4Z3JA

Crystal structure of the lectin domain of papg from e. coli bi47 in space group p1
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
196
structure length
196
Chain Sequence
AWNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPGIATVTWNQCNGPEFADGSWAYYREYIAWVVFPKKVMTKNGYPLFIEVHNKGSWSEENTGDNDSYFFLKGYKWDQRAFDTANLCQKPGETTRLTEKFDDIIFKVALPADLPLGDYSVTIPYTSGIQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PapG, lectin domain
publication title An unexpected way nature improves solvation entropy
rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
total genus 45
structure length 196
sequence length 196
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1370 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesin receptor binding domain 4z3jA00
1J8RA 4Z3JA 1J8SA 4Z3EA 4Z3IA 4Z3HA 4Z3FA 4Z3GA
chains in the Genus database with same CATH superfamily
4JUSA 2VITA 4GAYB 4LMQI 4AZ8B 1DSFH 3F3HA 3TBVA 2IBBA 3F7VA 1RHHA 4M6ML 2YWYA 3QSKB 4ZK8A 5E1GA 3BQUD 4HG4J 3LQAL 3B2UD 3LVEA 2IV9A 2WQWA 4M1GH 4XMXA 2X4RB 4HXAH 3VX0A 1M7XA 3GSOA 1YYCA 4MX7A 2I7SA 5CEZE 1RQ5A 4OJFL 4W9LC 5MEQA 4OLUH 4K8RD 5IB1A 1KIRA 2BNQB 5CAYB 4X5XB 2GBAA 2J44A 4XPFH 4ELKB 1XBRA 4MMXB 1YYLH 5AVVB 2VZOA 4RAUB 3AQDA 1TZHA 4AEHH 3FQRA 4Q4IA 4NN6B 5C07D 3MXWH 2Q5BA 3GRWH 2G2PA 5D7IE 1Q9LB 4K9EL 1M7DA 1REIA 2NY5C 2VMDA 2WWNA 2ZPKL 4MXQC 4TNFA 4AKQA 1CDIA 1BF2A 4X4YB 4BIKA 3MC0A 4D9QE 4FHJA 2F61A 2DLIA 5BQ7B 1U33A 1R3LA 1E6OH 2ILLA 4PJBB 2CUMA 2EUVA 3MROA 2OYLA 1RVFH 4A2EA 5GGVL 5E8DL 3X12A 5D7LE 5IEHA 2G9KA 1P6AB 4UCFA 3UAJC 4ETQB 1L7IL 2BP8A 3UTPD 1QSZA 5DTFB 3UBXG 2K78A 2DDQL 2CIKB 4JR9H 3V4PB 3B2PA 4AQ1C 2GK0A 4NKMB 1HSAA 3QFDB 4LKCB 4W9DC 2N4IA 3IFOB 5T1KB 1EDQA 3MRHB 3TFKC 1I31A 5ITFB 4DTGH 1BG1A 5BV7L 3WFDL 4AGQA 4XR8C 4XOBA 3CVHB 4FRWA 2YC1B 4LP5A 4MXQD 3KYKL 5AOZA 1HIML 4R97B 5D1XC 3ZHFA 5T3ZD 3FYEB 1HZKA 2YBRA 1K8IB 3D50A 2XY1A 1OGAB 2PCYA 3ECBB 3HCVB 1AQKH 5ESVB 4A2LA 2DKMA 2B8OT 4C4UA 3T2NH 1YNLL 4HXBL 1T1WA 1HE8A 3GO1H 4AE1A 1NINA 1QBAA 3VFVA 3UAJD 4ODUB 1HWHB 3MCKA 4V11A 1PY4A 2PYEE 2I5YL 3BKML 3IJ8A 4OF3A 5A7EA 5EEUA 1YPZF 1IGTB 4OLVL 5I24A 2X2JA 5EUOA 2AJSL 3DX9B 3JYCA 3FUKA 1ACYH 5DHEA 3FTWA 3B2MA 1HCYA 3U0PB 1O9ZA 3UBGA 3S9DB 2VXVL 1NC4B 1TU2A 3ZTJG 2LOEA 3TFKD 1J12A 1XGQA 5AKTA 5JPNA 4I3SL 1X3DA 4WY7H 3WNJA 1JDCA 5E95B 3LZRA 3FT4A 5D1XD 3VXRB 4YHLL 2CDFA 4ZXBC 3NQIA 5B7FA 4J1UB 2OKMA 3BW9A 5FYKU 1JK8B 4H25A 4AITA 1V3KA 4ODWA 4H4NA 3IPFA 3MV8B 4AXWA 1BM7A 3CMOL 4EUPA 5I8EA 3UACA 5IW6B 1I8KA 5E2UL 3IMUA 5C09A 1HL8A 5ISZE 3SE8L 3E2HC 3QDGD 3S97C 4KNUA 3TBSB 1TVHB 1UJ3C 2WMPA 4H1LA 2E6JA 5CCKH 3QDHA 3QEHB 4GW5A 3MREB 3DXAA 3FBQA 1P7HL 3QT2A 2AZUA 4NO3B 5L2JA 2ITFA 1A14H 5F6HJ 4DQOL 2ZKMX 2F53D 4NJ9H 4LL9A 4OZGB 3QARA 4AOFA 4HIHA 3CFKA 4X5LA 3QJQB 4ZXBD 1XZWA 5K5YA 5HHOB 2MPVA 3IRPX 4PRIE 2ENSA 2FBRA 3GM8A 1GKEA 4PM1A 2Z93A 4DETA 2WIIA 5DRXB 4O00A 5EN2B 4ECNA 1S9YB 2OP4H 3EDJA 5F1KC 1YMMA 2AGJH 2KPNA 4N0UA 1A9BA 2APXA 1ED3B 3EYOA 3QZMA 4IEFB 4NN7C 1JYWA 4L29A 1NFIB 5J57B 5DD1H 1E6JL 1H9VA 4H5SA 1S9XB 4HC1H 3UG4A 1NANH 4PJBF 3H7BB 2OQJB 3H9YA 3S3CB 3BFQG 4QRTB 2JVUA 2GAZA 3ILQC 4ACPA 2GT9B 5AENA 1ES0A 1EXUA 7PCYA 5DJ0A 2UY7A 3GEWB 4JFDD 4P5RA 3D9AL 3O2DA 4HLZG 2MIZA 4UDTB 4FE9A 4N8PA 4UIKH 1C8PA 3D18A 3C08H 3MUGB 5GS0L 1R47A 1G9MH 3L3IB 5AAMA 4DKFH 2IBGA 1IJNA 3VWKA 2PCFB 1MWAL 1NCTA 1CXEA 4HWEL 4MAUH 3FF8A 3KXFD 2BVUA 2V2WA 3W9DB 4OAWA 3D3VD 4DNLA 1Q0XH 2F54D 5DJDA 3BAEH 4DN4L 1R75A 3WO4C 1AS8A 3HC3L 1U93A 4NB7A 2H4EA 4ESKA 4N28A 3MKKA 1RAMA 5BRZE 3GSXB 1J5DA 1J9CT 1ZDQA 3ILQD 1M57B 4LSSL 4XPTL 1YNKH 5SWQB 3N0AA 1DLFH 4D7BA 2XQ0A 5JLZB 4UYQA 2F6AA 2XN9E 2MNJB 3HZ3A 4BK8A 2F18A 4YSRA 5TJWK 2B0SL 3X14B 4ATWA 3L3OA 1UH2A 4QXWA 5FWQA 2Y06H 3E7JA 3FN0H 1ZLSL 1CXFA 3IDJB 4H8WC 2BZ7A 4N87A 2AXFB 4WTZA 1BREA 3EH5B 3FTZA 4WHCA 3VCLA 2G4GA 4ZPVB 3WDIA 3T0XA 2YD5A 3QXVA 5I18L 4A04A 2IOMA 5ENWB 1J8HD 3TCLA 2PETA 5JZ7C 3O6FC 1GZQB 1CFVH 2C9RA 3C8KA 1NCBL 5F44A 4CGTA 4N2BA 4L8SA 4WUUA 2QZQA 1FYTB 3GSUB 4PVMA 5ICUA 1VHPA 4MHHI 4LVHB 1Z0MA 3OSVA 1E3ZA 1MEXL 2YPKB 5GRJH 3R1GL 2F58H 3DX8B 2FX8H 4ZO7A 4TTGA 2BCKA 4KTEL 1A66A 3L7EA 4KJWC 4LEXH 4OGXL 5IT2L 3BWAB 5DQDL 1FNEA 3O6KL 2D7QA 2P47B 4EOWH 2Z35B 1Q90A 5GPRA 4AJYV 2KBGA 4I2XE 1DQLL 3KDMB 2FD6L 2ZSVA 3EYVA 4OZGF 1HILB 5C07E 3TO4B 3A67L 4PRPB 1NM9A 4JNXA 1JV2A 3HHSA 4P59L 1PSKL 4DPBX 4DKTA 2DIJA 5JZ7D 4LOEA 3O6FD 1IM3D 5IHUL 3JUZA 1OAXL 3V6BR 3AITA 4LSRL 3B7RL 3RVTC 2DEWX 3CDCA 4PRAA 1AAJA 5GGRB 1S5HA 2MHAA 2PMZA 2ODIA 2AERT 2DQIH 1ETB1 3CDGB 3WE6B 4GRWB 1RURH 3FTVA 2QPEB 2XACC 4GP8B 4N2LA 1EO8L 3LXCA 3W0WB 2GFBB 2RGSA 3G3LA 3V10A 4UNIA 2IVFC 5FUOL 3ARDA 3LNEA 4BFKA 3L8QA 2LAGB 4KJWD 1U8QB 1ORQB 3QS2A 3V4VB 1GMEA 3MX0A 5C71A 2BP0A 5CKAA 3VFMB 3ZYJA 3LPPA 3QQ4B 4D9RD 5J9PB 4A7VA 3NK3A 5D71H 1JPFA 5CP3H 4YGAB 5A2KH 3DUSA 2Y3NA 2O6PA 4I18B 3TT3L 2X6MA 5JYMA 1KXQA 5IBTL 2WXLA 5I6OA 3RVTD 5FWRA 4OFVA 3RRQA 4JFYB 1R3KB 1S6NA 4WJKB 3X3GH 3B8YA 1HZHL 2WLMA 5IFHL 3RUGA 4RAVA 1E3FA 1TTGA 2NY4B 2KDGA 5EDXA 4NNYB 4AMKL 1P4IL 3LXAA 4K7FA 5JUEL 3D69B 3L3HA 3EJJX 3O6LH 3CFEB 3TM6A 1GZPB 4F7PA 1PJWA 3MGAA 2IFGA 4CKQA 1O6SA 3GM0A 4NCC2 5KG9B 5I1JL 4HCIA 4NUJA 1T3FB 3MA7B 2NCEA 2NY1B 5DZLA 4QGYA 4F1ZA 5F7EH 3CZFA 4L4VA 4YFDB 3N9GH 3BP7B 5D7KE 4GP5B 2BNRD 4YBQD 4MS6A 1MOEA 2OSYA 4AGNA 1WIPA 1KFAH 2H8PA 2JIXB 4DP9X 3KZ8A 5IBLD 4G6FB 2VABB 4TUOB 1LJMA 3RGHA 2ZKHH 3WCYA 3QDGE 2XBTA 3KDPB 3OXSB 2R2EB 2VUYA 2MCAA 2ZG1A 5AVXB 3TT1L 4G3YH 4QOKB 4CBZA 4KNSA 1XGPA 3BDXA 1Y1UA 2VR5A 2B16A 4PLOB 3MRKB 1KBWA 3BVXA 4UT6L 2JJWA 5B1JA 4YHNA 3F64A 1U30A 4FHKA 5HD8C 1OTUC 3QVAA 4TVPL 5FCSH 3KWWA 5FLUA 5ICXB 3CG8A 3E6FA 4M5SA 1A6ZB 1YEKH 5DVNA 4EDXB 1SEBB 5KVGH 1WBXB 2P5EB 4OCRH 1CPUA 1WD8A 3EDKA 1KOAA 2IDFA 2VJXA 4IOIA 4NRYB 2PXYC 4AENB 5DJCA 1UT1A 3FSWA 3WKML 5D93C 4LFHG 3IETB 5H94B 5LJYH 2YUVA 3BYYA 4YDVA 4ZODA 3S36L 3UTSD 3D0VA 4EKXA 4X6CB 2FJUB 3EJTA 2LTQC 3LRSB 5IG7B 3IDIB 4TLUA 3IMSA 4F7EB 4TNVF 5HPMA 4EI0A 3DHUA 4ZBJA 4W1TA 4ABQA 1G1CA 2AXGB 4MD5B 1NGWB 3CHPA 3O4LE 3LKSA 3F84A 2BY2A 2X4TB 3GMRA 3RVVC 4A39A 3INUL 5F21B 2E9BA 4GRWF 5CZKA 4FYQA 1HI6B 2AVFA 2YAOA 1OTUD 4JFDE 4D8OA 4MJ2A 5DRNB 4HEMA 3MRRB 4TM9A 3O2VL 3V4PH 4W81A 3RFZB 3NFPA 5KN5A 2FO1A 5EC2B 3NCJL 3NK4A 3EHBB 2VDKL 4UV4L 5B1AB 5C08B 2QKIA 1NPJA 5C0ND 1FH5H 4MA1B 1ETZB 2IPKB 2PXYD 3Q2NA 4LBEB 4AQOA 4LVNC 4TPRL 1J5HA 3MBWB 2IFFL 3NDZE 3KVDD 3RI5K 2VWEE 3KXFE 1P7BA 3CVHH 3D3VE 4AIOA 3MRBB 2F54E 4QWWC 1UB6A 4Z7OE 4JZOA 5I15H 1EH9A 4YMPA 1A1NB 3WNNA 1NDGA 2I24N 2R39A 4OJAA 3SGDH 5J13C 1JZ4A 3FCSA 2H32B 1JZIA 1A4JB 1HWWA 2AQTA 3RVVD 4Z3EA 4L8DA 2LV4A 1IGYB 3KMDA 1SVZA 5E6IA 5EORH 4L5FL 4HFUH 5IZ7A 1UACL 4MXVE 3K2IA 2ZNXA 5I6XC 1H3PL 1SJMA 3CFQA 4PRNB 2E7MA 5IOPA 3O8XA 3DXAD 1QPPA 1DBJL 4QLRA 2B5IC 4ZJ9A 5EB9A 4BKLB 4CNIB 4OIFA 4Z7UB 1DQQA 3N1FC 4ZFGL 4XN7A 3ERXA 2HRLA 4AEFA 3JWOL 1KTRL 4HSQA 2YK1H 5AAMC 3FO0H 5F7DB 3GLZA 4L4TA 3VWKC 4JKKA 4TL4A 2X4SB 3HI6H 3IM1A 2Y3AA 1IAIH 3FKUS 4OD3L 4Z0BH 4HX1B 4YHYB 1RZGB 2D73A 1N5YH 1BW8A 5AFAA 3ZTDC 1UADC 2X89A 3EG9B 4JY5L 5DS8B 3ZE1B 5C3TA 4HOXA 3LH9A 3Q6GH 1LP9A 5IHZA 2CIIB 3HE7A 3OL2A 5T33H 3IJHB 3IDGA 3T4AA 2VN3A 3NCYP 4TVPE 4BSVB 4J5VA 3D4ZA 4OV5B 1CLOL 1AGDB 4LCIL 2CO3A 4HKXB 4NRZB 1UEYA 4LXFA 5C70A 4JE4B 1SBSH 4GG6E 1TFHA 4KX8A 4PJFE 5D2NA 3OLEA 3VI4B 4BFIA 1KYAA 5HJ3B 4XXWC 4DWHA 1QR1A 4GKNB 3AY2A 1VPOH 1UD4A 5IBUG 5AW7B 4DJMA 1QG3A 1FP5A 3GHBH 2CWRA 3VWKD 2O6CA 3LEXA 4ZUUA 1BVZA 2N7SA 5HHMD 4I85A 3L4TA 1PKQB 5F1IA 5C92A 1V55B 3U7WH 4FL4C 2VISA 4C56B 1SYSB 1GGCL 3LXUX 1F02I 4K5PA 2H0PA 1AJ7L 1J9SA 2XZQL 3NFNA 4XN1A 1TCMA 4X6CF 4LLYB 4WSKA 2EH7H 4XWOC 4TULL 1UXSB 3PQYA 3HMXL 3MV7D 5HHNB 2PTVA 1NJ9B 4L8SC 1MIML 1B88A 3ULSA 4C59B 4EZLA 3L9BA 4YGVA 3WS3A 2PO6C 3ZBMA 2ZUQB 2K9FB 4NZDA 4UUJA 4HUCA 4H44C 3I6LD 1OANA 2HX7A 3UPRA 1T1XA 3M7FB 1UQSB 4FTVB 3LH8A 3GUTB 3IN2A 4TSAH 3EJRA 2AI0H 2A4ZA 3MUY1 4ZTEA 1WLHA 1L9PA 4OGAC 4FQLH 4UV7L 3TBWB 4DK3A 2P52A 2CNYA 3FB6B 1RY7B 1JF6A 1FV1B 4M00A 1S8DA 3EYSL 4XVUC 4MXWL 4HLEA 1E3XA 4F20A 3JYBA 4GXUN 5C0AA 3FOMA 4XWOD 5TDPA 3JZYA 3NZHL 3QNXA 5D8JH 2UXFA 1B0IA 3V0DA 3FQUA 3WTTA 2PO6D 4FQJL 4MWFA 3BZEB 4F57L 5JW3H 1KCRL 3IAQA 1EANA 4HHGA 1WAAF 1R19A 1U92B 4IIZA 5LG1A 3ESNA 1RFDL 4X7FC 3VFGL 1YEEL 3CSBA 4JPSA 4OGAD 4RH4A 2L4OA 3KCPA 3O4OC 2CLVA 3H3KA 3F6IA 4E9YA 4GJTB 1ASPA 5DK0A 3WUWB 1BBDL 3L5WA 4Z7UF 3QNYA 4XVUD 2VDOB 3QXDB 3UYRL 4X98B 5IB2B 3T6VA 5EZOH 3NMEA 2QMJA 3SJVB 5I5IA 4XAWH 3RG1C 4HPYH 2B59B 1AIZA 2P80A 1VFAA 4X7TB 3LKNA 3QUKA 2VT0A 3EBGA 1N7MH 5HI3C 3ZE1F 2W9EH 1J0IA 4PAZA 3QG6B 5L7XL 3LIZA 2A7BA 5TPWL 5DD6A 3MRQB 4U1JB 3QPXH 1LXMA 2GCYA 1BQRA 1J1OH 3G5VB 4FQHB 4Q9BA 4W9GC 43CAB 4OFYD 1T03H 4TQIA 2BNUB 5EU6A 2OTUA 5KVDL 3DPBA 2GKIA 1UH3A 3VI4F 1BQUA 4P2YA 1N4XL 2RACA 1NAKL 3OZKA 3QUZB 3V52H 4A6YB 4OZHB 1XF2B 4UQ2B 2W1NA 1YRKA 3CIAA 3OKNA 1A7RH 3PABA 1S7WA 1YEFL 4EIZC 4NKQB 3RKPA 1RIVL 2XG5B 3NIGB 4X8JB 2NXYC 3WHXB 1A3ZA 1EJOH 1INDH 2Y25A 1I8UA 1HXYB 5JA9A 4XNUH 1WIOA 1A7OL 5F96H 1UOWA 2OYPA 1FE8H 1YEDB 2BO0A 2VLKB 2VMJA 3CC5A 5HI3D 2X7LA 3TURA 3OB0K 2JKJA 3UADA 4OZFB 3IF1A 2VXUL 3GJEA 3MUHL 4NXKA 5EUOE 3FBKA 3U4BL 3LRKA 1L9TA 5CZVL 4GRWH 4ZFOB 1M05B 4JFFD 2AMUA 1KELH 1MRCL 3QIBC 4EQ2A 2J55A 2YLHA 4HUUA 2HVJA 3HNVH 1W2KT 3LS5H 4KI5F 1MF2H 3HZMB 2RH0A 2W94A 5B1JC 3NTCL 3Q1EA 5C0IB 4WKXA 5F7LB 4JG0H 1W72A 4MLIA 1B2WL 4JRXB 1WS8A 2ITCB 2VO8A 5FYJD 4I7ZC 5D2LB 2EXWD 1WHPA 3V8OA 2QADB 1PPIA 4WI0A 1JZEA 3LMJH 4NHCL 4L4VD 5LN4A 1S7RB 3VI3B 3PL6A 5I6LA 3ECVA 4IK6A 5C6TH 4XCFH 4BZYA 1P84K 4BJLA 5GSVB 2XETA 3MLWH 4UYPA 4KK8C 3VH8A 3WIAA 3ZSSA 3B9EA 3WD5L 3D52A 5K1JA 1R24A 5C09E 1MJJB 5KAQF 4N2AA 2E0PA 3P73B 3CVBA 2P4AB 2XT1B 1LO0H 4ZOBA 1CS6A 3KNBB 1KIPB 5C0CB 5F9DC 1N0XL 4N20A 5K9OB 1ZTXH 3AGVA 3TWYA 4ZZFA 4P23A 5ESQA 3QIBD 3NA4A 2KH2B 1XTMA 4ZPTA 5GS3A 3VSVA 1GIGL 3DXAE 4UTAA 5E1AB 4PJEB 4A67A 2ZWNA 4OFQA 1BEXA 5T1DH 2VO5A 1HHJA 3BE1H 4GAGH 3EOBB 4PJ5A 2OM5A 5LCVH 3L4CA 5F9JA 4ZMAT 4BA8A 2VERN 4CW1A 2AQPA 3MGOA 3SQOH 3DJTA 3QCUL 5TGBA 1AQ8A 1BVLB 2QLYA 1VZGA 2X4PA 3S2AA 4AI7A 4BZ1H 3DA0A 1QFWM 5A2JH 4K5OA 3Q05A 2YEQA 1NGZB 3DOSB 1YC7A 1YMME 4N0UE 5DWUH 5KVEE 3ABLB 2BP3A 3MV11 4LCCB 3FB7A 4R4FL 2HN7A 2ADJA 4JREB 2YSTA 2DWEA 3DYPA 1Z32X 5CCGE 1CYWA 3GJFH 2WLLB 5CD5C 1AO7B 2WQ8A 3SE6A 2JXMB 2BSTB 4R96A 5K39A 3OAZH 4GW4A 3K2UL 4MYWB 3VSQA 4C4BA 4Z7WA 1QBLL 2DM3A 2FWOB 4ZFFB 2Z1PA 3WUZA 2DBLH 2ZCZA 2CR3A 2CG9X 5TE7L 2FNBA 4JHBA 5LWYH 4OGYL 4A7SA 2ATPA 4JY6B 5A40E 4N8CH 2NT0A 1OWRM 1UEMA 5D72L 3O8XC 1C5DB 3BT2H 2V5SA 3G6DH 1LK2A 4XMVA 1S78C 3PNWB 2OR9L 2EIEA 3MGTB 4RGNC 5TE4H 2HUHA 3L3GA 2TSBA 4QRRA 4OZHF 1RUQH 3NH7H 4GEJA 5HHME 3GF8A 1N8ZB 2X53A 5IHLB 3OWRA 4DCQB 1CL7L 5CIPA 1FFTB 3NIGF 2A74C 4WO4A 4P99A 3IJ7A 3HI5L 4NJAH 5K69A 3VQMA 2KYIA 4U1GB 4NN5C 4QIRA 2AJVL 5CD5D 1BVOA 2J43A 1TQWA 2Q76A 1A1MB 2CHXA 3HE7C 4G8EB 5HDBE 1DQDL 1P4BL 1IMHC 5EF0A 5EZJB 5E9DA 3I6LE 1EEQA 4NQXB 3S0PA 1J05A 4PGBB 4L3CB 1NPUA 4KJYB 4MNGA 4OCSL 1NFKA 2HH0H 3O8XD 3UCQA 2J8UA 5IQNA 3KBPA 4KKCC 4P2QB 3PHOB 1XIWA 1ZHNA 2VAAA 2XVGA 3M6DA 5D2NC 1S78D 5EOCH 1IFGA 4RGND 1KBKA 4FFYH 2GW5A 5T3XD 5D7SH 3MO1B 5A6MA 3DSFL 3P9MB 5DGRA 4Z5RA 1BFOB 1F41A 2D7TL 1HYSC 4IMLB 1A5FH 5D2LF 1JGLL 3KBFA 1UM4H 4JPQA 1AZRA 5EPMA 5K59F 1AP2A 1YLBB 4GOSA 2L0DA 1D5ZA 2WANA 4O2EA 3VI3F 2X89D 3G04B 1OP4A 4WUUE 4ELDA 1WBYB 2BMKB 2B4CL 2N01B 5I19L 2R59A 4AV4A 3HE7D 3FOLB 3HRZA 1LE5A 5IV2A 1S5IL 4JFED 3T0EC 2PPFA 3QRGL 3Q8FA 4FYRA 2YOCA 3O2WH 4KKCD 2RHEA 5CN2A 4Y2DA 3NP4A 5ERWA 4PJEF 1BXAA 2BS71 1N26A 5IGXH 5KYXA 2EIMB 3DX2A 1F58H 4LSQH 3HNSH 1GPOL 1HYSD 4F91B 2OL3B 2QLVB 3S8GB 2XZAH 3MRGA 1KEML 1T4KB 4CC4C 4AIEA 1LO2H 4PW9A 5BS0B 1PYWB 1KTJA 4GQ9L 2SEBA 3CXHK 3WLWC 1CLZH 5ID1B 4XCEA 4S10A 4PGCA 2OULB 5JQIB 1UHVA 2YMTA 3OMNB 5L8LB 2WZ5A 1LEIA 4C83B 1VZHA 4PVLA 2FL5B 3T0ED 2UZXA 1E28B 3ZDWA 5ITBH 1FGVL 1ROWA 2DQ6A 1RCYA 4Q2ZB 1A21A 4ZS7H 1G7MB 4XZUA 3ZT7A 4YL4A 1WS7A 1SXCA 1ML0A 1ZLUH 1UWXH 5DHMC 2ICWI 1U3NA 1BPLB 3CFBA 4M4RB 4K3EH 1OM3L 4XP1L 2GJJA 5GGTL 4NUPA 2ZT9C 3BD3A 2E46A 4Z7QE 1BECA 2FTAA 1KXQE 3WLWD 1QWHA 4RGOH 4IS6A 2EVFA 1KIQB 3IFLL 5AYQA 2WLYA 4U7KA 2WGXA 3Q8EA 1IT9H 4HWZB 4X99A 3NCBB 1IAOB 1MW2A 3RUGE 4MD4A 3EO1A 4CUCA 1W91A 2WXJA 1H0DB 3V9FA 4PQXA 1IQDB 1OP3H 3B9KB 2X6CA 4OJEH 5EZIH 5HBBA 2OX5B 3U2SA 5D7EA 1P4LA 4XC1L 5EEZA 2RIKA 3GSNB 1I4FB 2FCBA 3QI9B 3T0BA 4XNYH 2YZ1A 2QQKL 2IGFH 3DIDA 1H15B 3RDTB 2Z31B 5BZDB 3ZTNH 2FHCA 3I2CH 4IIQA 1L6XA 2R4SL 5FYJE 5MHSD 1DANT 1ACXA 3CQPA 5LAXB 1KN2H 4L4VE 3DIFB 5CLWA 3DOIA 3ZDZB 4RFOL 5SV3A 1HFUA 4YSPA 4XBGA 4UM8B 4PJ6A 4OM1H 2ZKXA 1N70A 1IGFH 4D3CL 3ZJAA 4JFXB 1OQOA 1VGKA 2P80D 1MHCA 3QEUB 4OF6A 4UB0L 1QSEB 3L9YA 4EI5C 3RWGB 4NQCA 5DQ9B 5DFWH 1E9OA 4HHAB 3VXSA 3S3SA 3CLFL 4QHLA 3U1SH 2AHIA 2F8XC 4XVTL 4BK4A 4ONOA 2F19L 4G9FA 1G7HA 3RWJB 3TJEL 3P9WB 4WU5B 1BZ9A 4MKTA 5CWSA 5EBMA 2QVMA 2FK9A 1FDLL 1ORSB 3SBQA 2I9TB 1U8NA 5CJOH 2XX0A 2FATL 3EJSA 4AV0A 3ARBA 1JGVL 2B39A 5FEBA 4YIQA 4HMEA 3BZDA 2EZ0D 1EV2E 2EAEA 1F1AA 3WNOA 4B9IA 4MJID 5CHNA 4CN1A 5I1DB 4JK0D 1BX2A 4M56A 1DDHA 1MFBL 5HJDA 4XMUA 1JHLL 1KPUB 1Z3RA 3FU9A 3AW5A 4WUKL 4JFHD 5IUSA 5JHLA 3HG4A 4M7KL 3FUJA 4ZO9A 1BYOA 4R4NC 3MRCB 3PGFL 2DI9A 3V0JA 1NIEA 3VFTB 2J3SA 1T83A 4EI6A 1LK3H 1M3JA 2BFGA 1F18A 4XNZB 1QLRB 5DEFA 3M17B 3C2SA 3SSGA 4ZSOA 4HEME 3SKMB 4AH2A 3UJJH 1LDPH 3VU2A 4B9KC 2XTJB 1OGTB 4FOMA 3WN6A 4UT9H 3L1GA 4JKPH 4PRBB 3MFFB 3HFML 1RIUH 4W9JC 5D1ZB 3VXTB 1MVUA 2IAMB 4KBPA 3ESUF 4TS6A 1FO0A 1D5BA 3CN0A 2NUPB 2EDBA 4A6YH 3NEXA 3PWNB 3D2UA 5FECB 3FO2B 1F4AA 3HAEB 2E3VA 4PMEA 3GNMH 3Q6FA 1KYOJ 3MJ6A 4DEUA 3KLLA 1DQJB 4R4ND 3V5KA 1KCUH 5IR1B 1CXHA 4OM0L 1HDMA 1YN7B 1Y18B 4Y19D 5I74C 2AQNA 2EDOA 1DFBH 2BSCA 2VH5H 5KYUA 4RDBA 1W0VA 2DQGL 1E9QB 5JIMA 3BH9B 2I60L 3MLYL 3VFPA 5JA8B 1GSMA 2E9IA 5J6HB 4R26L 4P23D 4Y4HA 4BWWA 4TKWA 4OZFH 3RWIA 3FONA 1EAPB 4B7IA 1TO4A 1X9UA 4BQ6A 2AKRA 2XQBH 2VLRA 2YXFA 3AU1B 2VM3A 1YJDL 2VQTA 3CZNA 2O61B 1KB9J 4Z7NB 4BSJA 4PJ5D 1FL6A 2ITDB 4YWGL 5T3XE 2LE9A 4LRNH 4U1NA 3TIEA 3NG5A 3X13B 3F2LA 3I3BA 5AOMA 3C09C 3ZQWA 1NGQL 3EYUH 4R2GC 4HKJA 1U8HA 1UWGL 3GKWH 4OD1L 2IJ0C 5E94B 2YFOA 4L4TE 1QRNA 1MCPH 2OJEB 2FJFB 1U58B 3EADA 3GTVA 3ZDZF 4ISVB 3OJDB 4XVJH 3V9CA 1I9IH 2OZ4H 1PZ3A 5F9WC 1UKQA 2ORBH 4M93C 1AXTH 1LP9E 3EJCA 3K4DA 4HISA 2YGPA 4AM0A 3QAZB 4FFVC 3AREA 5E2VL 5LG6A 2B1AL 4MMZA 3GIVA 2GJZA 3L95A 1G0XA 1D5MB 3UZQB 3VU1A 1DJIA 1EAJA 1AKJD 2ZCHL 2X6BA 1UCBL 3F6LA 3I75A 3ZDYB 1MHEB 5D2NE 5I71B 2C4FU 1A9EB 3FJTA 1XSOA 3UZVA 4ZZKA 2WO2B 3ESPA 3HS0A 2B3IA 3E6HA 4R2GD 4HK0B 4PLKC 1RV6X 5AVTB 4NQUA 2VSDA 1CYXA 4QRRD 2B1OA 4L9LB 3MRJA 5FGBC 5C3IA 2VSMB 1D2PA 2NCMA 2VIRA 1UT9A 3L7FA 1WO2A 5ANHA 5DJ6A 3FH8A 3F7YB 4OCNC 2K7QA 1XMEB 5HGBB 4HK3J 3C2AL 4YPGA 4MBOA 3EIFA 2P24B 1QKZL 3FB8A 3PQYE 3FT1A 3NSDA 2EYRB 4AWJC 2QSCL 5IKCA 2VDNB 2XPGB 5GHWH 2P5WB 1IQWH 2B15A 3HRZC 5H37H 3DX0A 1I9JH 4NYLA 4TUKH 5E9DD 1CR9L 3V7AE 1TZIB 3AGWA 2A4CA 5DRZA 32C2A 4BDVA 2AP2A 1ZWIB 2UUDH 4PLKD 3CSFA 1OM9A 4Y2DC 3E80A 3EH2A 5E1IA 4Z9KB 3VVWA 4BFFA 2ICES 5FOBA 2CUHA 1O6VA 2QZ5A 1MLCB 2JWYA 3WG7B 2XIBA 4HS3B 1FNGA 4KDVA 4WDIB 1LL1A 1R3HA 1X5FA 3QNZB 4D0DB 3VXOB 5ADOH 4M9PA 2DQCH 1E4XL 4O51B 3UEZA 2NDFA 4ZI8A 3RB7A 1IEAB 5C0AE 2HA1A 4OF7A 1XCTB 3CXDL 2A83B 4M5TA 3KPRA 3ZHLA 4UQ9A 5FPIA 1UXLA 2AEOA 2W0KA 4ODVL 4EAEA 2QBWA 3MLVH 5DFVC 1T5KA 4A2HA 4J7RA 4ODXB 1W0WB 1YPZA 5DJ8A 1QBBA 2XWBA 3DHJA 4P5TB 1I1AC 3NJXA 3OC8A 3QR2A 2Q8BH 4R7DB 5E24E 2H6PB 3L9EA 1W6LA 2MCPL 1QI3A 3CPLB 5E6YA 1SDAB 4WCYL 5C7XH 1JMXA 3OLDA 3MCYA 3NAAH 3PS6A 2VZSA 3RY4A 3HUJB 3PGCB 1CICB 4R6UA 1PY9A 4Y2DD 4F3FB 5MHSE 5JXAL 4CADB 2R1WA 4Z7NF 5C0DB 2K7PA 2YJQA 1MW1A 6CGTA 4LP8A 2YD1A 4F9LC 1HH9A 1DBAL 3D34A 3RTQA 4ZUSB 2VZUA 2V7HA 3TBTA 3U9WA 2IMNA 2YXVA 5IVXA 3HZKB 3P3TA 2BRQA 1OT1A 1B6UA 5IK3B 4G7YH 4UM9A 5KSAC 2PR4L 4GAYA 5DFVD 4LHUA 2WV3A 4WEEA 2KT6A 2NSMA 3KPMB 4YHKL 5JW4M 1JTPA 3AWFA 3GHPA 1I1AD 4OLEA 4X4MA 2E9JA 1AY1L 5C0BB 5IJKC 1GJUA 4FG6C 3VRLF 4ONHB 4JB9L 2E74C 4U1HB 1ZV9A 4MVBC 5D70L 1A64A 1KJ2L 3VXPB 2KS0A 1BAWA 4N85A 4QTIH 4R90L 1CF8L 1GYWA 4R8WL 3IU4H 5EU6E 3ZDYF 4X5XA 4MQ7B 4K3JL 5CILL 4BWTA 4ELKA 35C8L 4MMXA 4JGJA 4DP4X 3US9A 4D9LL 3L5XH 4RAUA 4Y4FB 1OHQA 1ZA6A 2NYYC 1TITA 1FG9C 4L4JA 5LGKA 4U6YA 1MCNA 3NFSH 3OX8B 4UQAA 4KVNL 4B95C 4BKSC 1CLYL 2WAQA 1EBPA 3CGTA 2FB4L 3GMLB 4W9IC 1Q9LA 5KSAD 4FP8L 4JFHE 4X4YA 1FRGH 3Q1SL 4QO1B 4EKJA 5C7ZA 5BQ7A 3ORJA 4S11A 1QUNA 4FG6D 2KL6A 1NAMB 3U7YH 1SMAA 3AC0A 2ZOUA 4DP1X 2WVUA 2YQ3A 3OM3B 4MVBD 1HNYA 3VFRB 1Z5LB 4L2YA 4ETQA 1UD3A 4OLXL 5DTFA 4M48H 4DGWC 1G5AA 2CIKA 3T77B 3V4PA 3GEFA 4N2MA 4UAHA 1H8OA 1DUZA 1X5AA 4LKCA 5GISH 3O6MH 1TYRA 4HU2A 1VGEL 5EA0H 3A4EA 1A6TA 2NYYD 3IFOA 5T1KA 3MRHA 5ITFA 5MP6L 5KUKA 3P3UA 1OZUA 5CEXB 5E2WL 3AACA 1U3HB 2X4NB 1L3WA 4U3SB 4NQVB 2EEAA 1PLCA 1K8IA 3HCVA 5ESVA 1OGAA 3D25A 1DQIA 2A5UA 2FYVA 4ODSL 4JJOA 1YY9C 3WJMB 5KYYB 4NQCD 1KNOA 5K9JH 1DSFL 2IDCA 4DQAA 1SDYA 4ODUA 3VXSD 2HLAB 1M1XB 3FSVA 3LKOB 4PJ8C 3FT3A 4HH8A 3RIFK 1IGTA 4FEMA 4EE2A 1A3LH 2IANB 4BH8B 4FQQB 4G9FD 3QS3A 3WXWH 5C1MB 3GSNH 4GBXB 3LH2L 4UOW0 3SD2A 3U0PA 4OLUL 4PJ5E 1NC4A 1IM9B 3HUJF 3C5JB 5E23A 3KYOA 3OV6A 2CHNA 1I9RH 3GKZA 3PDOA 4FFWC 3II2A 5DZPA 1RZIB 2O72A 3B5GA 1AFVH 2XQYG 4AEHL 5I17B 5TDOB 1G9NC 3MXWL 2O93L 1JK8A 3GRWL 1B0RB 3MV8A 4LRIC 3ILPB 4BQ9A 1YY9D 2AXHA 1W0YT 1IC7L 3BZ4A 3WHE0 1XGZA 4BFBD 1OTTC 5IJCC 4PRHD 1FWXA 1P53A 3S6CA 4K94C 2IG2L 1TVHA 4PJ8D 5J3HC 4BFGA 4Z7WE 2O1AA 1E6OL 4ODHH 3QA3B 1FNSH 5HHXH 4F92B 1RVFL 3PWPA 1F3DJ 4GO8A 3MRLA 3GB7B 3V6ZB 2ZWKA 1MCCA 2WUBH 2H0FA 4B9ZA 1AGBA 3QUMB 3MREA 1M6UA 1UFUA 5HDWA 2EDJA 3BPLB 1DO6A 4NNXA 2JKNA 5CP7B 1MFAL 4FFWD 4KMLB 4ILDA 3QIWC 4QRRE 3WOVA 3BP5A 4DTGL 2DZEA 4QHMB 4IRJC 5D7JB 5B1CA 3ABZA 3CXFA 3RHWK 5DRXA 5FAAA 4CVWA 2AC0A 5EN2A 1CL7I 3APCA 1S9YA 2CD0A 3M1BB 4KO9A 4YNYB 3Q2CA 4HZLB 1ED3A 2GBUA 4IEFA 3MR9B 1AQKL 1NFIA 4N86A 4MNHB 3T2NL 1S9XA 3GO1L 5DD0H 1KGCD 4N9GB 1FZJA 5E9DE 3AREC 4BGDA 2OQJA 2NZ9C 3UTQB 1AR2A 2KZ1B 2OXGB 4QRTA 4CC0A 4JO3H 4G7VH 3QQXA 4MNGE 2ADFH 1CU4H 4GUQA 4RZCB 2D7OA 2J8UE 2VLRD 3LKQA 2VRQA 5B38A 3CX2A 1ACYL 3GUFA 2JKRM 5KBMA 1I7RB 3UG5A 1XGTB 4UDTA 4KQ4H 4X7EC 3MUGA 3QIWD 4X50A 2GHWB 1QFOA 1NUDA 2XCMC 3BPNB 1MI5D 4JM4H 2AEIT 4OJYA 4I5BA 4F1SA 3H54A 2K45A 1CGVA 5I30H 1MJ8H 2I9LA 2XWTB 4WY7L 3P0VH 5LNGA 2KMWA 3SPJA 4BCYA 1QRND 3TA3B 4M7JH 5IQMA 1X4YA 4B27A 5FGCB 2DQJH 4QCIB 3W9DA 3HAEH 3CHSA 2VXQA 3MJ9H 3RDJA 1M9WA 1PG7H 1MCWM 2PW1B 1E4KC 1GC1C 2E59A 4NPKA 4S1QH 2O5XH 4DP0X 3ARED 2NZ9D 1Z2KA 3AB0C 5GSRB 2X5PA 1RZKC 1DZBA 1K6QH 4NP9A 1RZQA 4XN4A 2WGNB 5CCKL 2OYMA 4NM4H 1PIGA 5CGTA 5DF0A 5EU7C 4JANB 4XP6H 1PKOA 4ZX5A 4Y5XB 1S7UB 4IBUA 4OZ4A 3L3JB 4XOCA 4YSOA 1CFNA 1BWWA 4I9WE 2CJ3A 1A14L 3LRLA 4HIIB 1JXKA 3FUFA 4AQAA 2F08A 4NJ9L 1G6VK 3IDJA 1KYDA 1AC6A 3QJTB 1DZ0A 2AXFA 5B3NA 1LD9B 3TONA 3WHE1 5INDA 3SGKA 4CSPA 4L8BB 3MTRA 1FIGH 3FH5A 4G8AC 4TOYH 5ENWA 3HBPA 2OP4L 4B60A 3FQ1A 1GZQA 1HC1A 2AGJL 1QLEB 5EFIB 4MAYB 1FYTA 1KGUA 2XG4B 3GSUA 5A2FA 4MRCA 5DD1L 5JHLL 1OAJA 4OFIA 2ZUWA 2YPKA 2FH6A 3CX5K 4IHOB 4HC1L 1NCDH 1V5JA 2W65B 1A4KA 2A77H 2RD0A 2XQYA 3DX8A 3V5HA 4JO4L 1RUMH 3NCYS 1FC2D 4A2DA 3W38A 5DMGC 2CRZA 4K15A 2YSSB 5HGAA 3CFJB 1JJUA 2CK0H 4OQTH 3UGEA 2Z35A 3C08L 5IFJB 3D09A 1G9ML 3TO4A 1HILA 2YARA 4PRPA 4DKFL 3CFMA 3RTQC 3GTTA 1FO0L 1DN0B 5AW3B 4RFNC 3ZE0B 5K9KB 1SN0A 3LQZB 4WI9A 1Q0XL 1ZY9A 4F93B 4KRLB 5GGRA 1YZZA 2XPZA 3BAEL 5HGDB 3CDGA 3UTOA 1OARH 1SJEB 3WE6A 1NLDH 4KZEH 4S1DC 1BP3B 3HN8A 5HVGB 1N6QL 1BQLH 3W0WA 2H9GB 4PWHA 2G2RB 1YNKL 5BCAA 5GZOA 4E41D 3ULVF 1ORQA 1PGRB 3V4VA 4LLWA 4RIRB 5H35B 2IPUG 3TWCL 1ZPLA 3VFMA 2DTSA 4DGYH 1QFWH 3QQ4A 2VYRE 4PI2A 2PPDA 3ATBA 2LR4A 4HUWB 5IROA 5J9PA 3GK8H 1C5CH 1SRDA 3TN0B 3M8OH 2MOGA 3D39A 3SDCC 2Y06L 4OBRA 3RTQD 4DP7X 2OYKA 4LHJB 2HLFC 4I18A 2X1WL 1DQTA 2H3KA 2QQQA 5L6YL 2IH3A 1X6LA 1IFHH 4A68A 1HH6B 4JFYA 1R3KA 4DAGH 1NOLA 1CE1H 2J5LB 3QQDB 4UM9D 3NJHA 1CD8A 2C4XA 4LHUD 3FTUA 3D12B 4NQCE 3WIFB 4KKZA 3X11B 1F4XH 3CN4A 1CFVL 1C7TA 4JY4B 5ALCH 3VXSE 4S1DD 3T2LA 4LGPB 1OF2A 5BOJA 5BVPH 4WHYH 4XH2B 3FN3A 5SX5K 3D69A 4WI3A 4LPVA 4AIXA 5KOMC 4G9FE 5SV4A 3RGVC 3NIDE 1GZPA 4XRCB 4C4KT 5GRJL 5DCCA 1XGRA 5BZXA 5KWYC 2F58L 2RFXA 1ND0B 1C8QA 2WINA 5B3SB 2VKXA 3DUUA 5J0BA 5KG9A 3QR0A 1T3FA 2FX8L 3QBTB 3W39B 4J3TA 1SDDA 1EERB 2VDPB 4NQDB 2Y36L 4LEXL 4B9CA 3SDCD 1OOAA 3N1GC 5EWIH 3POHA 1NKRA 4EOWL 4KHXH 2HLFD 1F1GA 1NM4A 1OW0A 4LNVA 2AEQH 1JAEA 1DR9A 5KANI 2P44B 3L2NA 3NDYE 4IDJH 2V8LA 5J6GB 3ZHKA 4HQQL 4JHAH 5ANMB 4R97C 1I3VA 1PD0A 1E90A 2JIXA 1FORL 2VABA 2W60B 4RRPM 2ALWA 4TUOA 3A47A 1G7QB 4AW4A 4TRPH 5C8JB 1RK0B 3UG3A 3IDYC 3OXSA 2DF3A 4OIIH 4U49A 1RJZB 2DQIL 2JKIS 3H0TA 3VRJB 3SPIA 3POCA 4ZW7A 4HUNB 1RURL 4QOKA 4Q52A 4ZSOE 3Q3GB 4D0BB 3MRKA 4WFEE 1I7UB 1CT8A 4LSDA 1Z0NA 1E4HA 4H7VA 2R29H 3D5OF 1Y6MR 2PWHA 5ICXA 4EDXA 3TEYA 4NNPH 1SEBA 5DRWB 5E6RB 3VNZA 1WBXA 4LPCA 3A23A 2Z7WA 2FLBT 3MFGB 5CCHE 2ZZUT 2Q10A 4IBLT 4AENA 5D71L 4G2AA 3IETA 5H94A 2CR0A 5J89A 2DL9A 2AJYL 5BPPA 3BPCA 1OGAD 1B0WA 4X6CA 5HYIA 2D3NA 4NZFA 3FCTA 3ZE0F 1X9LA 1NL0H 2DH3A 2GBTA 2NY0C 3IDIA 2D3VA 3NGBB 3IDMB 4F7EA 1KGCE 3NVQA 3OAUH 4BKTC 4DGUA 1ZCRA 4OUUB 3NZUA 2AXGA 4MD5A 1NGWA 1NAMH 2XA3A 1AD0A 2X4TA 3FMGH 4FJZA 1DEEB 3O6LL 4S1SH 2VLRE 1HL4A 3RNQB 1HI6A 2V17H 4JCLA 2WXGA 2XVLA 4M61B 4PSPA 5KAQG 4PB0H 5DRNA 1KT2A 3MRRA 2YQBA 5C6PB 3DO7A 3RFZA 3B9DA 4L3FA 2VNCA 3T0DA 3IJYB 5EC2A 2MOQA 1B6DA 2PLTA 1YA5A 3QJHA 5C08A 4TXVB 2CHWA 1ETZA 2IPKA 1R17A 2QQNH 4FULA 4LBEA 1YNTB 1U8OA 1CFSB 1V8HA 3MACL 1ZT4B 3BO8A 4G7RB 1QTSA 1QRNE 1KFGA 3CZKA 3RY5A 1DBBH 4A2FA 4GKOA 2VR9A 1EHLH 2VRKA 2QPDB 2BVOB 5F7EL 1SJHB 1MIEL 3BSZH 1J0ZA 3MRBA 2NXZB 2VDRB 3N9GL 3VDCA 2NY0D 3PJSB 3ZYZA 3BEVA 3QXWA 1KFAL 2HVKB 4JQVA 4QI3A 2DQDH 3WUWG 4EVNB 5HVFB 2H32A 1OKEA 3D85B 1FZMB 1A4JA 5HHPB 2BOCB 4OJDH 3LS4H 2K8MA 2X1PA 3KPOA 1JNLH 3PWPD 2WBJB 3RA7H 3ZVVA 1ODAA 4G3YL 4QHKI 3WFBH 1PG7X 3PFQA 5DK3A 4PRNA 4NT6A 1RHFA 4OIAA 3LVTA 2A6IB 4BKLA 4N0CC 4CNIA 3HC2A 4Z7UA 1UURA 3EYQC 4JLRA 1C9SA 5KVGL 4W93A 1KXTB 4QNPE 1I1YA 4OCRL 3T8VA 1MFEH 2BWQA 1ERNA 1D5IH 1PCSA 5F7DA 2ATKB 3PP3K 4JFTA 5LGJB 2Z8WC 4X80H 2ZF9A 2X4SA 1NDMA 1NIDA 1M7IB 4ZMPA 4IRZA 4PWFA 1PS3A 3PGDB 4HX1A 1RZGA 2BVQA 2FE0A 2LFEA 4GQRA 3V0GA 1TZ8A 1TZAA 2ZOLB 3TASA 4Q9QH 3V0HA 3Q9QA 3EG9A 5IVZB 3UJIH 2J71A 1AGFB 3TLRA 4U6VH 2CIIA 4PCTA 4X4XA 3IJHA 2FBOJ 1UWEH 4G6KH 1F8TH 3SE3C 1HVXA 3P4OA 3U1QA 3WKYA 4BSVA 1AXIB 4JJHA 1Z9MA 4LVOC 4OV5A 4Q6IB 4L8CB 5EU7E 3W56A 2Y07H 2HPOA 4HKXA 4NRZA 5DEJA 5IVNA 4B9FA 4BQBA 4ANKA 5EO0B 4N0CD 1A7NH 2X4UB 1IARB 4P9HL 3VI4A 5CJQH 3EYQD 5HJ3A 5IIEB 1IAKB 2C9SA 2YD2A 2ZCLH 3D4YA 4GKNA 3V4PL 2NSQA 1IRAY 4RETB 5SWZD 3SHSA 1OWWA 3QUYC 4LDEB 2ZUVA 4OZFG 4FZEH 4BRVA 4GRMB 3BWUF 2VERA 3WO3B 4AQEB 5TH2A 4KV5F 1DFXA 2MFNA 4NUGH 4IRSA 1I7ZB 2IOOA 3CVHL 1N2RA 3KPRE 3SGKC 4C56A 1SYSA 3HBZA 1OL0A 2EEDA 5CSGA 1YPZE 3IDUA 3U82B 5HHNA 1NJ9A 1CI3M 3S4SB 3PWUA 5TDNA 3ZUCA 5HYEA 5ES4B 5IQOA 4HKBB 1UA6H 2MSPA 5DI8A 4FMKA 4M43H 5DHVB 1JBJA 4C57C 3T65B 5EORL 4HFUL 4P07A 2YPVH 3VDAA 5FV1L 4ZMWA 4FI8A 5L88H 3GUTA 2X2IA 4BFNA 2MPAH 4PV8B 4JM2C 3OZLA 4MB3A 4BQ8A 3QUYD 3ULAB 4KTYA 4Z8FL 2X3BA 3TBWA 2WXPA 3K6IA 2O6DA 4PRDB 3FB6A 2CK2A 3OHXC 2W9LA 1EEZA 1FV1A 1NUGA 1YNTF 5IVXE 3FO0L 1WICA 4PP2B 3AM8A 4QYOB 1T0MB 3AG4B 3Q0HA 3HI6L 5EO1B 2VQ1B 1IAIL 3EGSB 4OVUA 2EE9A 4M29A 1G6RA 2VSCA 3HG0A 5JPMB 1FYTD 1GW0A 4X4ME 1PG7W 4N22A 3VE0B 4A7GF 1GYVA 1TETH 3Q6GL 3BZEA 5T33L 1R0AH 2OK0H 3ULUF 4FJ6A 3OJ2C 4WU7B 3ILDA 4QHUB 5DS1A 5FC9A 3T0VA 4A7TA 2IWFA 2GEEA 2OFQA 1U92A 1BA9A 2BK8A 4JM2D 4P46B 4U2YA 3QZBA 1SBSL 2HP4A 4I9XA 4GRLA 4M3JA 5JW4N 4UQ3B 5EIQA 1ADQH 1JF1B 4UBDC 3N85H 3FO9B 1OTSC 1KZQA 1X7TA 1TQUA 3WUWA 3PV7A 2X4QB 2BSEA 3FQNB 4G6AC 4GO9A 3QXDA 1GMIA 2VW6A 2WCGA 1PTZA 1NCAH 3A21A 4HJ1A 3H2WA 2R7EB 1SUJA 4R0LB 4WW2B 5I73C 3BIBX 3SJVA 4HDIB 1BFTA 2JJSC 3LDBB 3U7WL 2XWXA 5I0WA 1JXFA 2B59A 1LWJA 5FA4A 3AUWB 4Q89A 4X7TA 4Z78B 4G6MH 2HVBA 5BO1H 2XC8A 2PR9A 4HYTB 4P9MH 1QLEH 2QHLA 4LZKA 3EF7A 3EO9H 3QG6A 4LCWB 1L7TH 3CUPB 1B3IA 4R9HA 2HG0A 3MRQA 1H8NA 4QRUB 1XGYH 3W0WD 3QDMB 3G5VA 4FQHA 4QPEA 4U0QB 3H9HA 4UT9A 3HRPA 4NKIH 4CDGC 1J8SA 2O5NA 4UBDD 3TPKA 1CGUA 2BNUA 3KPSA 3BRGC 4TSAL 4KROC 2AI0L 3W2DL 1TZGH 2OSLB 3QUZA 4KJQC 4NHUA 3UFIA 3VW3H 4G6AD 4K07A 2A4EA 1BFVH 2ZWYA 4FQLL 4OZHA 2X88A 3S35H 3D39D 3ZTCC 5CZRA 5AKSA 2AXJA 3ZN6A 3HG5A 2ZQKA 1WZ1H 3UMNA 2XG5A 4ABWA 5HYJD 1OW0C 2VR7A 4PLNC 5HSFA 3FCBA 1OGAE 4I13B 3BJ91 5FW8A 2YS4A 3CHXA 3CU1A 4Q8BA 5HY9B 1XR8B 1DCLA 1YEDA 5B39B 4HGKC 2WXFA 1N0LB 4PS3A 2NY4D 1K5NA 1QBMH 2ZCKH 4MA7L 1HEZA 2VXQL 5D8JL 5T1LB 2AZAA 4XNXH 4XN9A 1FF5A 3X1BA 5JW3L 3DETD 1JPGB 1F97A 1M05A 3HZYB 4KRPC 3Q01A 5GJTH 2O30A 4FD0A 4NWTH 3VFUB 2ADGB 5HGHB 5JORB 1AQHA 2A9DA 1F6AB 3V0FA 1F13A 3HG1B 3MOAH 1CBVH 4KROD 3BP4A 4JFVA 4RMTA 3UTZA 5C0IA 3DRTA 4KJQD 4HETA 1MKFA 3MJWA 1X5XA 1F11A 2KZWA 4WGVB 4JRXA 2R0WH 2NY1D 5DJAB 3GXMA 2ITCA 3DNKA 2CCLA 4LASH 4EZJA 3H85A 2WNWA 1PIFA 5AYTA 3SPHA 3SY0B 4P2OC 1CDGA 3WKQA 1S7RA 4F8QA 3WTWA 2LABA 1UJTA 2WVTA 3FU0A 3VI3A 3MV8E 4GT7A 3VSUA 2A0LC 1DJZA 5GSVA 4KXAA 1OAQH 5DYOB 4BH7A 1EGJH 2JIXD 3DROA 5EZOL 4XAWL 4P8QA 3SQRA 3P73A 3P3YA 3HS9A 3KLAA 4JZJC 5C0CA 1KIPA 3ZK0A 5K9OA 3P77B 4IHBA 5IF0B 3QRFM 4NX0A 2NTSP 2W9EL 3KYMB 3ME0B 3PWPE 4K3HA 4KRPD 4X5QA 1ZIAA 1QSFB 5GRZA 5T1MB 4R3SB 3QIUB 5IQ7L 4YHMH 2OMTB 2BVPB 3PWVB 4PJEA 3FUNA 3QPXL 2WQUA 1O7VA 1GHFL 4ZTPH 1T03L 2H26B 4E0RB 3R8BB 4BXSV 5INCB 2CKBB 4G8GA 2PNDA 1EZVX 3K4AA 1CD0A 4XO3A 3IDXL 3MNWB 2P8LA 3V52L 1PFOA 1XH3B 2DLEA 1OCWH 4Z1PA 1BVLA 1A7RL 4FF9A 2A0LD 3AT0A 5DZOA 4DKAA 5CGYC 5E8PB 1NGZA 1FFPB 3V0WH 1EJOL 2CLZB 5IFAH 2C9AA 4LCCA 1YHPA 2OCCB 5JHDD 4WW2F 4XNUL 4NI3A 5HHVL 3T4YB 1QABA 5T5FA 5F96L 2ZX9A 2A9AA 1FE8L 2WQXA 1VEMA 3QG7H 5IM7B 1ZLVK 2WLLA 1AO7A 4JQVC 2JXMA 1DLHA 2BSTA 3LD8B 1KN4L 3UMTA 3E38A 2JQAA 2FWOA 2MNUA 3TYFA 4ZFFA 5GIRB 1T2JA 3T6ZA 2NNAA 4NBZB 3NJNA 4JY6A 1KELL 2AK4D 4ADIA 2Y0SA 4YO0A 3QXAA 1WTGT 3JXAA 3HNVL 3LS5L 4NP4H 3GMOB 1MF2L 4NZ8A 1T5WB 1WFMA 4Z7IA 5C0FA 3V4VL 2BIHA 4JG0L 3Q5TA 3J07A 4U3CA 1M1SA 3MGTA 3QJXA 5CGYD 3D05A 4J4PC 1N8ZA 1MCSA 5I6NA 4DCQA 1WD9A 3G6JB 3LMJL 1KWKA 4OCXH 3T0WA 1M53A 5F6IB 3R06A 1QZ1A 4XCFL 5LBSH 4KY1H 3MOQA 3MLWL 2CPUA 4J3OF 2AQRA 3EFOB 2PF6A 1F4YH 3FRPB 1LO0L 1A1MA 5DMJB 5FUCC 2NNXA 1ZTXL 1O5PA 5EZJA 4NQXA 2WWKO 4PGBA 1K4CB 5B1KA 4KJYA 4Q9RL 3QYCA 3RFRA 2FECL 4Y2LA 4DPRA 5I16A 3KM1A 2OPCA 1MQKH 3SDDA 4JS7A 4LT7A 3OGCB 4NQQA 5T1DL 3BE1L 2YO3A 4GAGL 3QDJB 2ETWA 3FQXB 5LCVL 2I25N 4Y1SA 3J8F7 3FFOA 4J4PD 3MO1A 3P9MA 2BHZA 4MDJB 3SQOL 1P7QD 2J7LA 1BFOA 3FNKA 4IMLA 3ZL2A 2GSIA 4BZ1L 1TTUA 2OR8A 3GS7A 1JGDA 4B5EA 1J8RA 1Z5YD 2CO4A 4IRSC 2EDNA 4MZIA 3L54A 5DWUL 4JFUA 2Q3ZA 5JW4Q 1FYTE 2BMKA 1D5XB 1NIFA 2IH8A 4N3TA 3QORB 4JPIB 3NRQA 3N40F 1IBDA 1IUZA 3FOLA 1KG0A 2BFVH 4KQ3H 4XCYB 4PWJA 1KLFB 2AITA 4H2CA 3ULUH 3U9PH 1U21A 3MNVB 1YEWA 3D0AA 4D2NA 2ZWZA 2FX9L 4TNWK 3FU3A 2DBLL 3VJ6B 1RUAH 1IBGL 5LWYL 4NFBA 5E4EB 4Z95H 5TQ0H 1BZQK 4JJ5B 2XRAH 1AHWC 3DVGB 4J23A 3BT2L 2G60H 3NABH 4PRPE 2BS9A 2OL3A 3G6DL 3FRUB 3PPSA 5JO5B 3T8XB 4ES8A 2IQ9H 1ZOXA 1T4KA 4X8CA 5TE4L 1J9TA 1RUQL 3NH7L 3UAAA 1N5AA 4IRSD 4WAFA 2DICA 3GMQA 3SDXB 5ID1A 3AM8C 2IAAC 1IGIL 2MQCA 5FYKH 1ZT1A 1XF5B 5BVJA 4NJAL 3LCYA 1MQ8A 1DQMH 3UZEC 2GTZB 4C83A 1H6UA 4OI9A 2FL5A 2KKQA 4LHQB 3OR7B 3IVKA 1I1RA 4YXLH 3W0WE 1H5BC 3HAEG 4Q2ZA 4B6ZA 5I1HH 1HSBA 1SLXA 4YC2C 3QHFH 5AWNH 3HB3C 5E5LA 2HT4C 5EZLB 3MBXH 2HH0L 2YGVA 5IEKB 3P0GB 2PCPA 4JRYD 4GRLC 3D39E 3GBEA 2FT7A 1FAIH 4YDJB 1E2WA 4FNQA 4FFYL 2PUQT 3QCTH 5MENB 3PE9A 4AY0A 3QO1B 2W81C 1KIQA 1A5FL 2XX1A 5EU3B 4HWZA 1DEDA 1UKTA 4IU3B 3G6JF 5AVWB 4FDWA 1JVOA 5E7BA 4HVBA 1AGCA 3S35X 1IQDA 2RCSH 2SODB 1BZDA 4H20H 1FCCA 1KBBA 3B9KA 1OALA 1TQCC 3PHSA 3H6JA 2YD6A 5LXGL 4HJEA 4MGXA 3IBOA 2FEEL 3DGGA 4IKJA 5KBKA 1TQBC 3GSNA 3HB3D 4KKQA 1I4FA 2HT4D 2BX5A 2HJFA 4PN6A 5DHVH 1H15A 3VAEA 3O2WL 4ZS6C 2DBJA 4GRLD 2OLDA 5IMLB 3W9EB 1TENA 3GSWB 2DMBA 1ZV2A 4DK5A 2VXTL 3CVDA 5GGSY 5IGXL 3HC4H 2BSED 5KUMA 1F58L 3LN5A 1KDIA 4E9WA 3HNSL 4NDMB 3BKCL 4XPBH 4RMQA 4XXDB 2XZAL 5D4JA 1NWPA 4XNDA 2DY2A 2GTWA 4LOFA 4PEEA 1WC7B 2Y6SC 1A7PH 1DBML 1CLZL 4U1IB 4MJ5B 2BVEA 3NCXA 1QO3B 3UGXA 3RX9A 2ID5A 3BEWB 2J6EA 3U0TA 5DQ9A 4N0FB 1JNNH 2JJTA 1MNUH 4HHAA 1AG0A 1WYJA 3C60C 4OFPA 4CU8A 2DIEA 2J4WL 4QOKE 3D1MC 1H19A 3GMMB 5F8RC 2KPWA 4WU5A 1XO8A 2UZPA 1OSZA 4ZS6D 3AS3A 4MS8C 3B3IB 3KPSD 2AJXH 1U2HA 1WZMA 3MLUH 3A4AA 3JT2A 2WQVA 2Y7OA 3SBRA 3QUZD 1QYGH 4OZIB 3CFTA 1KJVA 4AEIH 4ZRGA 5JYLA 4XP9L 2MKWA 2AJUH 3FT0A 5ACZA 1A6PA 1FUNA 4JCWA 1SHSA 5I0YA 5I1IH 4RGOL 1DSYA 2WJ5A 4X6CE 1IKNC 2HJKB 1RZJL 1XR9B 5BXFB 3M07A 4MAZA 2X87A 5C0JB 4N3UA 2IQAB 1IT9L 3SDXF 3P4NB 3MRCA 3KPPB 2X0WA 3C60D 3EJPA 2NY6C 1NC2A 3TTYA 3VFTA 3FUHA 3CFCL 4KUCD 2XJKA 2Q7YB 4AYBA 3IRCA 2CO7A 5A7BA 5EZIL 4TQHA 4PI0A 1QLRA 1BAGA 3M17A 4JE0A 1JGUH 3CZGA 3A6CL 5D1QB 3L81A 4MS8D 1BYNA 2JKWA 3LRMA 3NPSC 3FC8A 5CINH 3ASNB 3SKMA 4G1EB 2FT8A 4XNYL 4AYFB 4LDCA 3APNA 4BFJA 4C47A 2IGFL 4WHYG 5AL0A 5C08E 3OPUA 4ANUA 3MFFA 3ZTNL 3I2CL 4UQBA 1IBBA 3VXTA 4GLRI 3CZUB 1ZMYA 1NGXA 4TLSA 2NUPA 4ABVA 4KH2A 4NQEB 2Z9TA 4JDTH 4WLCA 1KN2L 3PWNA 4JHUA 1SVCP 3FO2A 1OGPA 3A22A 4QAWA 4KTGA 4HA1A 5IB5B 2WN3A 4YR6A 4GNKB 1WA1X 4UT7H 1NIBA 3TCTA 3TESA 1DQJA 4XN8A 3JWNC 4OM1L 3ROLB 1YN7A 3ZW3A 2NY6D 1IGFL 3SKJH 3A4DA 4J3OH 3DWTA 5C0CD 4CC1A 1RD6A 2JELH 3BKYH 3HVDA 1E9QA 4LLAA 5E6SB 1GGYA 4HJGB 3BH9A 2V9UA 4PJ9B 5MERB 1JZ3A 5LBVA 4NIKB 3V4UL 1QHPA 1FZOA 3U1SL 5J6HA 3I85A 5LGYA 5E9NA 1FLTX 1EAPA 2QEJA 2OI9B 3AU1A 1RIHH 1OP9A 1F6FB 2YPLD 2O61A 1NSNL 3EOAB 1OB1B 1KCWA 2Z92B 4Z7UE 3U4AA 3DTDA 1O5DT 3VXQB 3KLSA 3OKMB 4G8GD 3IKCB 4KXZI 2ITDA 5CJOL 5ECJE 1AZCA 3X13A 1TKWA 4HFWA 3HR6A 1BOGB 2BZCA 1CN4A 3AQYA 2YD8A 3EH3B 3UL4A 2FJFA 3TNMB 1U58A 3V5DA 4N25A 3ZKXB 2VDOL 4FQXB 5B8CB 2EADA 3ZE1E 4XNMB 2KLRA 2WLNA 3JWNH 5KBDA 4NPJA 3NCCB 4HW6A 5FUCE 3QCVH 4HCRA 5HHQA 5ICZB 1A6AB 4YZFE 2UY6B 3ZE2B 2VJ0A 3H7LA 3PAYA 2R69H 3ECQA 4IBVA 5BOPA 2CRMA 1LK3L 5EUKB 3UZQA 3IMRA 1SPDA 2XXGA 2GI7A 2YLKA 3SKOA 4C55A 4AZUA 3QWRD 3MBEC 1MHEA 3Q2VA 3KJ4B 3MRPB 3VI4E 4X8GA 1A9EA 3S37L 1LDPL 3DARA 4P3DB 4U1LA 1RH8A 3CIQA 3BUYB 4UT9L 2CBTA 3SDDC 4JKPL 4J3BA 4HK0A 5D5MB 2FJHB 1RIUL 2CKBH 3T09A 2MKLC 1YEIH 4X6DB 4OZIF 3GQFA 4AMWA 4L9LA 1B4LA 1XH1A 3VG9C 3OVUB 3TEZA 2WCPA 4A6YL 4H8HA 4Y9BA 1T20B 1TTBA 3QC5X 4AV5A 4C56E 2VDLB 3LKPA 5AZUA 3F7YA 1CFMA 5DUJA 3GNML 4F2MA 2Z64C 4XCNB 4K3GA 3V55A 4B41A 4F9PA 1GCFA 2P24A 5DURB 1KCUL 1H8LA 3C9NB 5AOLA 5SWSB 2EYRA 2OBGA 2PN5A 4QXTA 4FNLH 1DFBL 5CR8A 2VH5L 2XPGA 2TRYA 2P5WA 3QNFA 1USQA 3GXIA 1U8LB 1PAMA 3E9TA 4XC3H 1TZIA 2EJ1A 3CQFA 3VACA 3CK0L 4KZDH 4FTVE 3PJNA 4DPCX 4PBVC 2IADA 3CH1B 1CC3A 2RR3A 3KJ6H 2XQBL 5E51A 2ZYHA 1ZWIA 3SDDD 4ZFOL 3ZL4H 1BOYA 4E68A 1U42A 5IHBA 1QLFA 2Y7QB 3NZ8B 1AR1C 4LRNL 2YGQA 1MLCA 2EIDA 4TVUA 4WDIA 3QNZA 4YUEH 3EYUL 4LSTH 2NY2C 3GKWL 2D9CA 4AEEA 2J6WA 2F74B 4W4OA 1MCPL 1N59B 1IEAA 1N64H 4NZUH 3UO1H 1I8MB 1XCTA 2A83A 3VM7A 4X0KB 4XVJL 1DQVA 3IU3A 1I9IL 3DRQA 5E1HB 1V7NH 2OZ4L 2EEXA 4AYGA 1AXTL 3MI6A 5C0EB 1AHMA 3C75A 4BZ2A 4HZ1A 1W0WA 3MLSH 3PPEA 4P5TA 3JV6B 2ICEB 5E8EA 4R7DA 3PV6A 2H6PA 4IBZA 3CAFA 4AE0A 2EIBA 3T6QC 4O4YH 4PD4K 2WXKA 1UM5L 4G1MB 4XPGH 3M1OA 5D7LB 5DJYB 2NX5B 3PGCA 3EDDA 4JDZB 3BFWA 2RBLA 4N2HA 4L3AA 5ESAB 1Q9WB 4F3FA 4NKOB 2R56L 4QHNB 1AR1D 5C0DA 1SXBA 4PJDB 5AW4B 4Z3IA 3I9GH 4MDRA 4LLQB 5I9QC 1ZHBB 2NY2D 3DX7A 4H8UA 5ABZA 4HUKB 2CU9A 4NRXA 1SJVA 4WNJA 1WFUA 3SJVE 3HZKA 4FS0A 4X9BA 4E9TA 2M2DA 3IKKA 5IK3A 3D0LB 2KHAA 3BT0A 2WLZA 1VFBB 2WZ0A 5DJ2B 5D7IA 1GKOA 5L0QC 1A02N 4JQIA 4N6RB 2VLJB 4XBPA 1E9PA 3GBMH 3TNNB 5DU7A 1FN4B 3CMGA 4GKSB 5GHWL 4U1HA 1IQWL 3ZE2F 3FT2B 3SD5A 2FYYA 4B9PA 1JDAA 1I9JL 1A47A 4TUKL 3VXPA 5EBWB 4P4RA 3KPSE 4HAFA 3OXRB 5IB3B 2YD7A 2UYLB 4MQ7A 2KLSA 5F3HB 4Y8AA 2EDTA 4OZHE 2CMRH 3B6SB 1VAHA 2GIMA 4FJYA 3V6FB 4Y4FA 2D4FA 4ICWA 3U36B 3OTTA 3NIGE 1DDTA 3B43A 3OX8A 4JN1H 4RDQF 5D5MF 3WJJA 2PW2A 3ZOAA 2BWDA 3GTNA 4X6DF 2XV6B 2DJ4A 3BVTA 4N1HB 4KXBA 4Y5VB 2DQCL 4ZOEA 1ZV5A 3ZIYA 3LOWA 3CDZB 2VGLM 1HXMB 1SOXA 1WG3A 3CV5A 4QO1A 2MMXA 5FO7B 2EDHA 3WU1A 2W80C 1YUHA 1NAMA 3WMSA 3JSSA 3MLVL 4Y4KB 5GRVL 3SGJA 3VFRA 1AIFA 1ZPUA 1Z5LA 3TF7C 2Q0ZX 5F70A 2Q8BL 1MXGA 3VXMB 3SE9H 4G11A 3T77A 2GSMB 2ESVB 2C5DC 1TUPA 4FFZA 4PCSA 5C7XL 1HJBC 1TPXB 3NAAL 2C34A 4L23A 3TYGH 2F15A 4JRXE 2DWTA 4Y7OC 2MCMA 1FI8C 3QFJB 4PG2A 3W3BA 5D2LE 4DO4A 1DHKA 5K59E 2V7NB 3QWNA 5CEXA 4FX5A 2ROXA 5K93A 3T2OA 3VI3E 3BSZA 3HNTH 1SY6A 4FNUA 5IHHA 4U3SA 5LXVA 3QQ3B 2G3MA 5E0FA 4Y9CA 1X5ZA 3O9WB 4IGBB 5E4OA 4G8FB 1LGVA 2GUOA 4YHPA 4PHXA 1JPSH 2JB6A 5AVYB 5C0CE 1U3ZA 2AEPH 5KYYA 2B08A 2BC4B 1EZLA 4GFXA 4MQXC 4X6FA 2WLJA 4KUZH 2HLAA 2XYBA 3LKOA 2OMVB 3US1A 1KJ2B 4B9JA 2IANA 4N2GA 3TCXA 4FQQA 4BH8A 4PJEE 2GHZA 4GBXA 3S5LB 4KI1A 4NFCA 1HINH 4QTIL 1NCWH 1NMCB 1JK9B 3FL7A 4HF5H 4K71B 4G8GE 1IM9A 4P57B 4UINH 2XTJC 3C5JA 3ABMB 3IU4L 1J9QA 3RL1B 4XE5B 5A2IH 4NAJA 5I1KH 2BRRL 1J5OH 4XHJC 2P46B 4PJDF 1RZIA 4NC0B 3IXAB 3ZO0A 1RK1B 1NBVH 2LU3A 3NFSL 5TDOA 1F4HA 2D2CC 3ZUNC 5F3BA 2X1XR 1OT4A 3O41B 4DGVH 1TJHH 2OL3L 2WVVB 1UZ6F 2VLMD 3L5JA 5L4IA 1EDHA 4K23L 4W6YB 5MI0C 5E5MB 3LRGA 3ZKNC 4MQXD 1FRGL 3MLZH 1AO7E 1NC2D 1XQ4A 4ALAC 1CLVA 3BJLA 3BC9A 4F8OA 5BUAA 2QDVA 4ZMXA 3QA3A 4WWKC 1JN6B 3BCFA 4P5MB 4GQPH 2UXGA 1B9KA 3TO2A 2V3FA 2X9YA 3V6ZA 4WW1B 4M48L 2YN3A 3D7PA 3QUMA 5IW1A 1MRFH 3FN9A 2XTJD 3RP1A 4BSWB 4YJZL 1SXAA 1UD5A 3CN3A 5GISL 1N67A 3QUXC 5CP7A 5EA0L 4XHJD 2W9DL 2Z0UA 5L8JB 2V2TA 3NIFE 1RZFH 4QHMA 2VRAA 4GSUA 3RZCB 1COBA 2VLLB 3QK0A 3M1BA 1MCWW 1UYWH 5A16B 4PJCA 5HVHB 4Y1AB 4IBQA 1I85C 3CHQA 2BY0A 5DSCB 1RZ8B 5JW5A 1OHZA 3VXUB 4MNHA 2AJZB 3QPQD 4FLOA 4XO8A 1X5KA 1SLVA 4WWKD 5K9JL 1YEHH 5EIIB 2EE0A 3UTQA 3KGSA 2XHNA 2CO6B 4DIXA 2W38A 5E9AA 4HCFA 1PD1A 1MSPA 1JXGA 2C1OB 4FNPA 4MZ3A 4NO2A 4RZCA 4ZG1A 3WXWL 4TYUA 3WNMA 3MRDB 1T80A 3GSNL 4CMHC 1I7RA 5L4FA 1XGTA 4S0HA 4D8PB 1AZZC 4RGMB 4J39A 1TYJA 4MA3B 2DWXA 3QEGL 4N6QA 1KGJA 3OR6B 1AXSA 5DVLA 1MJ7H 3K81A 3RWFB 4N68A 3E3QC 4KJPC 5EH1A 3TA3A 1AFVL 1E40A 2ZF8A 2NSXA 1TSHA 4QCIA 3MNZB 3FO1B 3L17A 4XHQA 3F62A 4EO5A 1H6FA 3FHEA 1P69B 2M1KA 5J8OA 5IESH 5FYLD 1JPST 3QH3A 4F9PC 4P0DA 1X7QA 2A3TA 4L3EA 1H3UA 1UT2A 3FTYA 1S7TB 1WDAA 4DFHA 2E47A 2XFGB 2XLLA 3TZVA 4WK0B 2NY7H 2YAMA 4U7SA 1Y1DA 3S7GA 4ODHL 1FNSL 1XB3A 5HHXL 4NUMA 3ARSA 1KCSL 1H3WM 2XZCH 2WUBL 4S1RH 4FXLA 1CFTB 5MEPB 4NLHA 4HUXB 2FJSA 4Y5XA 1F3RB 4H0LC 5KBPA 4P3CH 4HIIA 1FCGA 2H0EA 3P9LA 3MJ7A 3RU8H 4GXFA 3SE4A 4KX9A 3N06B 1TXKA 3MNMA 1AMXA 4TLTA 3I9IA 2VR8A 4UZUA 3JV0A 4E5XB 1GZHA 1T7XA 2F5AH 2DL2A 4U6TA 5AAWA 2XA8H 3QQ9C 1SBBA 1WCBA 4IU2B 1SUHA 1CE6B 4W4OC 2FT6A 3APMA 3NSXA 3NA9H 3C6EA 1ZAGA 3HHMA 1IEBA 4LAQH 2LLLA 1QNZH 2XG4A 4PR5A 2IEPA 1DVUA 1P5UC 2V3DA 1XCQB 2K3TA 3ESOA 4IHOA 4R7NB 2A6KB 5I5RA 5DD0L 2W65A 3MJ8B 1IAIM 2APSA 2D9QB 3PXLA 2YMXH 3JVFC 2VR4A 1JV5B 4G7VL 3OF6A 1TTRA 1VENA 4RX4A 2ADFL 2DQUH 4YK4C 1CU4L 4AQ1B 2PWGA 1XF3B 8PAZA 2YSSA 3CFJA 1S4IA 3LAFA 2IDSA 3CPUA 2GI0A 4N1CA 2C3GA 1ETJA 4KQ4L 5JIHA 3JWDC 5LKNA 1NCGA 2EDXA 3L3DB 3MYZA 4JM4L 3OMAB 5AVZB 1MWAA 2OJZH 3KLKA 1MJ8L 3QQ9D 5I30L 2K3HA 1HN1A 4LARH 4W9FC 3SN6N 2YEZA 4JUTA 2VUKA 1DN0A 5D1XB 5K9KA 1YQVL 2ZE0A 4M7JL 4FXKC 5KTEH 2DQJL 3NRFA 2VDLH 1IE5A 3SQBB 2ZXEB 1VFOA 1PG7L 3GZKA 1PDKB 4S1QL 2O5XL 2DQHH 3DK0A 1SJEA 4LBAA 4U6HB 1BVKB 3M7OA 3IGAB 3LN4A 1ONQB 4JZNB 1K6QL 5E4AA 2G2RA 5D96C 4B3VA 4PBDA 2IOIA 3F85A 1DVFC 2BS8A 4NM4L 4IKKA 5DK2B 1H3VA 3ARVA 5H35A 4WJ5A 2Q7NA 3BUIA 4XP6L 4YFEA 4HUWA 2X42A 1NKGA 3RWEA 3RL2B 3TN0A 5CEZH 2F9BT 2F53B 4QRSB 3ZDZE 3VWJC 2AAAA 2NNRA 4G7QB 4QXUH 2ZWSA 4YN3A 1R3IH 4ZXBB 1QA9B 3WJJC 4RMVA 1G0DA 5DGQA 3VGBA 3CVIL 1KC5H 3D48R 1FIGL 1WWWX 3L2LA 4GUPB 4TOYL 1U8JB 2ALAA 3X11A 4JY4A 3FHQA 1I8IB 5LQBL 12E8H 1KB5B 2P7TB 1OE2A 2OMWA 3E2HB 4XH2A 4G9DA 1RMFH 4D9QD 4PYHA 1UJ3B 3C6LA 1JWSB 1OIOA 3PU7A 4XRCA 1NCDL 1HQ4A 1DVFD 5AVUB 2DTMH 2A77L 1CDBA 1F1DA 1ND0A 3U79A 2YRZA 4WV1C 2ICWB 2J12B 2XY2A 4BBWA 5C0GB 3W39A 4KPHH 4JQXC 5DFAA 1QFPA 4JFDB 4NQDA 2XWJB 1IX2A 3O81A 5KVFH 2CK0L 2COQA 4OQTL 3VWJD 4AL8C 3AT9A 2D2OA 4YDKH 4PG2C 3B2VH 3WN5C 4ZUVB 1HL5A 1UFGA 2EUWA 4QJ3B 5JQ6H 3NSYA 2WXHA 1BZ7B 4RBPH 2BSSA 2OSXA 5J6GA 4N8VB 5DZ9A 4TLKA 2H1PL 1TEYA 3HG3A 3JTSA 4DF9A 1ZT7A 3P4MB 4X2UA 2W60A 4JVPA 3VGAC 2DQFB 3I02B 3D3VB 4I48B 4J27A 4NN7B 2F54B 1RK0A 3T1FB 4P4KA 2ZKYA 1L0QA 4Z7OB 1RJZA 5E08H 6TAAA 3VRJA 4QKTA 1HOCB 1KY6A 3LQAC 1OARL 3MRIA 1NLDL 1QFUH 3S48A 3WFEH 4KZEL 1ZS2A 1NCNA 3K74B 4D0BA 2UXVA 3DI3B 1BQLL 3IJEA 1I7UA 2XTJE 1HNGA 1E5YA 4FABL 2PYED 1JVKA 2V3EA 5AOJA 5FHAL 3L5IA 2D0HA 3OKDB 5I6PA 3TA4D 3WJLA 1U8CB 2XNAB 1I8LA 5CEYB 4DGYL 1QFWL 3PYCA 3S4SG 3TU6A 1GY2A 2NRDA 3M88A 2XU9A 3GK8L 1C5CL 5I8KH 3CCHB 3M8OL 4KVCH 4WSJA 5G4OA 5FKPB 3RIAF 1FLRH 3WMPA 4MD0A 1IFHL 5DC2A 4M1DH 4JKMA 5HVWA 1IBHA 4DAGL 1CE1L 4ANVA 3WO4B 2MQ0A 1J8HB 1YQ2A 3IDMA 1F4XL 3B56A 5ALCL 5B4MD 1AD9A 4OUUA 1MN4A 3HS8A 1BVNP 2YN5A 1EZVY 5BVPL 5FFGA 1DEEA 5ISZD 4BZ2L 5F0PB 1RJLB 3RNQA 4F37F 5ETUB 1TQSA 4M61A 1JPTH 1V05A 4Z7NE 2W95A 2J21A 1TMCB 1ICTA 3QZPA 1CGTA 1IM9D 1CBJA 1R33A 5DUPH 5EEYA 2YJLA 1HHIB 3IJYA 3L6FB 2BSBA 4TQ8A 5BV7C 3T9WA 1YNTA 5EWIL 1A2YB 1BIHA 3GBDA 3OQRA 3TBYB 2WZ6A 4KHXL 1SXSA 2X6VA 2BVOA 5CXPA 4YDNA 1SJHA 5A1AA 2AEQL 3V4LA 3WAJA 4PRID 2ZPKH 4JHAL 5F7HA 1ZA3B 1SZNA 2CGYA 3BFOA 1IM3B 1THAA 3O6FB 3VRLE 1EUUA 5JOEA 1E67A 4EVNA 1BWMA 5I26A 3D85A 4TRPL 1JXJA 2BOCA 4OIIL 5GGVH 1ZLWH 4JQIL 5KSVB 5DMKB 2WBJA 4UT6A 3ARFC 2Y69B 4LO9A 5M94B 1BGXH 1GL4B 2OMZB 4HOZA 3HBGA 3EDFA 2A6IA 1BMGA 2R29L 4CILA 4G72B 2FEJA 4NNPL 2XKNA 4PJIB 1KXTA 4Y8DC 3E3QE 4YBLC 5BZWA 4F7CB 1A0QH 3WFDH 4X5WB 4TN9A 1E43A 1ZE3H 2D3LA 1EFXA 3K1DA 3CBKB 3CFUA 1N6UA 5LGJA 4Z3TA 4FTDA 5AB2A 3KYKH 4F2ME 1M7IA 3GHEH 2APTA 5BNXD 2ZOLA 4CSTA 3DIVA 3T1WA 4ODTH 5FDWA 3N44B 3ZRFC 5IVZA 1P5VB 4UANA 5ACMA 2GITA 1AGFA 3NJIA 1NL0L 2X41A 1XWVA 1W15A 2P5WE 2YBGA 1WAPA 3DO4A 5I6MA 1EEYA 3TBVB 3OAUL 3RYMA 4Z7OF 3ARFD 1Q72L 3BKMH 4L8CA 3TZVC 1NAML 3ARQA 5KEZA 3MA9H 3FMGL 4YHOL 5BRZD 3A6BL 3BQUC 4S1SL 2V17L 4J3OG 5EO0A 1BMWA 2X4UA 3S2CA 4PB0L 2YAFA 2W59A 2EUXA 5B39G 5IB1B 1WP6A 1QEXA 1CF1A 1T7YA 2P48B 4K8RC 5AKRA 2XN9D 1IIIA 2WBKA 4JPKH 4H88H 3F04A 3SE4C 2QQNL 4X0NA 4AQEA 2LGNA 3RIKA 4YHLH 1DBBL 1W8NA 2WYHA 3NCFB 2EXTA 1GZHC 1X44A 3TA3D 1EHLL 1I7ZA 4K3DH 4KK9C 4LL1A 5AAWC 2E5EA 3BSZL 3OJMB 4YS4A 2BNRB 1SY6L 4UTBA 1WFIA 4L1TA 2CDGA 3ZMRA 4FEIA 1I3GL 2B1HH 5IJBC 3CFDB 2UZYB 3GSVB 1SOQA 3QJFB 3QXUA 2DLFH 2CA3A 4L3ED 2DQDL 3BDYH 3S4SA 4JO5A 3KVQA 3TZVD 4XNAA 2ZNWA 3RLSA 1R3LB 3RZWA 1EMTH 4DKEH 1NCOA 4HKBA 3WTXA 2E7DA 4WTXA 5DHVA 4U4BA 3X12B 4MJHA 4TMPA 3T65A 2ZKWA 3RA7L 5IEHB 4GAJL 3WFBL 1EA9C 3C5ZA 1ROCA 2WTRB 3C8DA 2CRYA 4K8RH 3H4HA 5FFLA 4PRDA 3MRFB 2Z1KA 3RBSA 4KK9D 4NO0A 1D5IL 5B3JE 1NA8A 2OTWB 4QYOA 5EHFA 4N2OA 4X80L 2GY5A 2VQ4A 5EO1A 3G6AA 4GQZA 2VQ1A 4YX2H 3BESR 4GKLA 3A24A 5IW1B 3UTSB 2QVIA 4YSQA 4Q9QL 3WIIH 1M2OA 2X09A 3UJIL 5F3FA 5I0ZA 1W16A 5HPOA 3OWEA 3N6YA 4WU7A 1UWEL 4LIQE 4QHUA 1ECZA 3MCKB 4GAFB 4K73A 4Z7VB 3EJQA 3OF6D 1G0YR 4GIPD 2Y07L 3QPKA 4LLDA 4RX4D 4P46A 1HHHA 3WNIA 2J8HA 4BRJA 3S98A 1A7NL 4BINA 5GS0D 1JF1A 2GYSA 1KYUA 3K2MC 2J1YA 3QUML 4Y9GA 2ZCLL 3U7AA 2X4QA 5CJXA 2EC9T 1XGQB 1DL7L 3FQNA 2DYPD 4HU8A 3CLWA 4PJIF 4FZEL 1XAUA 4GG8B 5HI4C 4UMGA 1AGEB 2PXYB 3Q8AA 2YD4A 5D93B 1B4TA 2R7EA 3ZKMC 2FLRT 4R0LA 5BRQA 1JRHL 4HDIA 4NUGL 3BW9B 3NYKA 2HKHH 5DLMH 2NY5H 4Z78A 1PX4A 2LTQB 3HMXA 1THCA 1L9SA 5T3ZH 4APXA 4RRPG 1OZTG 1H6EA 1I8KB 4LCWA 3P2TA 3SBWA 3CUPA 3TX4A 5K1VA 5CKGA 2EKSA 4MJJA 3SIKA 4QRUA 3C6LC 5I1LB 3EJUA 3VX1A 1UA6L 2X4OA 5TK2A 1JYNA 1T66C 4M43L 2VZ1A 2ZX6A 4QRBA 5IMMB 4DO6A 3ULVL 2YPVL 4GW5B 5L88L 4FCHA 2MPAL 4X8XA 3BAXA 3GGWA 3DXAB 3QP3A 2OSLA 3FRPG 3KLHC 3HIZA 1OY3B 2XQYK 5HI4D 3K6NA 3D33A 3UCRA 1ZLSH 1I8AA 3PXHA 5DJXA 4LVNB 2WOBA 4XB8A 3ZKMD 4WSGA 3WTUA 2E9GA 2HFTA 1XVSA 5JHMA 1EVTC 1LQSR 2AQ1A 2Z93B 3UX9B 2AQ2A 4FMFA 1ZIBA 5HY9A 2DWSA 2R51A 1NMAL 4G6JH 5ID0A 5D7KD 5B39A 1X9RA 2FUQA 1NCBH 1WA2X 1TLKA 5J13B 3SCMA 1RUKL 5T1LA 2R1YB 4L29B 2NTFB 1M71B 5FB8B 4P4KC 3C6LD 1TETL 1KXHA 2IANE 2VW4A 4GP4B 1R0AL 2OK0L 2R23B 1T66D 3MZTA 4TNVK 1JPGA 4DHLA 1VIWA 3L4ZA 5HGHA 3KVPA 3MRMA 3ZQ9A 3QRBA 2ADGA 5I6XB 1F6AA 2GAZB 3L16A 4K55A 1ES0B 3OPZH 4JM0A 4ZTOL 3KLHD 1SMOA 2B5IB 2K70A 2UY7B 2APFA 2Y5EA 4G80B 4NQDD 3ZHNA 1ADQL 5DJAA 5CMAB 4G8IB 3VFWB 1JNHB 1JPEA 1KZYA 4JO1H 3SY0A 3FTGB 4OV6F 1S3KH 2WJ7A 2VB5A 3ZRSA 4HBQA 4PTUB 5JNYB 3V8CA 3VWKB 1NCAL 5DYOA 1M2VB 3RVUC 3LEYH 4LSRH 4MB1A 4OAWB 3DHMA 2VWEC 5TF1H 1G4RA 4G6ML 1AS6A 1LDSA 1HWGB 4JL1A 4P4KD 2HTLD 5BO1L 2DS4A 2GG1A 3P77A 4L48A 1QOKA 1U93B 4P9ML 1QLEL 1KB5H 3KYMA 3MV7B 1QSFA 3EO9L 5T1MA 4R3SA 3QIUA 4OQ1A 3UOAB 2K6ZA 1E8ZA 3RB5A 4CVUA 3PWVA 3BZ5A 4YH6A 4ZMTA 2B9AA 2G4EA 3NP3A 3O4LD 5HDBB 3VGHA 3PUUA 4Z7VF 1A1OB 5BW7A 4NKIL 2H26A 2X0UA 4E0RA 2F7QA 5INCA 2CKBA