4Z3JA

Crystal structure of the lectin domain of papg from e. coli bi47 in space group p1
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
196
structure length
196
Chain Sequence
AWNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPGIATVTWNQCNGPEFADGSWAYYREYIAWVVFPKKVMTKNGYPLFIEVHNKGSWSEENTGDNDSYFFLKGYKWDQRAFDTANLCQKPGETTRLTEKFDDIIFKVALPADLPLGDYSVTIPYTSGIQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An unexpected way nature improves solvation entropy
rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
molecule keywords PapG, lectin domain
total genus 45
structure length 196
sequence length 196
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1370 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesin receptor binding domain 4z3jA00
1J8RA 4Z3IA 1J8SA 4Z3HA 4Z3GA 4Z3EA 4Z3FA 4Z3JA
chains in the Genus database with same CATH superfamily
3WTWA 2VAAB 2HRLA 1GAFH 3O6KL 1DQMH 4X80L 3MNWA 1B6UA 1AD9A 2HT3D 2CO4A 2X6MA 3PJSB 4EI5C 5AVRB 4WJ5B 2O6EA 4APQB 2ROYA 4W4OA 2A9MH 2YQBA 4OFQA 5C7XL 1ZHNB 1FO0B 4JHBA 2CIIB 3IYLW 3O8XB 4AM0Q 4M4PA 2A6JB 2YRLA 2Z1PA 3QUZD 5DC4B 3WL9B 5CCKL 1KB9K 3MOQA 1MHEA 1X5KA 5C0AA 3DX7B 1CLZL 2ED9A 4P06A 5EOCJ 2ZPKH 3HMXH 5IF0B 4IKJA 1KBVA 2OA9A 4X0KB 1H6FA 5E6IA 3IAQA 1RY7B 1ZV5A 2Q6WA 4NYLA 2AC0A 1CMOA 3VWJC 2EDBA 5CD3A 3MLYH 3TVMC 2Y7SA 3WFCL 1AR1B 1AGBA 4ZW7A 4ODWA 5L2KB 1UKQA 2FWSA 1NUDA 2IANA 5CWSA 2P8LB 2PXYA 5I1LA 1BXUA 2QLYA 1LO3H 2C7UB 5AALA 3PWNB 4QRTB 5DMIL 4DFHA 1XMWA 2L0DA 2X2IA 4B9ZA 4OZHB 3S88H 2CUAA 3NCBB 1AGFB 4JZNB 3BN9D 4KQ4L 4M6ML 3TU6A 4BZ1A 3IVKB 3BYTA 1CT8B 1BIIB 5EU4A 3UPAA 3VFPB 1YC7A 2Z8VC 4HJEA 1IVTA 5F9OL 4HXBH 4DN4H 3WYRA 2VMDA 1Z3RA 1ZSHA 3IDYC 3OLIA 1I3GH 4XXCC 1IBGH 3M8OL 5F71A 3QJRB 3TEZA 1ASQA 3ZKMC 1ZK9A 4LEXL 3OKMB 1E4WH 5FDYA 3ZYOA 1T1ZB 3TT1L 3L4UA 4OCYH 4TVSa 4BSWA 3WS6A 4L8SA 4DZBB 3K74B 3K1DA 4GQQA 4AC2A 2ZYSA 4F2EA 5B22A 5EB9A 2IEPA 2R69A 3N50A 3ZT7A 2WVUA 3IK2A 1AXIB 1XGZA 1MIEH 4KXCA 4N68A 4ODXB 2GYSA 1U3NA 4AH2B 3O6FA 3JWDH 4B97A 4PRBB 1LYQA 4NBZB 2M2DA 5DFVD 3L4ZA 3BZEB 4OUOA 5D70H 3BZ5A 3QNZB 1LNUB 1XXFC 1HEJC 3HRZC 5AAMA 3ZKMD 5DHDA 1PCSA 5D7HA 3IT8D 2N59A 5CJBA 1J5OL 5MENA 4JM4L 2WP3T 1UOKA 1OOAA 1RLBA 3S97C 3WFHB 2VXSL 1SM3H 1IC7H 4Q7DA 2DMGA 1GS8A 1H3TA 1OCRB 3OJDA 1QLRA 4PBXA 4U0RC 4XT1C 5J1TC 4XB7A 5I23A 2P1YA 3STBA 1LE5B 3DV6B 1BVLA 3IU3B 5HDQL 1U8CB 4WHTA 3QEUB 5DJ8A 3ZZ1A 1CK0H 2J25A 4UINL 1NFAA 3GSUB 3IDMA 1KIQB 1SBSH 4YXHL 2XQ0A 1F97A 2DYPB 5AZEH 2CR3A 4WFFE 3U0PA 2GUYA 3QYNA 3SDYL 3GEWB 2G4GA 1XAUA 2NW3A 2IDUA 5B7MA 3KCWA 1FYTA 2JQZA 5DTFA 3ARDB 1UT1A 4O02L 4NO2A 4TS6A 5I6LA 4XPAL 2O6DA 4FYQA 4EUPG 2OV0A 2P5WD 4CSZA 2JTDA 1EFXB 3DGDA 2YMXL 3C2AL 2OZNA 4Z3TA 1RK0A 5IEHA 5DJZB 3VFTB 2GITA 2X6UA 4NFDA 4UYQA 1N5AA 5DJCA 3T6ZA 1X7QB 3WCYA 4MNHA 4TOYH 4YXKL 1YMHB 3SQBB 2J56A 2H1PL 5I73B 3APMA 4YBHA 3ARWA 1T0OA 2BS8A 5ADPL 3E9TA 1R0AH 4H40A 1UWEL 4KHXH 3U7YL 4FQLL 3ARFC 5LBGA 3MBXL 4JHWH 3AZUA 3Q2WA 4KJYB 3S5LG 5MENE 4EZMA 4I2XA 1SM3L 1BFSA 1TZHA 1U41A 3VRJA 1A2YA 2F7IA 3U1QA 4QHNB 4YDZA 1QMUA 1ZDQA 5DI8A 3TGXA 5J56B 5AZUA 3FUHA 3MYJA 5E8NB 3ZHNA 4NCC2 1O7VA 1IC5L 2GJ6A 4V1DB 2IDTA 1VGEH 3NCCB 4U1MB 3U2SB 5F7NC 1PG7L 1NGPH 3DDFA 3NZHH 3VD4A 2PETA 5EO1B 3LZQA 3QQ9C 4LESA 4J1UA 1KWGA 2R0WH 1KJMB 2XTLA 2WQRA 2XZAL 4WNJA 1OSZB 3VXME 5CJ8A 2ZUVA 3MV8A 3UJIL 4LMQE 4QAWA 4XXDB 5FO7B 3MODH 3L9YA 4BH8B 3L3JA 1AGDB 2OL3H 4Q9BA 4P2AA 3LDBC 2NT0A 3LSOB 3HTLX 1GJIA 1N6QL 4IKLA 3QT2A 2J8UB 3LIUA 1QSVA 2OULB 3UZEC 1NCDH 2FO4A 4IRJC 1M2VA 1NFDB 1ZK5A 3K72B 4JANB 3SCMD 1SEBB 5EIIB 5IW6B 2JCCF 3EOYG 3RGBA 2WYTA 5DJCB 5KYXA 5MP6L 4XE5B 3RTQD 3ZE0E 2HAZA 1CK0L 2OCCB 3ZL4H 5KS9F 2DPKA 4X6EB 2ED8A 3LKPA 1DVQA 2Z64C 2A6DA 2EXYC 3BXNA 3JV6B 4KQ4H 1JP5A 3K5RA 4R5XA 5IEKB 1JERA 5J3HD 3EO9H 5CSGA 2D9CA 1ZPLA 4XCFH 4EBQL 4J6RH 5FM4A 3VNYA 1F1GA 4ATTA 1F11A 4K3DL 3JTSB 1R3IL 5M94B 3KPSE 5D96C 5KVGL 3W9DB 4PYHA 3NSXA 3X1FA 1EERB 2ZUWA 5IVOA 4WSKA 2OXHB 3MRLB 2KKQA 1KCKA 5FC9A 2OBGA 1TZGL 3V5KA 2NY1C 3OAZH 4KRPC 1BREA 4NQQA 2AJZA 3VFRA 1G1OA 4KZEH 3AS3A 1ZHBB 3GXFA 5T3XH 2AQ2A 2QHRH 4FYRA 4JG1L 4G7SB 4ZSOA 2FRGP 1WFNA 4GO8A 2WBJC 3BWAB 2J4WH 3T8VA 4HIIA 4ZI8A 4PW3A 2FEDD 3UEQA 4GIOA 4X7CC 1T89C 1NIAA 5E9NA 1P4IL 4P5TA 2ADJA 2Z93B 3KPLA 1LTXA 1LK2A 3HMXA 4MLIA 4OLXL 3TT1H 2VMEA 4XPTL 3NMEA 5BMFH 4Z7IA 3E3QE 4ZTPL 1K5WA 4FGMA 4M8QB 4U1NA 3K2IA 1AZVA 4NQVB 1E2VA 4H25B 4RCAA 5EZPA 1U8KB 2CLVA 1KLUA 1MIMH 3EYOB 1SXCA 4PJXA 4TRPH 5AKSA 3WNIA 4OQTA 3JYBA 5KSAA 2WV3A 2GABA 2HZHA 4LSPL 3KMDA 2P5EA 2HVBA 5EZIH 1YEGH 4FZ8L 1PLCA 5ISZA 2BP8A 5HI3D 4EUPB 5JHLA 1KT2B 1ZS8B 4HUXB 3HUJF 4IS6B 4JKPL 3KW7A 4U7SA 3MRMB 3R7QA 4QT5A 3QDJA 2YA2A 2BY0A 1DLHB 3P69A 2WXHA 4IKKA 4IU2A 4NFCA 3HBPA 5IQLA 4UTBA 2WIIA 3TEUA 3GUTA 2XWJB 1CU4L 4UT6L 2F5AH 3MLTA 3AWFA 4JCLA 2DQJL 3UAJC 4AZ8B 1I7RB 1TEGA 3EJJX 4RRPA 3MLYL 2FBJH 5FYJU 1BBJB 3HG3A 4OY9A 4UOZA 5F6IB 3FRPB 4HIEB 1H5BB 3V6ZB 2Q87A 1II4E 3MOBL 4XO4A 3SPHA 4QLWA 3KPRE 4Y4FB 2I9LB 2FYVA 2R9HD 4LSQL 4HQQH 3DTXA 3MTRA 3WHXB 4IRSA 1AGCA 1KGWA 3THML 4EMZA 1EAPA 3VI3B 4X8JB 5TDPB 4E5XG 2CH8A 1Z0MA 5CEZD 5C09A 1I9RL 1WF5A 2OSXA 4JY4A 4BGLA 3VGDA 5BQ7A 2W0LA 5G5DB 1MNNA 3DWTA 3D4ZA 1QFUH 2PF6A 1HEZB 1E43A 2IAMA 4L9DA 4GAJH 1FZKB 4XNYL 4XOEA 5FOBA 4ES8A 3D39E 5IUSA 3GYRA 4AG4L 5CBEA 4NBYB 2C4FU 4OU3A 1E9OB 3CHPA 5DT1L 1SRDA 3GJFK 4WEBL 3DROB 4F27A 4EDXB 5AB9A 3LB6D 1XTLA 4HGMA 3S35X 2K6WA 1FH5L 1K4CB 3GJFA 4XAWL 5AB0A 2ZKHH 2P5WA 3NAAH 5K59E 5FECB 3H9HA 3MRMA 4OLXH 1G9NC 2PYEB 1NMCB 2V33A 4UTAA 1XCTB 4JQVA 5E2WH 1FPTH 3FQRB 2DM7A 1W72A 3ECVA 3G6JB 4GJTB 1AGEA 4Z7WE 5FUOH 3B9EA 4PI2A 5EMYA 3W38A 3U9UA 5JNYB 3ZT6A 2YWZA 1OSYA 3SZKC 1QI5A 2G2NA 3B2DC 4GQ9H 5F7WC 2ZOWA 3LV3B 1HHJB 1M2OA 1JFHA 4K7FB 1E2ZA 1A1MB 4XO9A 3WUWG 2X4SA 1V3LA 2Z35A 1BXAA 1BD2D 2OP4L 4V11A 4AGMA 1DQQB 4QY8A 3T5WA 4ORGA 4QWWD 4I0PB 1WFJA 3X1EA 3VSQA 3L9EA 2D3VA 4CVXB 4MJIE 2ZSWB 3WN5A 4E42B 2VQ4A 1QW8A 3MRJA 4TULL 4CUCA 1HH6A 1J1PL 1XIWD 1Q9OB 3WMSA 2YD6A 2JJUA 1CVRA 5M7QA 4EKXA 3L4CA 4PJIF 4XMPH 3UG5A 1M6OA 2ZKYA 3LRMA 5EBLB 4D8PA 2AJSH 3TO2B 4I8DA 3BFWA 3HS0C 4CBPA 4EBQH 4LHUD 2LTQB 1PJ9A 3RY6A 4KVCH 3OKDA 1KG0A 1MCKA 1T4KB 2H8PB 4X6CB 2AABL 1YUHA 2XV2A 2JELL 3JT2A 3UGXA 3L2MA 3MUGA 5CAYB 4LSUL 4Y4FD 5F8RC 3SE4A 1HWHB 5EU5B 4C56D 5FO8A 1PBYA 4BD4A 3BEVB 2VQ1B 3EOBA 5I8EB 1VACB 5GRVL 1GOHA 1WCBB 1T0PB 4DQAA 2J12B 1VJSA 5K9QG 4JJ5B 3K2KA 4HZLB 1PX8A 3RIKA 1OL0A 2NY6C 1Q9LB 3FFCA 4B9IA 4N5EC 2XN9E 4Q2ZA 4QF1A 2NXZC 1L6XA 3HG1E 3PABA 3QRBA 1FE8H 1RSFA 4G3YL 3U46B 4ONFH 2OYKA 5DO2D 2IDFA 2PW2B 1TCRB 1IAMA 1KIRA 2XG4B 2FH6A 3OPUA 5H8DA 1AYRA 1EJ6A 1KJ2H 3EJPA 2NY7H 3BGFB 3TJHD 4BKSC 2DV6A 2BRRL 4DVBA 2AEPH 2ZSWA 3WN5B 1BCIA 1VFBB 5DF0A 1QWNA 3RWCB 5C0JB 5KS9E 4RAHA 5CUSL 1R3IH 3N43B 5IBLC 4YHYB 2OMYB 4U1JA 5EC2A 3BVDB 4MMZC 4MA8H 4DVRL 3MLUL 4MA1C 1DVFB 4XN9A 3EDEA 1QBLL 3QG7H 4Z3GA 1Z9LA 2TAAA 2UWEF 5FUCC 3EJRA 3DV6A 5A3IC 5C71A 3JT0A 2UZPA 4FQ1H 4ETYA 3RDTA 3HS0A 4JFPB 4BDVA 4K8RH 5AOZA 3U0TB 2PP9A 5BRPA 1JXJA 4X50A 2BNQD 4G82A 3B7SA 1FORL 1G7JB 4IBTA 3U48A 4FXGA 3D87B 4N1HB 4QLRA 3W81A 3FUMA 3VU2A 3VD2A 1JNNH 5E6ID 4BZ2H 3CZUB 3KBHE 5I1GH 3RFZB 4F9PA 4FXKA 4I5BB 2XWTA 1A1MA 2QVFB 3NAAL 3EH3B 4FNLH 2EDTA 3KWVA 4KK9C 3HG1A 2WXGA 3PABB 2WKOA 1E8ZA 1O7SA 2ZWLT 4W93A 4V2BA 1W6WA 1A3LH 1EAJA 2J8HA 5HHXL 4KX7A 4R3SA 5IESH 5IIEB 2ZUUA 1TQUA 3GSVA 4FQ1L 2XZZA 2YXVA 3UYOD 2KDGA 2WNKA 7CGTA 4RFOH 2CM5A 3GMNA 5C08E 4JDZB 3LKNA 3SKOA 2EVJA 5ABDE 3PWUA 4WI9A 3FQUB 1OAUL 4LRIA 5FK9B 2QQLL 4RRPG 4PRDB 4HGWB 3QDAA 1CGSL 1IM9A 1KFAH 4P2QE 5HI4D 4F58H 3E2HB 5C6WH 1UXMA 1OCOB 4XPHL 2CJUL 5EEXA 3QI9C 4JHAL 3ULUD 4H1LA 4WFED 3OTTA 2YSSA 1KLFA 4I3SL 4MNGB 5INDA 4ZMVA 1KGCD 1A6AB 1PG7W 3R8QA 3SGDH 3AT8A 3KPQA 3D18A 3QJUB 4PTUB 5HYIA 1GS7A 3MUHL 3BH4A 3OB0K 4DETA 4FQXA 3INOA 1RKRA 3OMZA 4G42A 1LILA 1I8KA 4Y19B 1R3HB 1R3LA 3V0EA 4BEIA 1Y0LB 4HVBA 1FLTX 5FO7A 1SHSA 4IRJB 4JFXB 3MLRL 2D7PA 1EGJL 4RETB 1C9SA 2WNGA 3BVXA 4Z7NF 1ZWIB 2JJVA 1XCWA 5MENB 2XG5B 1CR9H 4IIQC 2EH7L 1YEKH 3QA3B 1K3ZA 1F4AA 4KDWA 1BZ9B 4OCLC 4N2AA 1XF4A 4XMXA 4HFWA 4R0LB 1E50A 3O6FD 4OD1H 1YRKA 4Y2DA 4UQ2B 5B3SB 2R7EB 3NIFB 3RHWF 5KVEH 3EJQA 3AU1A 2DB8A 4JKWA 4R4BA 1EA9C 4XC3L 4FKKA 3ZDYB 4DKAA 5CEXB 3FUIA 5IMKB 3QJOA 4NO5B 5FUOL 5HYSB 1YEGL 4FZ8H 1F3DH 4ZD3H 4OZGA 3CSTA 5I18L 1KTRL 1YNKH 2FAUA 3NGBC 5F9OH 5ILTL 4FDWA 1QABA 1EANA 4JFYB 4R5TA 2IGFL 5CIPA 3I02A 2WTOA 4MZ3A 1KYOJ 3BKML 1UCBH 2LFGA 2HXAA 2X6CA 5LWYH 4FI7A 2AANA 2WVTA 1KYFA 2EZ0C 4R8WH 5AVQB 1H6TA 4P2QA 5I1HH 3ZTDC 1ECZA 4HJ0D 1T2XA 4X4YA 1VKXA 3PIQB 1UOWA 2VH5H 4GEJA 3D12B 4Y2OA 1JDDA 1R5VA 5SX5K 1UZGA 3VRIB 5D1XC 4PEEA 3WJLA 1EHLH 4PJBF 1Q8MA 2YSSB 4LSSL 3W9DA 1M7DA 2HJFB 1IM3B 3KYAA 5DFWH 3HI6H 3IGKA 1OARL 4P2YA 3BIKB 1YMHA 3O11B 1PFCA 4FQXB 3P30L 4G7YH 4ACPA 1JNJA 1H6EA 2J21A 2ICCA 4J12A 4XNMA 2R8SL 4PJDF 1JVLA 3K1KC 4QEGA 4RESB 1OALA 2Y22A 4YAQB 2V2TB 3OMNB 1RMFL 1TQBB 3PNWA 4D8OA 5ADOL 4LSVH 4O02A 2QGBA 4XCEA 5DYOA 4Z0XB 1IEBB 4FQIH 4W6WB 3O4LB 2H0EA 5KG9B 2Z4TA 1NFDF 1D5MB 4NN7C 4F2MA 4G8AC 3HPJB 3W57A 3QR1A 2Q7YA 3FB6B 1AHWA 1NBVL 4XX1E 5E5MA 2WOYA 4M1DH 4X42A 2LU5A 5GGRA 5DMKA 4ERSH 4HG4K 1ZT1A 4KRPB 1U8OA 3NPSB 2FEJA 1VAHA 3L3JB 1FZOB 3GBEA 3X17A 4WEUD 5JPMC 2HTKD 4KXBA 5BS0A 4QTHA 3AFLA 1KTLB 1A9BB 1T2JA 1WVZA 2J1KA 3ARDD 5ICXA 4LLDB 5IMLA 4AEEA 3PIQA 1TYRA 3QXVA 3VFWB 4JKMA 5GGQH 5BZWB 3DRTB 2CK2A 3VYOA 4BXVA 1NLBL 2HX8A 3QIUD 3RJQB 1LL1A 2G60L 1JCKA 4A7UA 1CYGA 5F9DC 1Y18B 2XV3A 4JPQA 4JO1H 4L0YA 4CGUB 1CD1A 5DJAA 3EFDH 4JUSA 1EV2E 3MX0A 1D5IH 3VI4A 2WGXA 4PJ5E 2WNXA 1G9NL 4W9JC 3PQYD 4HUVB 2XRAL 3ARGB 2DTMH 1QLEL 2NOYA 3ZX1A 5CO1A 3HMXL 2NCMA 3TNMA 3GTTA 5I5IA 5IGXH 1C1EL 2IF7A 3IFOB 12E8L 5DEFB 4IIQB 1T5WA 2EABA 3AY4C 2R2BB 3IMSA 3BVNA 4HALA 3HNSL 2A74C 2Q76B 4EIZC 3JWOL 4M5YH 4LK4A 2DLFL 1OE1A 2P47B 3QJZA 5J11B 1IGYB 2GBTA 4WNSA 2Z8RA 3EO0A 3O8XA 3BAEH 2VRAA 1CWVA 2HPOA 3B2UD 3I84A 4JL2A 1S7WB 1EVTC 2CDGB 3FFOA 3P3TA 4RA0C 3BQVA 5FYKE 1LEIB 1R19A 2WLLB 1DQML 2OMXA 4X80H 5HI3C 2ENPA 4N20A 1F3RB 1NC4D 3BWAA 1MAKA 4QWWC 3UMTA 4XMLL 3QUHA 1QKZL 3L7FA 3QCUL 3AXLA 3KPOA 3GMPB 2WN3A 5IB3A 5FYKU 2XX1A 3GM8A 3HLKA 2W38A 3TIDA 3FCSB 4NKOA 3QEQD 1Q1JL 3W0WA 5BZWA 1CBJA 3JTTB 3MQIA 5TQ2H 3HAEA 3ARFA 4HJUA 2LLNA 5D9SB 3CK0H 3HZKB 3P73B 3M17A 5D7IB 1W0WA 1BLNA 1SYSB 4PGCA 1F3JA 1SBSL 1H3PH 3FAWA 5KSAB 2JI2A 4LNRA 1P84J 3IDGA 3TCTA 2Y5QA 4IOSA 4K7PL 4ODSL 3NZ8A 1AQHA 1F6FB 2BSSA 1I8IB 1OGTB 3KE0A 2XT1B 1KYAA 3WHE0 2FGWH 1A6UL 2Y69B 4FQJL 3QNYA 2R0ZH 4LFHG 5CD5D 1EO8L 3CFCL 1WE5A 3ARUA 1P7KB 2EH8L 4DP9X 2K0RA 1CFVH 1DBJL 1TXKA 3CDZA 3T0EA 1BECA 5K1NA 3LS5L 4G2AA 5E99H 3F58H 1MLCB 1EDHA 3LZFL 4FCHA 5JW5B 1BAWA 5D2LA 1KJVA 5D4IA 1VFUA 2ICWI 4UZSA 3VSVA 5AD0B 2JI3A 2NXYC 2DDQH 1CGTA 5B39A 1SJEB 2UZIL 3DMMB 1OSEA 4JRXB 4KVNH 4DZBA 1CG9B 4QYOA 1S9YA 1A6VL 5JZ7C 3M7OA 1J0JA 5IHZB 3OKDB 4QRRD 3NDZE 3N42F 3P77B 2GFBA 2IFFL 1EHLL 1NM9A 2CGRL 2ZG2A 3T1WA 1T21A 4NLAA 3GXMA 2J1WA 1UADC 1NIBA 1Z9SB 3I6KA 4YHZL 3F05A 4N0CD 2J8UA 3QH3A 2BSTA 4ZAKD 1RZGA 3AG1B 4AW7A 4IDJL 5F7UA 1KTKE 5KYWB 4M4RB 4L4VE 2APWA 3ASWA 4A2HA 5F93C 3LKRB 1B4TA 5AAMC 3HRZA 1WV7T 4RFEB 43CAB 1LO0H 3AG4B 2HFFA 3DURA 3KWWA 3B7UX 3DI3B 3N43F 1E9OA 1BJ8A 3PNRB 3HHSB 4D9RE 4ZUUB 1EJFA 4YDVB 3U46A 1FV1A 3LEVH 4XPAH 1UD2A 3NJXA 5IVXA 1CC3A 5JIDA 1GS6X 3Q2VA 4X9YA 4DF9A 4PJGE 2UWEB 4PLKD 5L0QC 1AOZA 3W2DL 1EX0A 1IAKA 1NGPL 5C8JB 1X9RA 1JV5B 1L9NA 1ZJBA 3TBVA 2IGLA 2IH9A 4PJ7F 3VFUA 2DQEL 1GXEA 2C9UA 2VLLB 1BQLH 3GDBA 3MLWL 3W82A 3ZW3A 3RURA 4GRWE 4RMTA 2DYPA 3UC0L 5DK2B 4JR9L 3UPCA 1HX0A 5C92A 3ILQD 1M1SA 5AKRA 3DUSA 1U92B 1SJXA 2VMFA 3PQYE 4QXTA 2CJTA 1KB3A 5CZXC 2GT9A 1HI6B 2R1WA 2GPZA 1OM3L 5TGBB 1WFTA 5HHOA 1KGXA 2YQ3A 3EJTA 2GFBB 2BJML 4PH8A 5FA4A 3W0WB 5I6NA 4QIRA 4W9IC 1S9XA 1QYGL 3PWVB 4O5LH 4KWUA 2OMUA 3CSGA 4HBQA 4BK4A 1JPEA 1S8DA 1L9SA 1UVQA 3B9AA 3PS6A 1KPVA 3MRIA 1RUAL 5CZVH 5C0CE 1HL9A 1DDHA 1LM8V 4N22A 4BSVB 3GI9L 4NN6B 2QDVA 4N1EA 5L4IA 1IM3D 4ZQTA 3D4CA 1KTCA 4PLOB 3LVEA 4ZZKA 4BK5C 5G4OA 4UQ9A 5CGMA 1UD3A 2EXTA 1TLKA 4JQXA 3EGDB 3VFNA 4YDKL 1A65A 1QZNA 1T04B 1GC1L 5LXGL 4L3ED 1ZE3H 1MZZA 3ABMB 4NP9A 4A66A 4I88A 4PWFA 1CLVA 5EDXA 2H9GA 4F24A 2P8PA 4HGWA 5E7FA 4A6YL 3AREA 2AXGA 1CE1H 1RUQL 2X40A 1OGPA 1MWAA 2DI8A 2ZWZA 3B3BA 4NN7B 4CKQA 1A7OL 1J1OH 3DYPA 4XO3A 1FL6B 2FZ3A 4LCYB 1KLFB 3QUMB 5INDB 3HNTH 1BF8A 3B6SB 3TYFB 5DO8A 1EQWA 2CR0A 3KPPB 4WKXA 2WLIB 4N85A 5IFJB 2P80D 5TH2A 3MA9L 1PGRB 3QK0A 1JVOA 2FLMA 5L2KA 3MV9B 4Z77B 1NEUA 1GYCA 1RZKC 2DM3A 3ZL1A 1AD9B 5E9AA 1OAZH 5HBBA 3CZJA 1RFDH 2HFFB 2DLHA 2NY5H 3HC3H 2Q86A 2AEPL 3GINA 5BOJA 2C7UA 2XWZA 5G5DA 2D7TH 3DX9A 4MS6A 1F45A 3D48R 5FUCE 1WSST 4ADIA 2LV4A 4YHPA 4A6YA 1JBJA 2E6JA 3AAZB 1AQDB 1L9TA 2AK1L 2GCYB 4L2YA 3V95A 1S5HA 4UOW1 3VG0L 1HK6A 4X8CA 1MHEB 4U3CA 4X6CE 4LEXH 5CJ5A 1T66D 3AACA 1XR9A 4C4KT 3F04A 4ODVH 3F6LA 1T0NB 5I8CA 1I9EA 1GCYA 3BEWA 2OR8A 1FJ1A 3W0WD 3HE7B 1BVZA 3MRLA 5I1DB 3ARFD 1CLYL 4PWEA 1GIGL 5D1ZI 3VYPA 1X6LA 3SKUD 3WNLA 3KWTA 4MJJA 2VZUA 1AKPA 1O6SB 3KVDD 4YQXL 2IPUK 3CLEH 3LKQA 4KO5A 4Y5XA 1P7QA 1WBXB 4XB3A 2BM3A 5DT1H 3RX7A 3V6OC 1MFUA 2D03H 3B6SA 3TYFA 4NKQB 4AKPA 2R2EB 1KELL 4N6RA 5EUOE 2JCCA 4QRSB 1D5RA 4NPJA 35C8L 1KXQA 3L5WA 5E0FA 1OB1A 3FQTB 5I8OH 1TZAA 3G6JE 4Y4HC 3IAGC 2VLMD 3KL3A 5EZLB 3ZRFC 3QYCA 1Z2KA 1H15A 2VYRE 1SMOA 3CFUA 3VXPA 3QXUA 3V52L 4AXWB 3K71A 1DN0B 3WFEL 1JNLL 4JN2A 6CGTA 1KIPB 4DGIH 1ZANL 1CDYA 4TTDD 2F08A 4GFTB 1SN0A 1FDLH 1MPAH 3BPCB 4M00A 2MCG1 1G94A 2BERA 3ZDXE 3FB6A 2Q7YB 4G7RB 3Q5YA 5GQBA 4NENA 2VITA 4X7SL 5L4MA 1CU4H 4IOFC 5JHDA 5KN5B 2E46A 4M7LT 2HKFL 4OM0L 3CUPA 5E2WL 5IUCA 2CO3A 3O11A 3MBEA 1N19A 4AGOA 1OAJA 1U9KA 1EEZB 2AXHA 5LJYH 2ZE0A 3RB7A 5ERWB 3WNNA 2HKHH 3ARDA 2PYED 4G7QB 3KR3H 3U6XS 1EZUA 3KS0H 4H8HA 4N0YL 4WWID 5E8PA 3LIZL 4U1KB 4ZO9A 1XCQB 4ODHL 5D7LE 5DHVA 2EDKA 2EC9T 2FUTA 4PRPD 3KM1A 4HJTA 4WHYH 5EUOA 2E9BA 2O30A 3OM3B 4PCKA 1XF2A 1A4JB 3BO8A 2R2EA 4L5FE 5JYLA 4ADGA 2Q1EA 1BEXA 2AW2A 3OZLA 4K0OA 3K80A 2XG4A 5GPRA 2ENSA 1LE5A 1A6TB 3LPPA 1A8ZA 3X13B 1VFOA 4B9CA 2DD8L 1T4WA 1SY6A 5C3IA 5FOBB 1KEGL 2H1XA 1HHIB 1YY8A 2VMJA 3KH3A 3N44B 3MXWH 3HG0A 1CD8A 4MQ7A 1FZOA 4AUYA 4JVUA 1OSPL 2D73A 1EJ8A 3IBOA 3NJNA 4XN8A 4BA0A 4YSTA 2APSA 1S7SA 3LIZA 3CFQA 1QLFA 3TJEH 2NX5A 5E5LA 4BJLA 4G1EB 4LHUB 3A6CH 4PVNA 4YDIL 3QEQB 3S34H 2V5RA 2YEZA 2FX8L 3RNKB 1GY2A 4FLQA 4HCIA 2ED7A 1CFQA 3L3OA 3QO1A 4I77H 3MCLL 5JXED 5HDLA 3A6BH 3BSHA 4M62H 1QFPA 3BX7C 4FKEA 1CN4A 4S1DC 3UJTL 2DBLH 3F62A 1YEJL 4G8IA 4ETQB 4RSYA 4X8GA 4JG0H 1P1ZB 3JWDC 5I1EL 3IETA 4NQCA 3LVTA 2CDFA 4Y4KC 3U9PH 1DSFH 2F9BT 2RTTA 4MCZB 5D7LA 1CZ8L 1P9MA 1XCXA 5BV7B 1T22B 4NUJA 1WC7B 4AIOA 1TZHB 4A37A 1QHOA 4NLHA 3D0VB 1J9RA 2Y1YA 3PWPB 4ZT1A 5LCVL 3ZQWA 2YA0A 1Y6NR 3V9EA 3NJGA 5T1KD 4AEIL 2ICEC 4BRVA 3GJEA 3H53A 4X6CF 4M7KL 5F9JB 32C2A 3TURA 2VXQL 4UIMB 5EO1A 1QSFE 3EYFA 1I53A 4P3CH 3V4PA 2ZIDA 4OGZA 4MZ2A 4RGNB 2X7LB 5C08B 3FQUA 2Z34A 3D39B 1N3NA 1YN7A 4YL9A 4C58B 2IMNA 2WD0A 1YZZA 1YEKL 3O3DA 1WJ3A 2FT8A 2OLDA 3BMVA 1K8DB 2BP0A 2QSCH 5SWZB 3LXCA 2BPBA 3O3EA 3P9LA 3W5MA 3JUYA 3MOAH 4FAAB 5I24A 2X9XA 4QCIA 2YD3A 1QQDB 4RMUA 5DEJA 3RLSA 4P3DB 3SE3C 1MQ8A 4L5FL 3EHBC 5CD3B 1A7PL 1AC0A 4RLDA 4XI5D 2D0HA 2VIRA 2O5ZH 3RWIA 5H35B 3WELA 4Q9QH 3NSFA 3ULVC 3KW8A 2XKSA 2YXMA 3ARBA 3S96A 2YOCA 4W1TA 2YEQA 5JPMB 1E90A 3NABL 1P5UA 5ESAA 2MRYA 3O9WC 1JK8A 3HAEG 2YRBA 4K5MA 2GSIA 1J11A 4ZMZA 2CXKA 2IADB 4L9LA 1NCGA 2WXIA 1PY0A 2ZX9A 4U6XA 3LQAC 3S3BB 4OM1H 1HSAB 3X3GL 1L0YA 4GW4A 3V5DA 2C3XA 3Q6FB 4D7BA 5T1LA 4DO5A 3AQYA 1IQWL 3V0VA 1KPRA 4GRLD 3QIBB 4XMUA 3WIFB 3LN9A 5GRXG 2YD2A 1GC1H 4V1DE 4F7CA 5EEWA 3MV7A 5ESVA 5L8KB 3CXDL 3HA0A 1PEWA 3GMOA 3NIDF 4QRPA 1NCCH 1T3FA 2HSIA 2UY6B 4PRPE 4PY7B 4WKZA 3SCMC 4AMXA 4GKZB 1T21B 3TIEA 2DYSB 1QA9A 4HKJB 4OI8A 2QV4A 4XMZA 3GJFH 1UH3A 4MD0B 2BMKA 1MW3A 1U91A 1F3JB 3MGTA 4LQFL 2WWMD 3DHUA 1BPVA 3NIGB 1A1OA 3T4AA 5I0VA 2IGTA 1N67A 2WN2A 2DQUL 4JDEB 3IF1A 3VXOA 2RJMA 3OZ9L 3SD5A 1DCLA 2PPEA 4NO0D 3QXWA 2DJMA 4JHAH 5DYOB 1MAML 3ZBMA 3JVFC 1D7BA 2JQAA 3FQXB 3KPSD 4LPVA 4QXUL 1AXSB 3MJ9H 4F15C 5I66A 2ZOLB 4WJKB 3OF6D 1CQKA 5JOFA 3RAJL 4YBQC 1MJ7L 3X11A 4ZUWA 4D3CH 2W65A 3HI6L 1BVLB 3L3HB 1BVKB 1UZ8A 4EN3D 2YA1A 4J4PC 1ZHKB 3LYRA 1FZKA 3D3VE 2CRYA 2V7HA 3PGFL 1S9YB 3QAZB 4YOKA 2WTPA 5G2NA 1PLBA 4LLVA 3V5DB 4I18C 4P46C 1NBZB 1UGKA 1ONQB 4ISVB 2Y6SD 2XIIA 4LOEA 4AGNA 4JFZL 2DQFB 1OAXH 2YBRB 4Q6IB 1AG0A 5KSBA 1Y1DA 5TJWK 1RVFL 2EDEA 2VUYA 4JKNA 3ALPA 3GUFA 4XVSH 2EDLA 3TCXA 1MJ8H 4F2FA 3WV0A 2K4AA 3FU0A 3MRQB 1XCTA 2VDML 4MAUH 4F7MA 5CMAB 1EDQA 4KHTH 2E7CA 3UTZB 4I48B 4JJHA 2CO2A 4OM1L 1Z3GH 1LO0L 4PV8B 1SYVA 3WSQL 2V9QA 3LD8C 3TFKD 1OZUA 1SDDA 4HWZA 1F5WA 2GIXA 3SYQA 4FHJA 4UNTA 5F0LB 3FL7A 2RD0A 3PPSA 4WTQA 2VDNH 4HUVA 4OF8A 1U3HB 3S8GB 2VJ8A 1BIIA 5F3BB 4E9YA 3UMNA 4ZAKB 5C8JA 3PV6B 1PAMA 1HNFA 4P2RD 5A43C 2XVBA 2I7OA 2EADA 2DEXX 4NZRH 4AM0A 2DQEH 3HN3A 3FCUB 4NQSB 3WGVB 4FLSA 4HYTB 4CVWA 4L4VB 2C3VA 5HY9A 3JV5A 4KZ0A 2EDHA 2HT4D 5KVMC 1YPZA 1M7UA 1RH8A 4BXSV 3PGCB 3QWRA 5HD8C 4KBPA 2OXGA 3LZNA 2NZ9C 1JPFB 2A74A 3VI3E 3ARVA 3Q8CA 3TIEB 3NIFF 1N59A 5JW4M 1T6BX 2GEEA 5GRVK 1M2VB 3GS4A 3IE9A 4CW1B 1DE4B 2H0JA 1GY1A 4UANA 4LBEB 2HFGH 1Q0XL 4NUMA 4LT7A 5D9SA 1XB8A 1YEWA 2H6OA 3GRBA 3MRJB 5A3ID 3IN0A 3CK0L 5A2AA 3VMPA 3FB5B 2EKSB 2X4TB 4L8CB 1IEBA 4KGLA 5B4MD 4LNRB 4P2RA 1WDAA 4V2CB 1JWSA 4NKMA 1AD0A 1YHPA 3VXMD 4N6RB 1AXSA 2JJTA 3TPUB 4OV5A 2VDMB 1NAKH 5F1IB 5FKPA 2X4UB 1G6VK 1GVIA 4GUCA 3RVUD 4S2SB 4NIKB 4A63A 4AMKL 5I1EH 4FG6C 4PSPA 4OI9A 5AVZB 4HP5A 4PRAA 4CVZA 3MRNB 4AQOA 2FATL 1UXWB 1A7BA 4OSUH 5D7KE 5AD0A 3LKSA 2BNRA 3P0YL 2ADIA 4GUPB 2NXZD 3AUVA 1IKNC 4P4RB 4FFYA 3SDCB 1KLGA 1FIGH 1M3JA 3OD3A 2YIHA 3MV8E 1O6SA 1AR1D 1NCBL 4NN6C 1I7UA 2E8YA 3B5TA 4CMHB 4NUPA 4ZSOB 3KPNA 1TVHB 4WIQA 3AXHA 4RMRA 4XNXL 2O5ZL 4MJ4A 3T65A 5HHQA 4JZJB 5E6IB 4ZFZA 5CCKH 2H26A 2XWRA 3O3BB 5HDBE 5C0DB 2OW6A 4R90H 3UDWC 4F1ZA 3U4KA 1MCQA 3K4ZA 4UT9H 1G9NH 3VTMA 1A7QH 1G4RA 3ETBJ 2P5PA 1BYOA 2X89D 3UH8A 3OKLA 4K5NA 4N3TA 2PXYB 1BG9A 5HYQB 1RZFH 1CF8H 3FT3A 4AK2A 1IEHA 3RKDC 2K9FB 2Y4SA 1ZVYA 5E4EB 3QZMA 1EMTL 3IM1A 1GGTA 2BSRB 4DP2X 2H2PC 4Q0XL 3VYNA 1MCCA 1LJMA 5EDSA 5JDSB 2Q76A 3WJLC 4YQXH 3JZYA 5C6PB 2ZTBA 2XWBA 2TSBA 3X13A 4AV4A 1WZ1H 1EEUA 3PU7A 4L4VA 3JVGC 4K3HA 1SLUA 4KVPA 4FXTA 2AJ3B 5JHLH 2EUWA 4AYSA 3L1EA 2VR7A 3HB3C 3F5WB 5D7JC 1TQWA 1P7QB 3BQUD 2W9EH 3DKHA 1LO5B 3GM0A 2NXZB 3O2WH 4IK7A 1B3JA 4DH2A 5GHWL 1S9WB 3I50H 2R1WB 1D6EB 1NFDE 1OHQA 2G0LA 4YBQD 5D4JA 3P02A 4GIPD 1U8HA 1GW0A 1OCWH 4CAGA 3QYMA 1CGYA 1FFNA 5SWSE 1Z6JT 2Y23A 3EFDL 5D7SH 1EO7A 2X1XR 3K6IA 1M4KA 3B34A 5DZOA 3O4LD 2IXQA 3QG6A 4FFTA 2NYZA 3NCEB 3S2AA 1VCBC 3MRPA 1D5ZA 3S9DB 2JFCA 4K3EL 2VC2L 1C7SA 4H2AA 1ACYL 4KJWD 3VXUB 2GK0A 1ZHLB 2WBXA 3FSAA 4WI3A 4XHJD 2W91A 2GBAA 3CPLA 2HRPL 1ACCA 4R0LA 1DDHB 2RGSA 3O4LE 2CHXA 2OZ4L 1G7MB 3EFOA 3CG8A 5T3ZE 5IB2A 1UWYA 2L7UA 1LK3L 1P0SE 3RGVD 4FABL 1XIWA 2CGYA 2DWDA 4JPKL 1V3MA 4MNGA 4HG4J 1MI5D 2QSTA 3MO1A 3ZZSA 2ZKHL 4DKEH 2F7PA 4ZW5A 4E5XA 4JY6B 2IVFC 1MCDA 4R2GC 1K5NB 4M9OA 3ZPDA 2VQUA 4BFEA 2A9BA 5GISL 5DUPH 3F5WA 2WKOF 4FI6A 1SJHA 1CF8L 4C47A 1NA8A 5E1QA 4PGZA 4XP9H 2XIBA 3C60A 1C8QA 3BSZL 1S9WA 2VZTA 1WWWX 3IJEB 5G4MA 4IJTA 3MV11 1G0XA 3ZKND 1JTPA 3MA7A 1PX3A 1JOIA 1X5AA 2R7EA 3DYOA 3HG2A 3IDJA 3IPFA 1AZBA 3GXPA 1NKGA 4F8PA 5FKAA 2OTPA 4NT6B 4PGBB 3CFKA 4G6MH 3S6CA 3CHRA 4Z0BH 1FQ9C 4FXGC 2EYTA 4N2LA 3HHSA 3BP6A 3NCWA 4MQ7B 1TZIA 3ULUE 3W5NA 1G6RA 4WFEE 5KVFH 5GGVY 1O6TA 5B38G 1FVEA 3MV8D 3TJHC 3FSWA 4P46D 3O2WL 3D39A 4OGYH 5KOVC 3OQRA 1VGKA 3V52H 3L95A 4U1IB 1ZLWK 1WIOA 2DQCH 3IU3A 4KK5C 4JO5A 4TQIA 4OCSL 3KNBA 2BH0A 4DEPB 4PCYA 4HS6A 1S5IL 3FFDB 4NSKA 1YCSA 1RPUA 3GIZH 3QHZL 4G9FB 4ZFOB 2VL5B 5LBSH 1PZDA 2YAHA 3N5AA 1A22B 1NSNH 3II1A 4HD5A 5KJRH 1P5VA 4RFNB 1ZD6A 5J7CC 2AZAA 2X53A 1L4IA 4HIXL 2FGZA 5KVEL 2CIKA 3ZDXB 3AJ7A 4H44C 2ZX5A 1EHAA 3PP4H 4WGWB 1J1XL 5AAWC 1IBZA 1F58H 3DVNA 4XBEH 1QI4A 4CMHC 2QGCA 3EXJA 3HE6D 1T83C 2X6VA 2BNQA 2WLKA 4L1SA 4XMKL 3HPLA 5F1NB 3W39B 1BZ8A 2ZOKA 2NZIA 1N5AB 3EZ8A 1WPCA 3MODL 4XNQB 4F7KA 4K9EL 5HYJB 4B9KC 1NC2A 4UF7C 5C6TH 1MRDH 2NYYD 4HMEA 2VM9A 2XJKA 4MS8D 2OJ1A 5JW4Q 3ZDXF 1A4KA 3JWNG 1X3DA 3AMKA 1B0RA 3FN0L 3CMOH 2VTFA 2A9DA 3CZNA 3Q2LA 3PY9A 3QQ4A 4KOCA 4NZUH 3TCLA 1KPUB 1TO5A 4MA3B 4Y16C 4K8RL 3WLBA 3ESNA 2V0AA 2WSPA 2BO0A 3FT9A 1QUPA 2PWEA 3FTVA 5ALBL 5GS2H 3L54A 3RGHA 2NR6C 5GS1C 5I66B 1P53A 5BS0B 2WWOA 1BJ1H 4U1GC 3ZZQA 4MJ6A 1A6VH 3P0YH 3Q8AA 4N0UE 1X6NA 3ZN6A 4EIBA 4UMGA 1YDPA 25C8H 3T4YB 4E5XB 5HYJD 3RUGB 3ULVL 4CADA 5TTRA 2LU7A 2VXQA 4NNYB 4P59L 3KCPA 3P2DA 3G6JA 4JEGB 1W91A 5SV3A 3C9NA 4IRJD 4MD0A 3LY6A 2NY0C 2WLNA 1EEZA 3KYMA 4UWQB 1WA2X 4MD4B 2IV9A 2EE2A 5TDNB 2H45A 9PCYA 5E8OA 3WUZA 3HCVB 4FL4C 4PS7A 2OMWA 2MTAA 5DD0H 5B38A 4MB5A 3VVVA 5I1AB 3LNEA 1B0WA 5AUMB 1OVZA 3RRQA 1REIA 3VFGL 5CLWA 3E38A 3S4SB 4Y7MA 5DD5H 1LQBC 1OT2A 1NC2B 1A7NH 1HWWA 3HE7C 4BWTA 3N06B 4ZUWB 3LPFA 5T1LB 3OVUB 5D1XB 4AW4A 4UT6A 4HS3A 4JM2F 5DUMH 2JI1A 2ZUXA 1TJIH 3ROLA 3SCMB 4TLTA 1MRFH 2Z92A 2IANE 2YMOA 4GFXA 4LSTH 4GO9A 1YEIL 3QDJE 4HK0A 3ZMNA 4HAFA 4MZIA 2H8PA 4OBRA 3SGJA 1TQCB 1TLMA 3P4NB 4TPRL 4EXPX 1VF5C 2VW6A 3FBQA 2QVIA 5IW3A 3G5YA 2EDXA 3LPOA 2B7DT 3KYOB 4R26L 2J6WA 1G0YR 2JKJA 3W11D 1SJVA 5KJRL 3OLGA 3GXIA 4OR1A 3T4YA 3F12B 3V9FA 4R4FH 4ELMF 5LUMA 1NAMH 4L5FH 2P45B 1R5IA 3ATEA 3EYVA 4HULB 3E7JA 5LVEA 5JIIA 1DVSA 4X6EA 4WI6A 5TE4L 1GCFA 3CLFL 3WAJA 1J9SA 3CVIH 1CTNA 1EZVY 3N1MC 3T6VA 1BZ9A 2ZOKB 4XNQA 2EC9U 4NRZA 3SPJA 2E56A 1C12B 5AW1B 3O0RH 1OLLA 4JR9H 3HE6C 2KPNA 1VENA 1W80A 1KCUL 3BDXA 2OMWB 5EH1A 3TYGL 2EDWA 3OXRB 2HP4A 4LVOC 3JWNC 5AB1A 3TJPA 1HYSC 1J8SA 1S7UB 4HC1H 3VVWA 4AQEA 1SVCP 4M5ZH 4ZQKB 2V7HB 1KLUB 4XVJL 1TMCB 2BSED 1J05A 4PMFA 1BA9A 3O45B 4LVHB 4AEIH 1RUPH 1INDL 5KAQG 3BIBX 4J27A 2OQJA 2ZOTA 2Z7UA 3MJ7B 2ALWA 1U93A 2FEEI 4J7RA 1Q9WB 3RGVC 1ZHBA 4F37F 3A22A 1U30A 4E9LA 4HUUA 3NQKA 5K5YA 1XSJA 2FUQA 4KI5E 3MKKA 1SDYA 4GRWB 3C2SA 1Q72L 1K4CA 2BDNL 3DVGB 4G8FB 4OLUH 3GUTB 1WIPA 1JPTH 2B15A 3J8F7 2F58L 4FA8A 5DS1A 5KSAC 2CO1A 5JLZA 1SYVB 3LHAA 3SDCA 5SX4I 4J3BA 3D3VA 1ZLVH 1G87A 1OHZA 2AEOA 4C83B 4TQEH 5T1KB 1UJTA 3D85B 4MNQA 3RU8H 1MI5B 4OBSA 4PJFA 1B3IA 3RPKA 1JWSB 3UX9B 1AZZC 3RJOA 4X6DB 5F7BA 5I1CL 2DQUH 2R2CA 4P5TC 2F5BH 15C8L 1JZEA 4NRYA 5JW3L 3Q0HA 1T89A 4KFMA 2AAVA 3C5ZB 4KKBC 3TT3H 3HEIB 3EBHA 3K0WA 1HINL 1X5LA 2CGZA 3PXHA 4JL1A 2WBJA 2Y1VA 5IBUG 1A6ZA 4NQSA 4D9QD 3GMNB 5BZDA 3TS8A 3DBXB 1CD9B 2DQDH 4ZXBD 1ECYA 2G5BA 1ZGLB 3HR5A 1HXMB 5H94A 2H5UA 4BSVA 2QZQA 4IU2B 4U6XB 5D7SL 3VXUD 2BIPA 1SFDA 5EEYA 4NRXB 2FJSA 1HU8A 2GI7A 2X6AA 5BJTA 3KYKH 2W9DH 4H88L 1QNIA 2EECA 4DESA 1T1YB 1JPFA 3R4RA 2M26A 1XF5B 1AKJB 1MVUA 4CDGC 2IH1A 3VDAA 4V33A 1W72L 1WICA 5KYUA 4Z3JA 1D2OA 2Z4QA 5L88L 2WOBA 4JPIA 4HPOH 4G9DA 4YHML 4QHKJ 5JTWA 3QFGA 3VTAA 4KI5C 3Q8EA 3AG3B 5GGUA 2OTUB 5DJ0A 3BAXA 2ZKMX 2GJ6E 2E5EA 4OIFA 3IWVA 5DSCA 5DDHA 4XVJH 3QWQB 5BQ7B 1AZUA 1U91B 1LD9B 5CBAB 3T3ME 1K4DA 4JM2B 4XWOC 1DSFL 4X5WA 3NTCL 5LBSA 3GMRB 2GBVA 2YUZA 4PJIA 5FDWA 3NIGE 4X4ZA 5IFJA 4GBXC 3V4UH 5HYQA 5IHUH 3UTSD 1JPSH 1Z66A 4M6NL 3WIHL 4OLWH 2YAQA 2R2BA 2VDKB 3BP7A 4TVPE 5E51A 2BZ7A 2W0PA 4FFVD 2ZX7A 4OJFL 2DWYA 4OCWH 2W65B 4EI5D 1XD0A 4P9MH 2GJZA 5KTEH 1TVBB 3W1ZA 2J6EA 3DLQR 1V27A 3UCRA 2LABA 4NCDA 2GCYA 3VE0A 3Q1SL 2A6IB 4LLUA 5FYJH 1L9MA 4MAYB 1KG0B 1T4KA 4O58H 4NC0B 5LDUA 1ZLEA 4H20L 2WIMA 5MERB 2DL9A 1A9EA 3V4UL 4G6KH 3DYMA 5A40E 2P24B 2ERJB 2OMZB 3GMPA 4KJPC 5IB3B 3FUEA 4ZNCD 4Q9RH 4ZPVB 3EO9L 2YPVL 1I1AD 1T5XB 3FTZA 3SJVE 4OLYH 5D2NE 3ZO9A 3O41A 3E9UA 4TUOB 5GS0H 1IIIA 1MH5A 1MWAL 3LAFA 1RSYA 5GRUL 1MFBL 3ZLQC 5I6OA 4EIGB 1HS6A 5H35A 1LNUA 4F5CA 5IP4A 3E6FA 5LO7A 4JQIL 4MHHG 3MRDA 2I7SA 4GKNA 5EN2B 3MACH 5T1KA 5J13C 3VXUA 3L4WA 1XR8A 3EGXA 1M3IA 2HJKB 4PJIE 3QIUB 2WQSA 4LPXA 1CLCA 2IBZX 4G6FB 4D9LL 4K3JH 1U4FA 4QHLB 2CWRA 1J86A 4MJIB 1YN6B 2P28B 1CDJA 3I9GH 3IDJB 3QUML 1MDAA 5BZDB 5DQJB 3NCYP 2KQNA 3F7YB 4HEME 5C0AD 1MHPL 2FIKA 3T0EB 1F3DJ 3BH8A 3BUPA 1LO2H 4MZRA 1GH7A 4UINH 4JFWA 1UB6B 1H3WM 2DMBA 4ZG1A 5D96B 1EGJA 2XNAA 3K6NA 4RGNE 3U7AA 3TV8A 5I19H 15C8H 3L1OL 4FG6D 2PKDA 3H2PA 5ISZD 5BOPA 4WO4B 4XC1L 4WHCA 4Y5XB 3KNBB 4U31A 3ZKSD 5IV2A 3G5XA 3EH4B 4BFFA 4AC4A 1RUQH 5HJGA 2WNWA 4I87A 2FO4B 1NEZB 1UD5A 2R0LL 5E56A 1L3WA 3ZY7A 5IQ9B 1MHHB 2WXMA 4NHUA 4UDTA 5KUMA 4TV3A 5K9KA 2OSLB 4DJMA 4NZRL 1D5ZB 1IZKA 1CLOH 4HIJB 5FYLH 1H9DA 3LKOA 2XYCA 3EDJA 3RG1C 5B3JE 1G7IB 4NT6A 5GJSL 1ET7A 3FO9A 5C6TL 2X9WA 4G3YH 5IW1B 4PJXF 4DP5X 2MJWA 4Z95L 3SBWA 2QGEA 4FTVD 4U1LB 3DO3A 2DLIA 4NP4L 2V7NB 2OMYA 4U1JB 5EC2B 1I7TB 2NY0B 1SY6L 4LKXA 4MSWB 5T1JA 3PAUA 4IRSD 1OV8A 1ZAGA 5BUGA 1TJIL 5IVXB 3IVKA 1T7YA 3BP5B 5K9JL 3BP7B 2M83A 3IJHA 4NO3A 2Y6SC 4P07A 4M7LH 1PZ3A 4LCUA 2BVUA 3H55A 4ZFOL 1IAKB 1TVBA 3K6SA 2KH2B 4BRJA 5MEOA 5ID1A 1NCJA 2EACA 1PW3A 3FULA 1CDIA 2FBOJ 1N4XL 3TH3T 4JGMA 3OR7B 4QHUA 4FFZH 3F7VA 4ZUTA 2JELH 3BZ4B 3L4VA 1QHPA 3ZE1B 4UZUA 5T5FH 1UXLA 3WY1A 2EUZA 3V4VH 4P2RE 1NANH 4LU5L 4WWKB 4WI4A 2VDQB 2V17L 4Q6KA 5FA4B 4Z5RB 1L9PA 3JTTA 5F7EH 5HYFA 5D5MB 1TJHL 4LEOA 3GMLB 5CINL 1K72A 3QXTA 5TF0A 4QGTA 4YE4H 3QEGL 1WFMA 5MEND 4TVPD 2WWMC 1R5WA 1OE3A 3M17B 4ZUVA 1BQHB 3MRDB 3LCYA 1MSPA 5LAPA 4L1DA 3WEBA 3SOTA 3QPQD 2W88A 3CN0A 3H7BA 2EYTB 4CJ0A 5C0FA 1CCZA 3BP6B 1K2DA 2B08A 2OP4H 4K8RD 4L29A 3LKOB 4YLQT 5I1JL 2VJXA 2IV8A 2H47C 3PWUB 4QXUH 4Y8DC 1AGFA 1OK8A 2EEAA 4JZNA 5DJ2B 2H3NB 3KHOA 3BUQA 4GRLB 5IR1A 5KBNC 5T1MA 2QGDA 3CQPA 1AI1H 3FU7A 4WW1B 3RVVD 2IJ0C 1PL3A 3ECBB 3X1NA 4R7DA 1T0MB 3OHXB 3FXIC 4RFNC 5IVZB 3BP5A 3EYUL 3V6FA 2YAFA 4CN4A 3TWCL 4S1SH 1K8IA 4NO0B 1YEEL 5I0WA 1CBVL 4FKHA 4IU3A 2BHZA 1AHWB 3Q48A 3X3FL 1G0DA 1BXXA 5DD6B 1SN5A 3FO2A 4K5OA 5I8KL 5AVYB 3H3PL 2PYEE 1JZ2A 4WV1A 4NWUH 5GZNC 2W95A 4PCTA 2ZCKH 5SWSB 2C26A 2VM4A 4IBWA 4HIIB 3EO1A 4LGPB 3BPNC 4IJ3B 3VD5A 3CCHA 3HFFA 2GHWB 3CSPA 4Y9BA 2X89A 5C0CD 3G5YB 4MDIB 4H0GA 2BW4A 3C6SB 1Q1PA 3DX4A 1FL3B 3N55A 5DWUL 3H0TB 3KPSB 5JPNB 1URIA 1SXZA 2Z0BA 2FSEA 1JWUA 5AQ0A 3QQDA 1FVDA 1KXQE 3FOMA 4NCC1 3QNZA 4X98A 3VFTA 4Z3HA 4NO5A 2DW5A 3C8KB 4WWOA 1L0QA 4ZO6A 2AMUA 2NZ9D 1AIFA 5DC2A 4AQAA 4F57H 5JUEH 5CIPB 1C5BL 2OR9H 3ECUA 3Q43A 4PBDA 5LCVA 3WNJA 4G5ZH 3V8CA 4Q9RL 3T0WA 1M57B 3VH8A 2B8OT 2VLKD 4JDTL 4OV5B 3EIFA 3G5VB 4GG8B 2AJVL 3FO1A 3KPRB 3RA7H 1I85A 1NC4A 1NDMB 3RY4A 1ZANH 5I71C 3NFSL 4A7GA 4GUOA 4PJ7A 3I75A 3ILEA 3RGVB 3SY0B 1MUJB 4BQ6A 4PJ9B 5T1DH 1HNYA 1JCVA 3R0NA 1FJ1B 2HCZX 4QCIB 4KXAA 1AXTL 1FZJB 2V6HA 1XGQA 3F3HA 1EEQA 3B2VH 1IC4H 1HCYA 3CV5A 2D3NA 3KYMB 4N9GA 3TLRA 2DQ6A 4LVNB 1IRAY 3D1MC 3E80A 4FE9A 4D9LH 3DX6A 1W9XA 3ARZA 3TFKC 1JGEB 2DRUA 1MCJA 4AYFB 5ES4B 2BIHA 2FJGA 4LDOB 4XZUB 4LEEA 5E2TL 1LP9F 3LQAL 4MDIA 3IJYB 1R5WB 4NQXA 4UTBL 2A73A 5CJQL 4YHKL 1G7HA 5BRZA 2R23B 2J8UF 5E24E 1KPVB 4L9LB 1JWUB 4MJ2A 2HUEA 3CC5B 3VW3H 3PYCA 5KYXB 1CICB 2BLFA 2G3MA 2XTJE 3LPGA 4JDEA 1N26A 4RGOH 4KK6D 2ADGA 3WUWA 3U0WH 1UWGH 1D6VL 4LZKA 2Y3NA 1TZ8A 1DQDH 1DVXA 2A6DB 3JV6A 4TNWF 2DOCA 4QHNA 1VFMA 3B5GA 3P4NA 4UU9A 4JY5L 5EG6C 3MV7B 5ESVB 3B2PA 4P4KC 5KVFL 3V6FB 2W9DL 3IXAB 3L3IA 3B2UC 1TQSA 2JTYA 2VR3A 1KUMA 4WKZB 3HR5B 5AL8A 1D9KD 4F8TA 3SDDA 3FT4B 2AJ3A 1X5HA 2NDGA 1ORQA 3KDMA 3S5LA 5I75B 2X2YA 4X5RA 3V5KB 2YBRA 3LSOA 4OZ4A 5HHMD 3FB8B 3LN4B 3KPPA 2JK5B 4P3WA 3QSKB 4FYSA 1C12A 4IGBC 3QZBA 4U6YA 2MTPA 4TSAH 4FD0A 3DVFA 2P7TB 1E9QA 1YY9C 5JHLL 3QZLA 3W56A 5CFAA 4YFDB 4QPEA 2ZOLA 4Y4KD 4YHNA 4JFVA 2PCXA 3IJ7A 4YK4C 1J48A 2QPDB 3ZE0B 5EN3A 5DA4A 5DJ6A 4DTGH 2E7LC 3HZVB 3P3RA 3N0PB 2FHCA 2V2XA 5KVDL 5DWPA 3HMWL 4GI6A 1U58A 3B7TA 1EMTH 3KLAB 3QZWB 1I3RB 4LKCB 1PLGL 3BJLA 1JUFB 3MJWA 1NJ9A 3LIZH 1GOFA 4GSDL 5DRWA 1T1YA 1FC2D 4WF7A 1BEYL 5FYKL 3STLA 3NK3A 1JGLL 4RWHA 3H2QA 1ACYH 1JXDA 2Y0SA 1M1XB 3DJTA 1JV5A 3HNVH 3B2VL 4OFDA 1MFVA 1XGPB 3V2AR 3CXFA 4P23D 3VXMB 7FABH 1DL7L 3MZGB 5JW3H 1WCBA 3BGFC 1YLBB 4C83A 1PX4A 1GPOH 5GJTL 2BFGA 1QRNA 2NY2B 4RZCB 3C5ZC 3C60B 4WK4B 3A21A 4K3DH 1ETZB 3BQUC 4YPGB 4L4TE 1Z9NA 1UG9A 1KGCE 4JY5H 1DQKA 3HCVA 2EE3A 5I1HL 5D8JL 2ATPB 1OAQL 5FV2A 1R0AL 1RIVH 3PWVA 3JV4A 3KGSA 3OAUH 1BWMA 1FFPB 2F68X 3PHSA 5E1GA 3KWUA 3DX0A 1JIBA 3QJTB 4AVIA 1IAIM 2VRQA 3GZKA 2UXTA 1D5XA 2C9VA 4ZD3L 1RZJC 1AH1A 1BM7A 4L3EA 3NACH 2E27H 4YHMH 4YGVA 1J0KA 2H32B 1XGTB 3U4EA 2NX5D 3E3QC 3T0BA 1HC1A 3AWEA 3LQAH 1AP2A 3B37A 1FN4A 3EH2A 4N87A 4TQHA 3F01A 4HIHA 4OJEH 3REVB 2WO2B 1XSKA 3V4PH 2AP2A 1A9EB 4NFBA 4PGDA 1KCWA 1IE5A 3MRNA 3HN8A 3IKKA 3FT0A 1UA7A 3TTYA 1Z5HA 2MQCA 1WP6A 2IH3B 3OZKA 4F2ME 2ESVB 3NGBB 4M48L 5F7FA 1I7RA 1RIUL 2ADIB 4XP5H 1F6AA 2HVKA 1P2CA 1KGIA 3M1BB 3BLPX 2DWXA 2A4EA 3DGGA 2QQQA 4HDIA 5CU9A 4MRBA 3O6LL 1H8LA 2J4WL 1CFSA 1KN2H 3C5JA 3CFDA 3NFSH 4OF0A 5HGGS 3OPZL 1A25A 2BNQB 1QO3B 2APVA 2EUXA 5ESAB 4GOSA 3C6LC 1UD4A 1TZGH 4JRWA 1PIGA 5EU7C 3WNOA 4YHNB 5A7EA 3QB7C 5DHEA 2XPZA 5SX4H 1UUSA 4R26H 4N2DA 3MRIB 4KAQL 4HKBA 4DCQB 1MFMA 5JIQA 2FIKB 3RWDB 1FVCB 3CDGB 4HJSA 4JZOB 3R7RA 1G7LA 2XKNB 2Y2YA 2YJLA 3MNZA 4XP6H 1MF2H 1DBJH 2PN5A 4PJDB 5E5UB 4Y19D 3CJJA 3HZMB 2NNCA 4KH9A 4ZMLA 5CGYD 4WW2B 2WM0A 4LLAA 4X9GA 4BFRA 3BT2H 2NX5B 3GZPA 4Q52A 5TGBA 1WD9A 1CVSC 1UT9A 3QARA 4Y1SA 1X5GA 3ZL4L 2CXGA 4BUQA 4GKZA 1JGIA 1IKFL 1GMIA 2HJFA 4EUPH 3DVGA 4G8EA 3P11L 4LOFA 1RJZA 2X9YA 2YXFA 1NIEA 2W9LA 3FBKA 5FPIA 1QZ1A 5DK3A 4F33A 2J44A 3EOTL 1XR8B 3EGXB 1QEWB 4Y2DD 5TQ2L 3RQ3A 4D94A 1CL7L 2PCFA 2V3EA 3ML8A 2HJLA 1X5YA 5DHYB 3D0VA 3VFPA 1MCOH 3I74A 2FX7H 1PVHA 2ICWB 1IGMH 2MNJB 3DECA 4NWTH 3ES6B 4HH8A 5ALCL 4D0CB 4DEUA 1RUAH 1RZKL 1BQRA 4XTRD 3RUGF 2NNAA 3BOVA 1F18A 3UTTA 4LCUB 3DARA 3I02B 2V2WB 3RAJH 5TE6L 3OKMA 1WT5A 3IDNA 1QRKA 4OCRH 5CZRA 3QVAA 1ZT1B 4C56A 1A4AA 2Z92B 2MCPL 5I16B 2NPLX 2DQGH 1YO4A 1YPZE 3VWJB 4BKLA 4JFDE 1IFHL 4ISVA 3WO4B 5BO1L 1PG7X 3U83A 4QMEA 2CHDA 1XIWB 2DWDB 1MJJB 1F4YL 3KBPA 2CCVA 2DTSA 2JKIS 3U4BL 3IJSB 4YS4A 1G6RH 1KXVC 2WXKA 3O3UN 3EH5B 3SE8L 4KUCD 4B50A 5JQHC 1JZIA 1YNKL 3CQFA 1A3LL 4Y5YB 2X4NA 2IPTH 3MV8B 4JFPA 4ODBD 4OJAA 1P1VA 2VDMH 4MAUL 4XMKH 1OTSC 4AKOA 1G7IA 4G9FE 1TJGL 2YFOA 1WS7A 4HT1L 1JDCA 1YEDA 3VI4B 3BPNB 4IJ3C 2YLHA 3DXAB 4HK3N 4CDHA 2Q2EB 2XN2A 1J0ZA 3VXRB 3MR9B 1VEOA 2PCFB 3QDME 3E1F1 2J3SA 2Q3ZA 4GRLA 3VM5A 5IR1B 3L4XA 4TNVK 1WS8A 2ICWA 4BUGA 1FSKB 4FULA 3HC4H 4DGWC 1ZEAH 1LP9A 3N91A 3QXAB 4IOIB 5CZXD 3T1FB 5HDQH 4Z23A 4ZK8A 1H15B 2NXYD 1D9KB 4OW6A 1E4JA 1ZA6B 3BXNB 5T33L 5GS0C 2AXJA 4L1LA 4XB8A 3BAEL 3BZ4A 3EBIA 5DK0B 3SOBL 3IJ9A 1G7PA 4U3XA 4ZDHB 3N2JA 2EKJA 2RR3A 3ESVF 2I27N 2NW2A 3NQIA 5GIRB 3S5YA 1VEPA 3WE1A 3NRFA 2AZUA 1OW0C 1URZA 2DBJA 5GSVB 3UG4A 1U33A 4GAFB 3RFZC 3ZDZE 3UOAB 3D34A 1N0XL 4UQEA 2EVIA 2H32H 3VO0A 4ZODA 5L8JB 5J4MA 2QT6A 2VDOB 4G1EA 3C5XA 3O6ML 4ICXA 1L3NA 3NPSC 4AIZB 1IFRA 2LOEA 3HW7A 4TUOA 3H7BB 2DYPD 4OJFH 5EBGA 3HBZA 4CC1A 5LGJA 3TZVD 2AKRA 1LEKA 4QNPF 3BSZH 3B56A 4EI0A 1DHKA 1GKEA 2FE0A 2FJHB 3HI1B 3M86A 3P0VL 1I82A 2X2UA 3V4PL 3CDCA 5HYEA 2BSEA 3G6JF 1WCQA 4KV5F 1A6UH 4BSJA 3BH9B 3VXSD 1Z0NA 5KVDH 1FHNA 3L08A 3SD2A 3PWJB 4LIQH 5I74C 4GAGL 1FORH 1FCGA 1UZ8B 2Z1KA 5CLTA 1FP5A 4KQ3H 1HZHL 4R2GB 4RQQA 1HKLH 4HUKB 4XPGH 1U8KA 2CLVB 3RNQB 2KERA 5HYSA 1M7IB 2APFA 5KSAD 1H0DB 3WGUB 2Y6TE 2FL5A 1MCEA 5FM5M 3KLSA 4A7VA 1EWHA 2E7HA 1MWOA 4LLYB 4N3UA 4E0RA 3MRCB 3EZJB 5FXCH 3L81A 1I9JH 4M61B 3QULA 4Z7UB 1S7SB 2HMIC 3ELAT 1OQXA 4OB5L 1QKZH 3QCUH 5FO9B 1EBPA 2EIEA 3MN8A 1UD6A 3TBCA 4AYGA 4N0RA 2BY1A 4GINA 1NFDA 1PD1A 1TTAA 2A7BA 3T3PB 5LGYA 3VQ1C 1S9VA 1EBAA 2R1XB 1IGIL 4TNEA 1QVOA 2Y7LA 3CLFH 4XHQA 5DVOA 1CQYA 3EHBD 3BE1H 4I48A 5HYJA 4HEMA 4LAJH 4M6OL 4KUCF 1EXHA 1ED3A 3NPZB 1ZGLP 2QSQA 1FBIH 5ITFA 3T3MF 3FC8A 4KK6C 4Y1AA 2XV6B 2YR3A 5GZOA 1VPOL 1Z32X 3MROA 2B39A 4TVUA 4R84A 2P7TA 3GXDA 4IIZA 1KB9J 4KRPD 3O4LA 2NY1D 5DJYB 5F0MB 3GK8L 3AS1A 3VXQA 2WY3B 2BP8B 1QSFB 5JOEA 1FAKT 2DD8H 2XWDA 3PHQB 4XNBA 5AL0A 3SY0A 5EU6E 5HGAA 4HMCA 2YEVB 1P6AB 2MMXA 3I85A 3L3GB 4G1MB 2GTZB 4WCYL 5B8CA 1KBGL 3FTUA 4I3RL 4N2GA 1UCBL 5E9DD 1CFNB 4HOWA 1KTDA 4P48A 1KULA 4HC1A 2A6IA 1OKEA 1UTDA 1BAFL 5LNDA 1V3KA 4R0LC 2WQUA 5DRWB 4UDUB 1P1ZA 3FB8A 5KVFE 4XNYH 1DJGA 3WKPA 4N26A 2O5XH 2ILLA 1O9ZA 2K4WA 4LASL 1EVUA 2YAMA 5JXEC 4PJ9D 1PZAA 1YEJH 1S9VB 3APDA 3ARGC 5B38B 4URKA 5E95B 2JF1A 5TF1H 3OX8B 5JXEA 4QTFA 5MEQB 4LL1A 3HC3L 2O4EA 2X4TA 4HCGA 3WJJC 1SEQH 1WD8A 4MJ5A 2FEDC 1TMQA 2Y06H 2D2CC 4AL8C 3SE8H 5D7JA 3RVTC 1A64A 3QZWA 2H1LM 1JHLH 3BKYL 4BH7B 3FH5A 4GG6F 4KH2A 3B3IA 1H8OA 1OE2A 3FOLA 4GW4B 2PTUA 1M6OB 1HHHA 1M05A 1JV2B 1ZHKA 1A7RL 1HCFX 1PFOA 5CEYB 1E4HA 2HLAB 3RDJA 3FRPA 2P8PB 3MRFA 2CDGA 2HLFC 3SKNA 5ICXB 3BFOA 3GTVA 4NQEA 5H37H 3VCLB 4QXWA 3U36B 1JVKA 3A67H 4YDJB 2ZCKL 4G8GE 2WUBH 3DOHA 3WFDL 4GAJL 3VXSE 1GGBL 1ZLUH 3UDWA 4NRZB 1QTPA 3BKMH 3VXTA 3CU7A 5PCYA 4QO1B 5FO8B 3IMBA 1I7ZA 1WG3A 5DJAB 1RK1B 3MBED 1CE6A 1TFHA 1A1OB 1ZT4A 3CXHJ 4MA7L 1MN4A 4JFFE 3FTGA 2WXNA 3C8KA 1MI5E 5C0GB 5FGRA 3AW5A 5CGTA 4Z7WB 5DD0L 4F7PB 1IKNA 1AY1L 4TTDC 2F74A 1UM5L 1ROCA 2WQ8A 4AT6B 2QJDA 1Y1UA 2H6PA 4FHKA 3Q6GL 2IOMA 1HILA 5F70A 5HGAB 5EEUA 3GIVB 5CR8A 2VUOA 3FTXA 5DJXB 3HVDA 1IFHH 4JFOA 1U6AH 3ET9F 2PW1A 3LTVA 4K94H 3ISYA 1JZGA 5D6DA 3ZSSA 3S3JA 3BUIA 4XOAA 1QP1A 2UXFA 2WKLA 3QUZC 5F3FA 1ONQA 2EJ1A 3FKUS 4TSCL 4JCMA 1F6AB 2CBOA 4TLUA 2FO8A 1HCZA 4GS7B 3P4MA 5SWQA 3WD5H 3BESR 3BCDA 3NN8A 1FNLA 3S7GA 4AITA 3HNTL 1RLWA 4L1TA 3FCSA 4O4YL 1JK9B 5EO0B 4RMWA 1CGSH 1KFAL 2UZXA 4I9WD 3U7WL 4PJFB 4XPGL 5D2LE 1SGKA 1E27A 2AV7A 4G8GB 5L6YH 1AE6L 3VM7A 3QIUC 4TTGA 2V37A 5EU6D 3PUUA 4MQSB 1MCNA 4E42A 5A1AA 3RVXC 4CJ1A 1GIGH 4XXWC 4MA7H 3RZWA 1NCIA 4EQ2A 1QPKA 2CBQA 4AYEC 5C0FB 1K4DB 4PV9B 1Q38A 4WUUE 5TFSL 1QSZA 3CHOA 5HHXH 5EO9A 3RFZA 3CDGA 4XVOA 1OW0A 1FG9C 4YIQB 4P2RB 4MB3A 4JG1H 1WIUA 1KIPA 4KI5D 2QEJA 2N0KA 3D6GA 2DQFA 3TM6A 2FDBP 2VN7A 3ZDYF 1NCUA 5C2UB 4PJAA 1G1YA 2AABH 3NSDA 5L2JA 4MMZB 4U6VL 3NRPA 2NNAB 3QI9D 1ET8A 2NY3C 5E94A 3ULUC 3NZHL 4LLQA 1E28A 1KCRH 2VN5A 3J7HA 1PKQA 3D08A 3FO0L 3G08B 1K6QL 5I0XA 4JFOB 1Q4NX 1DEDA 2VN4A 3T2LA 1N0XH 1NOAA 2F7OA 4BKTC 2BIIA 5JHDB 4AEFA 5KN5A 2IWGA 1WWBX 2P44B 3KDMB 3BN9C 2DQTL 3CVHB 4P59H 5IVXE 3OSKA 4JKKA 4NUGL 3VFVA 4W70A 4I85A 4ZMYA 4GG6A 3WEOA 2IIJA 4RRPM 2L8AA 2EH8H 1KY7A 3ALXA 5AG8A 4N5ED 5IT2H 4OJCA 1BZ7A 1XHHA 1DJZA 1KB5A 4AV0A 4Z76A 1G9MC 4GQ9L 1AGBB 4IRSB 3UG3A 4F9LC 3GO1H 2NY4C 1F4WH 1CE6B 1RP8A 3OB0H 1AQMA 2IWEA 5EU3B 4PRID 5CS7A 4KJWC 2BRRH 1JI2A 2VDQH 1FLRL 4UT6H 1BAGA 1XV8A 2X88A 3PJLA 2ZSVB 3QNFA 4P99A 5HDWA 2CRZA 2DEWX 5HHOE 1BFTA 1DN0A 1WAAA 2IAMB 1U2YA 4PJDA 2MOGA 4Y8AA 3LEVL 1YJDH 3RI5F 1Q1JH 3RX5A 4QTIL 3FO1B 3TEWA 4JLRA 4PIBA 1MOEA 1J5IA 2PR9A 5DLML 4U3SA 4YXHH 3FU6A 5AVSB 5ABZA 1ETJA 2BCKB 4NQUA 1WT5C 5DJXA 1BAFH 2ENQA 2R0WL 4WO4D 1D9KC 1V8HA 1GMEA 1DCEA 4KMTL 3ZXAC 3DOSA 4OFIA 1PZ5B 5D1ZD 4ZTPH 4DK3A 1QSFD 3SEPA 5G55A 3ZE1F 4HHWA 4LAQL 1QFUL 2EVHA 2YD5A 4YL4A 5F88A 5IY5B 1NBCA 3MLSL 1HI6A 1JGEA 2PP8A 2WK2A 2GTQA 2QADD 4FL4B 3FQNA 4ZO7A 4PSRA 3CSYA 2FZ3B 5SWZE 4MXWL 5HGHB 4QRUB 4ZUSB 1D6EA 2AQRA 2ADJB 2O6FA 3QQNA 1BZOA 5AW3B 3KZ8A 4AIEA 1PS3A 3KVQA 4JFEB 3UADA 4IEFB 4XBPA 3AU1B 5EF0A 4F80A 3II2A 4M8RA 2ICWJ 4LARL 5INCB 4UIKL 4ZJ9A 1L6PA 2XWXA 5CILH 2NMSA 3TN0C 1BSIA 1DJSA 2AJUH 3KD4A 4M6NH 3WIHH 3N44F 1FFQA 4U05A 1A5FH 3N1QC 3QUMH 4LKXB 4MSWA 1RZ7L 4GUPA 2P43B 4OAWA 4LF3B 4PP2B 1QR4A 2Q3AA 5E4EC 3B7YA 3C12A 4OKVA 3TV3H 1LMKA 4HV8B 1J9CT 3IBEA 3PL6B 3HUJA 5A2JH 2Q8AH 4LHJB 3QWNA 3GBLA 4LDEB 1LVEA 5AZEL 4EZKA 3UTTD 2QVKA 4HXAL 3RUGA 1NCAL 2A83A 1JAEA 5AW9B 2NY1B 1P7BA 5FM8A 2R51A 3DV4B 1EEYB 3ROOB 3E1ZA 4OIIL 3IDMB 4PFEA 4WSJA 1UA3A 5EU5A 3O9WA 3MREA 3VFMA 3D9AL 2I85A 1DQLL 1L7TL 2ICEB 2Z0UA 5IHLB 3DJRA 1P2CB 4M1DL 1KBGH 3BKCH 2OL3B 3N41F 4YHOH 1U8PB 4Q0XH 3DO4A 4P57A 5IBUB 4KZDH 1E3FA 4OCXL 1P4IH 3WDJA 5A2KH 4I0PD 2IDCA 4B6ZA 5I1AA 3GKWH 1X5FA 3SPGA 4F91B 3H85A 5T3XD 5CJOH 4JY4B 2G3XA 5ITBL 2BOBA 1A7PH 3MX0B 3MYZA 1OTTC 3ARQA 3K7UA 5F7DA 3HZVA 1MNUH 3ML9A 2F7RA 4UQAA 1WA0X 3K6SB 4GT7A 5C0CB 4LO9A 2XQYA 2G2RA 1MIEL 2BZDA 4YSPA 3GRWL 4YO0B 5T3XE 1M7IA 1N3NB 4PJ6A 1OARH 1KCBA 1D5BB 4YR6B 1I9IH 1P6FA 5KSVB 5DS2A 5IMOB 5DJYA 2DKUA 3AM8C 3WIFA 5AOMA 4Q97A 3QJFB 4RH4A 2X87A 2AERT 3CN1A 4S1QL 1IM3A 3LB6C 3M07A 2JJSC 1UEYA 4C8XA 1IGYA 4JREC 4NM8L 1Z1WA 3OJ2C 2DQJH 4FYTA 2Q2LA 1CO1A 2QZ5A 2ZUQB 2QMJA 1H8SA 1LEIA 2GITB 1MFDH 4UOQA 3K3QA 4ANVA 4AQ8A 2X28A 3FUJA 4EQ3A 1U8MA 2MPVA 2BS9A 1F90L 1E5AA 2VXTL 4P2CG 5AZ2H 3CSYB 5HJ3A 4FS0A 5A2BA 4ZOCA 1ETZA 4TSAL 1BDYA 4XPBH 1G43A 1OPGH 1KGYE 3LV3A 4WEEA 5KG9A 2B1OA 3VXUE 2VN3A 2YLKA 2WBJD 3Q1EA 5T5NF 3L5WB 5F7AA 1SPDA 4QY8B 3AGWA 4O9HL 2UWEE 5DFTA 3LX9A 5B3JF 1E0OB 2CO7B 3L48A 3NCMA 3BGMA 2VDQL 2AQSA 4JFQB 5EA0H 1SN2A 4UTAH 4JFDB 4R3SB 4UIKH 3VGEA 1CS6A 5C07E 2C3WA 2XOTA 4JFEE 4QOKD 1BVKA 1CYWA 1ZJAA 3VXPB 4AXWA 3K71B 3QIBA 3I3BA 5DC9B 4BINA 4E9WA 3KL5A 1WITA 4R90L 3QDGB 4L3AA 2OMBA 5HGBA 1VZGA 2O6CA 1SXAA 1QWUA 5CXPA 1IGFL 4P5MA 5KVDE 2ZD0A 1SUHA 3MRKB 2L3BA 4FNQA 2J6EH 2CNYA 2YN5A 2HG0A 3V0WL 4N0UB 5T3XL 2BNUA 4PJ5B 1MQKH 2DQTH 5IJKC 1I8AA 3WLWD 1G9ML 3EYQD 1KTJA 3TIDB 4LRNL 5BS0E 2GQHA 3KPQB 1UEMA 2XN0A 1BMZA 1S7XA 2A6KB 3MBXH 4AWJC 3HJEA 4KY2A 5EFIA 3CSFA 2FWLB 3BEVA 5ANMB 1ED3B 3ZMRA 1JHTB 4GSDH 3GKZA 2EIJB 3TONA 4MYWB 1TTUA 5ICYB 4Z9KB 3IF1B 4JE0A 1QPXA 3MROB 1C16B 4KZDL 2W07A 1DEEA 3PF2A 1XF3A 2LVEA 1YA5A 4AQAB 2HH0H 4NQCB 3IRZA 2OSWA 2YRZA 2HTKC 2N7SA 4DTGL 5F6HI 1VEMA 3TF7C 5IFAL 2CLRB 3RIFK 1KTBA 3SYAA 2DI9A 4QHLA 1WC7A 3GXUB 1E4XI 5JXAL 3L16A 3L95B 3VGHA 2K3TA 4HPHA 3QAZC 3PP3H 1WUZA 2F53A 2IBGA 2ZKXA 5AUMA 3UPRB 1INDH 5IVXF 4ZOBA 5DQJA 4KHTL 2BOLA 4RX4D 3PDGA 1ADQH 1Z9MA 43C9B 5CEZE 1FZJA 1I3GL 1U3YA 2CPUA 4CSPA 5HY9B 4LDCA 4YDKH 2YD7A 3FPXA 5DK0A 5E4AA 2COVD 2QFRA 4FEIA 1JGVH 4NQCD 1OO2A 1M53A 2AQNA 2B1AH 3BD5A 4LHUA 1RZIA 3UAJA 3EOAB 1RV6X 5EC1A 5FOJA 3REWB 5IJBC 2IWKA 4Z95H 4F3FB 4QKXB 4GMTH 3O2DA 4OZIA 2XPYA 5CMAA 5F1NA 2Z8WC 1ORQB 5EOCH 4OT1L 3WY2A 4GRWH 2V5SA 3P73A 5DSCB 4NQXB 4YSDA 2QPFA 5C70A 4KTEL 4JHVA 3ATAA 1DE4A 3MA9H 2WYHA 3SKMA 1RK1A 3IETB 4KPHH 1E42A 4JZJC 4FQQB 5D1XD 4MJ5B 5FGBC 1FFOA 1DUYA 1EUTA 4ZFQA 3CAFA 1IB5A 5J57B 1MREH 3GS7A 1GZHC 3QCVH 4NM4H 4ONGH 2XVLA 5H4ZA 4XPHH 1JGUH 4UUJB 1JPST 4APXA 3I6LD 2Y1ZA 1V54B 1U8QA 4RGND 2XQBH 3LXUX 4MKTA 1YNTA 5AG9A 3CMOL 4GSQA 2ESVD 2FK9A 4LCCA 5DZNA 1FNAA 3EOTH 1F56A 3CVHH 3LPWA 1BBDH 3VRLF 5C09D 1N70A 1M05B 4M7LL 1IBHA 4Y5YC 1XGRA 1S7QB 2XLLA 4S1SL 1HSAA 2EDOA 4ZZFA 1BQKA 3UCQA 4H5SA 3PWPD 3QDMD 4LPYA 4FNSA 4FA7B 4FNLL 1UACH 4NQEB 5T5FA 1I1YA 4P4KB 1L5GA 4HJIA 4PJCA 3UERA 2NYKA 5D2NC 2LU3A 1WTGT 3POCA 5TDOA 5IB4B 1O0VA 1A9BA 3G5ZA 5KZCB 4LLQB 1LWRA 4WWKA 3CHQA 4KMLB 3RVVC 1TQBC 4M1CC 3JXAA 4HIXH 5JA8B 3NESA 4RDBA 2FHFA 5JMRA 4LEOB 4EN2A 1SMDA 3MLRH 4XP6L 1E4KA 2P4AB 3B2MA 1QA9B 4HKJA 4JQIH 1F1DA 2WB1A 1LO3L 4MB1A 3K6FA 5C0GA 5C07D 4FTVA 3EBGA 3EW3B 4LCYA 4YDLB 4KI5F 1N5YL 4NKMB 3RVWC 5IQ7H 2F74B 2OCJA 3L1OH 5DU7A 4S1RH 5IOPB 3C6EA 4XWOD 4WZ9A 5F9AC 2AHIA 3NBNA 4NUGH 1J1OL 5BXFA 4XR8C 1R33A 5CUSH 2FD6L 2X1PA 2ZWNA 4KK8D 4RMBA 4ENZA 5HVFB 1NBYB 3QRGL 2BSRA 1YYMH 1RJYA 4LB8A 5E5RB 2GKIA 5F3HB 5DVKA 3S48A 1A3RH 3HG1D 4W9DC 1U8JB 2DQHL 3ETSA 4PJ7E 3CX5J 1KV7A 2Q7AA 2QMKA 4YGVB 1OT1A 3G08A 3K81A 4AL8L 4DAGH 4F7TA 2NNXA 1FYTD 3T09A 4DQOL 4YFEA 1S7QA 1HEHC 1QTYT 3HLAA 3K8LA 4XN7A 5I71B 1FIEA 3FHAA 3NA9L 1S5HB 4LLVB 1FNGB 5IREA 5IFAH 3KDPB 5CJOL 2EC8A 4FQPA 4Y2OB 3TF4A 4B3VA 4Q6IA 3RTQC 5AVWB 4F3FA 1VLXA 3FT1A 4FQJH 2PMZA 5E1AA 5FHAH 2KZWA 4DP1X 3FJTA 4L37B 1NEZA 3VGBA 1NEZG 3ULVF 4XPBL 1YNTF 4DW2L 5CN3A 5F88B 4ZW3A 2QR0A 3BKJL 3CDFA 5I76B 5FW7A 1S5IH 1P7QD 2CSPA 3BQUB 3DX8A 3IGAB 4J8RA 4PRNA 2HKFH 4OM0H 5LCVH 4X7FC 3CFBB 3AWGA 3HG5A 4UTCA 1PZUB 2GK0B 2FLBT 5I1JH 3OAUL 1W8EA 4S1RL 1P4BH 1HN1A 2YPKB 2JKNA 3C5ZA 4M7ZB 3CBJB 3RP1A 4ALAL 4OIBA 3IGLA 1JNHA 5SX5H 1RZ7H 2AVFA 5D1ZB 1RZPA 2WC7A 4QYAA 3JQOB 4FERA 1E6JH 2YXWA 3LZRA 1Z9PA 5TF1L 3P2BA 1UZ6E 3O4OC 5AW7B 2FX8H 3FSOA 5D4QA 3UBXI 5JLZB 1LO5A 3RB5A 1IEAA 2XN9B 4O2FA 5AEAA 3VXRD 1GL4B 3ILQC 5CEZH 2ZPKL 1KMGA 2RCSL 4O51B 4ZS7H 4XP9L 3ISRA 2R56L 3BAIA 1JHKL 1WTLA 2VXTH 4FLHA 5C0EB 2WWNA 1SXBA 1CTOA 2C34A 2LT9A 2OJZL 3L5XH 2EAEA 1HQ4A 4KJQC 3R1GH 4LLMB 2BSTB 4NOFA 4WHYG 5FYKD 2H2SD 3FUKA 4DK5A 1GW6A 1MFBH 1D5IL 2AEIT 2WO3B 3OQ3B 4PREB 3UABA 3WFBH 1OTUC 2HA1A 1MCSA 1FH5H 4FQHA 1UOVA 2X4PA 4PQXA 4XAWH 3TO4A 5BMFL 3UO8B 5FDWB 3L3KB 3EYOA 4J3SA 1JGUL 3QIWD 4PRPA 4B53A 2XZCH 4OZHA 3TA3C 2IFFH 1EJOL 2J8OA 5BW7C 3QRFM 1HHKA 1EXGA 2NLJB 2MIZA 3BPCA 3VFSB 3X14B 4EVNB 5CKAA 2MNWA 2BK8A 1BFOB 1A6TA 5FKPB 1A14L 5J6HA 4WNQB 2NUPA 3MUJA 2EXWC 5E8EA 3EO0B 3S37H 1F6LL 1HSBB 3V0WH 2X70A 3QAQA 1WWAX 5I16A 3KLHD 1G1CA 5F1KC 4QDGA 1O7DC 1IAII 3IFNH 5MEPB 2ZUSA 4XN5A 3POHA 1I8LA 5CBAA 5I1IH 1NCBH 4QRUA 1P84K 5KVGE 4JDTH 3VXNB 2J8UE 4FN0A 1UYWH 4ZPVA 4BA8A 2IH8A 4ALAH 2ITCB 4MWFA 1W8NA 3AY2A 5D1ZA 1EHNA 3G6AA 2VDKL 3QQDB 3SJVB 3X2QB 3WNPA 4X8JA 4TQEL 2AJXH 4H4NA 3PXLA 3PJSA 1MG3C 1U8MB 3T77B 5EPMB