4L8DB

Crystal structure of the h2db in complex with the np-n5d peptide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
QKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Acute emergence and reversion of influenza A virus quasispecies within CD8(+) T cell antigenic peptides.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 15
structure length 98
sequence length 98
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l8dB00
3UTPD 1JYVA 3F7QA 1BFSA 4C56D 4WEUD 4FRWA 2NXYD 3WEXA 3WXVH 3WIHH 2VISA 3OJDB 1OF2A 1U8QA 4DKEL 5DJ0A 4MJ4A 1SYSA 1TLKA 4LIQL 5B39A 3PDOA 2WAHA 4LLDA 4NQUA 1QYGH 3AB0B 1PBYA 1RZIA 1TNNA 4Z0XB 2PCPB 5FDWA 1MCWW 2C3WA 2VDLH 3BAEH 3DX7A 5E2WL 4Z5RB 3CSYB 4WU5A 4KJPD 1IGYA 5GJTL 4G6AD 1LVEA 4PUBL 3NIGE 5I1KH 3OXSB 1ED3A 4KTDL 4H25A 5BZDA 5LVEA 3OAZH 1DZBA 3U6RB 1QRNA 2Y6SD 3LPGA 4MVBD 1W72L 2NX5B 2J6EA 4OQTL 5I15H 3T04D 5ADOL 4MJID 4X6BB 1HZHL 5E8NA 4TQEL 3ZT7A 4XVUC 4WY7L 4CN1A 1MCIA 4ZSOB 2X4SB 1HHIB 1G7JA 4U3CA 2IAMD 1WBXA 4FQIL 4G8EA 3QG7L 5GSVA 5DJ6A 1MRFH 4KTDH 4KRMB 4KU1A 2OJZL 1QNZL 3C6SB 3VXRD 2Y7QB 2DD8H 4L5FH 4L4VD 3MMEA 5TH2B 2NY4B 4ODWA 1MJ7L 2R0KH 1Q9LB 4YUEH 3AU1A 5C0DA 2DICA 3SDXF 2Y07H 1PGRB 1NUFA 1K4DB 3BQUB 1BFOB 3V0VA 4XTRD 2B7DT 1EFXD 1EZVX 2PO6D 4OB5H 3QJHA 3O6FD 3KHQA 5E6IC 3ZHLA 2P8MA 3W9DB 3QUMB 3L3KA 2DIBA 1U8KA 2H6PB 3NN8A 2JJVA 3AREB 1WAAF 1R3IH 2FSEA 4IDJH 2ZJSL 2MPAL 1MAML 2G60H 1RUPH 3S96B 4NKIH 3TYGL 2ZUSA 3JBG7 2YUZA 3OJ2C 5IROC 4LP5A 2CLRA 4RMWA 4PRNA 3WHE1 3C5ZC 2AEPL 4P9HL 5D9SA 1A8JH 1B6UA 3WSQL 3TEUA 5FYLH 5DK0B 1A7RH 1WCBB 4LNRB 3TBTA 4BZ2L 4YPGA 3QZWG 5T5FH 3MCKB 5DD0L 1HH6A 3EFDL 1AXIB 4NO0B 4OLYL 4UI2A 4Z7VF 4J3OC 4BQ6A 3LN4A 4CN6A 2MNUA 4LK4A 1KTRL 2YMXL 3BPLC 4X5WB 4X98A 1MCNA 3TO2A 4Y16B 5IJVA 1ZLSL 2EIZB 3VH8B 4X5LA 4G7YL 1QBAA 4FFZH 2CUMA 5HYQA 1ADQH 1J8HA 1GGCH 4M9PA 5BV7B 5C7XL 3HZYA 2YPKA 4A6YH 3IKCA 2DQIL 2I5YH 4JFDE 3JTTB 4OT1H 4MD4A 1JJUA 3T65A 4D0DB 3MLPA 3CUPB 4U1LA 1KV3A 4LU5H 4ODUB 4YDJA 4LSVH 5GSRA 3NIDE 5FM5O 1FPTH 3F12B 3I75A 4NQCD 4KK6D 2XN9B 5BXFB 3P40A 1CD1A 1TZGL 3B4NA 5CUSH 1QFOA 1KJVA 1QFPA 3G5ZA 3MLUH 2YSSA 4GQ9L 1A47A 4NZUH 4PRDA 3JV6A 5FGCB 5HD8D 3IF1B 2HFEA 2RR3A 5BZWB 3CVIH 5CEZH 5GGSA 1H3VA 2WIIA 5ACZB 2CSPA 1FYTD 1U8IB 1RJZB 3UTSB 4UDTA 3HUJA 3I9GL 4RAHA 1FO0A 1OLLA 4B50A 3PWLB 5T3ZH 4HKBB 4LASH 4OI9A 4Z95L 5EC1B 1DEEA 3MV11 3LV3B 4I9WE 3T4YA 5AAMA 3RI5F 3V4UL 3TO4A 1A2YB 4APQD 5D7JB 5K93A 2YN3A 2GT9B 2C3GA 3RWFA 4I4WB 5SWZD 3AROA 3BHBB 1QPPA 4Y2OA 1G7LB 1LEKA 5D1QA 3DURB 1XCQA 4JCMA 5EUKB 5IGXL 1LK3H 2JELH 1RJYA 1CS6A 3RGVD 4WWKA 3E3QE 4UV7L 2AEIT 2QQLH 5DJ8B 4ZS7L 5IR1B 1EXUA 4LVEA 4PB0L 1S7TB 4PG9A 1JGEA 3EHBD 1CE6B 3LEVL 4NZRH 2NCMA 3MOBH 4MLIA 5BW7A 3ARDB 5C0BB 4JQIL 4WW1A 1PSKH 1U92B 1WWWX 4GG8B 1DR9A 3OAZK 3CD4A 4O5LL 2R1WB 1E4XH 1MCLA 3OXRB 5IHUH 4DK6A 3QQ3B 3KDMB 3S3JA 3W5MA 1I75A 3C5SB 3ZDXF 2PYED 4MCYA 4L8DA 5C07D 4OJFL 4Y4KD 3CXHK 1UFUA 4HFUH 2X2YA 5I1CL 4OI7A 1TVBB 1MLCA 3SDXA 3O3EA 3U2SB 2YD2A 5FK9B 3R06B 1BHGA 1JPFA 2OR7A 4IRSD 5E08L 1IZJA 4IIQB 3QISA 3TYFA 4AL8H 4EOWH 4V1DA 4O4YH 1CDGA 4HIIB 3SQOL 4NP4H 2Y1VA 3HAEG 5CS7A 1FRGH 5GGVY 2CKBA 3F65A 4OZGB 4LCIH 3BKCH 4OCYL 3VG0L 3RDTD 3ALPA 2R0LH 5HDQH 4F7PA 2MSPA 1QUNA 4LSTL 3S97C 5ACLA 3GSUA 3VRLE 3S9DB 4RMSA 1I85A 4PJDF 3MRCB 5CILH 1KXVC 4HMDA 2XNAB 3OZ9H 5I16A 3BZFA 4K07A 1AFVL 3R0NA 1L7IH 5JHDA 4PJ7E 4YBQC 2ESVD 4QRUB 3QI9D 3VFGL 1XGYH 4ZYKA 3MV9D 5I8KL 3V0WH 3SQOH 2E6JA 2IFGA 4OIAA 1Q94A 1TDQA 4OCYH 2SEBB 4HC1A 5HHOA 1MLBB 1PQZA 1QSEE 2ZG3A 2IF7A 3CSPA 4J6RL 4YDKH 2D3VA 3B5TA 5F6HI 3BIBX 1GVIA 2ERJC 2PR4L 2J5LB 4GMSH 1AD9A 4OZHF 5EUOB 1QR1B 3WIFB 1K8IB 2GKIA 3FT2A 8CGTA 2X4RB 1T22A 2VZ3A 4JFFA 4JRXD 1EEYB 3GM8A 2IBZX 4PJXB 3LS5H 4HPOL 5D1ZD 2Z92A 1AQKH 4JM2F 1OGTA 3EYFB 4L9LA 4LPUA 2HTKD 1I9IL 3CMOL 2DI9A 4WGWB 5GRVK 1KENL 2VLRA 4K3DL 2IH1A 5K9QI 4CU8A 4ZOBA 3TFKD 1MIEH 2Z31B 3FQNA 4TOYH 4OTXL 3P2TA 4NQDD 4QCIA 2BFVH 4POUB 3DTXB 3IDYC 1MJUL 1AY1L 2D7OA 2WQ8A 3CDCA 2DQJL 2P5WD 4TNWF 1J0YA 4M5YH 3W0WA 4RFEA 4NFCA 2PTTA 3M1BB 4XVJH 3SBWA 4GLRH 1OSPH 2ITDB 4NFBA 1WFUA 2V7HA 1GGIL 4XP9H 4UBDC 5T1DL 3ULUD 3GIVA 1R3LB 1P69B 2R29L 3E6HA 4FQCL 4XCYA 1M7DB 3VD9A 1SY6H 4OCRL 1KFAH 3ILQC 4Q0XL 3C6LA 3N1MC 4F33A 3MV01 4LLYB 4JHAH 2ICWA 3O45A 5IV2B 2EKSB 4M7KL 4KJQC 4H1LG 4JDVB 1F58H 4PRPB 4QRRB 4D8PA 5JR1H 3S35X 3TCLA 5T1KA 1AGFA 3DETD 1R5WB 2NY3B 3S35H 5MEOA 3GHBH 3CLFL 2W9DL 2RBLA 3MUGB 1YN6A 1JGLL 1GGIH 1IM9B 2HJKA 1IKNA 2BNQE 2ICWI 1UM4H 2K3TA 4OCRH 5GGRA 1ETZA 1I8IB 5ALBH 2W65A 1RZKC 1RIUL 1IFHL 5D2LB 3SDYH 5HGAB 3GSNH 3MRMA 4NCC1 3BSZH 4LHUG 1FL6A 2A6KA 4LPWA 4YXHL 2DWEA 3FQWB 4UUJB 3QYCA 4KVNL 4ZDHA 4AYFA 2A6IA 4G5ZH 3LQZB 5LJYH 1I9RL 2W9DH 4Y4HB 5DJAB 5JW3H 1UYWL 2X89D 4M02A 4R2GB 3KPOB 4LLVA 1HINH 1ZS8A 3MRNA 1MREH 5EIIA 1KN4L 2Q76B 5FUZL 2Y4SA 3G5VB 4D9LL 1N5AB 1T04B 4J1UB 2CUHA 4X6CB 3JUYA 4K7PL 4HT1H 1EEUA 3U9UA 4LGRB 5JMOC 4XXDB 2CLZB 4JFOB 2XG4A 5T1MA 1AXTH 5TE6H 1FFRA 3VXTA 2CIKB 4YXHH 3QUZC 4KZDH 1CQKA 1MJ8L 3M17A 3B3IB 2LQRA 2P8LA 4X7EC 1DVFA 2VXSL 2H2SC 5ITFA 2MCG1 2BSSA 2DRUA 3DV4A 4H5SA 3REWB 3BN9D 5E5MA 3LKRA 1G9NL 5LXGL 2YXFA 4X6FB 3P0VL 4PJ5A 5ICXB 1KJ2L 1R6VA 3GIZL 4X4YB 3QNXA 1IC4H 2QQKH 1I1FA 4K7PX 3TA3B 4N1EA 4PJDA 1KCSH 4NQTA 5E2VL 2XQYG 3HE6A 3MLTA 5DZOA 4PJHB 4HH9B 1R5IA 1AI1L 1A9EB 1RHFA 3D39E 5GRWA 1GGBH 3E2HB 5ETUA 1A5FL 2IG2H 4PJBA 4U1JA 1XIWB 3RNQA 5C09A 2ZPKL 4U1HB 1S7WA 3KLAA 4KTEL 4GRMB 2V2TB 4YHNA 1S7SB 4HS6A 1NAMH 1C16B 3S4SG 4OD3L 5E24E 4GUPA 1I85C 4GSDL 1YEDB 4IJ3B 3WE6B 1EUTA 3QIBC 4OZHA 3W11C 4ONGH 4GW5B 1T80A 3FN0L 1F6AA 3WYRA 3L3GB 1CDIA 1RUAL 4N0UB 1M6OA 2VQTA 1J5OL 3UTTA 1NCTA 3CZFA 3OL2A 4KRLB 4FNLL 4UQ3B 3I3DA 4OCLC 4XP6L 1R0AL 5I18L 2BJMH 4JZNB 4HWZA 5CIPH 3WS6C 3P4MA 4MD0A 4E0RA 4HUUA 3PP4H 3U9PH 3HS0B 3S7GA 5IK3B 1CLCA 2ZG2A 4K3HA 1IAKB 1FFPB 4ZXBB 3H9SD 2E27L 5GS1B 3T8XB 3S88L 3BWUC 2IFFL 5K33A 2G9HA 2AABL 1UQSA 2FEEL 3TVMC 1IGCL 3PE9A 1DQQB 1K3IA 3GI9L 5EBLA 1TPXC 4Y88A 3BUYB 1OP3H 4F7CB 5D71H 1CLYL 3B2UC 4XVUD 5GRUL 4XH2A 3QDGD 4A6YB 1Q38A 4FTVE 3HRPA 4P5TB 3BFOA 1SJHA 4WHTB 4XCNB 2BY1A 2X4QB 5C70A 1SEBB 1M7IB 4ONFL 3IAQA 4H1LA 3QEUA 2P7TA 5HHMD 1ZLVH 5I73B 3SBWC 1A7NL 2DLGA 2F74A 1L0YA 2LVEA 4NFDA 1S7QB 1CDUA 1AO7D 4RFNB 1FYHB 4QOKA 4YHPB 3RWEB 3QRGL 1XF5A 1XF4A 3EYOB 3I02A 4YHOH 1JIBA 5ANME 3HB3C 3C6LC 4HIJB 4KRPB 2AI0L 2BVQA 2Z93A 3SE9L 1IGJB 4ODSL 4X7TB 3W9EB 3MODL 1L7TH 2DKUA 3WFDL 4NWUL 4ZO7A 2XKNA 4URTB 3DYOA 3E3QC 1T5XB 5DFVC 2ENYA 5J8OA 3VXUB 1DANT 2VITA 1HDMB 2XOTA 1GGTA 4KDTA 3TWCH 4Y5XC 4L1DA 1YMME 2LE9A 3K4AA 1BIIA 4XHJD 1AD0A 2KQNA 2FO4A 1AGCA 4H26A 4HH8A 1A6ZB 1BF8A 3WIIL 3GGWA 5E8DL 4UT7L 4N0YL 4NKOB 2RAMA 4HAGA 1J0IA 3FFCB 3O2DA 1YYMH 1PAMA 4Y4FB 1HXYA 2AV7A 3CVHL 5MEPB 3C5ZD 3ESUF 4JN2A 1U8LA 5C0CA 3QJFA 3RRQA 1KELH 5LCVL 4AEHL 3MLYL 2IANE 4M6OH 2ZNWA 2G5BB 3ULVE 2ADFL 2WBWB 3UJJH 4GKNA 3THML 2OX5A 1J86A 3IVKA 1BFTA 1Q0YL 1BD2D 5C0JB 3FONA 1HH9A 2XTJE 4C54A 2D7NA 3LN9A 5I1GH 3QO1B 4PV9A 4XP1L 1D6VH 4WI6A 3OKLB 4R8WL 4YDVA 3PHQB 4BZYA 4GRLA 4KK5D 5LCVH 3RKPA 4P3DB 1IQDB 1MAKA 5LKNA 5F89B 1F90L 4E41B 1CE1L 2V6HA 2BVOA 3VXME 4NKQB 1HHKB 1RU9L 4OLEA 2LAAA 5J56B 4UDUB 4DEPC 2KL6A 4HWEL 3BP4A 1FL5B 4LQ1A 5C92A 2A6JB 1KPVA 1D9KB 2C4FT 1SEQL 1UCBL 4E9LA 1TENA 4U0RB 2GITB 3QIUB 4HV8A 3U46A 3VXPA 5LGHH 4MNQB 3OG6B 5L2KE 5J6GA 4QHNA 3X14A 1Y6NR 2GCYB 4YE4L 3GKZA 4JAMA 4P4RA 2MKWA 5BVPH 1DQDL 3P11L 4G8IA 2QHLA 4JO2H 1S7XB 5EO0A 4XNUH 1YYLL 4TNVF 1DL7H 3F7RA 4KQ3L 1FAKT 3JWOC 1OM3L 1KPUA 2HTLD 1DQLH 3QAZB 2Q7YA 1CLZH 5KW9H 4HGWA 1UWXH 4NIKB 3C87A 4ZUTB 3AMKA 3RVVC 4PRHA 1WBZA 2MQ0A 5CP7A 4G9FB 4EXKA 3Q6FA 2VXUH 1LO5A 2VR9A 3QDMB 3OHXA 4Q9QH 5FGSA 1MCDA 3TIEB 1TJGH 4IOIA 1I8MB 3OX8B 2Z4QB 5IESH 2G2RB 1Z9OA 4KKBC 4QXGH 4F7MB 2W60B 2A6DB 4QHLA 3JTSA 4L4TA 4P46B 2IADA 2QSCH 4XMKL 5HHXL 5F7DA 4M00A 2APWA 5C6WH 3A6BH 2DQCL 3MGOA 5IQ9A 4RA3A 4JG0L 1FFNA 2BNRD 1IM3B 2HT3C 2EDRA 1AC6A 1A0QH 4DGYH 3QHTC 4LAQL 1XCTB 3QP3A 4DUWA 1CT8B 3QXDB 1J1OL 4MJ5B 5F7WC 4X8JA 5I1HL 2OQJA 4G43A 3QCVH 3BI9X 1ZKAA 4P23B 5CJOH 2ADJA 2P24B 2WIMA 1CDYA 2J6EL 5ESQA 2XXCB 3NABH 3RP1A 3O9WB 3KYMB 2AJYL 3IFLH 4HK3N 4MXVF 1ZLVK 5K59F 2WANA 3ARVA 4Z7OE 5CFHA 5HGHB 4FXLA 4OCSH 1KPRB 1FNLA 3QUKB 3T0WA 3GJEA 4KC3B 5C86A 1IEBA 2LABA 3NA9L 5T1LA 3SY0A 1JPGB 3QPXL 4O2CB 3HZMA 2L7JA 3K7UA 2VKXA 4DFIA 1F00I 4GO6B 5E7FA 4P2RD 4ZFZA 1JGVH 5AWNL 1OW0A 3TZVA 3EOAA 4JFEE 4G6FB 5J89A 4MB3A 2V9TA 3C8DA 2HKHH 2DJ4A 5I74B 4TUJB 5SWSB 2MCPL 1WISA 4U6XB 4ZAKB 2NTFA 6CGTA 5EIQA 4KKNA 2F54A 2BP3A 4ZUUA 1X5IA 2EXWC 1ZLWH 4XP4L 5D8JL 2PUQT 3HCVA 3BPNB 1B4RA 3REVA 2XRAL 4AG4H 4PLKC 4HUWB 3TBWB 4PJEA 5EU5A 3GSOB 1FE8L 4QT5A 2A2QT 3ARRA 2FX7H 4LRIC 5HJ3A 1AP2B 4O02H 3FRUB 5C0EA 1F4YL 2YPLB 4NQSB 3QQNA 4OCXH 4WNQA 2QSVA 4KVCL 3T08A 2XZZA 4PGBB 1OSZB 2DQGL 1MI5A 4ODVL 1NLDL 2ADGA 4BSVB 1DBAH 3T0XA 3R0MA 1BJ1J 1IEHA 2VAAA 2VOTA 1QSFD 3N1FC 5F9WB 1PKQA 1NMCC 2FIKA 1NGYB 3L3IA 2DS4A 2HG5A 5D7IB 3FFCE 5IW6A 1VKXA 2WUBL 4UINH 1X44A 2DIJA 2GJ6E 1QOKA 3IJYB 4PRIE 5INDB 2EDNA 3UC0L 2D9CA 4XRCA 2EE2A 4JB9H 1X4ZA 1F4YH 2ADIB 4UBDD 2FYYA 3SCMA 2P49B 1LE9A 2UWEA 3G9AB 1R3HB 4H8WC 5F1IB 3PQYD 3ILQD 3MROA 4RAUA 1URLA 1H15B 4I0PB 1DLHA 4ZD3H 1N64L 5J3HC 1F3DH 3VI3E 4N9OB 4GT7A 4KJQD 4GH7B 4W4OA 5DEFA 4FZEH 1PY4A 5KVDL 1YC8A 3QUYA 3DYPA 5FYJH 2EDHA 1NAMB 2FX8H 4P59L 5F7KC 4YHYC 4HUXB 4XCFH 1FZMB 2YUXA 2NTSP 2ZSWA 5CZXC 4N5EC 3JV4A 3G5YA 2AK4A 4NNYA 3S3SA 1Y0LB 4U7SA 2B0SH 5D7LA 1UWXK 1JUFB 1BQUA 5B4MC 2HFGH 3KPLA 4P4KA 4PTTA 5I71B 3QXAB 1IKFL 3X3FH 4F7EB 1SJXA 4U33A 5C8JA 4PJGB 4XB8A 5CIPB 5LGJB 4Y2DC 1J1PL 1C7TA 5EWIL 1FO0L 1RZKL 1XGPA 2CJUL 4WV1B 5DXWA 1MHHA 3LS4L 3HPJA 2NY2B 4EI5A 3EYSH 5IVZA 4TVPH 1NLBL 2VIRB 5ISZE 4EN3C 2EYTA 2R4SH 4ZUVB 1U8NA 2J2ZA 2XG5A 2XIDA 4WUKL 2CDGA 4FZ8H 4EDWL 4ALAL 2OP4L 1IKFH 2FGWL 4HSQA 4Z7WE 1RPQA 1H8OA 4XNYL 5CD3B 3QUZD 1S7VA 4MX7A 2G75A 3EO1A 4P5MB 3MGTB 3ZTJG 1NMBH 1FCCA 1U58A 4P57B 3MRJB 3QEQB 3CFBB 5FYKH 3RA7L 1G7PB 1KACB 4DVRH 5I6XC 4YEEA 1FFOB 4WTZA 5C0FA 3MNVA 3NCYS 3VE0A 5D7KD 1RZ7L 1WT5A 4CVZB 5BCAA 1ZVSB 2OSLA 3VGAC 1KN2L 3ZKSD 4DGVH 2VDPH 3HC0B 1YUHB 4MAYB 1U91B 2HP4A 2OL3H 3RX8A 4XT1C 3EZ8A 4HMEA 5IMKA 2C4XA 3C5JB 3L3OA 4NZTL 3CXDH 5J06A 3RA7H 3H3KA 3VXSA 2Z35A 1KSRA 4KZEH 1IQWL 3ZTNH 3SKNA 1G7QA 2AQ1A 1MEXH 5F7FA 3ULVC 4R7DA 4UQ2A 5CP3A 2JCCA 2NZ9C 1RMFL 1J0KA 5IB1B 2CKBL 2AXGB 4R26H 5EU6B 4NKDA 5D2NE 1RZGB 3QIBD 4NO2A 3C8KB 3W11D 3DIFB 2OCFD 1Q1JH 3ORJA 4JN1L 4I18A 1H5BA 5I8CA 3SDAB 1PLGH 3TZVC 4O2FA 2KZWA 3ARBB 4K3EH 2AJSL 4GAJL 3NIGF 5HHOD 3TN0A 4MA8L 2FL5A 3O6KL 4P48A 1KB9K 2GUOA 1MFBH 3V7MA 4K7FB 1Z2KA 4JZOB 4YNYA 4XPGH 3B6SA 5HYJE 3VDCA 2AKRB 4JFDD 1DUZB 1P6FA 1OVZA 1I3GL 2D7TL 5F3HA 1FIGL 3PWPA 2YOCA 3UJTL 4RZCA 1NCUA 3EKCA 5F6IC 2VE6A 3SDDB 5JIHA 1FJ1B 1NC4A 1C1EH 3NZ8B 3TVMD 1X5AA 2Y5TA 3SGEH 1DLFL 1GPOH 3S34L 3H3BC 4N0FA 3MRPA 5DSCA 4WDIB 3B2UD 5CCKH 4FP8L 4YIQB 1XGQA 3L7EA 3BD4A 3VFMA 1X7QA 3RX5A 1BZ9B 2APTA 2F9BT 5C08E 3SJVA 3ARFC 3UYRL 2H8PB 3P4NA 4HC1H 1BQHG 3NACL 4UV4H 2EKJA 4RAVA 4YWGH 2YUWA 1JF1A 1W0VA 3BIKA 3Q48A 5E5UB 3MV7E 5I1EH 3U0TB 3W0WD 1T1WB 1ORQA 4NM4L 5I9QC 2K7PA 5E00B 3ESVF 4I9WD 2VZTA 3IRPX 1G9MH 4WUUB 4LCYA 5KG9B 1SBBA 3RJDA 3C60B 4X5XB 5DRZA 5F1NB 3VRJB 1BPVA 3HB3D 2D7MA 3H6JA 3ZYOA 1LO2H 3BW9B 4F37F 3ES6A 1MHEA 1T1XB 4IMLB 1FSKC 2DKSA 3SPVB 3MREB 5E2UL 3OB0H 1U8MB 4NYLA 4GKZA 4FQXB 1MCEA 4P2QD 5DFVD 5EG6C 1V7NH 5DUBA 4JPIB 1YEKH 1IAIH 4P3CL 4PJCB 3CZJA 2E5EA 1KBGL 1FC1A 2VN4A 5SX4I 5GJSH 1VPOH 3MLRL 3RWIA 4QHMA 1XR9A 1F6FB 5MERB 1ZHLA 4HLZG 1NCWL 1U8OB 1HHGB 1X5JA 1MQKH 5BS0E 1FNGB 3KYNB 5IMOA 3SO3B 3STZB 3B5GA 1HE7A 4WO4A 3I50H 1KIUA 4HBCH 1RZFH 2J8UE 1E28B 5LWYH 4D9RE 1IARB 1C5CL 4P3CH 1FG9C 5J6HB 1JHLL 4HCRA 4EI5C 5DUPL 2YBRA 1I8KB 2HVJA 4IRZL 5E8PA 3U4AA 4PB9H 3B9KA 1LO3L 4HJGB 3RY4A 1MWAB 4F80A 4CMMA 5GISL 1OAYH 1W0YT 5HHQA 4P2OB 1Z5LB 2P46B 3QIWB 2R8SL 2A9NL 4M8VA 4TVSa 4R96A 1OF2B 5B38G 3M45A 5DD5H 2ID5A 3NIDF 5CGTA 1IC1A 3MCLL 7CGTA 4M1DH 1AXSA 4QY8B 2ITCA 1JZ3A 1VFOA 1BAFL 5DJZB 5FHAL 1T4KB 3QRFM 2JJTA 1CD8A 3LAFA 3QDHA 5HDOA 4J2XA 4JKPH 3WFEH 3UJIL 2A9ML 1FHGA 2VDKH 4PJ5D 5CWSB 5LQBH 3TBVA 1INQA 1G6VK 4O9HL 3QEHA 4MLSA 2P8PA 4HJ0C 1F3JA 4M7LT 3RNKB 3SDCB 3K46A 4OD1H 2Q8BH 3T1WA 2A9NH 1JNHB 3FQTB 1GIGL 4QXUL 3GUTA 2ZUXA 3VRIA 1GOGA 3WFBL 1QSED 3KYKL 4X80H 5F88B 1AE6H 1AKJB 5EA0L 1C5DA 1IC7H 1G7HA 2YWZA 1N6UA 3K1KC 1CFBA 3DUHA 4JRWA 4YR6A 3OJMB 3KJ6L 5BQ7A 3WNPA 1MFDL 4OV5B 3DV6B 1I4FB 3MBEA 5IHLB 1KIPA 4DCQB 1KTDA 2I25N 1NFDA 5D72L 4WFFD 3RVVD 1G7JB 1MPAH 4R0LB 5C0AB 3JWOL 3OKNA 4HEPG 5GSVB 1SJEB 3KPPA 1LEGA 4I18C 4RGNC 2W0PA 2Y36L 3WD5H 3UTTD 3O4LB 4PJFE 2DLTA 5FGBC 5EBWA 4MNGE 4KXZH 2N56A 3UTQA 3TCXA 1RY7B 3P9MB 1CFSA 4M93B 3TM6A 2R1YA 2X7LA 2FJGB 4ZUSB 4L29B 2BVTA 2VUOA 5CBEA 4JPKL 1QLFB 5ALCH 1F2XK 3MRKB 4UU9A 1T3FB 5DJYA 5LBSL 3GSQA 2X1WL 4Z7UA 3W82A 1FNSH 3PGFH 3QA3B 5DD3H 1LD9B 2JIXB 3OKYA 3WCYA 1NGWA 4BZ1H 2AJVH 3G5XA 2HT3D 1YQVL 4BH8A 4OLZL 5CEXA 4D0CB 1JF5A 5IB3A 5IM7B 2XA8H 2MMXA 1MCKA 1FGVH 1ZT4A 1RUML 4WI4A 1E6OH 1XF1A 2AJXL 5I1JH 5F7YC 2J1KA 1BECA 3CCHA 3TT1L 3KXFA 4YX2H 2IBGA 1BVZA 5C9JB 2CLRB 4JPKH 2H9GA 2FWOA 4R97C 1KNOA 5LBSH 2BNQD 1HXMB 3O41A 4XAKE 3GMLA 1MF2L 3MJ8A 1F02I 3MFGB 3L3JA 3B8YA 1HSAB 1I7RA 2ARJA 3IS0X 3IU4L 5D70H 3VRLF 3BVNB 3VW3H 3AMLA 2E3VA 2JB6B 2P5EB 3DXAB 3GSXB 3HLAA 1UKQA 1GHFH 4G6ML 3L6FB 4OLWH 4PJ7F 1KIRB 4F2MB 4DVBA 3GB7B 4OGZA 4S11A 1UM5L 2VLKA 1LE5B 5TDOB 2DAVA 5MENE 3OB0K 4RMTA 3NPSB 1X5XA 2VDQH 4G7VH 4OKDA 2OI9B 4XWGL 5EC2B 5HVHC 3P9LB 5I19H 5M94B 3SGDH 3IAPA 3UCRA 5TF0A 1UH4A 4GBXA 4X7CC 4LHUD 4GQPH 4EBQL 1QA9A 2D2OA 3FO2B 1N0LA 1LWRA 2D03H 5KZCB 3HFMH 4MD4B 1EMTL 2Y5EA 1NEUA 5DURD 2XY1A 4JPVL 4YDJB 4B7LA 3HE7C 3WUWB 1YC7A 1CG9A 2UYLB 4BFIA 2Q86B 2EXWD 3VWKB 5C2BH 4I0CC 4TPRH 3CLEL 1N2RB 1BOGB 4NN5B 2VDRH 3D18B 4PGDA 1WC7B 1A7BA 3B9VA 5ICYB 3A6CL 1M4KA 4NBYB 3M8OL 1AR1C 5DQ9B 3N9GL 4FQ1L 1RSFA 1FNFA 3EAKA 3O2DL 3WFCL 4M62H 4XBPB 3VGGA 5A16A 4BA8A 1A3LL 1RHHA 3D39D 3U7WH 4EUPG 1TJIL 5AEAA 3ILPB 1KJMB 3NZHL 1ZSDB 3OKOB 2QBWA 4XCEB 2VXVL 5DVOA 4NN7C 4F15B 5IT2L 4OZFG 5IMMA 2H32H 3RWFB 3OWEA 1ZA3B 4U1GC 3NH7L 3E1F1 4L3CA 3RTQA 4PGCB 3R1GH 4S1SL 5D2NC 4LOUC 3VH8G 4JHZA 1UB5B 1RVFL 3GHEH 1DN0A 3EBAA 1CGSL 1YJDH 1UH2A 5CEYA 4KKLC 3U4EA 4XP5H 4M5ZL 2OL3B 3DX8A 4JRYE 2D0GA 5J3HD 3ULSA 2Y06L 3RZCA 4UIMB 5E9DB 3MOAL 1EPFA 3VD7A 1MCPH 4H8WL 1QTYT 1XGUA 4PJ8B 2HFFB 5DD6A 5HPMA 5KSBA 2FHBA 1LEIA 1GH7A 1ROWA 4FHBD 2DQDL 5CZXD 4U6HB 4KUZH 4MQSB 4N5ED 5D5MB 4XX1G 4QNPE 3AM8C 1X5FA 3QFJB 2F53B 4JKKA 2FEDC 1H3PH 2ZOLB 2APXA 4CL7A 5IHBA 3ULUH 3KAAA 3KPSB 3DPBA 4Y2DD 1GGUA 2PCPA 3MLSH 2FNBA 3KPTA 5M7QA 4FTVD 4LSRL 4Z5RA 4XVSL 3CSYA 1Y18B 3NCYP 1VCAA 3R8QA 3O2WH 3NIFE 4I8DA 4MA3B 3UTOA 5E7BA 4PY8J 1UC6A 4EN3D 3OXSA 4LCCB 1JMZA 3RHWF 1BJMA 1FVEB 2FATL 3VMPA 4C56B 3U6RA 2X9YA 2NXYB 2F5AH 4LEXL 4JY4B 2NX5A 1V7MH 2XXMB 4TSAH 4X6BA 4M1GL 2GFBB 4EDXB 3GBLA 4ZSOA 3TT3L 3U1SH 2HLFC 5TFSL 2X4SA 3NTCL 1HHIA 4RGMC 4JQXC 4JG1H 4ZOEA 4Z7VB 5B3NA 3LCYA 2C7UB 5JW5B 4ZTPL 1MFEH 1YMMD 3C6SA 2Y7QA 1CTNA 4RRPG 5TH2A 1IGIL 1JWMB 1Q9LA 4X0KB 2E9WA 1KB5H 2A0LC 4WFEE 3OGCB 1YEFL 4PJ9D 1NUGA 2VLRB 2E7BA 5DC4B 5F9JB 1K4DA 3V4PH 1BFOA 3RWGB 2RCSL 1EA9C 3BYTA 3NTCH 4TNWK 4XBGB 2IAND 4L8CB 4OZIE 3ULVD 5T1LD 2NZ9D 4DW2H 4IEFB 2J8OA 4R90L 3BRDA 1NCCH 4BQBA 3BMVA 3QUMA 4JVUA 4U3HA 1A7QL 2HKFH 3D69B 3NFSL 5TQ0H 2H6PA 3ARXA 2IAMB 2XTJD 3AREA 4J12A 1DQML 1OTSC 3TZVD 2OTUB 1A3RL 3S96A 3K1DA 3ARQA 3DX6A 3DXAE 1HI6B 3GMOB 4L4VB 4LKCB 3BKML 1HEZB 5JQHC 2HT4D 4U1KB 1GXEA 4TUKL 3VG9B 3VXMD 1ZGLB 2CIIB 2H26B 1E6JL 1FZKB 2YA0A 5DK0A 2XKUA 1MIMH 1XEDA 5TJWK 1EFXB 1WCBA 3N1QC 4HLJA 35C8L 1NSNH 2PO6B 3T0DA 3QUXD 3MCKA 3I6GB 1DQMH 3O6FB 4NO0A 3V6FB 2ICEB 4X9FA 1IBGH 2GY5A 1JNNH 1BX2B 3T4AB 5LGKA 2ZUTA 3P9WB 4Y5YC 3LQAH 4X5WA 4AT6B 1IAOB 1OWWA 5L2KD 4Y16A 3VH8A 5AD0B 1KT2B 4PJXF 3HR5B 2V7NB 5F3BB 1PFCA 5FEBA 3ARFD 3MRMB 1RAMA 3MGAA 2IQ9L 3D3VE 1TQCC 3BJLA 2DWEB 3GZKA 2NY7L 5JIIA 3JTTA 2VMFA 1NDMB 5EB9A 4D0DA 2APVA 3CUPA 5JIPA 4NJAL 4JREB 5TE7L 4ODUA 3RTQC 4HWBA 4ZOAA 1SMAA 3ZDYE 5IB5B 3F12A 2XN9A 4FQJL 5BXFA 3DLQR 1JGUH 3VGBA 3T77B 1B2WH 1A6WH 3CDYA 3UBXB 1CN4A 5HGDB 4LDLB 1JZ5A 4P0DA 4U1MB 5J13C 3RZCC 3VFPB 4M7ZC 3D1MC 2BY0A 1TETH 2IQ9H 3VXTB 1O5DT 2R2EB 3IF1A 3AC0A 5BZWA 1H0DB 3DMMC 1S3KH 5ACZA 2UV3A 1U8IA 1RJZA 3UTSA 3EO0B 4NQEE 4UOW0 3TNMB 5FCUL 1CI5A 4HK0B 3PWLA 4HKBA 5J57B 5EC1A 3LV3A 1TMCB 4JPWH 1NCBL 3NVQA 2NXZB 1A2YA 3ULVF 3DX9B 5D7JA 4NWTL 4NUGH 2GT9A 4I4WA 4G8GE 1OAKH 3BHBA 1MCOH 5BRZE 4NQCB 2AJUH 3S5LG 1NBVH 1G7LA 3DURA 5EUKA 4XVTL 1T0MB 3C09B 2EDXA 4L3EE 2L0DA 3P30H 1Q9OA 2R4RH 2HYMA 4XC1L 4U6VH 5IMLB 1JV5B 5DJ8A 3MBXH 5EFIB 3G6JE 5I2IB 5CJQH 4EI5D 5IR1A 1FNAA 3K80A 5CJXA 5GRYA 1S7TA 1WLHA 5KVMC 1CE6A 5IBUG 1FYTB 2FD6L 4GUPB 3PUCA 1EH9A 5TQ2L 3ARDA 2CDFB 5C0BA 4CVXB 4GG8A 1QRKA 3F58L 2A74B 4X9GA 5DUML 2R1WA 3OXRA 3QQ3A 1UZ6E 1F6AB 2M26A 4APQB 1H8NA 3KDMA 3C5SA 2H1PH 4O2EB 4XCCH 5SWZB 3O2VH 3DO7B 2X4OB 4LCWE 3BDYH 4JM2B 1AH1A 3VI4F 2DDQL 1ZHKB 4X6CF 5DA4A 3RL2B 1LP9E 1TVBA 2UY6A 3U2SA 5FK9A 3RGVB 3R06A 1JPSH 4JGJA 3FCTB 5B3JE 1JYWA 4IIQA 4JFED 2RJMA 3MACH 4J4PC 4ZTOL 4HJ0D 4HIIA 2VLJE 4LIQE 3RL1B 3UPRB 4WW2C 5I1LA 4OZGA 1TTGA 1NBQA 2VERN 4LPCA 1HSBB 5DO2C 3SGJC 2E7MA 1A1NB 1A7PL 2YK1L 5L6YH 2R15A 5FA3B 1XR8B 1XAUA 2D0HA 4JQVC 4XPTL 3MRCA 1E27B 2XFXB 1OTUC 1NBYB 2XNAA 4PJIE 1DBJL 4PP1C 2JJSA 3BQUC 4PJHF 1TXKA 4LBEB 2PYEB 4Y4KB 4QRUA 1CFTB 1SJVA 2IJ0C 4R7NB 3H3PH 5JDJA 3BISA 3S3PA 3GRWH 3INUH 1LK2B 2IGFL 2AQ2A 2SEBA 3AREC 5KSVB 4IRSB 4HS8H 4RGND 1A7PH 4L8BB 1MLBA 5CGMA 1HIML 1CXFA 3PNWB 4XPTH 1EV2E 1FVCB 4X7SL 5EOQL 3LKQB 3RDTB 4BKLB 4R6UA 3KPRE 5EUOA 1J05B 4Y5VC 3WIFA 1QR1A 3ROLB 1DBMH 1K8IA 4MJIE 4YBLC 2X4RA 4W6YB 1J0HA 1J1XH 1EEYA 4PJXA 2BSTB 3V4VL 4D94A 3V5DB 3EYFA 3QEGL 5JUEH 3AGVA 5HI4D 3MPCA 2ESVB 3SO5A 3QI9B 3T2NL 1FG2B 5CP3H 2O5XL 4KHXH 4Q9RH 2Z31A 1RIHH 1HIMH 4K23L 2WLZA 1BIIB 3ZKXB 3VXRE 1BLNB 1QBLH 4H26B 2H32B 3WS3B 3DTXA 3QDJE 3MNWA 1JHKH 4Z7OF 1T03H 5EZJB 1CD9B 1S7RB 2A1WL 1HYSD 4KMTH 5GRXG 1UG9A 5FCSH 4YHLL 3G9VA 4NN6B 3M1BA 3RIFF 1U3HC 3JV5A 4F3FA 1NC2D 2ITDA 5EOCJ 4LVNB 2CR6A 5HYSG 2EDBA 1R3LA 4IDLA 4JRXB 4JDTL 1M7DA 3OAYK 5D1ZB 5DJXB 3RY5A 3C2AL 1ONQB 5FUCE 4LLYA 2JKXA 4MD5B 4Z8FH 5IV2A 2EKSA 1XFPA 5DRXB 1P4IH 3FHAA 3RJQB 1BVLB 3KWWB 4JDVA 2ZCHL 4PRPA 4QRRA 2P4AB 3BKJH 2VXQL 2A1WH 4GKSB 4NQDB 1R5WA 4XI5C 4GXVL 3IFNL 3CU1A 1MCBA 5E8OB 2F19L 5FUOL 3MUGA 4DTGH 1A7OH 3WIHA 5ISZD 1IM9A 2NY5C 5I30H 2P5WB 2QHRH 2DM4A 1I8IA 2FHFA 4OCWL 4XAWL 1P9MC 1T21B 1F4AA 1YDPB 3ELAT 5IB2B 5D2LA 3WUZA 4ENEC 4MDJB 5HGAA 5JW4M 1FAIL 3HE7D 1MCFA 4JR9L 5I1AB 2EH7H 3FQWA 1T6WA 4RBPH 5D7JC 4R4NC 4ONOA 4C4KT 1J8KA 3SKJL 3LQZA 3LIZH 4Y4HA 5DJAA 3MXWL 5CINH 4AK1A 1NJ9B 3BJ91 3KPOA 5E2TL 2ILLA 1AR1D 5F97E 2K7QA 5DMIL 3G5VA 1N5AA 1T04A 4J1UA 3NFNA 4X6CA 5JQ6L 4LGSB 3O0RL 3VXNB 5ERWB 4XXDA 2CLZA 4JFOA 3T1FB 2CIKA 1WWBX 4RQQB 1FH5L 3B3IA 4XBEL 1OP5K 2VUYA 5JLZB 5T5NG 4HCRL 4M1CC 4LSQL 3HG1E 3HC3L 2JK5B 1CK0L 2FX9L 3L3HB 5EO1B 4ODTL 1OGAE 3REWA 3SHSA 2ED8A 2JLLA 2FJHB 3DGGB 4X6FA 4UAOB 5ICXA 3OR6B 3JV0A 1YEIH 3LHPH 4X4YA 3P0YL 1OL0A 3FT3B 4FFVC 4KHTH 2DJSA 4LSUL 3VI3F 4N8VG 1MFCH 3TA3A 3B8SA 1CGWA 5HHVH 3HI5H 1FCGA 3QSKB 4X4XB 5ADPH 4PJHA 4HH9A 1P1ZB 4KKLD 2WSKA 4IIQC 1A9EA 3MXVL 1DFBL 1TCRB 3O6LL 1KB5B 1T20B 4YXLL 5DGRA 3RUGE 1D6EB 1XIWA 3E8UL 4U1HA 1U6AL 3V6ZB 4U7MA 4GRMA 2V2TA 1C16A 1YNKH 2D0FA 3VD5A 3NCMA 5HYJD 3G6DL 1YEDA 3WE6A 1AJ7L 1K6QL 1NAKH 1EJOH 1DSFH 5DZNA 5CJ8A 4DAGL 4GW5A 4LEOB 4U1NB 1RIVH 4ZFOB 2FEDD 3L3GA 3O6MH 4N0UA 5AYUH 2I9LB 4AENB 1HKFA 4OGYL 3T0EE 5GHWH 4UQ3A 2XZCL 5F96L 3DECA 4HBQA 1ZE3C 4JZNA 4K71C 4FA8A 4W6WB 3MLVH 4GMTL 5CJ5A 5C08D 4K8RC 3PHSA 2BVPB 3HS0A 5IK3A 4Z7WF 2RHEA 3GK8L 4ZQKB 1HHHA 1IAKA 4YHKH 1I1CA 3MV7D 3N85L 4AIZB 3CU7A 3IDGB 3QXTA 5EOCL 4ZXBA 3ULVH 5GS1A 5C07E 3T8XA 4CJ0A 1UJ3C 5HHNB 3LZFH 4R4BA 4J3SA 1DQQA 1UWGL 3HNVH 1EJ6A 1L6XA 4JGUA 3BUYA 3NAAH 5IVXE 1ZLUH 2O5ZH 4F7CA 5DK2B 1S9KC 4GMTH 4XNZC 1ADQA 1WJ3A 2BXYA 4JM4L 4Y1AB 4A6YA 1U8JB 3QHFL 4P5TA 1PD6A 2HLFD 3GK8H 2NW3B 3QH3B 2AGJL 2A83B 4WHTA 4XCNA 1A6AB 2X4QA 4MA7L 1SEBA 1M7IA 1JNLL 4F8TA 2LFGA 5DQJB 1QLEL 3N1GC 1WQVT 3ARZA 1T0PB 1PZ5B 1UWGH 4K94C 5AUMB 1S7QA 3KPQB 3H9SB 2E6QA 4YHPA 3RWEA 3EYOA 3STLB 4C83B 3MV9E 2VL5B 5BO1L 4HIJA 2XZQL 3TNNB 2A0LD 1IGJA 2EDQA 4ODBD 5BS0D 1T2QL 2WNGA 4X7TA 5C6TH 3W9EA 1NCDH 4XMLL 4JLRB 1YEGL 2AGJH 1CLOH 4P5KB 2N7BA 4GFTB 2E7LC 2M8XA 1OT2A 2YA1A 1T5XA 4PBVC 3JZ7A 3OKEA 3VXUA 1HDMA 2EO1A 5J1AB 2X44D 1MHCB 4I2XE 3QWRA 3WXWH 3BRGC 2OTWA 5KVGL 1A6ZA 1OTSD 3OPZL 5GGTA 5BO1H 5HHMB 3K2MC 5FB8B 4QTIL 1NGQL 4N1CA 3SCMB 4NKOA 4DN3L 1AO7B 5DFTA 3FFCA 2GJZB 2XWTB 5JO5B 3B9EA 4RBPK 4Y4FA 5DJDB 5MEPA 4RMVA 4PG2C 4GRWE 5IUSA 3FQRB 2G5BA 2F5BH 2GI7A 5C71A 1IL1B 3O3UN 2X1XR 3L5WB 2VDOL 4R2GC 3CFDB 3O8XC 1P84J 4BUGA 1OCWH 5C0JA 1IGML 4OLUL 4J8RB 4HULB 5IOPB 1QHPA 4CNIB 3IRZA 3QO1A 5GGQH 3GSWB 3T3PE 5IP4A 2BMKB 3CVHB 4NBXB 3OKLA 2PW1B 3PHQA 3RVWC 1G1YA 5IW1B 4P3DA 1IQDA 4DQOH 1EFQA 8FABB 5F89A 5TPWH 4E41A 4UT6H 5FFLA 4QRPE 3CFIC 4HF5H 5IWLA 3MLXL 4S1DD 3GKWH 1HHKA 4E42B 3C5ZB 3RQ3A 1KCUH 1MY5A 4EXPX 4R9HA 4UDUA 1YEHL 4GAGL 1E4XI 1FL5A 4LQFL 2A6JA 3RVXC 1D9KA 4I48B 1A6UL 3TA3C 3UDWA 2GITA 3QIUA 4S0SD 1KG0B 4MNQA 3D87B 4ZPTB 4JFHE 2GCYA 3FRPA 4LSDA 1XZ0B 3OR7B 1B0GB 5D6CB 3E2HC 1QFUL 1MFAL 2VB5A 3RZCD 4OLXH 1S7XA 4NGHH 5L88L 1S7VB 2ED7A 4RWYH 2ORBH 2BNUB 2X1QA 3DMMD 3FO0L 2XWJA 1IC5H 2B5IC 3DROB 1T6VN 4ELMB 4ZUTA 4OF6A 3F8UB 4Z7WA 1J0JA 1A9BB 5FV1L 1FGNH 2J8UF 3MNVB 4CN4A 4FMKA 5ESAB 1KLGB 5D1XA 3FN9A 4JFZL 4G9FA 2AP2A 1HWHB 1ZK9A 2R69L 1QBMH 3QDMA 4KJWC 3TIEA 1I8MA 4MCZB 3OX8A 2Z4QA 4DZ8B 2G2RA 4E5XB 1MRCH 4GG6E 1G6RH 4F7MA 2W60A 4HUMB 2A6DA 4IRJC 1IAMA 4P46A 2DM2A 3CX5J 2YD9A 5IEHB 5F7EL 1RQ5A 2PW2A 4PJGF 3FMGL 1VGEH 4XAKD 4FQQB 5F44A 1N7ML 2WW8A 1FNEB 4WU7B 4XPFL 2OK0H 4CGTA 1L4IA 4FABL 2ZCLL 5L9DH 1CBVH 3BYYA 1IM3A 1XMWA 3J8F7 4GKOA 1P7QD 4WTXA 2J4WL 1MH5B 1XCTA 3PWNB 1EGJA 1CT8A 4MJ5A 3Q3GB 1F45A 5DLMH 1S5HB 5MEND 2BK8A 1N4XH 4P23A 2V5YA 4TTDC 4P5TC 2P24A 4WEBH 1BGXH 1ACZA 2DMKA 1GAFL 1EUUA 3KPMB 5FKPB 1UA6L 1SY6A 3KYMA 15C8L 1BFVH 2IEPA 1F42A 4J4PD 1WEJL 1XGTB 5HGHA 2Z0BA 1DCLA 1MVUB 5DGQA 1KPRA 2YD4A 3Q5TA 3ALWA 4RIRB 3QUKA 4RFNC 4YHZH 5DO2D 1NCAH 2GY7B 4GLRI 2BNRB 2DMCA 1I3UA 2VZSA 3EO9L 1C8PA 1JPGA 3DVIA 1AIFB 4LP4A 4O2CA 4X6DB 1OTUD 3HR6A 4PP1D 1KCLA 3BQUD 1ZHNB 4NRZB 5L8KB 5IHZB 4LLMA 4LARL 1JTOA 4PJFF 2ZUYA 1L0XA 1P4BH 2IH3B 4OGXL 4NKMB 3HAEH 3ARED 4JZJC 4TUJA 5SWSA 3ZE2E 4U6XA 4ZAKA 4F37K 1GJIA 1Q8MA 2QQNL 5DJCB 4UTBL 4YFLF 3QUML 2DBLL 4OIIL 3IXTB 4G6KH 3ECBB 3R4DA 2VZ1A 4HUWA 1I8LC 3TBWA 1UB6B 4RX4A 4D3CL 7FABL 2VDNH 3GSOA 5SX5H 3KLHD 1BP3B 5DD1L 4HZLB 3QDGE 1AP2A 3FRUA 2YPLA 3OKKB 4NQSA 1I1AB 4OBRA 2GEEA 4FOMA 5EO9B 1LO4L 4PGBA 4P2RB 1OSZA 1D5XB 5KS9E 3L5XH 4BSVA 4GAFB 4HQQL 2VH5L 3MLZL 4UTBH 4LMQE 3QQ9C 1NGYA 4NUJB 5D7IA 1EO8L 2H41A 7FABH 1B90A 3IGAB 3IJYA 4XPHL 4PJAE 2ERJB 5INDA 1SHMA 4WHDA 3NBNA 5IWLC 1U3HD 3V6OE 4JANB 2ADIA 3MJ9A 4YGVB 5E1AB 2YD6A 4X4MA 1B6DA 3ZL4H 4EZMA 1LO4H 2EDDA 1I7TB 2FB4H 4Y19E 1R3HA 5F1IA 3UEZA 1D9KC 2Q3AA 1H15A 2WLYA 4I0PA 3BE1L 3I6KB 1NFIA 3UDWC 1X6LA 3QIUC 4JDZB 2YBRB 1CICD 3F6IA 2CH8A 3ZE0E 2ZUWA 4Q9BA 2LU7A 4NPYB 2GYSA 2IBBA 4ZNEA 1NAMA 4YK4C 3HC4L 4HUXA 4HWBL 4UB0H 1FZMA 1QSFB 3VGHA 4XI5D 5JOFB 5JPMB 1WF5A 1F2QA 1Y0LA 1JUFA 2Q6WA 4HXBH 1CR9H 5BV7H 3QXAA 4RISL 3C08L 5EH1A 4ENED 1BD2E 2NY5L 4F7EA 4AEIL 4PJGA 2Z8RA 1D5IL 2VLME 5CIPA 4XNXL 1IZKA 4R4ND 4C4KO 5LGJA 1FLRH 1HOCB 1JNJA 3BT2H 4KK9D 2VC2L 4V2BA 2CGRL 3H8NA 4U6YB 4WV1A 1JN6B 1BBDH 3SGKA 4DUVA 2N4IA 2FJFB 2VIRA 4TRPL 5FYKU 2HH0L 3NCJL 3TBSB 1A4JB 4WFGE 4ZUVA 5A2IH 2FHCA 1KGCD 1H3XA 1MAJA 2UZIH 3IDIB 1N3NB 5ENWB 2I07B 5CD3A 2VAJA 4CDGC 1FDLH 4A2MA 4XNXH 4KKAC 4P5MA 3MGTA 1BBJB 4WFED 5GRJH 1E4WH 5ICZB 4G6JH 4M1CD 1AQDA 1CXLA 4P57A 2FLBT 4ZFGH 3MRJA 3QEQA 3CFBA 4U4BA 1GRWA 1G7PA 3PIQB 3FTGB 4JO3L 1RUQL 4LRNH 1FFOA 5E56A 3U7YL 1UM6H 1AGBB 3PJSB 5EIVA 4CVZA 1MRDH 1CD0A 4X99B 4CU6A 1IE5A 1R5VB 1ZVSA 5B39G 3O9WC 1T7WA 1IGTB 2DQFB 3HC0A 1YUHA 3ZHDA 1IGFH 5GGVL 5CBEB 2VTFA 2MQCA 4XPAL 4MAYA 1P4LB 4HJJL 1CFVH 1U91A 2BOCB 5MEQB 3CDFA 4QNPF 2AV1B 3C5JA 3QUZB 1EIBA 1BJ8A 3IDNB 2EC9U 5KJRH 3RIAF 5CZVL 5IEKB 4OFVA 3D85B 3MUHL 3BGMB 5IB1A 3TJEH 2AXGA 5EU6A 1D5MB 5AZEL 1RZGA 3C8KA 3DIFA 4XXCC 1CZ8H 1KTKE 3B2VH 2O26U 4M61B 4TULH 2L4OA 1O7SA 4HDIB 4Q7DA 2WV3A 4XNMB 3SDAA 1X5LA 3NIFF 3S36X 3ARBA 4EEEA 1INDL 3S36H 4UOW1 1QFWH 1KCRH 5TE4L 1UWEL 2IPTL 4K7FA 2EYRB 4JZOA 4K8RD 2CXKA 3NFPB 3D3VD 3BPNC 4LSSL 1QRNE 4TSCL 1Q9WB 1CGUA 5SX5K 2NY6C 1JFQH 3UAJC 5ID1B 4LMQI 5KAQF 5T3XD 1P84K 3S6CA 3EFFB 4PLNC 3SDDA 2QKIA 1FJ1A 4EQ2A 3QHZH 1QSZA 1Z3GH 3NZ8A 3QIBB 3FJTA 3JWDL 5DHVH 5DRNB 2MKLC 2BX5A 2AAVA 4M6ML 5T3XL 2C3HA 3HMWH 5EORL 4WDIA 2Q8AL 4YIQA 4JVPA 2IALB 4FFWC 1BZ9A 2H8PA 1UACL 1KC5H 5I8EB 1AHWA 1W0WB 4JY6B 4DUXA 3QCUH 4NQED 3QZWB 3U0TA 1SQ2N 4ODHL 5DQDL 3OB8A 1T1WA 3L7FB 5IVOA 1KEML 1J12A 4JFDB 5E00A 2PYFB 1PW3A 4WUUA 1RZJH 3DUUB 4OZIF 5KG9A 1EAPB 3C60A 3D2UD 3L3DB 4X5XA 3HMXA 1L9MA 3SOBH 5F1NA 3VRJA 5DR5H 4G8GD 1IT9L 2CK0L 4XNQB 3TVMB 3BW9A 1B0RB 3ZE1E 1JYNA 4EIGB 3IDUA 5E95B 1T1XA 3BH9A 4IMLA 3T2QA 3SPVA 4K94L 1GL4B 3IETB 1UACH 3MREA 2EEAA 2WM0A 5JXAH 1U8MA 4L3ED 2R0WH 2CUIA 1OAZH 4FQXA 3WO4C 3FB8B 3HI6L 5ID0B 1NANH 4JPIA 4Q6IB 1FQ9C 4PJCA 4RMUA 3MRFA 2R0ZL 4FFYH 2OR9L 1EHAA 6FABL 5K9JL 2QQQA 3DSFH 5MERA 1PY9A 1F4XH 1U8OA 1HHGA 1FNHA 1Z9LA 2QV2A 2Z8VC 1ZT1B 2V17H 3WXVL 3WIHL 2XY2A 1DN0B 2XQBH 4ZO8A 4PGJA 1FNGA 3KYNA 1G6RB 3STZA 4LCWD 1E28A 4U2YA 3LSOB 2PTVA 5J6HA 1M1SA 1QYGL 3CX5K 1N6QH 1NBZA 1W8OA 1B4JH 4M03A 4R2GD 3O8XD 1DN2A 3H7LA 1I8KA 4PRAB 2EXYC 3D48R 4HJGA 1MWAA 2VDLL 1J8HE 2HRPH 3BAEL 2VLJD 4JRYA 4R4FH 5KTEH 2F8VA 1ZA6B 3TC9A 2O93L 2NLJB 2ICES 4Y5XB 4OUUB 4P3WA 4P2OA 1S5IH 1Z5LA 2ZP0T 3QIWA 1NGPH 1F4HA 4TSBL 3O4OB 5I1KL 5F8RC 1S9VA 3JVGA 1WFNA 4YZFE 3RVWD 3PQYE 4U0QB 4JFPB 3MA7B 4QY8A 3ZDYF 2E9IA 2IPKB 5DJZA 1KCVH 3RPIA 1T4KA 1QZ1A 5I15L 4KPHH 4JO4H 3TH2T 4KUCF 3ALXA 5CWSA 1TNMA 4CVWA 3RVXD 2AJZB 3BMWA 2WK2A 3SDCA 1CU4H 3Q1SH 3RNKA 4TSBH 1JNHA 1PX3A 1P7HL 3FQTA 2W1NA 1DQJB 2NY1C 1MRFL 4K9EH 5F88A 1YECH 1AKJA 3BO8B 3HUJE 4KGLA 3KPRD 2DD8L 4L5FL 2XICA 3HNSH 4MXWH 1XF2B 1TZIB 1IVLA 3SKOB 1QKZH 5JPNB 2R0KL 4OV5A 4YUEL 3DV6A 3BZ4B 1I4FA 4HXAH 4CVUA 5IKCB 2DTML 2Y07L 1YY8B 3OF6D 4DCQA 2X4PB 3HAEB 4NCDA 4PJ7B 4DEPB 4R0LA 5C0AA 2O5YH 1SJEA 4OB5L 1M71B 5DVMA 3SDAC 1T0NB 5BOPA 1P6AB 1JZ8A 3G6JF 4HPYH 5H37G 3O4LA 3ARBC 4KJWD 5D5MF 1R3IL 3QDJD 4IDJL 4YHMH 1QSEB 4JHWH 2G60L 3LDBB 3P9MA 1RUPL 2BHUA 4NKIL 1FORH 4IRJD 4XMPH 5FYLD 2DTMH 2FJGA 4X8XA 4ZUSA 4L29A 4H88L 3V6OC 1QLFA 3RU8H 3MRKA 1EHNA 1T3FA 1EEZB 2WBKA 4AMKL 1D3CA 3QA3A 1JE6A 4NJ9L 5FYLL 1LD9A 1A7RL 2JIXA 1G0DA 5D7KE 1LP9F 3SDXE 4DKFH 4D0CA 5T5FL 3QWQB 5KSAB 2JF1A 5GRVL 3L9RB 5IM7A 1HWGB 5B3JF 5EBGA 4U7KA 2YHGA 4V1DE 3DX6B 5GIRB 4TTDD 4H88H 5C9JA 4P5TD 4WJ5B 4HEME 5C9KA 3SE3A 3V5KB 1VHPA 3BP6B 3V8CA 4FFZL 1HXMA 4AMKH 1ADQL 3HPLB 1GGCL 3LKSB 4G3YH 1HSAA 4NJ9H 4NNPH 3BVNA 1U0QA 4A6YL 4PJIF 2JB6A 3MRIB 2I5YL 1CWVA 1CGVA 1NMAH 2P5EA 3DXAA 3RAJL 3GSXA 4OT1L 5GXBB 3L6FA 5JHDE 4LU5L 5K9QG 5AAWA 1R3JB 1UKSA 4G80B 4LSVL 1KIRA 4F2MA 4MMZC 4HX1B 1FBIH 3GB7A 1FPTL 2P45B 1LE5A 5TDOA 3FT4B 4S0TD 2AXJA 3BGFC 5CUSL 5HHOE 5EC2A 3VFRB 3MLUL 3P9LA 1K5NB 4NZUL 5F1SA 5C0IB 3HTLX 3V6BR 1EVTC 3TESA 3FO2A 3JXAA 3RAJH 4BM7A 3CVIL 5CEZL 2XA3A 2BNQB 2CKNA 5JDSB 1T83A 2XYCA 4JFFE 1MNUH 3WUWA 4ESKA 4XC3H 2UYLA 3WV0A 2Q86A 5T3ZL 1ZVHA 4LASL 3VWKA 3HG1D 1QR4A 1N2RA 1BOGA 3QXUA 5TDNB 5IQ7L 3D18A 1OGAD 1WC7A 3U0PB 5D7SH 5EZOH 3EZJB 1TQBB 4I77H 5ICYA 1F6LL 4OZ4B 2JTDA 5C1MB 5DQ9A 5JMRA 1RFDH 5I8OH 1LK3L 2LV4A 2JELL 4NRXB 1MJJB 3EJYC 3MRGB 4WI3A 4XBPA 4S2SB 4LHUB 2DYPD 2ZSVB 2QQLL 1QVOB 3W0WE 3UPAA 4YAQB 2W9EH 3ILPA 1KJMA 2B1AH 4DOHE 3QQ9D 1ZSDA 3AS1A 5IQ7H 3OKOA 4XCEA 1UJTA 3QIWC 4NZRL 3MOBL 1ULVA 5DURB 2VLLB 3MLWL 1PSKL 3EIFA 1GYAA 2LU3A 2C3VB 1ZA3A 5GGTH 1JZ6A 3K2UH 1E4XL 5IHUL 1N59B 1XF3B 1HKLH 1PEWA 3GNMH 4PGCA 1QBBA 5IBTL 4X7DC 1UB5A 1X5KA 4P2QE 4P49A 1Q9OB 4ERSH 2PKDA 4KKCC 3GMQB 4HFUL 1D9KD 3MRBB 1TITA 2OL3A 2ZKHH 3DHMA 3T0ED 3GBNH 3SDCC 2VZVA 4UIMA 5E9DA 1VSCA 2NYYC 5CMAB 2AK1H 4UT9H 4AL8L 3MLWH 3WL9B 4EOWL 3D39B 12E8H 2D4DA 4O4YL 4NP4L 4PJ8A 2OM5A 2HFFA 4PTUB 1FRGL 1NMCB 4OUOA 4LCIL 3BKCL 2R0LL 5HDQL 4Y89A 5IBTH 4U6HA 1BQSA 1FC2D 4MSWB 5D6DA 4CRPA 5D5MA 1A02N 1KCKA 2B2XH 1Q72H 3MNZB 5CILL 3QFJA 2F53A 2YZ1A 1NH6A 4M4RA 3OZ9L 4GS7C 4RDQG 5INCB 2ZOLA 1L7IL 4JO1H 4OKVB 4R0LC 3KPSA 4HUKB 1XGYL 3V0WL 2NNAB 3H42H 5BVJB 5I1LB 4WGVB 2C3XA 2AXFB 2YEZB 1Y18A 4XZUB 2VDMH 4MA3A 4Z9KB 1WAAA 3G04B 2DQEH 5SX4H 4YHYB 2EEBA 4YDKL 1Z6JT 1WICA 3ZKND 5JNYB 2B4CH 4GMSL 4LCCA 4KAQH 3O3AB 2V5TA 1FVEA 5DHVB 4C56A 4KY1H 5AZ2H 4PJ5E 2A73B 4JY4A 4FQLH 5JHLH 4K3JH 1A6PA 3LS5L 4QO1A 4KKAD 5FO9B 1AQKL 2ZNXA 1ZTXH 2GFBA 2D9QB 4EDXA 4PJDE 1U8HB 4HIXH 3P73B 4NOFA 4EI6B 4ZFFB 2KQMA 5CKAA 1QSVA 5T5NF 3CDGB 4HD9A 4Y2DB 1MIEL 3SGEI 4OM0H 3EYUH 4YDIH 4TOYL 4Z7VA 4FTVB 2RB8A 3RUGF 3AS0A 1MSPA 2BFVL 4PJBE 2C7UA 5JW5A 1H3TA 5C09E 4Z7QE 1NDGB 1W72A 1R24B 3O9WD 4EN3B 4M5YL 4S1QL 5FO7B 2B1HH 4BK5A 2YZ8A 4AEEA 1UCTA 3MR9B 1JWMA 4XVJL 5F9OH 5FOJA 4X0KA 1OSPL 4ZO6A 4XP9L 4WFFE 3OGCA 4WI2A 4OZHE 1QQDB 5F9JA 5DYOB 5ANMB 1SY6L 4MQ7B 3RWGA 1JF6A 1KFAL 1WIPA 3AVEA 4XBGA 4JJ5B 4L8CA 4JHAL 3UTTE 4ZPVB 3ZZ1A 1H3UA 5T33H 1F58L 3MNWB 3NPSC 3D69A 5JR1L 1EGJH 1U3YA 3UZVB 2IAMA 1VACB 1U93B 1Y6MR 3BZDA 1CGXA 4S1QH 4UIKH 3S37H 3S35L 3GHBL 3DI2B 2OTUA 3MA9H 4F3FB 4KQ4H 1YMMB 3PP3H 3VGAB 1HI6A 3VXRA 1IAII 3HNTH 3GMOA 1T83C 4IOFC 4LSPL 2X70B 4L4VA 1UM4L 3CAFA 4LKCA 1HEZA 3UTZB 2ARJQ 5ALBL 3ZLQC 2AVGA 4U1KA 1WVZA 4QRPD 3SDYL 1ZGLA 1F97A 3GSNL 4PJ9B 2CIIA 2H26A 4MA1C 3SE4A 1FZKA 2YPVH 3BSZL 1T1ZB 1HN1A 5IVXF 1EFXA 2NY6D 4OLVH 3UAJD 2IANB 1L6ZA 2PTUA 3HZKB 2PO6A 1X4XA 4Y0GA 2NW2B 4G5ZL 3I6GA 3O6FA 3V6FA 2ICEA 3VA6A 2EH8H 3TPUB 5JW3L 3UX9B 1BX2A 3T4AA 2YPLD 3W81A 2PF6A 4AT6A 2DQHH 2XTJB 1HINL 1IAOA 3ETBF 1MREL 4JFHD 2E8ZA 1S9XB 4LSPH 2AEQL 5AD0A 3OQ3B 1KT2A 3HR5A 2V7NA 5F3BA 5KBNC 5GPRA 4FFWD 1OAQH 4HT1L 5DT1H 5DJ2B 1ZWIB 1AXTL 5HI3C 5TE6L 4QOKE 1D5ZB 2ICCA 3TO4C 4KZDL 2DLHA 4NT6B 5GS3A 1NDMA 4C57C 3VXMB 1OPGL 4Z7NE 2X6MA 5D1QC 3IB4A 3PF2A 5IB5A 1EHLH 4M4PA 1BEYH 4WWKC 2WUCH 3QUXB 2MWCA 3T77A 2AEQH 3LMJL 1YEEH 1IC4L 1K2DB 2QQKL 1LDPH 3UBXA 5HGDA 1QO3B 1KCSL 2C9AA 3NFNB 4ORZC 4U1MA 4IMKA 3VFPA 5L2KB 2W92A 5J7CC 2HN7B 4M7JH 1ZGLP 5BW7C 2R2EA 1A1OB 3TBYB 1H0DA 3UPCA 5JW4R 2E8YA 1GGBL 2IG2L 1OPGH 4KK8C 3ARFB 3EO0A 3WKMH 1OAXH 3TNMA 4RCAA 4HK0A 5F72S 3WLBB 5D6DC 5I17B 5C0CE 1MHPH 4GRWF 1NAML 3LMJH 3DX9A 1CF8H 2EDLA 3VJ6B 4EIZC 4Z76B 4ONGL 2X4UA 3MJ9H 4NQCA 3G6AB 1B88A 3AAZB 2BDNH 1T0MA 2OXGA 5FAAA 1I7UB 5JOEA 5TF1H 2YA2A 1FSKB 1N0XH 2YD3A 2YR3A 1JV5A 5E99H 3VXQB 5IMLA 3ULUF 5EFIA 4D0BB 32C2B 2BJML 5I2IA 1MUJA 1V05A 5KVEH 1FYTA 1BZ7B 5TGBB 3WN5B 2EXYD 2CDFA 3PP4L 4KXZI 3U9PL 4CVXA 3W2DH 4LCCC 5I1DB 2A74A 4HLZH 2WBJB 4AQ1B 4F57L 1KEGH 4HZAA 2GSIB 1BQLH 3W39B 3DYMA 4AJ0A 43C9B 4M48H 4APQA 3IDXH 4O2EA 5SWZA 4K3GA 3DO7A 1MY7A 2X4OA 5DVNA 4JM2A 1QHOA 2R39A 1ZHKA 3BP5B 5H94B 1GOHA 3DSNA 3RL2A 3NPZB 1VENA 3AFLA 5D71L 4YJZL 3RGVA 2F8XC 3L1OH 3FCTA 4UMGA 4XPBH 2NR6C 4FN0A 4KJPC 3BPOC 1HHHB 4LFHG 3RL1A 1G9MC 3UPRA 4F57H 3DHJA 4M7LH 1AGDB 1FZOB 1JYXA 3NCEB 2NY1D 1W8NA 3V2AR 1HSBA 1A1NA 5HGBB 1QEWB 3LEYH 4L9LC 5FA3A 4R4BB 1U95B 1XR8A 5D4QA 4MB5A 1C5BH 3QCTH 1KJ3H 3MRDB 1BREA 1JRHH 3MUY1 1E27A 2XFXA 2HLAB 4PRHE 1NBYA 2EIBA 3D25B 4LBEA 4YHOL 2I60L 2PYEA 1WZ1L 5C07A 4Y4KA 2VQ1B 1RZ8A 1SYVB 2ZOKB 1CFTA 2BVYA 4R7NA 1L7TL 3X3GH 1P53A 4CW1B 1LK2A 3U7AA 4GG6F 5KSVA 4IRSA 4LCUB 4JFEB 2GK2A 2KBGA 4L8BA 5J9PB 4L4TE 1L9NA 3PP3K 3TWCL 3SGDI 3PNWA 1T5WB 3UZEA 1FVCA 2BZDA 3LKQA 3RDTA 4BKLA 1J05A 3ROLA 3PDGA 2EICA 3FQXB 4KDWA 2I60H 4HAFA 1WZ1H 5IF0B 5B21A 2BSTA 3SE4C 2GTZB 3V5DA 1YYML 2PXYB 3BKYH 3N1PC 4XTRC 3QB7C 3MV8D 1KELL 4I3RH 4Y19D 4M6OL 1JHTB 2ESVA 3OKEB 4QTHB 3QI9A 5L0QC 3FO1B 1FG2A 5E6ID 3UJJL 5IFJB 3MV9A 1E0OB 3O6FC 1LHZA 5J0BA 3MC0A 4PBWD 1RK0A 4QHUB 3WLWC 1IKNC 2Z8WC 2OTWB 1BLNA 3MRRB 1K8DB 3ET9F 2H32A 3WS3A 5HVFB 3RBGA 5I1GL 3QG6B 5EZJA 5MI0B 2FBJH 1S7RA 1EVUA 1D6VL 5L7XH 2UY7A 3LPWA 3WO3B 1MCRA 2GJ6B 3MUZ1 4PRIB 1KULA 1SBSH 4POZC 1ZT7B 1T89A 1VDGA 3QO0B 4JRXA 2FO1A 1D5BB 1J7VR 1A22B 3U0WH 2EIEA 5D1ZA 3VFWB 4ZUWB 2VJXA 5DJXA 5JORB 1ONQA 2HWZH 2D7PA 2BRRH 4L8SB 4MD5A 1GC1H 3CC5B 5DRXA 1X5ZA 2QR0B 2VLMD 4S1RH 1BVLA 3ABZA 3KWWA 2P48B 3U36B 2WMPA 1ZEAH 3DARA 4Y7MA 1BM3H 4GKSA 4NQDA 5LGHL 5A43C 2FGZA 3MFFB 5E8OA 4IS6B 1LNUB 3T0BA 5BVPL 2P5WA 4WFGD 2F54E 1DVFC 4JO2L 1JZ7A 4XNUL 1RURH 3DUSB 3IJSB 1DL7L 1NC2B 1VADB 1T21A 1YDPA 5IB2A 2ATPB 4PJEE 5F7UA 4MDJA 2R56H 1DQLL 2MOVA 2C1PB 1S9YB 1CLZL 5KW9L 4ACPA 4PP2B 2NXZC 4C58B 5I1AA 5DEZA 4P9MH 3L5HA 4I3SH 5HGGS 4YFDB 3GMMA 3HE6C 4NM8H 1WFTA 4OFYD 5KS9F 1MI5E 5C0RH 1NJ9A 1S8DB 4HKZB 1F3DJ 1RUKH 3C09C 3HMXH 2VXUL 3EGSB 4B5EA 4Q9QL 1PKQE 1TJGL 4H20H 3FZUC 3VGFA 3O81A 5IESL 5HVHB 4OF7A 5ISZB 1H3GA 3EJYD 4QXGL 3VXNA 4RWHA 5ERWA 3CPLB 2XWJB 1F4WH 1OB1B 2V5RA 4PJAF 5EOTB 3T1FA 1MCQA 2QSCL 3O3BB 4RQQA 1JK8B 3A6BL 3A67H 5JLZA 5FV2A 5DS8B 1CXKA 4Z7WB 3MRLB 3CIQA 2JK5A 4NO3B 3L3HA 5EO1A 3HE7B 2UWEE 25C8H 2FJHA 4WFHD 5D1XB 3DGGA 5GZNC 1OD7A 1E4KA 3OR6A 4JM2C 1A0QL 3FT3A 4OD2B 3U4BH 5ECJE 4DGYL 1ODAA 4MXQC 2OXHA 2X89A 3ZE0F 4LPYA 3WNKA 2W07A 4ONHB 1A6TB 3QCVL 4X4XA 5IB4B 1P1ZA 4KKCD 5CJOL 1TCRA 2F58H 4PS4H 1KB5A 2AS5M 3SDCD 4EUPH 1T20A 4N8PA 2PW2B 3I2CH 4OFKA 3NABL 2NYYD 1D6EA 4J3XA 2AK4E 3EHBC 4U3XA 3IFLL 3FOLB 5D7LE 3NCCB 1MWAH 3V6ZA 4BUHA 1AKJD 4OZFH 4NHCH 4OCSL 1QRND 1OP3K 3ISWA 3VFNB 4NN7B 2I27N 3CGTA 4U1GB 1CVRA 3FB5B 2X1OA 3U48A 4LEOA 2CO7B 5JA8B 4U1NA 4ZFOA 5D96C 2FZ3B 5E4EB 5D2NB 5F8QC 4AENA 3RVUC 2I9LA 3VCLA 1T7ZA 4RGOH 2EE9A 3GBMH 4HW6A 1MCWM 4BYHA 4HS3B 1JGVL 2WWKT 3U83A 3WJJA 4M6NH 5HI5C 2VR5A 2C1OB 3EYVB 4ELMF 2HKHL 3CK0H 4WTZG 3ARSA 2BVPA 2XKSA 3Q5YA 5IIEB 4ZQKA 1VEMA 4Q2ZB 3BXNB 4AIZA 4PGEB 3IDGA 1WBYB 5GS2D 4MXVE 1HILB 4MYWB 4NNXB 4B7IA 5K59E 5HYJB 5HHNA 3RKDC 4AG4L 2IMMA 2VYRE 3UO1H 1ORSB 4YBQD 4LLMB 3RGHA 4Z0BH 1NUNB 2FX7L 3PXHA 4NDMB 1RULH 5L8LB 5DK2A 4O02L 1OAUH 4OCXL 2XPGB 4KDTC 4Y1AA 2AJ3B 4HKJB 1U8JA 3ZKXC 2NW3A 1ND0B 3QH3A 5ITBL 1DBAL 1WCQA 2A83A 4X9HA 1DDHB 1A6AA 1RJLB 1A1MB 2MJWA 3EYQC 1G1CA 5C08B 5DQJA 4ZNCD 4KROC 3KVQA 4UINL 2QLVB 1PZ5A 2X4NA 3VXSE 3F7YB 5AUMA 1XGRB 3MV7B 1T89C 3ARGB 1OTTC 4OGAC 3BP7B 1YJDC 3KPQA 3H9SA 2EEDA 5EZIH 2JCCE 1BIHA 1V8HA 4MNHB 3STLA 4C83A 4JB9L 2VL5A 3TNNA 4M9OA 2P5ED 5C0GB 1J87A 4LVOB 4KRNA 5CHNB 2IPUK 4JLRA 3C9NB 5FYJD 5ITBH 1BQHB 2DQUH 3CMGA 4RGNE 4P5KA 3F6LA 2OZ4H 3NGBC 4ZD3L 4DGIH 3X13B 3A0OA 2XZAL 5J1AA 2A77H 4FZEL 1MHCA 3Q6GH 5DI8B 4TUOB 5FYJL 4CMHC 4RGMB 1ACYH 1WTGT 2FX8L 4GRLC 5KS9A 4XCFL 1J8HD 1JL8A 3CXHJ 1CIDA 5E8EB 5IG7B 3OAUH 1A6VH 4LPXA 4X6DF 5FB8A 2NQCA 5KZCD 3CFCL 2B0SL 1KOAA 1AO7A 4IOFD 2GJZA 2XWTA 3PWPE 3FAXA 5JO5A 2HFGL 5DJDA 3S98A 4U1IB 1NFIB 5DHYB 4BK4A 5BS0B 3FQRA 1HNGA 1JWSB 2XZAH 1WZKA 2EO9A 3X3FL 3BH8A 1G7IB 4KJYB 1IL1A 2UVEA 4TVPD 3SE8H 4K2UH 2FH8A 4ODXB 2J8UB 3L5WA 1V3LA 3CFDA 3KR3H 4OBSA 4J8RA 5IOPA 3SJVE 4L9DA 4CNIA 3EYSL 1WZLA 3CFCH 1Z9MA 4FQPA 4TVPL 3VXOB 3GSWA 4ETQB 4PY8I 2BMKA 3CVHA 2V2WB 2R4SL 2Q6WB 2PW1A 4DN4H 2GK0B 4YH6A 4OSUH 1WIUA 4FZ8L 4G42B 4YC2C 5IW1A 4OF8A 8FABA 5KVFL 5HXMA 5IROA 4U49A 5HI3D 4HUVA 4QRSB 4YPJA 3TO4D 4P2CG 4PBXA 4E42A 1NL0H 3C5ZA 2RGSA 3QULB 3PHOB 4UAOC 4EQ3A 1NMBL 3WDHA 3ZE1F 3D9AH 1TZHB 3GMRB 3SKMB 2G5RA 4K8RH 5D1QD 5FYKL 2GJJA 1UT9A 4I48A 5GS0H 4DVRL 1KG0A 4MWFB 4WWKD 3CFEB 5B38B 4ZPTA 1Z9SA 2XWBB 4MGXA 3VGEA 4DKDC 5FHBH 1XZ0A 2VXTH 1B0GA 3OR7A 4F9PA 3ZO0A 5D6CA 5KVFH 5CGYC 2W91A 5E9DD 1PG7W 3O11B 2OS7A 4BH7B 4CAGA 4DGVL 2VDPL 2DQTH 3AS2A 1KXQE 2BNUA 3KYAA 1YNLH 1ZXQA 2OL3L 1AQDB 1F8TH 1JP5A 2H2SD 3BEWB 3IU3B 1PYWB 3DROA 4ELKB 3GRWA 1TQCB 3CXDL 4KGJA 4ELMA 3HI1B 1QFWM 4KZEL 3ZTNL 1A9BA 1MEXL 1KLUB 1EDQA 2W0FB 5ESAA 2VZOA 4R26L 1KLGA 1JGDB 2KPNA 3CFKB 3AS3A 1T7XA 1Q1JL 4MCZA 4DZ8A 3RIAK 4V1DD 1PLGL 3BPCA 4E5XA 2NY0C 1UKTA 2QSQA 3WJJC 4PJFB 4K3EL 4MNGB 5IEHA 4BQ9A 1II4E 2ED9A 1J88A 2FBOJ 3DMMB 1MFBL 4FQQA 5MP6H 1FNEA 2LTQC 4WU7A 3ZHKA 1K9TA 2FIRT 3QWOB 2EZ0C 4XPGL 1CGYA 3ZT5A 1DBKH 2VABB 3LKPB 5D93B 1YZZA 5JOPE 3LQAC 5H35B 2VQUA 5JHDD 1MH5A 3AUVA 2HT2C 3ARYA 5BMFH 4BFBD 3PWNA 2W9LA 5I1IH 1OW0C 5IFHH 1C1EL 2ZZUT 3Q3GA 1LQSR 1GPOL 1S5HA 5FECB 4ETYA 5CCKL 3V8OA 3MJGX 4JGMA 1ZLWK 4UNTA 2JE8A 3HUJF 3KPMA 5FKPA 3EOTH 1DBBH 2NR6D 3I3EA 1YPZB 4HC1L 1XGTA 4UV4L 1MVUA 4YWGL 4JFFD 4LL9A 3DNKA 4RIRA 5I1EL 4DKEH 2QKIB 4GAYB 1JBJA 2BNRA 4LIQH 3RWCB 2Q7NA 3VU2A 1NFDE 1N26A 1G9ML 1P7QB 1AIFA 4X7FC 4X6DA 2VLRD 1QPXA 1VFUA 4KTYA 1G7MB 1ZHNA 4HIHB 4NRZA 1LO2L 2MHAB 5IHZA 4QLRA 5MENB 5E2WH 2EDYA 5E94B 2E7CA 3UXFA 1AHWB 3WNLA 2IH3A 5GJTH 4NKMA 1HQ4B 3PL6B 2WQRA 4B0MM 4PUBH 1V7NL 1YEKL 1IAIL 3RY6A 1LGVA 5DJCA 4WW2B 5GJSL 5FA4A 3SCMC 3IXTA 1VPOL 1DE4B 1W72H 4EKXA 3ECBA 2FECI 4OQTH 4Z7UE 4ZO9A 5ADOH 3D0VB 1UB6A 1HZHH 3C6LD 4TQEH 1P2CB 1MQKL 4WY7H 1S78C 3GJFB 3BH9B 4HZLA 4W4OC 3QUYC 3OKKA 4MZ3A 1X6NA 1I1AA 1I9EA 3I50L 4HBCL 1RZFL 5EO9A 4FQIH 3KJ4C 3QG7H 4P2RA 5T1KD 5LWYL 1D5XA 3KYOB 3KXFE 3MRFB 3H0TA 1H8SA 4YO0B 2IQAB 2CMRL 2OJZH 1QNZH 2JJWA 3WLWD 3ME0A 2B39A 1A14L 4PB9L 4GW4B 1IMHC 5EPMB 4XHJC 1S7UA 4NUJA 5GRZA 1HQRB 4P4KC 1DUYB 1B9ZA 1MJ7H 4L3AA 3IGAA 1OAYL 4WI5A 3BN3B 2MQ3A 1NGXB 4LNVA 4Y5VB 5CBAB 2HMIC 3HZVB 4JANA 4YGVA 4JY5L 5DD5L 4YBLB 1NFKA 4GXUN 5E1AA 3OKMB 4POZD 5A2KH 2BOBB 4M1DL 3ZYIA 1I7TA 4CDHA 1JWUB 2VLKE 5AG9A 3TPKA 4EUPB 2X10A 1NBZB 2CMRH 3I84A 4JKPL 3WFEL 3I6KA 4JDZA 5E03A 2VDKL 4WI7A 2DMBA 1A14H 3FB6B 5CZKA 5LQBL 3QNZB 2ZJSH 5J11B 3K8KA 4JRYB 4OZFB 4NPYA 2MPAH 1MAMH 2YD1A 5F7LB 1O7VA 4OD1L 4F9PC 2Q8BL 3TYGH 3K74B 3WFHB 1QSFA 1VFBB 4MHHG 5JOFA 1S9VB 3X12B 5JPMA 4BQCA 4JY5H 4LVHB 4X80L 1QFHA 4P9HH 2AEPH 1AE6L 1I1YB 4U1SB 3V95A 1IC7L 4KK5C 1FZJB 3WSQH 1DVFD 3RPIB 3Q5OA 4QHKJ 1U3HB 2QTEA 2PNDA 2HJLB 3HKFA 1OQXA 4BZ2H 4D9QE 3FB7B 5DD0H 3EFDH 3PQYA 2NXZD 4OLYH 1WT5C 1HOCA 2YMXH 2OMBA 1MPAL 1CFQB 1CICB 3HE6D 4U6YA 5GGUB 1JN6A 1ZLSH 1ERNA 3MRQB 2VSCA 2DWDB 3AXLB 4G7YH 2FJFA 3WD5L 3U79A 5KOVC 3WNOA 3TBSA 1A4JA 5C7XH 4MMXC 3FZUD 3WHXB 5C09D 2DQIH 3IDIA 5F70A 1N3NA 5ENWA 2I07A 2HTLC 3MO1B 2CK2A 5ALCL 1BBJA 4PREA 4M3JA 5ICZA 1JZ4A 3GFUA 2ZG1A 5ESVB 3PDDA 1A4KB 2J88L 1FNSL 3PGFL 1TZGH 1H5BC 5DD3L 5GZND 3PIQA 3L95B 4GQ9H 3FTGA 5EBMB 4BZ1L 2AJVL 1OWRM 2EECA 3IDJB 4JM2D 2Y23A 4ZG1A 4MXQD 5IW3A 1AGBA 4KDVA 3PJSA 2XA8L 3TN0C 1FGVL 4KKBD 4X99A 3RVTC 1R5VA 1CDJA 1E6OL 4EVNB 5I1JL 1X5HA 1UVQB 2DQFA 1IGTA 4YX2L 5KSBE 3D0LB 3I9GH 1P4LA 2BOCA 5MEQA 4Z95H 1KUMA 3I6LE 2WP3O 1U36A 5DRWB 5FDYA 2J88H 3V4UH 2AV1A 4RMQA 1K4CB 3QUZA 4HFWB 5D70L 3LOWA 3IDNA 3VW3L 2DKMA 3QDAA 4B53A 5IEKA 1GHFL 4KMLB 2QADC 3D85A 1U3JA 3BGMA 4OLWL 5IGXH 4G9DB 1D5MA 1EX0A 4MQTB 4OZIB 4NSKB 1JPTL 2HJFB 4M61A 4UV7H 4HDIA 3BZEB 4XNMA 3RVUD 2ATKB 4MQXC 1YPZE 2VDQL 4ZS7H 2PN5A 4G7VL 3JWNC 5F1KC 4PB0H 5I19L 1SMOA 3LEVH 4RDQF 4PYHA 3HA0A 2WWKO 3V5HB 2GAZB 1T1YB 4JQIH 3RY6C 3P4LA 5HI5D 2D03L 4XWOC 4O5LH 2EYRA 1WUNT 3HFML 3NFPA 5F93C 1Q9WA 4QOKD 2NX5E 2R1XB 2YD7A 4LLQB 1JPTH 1REIA 5ID1A 5C2BL 4OJFH 3EFFA 3BOVA 4TPRL 3DBXB 2VDRL 3RKDD 4ZSOE 5I1CH 5I76B 3QIBA 5IBLC 5CD5C 1I1AC 4WHYH 4N1HB 5DRNA 1EBPA 3LEXB 2YN5A 3GMPA 3PWUB 5E08H 3MRHB 1UH3A 1VERA 5DMYA 1RK1B 1FFQA 4PJBF 5J12C 2IALA 4Z7QF 4M62L 4R3SB 3VG0H 3VWJB 3BDBA 5C0NC 4K71B 5I8EA 1W0WA 3U7WL 4JY6A 4LSTH 1BOYA 5CSBA 2F8OA 1YNTB 3WS6A 3EYQD 3JSSA 2EDEA 3QZWA 5IVNA 3D3VB 4KROD 4PLKD 3L7FA 4JFDA 3VFSB 1AFVH 5C0CD 4WO4C 2PYFA 1OTTD 2K9UA 4OGAD 3DUUA 4FQHB 1DANU 1M7XA 4WCYL 1CQYA 1EAPA 3VFGH 2KDGA 1UJ3B 3L3DA 4PV8B 5I8KH 3R1GL 2RFXB 3U30B 4XNQA 3TVMA 1B0RA 3RI5K 2B20A 2ENSA 3PGDB 3GHEL 3IETA 3B9KC 1YJDL 4XP5L 4XNZB 3FB8A 4J6RH 3N06B 4C55A 5ID0A 3LD8C 4Q6IA 2PR4H 3MJ7B 3K8MA 1MCPL 4MHHI 1TTUA 5CSZB 3FKUS 4GRLD 3FOMB 4NQEB 4WCYH 5ELIA 5C2UB 4C59B 4HPOH 4KUZL 2JJTC 4OQ1A 1XH3B 1I9IH 3CMOH 1ZT1A 5BJTB 5LAXB 1KENH 4K3DH 3MZGB 3D2UB 1P7KB 1G6RA 1INEL 5I75B 4G8GB 1H3PL 5BRZB 2V5SA 4OTXH 4Q97A 1CL7L 3LSOA 4N5UA 3ULUL 4NC1E 3B5HA 1MJUH 2F15A 4L3EB 1AY1H 4P2QA 5DHXB 3MLSL 2DQJH 3LRSB 4GRWH 4PRAA 3P4OB 3G6JB 1J10A 5TDPB 1ZA6A 2NLJA 3O2WL 4Y5XA 4OUUA 1IILE 5T1DH 1UZ8B 3ZMRA 3OV6A 2R29H 3S5LB 4FQCH 5B4MD 3DRQB 3UYPA 4Z7NF 2C4FU 3MBEC 1INEH 4Q0XH 2VKWA 4JFPA 3TIDB 3MA7A 1CL7H 2IPKA 2CR3A 4M7KH 2F5AL 4PRHD 2XN9E 3IS1X 1V7ML 4TSAL 2R2CA