEVB 2CHNA 2WKOF 1XSIA 4XODA 4HIEB 4OFPA 4R7VA 5DMGC 1SQMA 5F7HA 1JHKL 1SYVA 2Q7AA 4Z0XA 2JCCB 1J0KA 1U8HB 1XXDC 2I5YH 3TPUA 4NUJB 3DSFH 1JGVL 4NB7A 3U1PA 1OTTD 3QEQA 4TPRL 1I3RA 4GIPD 3ZO0A 3EBAA 5C97A 1FVCA 3O6FC 4N2KA 3LKNB 4ZBJA 1LE9A 2FO1A 3ZXAC 5MENB 4DGYH 1S7SB 1S9YA 3VO0A 3RE0A 1OK8A 3T0BA 4YEEA 2I07B 3GIVA 2AKRA 1G7IB 3B83A 3VXMB 3NCCB 3IYLW 3PAUA 4HA1A 6FABH 4UUJA 1VKXB 3CDGA 4KKBC 4U6VH 4N8PA 4LCIH 5DRNB 5AZ2L 2G2NA 2QLYA 2ZUSA 2YUWA 1OE3A 3H7BA 3LDBB 2EDEA 1KELH 3QQ3B 3LNDA 3AW5A 3T6WA 3WKYA 1UCBH 2JJSA 2ZAGA 4WF7A 5EFIA 4QT5B 1P5UA 3HN8A 4Y19A 4X99A 4L5FL 5E1GA 3AGVA 1ZVHA 2WB7A 2ZONA 2OMBA 1WFOA 3L45A 3VQ1C 2WTRB 4NBZB 4GPVA 1PEWA 2GJJA 4WI2A 5I1KL 4G8GE 2WXFA 1BOYA 1N0XH 3BHBA 1CVRA 1MI5D 1B90A 4X8XA 3FU6A 3A67H 3ZRSA 1EO8H 4IJTA 2FSEB 3HCVA 2JB6B 3CC5A 2F54A 3RWDB 1DJGA 3NOIA 2X1PA 1AQDB 3HLAA 3HNSL 4K7PX 2XRAH 2UX6A 3CXFA 1LO4L 1EHNA 5C0GB 5DHVB 5AWNL 5DWUH 5FYLL 1NH6A 3MRBB 2ALAA 1H3PL 1ECYA 4XC3H 1TQWA 1VA9A 4PJFF 3JWNE 2IBBA 4NCDA 4MYPA 2WC7A 2KHAA 3B7UX 4NAQA 4M7LH 1YEJH 2GIYA 2CLRA 1X7QA 1OSZA 3PWJA 2YAPA 1GJUA 1DL7H 2I32A 1MI5B 3CZFA 4Y1AE 4N6QA 1S5IL 1S9XB 3U9UB 4TVPH 3VFGL 3OLDA 5CEYA 3D07A 2CO6B 4YDJB 3H56A 3P4NA 1CQYA 1KMGA 12E8H 3QGVA 4CKQA 5TK4A 4PGZA 1KF9B 5A2AA 1DLFL 4KJYA 2CCVA 4FXKA 3VMNA 3D9AL 1W8EA 2L8AA 1U8MB 2ITDB 2R27A 2Z34A 4PJ7F 4AVHA 3BAEL 4XOCA 5ALBL 4ZI8A 4G3YL 2HRLA 1VB9A 3CFNA 3DO7B 1AE6H 3MJ7A 1HZKA 1ZLEA 2AQTA 5JW4M 1QI4A 4Q9QH 4ALAL 3W11D 3JWNC 3QIBC 1AQKL 2D0GA 4JFEB 1TZGH 4X7SL 4ELME 4E9QA 5C0NC 1FE8L 2X38A 4HBCL 1N2RA 1BBDL 4BBWA 4FQXA 1HEZA 2C7FA 1FNSL 5DK2A 2NY1D 2A6JB 4IDJH 4QKXB 1IGTB 4X6FB 2F7RA 4FTVD 4FX5A 2XN9D 1H8NA 3L4WA 4MKTA 1XGUA 1A7QH 2COVD 4YFLI 2CKBH 1I1RA 4DFHA 5C0BD 1EXUA 1DVFA 2CBQA 4CDGC 3ZDYB 4E9TA 3PL6D 3AY2A 1T1ZB 5DF0A 4PRIA 3CUPA 3P4OA 5AAWC 2XV0A 3HJ0A 4Y4KA 3MUHL 5GRZA 1E0OB 4M5TA 4ZTOL 5JW5A 3DROB 3T8XB 1P0SE 2KPNA 3C6LC 4FXGC 4NNYA 4AV0A 1B2WL 3UYRH 4H8QA 3WNLA 4HWNA 1MVUA 3BT2H 4U4BA 1QKZH 1VGKA 1AKJD 5EF2A 3V7AE 5KVEH 3ML9A 3BXNA 1FL6A 3HS8A 1JGEB 2NY1B 4YDVA 5CUSL 1BZ8A 1XAUA 2WLJA 4FTVB 3PWPE 5HHMD 4P2AA 2Q6WB 2XN9B 1SMDA 3HS0B 3LRGA 4IKIA 5BZXA 2EIKB 3V8OA 4GKNA 4DAGH 1CK0L 1WHOA 4ZFFB 3QXVA 4Q0XL 2I7OA 5C0BB 3ZHDA 5D7SH 2GT9A 4PBVC 4B60A 1YNKH 3PL6B 3T4AB 2ARJB 3C5ZC 2PR4L 5I66B 2Y7OA 4FNRA 4G7YL 3T6ZA 4J4PA 1ZEAH 5DJ2B 4LU5L 5ADPL 2AF2A 4YR6B 1EZLA 1A9EB 1FJ1B 3GHBH 3EGSB 4NI3A 5K9JL 4PS4H 2AANA 1ZS2A 4PLKD 2CBMA 2UWEE 2UUDH 1TU2A 1TYJA 3DWTA 3OAZH 4FKKA 5F1OB 1UVQB 3OPZH 4V1DD 2GBVA 3B9KA 5C0AD 5TGBA 1M57B 2GTWB 5HHMB 4MNGE 4K5PA 3SDDD 4ODSH 3ARBA 5AVXB 4P5TD 3H42L 4N0UB 5JNYB 5TD4A 1DFBL 2CRZA 4HH8A 4PLJC 3KPNA 4WJ5B 4EI5A 5IMMA 4PM1A 5AOZA 1E4KC 4GAJL 4CC1A 1BX2B 1E8WA 1K4CB 1HSBB 4NKDA 3OKOB 1D5BA 2D73A 4DKFL 3FCSA 1TYRA 3DVGA 3RTQB 4TTDC 3UBHA 4G70B 2H3NA 2VXSH 4A68A 4JFDA 5TDNA 3ESMA 4HF5H 4WTWA 4U1JB 3JUYA 2XN2A 1V3JA 2Z92B 4G8FB 4Y5XC 2ZX9A 4LDEB 3K74B 2PW1A 4H0LC 3HUJA 4EN3B 4G1MA 3ZIYA 2X3BA 1AHMA 1IC4L 4H8HA 3EO0A 3LS5L 4OLEA 1YEEH 3MU3A 3PJSA 4KNSA 3VFMB 3VGAB 1XDTT 3WG7B 4R83A 3G5VB 4RDQF 4W68A 5J7CC 3D12B 4P5TB 1HXKA 4C4UA 3LX9A 4AQ1C 1DVQA 5C6TL 3EFDL 5I0ZA 1IGYA 2W81C 3UO8B 3PWPD 1OSEA 3SKMA 1VEPA 3CVIL 5MEPA 1IGFL 5AVZB 1I7ZB 2PXYC 2DQJL 2ZXAA 4OFYA 2E7LC 3EXJA 1AC0A 1T6BX 2J25A 1KIQA 3QYNA 3N06B 3ZYJA 3MFFB 4O4YL 1K4DA 3SKJH 1RIVH 3NSCA 1RY7B 5FGSA 4L2LA 3WIIL 2WWNA 2HRPL 3PPEA 2MKLC 3T4YB 2W88A 3REWB 2HX7A 3O6LH 3RGVA 1ZT4B 1GCFA 1WH0A 1U3HD 4Z95H 1F86A 5SV4A 4R4ND 1FFOA 3LVTA 3HE6C 2FAUA 3TBCA 1J05A 4LIQL 3B1TA 1HE7A 3WFCL 4HPYH 4YSTA 3C8HA 3BYTA 4H8WC 4NUGL 4TRPL 1I8IB 4KDWA 1JNJA 1BWMA 2B5IB 3MJ9H 2I25N 2V2XA 4JDZB 4KRMB 2EYSA 5AW2B 1G7JA 3S8FB 2DWEA 1PLGH 1IAKB 4AOFA 1D9KA 2P24B 3GBLA 3QR0A 3TV3H 5EUOB 4GG6A 1GXEA 2X4TB 2TRHA 7FABH 5IROA 3VSTA 1X4ZA 3VD0A 3HG2A 4X80H 2UZIH 3FQNB 4Q2ZA 2ZNWA 4QHPA 3QNZB 1WC7B 5FECB 5I18H 5T3ZH 3O4OC 3P4MA 1AD9B 2Q3AA 5LNDA 3P3SA 1UT9A 1MRDH 5D2NE 3ROLB 4NRYA 2X4PA 5EULV 3ZHKA 4ES8A 1JF1B 2OYLA 1BVKA 3ARFD 1UB6B 3P02A 4RGOH 3BKCL 3KPMA 2A6DB 1U58B 3ARWA 3DJRA 4XGZB 5GS1B 5HPMA 2VXUL 4DOHE 5DXWA 5DEGA 3QSKB 2GSMB 4PJCF 2AJUL 4E41E 3N91A 4HYTB 1QA9B 3W39B 5BPPA 2UVEA 5JXED 3V0FA 3ABKB 1CXFA 3QCTH 4X6CE 2VMJA 4Z7WF 1KWKA 4J2XA 4XVUC 4KZDL 1H0DB 4WU7A 5EOCL 3L1EA 1AR2A 4Z7UE 3TVMD 2O30A 4UDTA 4A7VA 2B14A 4OAWB 1EEZB 4LGPB 3OPUA 1P5VB 3BI9X 3ARFB 5E2TL 4XX5A 5HI3C 2BS8A 4YEFA 3MAWA 5C07A 5GZNC 5HHXH 3FRPG 4TUOB 2QSVA 4YSPA 4CN1A 4LSTL 1KTCA 3WSQH 1LQBC 4GXUN 1ND0B 3QUMH 1RMFH 2VAAB 4MAYC 4XXCC 1XFPA 5ACMA 1TQSA 3ZPDA 5DJAA 3BMVA 3J2PA 5I30L 3FQTB 5JUEL 5SX4H 3QAQA 4J3OF 4NX0A 3T09A 3D2TA 3QA3B 2WQWA 5FO8B 4AUJA 3OHXA 1DFXA 2N0KA 4B5ZA 1AZCA 3H0TB 5IHWA 2A38A 1S7XB 3IDGB 1ZTXE 4M6OH 4YPJA 2ZCKL 3IDYC 2XIIA 2IBZY 2WJ7A 4GG8A 3TVMB 3MRHA 4FA8A 1CICC 1DQJA 1OD7A 1N7MH 1GL4B 3ZDZB 1LE5B 5AD0B 2J88H 3S35L 3DARA 3TNNA 3A47A 4XBEH 4RMUA 1B4LA 3IKCB 5IBUG 5L88L 3QQ4B 3T2NH 3N55A 3RWHA 1OAUL 4JY5H 1H6UA 5D93B 5F7LB 1T6VN 3TU6A 5AOJA 5C9KA 4P5MA 5D7KD 1NKGA 1DBAL 5DA0B 4BH7B 1IM3A 1WAEA 3MO1A 3QUXA 1OIOA 1DLHA 4AYFB 5J4MA 4DP9X 4JZJA 2XQBH 2CMRL 4X50A 1R3IH 1QQDA 2WLLA 4PJXA 4F33A 1TNMA 2CK2A 3BUBA 5IHZB 2E7HA 3AZUA 3QDJD 5KVFE 3C8DA 5D1XA 3U9PL 1Z3GH 4UQ9A 2JKJA 3SDXE 4XCCH 4X5WA 1MCQA 3FUDA 2X87A 1GCYA 2XQYK 4AW7A 4F9PA 4HS6A 1I3UA 3QG7H 3O3AB 3NRFA 1LK2B 3DPBA 4DO6A 1SN2A 3IRPX 4HLZH 4XNZC 5D9SA 5E00B 4CNIB 5I71B 2DYPA 1W80A 4HMCA 3VFTB 4P4RA 2V2TB 4NQUA 4KDTA 3X3GL 1RK0A 2AJYL 3RVTD 3WFEL 1J5HA 4ZNEE 3FQWB 1OSPL 2Z7WA 3NA4A 5EBMA 5FUOH 4DN3L 3UADA 2X88A 3QDJB 4PJEA 4RISH 5E9DD 4IGBC 1GGYA 1HINL 1QNZL 1HU8A 3L5IA 2EINB 5E6IC 35C8L 1W6WA 1TKWA 4I3RH 4BZ2H 1MCPL 3KR3L 1ITCA 4NZDA 4WV1B 1LD9A 5E8NA 4M7ZC 1KV3A 2MNUA 1CD8A 1WAAF 5IREA 1T0OA 3MRGB 2RMNA 1BFSA 5GRVK 1XF3A 1JV2B 2ZNXA 2Q9OA 2EABA 3AROA 1OP5K 5JIPA 3LKQA 3IJ7A 4KJWD 3DK2A 3MXWL 1JJUA 2DTMH 1B3JA 3THML 2UZYB 4M1GL 4PYHA 1PLBA 4YIQA 3DXAD 1DQTA 3T1WA 3FT1A 3D05A 5E9DB 1Y18B 3OKMA 4WW1B 1C8PA 3I84A 1CFMA 1A7OH 2AMGA 2BM3A 4X4XB 4X5XA 4TQ8A 1QBLH 5AB0A 2ILLA 4NQXA 1YPZA 4UM8A 1EZSA 1AACA 1N64L 2ARJQ 3NQKA 4HT1L 4HZLB 4LDLB 4R7DA 4YFEA 2CK0L 4Q6IA 5F7DA 3RZCA 4J39A 1AG0A 3L3HB 3P30L 1U8QB 4LSRL 4MWFA 4MMYA 3VFUB 1GSKA 1W72B 3WV0A 4L8SC 3U4BL 5FUZL 4EZKA 2FATL 1MHHA 1GA2A 4ZPTA 2CJ3A 2H1PH 2BSCA 1JPTL 3INUH 1GIGH 1GAFH 3B2UD 3BO8A 2XWZA 4NWUL 1QSFA 4JPSA 2DWXA 3V6ZB 1LWHA 4MJJA 4EDWL 3LQZB 3S36L 2XXCB 2HTKD 5CLXA 4ABVA 2A9DA 4MJIA 4JR9L 2YRPA 4EF3A 1M71B 2IANA 3GS4A 4E36A 2HJFB 4IBWA 3K6IA 4CAGA 4M9PA 2WLIA 1EFQA 2NX5A 3CHOA 2NNAB 5DD5H 3BPLC 2DQGL 3KW7A 2WB1A 1KIUB 4APQA 4KI5E 1EAQA 25C8H 1S46A 4F2MB 3A4EA 2DYRB 3QO1A 3FN0H 1FV1A 3O2DA 1I9JH 5LGKA 2A6IB 4BCYA 1QO3B 3L08A 1WTLA 2B20A 1BBJA 4P23C 2ICWJ 1EDYA 4OCSH 4XB8A 2JKNA 5JDSA 3DUUB 1T2XA 1XF2B 4FG0A 4FQ1H 1CE1H 2AQQA 4GSQA 3VCLB 1PX4A 1VJSA 4Q14A 2VSDA 5AW5B 1V7NL 3BP5A 2R7EB 3T6QC 4RAHA 2GY7B 2XTSA 1XF4A 4G5ZH 3RI5F 5EBGA 1DN0B 4U6YA 2IEPA 4N6RA 2CGRL 2NY2C 3LHPL 4Q6KA 5EIQA 5F93C 3V0AC 3D39D 2QDWA 4KI5C 3FN3A 2J4WH 1X4XA 3G6AB 2XICA 1S9KC 4IRZA 2CO2A 1EHLL 1HZHH 2JJWA 3G5YA 2WZPA 3DRTB 5EZIH 1OZTG 5J13C 2Y72A 1QLEB 4XT1C 1SMAA 4HBQA 3V4VL 2BDNH 4X0NA 4HG4J 1MW3A 1U8KA 2CJTA 2A83A 3NSJA 4CUCA 4QHLB 4HAKA 1R24B 1I3GL 1T1XB 2GJ6D 4FMKA 4K94L 2MTPA 4IJ3B 1UENA 3BVNA 4QXUL 1N0LA 3UPRB 3FYIB 2HFEA 5KBMA 5DZJA 4BFOA 2F58L 4NPKA 4P2RB 3FFDB 3CDFA 4QCIB 3MRNA 3EG9A 3VH8B 3DVNA 3IAQA 3L2LA 3D39B 2F68X 1JK8B 2ICCA 2QJDA 1EXHA 2GEEA 5F3HB 4MBRA 2XV6B 4PJCB 3ATDA 2SODB 2J5LB 5FFOA 5FDWB 1UACH 2EH7H 4L1HA 4F8OA 1HHIA 2V17H 1O9WA 2NQDA 1SDYA 4AENB 1FYTA 4PGBA 1LK3H 2J8OA 1DZBA 4PCSA 2ED8A 4DK3A 5F1NB 4Y5VC 5D7EA 1E4JA 2R1WA 5HHVH 4HV8B 3EJSA 2DDQL 1MQKL 3PV6B 5TDOA 3SGDI 4CU7A 1LEIB 1SUJA 5HJGA 3UGEA 1QW8A 1E9PA 5AOLA 1A6VH 5IROD 3E3QC 3NABL 2G60H 2FLRT 1GGIL 5IFHH 5JIQA 3ULSA 2L7EA 4AEIL 2E74C 4XVOA 3T2LA 2B1AH 1KTJA 1MH5B 1XR9A 4NQEA 5CEZE 3SYAA 5KBLA 4XOAA 3RNKB 4GRWB 1S3KH 2C9XA 3QHZH 4UOW0 3S4SB 1N0XL 3QFDB 1LNUB 4N0FA 5INCB 5BS0A 5HDWA 2BNRB 1RUAH 2F8VA 2IO5A 3VNZA 1D6EA 3ZHNA 3BP7A 4LFHG 3SQOL 1U3YA 1T7VA 2HKAA 4P2QD 4AJVA 5IB3A 2R0ZH 2Z35A 1A6TA 2XRAL 3I6GA 4FL4B 4O9HL 4IMKC 3WYRA 4AITA 4DPRA 5KS9B 5DSCB 4OLXH 1B88A 3BQUD 4U6HB 4MQ7B 4WWPA 2Q7YA 3BH8A 1CFSA 3PNWA 4QXGH 1GTNA 1QSEA 3A5VA 4KJQD 3DV4B 4JRXB 3A21A 2IAMC 2AAVA 3WJMA 1IC5L 4WVRA 4JDTH 2IMNA 2VN3A 3UC2A 2VLJD 2BX5A 4IHBA 4JFWA 4U33A 5KW9H 1PQZB 3CFMA 2VUKA 3OX8A 3ILEA 4EO5A 1NFDA 1DR9A 1X5XA 3PGDB 3WTUA 4Q9RL 2NY0D 2BFVH 3LIZL 4Z9KB 5L8JB 1YMMD 4GRMA 3HIZA 4TVPL 2G2RA 3EOAB 3MUJA 2PWGA 4H2CA 3TBVB 12E8L 4CJ0A 1V10A 4OV6F 5FB8B 5ID1B 1Z2KA 1J88A 1E3FA 1H5BC 2XNAA 2ZWSA 2CU9A 3TO2A 3B7RL 1JOIA 3BQUB 3CN3A 4JG5A 5EU5A 1XCTA 5DZNA 2CSPA 4M7KH 4IK6A 4FLOA 5GJSH 5JPNB 5KG9A 2WLNA 1IARB 5SWQA 1AE6L 3SD2A 3MJGX 3O6MH 2OFQA 4Q9QL 4KBPA 3E8VA 1XF1A 2R23B 1IGJA 5D7IF 5KSAC 4CADA 4AZ8B 1X6LA 3IAGC 1NGZA 3IJEB 5DZAA 3UEZA 5IVNA 2P1YA 4N1CA 1YEWA 4BFIA 2NY0B 1T21A 5IESL 2EEFA 1QMUA 3DX6A 5LHDA 1T0MB 3FTGA 1YMMB 4NO2A 2X6VA 4J1UA 2XSKA 2O1AA 5DUPH 1JRHL 2ZICA 4X7EC 4Z7VF 3Q6FA 2GTZA 1ZY9A 5DTFA 3OKLB 4HKZA 1I1FB 3HG4A 5J1AB 5F21B 1RXLA 2Y6TE 5KVDL 1XGRB 2DIAA 3QE5A 4M5YH 2WVTA 4JRYA 1FG2A 1V3KA 1MCWM 4BD4A 5DJYA 1QYGL 2MHAB 2E8YA 2XZCL 3DMMC 3FFCE 1ZLSH 6TAAA 4JFXB 4K3DL 3C6SA 5F0MB 1JUFB 2JKRM 2YSTA 3S6CA 4MGXA 2YK1H 4WO4C 2D3VA 4LKXB 5DS8A 3S3PA 1JD7A 1MDTA 5TQ2H 2P52A 2F1BA 4BQ9A 3WTTA 4Z23A 3GNMH 4K9EH 4DAGL 1CF8L 3LOWA 5LQBH 4KUCF 1U8LB 3BPNB 4OCLC 3ZU8A 3UZEC 2VXQH 4FFVD 3APMA 2JWYA 5DZPA 2C3XA 1S8DB 1KYUA 3O2DL 3QJHB 4AMKH 3TF4A 2CA4A 1QRNB 4W9KC 2BSDA 3HN5A 4PUBL 3X13A 2OX5B 5D4QA 4HLEA 4OIIH 3MFGB 2B59B 3S3JA 4PV8B 4OF7A 4WFED 3QUHA 4NZUL 4I77L 4PS8A 2JCWA 3GHBL 5LLIC 1UXMA 1F4YH 4QTHA 5INDB 1IAIH 3ZR5A 3OPZL 2C3VB 4W4OC 2R15A 2JIXA 4LF3B 1E5AA 1KCSH 4PJGF 4ODSL 4UT6A 5IQ7L 1C08B 2OL3A 3MGTA 4G83A 3W0WE 1GTFA 1CXLA 5CF3A 2F15A 2WBKA 3OQ3B 5CBAB 1SEQH 5BV7C 4OI9A 5C0EB 1QX1A 5AVVB 1QBMH 3C87A 5FWRA 5AW7B 4G7VL 4R26L 5K9KB 2HMIC 3TA3A 3BE1H 1GC1C 5DQJB 2NY6D 1UYWH 3IRCA 2F53A 4FTDA 1GGCL 4UIMA 1W2KT 3TASA 2GHZA 1L9PA 2WK2A 2DLGA 4IOIA 2BVPB 4NLHA 3VFSB 4NAJA 4PV9A 4NO5B 1G1YA 1J11A 1QTPA 1I1YA 5C09E 1LO2H 1P6FA 2WKOA 5IJKC 3GPEA 3NN8B 3BUIA 4Y4HC 4G6FD 5DR5H 1J1OH 3SZKC 3IT8D 4GSDL 1RQ5A 3KBEA 3K8KA 1L4IA 5DD6B 1UM6L 3WEAA 4F7TB 5T33H 1Q9WB 4Z3GA 1J8RA 4OGZA 4ORGB 2DLEA 1YEFH 1MFBH 4WENB 3MLPA 2D7TH 3ZQ9A 1T66D 4RFEB 3M8OH 1RIVL 1Q9OB 3HTLX 2C9PA 5ESAA 3N2JA 5EEXA 2MPVA 3OSVA 4TUJA 3EYQD 4G8IB 3ZX1A 2FUTA 2VQ1B 4HDIB 2JMRA 1LP9A 2RACA 4OKVB 1FPTH 3BDBA 3HJEA 4QAWA 3EDEA 3SDAB 3O6LL 4XPAL 4GMSL 3WS3A 1EAJA 2D3NA 5DMKB 4G6FB 2V2WA 3WHXB 3KXFD 1BF2A 2WCPA 3IFOA 2F74A 2LTQC 4HPYL 3L9RA 2WYIA 1UOWA 2J44A 4QYOB 1A14H 1G7PB 5JMRA 1ED3B 1IAMA 4A37A 1GKOA 3MJ9L 2VDOL 3QRFM 3NCYS 3BH9B 5FGBA 1NBVL 4IRSD 4IHOB 3JV6A 4CSTA 2GVYA 3FAWA 2XV3A 1KIRB 1SUHA 1XGYH 2DD8H 3L5HA 3DX1A 4LVOB 2EE6A 4RNRB 3WEBA 2Q76A 3T08A 4KNUA 3LNHA 3O3EB 2UZIL 5KTEH 4UNIA 2RJMA 4KMTH 2WKGA 5K9QI 1MRDL 4LLQB 3US1A 5ANMB 3KXFB 2X4UA 1G94A 1AGEB 4ONOA 1BQHA 3AGWA 1UJTA 3NFPA 3MUGB 4MCMA 4BHUA 1KFGA 2N1TE 1QR1A 2SEBA 4DPAX 3TJHC 1O7DE 4XRCA 1N5YL 4U1LB 5SWZA 2YEZB 4IBYA 1RL1A 1ZKAA 4JFOA 2APVA 4PJFA 3BPCB 5DO2D 4AYSA 2A73A 1AIFB 1ZHNB 2ADGA 4KVPA 3ARDC 4YXKH 4OZGF 3NA9L 4I9WE 1XO8A 4P4KC 1F4XH 1M7UA 3HMXA 2Z7YA 1GR7A 3HBGA 1BD2D 5D1QD 4HJ0C 4N8CL 4JRWA 1CG9A 4Y2LA 3ASNB 2AI0L 4WU5A 2CIIA 3OKEA 3HAEA 3VXUD 2WGXA 4N2DA 3V5KB 5EG6C 5IIEB 1BXUA 3WL9A 4YHPA 1XGQB 1QRKA 2PPFA 5HHXL 1F18A 4PJ7A 4QGTA 1NGYB 4UT7L 2OMWB 1O7DC 3KPRE 4YO0B 1KN2L 3HMWL 1UWGL 1RMFL 1AO7D 1AR1C 3GSRB 3L4TA 3EGXA 1OGAB 2DS4A 2ROYA 5L4MA 1A22B 4GW4B 4FLQA 4ZUUB 1UXWB 3MACL 3SPHA 1EFXD 1R3HB 2ENSA 3MI6A 3KLAA 4M48H 4XMKH 3BRGC 2PMZA 3MRKA 1AGFA 4HUXB 5CNHA 5JIKA 5HYSA 5D1QB 3FRPB 4PJIB 3ZZQA 3GXTA 3ILPA 1TZIA 3SKOA 3VXUB 1GZHC 5FYKD 1MIMH 3LNGA 1NEZG 1RZKH 4W9FC 4HIQA 3W57A 2EH8H 1OAZL 3QR1A 4KTDH 5D72H 2CWRA 3V4PA 3U0TB 4L5FE 3SOBL 2WXQA 5FAAA 3QIWD 2R9HC 5A2CA 1NAMH 2A9BA 1KJ2B 5D7IB 2UY6B 2Y7QB 1EFXB 2IFGA 1PNDA 3C60A 1B0IA 3QBTB 1NL0H 2ZKXA 5GGQL 4ANKA 3RL1B 4P2OA 1MCLA 2GFBA 3M17B 1EK3A 1N8ZA 3WS6A 3E6FB 3EOTH 2ZG3A 3OZLA 1V05A 5I1JL 3LTVA 4TLKA 2DJUA 4WFFD 2Q87A 2WINA 1PIFA 2A77H 1V8HA 1X5AA 2WSPA 5D96C 1WA1X 3QRLA 1H15B 2FHFA 5FYLE 1AG6A 3WY2A 3X12B 2ZAIA 3BVVA 4AGQA 1IGMH 3KWUA 3QC5X 3QIWB 4LVNC 5DVMA 4B96A 1JP5A 1WF5A 5FFGA 4JHBA 3U7YH 4LSPL 1KZYA 2QELA 3QEGL 4JZOA 1BVLB 4GBXB 4JPKH 3V6FA 4ZNCD 1NCCL 3QXAA 1TMCB 2EQDA 4PG2C 1BJMA 1T22A 1CGUA 1DJYA 4PR5A 5DRXB 4OZ4B 1JZ8A 4KK5C 2H0JA 3B9VA 4UT6L 4WEBH 1W9XA 3ENEA 2WQUA 1HDMA 3FO1A 4I3RL 3ATEA 5M7QA 3KM1A 4PBWD 1XBDA 4QRRD 5E94B 5GSVB 3WELA 4M4PA 5IHLB 1BIHA 4GMTL 5CBEB 4Z3JA 2WUCH 4OFDA 3FBKA 4RSYA 1U30A 1H3WM 4XPHH 4WKXA 3EYOA 1UEYA 4NHUB 2APXA 4OF0A 5LBSH 3STZB 4RMVA 2DV6A 4BKLA 3DKHA 2IDTA 3TZVC 4JGUA 1NBCA 2WLHA 4DKEH 5HYJD 1DO5A 3NGBC 5E8EA 4QHMB 2AQRA 4N4YB 3ECBB 4UV4L 3K2MC 3DETC 1XIWC 3S35X 4JB9H 3O3DB 2GITB 4QRSB 3EJYD 1CGSL 5CMAB 5CZVL 1EVUA 2NT1A 3IFNL 4FOMA 4QRRB 5T3XD 1MFEH 1Z1WA 3PP3H 4Z77B 4C56B 4D9RD 3BKJH 1YECH 3AREC 2XWTA 3LMJL 1GAFL 1Y0LA 3MR9B 4RETB 4ALAC 2NY4C 2NCEA 1OGTB 1W16A 4K5OA 5B8CB 4F92B 3ZQWA 4K8RH 4X4ME 1YUHA 3GMMB 1E9OB 1VGEH 2IV8A 4G80A 4UINH 2FNWA 3EYUL 3UTSD 3CSYA 5HYJB 1JV5A 2PYFA 4LXFA 2CJUL 3W82A 3C09C 2VSMB 4HUWB 2DQHL 5J56B 2ATKB 4IOFD 1NCAL 1RPQA 2WYTA 3Q5OA 4Y16A 1Q9KA 3FN0L 4JQXA 1I7RB 1I9JL 3BUTA 3CCHA 3RJDA 3TFBA 1BQUA 8CGTA 4R3SB 3WMPA 3KHOA 3LB6C 1TNNA 1E90A 1MIEH 1OEZW 3CH1A 4UBDD 3K0WA 1J5OL 4OCSL 3D0VB 3RUGE 2VRKA 5IOPA 3AY4C 3NJVA 2R2EA 5FKPB 2PCYA 3FN9A 3VE0A 2Z4QA 4G7RB 3PWUA 4JAMA 4X98A 1F1DA 2P5WE 5D4JA 2ICEA 3UTSB 1OPOA 1CZ8L 1WS7A 1CDYA 4WY7H 2X4QB 5EU4B 3FTVA 4PY7A 4OD2B 1OVZA 5E4OA 2VN7A 3NSDA 2HT2D 1KG0A 4GQQA 3WFBH 2A99A 1IL1B 4Z3IA 3BUYB 1WD9A 3IDXL 5DJCB 3MV01 4A7GA 2VJXA 4FI6A 5EZIL 1PZ3A 1BJ1J 2FIRT 3C75A 1G7HA 5H2BA 5I6KA 1GOGA 3UEQA 2BDNL 2EDOA 4H2AA 5CGYD 1XB3A 4HISA 3E8UL 3IGKA 1XGZA 4Z7WA 2NXZC 1OALA 1KTDB 1A2YB 2DQTL 4MA1B 4OGAC 1FL3A 3HW7A 4NKOB 3TJEH 1H3XA 1I1AA 1B0GA 4G8AC 3S0PA 4DF9A 3T3ME 3HMXL 2VLRE 4U05A 2HAZA 1AD0B 2W9EH 5F0LB 4KTGA 1T2JA 4BM7A 3ABLB 3BISA 5DQ9B 4U1SA 3QISA 5IWLA 1U9KA 4LQFH 1M7XA 2C4XA 4PWGA 3TV8A 1UH2A 1MJJA 2R0KL 5AYQA 1UACL 5BW7C 2EH7L 2UXFA 5BCAA 3MRQA 5KYXA 1WFTA 4P5KB 2HVKB 2FJUB 2VZ3A 2XG4A 3C2AL 4HUMB 1XSKA 4NJAH 5ITFB 1XSJA 4MA3A 2HLFC 3BMWA 1BM3H 1E4XL 2W65A 2ZX8A 4HXAH 4BGDA 5TE7H 4BKSC 3HZMB 4CBZA 5CM1A 4LSSH 2H0PA 1DVZA 1NANI 4YHZH 5HHVL 2J2ZA 2BSRB 3GMQA 3RNQA 4IM8A 5T5NG 4BQ8A 4WTZG 3G5XB 4WWNA 5JQ6L 2EUVA 4LIQE 2O6PA 1T5XA 1CI3M 3EFFA 3MUZ1 5E8OB 2Q1EA 1A6VL 1UASA 3IMWA 3QFJD 1VFOA 4MNQE 1DE4A 3D3VE 4CVZA 5I16A 3OG6B 4ONFL 5IFHL 3VGDA 2AGJH 4S2SA 5BRZB 2VC2H 2BSBA 4MS6A 1PL3A 3VFRB 1ZT1A 1T2QL 3BPOC 4PJ5A 3UBXA 4KPHL 3V4PL 4JMXA 4A7TA 5IUCA 1UM5L 4H1LH 2PYEE 3TX4A 2NY3C 2FX9H 1IO4C 2G3MA 4XVSH 2R59A 1OV8A 1CLVA 1F1AA 1FFNB 1PG7H 4JFQA 1PDKB 3ZZ1A 4RSVA 4DN4H 2X4SA 4F93B 5ENWA 5I28A 2B08A 4FQIH 4BDVB 4NNXB 4DCQA 3EJJX 4LFHD 2IMMA 3FHQA 3HG1A 5F1SA 3CWGA 2P8MB 3I6LE 4CBPA 3S96B 5LKNA 5IUSA 1ETJA 1FLTX 2YUZA 4W6WB 3RDTA 2OMUA 3D2UB 4HK3N 4XAWH 3BWAB 4XTRC 1G7MA 4Q4EA 2KS0A 3QFJB 3RA7H 3ZKNC 4M4RB 2NDFA 1NZRA 1TQTA 1N5AA 2R0ZL 5IW1A 4UU9A 3MV7A 3PQYA 3RIFF 1DVUA 4ODVH 4HVBA 3ZE0B 3DDGA 2ZCLL 2DW5A 3FH5A 1P5UC 3MRJA 4AGLA 4DQAA 4X4YB 1M2VA 2NXYC 4AI7A 3SJVE 4AYBA 1A1MB 3SOTA 3IE9A 4CN4A 2OI9B 1BAFH 3KCWA 4QJ5B 1JHLL 1WWAX 1TTFA 3QG6B 3H3KA 1CYXA 3CBRA 5F97E 1UADC 4YSRA 4EUPA 4FQ2H 1A6ZA 5HHOD 3UTPE 3FT0A 1GH7A 2AEQL 1KGCE 1P53A 2NY7L 3OLIA 4KKBD 4XCEA 4V33A 1NGXA 4XNQA 5JTWA 5D2LE 2C5DC 2CO7B 4QOKD 2LGNA 3KPTA 4IU2B 1Q1JH 4XAKE 1JYWA 1WAAA 2Z8SA 2Y06L 1PZ5B 3REVB 2RTTA 2C1PA 2W0FA 3CN1A 1RVFL 4G43B 1DBMH 3ECQA 4MNQD 4KXBA 1Q1PA 1WBYB 2X6UA 4OCXH 4ZYKA 1CVSC 5B4MD 1L6XA 3TBSB 4IBUA 1D7BA 2ESVD 4HIHB 4PWFA 5AKRA 1L5GA 1XL6A 2CBOA 1TQUA 3MKGA 5HHOB 4YZFF 3PHOB 4MTMA 1JVKA 3T6XA 2BVUA 4JO5A 3CFCH 4XMPH 4RRPA 2JQAA 2BY0A 4QOKB 2Z0BA 1ZTMA 5JPMA 2VDLH 3VGFA 2EUZA 3R7RA 4JLRA 3W9DB 5IEKB 3PG2A 1MWAH 4QY8A 5DLMH 4H26B 3V10A 1XR8B 3RKDC 3D0LA 4KROD 3L3JB 4TSBH 3VWKA 1R3JB 3WDJA 4WCYH 5DMYA 1ZLSL 2K4AA 1UA6H 3OXSB 2WVUA 2V9RA 2ESVB 4MHHI 4OV5A 3IJSB 5ALCL 1A5FL 1Z5HA 2YK1L 2YKLH 4ZDHB 3LXAA 5JORB 1XMWA 4FQXC 5LUMA 1QLFA 4DHLA 5CZXC 1IEAB 1WGVA 4YSOA 3VQMA 3K81A 4KDVA 2AJ3B 4FCAA 4P9HH 5LO7A 4BWWA 1NUNB 4Y2NA 4Z8FL 4JG9A 2X28A 5B7EA 4Y2OB 2R2CA 5HVWA 1DVFC 3FHEA 3IMUA 4P5RA 1U3NA 3BCFA 4AV5A 1RKRA 3HS9A 4MMXA 3OF6D 1GS7A 3O2VH 5D7JC 2X5PA 3LKRB 3NIFE 4Y4KC 4AGOA 1KWGA 4KROB 4QXTB 3QIBD 5ANHA 4JANB 4E9LA 1J8HD 3E2HB 4ZZFA 4GSUA 4TNVK 3FUJA 4F7EA 5E7BA 2F1EA 4X6CF 3MDJA 2ZXEB 3C5JB 4Z78B 1GKEA 2BHZA 2R2HA 1IBZA 2E4TA 1YJDL 3ZZLA 4YVNA 1RJZA 4Z7UF 1ZGLB 4XP9H 1CD9B 1U8CB 1XTLA 4A7UA 1JMXA 4Q58C 4FFZH 3DHMA 1RK1B 4TLSA 4LCWA 3Q3GA 4OIBA 4Y4FD 1LO0H 1SEQL 2B3RA 4ZQKA 3HI5H 1NLBH 1TG8A 1LM8V 4J4PC 1FL5B 3GMRA 3C6LD 3VFPA 3VI4E 3UC0H 2R8SL 3QIBB 3BKML 3BE1L 3P3UA 3V6OA 1J8HB 4AXWA 3GM0A 2QMJA 1UYWL 4PJDB 3FSVA 4QRPD 2GY5A 3WFHA 1L9SA 4FQCH 3LH2H 1U0QA