1SHSA

Small heat shock protein from methanococcus jannaschii
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
115
structure length
115
Chain Sequence
TGIQISGKGFMPISIIEGDQHIKVIAWLPGVNKEDIILNAVGDTLEIRAKRSPLMITESERIIYSEIPEEEEIYRTIKLPATVKEENASAKFENGVLSVILPKAESSIKKGINIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Heat shock protein
molecule keywords SMALL HEAT SHOCK PROTEIN
publication title Crystal structure of a small heat-shock protein.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 18
structure length 115
sequence length 115
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 1998-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17886 ArsA_HSP20 HSP20-like domain found in ArsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1shsA00
1WFIA 4YE0A 4JUSA 3J07A 2K8QA 4MJHA 3AACA 1SHSA 3Q9PA 3EUDA 4PCKA 3AABA 4I88A 3GLAA 1X5MA 1WH0A 2BOLA 3GT6A 1EJFA 3L1GA 3N3EA 4FEIA 4RZKA 2WJ7A 5DS2A 4ELDA 2JKIS 2N0KA 2KMWA 4YDZA 4YLCA 2Y1YA 2Y22A 3L1FA 2Y1ZA 3GUFA 3QORC 5DS1A 3QORD 5LUMA 2XCMC 1GMEA 4PBDA 3QORB 3QORA 4YL9A 3L1EA 2N3JA 2MNWA 2O30A 2KLRA 4ZJ9A 2WJ5A 1RL1A 3VQMA 3IGFA 2RH0A 3Q9QA 3W1ZA 4M5TA 1WGVA 4JUTA 2CG9X 4M5SA 3VQLA 4YLBA 2CR0A
chains in the Genus database with same CATH superfamily
2X2UA 2EADA 2AQ1A 3Q9PA 4X4KA 2QSVA 3I84A 2ZCLH 3VCLA 3HFMH 2CO3A 3AB0C 3NK3A 1WBZB 3NG5A 4MJIE 3ZZQA 3SDCD 4L29A 2XU9A 2Y22A 4HKBB 2R56L 3WXVH 5L2KE 3N1GC 2HKFH 4MS8D 5AD0A 1JZEA 5KANG 4CGTA 2W07B 2G4EA 5AAWA 2EYTA 2GW5A 1YYLH 3B83A 1U58A 5DZOA 5IW6A 2PYEA 1QFUL 1KMGA 1SHWA 4X80H 4NM4H 1HCVA 4HS8H 5SWZB 4ABWA 3UG4A 4C4KT 3GLEA 4GP5B 3IYLW 1WFNA 2JB6A 4HG4K 4ACTA 5EHFA 2GSMB 5FUZL 1C5BL 1IGCL 3U2SA 4Z7WE 3B56A 2CQVA 4OQTL 5EFIA 1KB3A 2XWTB 4LF3A 5BZXA 3EYFA 2PWFA 3FU7B 4WU7A 4E9WA 1X9LA 1JVLA 1HESA 3I02B 2A73B 1M1SA 3TP4A 2OMNA 5I73C 3H56A 3O8XC 1UWGL 5LG1A 1R0AH 4K3GA 2ITDB 3LHAA 3KPPB 5DI8A 3V0IA 2JJVA 5F9DC 4HK0B 5CEZD 2C9SA 2VW4A 4HCIA 3ECBA 3BN9C 5F7AA 3VCLB 3FT4A 4FTVD 5BOJA 4QKTA 3MI6A 3QIUC 3W82A 2FEEI 1HAUA 35C8H 4L29B 4LK4A 1GCFA 2CBTA 1KEMH 4G7VH 1X5GA 1F3DJ 2AJYH 2BWIA 5IM7B 4WWKD 5AD0B 5EF2A 4XPHL 2EYTB 3B1UA 5HYQA 1G5GA 4Y2DD 4WK4B 1MJ8L 1Q9LA 1E5UI 1HHJA 1U58B 3U79A 4R7NA 3VWJC 4DK3A 2VERA 5A6IA 3ZTNH 3RG1C 3RX5A 5F9JA 2AXJA 2CUAA 3HNSH 2A1WH 3CDZB 3RVTC 4JQIA 3QPKA 1YEFH 3FRPA 3BZ4A 3U2SB 1QTSA 5EFIB 3IMWA 4FLRA 1KCSH 3EYFB 4WU7B 3L7FB 4D7BA 5I66A 3BUQA 1BJ8A 3HAEH 1Q0YH 2DQGH 2R2BB 1OPOA 4UNUA 3AMKA 4LBAA 3DJZA 4NFBA 1XZ0A 2QGBA 4LLWB 2IFFL 2QPSA 3P4NA 1TTRA 1I9RH 3RUGB 3ECBB 3KR3H 3ARYA 1GCYA 1IGYA 4M3HA 3FT4B 3W9DA 3M46A 3FU8A 5I6XC 3GMQA 1P5VA 4ZMZA 1X5AA 4NBXB 3P54A 2KC0A 2R29A 1RVFH 1IQWL 1G9ML 5FHAH 3NRQA 5AVSB 2DBLL 1PCSA 2EVIA 4U3SA 2AJSL 1CN4A 1NINA 4UOW0 1HHJB 1NBQA 2BS8A 4R7NB 1PZDA 1D6VH 2PXYD 3UTTE 5F9JB 1Q9WA 2DZEA 4C8XA 2EZ0D 1GGCH 2YKLL 5DUJA 2C8NA 4AG4L 3FRPB 3BZ4B 3TYGH 1OCWH 4HPOL 1M9SA 5AKTA 4XC1L 3BQUC 4PHXA 4PM1A 5IMOA 4OUUA 2F53A 2CK0H 4RAVB 1V3JA 2GTQA 5EU4A 3O2WL 5I66B 4Z7AA 2IPTL 2Z8SA 4DN3H 5EWIL 5FGBA 1MRFH 4ONFH 2X3AA 5D4HA 1XZ0B 5JW4R 1WFUA 4R4BA 2FHCA 4FJ6A 2ITEA 4F7CA 2JELH 3N04A 5C3LD 2YS4A 3OMZA 3LZFL 4B9YA 4LPUA 1J05A 3EJYD 1ZT7B 1WGOA 4P2OC 1KPVA 4RMUA 3KPRE 4YZWA 3KS0H 4UQCA 3W9DB 4YGAB 5SWQA 5DR5L 1KTLB 3QDGA 3MYJA 5AKRA 3CVCA 3GMQB 1P5VB 4XAWH 2VRAA 4L0PB 4GW4B 4QRQA 4Y19E 4L1TA 1JDAA 2Z1PA 1IGML 4M7KL 2MHAA 5D93B 4U3SB 5FDYA 2DWEA 3OXSA 5AOLA 4FC3E 4Y4FD 2VDRB 3CVHL 1QFWM 3QQ9C 3H9SE 4N87A 4X7CC 4YDMA 5EZJA 2LW3A 1Q9WB 4W9IC 2BS9A 1AHWA 4FADA 2APFA 4JM2D 3MLRL 5ALCL 1QNZL 5E5RB 1A3RH 3S3SA 5IMOB 3V0VA 4AV4A 3FUEA 5SX5K 4OF5A 2Z65C 3UIYA 4EQ3A 1B4JH 1MLCA 4YBQC 1TXKA 5EH1A 3KCPA 2ZWKA 1AQMA 4H26A 5KVEL 1XVSA 3QEQE 3U7YL 4GO9A 4R4BB 2R4RH 1OLLA 5H37H 4F7CB 2Z91B 4PJDA 3U7AA 2MPAH 4YEFA 4XP9L 1G7LB 4GAFB 3DURA 1J05B 4UQ9A 3QUYA 3UYOD 3D39D 1RZJL 4KXDA 2Z64C 4UT9L 1LD9A 3IGUA 3MYJB 2BERA 2IH1A 3PRZA 4QRQB 3V4PA 3RIFK 5C6TL 2AP2A 1INDL 2Y24A 2ZOLA 4AVKA 4RMTA 2MHAB 1YMMD 3C09B 2DWEB 3OXSB 4FQXC 4M9OA 4Y5VC 2LGNA 3BAJA 4MNGA 4K7PX 3SKJH 2P8MA 3WXWH 5I1IH 1AHWB 1QTPA 3NCJH 3Q3GB 2EH8H 4G72B 1YN7A 1JPSL 1RZ7L 3HBPA 4Z3GA 5CJ8A 1ZA3A 1TZAA 2ZKYA 4Z3JA 1IE5A 3SCMD 4YXLH 4HH9B 1KCLA 4ODSL 3PNRB 1OTUC 3V0VB 5C0CA 3W11C 2J2ZA 4RFOL 1MLCB 3KCPB 4ODHH 2BDNL 3K6OA 4QCIA 5BV7H 1CD0A 1NCNA 3DA0A 1DVFD 5IEHA 1C8PA 5IZ7A 4TTDD 2VSKB 5JMRA 1A4JB 3K46A 5GGTL 3GJFB 3PGCA 1TJHL 1X5JA 3CHOA 1W8OA 4S1SL 3S34L 1U8NA 1CVSC 2QHLA 1RUAL 1A6TB 3D4ZA 5C08B 3NACL 2DM7A 1JK9A 3QUYB 5BVPH 2NZ9C 3MLTB 1H3TA 2FJUB 1LD9B 3C5XA 5IGXH 2DEXX 3LN5B 5AZEH 5DD0H 3V4PB 3QEGL 1UA3A 2Y9RT 1S7XA 4I0PC 2EO7A 1A02N 4N90E 1TYRA 3UMNA 3SPJA 4KO7A 5EBMA 4YN3A 3JV5A 3MJ6A 4MNGB 3I6LE 2BIHA 2P8MB 3UABA 1UZ6F 4D2NA 1YN7B 1QWNA 2VDQH 2PWDA 3VH8A 3DSFL 1ZA3B 1DJZA 4OD1H 3JVGA 5T5NF 1TZGL 2XQBL 3BPLC 3S37X 1RFDL 1MCOL 2XWJA 3ALXA 4N22A 3L4CA 2V3EA 3AG3B 5C0AA 2BP5M 3OAZK 5E0FA 3H42L 2J2ZB 1M2VA 4LPVA 1CE1L 4KZEH 5F7LB 2AEWA 2O4EA 4QCIB 3WNPA 4K9EL 5IEHB 4PRPE 2BWQA 2KPNA 3JWOH 5F3HA 3I9GH 4N8VB 1OALA 3VD3A 2CXKA 3DVGA 3PGCB 3GXTA 2QQKL 1J87A 1ADQH 3DJSA 3WO4C 1U3HC 3G04A 5A6LA 3TA3C 3IAPA 1GJWA 4NUPA 4IKIA 5HHNA 4F5CA 3MV7A 3PYCA 4JCLA 5DZLA 1TJGH 2EIKB 5CP3A 3UG5A 3FPXA 4LMQI 2B77A 1ICTA 3KWUA 2VLKE 3HLKA 2FH8A 4F9LA 2O5NA 2ZCHL 1I31A 1S5IH 4FP8H 4YXKH 1M42A 4L0YA 2EKSA 2GYSA 1CURA 2PR4L 3RWFA 1XTLA 4IIZA 1UFUA 5EBMB 3RIFF 1CXEA 5E00A 3ZRCC 2VDNL 1JZ3A 2JVUA 2CMRL 4FA6A 2IGFL 1NPUA 5JUEL 5IMMA 3HZVB 1BLIA 3B9VA 3VH8B 1UM4H 2O6CA 4KU1A 4PJAA 2EVFA 1H3PL 2Z7YA 4JGMA 2XWJB 3U25A 1UVQB 2Q2EB 3D4GA 4HGMA 3S5LG 3HNVH 1D5MA 5C0AB 5FW8A 1NMBL 1EJOH 1M2VB 2G3MA 3KD4A 4CN4A 3BD4A 2BNRE 2X4SA 3EZ8A 3LNDA 4XX1G 1KFGA 3B2MA 1ODAA 1WAAE 2YAOA 3QIBA 5F3HB 3RVXC 1MFBL 5E6IA 1YO4A 3MYZA 3DVGB 3BLBA 1J1PL 2DYSB 1FPTL 3WI9A 1CXKA 4Q74A 1F4AA 1S9VB 3G04B 2ZXCA 3CXHJ 3HKZA 1H6FA 5HHNB 3VFNA 3QB7C 5J7CC 2JB5L 3MV7B 4HIPA 3F58L 1LK2A 1NUDA 4BWTA 1G6RL 5DO8A 3TO4B 3KYAA 2F5BL 2NXYC 2BJMH 2YUVA 4QXGH 2B3RA 4Y2NA 3GSVA 3A23A 4MXQC 4NDMA 2NUTA 3W57A 3JBG7 1YY9D 2EKSB 1JZ6A 3RWFB 3TYFA 2AJVL 4NO5A 4DAGL 3ZZSA 5E00B 1UJ3B 4MDJB 3ARWA 2YLKA 3EOTH 4XN1A 4KPHH 4H2CA 4HQQL 1IEHA 4DIXA 5IMMB 5HJ3A 1MJJA 5MP6L 1P5UC 2AABH 2YN5A 1I9JL 1XIWB 1MF2L 4ELMF 3FFCD 4JY5L 5EO9A 1AP2B 4IRJD 4YPJA 3T2PA 1YEJH 4PIRF 5IOKA 1SPDA 5D1XD 2WQAA 4YR6A 3S4SA 3RHWK 3M8OL 1C7TA 2Y1YA 4UZUA 5CIPA 1ZCRA 2X4SB 5DS1A 5LUMA 2HLFC 1GZHA 2IPKA 4QRSA 3QIBB 1RCYA 5E6IB 3QJOA 3QFDA 4PLOB 4LSVH 2XWBA 3ISWA 4FQPA 1WSST 4X5QA 5FX3A 2B0SL 2V6HA 3VFNB 1A3LL 4YDVB 5DQ9B 4GLRH 2YN3A 4PJ8D 4KV5F 2PP8A 1LK2B 3EJCA 1KC5H 2YUZA 3K6IA 4UV7L 5D1ZD 1NPJA 2CLVA 1WT5C 3NEXA 2J4WH 2NUTB 1N64H 3GSVB 4W70A 2E9JA 5T8IA 4C54A 1XGPB 1OSYA 4TRPL 2WTPA 4NO5B 3T4AC 1R4XA 1U2HA 4YH6A 3INOA 1CGXA 3UYRH 1UD6A 3CFTA 4XH2A 4HUUB 1DQLL 4C56E 5EUOF 3LVTA 5HJ3B 1MJJB 3C5ZA 2DYPB 3WFEL 1CFNA 1B2WL 1S9WB 5EO9B 3CU7A 4L4TA 4LSSH 5INCA 1OP3H 1KBWA 2APTA 4XBPA 1UWXH 3S4SB 1H3GA 2YLHA 1PF3A 5T5FL 1TFPA 4YLCA 3MRGA 1PG7L 4LIQE 2YBRA 2WOBA 2QVFB 2IPKB 4QRSB 2WSDA 5E8OB 1JXFA 3IT8D 1L0XA 2NXZD 2OMZA 2XTJD 3QIWD 4J6RL 3QFDB 2XWBB 1SLXA 4PJCF 1PD0A 2X2IA 1KLUB 4PY8J 4QYOA 2YPLE 2N7BA 1YC7A 3VTAA 2DEYX 4ODVL 2CLVB 3GI9H 3N2JA 4GEJA 5D6CA 4OZHF 5CR1A 4Q9QH 3GSWA 1NLDH 2CCLA 4J3VA 1BGXL 1HL5A 4EI0A 4LPWA 1OKEA 1TUPA 1L5GA 5C0FB 5C09A 3BMWA 2Q9OA 1F58L 2LU7A 4J3TA 4BFNA 5D2NA 1ODUA 4XH2B 4U1IA 2V2XA 1PY9A 3C5ZB 2BVUA 4KITB 4UZSA 2DQCL 3BKMH 4Z9KB 4ZPTA 1CXFA 1ZHBB 4XBPB 4K7PY 4XAKE 4NO3A 3PWLB 4NUGL 5KTEH 4MMZA 3AQXA 2YBRB 3GZQA 4TOYL 3CE1A 1B3IA 3G7TA 5F6HJ 1D2PA 4OD2A 3LAFA 1CU4L 2MOVA 2OMZB 4L3EE 5I9QB 3RHWF 7CGTA 4OGYL 2YAQA 2C9PA 1SMOA 4ENEC 5KANI 1IGFH 3P4LA 4Y4HC 3HHRB 1NKRA 1SUJA 2YGPA 4FULA 5TF1H 4QYOB 3M1CA 3SKNB 2GBUA 1S7QA 2X38A 3DXAD 4Z7QF 2H7WA 5F0JB 1XL6A 4U1GB 1FL6A 4Y9EA 1SYVA 3ZKXB 3FTSA 5D6CB 1NKOA 1FI8C 2E47A 2OR9H 4TXVB 4JFVA 4I48A 5D96C 3DHJA 4UIKH 1QRNA 1QZNA 4TUKH 3GDBA 4BSWA 4F33A 2CUIA 4ODXA 4RH4A 1WA2X 3OMNB 4RFNC 2YEQA 2H32H 2V2XB 4FFWC 1I8MA 2D7QA 3M7OA 2GJRA 5SWZE 4ELMA 9CGTA 3FW6A 1YEIH 3MCLL 3BT2L 1WHOA 2H0FA 4JL1A 5CJXA 2EUZA 3MV9A 4NXSA 4HOXA 3WKML 1HILA 4NO3B 1SQ2N 3U6RA 4ABQA 3K1DA 4FL4B 5IBLC 4FERA 4LAQH 4S1DD 4OD2B 4XMKL 1K5WA 3JQOB 4RESB 1PTZA 3WJMB 1KBGH 3OL2A 4YK4C 1N68A 5CEZL 2VLRE 2D2CC 4D3CL 1P7BA 4I9WE 1BF8A 4S2SA 4YNYA 4CAGA 1FL6B 1ORQA 2VT0A 3FO0L 1SYVB 2OMYA 5GHWL 4UM9D 5HHMD 4B9PA 1A3ZA 1NGQL 3RVWC 5DJYA 4J3OH 4BELD 1TITA 3KJ4C 4I48B 4YHLL 2WWMC 1O6TA 2XBTA 3ARXA 3TCXA 4QEGA 1G9MC 1QRNB 2LHAA 4MB1A 3BUDA 3VWKD 2DN7A 2B1AH 4AM0Q 1OE2A 3NJVA 4KJYB 4BSWB 4GAJL 1EVTC 2PPFA 5EUOA 4X6DE 4ZTPL 4YDIH 1T0MA 1ZE3H 3HRPA 4P4KD 5LLIC 3SO5A 4WKZA 1BG1A 1S78D 3HG2A 4XI5C 4ELMB 5T1LD 2ZX6A 3NTCH 2IDFA 3F65A 4HWBA 4YOKA 3QUMA 2KLTA 3MV9B 3OPUA 4XWGL 1M3IA 4CILA 1EHLH 5I75B 1HILB 5BVJA 5T3XL 3KPSA 4KZ0A 5IG7A 3U6RB 3KW7A 1S2EA 3V4VH 2EDKA 4ZAKC 4AEHH 1L9MA 1JGUH 5EC1A 4KHTL 3MBEA 2O5YL 1YJDL 4XMXA 5LCVL 1ZLWH 1AYOA 4H8WH 3WE1A 4QOKE 3OB0H 2AI0L 2ZONA 4JY6A 4XPBH 3X17A 4FQ2L 1F4YL 3S88H 1JNNL 2EC8A 4S2SB 2EDEA 2IF7A 3RUGE 4YNYB 3RVVC 4DPBX 2AJXL 1F6AA 1ORQB 4OZHA 2JJTC 3QPXL 2FX7H 3B9KD 5JA9A 2XIIA 2YK1L 3RWIA 4GSXA 2W80C 5MHSE 5DJYB 1PJWA 2J88L 5J11C 4M6NL 3HMXH 3ECVA 4KMLB 2H0JA 4QRPE 1U33A 3T1FA 5GZND 3VRIB 4DEWA 3K5SA 5HGDA 4DZBB 1QBAA 4OJDH 4EDXA 1K85A 2FD6H 5EUOB 4NJAL 3LRMA 1T0MB 4WKZB 4WTQA 2WB1A 3ULVE 2H3KA 1CGUA 1HKLH 4XNAA 8FABA 1QG3A 4FEIA 1PKQE 2DQJH 3WS3A 4OKDA 4DKDC 5IG7B 4YMPA 1LM8V 4MCZA 3B7UX 1OLZA 4G9FA 1E4WH 5ISZE 3MREB 4PWJA 1XD0A 1ZANL 4K3HA 5EC1B 2GG1A 3JTSA 3MBEB 4H0GA 4U49A 2CJTA 1UUNA 4GRLD 5IESH 2GT9A 3GWJA 4PJCB 4H7VA 2W9LA 4Z7VA 3W9EA 4I18C 4JY6B 3O3AB 3WNKA 4AV5A 3L3JA 1TTFA 3ZZLA 3N1FC 5JZ7D 1QKZL 2OSYA 2YA1A 3AFLA 2R2EA 3OD3A 2Y7MA 1RZJC 4ZMWA 5IHUL 1BD2D 4HPYH 4OZHB 4DP0X 2WXFA 3HAEB 3BRDA 2P5PA 3RWIB 4EDWH 1MCBA 5J89A 4WDIA 1GC1L 1AG0A 4RAHA 4RGNC 2GFBA 4DKTA 1U4FA 5KBDA 3QEUA 1INEH 4I1RA 3T1FB 1SFHA 4I85A 4DGIL 2Z4QA 4HU2A 4EDXB 4Y16A 4GXFA 2PYED 3GHPA 3ZGHA 1OGPA 4XCFL 3ZYJA 2P44B 1FDLH 3VM5A 1AE6L 5I71C 5FF6A 2IH9A 3ET9F 2KQNA 1SVCP 1UM5H 4A7VA 3WS3B 2H1LM 3QO0B 4DERA 2X1WL 3GLDA 1XF1A 3QNYA 2VLLA 1H5BC 4JRYB 4G9FB 2HVKA 4FLSA 2WUBL 4PFEA 4HKJA 4IQHA 3GTVA 1T2JA 4OGXH 3MV11 3JTSB 2RD0A 4L3CA 4H8PA 1GY1A 2XWEA 1EK3A 2ALWA 1UXWA 3W9EB 5MEPA 3TBVA 2EDWA 3RGVA 2EECA 1OP3K 1AXSA 5KYYA 1U0QA 1UWXK 4HGWB 2NY6D 1ITCA 3L3JB 4Z7QB 1QLEH 4DCQB 1L9PA 3N50A 2R2EB 4I3SH 3SOTA 3DPDA 5I8EA 1OAQL 3FT2B 3FQXB 2ZOKA 1GPOL 1PZ5A 2BZCA 2ZKMX 5DURB 2C4FT 4WDIB 2K70A 3O9WC 3WSQH 5F7BA 2GFBB 2QSCH 5H37A 2QLVB 4EOWL 5I1EH 4XCCL 5IJKA 1FFOA 2Z4QB 1IBBA 1NDMA 1IUZA 2EIDA 2VMJA 1T89A 4Y16B 2ZP9A 4G6MH 3S98A 4WUKH 2OBGA 1CK0L 5IOPA 2FWOB 4LESA 3ARFC 4ZD3L 1BF2A 5HDOA 3UBHA 4MX7B 3HZKA 3BH4A 1ONQA 3QNYB 4X4YA 5E4IA 1QZ1A 2G75A 3JYCA 2DQDL 3K0YA 4AIEA 2E27L 3NOIA 1NEPA 5DWUH 4K9EC 3QEHA 1NUNB 2MWCA 4L3CB 1ZXKA 3LMJH 5MENA 1BXAA 1JPTL 3WUWA 5I6NA 4PV1C 1T03H 5MEPB 1UXWB 3BSZL 3TBVB 3RGVB 3DUHA 2OCCB 5KYYB 3JYBA 4JUSA 2W9EH 4XNZB 1OSPH 5C08E 3EJJX 5SV3A 3TFKC 2E6PA 5L4IA 5BRPA 3ZQXA 5DFTA 1PZ5B 4PN6A 5E7BA 1HINH 5IKCA 4DP6X 4DKFL 1BQHB 4BJLA 4MVBC 4H20L 5I1CH 2RBLA 4KTYA 1GYVA 4A6YH 2MNWA 1A7NH 2QR0A 4MKMA 4WEEA 1F6FB 1WTGT 2EE0A 5IOPB 1OTSD 2IGLA 1ORSA 4FXKA 1JF1A 3ARBA 1TZHB 3CBRA 4KKRA 5CF3A 3HS8A 4YHZH 4M8QA 4JANA 1PL3A 4X4YB 1F0LA 2YPKA 3U0TB 1P7QD 2F53D 2G75B 1HC1A 2I5YH 3PP4L 4R7XA 3SKMA 4WO4D 3PDGA 2VGLM 3QEHB 1IKNA 2WLHA 5MENB 2VDLH 2GUOA 5JIHA 3BKJL 3UP1A 4BQ6A 1BAGA 2E6JA 2D0GA 4ZI8A 1AS7A 2PCYA 1T4KB 4L1BA 2K1MA 4W6XB 4Z8FH 2CHNA 1MFAH 1R33A 4P2QA 3NSJA 3SDAB 4S1QL 5IVNA 4Q9RH 4HIJA 5IROC 1BECA 1QPPA 3EDDA 3I50L 3QDGD 3Q8AA 4LCWD 1KBPA 3EIFA 5IKCB 2QADD 4HUMB 2DMGA 3LS5H 1NC2A 3QDHA 3MJWA 2FECL 2Z31C 1WICA 3QAZC 4NQCD 3H54A 3QO1A 2XWCA 3G5VA 2F7QA 5DA0B 2QR0B 4X6EB 3L2NA 4KDTA 1SY6L 3U1PA 4AE1A 1E2VA 1JNLL 4TSAL 1ORSB 1JF1B 1RP9A 1Z9LA 1ZEAH 3ARBB 1DZBA 2Z7UA 1SM3H 1SVBA 2C3GA 4MASA 4M8QB 4JANB 3ZXAC 3EYQC 4OAWA 4BFIA 5KSAA 3B3BA 1V3KA 2YPKB 3LIUA 1ZWIB 4NWUL 1J5DA 2BO0A 2XXMB 2Q86B 7PAZA 3SKMB 1T22A 4LSTH 1G7HB 4IW4C 4XGZB 2VM9A 2VSMB 1A9BB 2COVD 2OJEA 2R4SL 1FZKA 3D85D 3I6SA 1NFDA 1MCDA 3W38A 1N70A 1GOHA 2WCGA 5G2NA 1T83A 4RDQF 1RUKH 5CSGA 1JDCA 2VDQB 4HJ0D 3EBHA 4HWNA 3H53A 1E8XA 2QT6A 3QFJA 1IM3D 2FRGP 3UFIA 3Q1SH 2DBJA 5L4MA 3JWDL 4PRAB 4DN4L 4P2QB 3ZN6A 3ATFA 3FTYA 4X9HA 3AQYA 4HJGA 4HIJB 2XG5A 4RLDA 4FAAB 3DRQB 2I9LA 2QFRA 4XVSH 1PKOA 1AXTH 1NC2B 3B7SA 1OZUA 1XXDC 2CUMA 2XA8H 5C0RH 1CLZH 4ZMXA 4LO9A 3OB0K 2J8HA 3L3GA 2VXTL 1AQKL 3QO1B 5HGHA 3UJJL 3EDEA 1NC4D 3G5VB 5E8EB 2RAMA 4G7YL 5K9KA 3PV7A 5HVHC 1RLBA 2LLNA 3IAGC 3THMH 3EYUL 2QJDA 4WSGA 2DAVA 2B4CL 2K6WA 3ELAT 5D7JC 1SHSA 5TPWL 4RVBA 4MQXD 3MRQA 5I1HH 2QMJA 3U30C 5EIQA 5K69A 4OAWB 4BFIB 4XMTA 5KSAB 5C0CD 2GEEA 1HAWA 1RK0A 1T22B 3IXTA 1HSAA 2Y1ZA 4JFFA 4KZDH 1FRGL 5F1KC 5FK9B 3RZCC 2OJEB 5E9NA 2F0CA 2P5WE 2DWDA 1U6AL 3GSUB 3O0LA 2HWZH 4PGEA 2LOEA 4Z3IA 1RAMA 2P24A 5KBNC 3S36L 5L4FA 3HBQA 3QFJB 4XPFH 5JOFB 2N01B 5LJYH 5JW3H 4HJGB 2NR6A 2XG5B 1MPAL 2B16A 4ECNA 2I9LB 1KB5L 1PZ3A 4FFTA 4XP5L 3MJ9L 3R0MA 1OO2A 3OHXC 1FGNL 1KXQA 4I3GA 1E9OB 2R15A 3QG6A 1AYRA 3L3GB 2FB4H 1BVOA 2AQRA 2H1PH 1SLVA 3Q05A 5LNDA 5K9KB 3W2DL 2NY3C 2DD8H 1FNAA 2QPUA 4NQDA 1NMCB 4A68A 4JQVA 4EZKA 5H35A 2ODIA 3RX7A 3HC3H 2CR6A 4TQPA 5I6MA 4GFXA 4GW5B 4CN6A 1VKXB 3FAXA 3MRQB 4K8RD 2V8MA 2XUWA 1QSEA 3RX8A 1Q90A 4HFWA 2XZCH 2WAQA 5LQBH 1OARL 4I9XA 1TSHA 4MJ6A 4J3OF 1KBVA 5DUMH 1RK0B 3T65A 4JFFB 4BCYA 1EIBA 5CSZA 2X3CA 2YAPA 2DWDB 4TV3A 3Q5TA 2BNQA 3QCTL 2P24B 4JO8A 4XX5A 4BRVA 1OAYL 4R90L 2ZYSA 1LLAA 3H9YA 4FQIH 4KKLC 5C0ND 4AVIA 1FZMB 1MFCL 2FATL 4NSKA 4CJ1A 1MW3A 5D7SL 3QNFA 4NN5C 5DD3L 1OAKH 5I8KH 5A2KH 3ECUA 1AR1D 3QULA 3TZVA 4DW2L 3NJJA 4MS8C 2XYBA 1GSKA 3KJ6L 4LASL 4M5ZL 2XV0A 1ERNA 4YO0A 5F7UA 3X12A 4UDUB 5FDWA 1CFTA 3VI3F 2A9NL 3AMLA 2QVTA 4UB0L 1SGKA 4FQ1H 3SE3A 1FV1A 2UY7A 2X1QA 4X6FA 3B8YA 3QP3A 4NQDB 5H35B 4ZMVA 4XHQA 5D7IE 2I9TB 2X70A 4FQLL 3HE6A 3RA7L 1LO3L 2VWEC 4P9HH 4YHNA 5L8KB 3BC9A 1QSEB 5ENWA 2LU4A 2YD3A 2NY1D 1X5HA 3HN5A 4HFWB 4F9PA 3V9EA 1KCBA 3ME0A 3T65B 1JGVL 3ASNB 4KDWA 1J48A 3GSOB 5EF0A 5SWSA 1N5AA 4W9ZA 5CSZB 1QYGH 2B08A 4NS0A 1JYVA 3AY4C 2HP4A 2BNQB 4TLSA 1KY7A 3FYEB 4W4OA 4LARL 3NK4A 4HXAL 4OI8A 4DP8X 2IQAA 5PCYA 1WV7T 4NSKB 3NGBC 3V6ZA 1E42A 4M43H 2NUPA 5KYXA 1ZXQA 4XPAL 1ZSDA 5CHNB 1YVLA 1T2QL 4UT6L 3RY4A 2A2QT 3BAWA 3HNTL 4WWKC 3GI8L 4WRLA 1H8OA 3GB7B 1FC2D 1VZIA 4N8CL 3X12B 4ETQA 1CFTB 3PL6D 3ARVA 1ROWA 4H0LC 1KGIA 1JAEA 3WAJA 1FV1B 2AS5M 4ICWA 3EH2A 4NAMA 4EI5C 12E8H 3PY9A 4R5TA 5I1JL 3IRCA 2X70B 3HE6B 1JRHL 2FQEA 3FSWA 4FNSA 4YHNB 1A4AA 3PFQA 3V4UL 5LN4A 3MFFA 5ENWB 1K9TA 4LIQL 3ECQA 4XO8A 2HFGL 2JV6A 2OL3L 4GKSA 4PUBH 2EYRA 4UDTA 1OTTD 1A7RH 3KBHE 3ME0B 2R0KH 3D2UB 1IC1A 1AZCA 4AIZA 4FKHA 5JW4Q 3TT1H 1BJ1H 1J5OL 1RULH 1MI5A 1FORL 1Y07A 1YJDC 3OVUB 5B3NA 1LP9E 2EXWD 4HULB 1YEEH 3AT9A 5DO2D 3KGRA 4L0ZA 4E9YA 4W9KC 3V6OA 2C7UA 5EA0H 4YSEA 2IQAB 3IDNB 1KYDA 2AQ3A 1RUQL 4TNWK 3V6ZB 4OLVL 4Y4KD 4UQBA 3TJHD 2NUPB 3EF4A 4ISVA 3SDYH 3CZFA 4AMKL 3T0EC 4MXWH 4AJYV 4LU5L 1UCTA 5GJTH 5C9KA 1JZ7A 4FI7A 2HT2C 1BF5A 4HJUA 3DX3A 3II1A 3UX9B 4HS3A 3GC3A 4ETQB 3VXSA 1MIML 3TWYA 1ZD6A 2Z34A 2HMID 1CMOA 3AADB 3CHPA 5J12C 3VGAC 3VXMB 4MDRA 4BV1A 1KCVL 2EZ0C 4E41E 2R1YA 1JPST 2VXQL 5T3ZD 2C34A 3RGBA 1GZQA 3K6FA 3LPPA 5FHBL 4L4TD 1J0YA 3MV9E 4NCC2 5TTRA 3KH4A 4GKSB 4Q89A 1MVYA 2EYRB 3L16A 2H9GA 2MCPL 5LN8A 4PJ9A 2YRZA 1G0DA 3N40P 4NUMA 4OZGF 5EEUA 4AIZB 3CFDA 1NEUA 2O1AA 1MI5B 1AGBA 3BKYH 1BPLB 4U7MA 4X0KA 2SEBA 4ZXBB 1SEQH 3IDYB 3GIVA 1FFRA 3QJXA 3EO9H 2XQ0A 4ZMQA 4RGOL 5DK0A 1ZHLB 4J7RA 4PWHA 3UEZA 3E9TA 4AZUA 1FA4A 1JD7A 3LH2L 3TIEA 1MHEA 3A5VA 3PCYA 4ISVB 3CZFB 4X8CA 5HHPA 3V4VA 3EAKA 1QI5A 2HT3D 5TK2A 4F2MA 2WGNB 3A4FA 2DI8A 1XAKA 4XMUA 1GC1C 3VI3A 4HEPA 3QORD 1GVIA 4YJZL 5C09D 3U9PH 4D0DB 5AW6B 3VXSB 5CJBA 3VXTA 4NRYA 2KI6A 3FHAA 3PNWA 1WS7A 5K59E 3B2VH 1SXAA 4UANA 4JM2C 2R1YB 2Y36H 3VNYA 3PU7A 4JG5A 3IRPX 1GZQB 1BMZA 1CZ8H 4RSYA 2DLHA 4GSDH 1DVYA 4OJFL 2HFTA 5EIVA 5I2IA 3FSZA 1B4TA 5CMAA 2L7EA 1E6JL 1COBA 2A9AA 4IOSD 1T7YA 2IIJA 1T7WA 3CFDB 4DP5X 1AGBB 5LGJB 4NNXB 3AWFA 3OAUL 3BDYL 2SEBB 1J9SA 1RJZA 2E75C 5CLTA 1DO6A 4PJCE 3GIVB 3QZWA 5CJOH 2DIJA 4Z5RA 5CNHA 1W9XA 2RQEA 5DK0B 4L4JA 2FT6A 3EYSH 3LNIA 4JRXD 4AYDC 2V7NA 4XMLH 4A39A 4WNQB 3TIEB 1I9IH 3V4VB 4JVUA 3GD1C 3D39E 1F4XL 4TNWF 4IRSC 2C1PA 1T5WA 3VI3B 2GSGB 2EYSB 2EQDA 1E5AA 1OSEA 4KVCL 5EZIH 1JHTB 4NI6A 2WXOA 3C6LC 3H3KA 3D1MC 3L4VA 3WMQA 1JZGA 1IO4C 4NRYB 4TVPL 3SGDI 3PNWB 1PY4A 3QI9D 1QSVA 4D8PA 1Z9NA 4U3XA 5D7HA 3BE1L 3PE9A 3IN0A 3SE4A 1JNJA 4HEMA 1FIGL 4B97A 2ZUTA 3VRLF 1NIBA 5AYTA 2M26A 2VR7A 2OSWA 3II3A 3D3VD 1HNFA 5I2IB 2V0AA 4JRYE 5AB0A 3SOBL 5H94A 3IMVA 4YSUA 2EVGA 4X7SL 3IDIB 2XTLA 2YC1B 2DQUH 3UJIH 1DYZA 1RJZB 4L37A 3QSKB 2EEBA 2XPYA 5CZVL 1OGTA 4OJEH 4HWEH 4LPCA 3V7MA 3QG7L 3HBGA 3U9WA 3OPZL 1F4WH 3ILQD 4KX7A 2V7NB 2P46B 4EQ2A 4NB7A 1JZFA 3HKFA 4PR5A 1W80A 3GBMH 2Y6SD 3F62A 4YEEA 4XC3L 1CDGA 1MNUL 4ONGH 3CMGA 1Q94B 2BIIA 4HAFA 4XP6L 2VLJD 4DVBA 1PMYA 3MXVL 1TETL 3F6IA 4OKVA 5KS9F 1OANA 4D8PB 2V3FA 2ENQA 2WXHA 4JQIL 4A04A 3R1GL 1ETZA 2WIMA 5AFAA 3QDJA 4S1RH 4W81A 1I1AD 2X4TA 1RZGA 3L9RA 5AVXB 1I7ZA 1RPQA 2WOYA 3KPSD 5A2BA 4KX9A 2AJUL 4OZGA 3TVMC 4Q6YA 4XO9A 3PGFL 5H94B 3TBTA 1BLNA 2E8YA 4L18A 5BO1L 5HPMA 1A6PA 2C3VA 3DX4A 5DHEA 1IC4H 1KDIA 4JZJA 2XX0A 4O5LL 4A38A 4NFDA 1URIA 4J4PD 1UXLA 4L37B 3MX0A 4G5ZH 4JE4B 1OGTB 1NLBH 1JWSB 3DYMA 4IIQB 2AMUA 3MC0A 1NICA 4MKTA 4N2KA 5KOVC 4YFEA 3EJUA 3T3PF 3T0VA 4FYQA 2AAAA 3QW9A 4H25A 4PRHA 2DTMH 4PR5B 2JI2A 3V52H 5EZLB 3VQ2C 2CKBA 2R29L 1R3IL 3AC0A 1H6EA 4AOFA 4JB9H 1XB3A 4NGHL 5IVZA 4YL4A 3UAJA 2EVHA 4KQ0A 4K3JL 3FB7A 2QDWA 1S8DA 2E7CA 2BMKA 5ADOL 3IKCB 3LEYH 2NW2A 3P73A 1H8NA 4OKVB 2O5XL 1I3RA 4KNSA 3RDTA 3CX2A 2AEOA 3DKHA 3QRFM 3GSQA 5BS0A 2NYYD 2A83B 2VR9A 4UU9A 3NFPA 3P30L 3MUY1 3TIDA 3N42F 1RZGB 4N0YH 5IY5B 2DM4A 2D7TH 3DSNB 5E6ZA 4OZGB 5JIQA 4JPKL 4BKLB 5GZOD 3GMNB 3K8LA 2H2SC 2H8PA 1BLNB 4A6YA 3WJLA 4QHKJ 4X4MA 2C3VB 3C60C 1SBSL 1QBML 3MPCA 3BUBA 1JHKL 4WI2A 1GAFL 3GO1L 2RQ8A 3MX0B 1KCUL 4R6UA 3E8VA 4DPCX 3CZLA 1P4BH 1CYGA 2XWZA 4LVOC 5ANME 1DDHA 1YEGH 4IK6A 4ONOA 3JWDC 3LKSB 4H25B 5EIIB 2CKBB 3WTYA 3L5XH 3ESPA 1MNNA 3V55A 4F57H 3L4XA 4O02H 3HZYA 1ETJA 3LPGA 4EIBA 1FLRH 3GXDA 1S8DB 4IHBA 2BMKB 4RSVA 4LKXB 3JUZA 4XBEH 1GZPA 2N0MA 2D7PA 2NW2B 2E76C 3LDBC 3P73B 4NP9A 2HJFA 4KJWD 3VD4A 4EN3D 1D9KC 1I3RB 4FNUA 3RDTB 2JIXA 1PZUB 4LEOA 3GIZH 4AQ1A 2Z93A 3GSQB 5TQ0H 2XDHA 1FNSH 3LQAH 4OCWH 5BS0B 2B4CC 3ABMB 5AW9B 3K91A 4UU9B 5FV2A 5IHBA 4KXZI 1OB1A 4K5PA 3TIDB 3UC0H 3UADA 1OIOA 3H7BA 4BUHA 3ZT6A 3FFCE 3RTQD 4L2YA 2H8PB 4A6YB 3NEOA 2ARJQ 4OT1L 4DTGL 5FAAA 5D1XE 1A6UL 1IM9D 3O6LL 4FLHA 5J6HA 5E5UB 2NY7H 3FFDB 5EU5A 4TPRL 3IM1A 5B7FA 2OM5A 1HN1A 1LWJA 3VGDA 2FJGB 1C5CL 1E27A 1DDHB 3RI5K 1T1ZA 4A7QA 1M56B 5CJQH 3OXRA 5JXAL 1P4IH 2XACC 2IBGA 2R8SL 1MQKL 3B5GA 4NQEB 3K0WA 3V4PL 1A6VH 2F9BT 1QATA 3CVIL 4U2ZA 2OMTA 5LNGA 3HZYB 1FE8H 5E9DA 3O4LB 5I0ZA 3S35L 2M1KA 1IC5H 2YD7A 2Y3NA 4CGUB 5EOCH 2HVBA 5ES4B 5KS9A 4PRNA 2HJFB 4HZAA 5LBGA 1QRKA 2ZTBA 4V33A 1HL9A 2JIXB 2PMZA 4LEOB 4Y7MA 1E3ZA 4AQ1B 2Z93B 1U92A 3F7VA 5D70L 3E8UL 3HA0A 5LKNA 3EUDA 3VMOA 5ADPH 3MLWH 4KVPA 1OB1B 2DV6A 3MACH 5DS2A 2ZF8A 3ATEA 5DUPL 1EUUA 4L5FL 4NO2A 5DVKA 2B5IB 4OZFH 5IW3A 4LLMA 1QSFA 1IAMA 2I7OA 2FVNA 3DO3A 4N2MA 4ZUTA 4RRPG 1ZLDA 1A6WH 1KIUA 1QR4A 4LQ1A 3CHRA 1N0XH 1ACYL 2NXZC 2XTJC 3HN8A 2G3NA 2WUCL 3QIWC 5J6HB 1G1CA 1CG9A 4WKXA 4G43A 1BVNP 4ODTL 2H5UA 4NPKA 4L05A 1WIPA 3FS9A 3MLPA 4PJFF 5EBLA 5H2BA 1BPVA 1T1ZB 3CDCA 4GKZA 3BKCL 1KSRA 3SGJA 1N6UA 5DRNB 3OXRB 5FYKH 1U8CA 2WVTA 3SPCA 4CSTA 4AYFA 4KGJA 1QFPA 3WIHA 3EOAA 2HJLA 1KJMA 2OZNA 5E9DB 5F7EH 4YDLB 3UYPA 1KNOB 2VZ1A 3FB6A 4KTDH 1R5WA 3V9FA 4EAEA 5KS9B 1A7BA 4PRNB 4AYEC 3DLQR 3G6JE 3K6SA 3UJTH 4GMTL 4QRRA 5HP5A 3ARTA 1LDSA 4APXA 1MY7A 3A6CL 1T20A 1AC0A 3HEIB 2P52A 3SYAA 1AI1L 4O9HH 3IRZA 1D5IL 2Z1KA 5BUAA 5DWPA 4APQC 4ZS6C 3OJDB 4K94H 1FBIL 1XSKA 4MJ5B 4OIAA 3MXWL 1DVSA 4NO2B 4LLMB 1QSFB 4MD0A 5B1AB 2A74C 4CA4A 1K6QH 4ZUTB 4FABL 1KIUB 2KUTA 3UBXA 3WFDH 3OLDA 4W6WB 4PGCB 1DFXA 3VGEA 1OT2A 3TO2B 3C8DA 3KL0A 4P5TC 5L7XH 1ET8A 1ZV9A 4Q6KA 1A25A 1IBYA 1OHQA 3EFDL 5I1DA 4G43B 2XI9A 1DBKL 3FSVA 2UZXA 2AERT 4WI8A 8CGTA 5C07A 5DVOA 2J73A 3T3PB 1DLFL 2VUYA 3H2QA 5EBLB 1IC0A 4GKZB 1X5FA 5IQ7H 1RZFL 1P5UA 1U8CB 3ZX1A 1RU9H 4AYFB 4C4UA 4LRIA 3EOAB 2NQDA 5LVEA 3VG0L 2CGYA 2WXNA 4FQJL 4Q9BA 3RI5F 2XZAL 3DXAE 1KJMB 3UPCA 3CN3A 4PJEF 4BGDA 4LSQL 3UYPB 3FB6B 5J6GA 1R5WB 3U1SL 3DJ9A 4CRPA 4KRPD 4QRRB 1M3JA 2P47B 3FN0L 4Y1AD 4APXB 3A67H 4KKCC 5MI0C 2LQRA 5E23A 3A22A 4JHAH 4BFRA 4IGBD 3N42B 1UUSA 5L88L 4YPGA 3X13A 1J1OL 3C08H 4QUOA 1OCCB 1IMHC 2OTPA 1HXMA 5CCJA 5IMKA 4R3SA 1BXVA 4FQCL 4MD0B 2RCSL 2IXQA 4TNVK 4BQBA 3U9UA 3V79C 1NAMH 3GRWH 3UBXB 4XMVA 1YYCA 1OW0A 5HGAA 3W5NA 3N85L 3KH3A 3SQOH 1QTYT 5I1DB 4XVTH 2BNQE 3U7WH 2CG9X 3GBEA 1NGXA 3TGXA 3PG2A 1N4XH 1M9WA 2FGZA 4NC1E 4QAWA 3U1QA 2HPOA 4ZO7A 1NSNH 3K2UL 5D1QC 2G5BA 4XZUA 3H4HA 4JVWA 1YN6B 4BZ2A 3OKDA 1VGEH 1EO7A 4AKOA 1FL5A 2CJUL 3NCEB 5HDQL 5J6GB 2LABA 5EORL 3ALWA 1DQTA 3NJKA 1UB5A 3VWKC 3TBYB 4NZRL 3FN3A 5E56A 3V0WH 4XN9A 3LRSA 4W9CC 4NM8L 1CE6A 3PQYB 2BIPA 4OD3H 4Q2ZA 1SNRA 3PAUA 1FH5L 1KCKA 1SVZA 3HHSA 3MLUH 4JO4H 1LO5A 5IT2L 1KN2H 1A9EA 4U6YA 3CZGA 3ATBA 4B50A 3DYPA 3T1WA 3CFCH 4BEIA 1MRDL 1WD9A 5J13B 3A4DA 3ZKND 4YPGB 3X13B 5HYSA 2P5EA 4N3UA 4QLWA 2ZCKL 3ETBJ 1HXMB 1PX4A 4R3SB 2IXQB 2A0LD 4LXFA 3UTSA 3U9UB 3FCSA 4LCIH 4KXBA 4YHYC 5JHDD 2AGJL 2R39A 2BC4A 1CO1A 2X4NA 5HGAB 5IUSA 5KVGH 4ANKA 2V9UA 3S5LA 3HZMA 4QF1A 3FRPG 4PJFA 4QGTA 4MB5A 4N3TA 1JZ2A 1NGXB 3FKUS 1ETB1 1NDTA 5F89A 3T8MA 3QFGA 1N10A 3QDMD 1UA7A 3E1F1 2NR6D 4YAQB 3FU9A 4QLRA 2G5BB 3B9KC 4P2RA 4HSAC 4TUOB 1XT5A 4OQTA 3Q5YA 3BZEA 2ZUQB 3M1BA 2WLYA 4KROD 1R17A 4ES9A 3HPJA 3OKDB 4MQ7B 4NRZA 1FL5B 4HIXL 4O2EA 4UQ3B 2JTDA 4X4XA 1U3JA 1MCSA 3TV3H 3MOQA 1UB5B 5BZWA 1MZZA 2C4FU 3TJEL 5JQIB 2JKRM 2KZWA 3U4KA 5DHVA 3QYMA 2X6CA 5D7KE 4Q2ZB 3NIGF 2ZE0A 4HIHA 5IVXB 5T3ZL 3BRGC 4QXWA 1JZJA 2A38A 1LO5B 3VXME 4U6YB 4XN8A 1R5VB 2FIKB 2OW7A 5EO1A 3O0RL 5HYSB 1QSED 4G7QB 4KQ4L 4R84A 5FIEA 3CC1A 2QHRL 3UTSB 3FCSB 4PW3A 1WBXA 2J6WA 1ZLUK 3ZL4H 7FABH 1JMXA 1XF4A 2BC4B 5A2FA 4HXBH 4L4VD 1PFCA 1YAIA 1SMDA 2X4NB 4W1TA 1S3KL 1Y6KR 3EXLA 1E43A 4TNVF 3HZMB 4QF1B 3RU8H 4PJFB 1QPXA 2G2NA 1N8ZA 1F3JA 3L9YA 4M62H 4OLEA 4QGYA 2GSIA 3FB5B 5F89B 2X6UA 5F7MC 4P23D 1PNDA 1PZ2A 1HU8A 4WJ5A 4OIIH 4XPTL 1W2KT 1KELH 4TQIA 4FFZH 5F6HI 3VXRD 3TZVD 3SDXE 3QUZA 4PJEA 1NL0H 3EJZC 3QQDA 3CDYA 3HI5H 4F2FA 3M1BB 1G7PA 4HD9A 2QV2A 3BZEB 3HPJB 4O2EB 4ZYKB 1AD0A 5CGTA 1PSKH 1BD2E 2AXHA 4HMDA 3B6SA 4X4XB 1M6UA 3CZKA 1Z32X 2HCZX 4KI5F 3T2LA 4JM4L 3IFNH 3JWNC 4HLZG 1MH5B 2WWNA 5BZWB 2C1OB 2YMXL 5DHVB 1ULVA 2XFGB 4HIHB 1ZLSH 4BIKA 2DEWX 4U1KA 5ESAA 3IMRA 3K4DA 3PWJA 4IM8A 1HZLA 4GQ9H 1FSKB 5FUCE 3QCUH 3HE6D 4MQSB 2X3BA 1LMKA 5EO1B 2D0HA 2R0WL 4PG2A 5CINL 1J0KA 4MA8H 1LJMA 2CRIA 4M7LT 3LS4H 1TQVA 3ZE0E 2F1BA 3NMEA 4K23L 3DVIA 4M93B 1WBXB 5F1IA 4ZFGL 1XF4B 1BZDA 2V33A 3RL2A 1UH3A 2IOIA 3AXIA 5SWSD 3BIAX 2F19L 5C0BA 5DZAA 5IQLA 3WAKA 3TCTA 5ETUB 1L7IH 4GMSH 4KY1H 2J5LB 3MKGA 1N8ZB 5IHZA 1F3JB 2XVGA 3DHMA 3AY2A 4LT7A 3T8XB 3M7FB 1HYSC 5GISL 2OSLA 5G5DA 4MAYB 1J1XL 1EEUA 1E5YA 3QUZB 2CDFB 2LVEA 1KZYA 4PJEB 3QQDB 5LXGH 1G7PB 3IVKA 5JPNA 2QBWA 1AD0B 4WUUA 3MV8D 4LFHD 2XZQH 1A1MA 4JFSA 4WSKA 3GKWH 4BZ1H 2YPVH 3MZGB 1UCBH 1A7QL 2K0RA 4JHBA 4Z7UA 2Y7NA 5ITFB 4D0CA 3DMMA 1NQBA 3ZBMA 2J44A 2Y07L 5J3HC 4R2GD 3HFML 4GG6F 5ESAB 4U1KB 2DLTA 1UM6H 2BSSA 4NN7B 3VA6A 3F7YA 4HFUH 4PJXE 3H2PA 4JFUA 1IBFA 3MLSH 2YGVA 5C0IA 3IBOA 1KJ2A 1CLVA 4PSPA 2JKIS 2HRGA 4HCGA 5DQDL 5F1IB 1XCTA 4K5MA 1V54B 4LCUB 1IAIH 1T3FB 1P0SE 3BUTA 3FUHA 4O51A 5C0BB 3R8QA 2EICA 1A6AB 3HVNA 5DC4B 4ZUWA 4JJHA 2H2PD 1DR9A 2OMXB 1CCZA 5IHZB 4MFHA 4JPSA 1GXEA 2AXGA 4X2UA 5GIRB 5F70A 3ZHNA 2OSLB 5HGGS 4JDVA 2H3XC 4PGBA 4MMYA 5FXCH 1LO0H 3VXOA 4G42B 4FZEH 2NSXA 2AXFA 5LBSH 3IVKB 3L4YA 4XP4L 5I24A 2UYLB 2OZ4H 3DUUA 4WUUB 4YIQA 3S3JA 2MMXA 3GMOB 5D93C 1XV8A 4BRJA 2AQQA 4N2BA 1OOAA 4H4NA 4KUZL 4B6ZA 2WBJD 3UTOA 1I1RA 1KCWA 1AFVH 4JKPH 4GKNB 4D0CB 3DMMB 1R9FA 2VABA 2P45B 5CUSL 4X99A 3M88A 4FG6C 4CKQA 1FFPA 2BSSB 4HWBL 3ZPDA 3QUML 1U3NA 4ODWB 3F7YB 5T1DH 3NJNA 2WO3B 2L04A 1RZIA 5ID0A 5C0IB 3SZ6A 1KJ2B 1AC6A 3E1ZA 3WGUB 5DMIH 1A7OL 4OI9A 2AXWA 2R1XA 4PJ9D 1S7SB 1BZ9A 4PJIF 1MWOA 5FGBC 4N6RA 3ZTNL 3EHBB 4O51B 4ZUWB 3VH8G 2X6MA 2EDBA 3U2JA 2A1WL 3VJ6A 3UMTA 4GBXB 4JDZA 4LPXA 1YEFL 1J8SA 1I7UA 2BIOA 4PRBB 2AXGB 4L9LA 5JXEA 1KCSL 2VCOA 4AEEA 2FQDA 4JDVB 3EO1B 3SPHA 1E40A 4OIFA 5HHXH 2FYVA 1Q0YL 3O6MH 3SGKA 2DQGL 1BFSA 2AXFB 3HRZA 1KXTA 5K9QG 3BEVA 5ERWB 1H5BA 1HTYA 4OSUH 3DUUB 4YIQB 3L9BA 3EKCA 1S7UA 4LCWE 4AL8L 1IAOB 3C09C 5I15H 5KUKA 2DLIA 2F8IA 4QTFA 4N2IA 2K3TA 2BX5A 4U05A 2AAVA 1XXFC 2VDPH 3NIGB 1JMZA 5DHMC 2FX9L 2WTRA 3L7EA 1MIEL 2VABB 2YARA 1AHWC 4JFYA 4KTEL 4NQCE 3BXNB 1UGNA 4X99B 4LL1A 1FFPB 5I18L 2L8AA 2YUWA 3GK8L 1IQDA 4OCRH 1GYUA 2OS7A 3BN9D 5C97A 2X0UA 4WFFD 3GLAA 4NKMA 5ID0B 2BY1A 3X11A 2EDQA 2J8UF 3IFLL 1GOGA 2J6EH 1T6WA 2FYYA 2HH0H 1Z9MA 1J86A 1JF5A 3A4AA 3OKYA 3X3FL 3FDWA 1VFAA 2R1XB 2RGSA 3QIUD 1BZ9B 4OZGE 4Q6IA 3DWTA 2VDKH 3PWPE 5LGHL 1M05A 4N6RB 2WXMA 1FG2A 4I0KA 5TH2B 3QARA 2DQ6A 4H88H 1LQSR 3MOAL 4XHJC 1L4IA 3KYKL 1SQMA 1H3VA 3VJ6B 1XH2A 1GGCL 2EINB 5F0MB 4UQAA 3VWJD 1I7UB 1ZS2A 2ESVD 4X6BA 5AKSA 4L9LB 5JORA 3WTXA 3QUYC 3MDJA 1NCDH 4RIRB 1Q1JL 1W8EA 2ED9A 3RVTD 3X2QB 4ESKA 2YXFA 5GGVH 4AITA 2AJZA 4DN3L 1P4UA 4DQOH 4G82A 2XFXA 3HRZB 3BEVB 1TPXB 3RWEA 4QJ5B 3NFNA 1S7UB 1NCBL 2APXA 2X4PA 1NGYA 3K8MA 1SJVA 2BSEA 4TL5A 1PAMA 1I1FA 3MLVH 3NDZE 4J8QA 4LSPL 4GG6A 2WTRB 3L7EB 4YXHH 4JFYB 1U8PA 1KG0A 1NAKH 5T1MA 2DKUA 3V2AR 3O11B 3QZMA 4G6FD 5TDOA 4MQXC 3VXQA 1IQDB 4XAWL 2WKOF 1LO2H 2Y4SA 4N0UE 1JRHI 4NKMB 1DE4A 1FO0H 3IETA 1M7DA 4NJ9L 2A4ZA 2ZG3A 2EILB 4JFDB 4N68A 2FYYB 5F0PB 1OWRM 3H0TB 4KH9A 4DF9A 3WS6A 4QHMA 4Q6IB 3X1NA 4BSJA 3G6AA 1X5KA 2GAZA 4D9LL 1M05B 1FG2B 2JJSA 3FO9A 3WG7B 5L8LB 3C6EA 3OMIB 1GMEA 2X4UB 5FM5M 2CU9A 1ZV2A 1OCOB 2WQXA 4G6KH 4IU2A 5GGUA 3W1ZA 4P3CH 4X6BB 3V0DA 2XPGA 3S4SG 2I60L 3D52A 4WY7L 3MROA 1VPOL 5I82A 3GMRA 1KYOK 1B4JL 2X1XR 1WG3A 2P48B 2AJZB 1EGJH 5KBPA 4NQEE 2XFXB 2MRYA 4IBYA 4M7ZC 1UOKA 1WZ1H 3RWEB 2R4RL 3NFNB 2VR3A 3O4LE 1NGYB 3V8OA 4FRWA 5M7QA 1CI5A 4S0SD 3L3KA 1JE6A 4YHPA 4N5EC 1I1FB 3SHSA 3D30A 5TGBA 4F8OA 4W9GC 2AKRB 4GG6B 2P9RA 2ENSA 3IJHA 1U8PB 2NY0B 1T5XA 2RFXA 3MRMA 1U8KB 1HDMA 5CLZA 4AV0A 5C0JA 5J8OA 3CCHA 1BVZA 1SF3A 4KC3B 2RACA 4Y7OC 3QDJD 2WNWA 3JVGC 5HDBE 4QHLA 4OCYH 3ZIMA 4AM0A 2HG5A 1WRFA 4P5RA 2E9GA 3FMGH 4CSSA 3IETB 3P4OB 1PEWA 4LEXH 4QNPE 4EEEA 4PJIA 1UD8A 2AC0A 3MSPA 4Y2OB 1W8NA 2XT1B 5GRWA 3G6AB 4OFPA 2GAZB 4WIQA 4EBQH 3FO9B 5FYLL 3DETC 5C86A 1KTBA 1TJIH 3U0WH 1N5YH 2GBTA 2FBJH 5I1IL 5HXMA 5T5NG 3MUZ1 1DUYA 3MO1B 3Q5OA 3QQ9D 2H3NA 5BCAA 1PLGL 5I30H 1IBGH 2XPGB 3M17A 2WO2B 4BFGA 3L9EA 4LCYA 2KT6A 2JE8A 2YJQA 5LBVA 2FX8L 4PRHD 5KJRH 2YQ2A 3DVFA 3GMRB 4PJ5B 5F9OH 4M48H 4NKIL 1OGAD 1RK1A 5F8RC 4A2MA 4F9LC 1YNLH 3U48A 4FI6A 4WEBL 4YBQD 1M7IA 3QK0A 3ROOB 3L3KB 4YHPB 5JA8B 5TGBB 3PP3H 1MVUA 3MRMB 2RFXB 4OIBA 1HDMB 3NP4A 3SPGA 5C0JB 3CCHB 1E4JA 1T66D 2Z92A 4GXVL 2I32A 1RZ8B 1BBJA 4QHLB 4AM0B 2J8UA 2HG5B 4LSDA 4M8UA 2EO9A 1DVQA 4PJIB 1OAZL 5F3BA 2JKNA 1UC6A 2BCKB 3QIBC 2UZIL 3P3UA 3TTSA 3RRQA 1W91A 3PV6B 3CH1B 4KK5D 4OLXH 2BFVH 5E6IC 1Q72H 3PREA 4L8SA 4A55A 3BHBA 2VDQL 3GBNH 1OF0A 4FQXD 1DUYB 2ZJSH 1WDAA 4XXDA 2E8ZA 3IWUA 4ZMAT 3M17B 2F74A 1B4LA 4WNSA 4YLQT 4LCYB 3LVEA 2VERN 3K6DA 4OZFB 2QELA 5IQMA 1TTBA 2KZKA 4KZEL 2LFEA 3RVUD 3LXUX 4P06A 4HIEA 3LNEA 5E6YA 1OTUD 1GYWA 3I9GL 1M7IB 1BZ7A 1KTDA 4QR7A 1Q9KA 4TVSa 2X1OA 3ARZA 1MVUB 4TM9A 1BAFL 2BZ7A 3FHEA 4ETYA 1TYEB 2MJWA 1R1CA 3DI2B 3ZUCA 2QQLL 4OM1L 1AZNA 2K6YA 4L3FA 4G8GA 2WKOA 4A37A 3MU3A 1BBJB 4PMEA 2F7IA 5BW7A 2AEIT 3CIAA 1TFHA 2J8UB 4R5XA 5AVTB 4ZMYA 3GT6A 4YXKL 5GRJH 4OV5A 3N9GH 2OW6A 3P3SA 3DRTA 4PD4K 1OTTC 2GTWA 2WCSA 4M6OH 2WYHA 4OTXH 5I5MA 5F3BB 2VMEA 1NIEA 2O5ZH 1GZHC 2XKSA 1L9QA 2YOCA 3GBDA 3KVDD 3TNNA 4ADJA 4I0PD 4KHXH 5D72L 2EKJA 3T2OA 5C92A 5DO2C 3QJRB 1EO8H 3DJRA 4A63A 4XXDB 5CLXA 1NOLA 2O72A 1P6WA 1OP5H 5JPMA 5IFAH 3UO1L 2OP4L 4JAMA 3ZSSA 4FJZA 5TE4H 1Z5LA 3HNVL 3V8CA 3CLFH 2WXQA 3L3HB 2BP8A 4Z7WF 3VD7A 2RMNA 2XA3A 4UAOC 1WE5A 3VXUA 4HIEB 4BA0A 1MAKA 2DWXA 4B9IA 2IOMA 3PWUA 3CFNA 3LYRA 1D5ZB 2VW7A 1BZ7B 3QC5X 1P1VA 1NUGA 1EUTA 2HZHA 3DX2A 4CVXA 2NYKA 1LK3H 1OQXA 3AROA 3OZ9H 3P0VH 3QXUA 4M4RA 2YEZA 1DQMH 6FABH 1UG9A 3PQYE 4G8GB 3C5ZC 2WKLA 1U3HD 3TA3D 2BJML 3BH8A 4IHOA 1IAIM 1QACA 4YUEL 5J1SC 3ABLB 3BFQG 3DRTB 2GTWB 1QSFD 4G5AA 1JD9A 2VXUH 5FUOH 3RWJA 3TA4D 2X89A 3CFKB 3L1FA 3TNNB 4GY4A 1D7DA 5I9QC 4N2NA 1EAJA 1WA0X 3RBSA 3KLLA 2KDGA 3KXFB 1TSRA 3WEOA 3VXNA 3V4LA 1K5NA 1YEJL 4ELKA 3ZKMC 4U1NB 4JAMB 5I28A 1M1XA 2E9WA 4DK5A 4GAAA 3KPLB 4U1GC 4M6AA 3ARGA 2KQMA 2BP8B 3UZEA 2NTSP 3ZKXC 4R4ND 4HALA 2G0KA 1HHKA 5BRZA 2Z3FA 3ARDA 5C7XH 2YD9A 3VXUB 3HE7A 3MBWA 4JFZL 4W9JC 2F54E 5DZJA 3DIDA 5BRQA 5EDSA 1KCRL 1MFDH 3PWUB 1NBVL 3FQNA 1DBMH 1I8KB 1ND0A 3NCYP 4CVXB 3ZR6A 5D2NC 1EZSA 3BPOB 4H40A 3RVXD 4D94A 4NEHB 2R2HB 4M4RB 3ZDYE 5JDSA 2R56H 5IUCA 2N59A 1TO5A 1QW8A 3HAEG 5IVXE 4RNRA 3CVBA 3RWCA 1KIQA 5AWNL 2H6OA 3PDDA 1DSFL 4IHOB 3IDXH 1N6QL 2ZICA 4FL4C 5I0DA 4ZOEA 4MMZC 1B0GB 4IDJH 3V0JA 2PTVA 1MY5A 3HB3B 4UTCA 2NXYD 3RWJB 4MXQD 4GIOA 1ILUA 1C5BH 1IGCH 2X9WA 3K4ZA 4IKNA 4BHUA 5HYEA 2H47C 3JT0A 2E7MA 3WDHA 3K72A 5C07D 2BVPA 4JJOA 4UILH 2I26N 4ZW6A 3SPVB 3VXNB 4ELKB 1K5NB 2AZUA 1NWOA 3RPBA 1M1XB 2JJUA 2BOCA 1I85A 3QJHA 1UWGH 1EA9C 3ARGB 3N44F 2I25N 4LLQA 2NNXA 5AZ2L 4HHGA 1UOVA 5BRZB 1HHKB 4KXAA 1ZPLA 3FFOA 2QL1A 3HE7B 4JRXE 4YE4L 5AW2B 1XO8A 1IEAA 3TN0A 2VZVA 2HTLC 3KYOA 3FQNB 3QQ3A 4TULH 4XRCA 4JO1L 1ND0B 1UT2A 3QS3A 5FYJL 1LO4L 1JCKA 3LZNA 1A9VA 2A7BA 3MJ8A 2QQQA 4QY8A 5JDSB 3S5YA 1ET5A 3PDOA 3RWDB 4UT7L 1KZQA 4RNRB 3DPBA 3GI9L 3EDFA 1KIQB 3C75A 4FFZA 4H8QA 5CJXC 4BFOA 1D5RA 1I75A 1MJ8H 3IPEA 4YDJA 4A7GF 2SODB 5HI3C 1EPFA 2IEPA 1BM7A 3V0HA 1V7ML 5K9JL 2YIHA 4MJIA 4U31A 1BP3B 2QQNL 5L2KA 2UUDH 3GEFA 5TD4A 2J20A 3FBKA 1TVHA 2FO4A 4OFYD 1W72A 3D3VE 3QHFL 1FG9C 1JHLL 4AYBA 3K72B 3C9NA 5INDA 4JPVL 5AZUA 25C8L 3VGHA 4F7KA 1I3VA 1INQA 1UADC 4E9VA 2BVPB 2F8VA 2W9DH 1MZYA 4JO3L 3OHMB 3TEYA 2BOCB 1NCGA 4ZTEA 3MHZA 3QH3A 4Z7WA 4FF9A 1SDYA 3TH2T 1FCCA 2K6ZA 5B38A 4K3EH 4K55A 2G3XA 2Y6SC 3MRKA 4XN2A 1JBJA 4P5MA 3ZTDC 4KQ3H 2HJKA 1EO5A 3TN0B 1WTLA 3KYOB 3ALPA 1WFMA 2CJ3A 2JCWA 2IO5A 3QQ3B 4XRCB 2H6PA 2X7LA 4NYLA 4Q97A 1NGZA 3GMPA 4FLOA 2DWSA 4BK5A 1EAPB 3OR6A 1H6UA 1P84J 2AK4D 2VLJE 1OF2B 2V9RA 1YQVL 1IQWH 4QY8B 4CDGC 5JW4M 3WNOA 3PDOB 1ZJAA 1G9MH 3ZDXE 3DPBB 3BCFA 1V5JA 2AJSH 3MGAA 3I2CL 1BQHG 2OR9L 2VW6A 4YDJB 4UYPA 4JFEA 4IU3A 1E4XH 2P5ED 2R51A 3QYNA 4DVRL 5H37G 3QJSB 4UIKL 3FYIB 1UASA 3PP3K 3CPUA 1UKQA 5KVDL 2YPVA 1FNHA 2YKLH 5L9DH 1TVHB 4AG4H 7PCYA 1DEEB 1FL3B 3MBEC 4E0RB 5A2IH 1TMQA 1W72B 4HPOH 1Y18A 3HZ3A 1W0WB 4XC1H 5DJAA 4NCC1 2CIKA 2GITA 4IJ3B 3SE9L 4IBLT 1EBPA 3O2WH 4RQQA 5E4OA 2WSKA 2A5UA 1PLCA 2IPTH 5GS0H 3AUWB 2ZWNA 3LEVL 3VU1A 3D34A 3MUJA 5EWIH 1OE1A 2CBPA 3GSXB 4YQXL 3QH3B 4Z7WB 5CCKL 5DEJA 1L9NA 4TQEH 4FFYH 4UTAA 5HJBA 2A6IB 4DEPB 1X5MA 4P2RD 5B38B 2DQIL 1NANI 2VQUA 4P5MB 4G8IB 3LZFH 4EUPA 3SJVD 2X4OA 4C59B 2VR5A 1O7DE 4AL8C 4HH8A 4FG0A 1O9WA 2H6PB 2X7LB 4O2FB 4HLEA 5DR5H 5CILL 3A21A 4OLYH 3ILEA 4HW6A 4Y9CA 3NCCB 1QW9A 3VM7A 3QRLA 1A3QA 5I73B 3VMPA 4PB9L 3O8XB 4GSRA 4ENED 1PZBA 2EE2A 3E2HC 4ERSH 5CD3A 2NYYC 4M7KH 1IGMH 4Y4HD 2NT0A 3QZNA 3ULVH 1N0LA 4PVMA 4UQIM 5CZXC 2FEDD 2YO3A 4JFEB 3CZSA 2XBDA 3MGOA 2N4IA 3R06A 4IU3B 3T0AA 2OZ4A 3DYOA 4HS6A 4WFED 1CL7L 1RKRA 4GAYA 4ALAH 2UZPA 1SN0A 1XGYL 2B1AL 5MEOA 1O5DT 1Y18B 5DJAB 4KMTH 5DFVD 4G7SB 2MKWA 3N0PB 5K9QI 3VI4E 1ID2A 3UTTA 3TWCL 4RQQB 3ECWA 3ZE2E 1RZQA 3W81A 5DXWA 2C9RA 2BHZA 2Z0UA 4PRIE 5KVEH 4PWIA 4AT6A 4LP4A 3U7YH 5K5YA 3UXFA 5F44A 2EDYA 3V4VL 5ABDE 4FQHA 4AEHL 2FWSA 2VL4A 4UQDA 4J3XA 1WLHA 4ADIA 5IREA 1NFAA 4XP9H 3W0WA 3DTUB 4EUPB 1U8QA 5EG6C 3IF1A 4QD2E 4IBVA 3M86A 5IBLD 3EFOA 1OP5K 3P4MA 5F7DA 2XN1A 4UT9H 1KY6A 1YNTA 2WYIA 4Y16C 2R9HD 3STLB 4OLUL 5CZRA 2WVVB 3S88L 1DSWA 2CNZA 1RPKA 1Z0MA 1HH9A 4P2YA 5D4JA 3H6AA 2WO4A 1INDH 1CD9B 2HG0A 3KLDA 5CD3B 2E86A 3RAJL 3E9UA 4D9QD 3KPRA 2IDQA 5KSBF 1N0LB 5E95B 1MJUL 5KW9L 4FX5A 5DZ9A 3R06B 1E5CA 3L48A 4KAQL 2JCCB 1T7VA 1LTXA 2OAAA 2WN2A 4GAYB 2F61A 1JPSH 5MEOB 1RZ7H 4Y19A 4NX0A 2JQZA 2BSBA 3RVWD 2VQTA 4X9IA 3IJ8A 2WWMD 4ODSH 2YXMA 1JGLL 4XPGL 3H9SA 3RGVC 3UTTB 4RFOH 1QMUA 4N9GB 1GW0A 1HKLL 2BDNH 1XF3A 2LTQB 3Q44A 3AAZA 4XNZC 5AW0B 2ILLA 3H3PH 4B9GA 4AT6B 2CA4A 4XI5D 1TU2A 5CZKA 5GGTH 1MDTA 4FQHB 1TJHH 4S1SH 2FLBT 4MA1B 3W0WB 1NFIA 2ZKHH 1U8QB 5MERA 3NACH 3BQUB 5IESL 2WXKA 3FQTA 3EFOB 2ZX8A 1X5YA 3KPNA 4ZAKD 5F7DB 5IJKC 4ZS7L 3TJPA 1WAAF 1T89C 5DVPA 1J18A 3WELA 5JR1L 2EH7L 2X6BA 4G6AC 2XIBA 2MKLC 1EAQA 4L3AA 2ZF9A 1UD4A 4KO6A 4EDWL 4FQQA 1KBBA 3TV8A 2GJJA 1T0NA 2XV6B 5B4MD 5EEVA 3O6FA 2IBZY 4P2OB 1INEL 2XPZA 1X5ZA 3FOLA 4JFDE 3ERXA 1F4HA 3MODL 2V2TA 4Y19B 5KSUA 1PG7W 3DSFH 4IK7A 5JYLA 1TT6A 5AOZA 2VDPB 4KK6C 3QHZH 4N1EA 2XQBH 1RFDH 1MCOH 4JPQA 3LN4A 5DU7A 1NM4A 5EU7C 2V8LA 2OX5A 4RBPH 5I76A 3H42H 3FUMA 4YBHA 1CE1H 2X0WA 1UM5L 3AAZB 2EEFA 4K9EH 3UTPE 4H8VA 5JYMA 3T08A 2QPEB 5B1BB 1TU2B 2WYTA 2F68X 4NC2B 4ZQKA 4PJBE 3TBCA 2QQKH 2Y7QA 3NZHL 1BYPA 2VDKB 1NFIB 5MERB 2IQ9L 3UTQA 3MUGA 3FQTB 2G2RA 2GBAA 3BIBX 3KPNB 2M83A 4U0RB 1MN4A 2HPTA 4X98A 5DRZA 2RIKA 2Q3AA 3D50A 4UUJB 4U4BA 1GHFL 3MNWA 3ESUF 3V5DA 1CFVL 1XCQA 2ZCHH 1XR8B 3ARBC 4E68A 4DETA 2PR4H 2E7BA 3ULUD 4MNQE 3ABKB 32C2A 3MCG1 1EGJA 5MEQB 1HWGB 1T0NB 1S7TA 5KZCD 4LQFL 1ZVHA 2VDNH 3O6FB 3AM8A 2CMRH 2BM3A 2IGFH 4QRFA 1N19A 3ZL1A 5JUEH 2QSCL 1OPGL 1G43A 2DW5A 2V2TB 5KSUB 1GTNA 1IKNC 3HC4L 4G6ML 1H3PH 4GP4B 4AYSA 4RGND 2AV1A 3LN4B 4UIMA 2OX5B 1EFXD 1O6SA 1NMBH 3EBAA 1F00I 1OEZW 4RAUB 3WFBH 4F3FA 5HGBA 4XOCA 1ZJBA 2R0ZL 3QWQB 5HVWA 2FZ3A 4QWWC 4DUVA 2UUDK 1E9PA 1FO0B 1MFBH 1IX2A 2PO6A 2XN0A 3PWVA 1P2CB 4N2FA 4ZQKB 1ZS8A 2CKBL 4RX4D 3MNVA 1PNCA 1J1PH 5T33L 1FPTH 2Y7QB 4HDIA 1JGDA 4PJ5E 4F7PA 4FD0A 2EUXA 1MUJB 4PBWD 4ZTOH 3U4EA 3WN5A 2ADFH 3MUGB 4KI5D 3LY6A 2DWTA 2JB5H 5JIMA 4PRPA 3F58H 2GJZA 3N43F 3LPWA 1G6RH 2N3JA 2QKIA 1MDAA 4KDTC 2F5BH 3MNWB 1QOKA 2W9EL 1XR9A 1P7KA 3D18A 2MNUA 3V5DB 3ZR5A 3ZYZA 1XCQB 3D33A 1GGTA 3EFFA 4Y1AE 1T5KA 1U95A 1WFIA 1WF5A 1I8IA 2VB5A 4FGMA 1HINL 32C2B 3SGDH 5KSAC 4NERA 2VLKA 3Q13A 4HQQH 4A6YL 5MP6H 2FUTA 2VXSL 1I9JH 1MF2H 4Z76A 3O9WD 4JY5H 2DOCA 2D7NA 1T83C 3A0OA 3ESMA 5HHOD 2C9AA 3IMTA 4UIMB 1O6SB 3M8OH 5F0LB 3SE8L 4F3FB 5AALA 1CD8A 5HGBB 3REVB 2VN3A 3GZPA 3BFWA 1QI3A 4YHZL 2X6VA 1OP9A 4PCTA 1E9PB 2PO6B 2DRUA 3PWVB 4TQ8A 3ARFD 4OCXH 2I5YL 1PIFA 1ZS8B 3EH1A 1IILE 1C1EH 3MNVB 4HDIB 3O6KL 2N7AA 2DQEL 4PJ6A 4RDQG 3T6XA 2KZBA 2GHZA 3U4EB 2ZNXA 2GQHA 3NH7L 2VKWA 1BW8A 2BNRA 3BPLB 3CQQA 3L3OA 3WN5B 1A3LH 3EGSA 3IE9A 1WAAA 4PRPB 3DX9A 2BSED 2GJZB 3L5HA 5F9WC 4DFHA 2NDGA 2V17H 3FQUA 3HFFA 1G7JB 2QKIB 4LNVA 3FZUC 4PREA 1XR9B 1IFHH 1MFAL 2NY0D 3D18B 3ETSA 3OAYH 4PIBA 5CKGA 1JFQL 2FJFA 3HC2A 5KSBB 1U95B 1I8IB 5FYKE 4XB3A 4HT1H 1GL4B 3EJRA 4Q8BA 2CRYA 3TFKD 1NZRA 2VLKB 3TCLB 4E42A 5C8JB 1DQLH 2GI7A 4TLUA 3H1ZA 1XH1A 2NNAA 3RNKA 3WFEH 2JNZA 2VTFA 1JCVA 2PP7A 4HIIA 4TN9A 3TH4T 2NW3A 1T80A 4I13B 2Q6WB 3OJVC 1D7CA 4MVBD 1QHOA 4IRZA 3VFRA 2BW5A 5JHDE 1ZEAL 5T5FH 4J3SA 1PG7H 3K7UA 1WITA 1NMAL 1R3HA 2PW1A 3FPYA 2NR6C 1SZNA 4J6RH 3GS7A 5A7BA 4LSTL 3BUIA 4DKEH 1EJFA 3QDME 4KROC 4XNQA 4JFWA 3QUXA 3D25B 3LXBA 1BFVL 2BNRB 3ZUNC 5F72S 2VO8A 3EGSB 3DX9B 1RUKL 1MCRA 2XCMC 3P3TA 4BA8A 3OF6A 3FQUB 4ODVH 4YBLC 3Q1SL 4LNRA 5GSRA 4CVZA 5FKAA 1AKJA 4JQVC 2PWGA 4R26L 5IB1A 5AVRB 1GS6X 2WNKA 3NIFE 5IF0A 2ADGA 2XN2A 4L8BB 1F58H 1AXTL 3FBQA 3ZKSD 2XA8L 1CLZL 3FNKA 3MRLA 1UJTA 4E42B 1SXNA 2UXVA 5IROD 2NNAB 3P0GB 1ZHNB 1T0OA 4MSWB 3RNKB 5DHXB 4UTBA 2ZWSA 2DQCH 2NW3B 4UT6A 2Z31D 2EAEA 2ZSWA 4XCYA 3VFRB 4U1HA 4CNIA 2W5PA 5IW1A 2DDQL 3D2TA 3F7PC 1KPRA 4L4VE 4N24A 4NUGH 4C56A 4TOYH 4X6DF 4J3OG 2YEVB 3KXFE 3VQLA 4AK2A 5I1HL 2CBOA 5DJDA 1R3HB 2PW1B 1CU4H 3AACA 4JO2L 4HCRA 3TZVC 5D7LD 3D51A 1C9SA 4YSRA 3QUXB 2G0LA 3EYQD 4R4FL 2ATPB 2HWZL 1A6ZA 3VXRE 3QWRA 1PS3A 3AVEA 5DQJB 2ZOOA 5EBWB 3NPSB 2D4FA 2WW8A 3AWGA 3SE3C 4XPFL 4LNRB 1A66A 5GSRB 5FKAB 1AKJB 4BKTC 4F15B 1YMHA 2BZDA 2ED6A 2VRKA 2CM5A 3BVUA 3G5ZB 4WI7A 4CUCA 3Q2CA 5IB1B 2YPLA 3HE6C 3KPMB 2W65A 2ADGB 3FCTA 1R3KA 3FH5A 5DD5L 1B9KA 2AVGA 3CJJA 1ZV5A 5DK3A 2OTWB 4HEPG 5E03A 3MRLB 3U46A 4F9PC 2EE9A 5FCSH 3BT0A 4Q56A 4MCMA 1SDAB 3CHQA 3MCLH 2CDGA 3BT2H 1N67A 3QRBA 1G7QB 3PLYA 3KLAA 4Z7NE 4H5SB 4W4OC 4U1HB 3EXJA 1KPRB 4YSOA 3WO3B 4C56B 5FGCE 2LR4A 3S3PA 4N26A 2BVQA 3P3YA 4XMKH 1JUFA 2F8OA 1T0PB 3ULVF 5LAPA 2IDCA 5D6DA 1HK6A 1WISA 3OWEA 5CEZH 1UD5A 3WBDA 3H9HA 4D3CH 1ET7A 1MW0A 1M57B 1TCRA 5E8DL 4U1SA 4NWTL 4XE0A 2YQGA 1G1OA 3N43B 5LGYA 1PLAA 5KVGE 3QQXA 4FQIL 3RZCD 3TPKA 3FO0H 3MV8E 1J0JA 3DTDA 4MXVE 5GHWH 1NGQH 2DI7A 3KPOA 5I8KL 1YMHB 2YD5A 5F93C 4YHLH 4P07A 2YPLB 1DEDA 3QISA 1IRAY 5I1GL 3UH8A 3DTXA 3FCTB 1R3KB 3NA9L 3J8F7 3E7JA 1YEKL 5HHVH 4GAJH 5I6LA 4ZTPH 3QPQC 4J2XA 3QZLA 3V6FA 2CDGB 4R96A 5KBLA 2W38A 3C2AH 4UOQA 4XWGH 4S0HA 1AD9A 3IDYC 5T3XH 3DOHA 3WN6A 1JPGA 3V6OC 4AGLA 5CGYD 5SWZA 4BUQA 2NY3D 4C83A 4M1GL 3IXAA 2BVQB 4P57A 5AB2A 5K33A 5JLZA 1YJDH 5LCVH 1ZA6A 4FNLL 5IFJA 4KFZC 2PN5A 2XWTA 4BZ2L 1CGSL 2VZUA 2AI0H 3H9HB 4FQ2H 4OZ4B 1QYGL 4DGVH 4U1SB 5LWYL 1JNNH 5I5JA 1M2OA 4ZX5A 1MFUA 3EG9B 3H85A 5E08H 4G3YL 5TE7H 3QPXH 2YK1H 4MAUL 2VLRA 3KPOB 2F6AA 4HKXA 2J88H 4LHUA 4FYRA 4M6NH 3CDGA 1BXXA 4X5WB 4YHML 4KKLD 5IBUB 2IFGA 1LNUA 2IAMA 3DTXB 4HCFA 3ZE1E 4W9FC 4KJPC 5CFAA 4NRXA 1KGWA 3D48R 1MKFA 4J3OC 5ICXA 4ZX3A 3M07A 2Q87A 1DTUA 3CMOL 2YGOA 2J1XA 4PJ9C 2AF2A 1EMTH 3HB3D 4HC1A 1E50A 3V6FB 3BYTA 4R96B 1S6NA 3HW7A 5IM7A 1CTMA 2CLRB 1QI4A 2O6DA 4XVUC 4YHOL 1AD9B 5M94B 1JPGB 4WI0A 5D96B 4X6DA 4AX3A 1OP4A 3FSOA 2GIXA 5LXVA 3MLZH 2P7TA 1SF5A 2AHIA 4C83B 2AK1L 1ZANH 3IXAB 4P57B 4RA0C 3HIZA 1CS6A 3CDZA 5JLZB 3KWTA 1FHGA 1ZA6B 3MCYA 2P3YA 4WQOA 5SX4I 2WB7A 5IFJB 2M2DA 3TT1L 3ARDD 2ICEA 4A1RA 1RULL 5IB4A 3L7FA 4IEFB 1A2YA 3GHEL 5IB3B 1QKZH 5D5ME 2EACA 5AAMA 5IQNA 4XXWA 2R2BA 4L1SA 4G80B 5IHUH 5L6YL 5DGRA 4DGYL 3VAEA 4QOKA 3VTTA 2EABA 2VLRB 4LLWA 1DN2A 4HKXB 3JV0A 4LHUB 3FH8A 4N6QA 3CDGB 1AMXA 1GC1H 1TNMA 4J3UA 4MZIA 3RUGA 1HX0A 1MXDA 1LNUB 2IAMB 1UWYA 4Z3HA 2DPKA 4DGIH 4MXWL 2WLIA 1KJ3L 3HS9A 4NRXB 5ICXB 2IPUK 4JFEE 2OYKA 5BPPA 5LHDA 4XCFH 3P0YL 1GW6A 4WFFE 3OAYK 1AE6H 4AJWA 4NZUL 4QRPA 3FQ2A 2IAAC 3BPNB 1ZTXL 4KKQA 1F86A 4WI0B 4AQEA 1EERB 2WWKO 1UFGA 4X6DB 4D0BB 2WUBH 2V7HA 4KRNA 2P7TB 4KUCD 3PGDB 3F8UB 4AQ8A 4EI5D 1EEQA 2ESVE 1N7ML 1PKQA 3VD1A 3O2DA 2Q1EA 2ZOTA 1N9PA 2ICEB 5IB4B 1I1YB 5ISZA 5T3XD 4RAVA 4UAHA 1A2YB 2J43A 3X3GL 4H2AA 3S2CA 1KF9B 3WEXA 2Y25A 2DJMA 1OAQH 1UZ8B 2V37A 1GPOH 4QOKB 3OR7A 3LPOA 1M7UA 2ZG1A 5M95B 2NY2B 3QQ4A 5DD6A 2ODHA 3SE4C 2Z8RA 4HUNB 1WD8A 1KV3A 4AIOA 4EOWH 3LPFA 1ZT7A 4XCCH 5TQ2L 2WLIB 1X9QA 1PQZA 4JCWA 4X5LA 4MJID 1KTLA 2ADIA 3FU0A 1CK0H 3JV6A 3ABGA 4AMWA 2JCCE 4N20A 3QRGH 4GW4A 4XNUL 5L2KD 1USQA 3ML9A 4X50A 1C08A 3T0ED 1VERA 4QRPB 3VFTB 5HY9A 3T2QA 4AJVA 2HT2D 2R69A 2WBXA 2ATAA 3GLZA 2Y36L 2MCAA 4AQEB 4ZOAA 5I6OA 4CU8A 2DQDH 4MHHG 4V2BA 1CZ8L 2V7HB 3GUTA 4E9RA 5AYUH 2GJ6D 2WWOA 5TF0A 4KFMA 4WGWB 1FUNA 3A3YB 2D3NA 4WEMB 4WFHE 1ZDQA 5EUKA 1JPTH 1PKQB 1SUHA 2R59A 3FK3A 4RISL 5HJGA 2HT4C 43C9A 2YUXA 3BSZH 5DMKA 3WEMA 2FSDA 4OM0L 4B9CA 5ISZB 3H3BC 3ISRA 4GQPH 3DC0A 3RILA 3W0WE 3WEXB 3LQZB 2DQTL 2B9BA 2FUQA 3DO7B 2EXYC 5D2LE 1WFJA 3BJ91 1WZKA 3LHPL 1MAJA 1RJCA 3OR7B 4X5XA 3L6FA 4DKFH 3GSRA 3MFGB 3FT9A 4XMLL 3BP7B 3QQ4B 5DD6B 4OFDA 5HPOA 5BOPA 4H20H 1G7LA 1XQ4A 4ZNCD 1OOWA 4ZO8A 1KJ2L 1PQZB 3Q06A 2HKAA 3K80A 4O2CB 1ADWA 1NJ9B 3KVQA 1KLGA 4UMSA 2ADIB 3JV6B 1FWXA 4NZ8A 5LO7A 5HHQA 4BGLA 3ASWA 4HBCL 4TSCL 1C08B 4P3DA 1MCEA 4OCMC 4JZJC 5HY9B 4H1LA 1NIDA 1P1ZA 5EOQL 4XMPL 4HF5L 2HTKD 4TSBH 2HVJA 3B2DC 5AVZB 4BCXA 1NGPH 4KK9C 2ZAHA 4M1DL 1L9SA 3Q3GA 2PWEA 4NO0D 3UBGA 3ENEA 4AUJA 1X6LA 3VYOA 1NBYA 5EUKB 3POHA 1SOSA 3BKJH 43C9B 1DJYA 5FWQA 5DMKB 2C7FA 4HH9A 5HYJD 1ROCA 2CUHA 3ISYA 3UAJC 3D7PA 3CIQA 1MREH 1VA9A 1FJ1A 1OGAE 1IE4A 3QR2A 4S1QH 2ZKXA 1AHKA 4ZFFB 3WL9A 5HBBA 2B39A 3I50H 4GRWE 2YRPA 3ZHFA 4X5XB 1A4JA 2WNGA 3GJFA 3L6FB 3RDTC 3GSRB 3ULUL 1T66C 5AW7B 4M1CD 5DHYB 2XN9D 4GLRI 1A6TA 2X9ZA 5HVGB 5C08A 4G2AA 1J8HD 3MLTA 3SYOA 2E74C 1XBDA 1NCWL 1SY6H 1KLGB 2DQFB 1JNLH 3LN5A 4ORZC 4TSAH 4AEIL 5HHQB 2X40A 3WJLC 3D9AL 2G60L 1GOFA 2NDFA 4LSRH 1JYWA 4P3DB 3VW3H 5KVFH 2J5WA 4IRSD 1GJUA 4KK5C 4H1LB 5ALBH 1P1ZB 1E9QA 3RJQB 3VFWB 3NJMA 3G6DL 1A5FL 3IJSA 4JDTL 4NWUH 5DEFA 3C6LD 5AVYB 1XB6A 2HVJB 3P9LB 4LEEA 2JXMA 2IG2L 4AKQA 2J1ZA 2PR9A 1PFOA 5ACMA 1NIFA