4Z3JA

Crystal structure of the lectin domain of papg from e. coli bi47 in space group p1
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
196
structure length
196
Chain Sequence
AWNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPGIATVTWNQCNGPEFADGSWAYYREYIAWVVFPKKVMTKNGYPLFIEVHNKGSWSEENTGDNDSYFFLKGYKWDQRAFDTANLCQKPGETTRLTEKFDDIIFKVALPADLPLGDYSVTIPYTSGIQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords PapG, lectin domain
publication title An unexpected way nature improves solvation entropy
rcsb
source organism Escherichia coli
total genus 45
structure length 196
sequence length 196
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1370 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesin receptor binding domain 4z3jA00
4Z3IA 1J8RA 4Z3JA 1J8SA 4Z3FA 4Z3EA 4Z3HA 4Z3GA
chains in the Genus database with same CATH superfamily
5FC9A 4FTDA 2DQUH 3SGKC 3EYOA 1QR4A 3ZHKA 43C9A 1FAKT 1HILA 4FHBD 3X1BA 5J6SA 2CA3A 4S1DD 3SGEI 3BH8A 3F84A 3N91A 1GW0A 3QEQE 2EICA 1OQOA 3EOTL 2DF3A 2C26A 4PP1D 3V0JA 4ACPA 4PLKD 4LCUA 4ZFFA 1YC7A 3CJJA 4X4XA 1CC3A 1BJ8A 4N3UA 4J3OF 2PP9A 5BV7H 4LAQH 1J1XL 4E68A 2YXWA 2B0SL 1SOKA 1PZ5B 5DJ0A 3S96B 3QG7L 1IU1A 3CLEL 1YY8A 3MCG1 1PQZB 4CKVX 4DPAX 4JE4B 1PAMA 4OQTA 3HKZA 3A47A 3PQYA 1A9EA 1XL6A 1C12B 1I8UA 3ARYA 3MXWL 2NY1B 4R4BA 2XCMC 2TSAA 3MPCA 3VG9B 3X14B 3LV3A 1F0LA 3PWPB 5CEZH 2FWLB 1GTNA 3GEFA 3HI6H 1A6TA 2E86A 3MVSA 1G0DA 1UOLA 4KHTL 4PVLA 2BSRA 2H26B 3BO8B 3BZ4B 5BCAA 5C1MB 4M8QB 1T7VA 3BD3A 3NQIA 2VNCA 3AACA 1CFSA 3RTLA 2X4PA 4UQEA 3L7EB 1OOAA 1DQLL 5T1KA 1YUHA 4KV5F 5E9DA 3IDUA 3K0WA 2EE2A 4DETA 4Y7MA 5D1ZC 5CHNA 1K8DA 2J5LC 1KBVA 4PJIA 4PRBB 2P8LB 2IIJA 4P23B 2DH2A 4N8CH 2AC0A 2ZKYA 4GRWF 4UAHA 1JZGA 2PPCA 1ZT4B 4LLMA 4UUJB 3EYVB 4P2QE 3ZOAA 1XV8A 3FCBA 2N7SA 3D85A 1BMGA 2C9SA 1XXFC 4FQPA 3VXMD 4M1DH 4NM8H 4BK5C 3LNGA 1WSST 1QLEL 1Z9PA 3MSPA 3TV3H 1KJMA 1UASA 4NUGL 2F15A 4NXKA 4PBVC 1BZ9B 4U1LB 3TZVA 3VXOB 4KX9A 3ULUF 3GMMA 5F7MC 4OI9A 4GW1B 3SE3C 3L3HB 4MWFB 2YPLE 4UM8B 2O4EA 4MQSB 3ZHLA 3VM5A 3ULAB 1XSOA 3NZHH 5AB9A 4EDWL 3CN3A 1TTRA 2Y1ZA 1SN2A 3MMEA 4G8GE 4KQ3H 3BAXA 3TBSB 3V4PB 4YSRA 3V5DB 4JK0D 2ZTBA 1A6VL 3E9UA 1VGKB 4I5BB 3SE8H 1HYSC 4GBXD 4I85A 2W9EL 4JRFA 2Y6SD 1D9KB 3IDMA 3FYIB 2B20A 4JFEB 5E2UL 4Z0XA 3WIAA 1EAQA 5JOEA 1UB6A 2Q8AH 2NXZC 1AZBA 2NTFB 4OF0A 4U6VH 4R2GB 5ADPH 2IQ9L 2YKKA 4M5TA 4E9VA 4QRBA 1Q9WA 3BKJL 1NTDA 3OL2A 1L7IL 3GNMH 2V2TB 1DQDH 4MJJA 3WKYA 1JF5A 2A38A 4CC0A 1M2VB 4JL2A 4F3FB 4HS3A 2XOTA 4FMVA 5EZPA 4UIKH 2BHYA 1RZKL 4NJAH 4YDVA 2CLZA 4N0FA 4JANA 3N44B 4DUXA 3C8HA 2XWCA 4QRRA 4KKBD 4X4ZA 4I9WE 3EJTA 4PTTA 2G9KA 4XCEA 5DZVA 3L54A 4OT1L 4OV6F 2PWHA 5JMRA 1KYOJ 1QBLH 5D9SA 3OLEA 3QI9D 4LPXA 2DJMA 2IF7A 1FIGL 1KXTA 2NUPA 4OZFG 4U1GB 4Y5VA 5HHPA 5HYJD 2B1AL 4GXVL 5JHDA 1I4FB 1KPUA 4HS8L 5K1NA 4Z7VA 1AQDA 2DYPD 1N7MH 4JRYE 3NIGB 5K59F 5FYJL 1TCRA 2ZJSL 4M5ZH 1A7BA 2DWYA 3ROLB 2J72A 2WXPA 4H26B 5D71L 3H56A 2VDRL 3ARGD 1ZT7A 1H15A 2Z3FA 4MAYB 4GXUM 5IB1A 3RVWD 5C0DB 4K55A 4WJ5A 5F3HB 1S8DA 3SDDB 1NL0H 5EU5A 1OCWL 1LO0L 3KW8A 1HOCA 1EZVX 5F7AA 1E28A 3RTQA 1G7PA 4WO0A 4NQEB 2HJFB 5D5MB 3RI5K 1A22B 4L18A 5HGDA 2OP4L 4A63A 3PDOB 3OAYH 2DEYX 4XCYB 3T8MA 2VXUL 5EF3A 3GHBH 2NQDA 4KROC 4AQEB 2Z64C 3NACL 2YD6A 3ZDXB 5ISZD 1L3WA 1AS8A 3HPLA 2GVYA 5KYUA 4BZYA 5EF2A 4JO4H 3U0TA 2YSSB 4ODHL 1AGEB 1Q0YL 1NCGA 1KCUH 3P0VL 3QO1A 4FG2A 2BP0B 5AVSB 4BGLA 4ZQTA 2QGCA 3F83A 3D3VD 2Y1AA 2MCAA 3WJJA 2PPFA 3QJQB 2W88A 5TF1H 5DVKA 3BISA 1UXWA 3PABA 1QI3A 2ZWZA 1XF4A 2WKOA 3FB5A 4TV3A 3V0WL 3OR6A 2NQCA 4GT0A 2R23B 4JR9H 4KUCD 4JN2A 1R3KB 3VVVA 1SOQA 1X5FA 3PHQA 1ONQB 5LHDA 5GIRA 3UTQB 1HYRC 2WQSA 1RK1A 1YHPA 5C0CE 3QFJD 3UPRB 4WFGE 3TNMB 1MEXH 3HNVH 5JXED 3S98A 3EO1A 3GBNH 1PBYA 1BFTA 1ZEAH 5T33L 3LIZL 1E5AA 3ARBD 1GZPB 4MNQD 5HYQB 5F7DB 1N5YH 2I85A 3NJLA 2AV7B 5GQBA 3JVGA 3TS8A 3KPRB 4RZCA 3TV8A 2ZUWA 4JDZB 2YD2A 4KQ0A 5IFAL 2IALB 3ABKB 4GG8A 5KANG 4LHUB 4PJAF 2VE6B 2VDPB 2WIIB 4AENB 1LM8V 1ND0B 4TL4A 3LZOA 4HKZB 4K94C 2UY6B 1M05B 3QXVA 2LOEA 4M6AA 4M9OA 3FO2B 2WBXA 2KKQA 4UOZA 4DCQA 1XXDC 4I2XE 2I9LB 5DD1L 2CK0L 2JKRM 2PXYA 4I87A 5CBEB 2VDQL 1RPUA 1JTOA 5FS5A 4OAWA 3RWJA 3DX9A 1IIIA 1NC4A 1G6RB 1NM9A 1BD2D 2Y0SA 3UIZA 2G75B 2FT7A 4K7PX 6TAAA 4OZHA 4NLAA 1KT2A 4AW4A 5IV2B 1PDKB 2WQ8A 4NC2B 2R83A 3ABMB 1NGWA 1A4JB 3NJKA 3SCMD 1B88A 2B08A 4G5ZL 2FIRT 5EHFA 3ULVD 2ROYA 3HZVB 2APFA 4JAMA 1WD9A 2L7EA 2L3BA 3T0XA 2YQ2A 1WGOA 4WO4A 4AYFA 3W9EB 3WIHA 4M00A 1FG2A 4YBLB 3UYPB 4M7KL 1ETZA 1IBGL 4FZEL 1ZS8A 5ESVA 1DJSA 3JTTB 1V3KA 2VRKA 4W6WB 1EAJA 3L3IA 4AE0A 2VMJA 5IREA 4U7KA 1OGAA 3GWJA 4BV1A 4PRDA 3UZEC 5DUPL 5M94B 3FW6A 3HAEH 1I85A 1KCBA 4DUWA 5D4HA 4JY6A 4NJ9H 12E8H 4CVXA 3GJFK 1CLZL 3NAAL 1R5WB 2GJ6A 2QV4A 5IQ9A 3WIIH 1DVFA 1TQCB 5HYSB 4KVNL 5L6YH 3HNTL 2FAUA 1QFWL 4KTDH 4IIQB 4MRBA 5F96H 2H6OA 3PHSA 5CMAA 5SWSB 4F1SA 1AP2B 4FNPA 1T7WA 2A83A 2H47C 2F7PA 1UA6H 3GXDA 4KJYA 5EB9A 3QIWA 2DM4A 5JW3H 2HH0H 2XN9B 3HCVB 3L48A 5T3XH 1I7ZA 2KC0A 2C7UB 3V9FA 4GP4B 1OAUL 3Q1SL 1NOAA 3NZ8B 3L2LA 3V4VH 1ZSHA 1E3XA 5FO9B 1U3HB 1FYTB 2UZIL 3DUSA 2F6AA 4FABL 1FVDA 1U58B 3QNYA 5AVYB 4MA7L 5C2BL 3LXCA 1XGYL 5GGQH 5C9JA 3POHA 1JPTL 1BVKA 1GC1C 1BBDH 5D7JA 1T0MB 2MHAB 1QSZA 3C60A 2HVBA 4ZZFA 3CG8A 5ACZB 4UQ2B 1AR1C 2WCPA 3SYPA 3HE7B 5DJDA 3NP3A 5AYUL 3SJVB 4RAHA 4PJDE 2BSSB 4Z8FL 4NN6B 1AZNA 5FK9A 1CR9H 1NFDA 2V37A 2XVGA 5KSAD 3LSOB 4I1NB 1AQ8A 5HHNA 2X2IA 2HFTA 4RVBA 1Q94A 4GXFA 5J9PA 4WHTA 3OPZL 2Q76A 4JO2H 2Q1EA 1SUJA 3PWNA 4OGYH 3SGKA 1ERNA 4AJYV 4OIFA 5KW9L 5E8EA 5AD0A 1PX3A 4FLOA 5CR1A 4OJFH 3FJTA 3A6BH 4HIEA 2X1QA 4N8VG 3DBXB 3VI3E 4HJEA 5ICXA 4ZAKC 4DJMA 4UDUB 3UBXI 5IJKC 4A68A 2TRYA 4UNTA 5JIKA 1OAXH 4PJGF 2QVKA 5E8PA 4GI9A 3IN0A 3N04A 3A23A 1P4UA 1QSEB 3PWVB 2ZAHA 4NCC1 1FFOA 2UZPA 2X7LB 4FGMA 3GXMA 4JGJA 3MBEC 1DANU 5F7WC 3VXNA 4PHZA 4XX5A 4FZ8H 3US1A 2Y2WA 3MJ9L 5F97E 4KXBA 1VKXA 1XTLA 1KF9B 1OGPA 1H3PL 3EUUA 3KYKH 3MA7A 2J56A 1MCPL 5F0MB 3STZA 1KCVL 4ODXB 4PJ8A 4WU7A 2ITFA 5IMLA 1WFNA 1Z9SB 1YEFL 5TE6L 4XNUH 5CEXA 3WNPA 5E8NA 4EXKA 5D1XD 5FM5M 3RVXD 4DGIL 4MMZB 5HYFA 1A21A 2RTTA 5DRZB 5SX4H 4P2CG 2YS4A 3KJ4B 3LH8A 3X17A 2ZONA 5BUPA 2XPGB 4KY2A 2WZAA 4LLQA 3QP3A 1FQ9C 3MYJB 1TYJA 5KBDA 2HTKC 3FUKA 4CSZA 1VEOA 1TT6A 2I5YH 4OJYA 3U4AA 3IGLA 3LKNB 4OF5A 1KCRL 2Z0UA 2UXGA 4AL8L 4BK5A 3BMVA 1BVNT 4MX7A 2AJYH 5EULV 3CMGA 3TO2A 1HYSD 1OZUA 5C09B 5FFOA 2O72A 4W9FC 4UTBL 3ZO9A 3B5GA 3APDA 4OCWL 1WIPA 4XNZC 5FGSA 3D0LA 4TQIA 1C8QA 1MVYA 3EAKA 3GJFA 1RSYA 1R3JB 2DWXA 2A9CA 2J88H 4LSUL 5E6YA 4G43A 1HSAB 3LDBC 2WLHA 3VFUB 4M8RA 1IM9D 2NY0D 5EOTA 1ZLSL 1MHEA 1WG3A 1PSKL 3NPSB 1T5XB 3M86A 2D9CA 2BNRD 2PWGA 4E2OA 1RCYA 2ODHA 3J07A 1GHFL 1OB0A 1DE4A 1Q9OB 3DX2A 5DEZA 3UAJC 3IE9A 2P8PB 4G1MA 5KTEH 3P02A 1LTXA 2HKFL 2XXGA 3O4LA 4ZG1A 3MACL 4QXUH 4I4WB 3SPCA 5D7SL 1I8LA 4XMXA 1DUYB 2CKBL 5FFGA 2BS8A 1E4XI 1T3FB 3DX8B 4CMMA 1FZKA 1NCCL 1GY2A 3CVHA 4ECNA 1ZXKA 4TSCL 4BYHA 1FC2D 1DVYA 4LBAA 4X8CA 5CWSB 4MQXC 3L3KA 4O2EB 2OMXB 3NEXA 2FSEA 3VRJB 1WTGT 3V6FB 1T21B 3SDAC 1OAZL 3N1MC 1XD1A 1MI5A 3HUJB 3NJGA 4H20H 4XMPL 3M17A 3VD3A 2IGFH 4HIQA 3ZDYE 1SVZA 3LMJH 4L1TA 3R8BB 3U0PB 3PV6A 3P54A 4U6TA 2PMZA 4PWKA 2NW3A 1GKEA 5FYKL 2Y5EA 4ANKA 2FIKB 1K6QL 2XWRA 4TQPA 3MZTA 4HUUB 1CXIA 2R56H 4OFKA 1EUUA 5DQJB 4DNLA 3O2DH 3O8XC 4JVPA 4LDOB 2LVCA 4K3DH 4P2QB 5TH2A 4Q9QH 3MRKB 4UT6L 5SWQA 1UJTA 2YUVA 3AJ7A 3O3BA 3GYRA 3TCXA 5BV7L 3LN5A 3VSUA 3HI1A 4J3XA 1A3RL 4WI4A 1WCBB 3QUGA 2ZCHL 3KDPB 3U2JA 4LBEA 4EUPA 1A6AA 1DQQB 1PJWA 4NIYE 2E9IA 2ENYA 32C2B 2YPLB 3HLAA 1WFMA 2H0FA 3QUZC 4V1DD 1L4IA 1NCUA 3TBWA 4DKTA 4LLWB 1MDTA 4XXDA 2P52A 4G8GB 2WYHA 3BSZL 2MTAA 3BESR 3QZNA 3ZKXC 4XNAA 2IPKB 3FO1A 3L5JA 4G7YH 1AJ7L 4PWGA 1QWUA 5BQDA 3I6SA 2ZCLL 1HHIA 1G9MH 4WWKA 4D9QD 4LCCB 5CKGA 4OZFH 2GAZB 4FL4B 5DF0A 3WEBA 5CIPH 3P4NA 2K4WA 3A24A 2QADD 1I9IL 5ADOH 3GBMH 4U1SB 4G7VH 4AYEC 5JHLL 3AS1A 5CGTA 3MXVH 1CK0H 4PH8A 4Z9KB 4YDKH 3TJEL 4JB9H 4G8FB 5IEHA 1JV5B 4LLVA 2C3GA 2OSYA 3FH5A 4KKNA 1K5WA 1U3JA 4HC1A 1S7TA 3V9EA 1NGQL 1TIUA 3KG5A 4PJFA 4KI5E 2VH5L 3TFBA 4PG2A 3UZVA 4Y9FA 1NEZB 5HHVH 1OAYL 1X9LA 1K4CB 4PLNC 4KKPA 4DQAA 4RAUA 2EZ0D 1GOGA 5C0RL 3BPNC 3NFPB 1DQVA 5BOJA 3NJJA 2BIIA 5SWZA 1WH0A 2FUQA 3TO4D 2OMUA 4JRYB 3ZMEA 2ZXDA 3ZHFA 4JRXD 1UCBH 5L8LB 4HLEA 3U9UA 5B3JF 3K71A 3JV4A 2AV1B 1PTZA 1RVFH 3IU3A 1GPOH 3V95A 4NI3A 3QCVH 3N44F 3FUMA 1MHHA 1W0VA 1E27A 3DA0A 3RWGB 4NC1E 5GGVY 1XGTB 4I8DA 5L2JB 3AQYA 3NCYS 5DK2B 5AW4B 4L4VD 2NX5E 4WTQA 3VTTA 2GTZB 1JZ2A 1JDCA 4YEFA 3K6SB 5F21B 3GNML 4ILDA 1GJUA 3RIAK 2NY6D 1BJMA 1EO8L 3P0GB 4KZCA 4EIBA 4UT9A 1NBZA 1PG7X 5LNGA 3AS0A 3NRFA 3NIGF 4UIKL 3OAUH 4P07A 5KOMC 3JXAA 3VXQB 1QSFD 1MWAH 2IH1B 3IDJB 2YGNA 4NNYB 1S7WB 2ZUQB 3MBWA 4K23L 4QXVA 4YXHL 3BYTA 3ULVH 2DQHL 1D5XB 4PCSA 5AKRA 4ZRGA 4ABUA 2FBOJ 5J0BA 1FRGH 1KLGB 1ZA6A 2W0FA 3PL6A 1RIUH 1VFBB 5D5MF 3FQ2A 2JTDA 3KCPA 4BWWA 4IK6A 5FYLL 2YLKA 4K3EL 1ID2A 2XWEA 2HRHA 5EV7A 3T6WA 4M5ZL 4NCDA 3NTCL 2FBRA 2B8OT 2LGNA 4GO8A 3RL2A 3EYSH 4KTEH 3ZDXF 3WY4A 3DSNB 1LEIB 3I9PA 4YPGB 4MDJA 3MNZA 3S36H 5ITBL 3FTVA 4XNXL 1NL0L 1YYMH 2H3NB 2V9QA 1JZ7A 3CFEB 2W0KA 4QR7A 4F24A 2E7LC 1H8LA 1QBAA 4B9CA 5C0GB 3BVNA 2XWXA 1F6FB 2ZNWA 2OPCA 3IETA 3ZYJA 2VB5A 4W9IC 4XRCB 1AQHA 1SM3H 5J5EA 4PY8I 4WK2B 3I3BA 1IAIH 3C87A 2OXGB 3L1OL 2BVQA 2DQJH 1D5ZB 2X9WA 2MCMA 2Z1PA 3QSKB 1C9SA 4B50A 1IGFL 3V4VB 3VXSD 1VZIA 3LRSB 2D9QB 2R4RH 3T4AC 4B3EA 2AJZB 2EVGA 4I48A 4LARH 3MCLH 2QQNH 1YDPA 1UHVA 2ATKB 2X9XA 2YXMA 3S37X 4WRLA 2EIMB 1JDDA 3UTSA 3UTTA 4C58B 1KTDA 2WTRA 3MLWL 4IU2B 2WYTA 3BE1L 1IQWH 1ES0A 1T20A 4X6BB 5CZVH 1KCUL 5DUML 1ICTA 2BOCB 1NAMB 4GKNA 5EMYA 5B39B 2J1ZA 3U4EA 5KG9A 2BIPA 4NFCA 3LS4H 4YEEA 4L8SB 3OVUB 4ZFZA 3RY6C 2V17L 1TZGH 3D1MC 3PUCA 2PYEA 3GTTA 3DRQA 3FTGB 4HIHA 1MQKL 2IPUG 1AGDB 1RKRA 3KPMB 2Y36H 1MDAA 3DMMC 2VXTL 4HZLB 4L37A 3L3JB 4NQVA 2ICEC 4X2UA 5CO1A 3SD2A 3F5WA 5BZWA 3CVIH 2AQTA 3HNVL 4PJ9C 3ESNA 4IHOA 3ARDA 3M88A 3B7YA 2WY3B 1H3TA 5KVFE 4FXKA 4X5LA 1DEDA 4UMSA 2BP3A 4XOBA 4JFSA 4BIKA 3BUQA 5A1AA 1EH9A 3L5WB 1ZTXE 2PCFA 3FNKA 3KJ6L 2IAMC 4ZAKA 5JIDA 5INDA 1I9RH 2BZCA 1SXBA 4B9PA 1G6VK 2X6BA 4M62H 1O6TA 2XQBL 4XP4L 2VUOA 4FNQA 2AZAA 1NINA 4K3JL 4F33A 3REWA 5A6LA 1XFPA 3DIVA 1AS6A 2H7WA 3FT2B 3QFDB 5C0JB 3DHMA 5GGTA 3FT4B 4K8RL 2LFEA 1P4LB 5GISH 3TJHC 3CDGA 1UD4A 2UX7A 3OXRA 3KBEA 4GMSH 3Q2NA 4DH2A 3US0A 5FF6A 2NSQA 2DD8H 1JWSB 4FFVC 3H9YA 2Z35A 5JORB 4P5KA 4FDWA 4GG6A 1H5BC 3QHZH 2WV3A 3E38A 5JIPA 4WWNA 1XB6A 4PY7A 2YAQA 3D05A 2Q9OA 3FQ1A 3H7BA 4UTAH 3HE6A 4FNLL 1KDIA 3VFSA 3F3HA 4Y2LA 3UGUA 4P05A 4FNRA 1FHGA 2OR9H 4TQEL 1OHQA 1TDQA 5EPMB 5EOCL 1YY9C 2VUKA 3ARFB 1BIHA 3DX4A 1ZLWK 2E76C 3H55A 4FQIH 1D7FA 2AFNA 5C7XH 3O0RH 5CFHA 3O3DB 3DRTA 4EI6B 5ICUA 4PJDB 5I1DB 3DURA 5IHZB 3D4YA 3HBGA 3U7YL 1F4YH 1UACL 1T1XB 1FE8L 4KK9C 2YK1H 2WLKA 4HUXA 2QZQA 5FKAB 4XMLH 1N2RB 2JELH 1GGYA 3IAPA 4Y16B 2HRPL 5EU6A 3VXUA 5CP3H 1USZA 5HVWA 5D7IF 4XZUA 4XHJD 1D2PA 2KMWA 2OI9C 1EHAA 4G59C 4U1MB 5CINL 3FB7B 5TPWH 5L6YL 2J2ZB 3EH1A 3UBXB 1J0HA 1AMYA 2PNDA 1T5KA 4PD4J 5HY9A 1BF2A 1OSZB 4RETB 4OLYL 4AQAA 2XWTA 1ZTXH 1ZJAA 2UVEA 3RWDB 3I6KB 4X0KA 2OZ4L 3VMNA 3BRGC 4GBXB 4O58H 1JWMA 4XBGB 1CL7L 4PLJD 5IUCA 1ZHBB 3UAJA 5JPNC 4EN3D 3CU1A 2CM6A 5DRWB 1HK6A 2WANA 1FN4A 1CF8H 4PI0A 3C6LD 3WNLA 3Q5TA 5FCSH 1P2CA 4Y2OB 1X9UA 4HKJA 2BIOA 4Z77A 4MGXA 3NJVA 2A6IA 2X4OB 3QARA 3VFOB 2LLGA 4JDEA 3IDNA 1LO4H 2XLLA 3GMOA 4FI8A 5HYIA 5MENA 3VXPA 2P46B 2F8XC 3OWRA 2Y5TA 3S35H 4WAFA 1AOZA 3BP7B 1U3NA 4LSRH 2C1PA 4W9CC 5FOBA 4Z78A 2AJVH 3WNNA 1CR9L 1NPJA 2VLJE 1IJ9A 2O5YH 3HEIB 3SDAA 2CBOA 3LIUA 4TQHA 5DHYA 1RJLA 3MGTA 3QI9B 5EZOL 4Z76A 4HIXL 3ELAT 4N1CA 4DQOL 1H0DA 1U0QA 4XPGH 2IAND 2EADA 4JO2L 4OGYL 3VGBA 5J8OA 3KW7A 3S48A 2EDRA 3ALPA 4TVPE 5I1CH 1Z9OA 1P69B 2OL3L 2DYPB 2AJSL 4ANVA 2WVTA 4AV0A 3BPLC 3A6BL 3B3IA 3O8XA 4FP8H 3SD5A 2W60B 4W6XB 1AHMA 4Y5YB 4XN7A 3UAAA 4PJBA 3JWOC 1F6LL 4L3EE 3ARGB 5DJYB 4HJUA 4CDHA 5FR3A 1JGVH 1AIZA 1DBBH 5I8EA 3O9WA 4LEEA 2OXHA 1RJYB 4X8JA 1UVQA 4BHUA 1UM4H 3INUH 5HI3C 4LVNB 5JQ6H 4XX1G 4TNVK 2ZZUT 4QY8B 4X5XB 3U2SB 4L4TE 5D7LE 2QMKA 5ITFA 2D03H 2HYMA 2ZSWB 4RSVA 4DVRL 4P9HC 4NO2B 5J6HB 3KE0A 2O5ZL 3QUZA 4TVUA 4AYMC 1F4HA 5G55A 3SPVB 1KJ2H 3IKKA 3RFZB 2NMSA 4P8QA 1K5NB 3FKUS 3B8SA 3UTPD 4JLRA 3CFDA 4RFEA 1B0GB 3RZWA 4QRPA 2EYTA 4G9DA 1KG0A 3V52H 1TQBB 3PDGA 3QZWA 1WGVA 4ZS6D 3PAYA 3VQLA 4G6JL 5D1ZI 2Z31A 4CC4A 5CIPB 2MJWA 2IXQB 5BUAA 1OGTB 8PAZA 5I66B 3HZMB 3ZKMD 4Y2DD 1YEIH 4HUWB 3PV7A 3BI9X 3TNNB 1JZ5A 1SFHA 1T1WA 3S3SA 2IV9A 1CGVA 3QNFA 4P4KB 5E08H 2JE8A 3CZSA 3TWCL 2EDKA 1J5CA 2XX1A 1Q72H 1YEEH 1OE1A 2EYSB 3P40A 4LE8A 4MCZA 1QZNA 4N0CC 4MS6A 3VWKC 4KX7A 2PP7A 5CGBA 2I5YL 2P24A 1MCSA 4N0YH 2GK2A 2DL9A 1Q90A 1EWHA 1Y6NR 3T77B 1WT5C 1W0WB 1EMTH 1P5UB 4X42A 2VRQA 4KHXH 3G04A 2EDBA 1G7IA 3ZDYB 5ICZA 3LN4A 5CLZA 5IGXH 4LQFL 3O2VL 4MNQB 4OCMC 1A0QL 5E6SB 3ZIMA 2DLFH 1G7LA 3DXAE 4S1QH 2J88L 4H1LB 4H8WC 3A4FA 1A7RL 2YAHA 1RJCA 4RH4A 1KYAA 1WBZB 1KGYE 4LLYA 2OSXA 5DK0B 3DGCR 4EOWH 4EO5A 4JFPB 3NCEB 1QX1A 1I7RA 2GKIA 3HFMH 4BDVB 4IKJA 2BSDA 2GY5A 2NXYD 1T22B 5EUKB 1JHKH 4AEIH 5AVQB 1I3UA 1RUPL 1MRDL 4BEIA 2DRUA 4JKLA 3K6IA 1LQBC 2Y2YA 1M7DB 4HCRH 4TXVB 2WP3O 2JV6A 3GZKA 1PAZA 4NZRH 5I30L 3RKPA 2NTSP 3VSVA 3KLLA 3QIUC 5DLMH 1OV8A 3G9AB 4ZO6A 3US9A 2A77H 5KYYB 1K2DB 1Y0LA 3M1BA 4KY1H 3UZQA 2I27N 4NM4L 1REIA 1A6PA 5KS9E 2AEIT 1MWAB 2O6CA 3FONA 4M43H 5SV4A 1SJVA 4YHPB 3SCMB 4M7JH 1ACYL 1UFUA 5IHBA 5B1AB 3UJTH 4X9HA 3X11B 4J3BA 4D0CB 5IIEB 4FE9A 5LGKA 5E6ID 1UT9A 1MFCH 3IFPA 1NCNA 5LVEA 3Q43A 1YAIA 3MNVB 5HJBA 5I82A 4H5SB 4APQC 3B56A 1HI6A 1UOKA 4XMKH 3S2CA 3UEZA 4O9HL 2PLTA 3V9CA 1ZGLA 4WFHD 4N22A 2J4WH 4P3CL 5DJAB 5AALA 1S3KH 3SODB 2BNQE 3JVFC 4R96A 5K33A 1ODUA 4V2BA 4HQQL 4YLQT 5F2FA 4IEFB 2FVNA 4GS7C 1LP9F 5A2AA 4W70A 4WFEE 4XB8A 1HKLL 1OAQH 1MW1A 2BVEA 3VRLE 5EORH 3MOBH 3RP1A 4YC2B 2KH2B 4EIUA 9PCYA 4HH9A 1JV2A 4HIIB 1AMXA 4JHWL 1RK0B 1MOEA 4KRPD 3IJ7A 5HGBA 1MFNA 3BYYA 2XFXB 1VRSA 1FVEB 3HI5H 2VQ1B 3II1A 1AKJD 2E9WA 3VB9A 5K39B 2R0ZL 3DVIA 3LB6C 5I8CA 3OR7B 3FK3A 3IB4A 5B3NA 4G7YL 5CSZA 4OCYH 4CN6A 3VX1A 4R0LA 3IE4A 3FB6B 1AQKH 4NQCA 4LSPL 1A6ZB 1YEHH 4X8XA 2JSFA 2Z8WC 1EEYB 3MROB 4IMLA 3OMAB 4YFLI 1UB5B 2VLKA 5LAXA 4HP5A 1TKWB 4X7TB 1U6AL 2XJLA 4GRLC 4Y4KB 4YBHA 2X1WL 2HFFB 3UAFA 4B6ZA 3PNRB 1BZOA 3MXVL 1CK0L 2NY3C 4PRHE 3WE1A 2HTLC 5MHSD 3OKMA 1SY6H 1MFVA 2IQAA 5TF0A 4P3DA 2GBAA 3K2IA 3EYFA 3CHRA 3H54A 1A4BA 2IFGA 2N7BA 3HN8A 1CT8A 3CN1A 2JWYA 3HN3A 4G6FD 1DJHA 4AV4A 5KSAB 2WXLA 3ESVF 3OB8A 5ANME 1HZLA 2I7OA 4O51B 5HHVL 2H45A 4ZK8A 2FX9H 2FYYA 1IVTA 4MB1A 2WAQA 1N0XH 2ZXGA 3NH7H 2APBA 2LW3A 1RUAL 2G5UA 4OH2A 5DWPA 5I23A 4PGBA 3EJRA 4ACTA 1UKQA 3KPNA 5DWUH 1FH5H 1CD8A 3H3BC 3ZT6A 3NA9H 4Y4HC 4B60A 5FUZL 1UCBL 2MQ0A 3WL9B 3PAUA 3F12A 1KTCA 2L7QA 3DHUA 4S2SA 4NQXA 3A5VA 1RVFL 4O2CB 3RE0A 1GPOL 2CO7B 2BINA 4NP4L 1U9KA 2P5EA 4J39A 1L9NA 1FL5B 1II4E 2ED8A 1VA9A 4KDTC 4JFOB 1P7KB 3QC5X 4P46B 1HXYA 2KLRA 4DO5A 3VA6A 4YAQB 1Z5LA 4X6CE 4A04A 2X6UA 2BO0A 2VJXA 4G80B 2Y7LA 5HBBA 4CDGC 2K45A 4N2LA 3ATBA 4KVCH 3JT2A 4TUKL 3C5ZC 4K71B 1KXQE 1VB9A 3IS0X 2BVUA 3OAUL 1J48A 4DN4H 2D3NA 5FA4B 1BOGA 2BZ7A 2D4DA 2PO6C 3KXFA 3L7FB 3K6OA 2NY2C 3F00A 3QO0A 2X05A 4AGOA 4CSPA 1ZHNA 2YPKA 2LAAA 3LKOB 4XWGL 1KPVA 4LCIH 1S5IH 4LGPB 2IANE 1G1OA 5AB0A 1F00I 1NIFA 1FRGL 1YLBB 3VD7A 4PGCB 5B38B 1KIUB 5I1EL 4Q0XL 1AGFB 1MFAH 3AM8C 3NABL 4RISH 3RHWF 4ZUTA 3MNWA 5J1SC 1PZBA 4V2CB 4PJHA 3CXDL 3QQDA 1C1EH 3W0WA 1HL9A 1XGPB 2QKIB 4W81A 2JK5A 1M6UA 4HFUL 4S1RH 3CVDA 5BPPA 1BFOB 3VAEA 3S9DB 3LKRB 4XVJH 5I1KH 3LS5L 5F7FA 5FW6A 3T0EC 4K15A 3MRNA 2NY5L 3CC1A 3WNOA 1YAZA 3OG6B 1NOLA 3KM1A 4HIJA 4K5LA 3RZCB 2R2HB 5GRXG 1DP0A 3Q2WA 1H3GA 4BE5A 3VE0B 2VGLM 4JO5A 3B6SB 1IM9B 2NY0B 5DJ6A 4C59B 2J55A 4A37A 1W8EA 3G5VB 2DQJL 3GMRA 5ECJE 1OANA 3BSGA 3GIVA 1AACA 4FMKA 4OJCA 2XNAB 4BXSV 1FV1A 4XN4A 1MJ8H 2CBTA 2KLTA 1CD1A 2DQFA 4HUMB 4OD2B 4UT6A 5JPNA 3ULUC 2VR5A 4I3RH 2XBZA 3S3JA 5IROD 4QHUA 4LARL 1CVSC 4U05A 3HZKB 5L2KD 1R47A 2ZWNA 3DETD 2DIBA 2MPAL 1U8CA 1E7UA 3JV6B 3MRQB 4UBDC 2FSDA 4HBCH 4WI2A 4ZSOA 3S5LA 4ALAC 4D9RE 4X4ME 1IQWL 1CE1H 4RRPM 5AQ0A 5CZVL 3E1F1 2YA0A 4L9LB 3QJXA 3O11A 4PRAA 4C4KO 3C8KA 1ZMYA 3DIFA 4GO6B 5DEGA 3MOQA 1F4WH 2CIIA 3GLZA 5JNYA 3BSZA 2PCXA 2VITB 2IFFL 1TZGL 4KKZA 1KOAA 1MNUH 5EC2B 4OKVB 1I7UA 1V27A 1U8QB 4ZUSA 4GW4A 3SGEH 1LE5A 5F0PB 2EDQA 1HSBA 2GSGA 1O7DC 4D0BA 3Q8FA 4R8WL 3EDJA 1IX2A 1HAWA 3QW9A 5DVLA 3O6FD 4O2FB 3G6AB 4OM1L 4P2OA 3LZRA 4U6YB 5AZ2H 5JHLA 3DDFA 3A6CL 5LBVA 1EO7A 1ZHLA 2R7EA 4BBWA 1U8IB 2EKJA 3X2QB 5IFJA 3AAZA 2VIRA 1HN1A 3RNQA 1J8SA 4C4BA 2UXTA 4PJEA 1NAKH 5EEVA 1ZANH 3FQRB 4UCFA 5TE4L 1AXSB 3ZR6A 3MFFB 1RZ7H 4NRZA 1MCCA 2BOBA 3WTSA 3CQFA 4F7MB 4M62L 4YOKA 2P8MB 4U3SB 4LL1A 3T0WA 3QXUA 5IB3A 1G5AA 2R2BA 3L5IA 2V9TA 5E56A 4J27A 3VJ6A 1I8KB 3AG2B 4KNSA 4L5FE 4PHXA 2O5XL 4V1DB 5FGBC 1A4KB 3IJYA 3UPCA 4YDLB 2JH2A 5GISL 2GSIA 2OZNA 5CGYC 5FAAA 2HZHA 1BEYH 4X9BA 4QF1A 1XGRB 3DV6B 1I1AB 3D0AA 2A6KA 1KY7A 2JJTC 1NCDH 4IBVA 4N9GA 4PJDF 1M9WA 3SDCD 5TQ0L 5BNXD 4IMKA 1A14H 4L8CB 1FAIH 3AXLB 1VFUA 2H6PA 2YEZB 3GMQB 3QHZL 4N26A 4TNWK 4ES8A 2VDNB 5IK3B 1HL5A 2ZXEB 2J8OA 5LGHH 1G9NH 5JUEH 3JTSB 4ZTOL 1XSJA 2QQKL 4PRPE 1YJDL 4XP6L 2KPWA 2OR9L 1P1ZB 4BSWB 2VMFA 5H94B 4UQ3A 1KIQA 4FQIL 4MHHI 3ZMNA 3U6RB 1KNOB 3BWUF 4MJ6B 4WFHE 1PZ3A 4JG0H 1NSNH 3Q3GB 4WU5A 3ZE2E 3VWKA 4GP5B 3V55A 3CMOH 1NH6A 4TPRH 5AOJA 3VI3F 4BH8A 4NZTH 1XH3A 4N2FA 3IU4L 5GZOD 1KEGL 3WCYA 1T4WA 2VLJB 4PVMA 2R2EB 1EJ8A 1WT5A 4HX1B 4NZUH 3VGAC 3VCLB 2YK1L 1NDGB 4MAUH 4O02B 2AQNA 2D2OA 5IW1B 5K9QI 3V6BR 3R06B 4LMQI 2NLJA 1CFMA 3TO4B 4OJDH 3BHBB 3U4KA 4BH7B 3X1FA 1OZTG 2YMXH 4OKDA 5AZUA 1KB9J 2EKSA 1WA0X 4L3EB 3QHFH 4PV9B 3C5SA 3TL5A 4OLVH 4HGMA 2WKLA 3QUMH 2QTVA 4JJ5A 4QNPF 1KJVB 4JM2A 2JQAA 2TSBA 3FO0H 1FORL 2JQMA 4L4TB 5D7LB 4E0RA 4LL4A 1MCJA 4DVBB 1W2KT 2AXGB 3SDYL 4F7CB 2FO4B 5MHSE 4FQQB 3QIUA 1QASA 5F7EH 3TYFA 1O7VA 2D7TH 2J5LB 2CLVA 5BO1H 1FGNL 3IJHB 4JUSA 4LVOB 3S8FB 4WNQA 3SKMA 1A7NH 5CSBA 3WUWG 2NZ9D 4LSRL 2B4CH 2WO2B 1QSFB 1DJZA 3Q8CA 4Y4FC 5AYQA 3T8XB 2NRDA 1VENA 4QD2E 3W39A 4NENB 3GBDA 4PGDA 3VFPB 4UU9B 4Q6YA 2YFNA 2O5YL 2YRBA 3IGAA 4LCYA 5G5DB 2OMWB 4PTUB 5GHWH 1YEJL 2WZ6A 2Y9RT 3VFWB 4KZDL 3QIBA 4ATWA 3JYCA 4N6RB 4XPGL 4DAGH 3C6SA 3PQYD 3KLDA 4APQA 1NGYB 1ZIBA 1JUFA 3ISRA 4MQ7A 1DQIA 4HSQA 1JPST 5F8QC 4ISVB 3V0VA 3U1SH 1HXMA 3L45A 5MEQB 1LILA 1J8HE 1JZHA 3MRBB 1XIWA 5DD5H 3AREC 1KJ3L 4RMVA 3X13A 4EMZA 4ZS7L 4Y2NA 1Q9KA 4WI0A 3U1QA 1X5JA 5IF0A 1KULA 1BQ5A 3H9HB 4Q9RH 3INUL 4AT6B 3CK0L 5JQ6L 1PEZA 1T6WA 3CLFL 5T1KD 2GFBB 2FWUA 4X9YA 3R18A 5E9DD 3FU7B 3FUHA 2D03L 1NCTA 4G3YH 2HMIC 4ZX4A 3DXAB 2XV0A 4DP4X 3ZKND 1YO4A 4HJJH 5DO8A 2J57A 2UV3A 2AW2A 1A9BB 5L4FA 5K9OA 1A1OB 3VXSB 3WD5H 3KWUA 4R7VA 2GC7C 3IFLH 4XTRC 3A6OA 3D85D 1JCVA 5KVMC 1PIFA 3DJZA 4IKKA 2XKNA 3OPUA 4IDLA 5GRVL 1E67A 3R0MA 4TTDD 2MCG1 4QTHA 1PG7L 1CGYA 2YGVA 3MKKA 2L0DA 4DFHA 3MO1B 3VH8G 1CBJA 5H35B 3GHPA 4ORZC 2R8SL 1P7HL 5FO8A 1DHKA 2FE0A 4KXZH 4BZ1L 5HD8D 2MSPA 3PCYA 3TFKC 2ZP0T 5TDPA 3RX8A 1J05A 5ABAA 4Q2ZA 2X4QB 2J25A 5KS9B 4F7EA 1W72H 2C34A 2ISDA 4EI5A 5FB8B 3EGDB 5EOQL 1MG2C 3AC0A 4Y1AA 5FHAH 4HALA 4E9TA 3BCFA 3LYRA 4M3KB 2Y7QA 4KJPC 4PS3A 3DK0A 4LOEA 1J0YA 3RAJL 3NJMA 4G7SB 1T2XA 5I28A 3WU1A 2QTEA 3N85H 1QA9A 4P57B 5EUOE 3L3GA 4B9IA 4DP0X 3ILQD 2GI7A 4LVHB 3PUUA 2E7HA 4JFDA 5L4IA 2DLFL 4QHMB 5AKSA 2WWNA 2GJPA 5HDBE 2BNQB 3EH3B 4YL9A 1J8KA 2LQRA 2NYYD 4ELKA 2ZX8A 1EZVY 1BZ7B 1HIML 1CICB 3GMLA 1AHWC 1IEBA 1INEL 3QJHA 4RRPA 3HFML 4BWTA 1OP9A 1T7XA 1RH8A 1HE7A 4PGZA 4KDTA 1JHKL 3CDCA 5I2IA 3LHPH 3BGMA 4URKA 2GUOA 3V0HA 5CP7B 2CHXA 2ZYRA 4YHIB 1RURH 4ZXBC 5JHDD 1KB5A 1YEGL 1XMEB 2FLRT 4HCRL 4PI2A 3T6XA 2ETWA 4PSRA 4E41D 5EBLB 1MLCB 3L4WA 3S37L 1KGJA 1J9QA 2OBGA 4DSYA 5BRZA 3BT0A 3N40P 3QQ4A 4PBWD 2OZ4A 3UCQA 3FCSA 1BAGA 4FFWD 1V7NL 1UUSA 3EJYC 3W2DL 1T1ZA 5IJVB 4M43L 1IBYA 3DX6A 1BVZA 3PPEA 4KI5F 4UQDA 3T6ZA 2VC2H 1OARH 3IRCA 2JKXA 4QAWA 5EO9A 3UJJH 2Q7YA 2VWEE 1UXMA 3S36X 1XD0A 4OM0L 3ZE0E 5GS1A 1JPGA 3RTQD 3GSVA 1L3NA 2D4FA 1D7CA 1JZJA 1O9VA 2JIXA 3UG3A 5L9DL 3AM8A 5D8JH 1O75A 2VDPL 3FHAA 4MZ2A 4AGPA 4KK6C 2Z8SA 2CO2A 4KFZC 1CGXA 4WV1C 5AW7B 3RB5A 1SYSA 4MQTB 3EHBC 1GIGH 5I6KA 4MJIE 5IVXE 1YNTB 4CRPA 3V2AR 3WLBA 4LO9A 5FHBH 5ANMB 3T0EA 4JFFD 3EOBB 2YWZA 1ZLUK 1D7BA 4MXQD 4JJHA 1JS4A 3HRZB 4ODTL 4ONFH 3MX0A 1G6RL 3P11L 4WF7A 3T04D 2V2WB 1UH3A 3IJSB 2OL3A 3ESMA 1V05A 1P4BH 1LO3L 4EZLA 5IG7A 1E2VA 1DQMH 1FVCA 4JHAH 5AL8A 1QUNA 3LVTA 2OKMA 3NG5A 3BPCA 1UATA 3P9MB 3B2DC 1JERA 1WUNT 3FQYA 1L7TH 4Q89A 4U1IA 5I5JA 5LB1A 4C55A 3HHSA 3WS6A 1VCAA 3UC2A 1FNEA 4X99B 5D1QD 2WJ5A 2VJ8A 3VFGH 1JNNH 2IEPA 3GXTA 5DS1A 5J1AB 1U8HA 5H37H 2E6JA 2AAVA 2H32H 4K7PY 5FM8A 5KJ7E 1A6UH 3JWNG 4HPYH 5I1GH 4YR6B 1FZJB 4X6CB 1K85A 1KZYA 4PP2A 3B43A 2AKRB 1BYNA 4JZOA 2G5BB 3MUZ1 3D12B 3FZUD 3K5SA 4CKQA 2RIKA 1F41A 4PG9B 1SN5A 4M56A 4RGNC 5DGQA 2WP3T 2LAGB 4YDJA 3T1FB 2NT0A 1OTTD 4L0ZA 2AXFA 2IWFA 5C0AE 3GT6A 4ZUVA 3VNZA 1GR7A 3BZFB 3PG2A 2QGBA 1JK8B 2PPAA 3ZZSA 3TM6A 4Q9CA 1V5JA 1FC1A 2XG5B 5CJQH 3MRDA 5FXCH 1DJXA 2CO6A 2IDSA 1U3YA 3H3PL 2IANB 1KGCD 6PAZA 1IGMH 1A1MA 2ZKMX 4XMWA 2NDGA 2PXYD 2QR0A 2AITA 1KTLB 4ERSH 4NO5B 2FZ3B 2A9BA 1B4RA 2A9NH 1BFSA 4BSJA 1NC4D 2R59A 4GSUA 5BOZG 1TJHL 4CGUB 1I1RA 3NJHA 1FH5L 2Y07L 5A2CA 4LKCB 2J1YA 4FMFA 1OE2A 4QYOB 5ALBL 5TFSL 1FH2A 4X80L 4FD0A 3S88L 4EZKA 1BWWA 4OLWH 4LP4A 5T1DL 4Z3TA 5IM7A 5T3ZE 1KN2L 3EFDH 3H1ZA 1E6OL 2N56A 4L3CB 1R5VA 4MZRA 3L81A 4ENED 3AWGA 1DJGA 4WO4D 1FL6A 2BY3A 4A67A 4LCWA 5FGBA 2NY1C 3GKWH 3QEGH 4AQ8C 4JKMA 4XXCC 4QHKI 4J8QA 4M8VA 4DP6X 1E9QA 2DKSA 4NRXA 2EXWD 2FL5B 4P9ML 3X3FL 2LU3A 1SEQH 2BHZA 4WI7A 2IG2H 2D73A 1URZA 5FECB 3VFTA 3FMGL 1OTSC 4APXA 1NCAL 4NP9A 4YDZA 4F8NA 5EZIH 5FPIA 2OTPA 2DQMA 3CSGA 1QZ1A 5KBPA 1QAWA 3BSHA 1MUJB 2YBRA 2OYMA 1CDIA 5HHQA 3MV8E 2OJ1A 2G60H 3TU6A 5KSBE 1ZHKA 2IDQA 2GJ6D 5IWLA 2K4AA 2ZXAA 4LCIL 1S5IL 1T83C 1XF3B 1DVFD 2Y2TA 1T2QL 4P23C 1DLHA 1N8ZB 1QW8A 1TXKA 4BFKA 3EJPA 2XRAH 5ERWB 1MFEH 5IVZB 3TT1H 2YD8A 1MHPL 4X6DE 2FH8A 5C6TL 1E4WL 4POZD 3QIWD 1TEGA 2EO9A 2HVKA 3HR6A 3CCHB 4JGMA 4FQLH 2CGRL 5KSUB 2ATPA 5C8JA 3K72A 3VYNA 1ET7A 5C08E 1NFIB 3RA7L 4XVJL 5EU4A 3WAJA 1AO7A 4N0RA 3RBSA 4G6MH 4PJCE 2VN6A 5D7JD 3D25B 2Q7NA 3V5KA 4YGAB 3BUBA 2C9AA 3G08A 4ZOEA 5C0BE 3C60D 3U9PL 3MU3A 2HKAA 4OCNC 4I18A 4FJZA 1NIBA 1EZUA 2B39A 1RZJH 3GB7B 1ZT1B 1S7XB 2C9VA 4FFZH 4KK8C 1I8IB 3KPSE 1QACA 2E6QA 3QJVB 4F7PA 2DIAA 1L6XA 2MKLC 3QUMB 4AK1A 1Y18B 3G6JE 3LQMA 3D18A 3MUJA 4R2GC 4I77H 1ECYA 1IL1B 4B0MB 3EXJA 2F53E 1DO6A 2HJKB 1F2QA 1WZMA 4GO9A 2XTLA 5DD0L 3V4UH 5EBWB 4PJAA 2R0LL 4BELD 1LD9B 1SNRA 1YN7B 2DWDA 2VLLA 5JPMB 1WRFA 3CIQA 3BIBX 4MXWH 3A4AA 1OSPH 3P2TA 1HEHC 3FOLA 1MJJB 4Y4FA 4Z7WE 1CO1A 4WHYG 4KKAC 5IMOB 1NBQA 3GIZL 25C8H 4MD0B 1LE9B 4U1GC 5LUMA 4PRPB 3T5WA 3ZTNH 3MLTA 2ORBH 3RI5F 1JRHH 1UOWA 3CZNA 1MCWM 3GSNB 2Z93B 5JLZB 5FW7A 4OQTH 4WGKA 2WINA 1BVLB 5AZ2L 1S7RA 3D9AH 5HDRA 2QKSA 3BGFC 3N9GH 3I9GH 1C5CH 1I1FB 1F3JB 4HW6A 4H44C 5DS8A 3ZE2B 5KJRL 1GVIA 4N0UA 3AREA 1NA8A 2ARJA 3OKEA 4M1CC 4MAYC 3TVMB 4CUCA 4NO3B 1QMUA 4MS8D 3ZKQD 5GGSY 1CYWA 3LDBB 1J12A 4NDMA 3SDDC 4PJ8D 2QFRA 1QRNE 4L29A 5ACLA 1MPAH 2Z4TA 1GS8A 3MA9L 1Z66A 2YKLL 4XP5L 5IW3A 4HDIB 3D69A 4IRJA 5DHDA 5DVPA 4XCFL 2VR8A 2P47B 2CIKA 1BPLB 1JI1A 1B2YA 2IH3A 3IN2A 3KM2A 4KRPB 5ESAB 3KLAB 5CUSL 5KVEE 1Q1JL 4CN4A 1SHMA 1TZIA 1NUGA 4E41E 1L0QA 5T5NG 2QSVA 2JB5L 3GSXB 5E1IA 4ZW3A 4CW1B 2FJGB 3I6GA 2UWEE 1NDMA 1SVCP 4RIRA 1D5IH 4OCSL 4XGZB 3B9DA 5KOVC 2VDOH 4IHBA 1A14L 3FSAA 2CCVA 3OXSB 2DBLL 1AIFB 1BW8A 1QTYT 4XMUA 4DEWA 3FQXB 5JUEL 1G9NL 3B3BA 5FM5O 3Q44A 2WXNA 3KGSA 3QHTC 2G2RB 5DEFB 1KACB 4XPBH 2NUTB 3REVB 3SHSA 1PD6A 5GS0D 3GXPA 2AQPA 3K6NA 4F27A 4OLUH 5EZJA 1N64H 1W72B 5I1LA 3CMOL 3NCYP 3P4LA 4LSSH 1T66D 4C4KT 4MJ4A 1FFNA 1T04A 4WNSA 5HGHA 4MJ5B 3MRMA 5D2NE 2WVVB 3QCUH 4M4RA 2AK4A 3A4EA 4JFFE 3AWFA 1MZZA 2R1YA 5I1IL 4NZUL 2Z92A 2Q2LA 3F7RA 2I26N 4DKEH 1E0OB 3ZBMA 3IVKA 1ZA3A 2OTWB 2X87A 3O4LD 3CVCA 5FUCE 1S2EA 4BQ6A 2BFGA 3F7LA 5ANHA 1G7MB 1KV3A 1HCYA 1ORSA 1ANUA 1WIUA 4EUPG 2CWRA 2WCSA 3PHOB 2WTOA 1J8HB 2VUYA 1JNLH 3F7KA 1U21A 5DYOA 2RR3A 1CE6B 4YZFE 3ZL2A 3ZRSA 1K3IA 2XTJD 4GAGL 1I1YA 1H3UA 1WAEA 4G6AC 2F1AA 5D2LE 3L9RA 5D1QE 4G8IA 4N2AA 1MI5D 2DQCH 3FQNA 1ZAGA 2HN7A 2WUCH 1BQLL 3PS6A 1FJ1A 3BZEA 4U2ZA 4YWGH 1ORQA 3EYUH 1EXUB 3EOAB 2Q6WB 2HCZX 5IBTH 4FQHB 4YHNA 1XGQB 2WXKA 4QCIB 2J8UE 2CO4A 2COVD 2BPBA 2Q86A 4PJGA 5LQBL 4LPYA 4A6YB 2FATH 3D39A 3EFOA 1UZGA 2D7TL 3O41A 3O6KL 1JNHA 4OLZL 3IKCB 1BZQK 3STLA 2BVPB 1CFBA 3MGOB 3ZZLA 3WN5C 2XZCL 2GSMB 3O6LH 4EIGB 4LKXB 3F65A 1U2CA 3L95A 4WKZB 4NUQA 1WBXA 4KO5A 3GINA 5KAQG 5J4MA 4QRSA 1G7HB 4L8BB 2FJHA 3QJFA 5FEBA 3DYMA 5DUBA 1DVSA 5I1AA 2ZUSA 4TUJB 1ZSDB 1EEZA 4OW6A 3DPBA 5GS2D 2C3XA 2ICWB 3CGTA 4QRUA 4AEFA 4J2XA 2W9DH 3BPNB 4RMSA 1PZUB 4WV1A 2XWBA 1QYGH 3BN9C 3MFGB 2X9YA 2D3VA 4W4OA 3T0BA 1U4FA 5D4JA 4BUGA 3BP4A 4FXGB 1HEZB 4XO3A 1NLDH 2YAPA 4JFYB 2BSCA 1JPSL 4WWKD 4M5SA 4NZDA 2HX7A 2HRGA 1VADB 2EXSA 3GTVA 2FTAA 1FO0A 3KH4A 1K3ZA 1M6OB 4HOXA 4UNVA 4U6XB 3BEWB 1XH2A 4IIQC 3OKDA 4PB9H 5EUOB 2WLMA 4E42A 1K72A 5K9JH 4K9EC 3CH1B 1E3ZA 3LEVH 4EE2A 2AQ1A 5EIVA 1G94A 5EN2B 1V3MA 3WIFA 5EIIA 3IGUA 1X4XA 2VL5A 5HDBB 2AANA 2VQ4A 5I8OL 2GCYA 1VGEH 2JB6B 3FT1A 3LD8B 3ZDZF 1U3HC 3FU6A 5EFIA 5KS9F 2CDGB 1MCWW 3JYBA 5HJDA 3E6HA 2ZOLB 2DTSA 5L2KB 1N9PA 3MOAL 2YFOA 3BFWA 3EJSA 4GAYA 1CXEA 2BIHA 3AT8A 5LXVA 2H32B 3L13A 4OZ4B 2X4TB 4FCAA 4GUCA 2HT4C 4PUBL 2CD0A 2H1PL 3EGSB 5SWZD 4R90L 4ZPTA 5EWIH 3MRLA 5MEPB 4LAJH 2VAAA 5L88H 3DGGA 1EANA 3Q6GH 2DM2A 1RIHL 5I26A 3RJDA 1T4KA 4N24A 1XAKA 1TJGH 5IKCB 1YEDA 1OAKL 1RUMH 2HPOA 3FCGA 3J8F7 3F7VA 5B21A 1EAOA 2FDBP 4Z7AA 1NJ9B 3PHAA 2IADA 4KO6A 1ZV2A 4N28A 5FHAL 2WPGA 1UWEH 4PREB 3X12B 5EBMB 4QRTA 3VRLF 4KPHH 3HVDA 3ZE0B 1MVFA 4MB4A 4OVVA 1XF5B 1CGWA 1I8MB 2CHNA 2NSMA 3KYAA 1WZAA 3VFNB 4M7LT 3HS0B 2YLHA 1KWKA 1GGBL 4ZW7A 5I17B 1EFXD 3L4TA 5B8CC 3G6DH 2ESVA 4J1UB 3K91A 2FGZA 4CA4A 2C3VB 4NHCH 2X2YA 4N2MA 1QNZL 4OTXL 4Z95H 3DSFH 4MJIB 5IVXB 4KKCD 4PU2A 3S96A 4WGWB 4AXWB 4XI5C 1J9TA 2XHNA 4M7LH 1L9TA 1AS7A 2BSTB 3ARWA 1HNYA 4QTIH 1PQZA 3FBKA 4ICXA 4LQ1A 4U49A 2OMZB 4YFLF 3WLWC 3V5HA 4J12A 1NAML 2VKWA 3JWNH 4QXWA 5EG6C 2O30A 1C12A 5DSCA 1ROWA 4ODVH 3HJEA 1N4XH 1TFHA 5E0QA 1UM6L 1R0AH 3WIHH 2WXMA 3TEWA 3NZUA 4MCNA 3C2SA 3PL6D 4MAZA 5KWYC 1VLXA 1I3RB 3BZ4A 2H26A 2MCPH 3BO8A 3QZBA 3PY9A 1TQVA 4M8QA 4ETQB 1WS8A 3FFCE 1NGPL 3SQBB 1TLKA 2PPEA 2UY7B 1S7SB 3GI9L 4FAAB 5E8DH 3UH8A 3SB3A 4YH6A 3F6LA 3L7EA 4I0CC 5GRUL 2GHWB 1R5IB 4OFYA 5C6WH 3FQWB 3HR5B 1PG7W 1L0YA 2VC2L 4AQ1B 4AJWA 4CAGA 1FNFA 3UJJL 4DZ8A 1T83A 3H4HA 2WLLB 5C3LD 2F54A 2P8LA 1CFTB 3KJ4C 5I6PA 1B0RB 2FQDA 3ARSA 3PP4H 5FW8A 4YSQA 1L9OA 3H3KA 1MIEH 2C1OB 1S5HB 4JFQB 5CU9A 5F1NB 4XPTL 3HRPA 1QP1A 1BM7A 1B4JL 1G87A 1VPOL 2AEPL 3AQDA 3DUHA 4UUJA 3TPUB 4LSQL 2E4FA 3QQ9C 5KBLA 1WFOA 3ME0B 3MV9E 2EIDA 2F18A 5C0AB 1XZ0B 2FK9A 2M2DA 4GY4A 1BZ9A 3VXOA 4BSVB 2IAMB 5FHBL 2LTQB 1A3QA 4QGTA 4LLDB 2HLAB 2AEQL 3DECA 4HHGA 3UTSD 4W93A 3UTTD 4MWFA 4WW2C 5BS0A 3NP4A 3TF4A 2DEXX 4U3HA 1MHCB 4WUKH 2A2QT 4Z3FA 3OKNB 1SQMA 3DVGB 4ZUWB 3OZ9H 3WTTA 3V4PA 1AR1D 3V5DA 3NPSC 3KHOA 4X6CF 4I5BA 4QHPA 1P4BL 1X5KA 2VMEA 2Z8VC 1D9KA 2I32A 4JHAL 4WGVB 5HGGS 1YCSA 4JFEA 2LU4A 1DBAH 1XB3A 1XF2B 3V0AC 2NTFA 2ED7A 1LHZA 4ZQKA 4XE0A 1DFXA 1BBJB 2NNAA 5KYWB 4PRIE 1R24B 4XCCL 4AMKH 5F6HI 2Y7NA 2F9BT 1UQSB 4I13B 5EEYA 2V2TA 4K9JA 1H5BB 2F61A 1JNNL 2V2XB 5F9OH 4XN1A 2VZUA 1M2VA 2Z91B 1J1PH 3ARDD 3IPEA 4F3FA 5E51A 4F5CA 4X6FB 3MUY1 4KKLC 2WK2A 4P2RE 2PCYA 3UJIH 5H2BB 4HCIA 5DHVA 4GEIA 2AEOA 2Y7SA 15C8H 1HE8A 2CAKA 2QPEB 3SO5A 3UC0H 4X4XB 3WDJA 2YEVB 3H9ZA 3RVVC 5AVXB 4X5PA 2ZWYA 3MRPB 3WSQL 2P7TB 3MV8B 4MHHG 5CS7A 4Y8AA 3ZL1A 1I4FA 2ZPKH 5CJQL 1DBJH 1WUZA 2QPDB 4HUVB 2GEEA 1GZHA 2R9HD 3GUTB 4H26A 1HZHL 4KFMA 4BZ1A 4X6DB 3HMXL 3LV3B 5LCVL 4OD1L 2OI9B 5E1GA 3MCKB 1A6TB 4ANWA 1TZ8A 2CUHA 1U33A 3I3DA 2YD4A 2VLRE 5C07E 5C08B 4N90E 3U7WH 2JFCA 4WSGA 1BQHG 4WJKB 2HPTA 3QRFM 3P4MB 3U46B 3HE6D 1Q1PA 2Z4QA 1YVLA 5D5MA 3T2NL 1Z2KA 1YUHB 2W07B 5E9DB 4PJCB 3ETSA 3PDOA 4IJ3B 4XCYA 1K8DB 1AY1H 2MRYA 1NCJA 2XACC 2ZCZA 3H2WA 4KTGA 5L4MA 3QEGL 4ONHB 1FNLA 4AQEA 4N1HB 4K73A 2HTKD 3PU7A 3SYOA 4BUQA 2WOYA 3KPSB 1SEQL 2F58H 2YSSA 3KYOB 3Q5YA 4LCCC 3UG5A 3TBYB 2VDOB 1AGEA 4FL4C 4F2EA 3G6JB 4JKKA 2VYRE 2JKWA 5B1JC 4D8OA 1MCOH 3HZYB 1CFQA 2BP0A 3E6FA 5D6CA 4ELME 4LEXL 2FGWH 3D2UB 4FHKA 4YXKL 1TTAA 5EU6D 1DBMH 1PU0A 4LHQB 3VXUD 2PW2A 3WG7B 1E5CA 1F45A 4MA1B 3IDGB 3SO3B 3GJFH 4DIXA 1B3IA 4L1SA 3T0VA 4FQXB 3HZ3A 1PCSA 1YECL 5GS0H 1U8JA 2D7OA 4NHUB 5FYJD 3EJZC 1RULL 1R3KA 4LLUB 1ONQA 4ZMLA 4Z7WB 4WEBH 3UPRA 3TNMA 3IDMB 4ZODA 4HHAA 3UAJD 1J5OH 1M71B 4HOMA 2WC7A 2F5BL 3WY3A 5FO7B 3KEHA 5HYQA 5F7DA 5KYXB 4QOKE 1Q9WB 2AV7A 5GRJH 4XVSH 5DHEA 3KPRA 4JDZA 1HU8A 2CJUH 5G4OA 3MLZH 3WENA 3IXAB 1ZPLA 3SBPA 4RFOH 2IALA 1OP4A 4YSPA 4LHUA 4WI3A 4AENA 1D6VL 2QV2A 5MEND 1RZ8A 4HKZA 4HVBA 2UY6A 1HH9A 3CVHH 4H4NA 3H8NA 4X0NA 4YFEA 1M05A 3GO1H 2K0RA 3ARXA 4N0FB 5K1VA 2BVYA 3IDIB 3FQ4A 3WDIA 3FO2A 4MQXD 1CGSH 3UX9B 5LNEA 4WVRA 1A8ZA 1B2WH 1E4XL 3DJSA 3L3DB 1YNKL 1CPUA 3DO3A 4TNEA 4XCEB 3D08A 5AUMB 4JRLA 3SDAD 1A66A 4G8EB 2DJ4A 1O7SA 3QZWG 2CHZA 2NUPB 4Y5VB 1G6RA 5AZEL 3W9DB 4YSAA 5JHDB 2G75A 4HF5L 1ZDQA 1KPUB 4Z7VB 4E41B 1RUKH 1XX9C 3TN0C 1OD9A 2FJFA 3O8XD 1N6QL 1PDKA 1BQRA 5EBGA 2UWEB 3VWJA 1A4JA 3ZE2F 3BLBA 1MN4A 2PR9A 2ZUQC 3HZVA 2FT8A 1ZT7B 5IB1B 3AMKA 1MREH 3O9WD 2WNKA 3JWDH 2P5PA 3W9EA 1MCHA 1KPRB 4EDXB 3AVEA 4PYGA 3K80A 3UYPA 1ZJBA 3ZTNL 1LWRA 1G7PB 3ZT5A 4EUPH 1A2YB 2ORBL 1JGDB 3JTTA 3K1KC 5HP5A 1MH5B 2CQVA 3N41B 4OQTL 4AC2A 4HOZA 4FNSA 5GS2H 3L16A 5HDQL 2EE9A 3D9AL 5BW7C 3QPXH 5E7BA 5E70A 4YHYB 3I9GL 4WW1B 5DXWA 3UMNA 3D07A 4FKHA 3JSSA 4CADB 4DHLA 1I9JL 4QRPD 5D2NB 3Q0HA 1R5WA 2LV4A 2YMTA 5ESQB 4GEJA 4JFFB 3FFDB 2GG1A 3B2XA 4JN1H 5HYSA 2Z31D 1CFNB 2CLRB 1PZ2A 4YO0B 4MA3B 4WDIB 4C57C 2QQLH 4RDBA 4IIQA 4YHZH 5SWSA 4WK0B 1ADWA 3D2TA 1AP2A 4HLJA 4EQ3A 4TRPH 2CCLA 2XN9A 4ZFGH 4YE4H 4A7TA 2XXFA 3FUNA 3QJTB 4MNGE 3NZ8A 4ZZKA 1DDTA 4PYHA 1H6UA 3FRPG 2WZ5A 3OR6B 1U3HA 4UB0L 1FYTA 3KLSA 5FO9A 4HC1H 2WVSA 1U58A 1BGXH 3ZQXA 5D7IA 5EU3B 4BK4A 3SQOH 4HGKC 2MOQA 5D2LB 2EJ1A 5D1QB 4YSEA 4TLUA 2DPKA 1IM3B 2MHAA 3LRMA 4XVUD 3UXFA 2O1AA 3EO1B 2X4NB 4LRIA 2BM3A 4JM0A 5IB5B 3BIKB 5ACZA 1NKOA 1LDPH 4UQ2A 3W81A 3HE7A 3N1FC 1YNLH 3SJVA 4YVNA 4DK5A 1U4EA 2BSSA 2YUXA 5DFTA 4PS4L 3UEQA 1S9WB 2I60L 2OX5A 3MI6A 4OLUL 5J13B 1FNSH 1JZ3A 3VI4F 3VG0H 1EAPB 1MJ7H 1WV7T 3RQ3A 4JM4L 1QLFB 1PKQE 3UTTE 4F37K 4DCQB 2HLFD 2F7OA 5LG1A 1IMHC 3NIDB 3A4DA 4S1DC 3RGVA 5F71A 4PB0L 3DX9B 3BUDA 3DBXA 3QVAA 3V79C 2RCSH 4R26L 5DCCA 1DBKH 4G5AA 5FO2A 2HKHH 4UDUA 2RQEA 3RJQB 5AVVB 4UT9H 2WNGA 5EO1B 3VU1A 5BRPA 1JNLL 1KBKA 4X5QA 3FSWA 4KMLB 5BQ7B 4NGHL 4D8PB 4HG4J 2AJXL 3OAYK 5L4JA 3TYGH 3PWVA 1G0YR 1QSEA 1Z5YD 2IPTL 5C71A 3MREB 4PW9A 2IWEA 1DJYA 4G9FE 5D72L 4M6MH 2VN3A 5EZLB 1Z32X 1IC4L 4OSUH 2WUCL 1E7VA 1FG2B 1RIVL 2XZQL 3MLVH 4AGQA 2BSEA 5EEZA 4D9LL 1LEKB 4LSTL 3EYUL 4KQ4H 4I1PA 3JT0A 4ODXA 4ZD3H 5KVDH 3GI8L 4MJHA 4YUEL 4ADJA 1INQB 3L3IB 5JW4M 1TJIH 4JKPH 2ZX9A 1KIPB 4A7GF 3ULSB 1Z9SA 1IFHL 3UP1A 4YNYB 2EH7L 4JY6B 1FDLL 5IB2A 5LWYL 4MMZA 1CFVL 5DRZA 4KJQD 2ZF9A 3KCWA 1Z6JT 4IU3A 1DVFB 4NQDE 3Q9PA 2CXKA 4Z7UE 3QA3B 2XPGA 3HNSH 3FUDA 1MQ8A 4NWUH 4M1GH 3MYJA 5JR1L 5EUOF 3OKKB 4UQ9A 4YE0A 4KJYB 3QIWB 1CYXA 2W9DL 3EDFA 2AGJH 3LKNA 1I7ZB 1OM9A 5ENWB 2BWIA 1QWNA 5HDBF 4UANA 1MWOA 5D70H 3WJMB 4ZI8A 2VRAA 1WC7B 4Y16C 1J1XH 2B0SH 4Y4HB 3DUSB 4WLCA 4DW2L 2OK0H 1FVDB 1KDJA 3QNYB 5C0FB 3NDYE 4NQCD 4JKWA 4WWOA 3W5MA 5HHMD 3CLEH 5F7HA 1R3JA 1TTFA 2VLKD 1VACB 1HSAA 3IBEA 3QEQA 1EQWA 1NIDA 3QUXB 4EN2A 5LKNA 1U30A 4AZ8B 1P9MA 3LEVL 3T2LA 1WZ1L 1T5XA 1JWUB 2CK2A 3IFOA 3MXWH 4FTVD 2MOGA 1BMZA 4W9GC 5A6MA 3EUDA 4GBXC 3CX5K 1Q9OA 2Y6SC 4LASL 1UOVA 2EVFA 3OKYA 1CJYA 3LQAL 2FQGA 5MP6L 1SHSA 3Q05A 1S46A 1VGEL 2P8PA 4KHTH 3D8MA 3QEUB 4HMCA 5HHNB 1IBHA 3WN6A 2EE0A 1SF5A 3BXNB 4LCVA 3WY2A 4XOEA 1NZRA 3OGCB 4I4WA 2VDKB 4KGLA 4U3CA 4UV4L 3PWNB 1DQLH 5A2IH 3DX8A 4W9JC 1T3FA 2F8IA 3ZE0F 2EDXA 4D0DB 4K5OA 4S1SL 2FECI 3ETBF 3S34L 4K0OA 4B7IA 4JFVA 1GJIA 2ZWLT 2ADIB 2QHRL 2OSWA 4HZAA 3CFCH 3FFCB 3MJ8B 3O4OC 1BQKA 2YGPA 4M5YL 4LXFA 4AKPA 4O2EA 2OMXA 4IKNA 3VRJA 1N70A 3V6FA 2GEQA 1KXVA 1TJGL 4WTZG 4A66A 4TNVF 3QI9C 2R4SL 3WE6B 4KAQL 5E8PB 8FABA 2P5ED 3FXIC 1N68A 1QLEH 5KVFL 2FIKA 4Z3JA 4HUUA 3ZU8A 3TJHD 5DQJA 4A7VA 4UQBA 5GGTH 4BFRA 1VKXB 4Y5YC 2GTQA 4P2QA 3ARGC 4JQXA 3RVWC 3STZB 1QEWB 3MV9B 5CD3B 4R6UA 1A6VH 4TNGA 3DSFL 4LVNC 1WCBA 2FWSA 3KXFD 3MDJA 4GRMB 4XMVA 2DH3A 1R19A 2W9EH 4RMBA 4AQOA 1DQQA 5J57B 1KTBA 1FA4A 2V5YA 1AOHA 5E2UH 1ASQA 3RIFK 2YPLA 5CEXB 5I6NA 3UYOD 2C9QA 2IQ9H 1QO3B 1AZUA 3GLDA 3AU1B 3BKJH 4LLWA 1CQYA 3MQIA 3QH3B 1L7IH 1QVOA 3MLYL 2PWEA 3PGDB 1LP9A 1CBVL 4LLQB 2IPKA 3WJLC 4FQJL 4JHVA 4PN6A 5DJXA 4ZFOB 1TQBC 5FM4A 1G9MC 4LCCA 4KJWD 1RZKH 3TBBA 4PJBE 4N68A 1OP3K 3W0WD 1TO4A 2G9HA 2GAZA 2IGLA 2YC1B 3DI2B 1E4KA 1K9TA 3U36A 2AABL 3H0TB 5LDSA 3WKNA 2VZOA 4F15C 3P3SA 1B90A 2WB7A 3OKOB 1JZ6A 4U1SA 2AVGA 3QDME 1Y6KR 5TK4A 2RALA 4OT1H 4WKXA 1S7UB 4H25B 1UENA 4G8FA 1FIGH 1JV5A 2B1AH 2B1HL 3ZTEA 3HG0A 5I76B 4GXVH 3ZGIA 3D4CA 2Y06H 1MIEL 3FAWA 4HS8H 5FYKD 1AHKA 4FQ1H 2XC8A 1MG3C 4NKOA 3DO7A 3COOA 5FKPB 5EOTB 1MHEB 2V5SA 5FYJH 4BFEA 1KBGH 2ZJSH 1QWHA 3QS3A 1KZQA 1NEZA 5D71H 1A47A 4I89A 3EADA 1DE4B 3TIDB 1K4CA 2GIYA 3Q01A 1P5UC 2CRIA 5E4OA 3NFPA 2EEAA 1HL8A 4N6QA 4Y19E 5CILL 1NCWL 2J21A 4KUZH 4H8UA 3CFNA 5D7KD 1CQKA 1OCWH 1LO0H 4YS4A 4NOBA 3TBVB 4IDJL 5HJ3B 4JRYA 3ZHDA 5DJCB 1OL0A 1X5IA 3CE1A 2OP4H 4CMMB 1FZKB 1BZDA 1KELL 4OI8A 4MRCA 2VXUH 1VDGA 4J4PD 2VDNL 5JOPD 1RLWA 2XTJB 2A9MH 1XGTA 2VLRB 3PXLA 3NACH 5L2JA 3CIAA 2L04A 2FSEB 2GTZA 2X4RA 4X6EA 4PGJA 4ODHH 5IBLD 4EZJA 3K6SA 1Q0YH 4LPUA 1TNNA 5KSBF 3P0VH 5F89A 5DZNA 5HGAB 1JTTA 4P2OD 1DSFH 3UGEA 2E7MA 4RDQG 4D3CL 4JEGB 2EO7A 3VXQA 3AITA 4WY7L 4KH2A 2IH1A 3IDJA 4X6DF 4E5XB 3H42L 2Y1YA 4NNYA 3SCMC 1SPDA 3ULVC 3V0WH 3OC8A 1XZWA 4MB5A 3EW3B 3UADA 1D5XA 2YD9A 4TTGA 1SDDA 4ELMB 4TVPL 1CI3M 2CBPA 1A6AB 4X83A 3W38A 3ML9A 2ZPKL 3ERXA 1VFBA 3WV0A 5DQ9B 1C7TA 5F88B 3VGAB 1ET5A 1DBJL 2VXSH 4PJCF 5T33H 3TJPA 1TQWA 4F80A 4NQEE 4JX0A 2PCPA 4NSKB 1YMME 3BWZA 4ONOA 5DMJB 1ZXQA 5IFAH 3V8CA 1LEIA 5E7FA 5C0CA 1W0YT 4AKOA 1S7VB 1U2HA 1K8IB 2H3NA 2J12B 3ZXAC 2ED9A 4BKTC 3G6JF 2OR7A 4QRAA 3UABA 2F74B 4QWWD 5DMIL 4GSDL 4QOKB 1F4XH 2I07A 4XRCA 3V10A 4BQ8A 5DD1H 2CK0H 3N43F 2OXGA 2VDQH 3NJNA 2XWJB 2XY2A 2UUDH 4HUNB 1HX0A 3FS9A 3KPOB 2NYKA 4HS6B 4J7RA 3VWKD 1H3VA 2AJZA 3C75A 2A7BA 4N0CD 1S7TB 2WYIA 2ATKA 2R39A 2H0EA 2ZXWB 4PJFB 2Z1KA 4YGVB 3PRZA 4HIPA 4HETA 4IU2A 3GM0A 2OW7A 1N5AB 2HXAA 4I2XA 4X6BA 4Z7WF 4ZMTA 3CC5B 4HUKB 1F11B 4G5ZH 2BOCA 1NAMA 1PKOA 1FFPB 4Y4KC 1MCBA 3F6JA 3U4BL 5HHOE 3N1GC 3RKDD 2UX6A 4ODBD 3H2PA 1V3LA 2B14A 1DBML 3DV4B 4L8SA 4TMPA 5SWZB 1AH1A 1TMCB 3BW9A 2WXQA 3HG1E 3I84A 3WFCL 4M7KH 3FTGA 4UAOB 3FULA 1IBGH 4FZEH 1ADQL 4BKLB 1AGDA 3M8OH 5FYLD 4AYSA 3KPMA 2DMBA 4K7FB 5J11B 5KSAC 3G5XA 3K71B 1MIML 1ID5I 4HZLA 4A38A 1FNHA 3DX1A 3L3JA 5DUPH 4WTWA 1QSVA 1IQDB 5JDJA 2H8PA 1MHHB 2XY1A 4UI2A 4QLWA 4JM2D 1KYDA 4IBZA 2GC4C 2X12A 4B7LA 3SSGA 5E1HB 1KLFB 1Z3GH 4KVNH 1CXKA 2ZE0A 5IJCC 3HNTH 1I7TA 1PW3A 3V4LA 1FLTX 2DJUA 5E4EB 3QIUD 3QNXA 1HWHB 4FTVE 1EFXB 2UXFA 2J1WA 2CBQA 4U7MA 2MIZA 3N42B 3MR9B 2UWEF 1OAUH 3Q1SH 3IJ8A 3P69A 1OM3L 1E6JL 4AG4H 3U7AA 4PVNA 3LXUX 4G72B 4AM0Q 3MBWB 1B2WL 2UZIH 4RAVB 3NRPA 4FABH 3NCXA 1P4LA 2YQGA 4MA7H 4XC3H 5C2BH 1SF3A 4DO4A 2QSCL 3QIBD 4FXTA 1JPTH 3QDJA 3P77B 2DIEA 4APQD 2W0FB 3MLPA 4L9DA 1JWSA 4MNGB 1RPQA 4XXWC 1NBCA 3IMVA 4K71C 1I82A 5JORA 2R69L 3D0VA 1RUKL 1J88A 2GPZA 3HMWL 2HB0A 3ETTA 2HFGH 4WZ9A 5FIEA 1XIWD 5DC0A 5AYUH 3V6ZB 4AV5A 4Z8FH 1ZLDA 4NQSB 5IMMA 1I75A 3I74A 2IBZY 3JZYA 1OPGL 5D1XC 1I3GH 5EPMA 2GI0A 3ARFA 1F90L 1KGWA 2HAZA 3R19A 4YL4A 5AW6B 2APXA 1ZCRA 3B9AA 1JZDC 2A4EA 1QHOA 3PIQB 3O3DA 1A3LL 3IETB 1TENA 1TO5A 4EI6A 4NQQA 5KW9H 5TE7L 3GKZA 4PJDA 4F9LC 4Z7QB 5IHZA 1VEPA 2OMBA 4QEGA 4HFWB 4MD5B 1WA1X 4FKEA 2EABA 4UTCA 2BVQB 2QKIC 1T1XA 4XO8A 3BH4A 4LT7A 2WUBL 2D3LA 1FZMA 3NJXA 3KLKA 1PLBA 4ATTA 5FKAA 1E9OB 1N2RA 4YZFF 2EDJA 4Y16A 4NT6B 4I48B 5MEOB 5E94B 5F72S 2B1OA 3TEZA 1YDPB 3GXNA 3N55A 4QHNB 5DT1L 5FYJU 1TVHB 3UTTB 1PKQB 2CXGA 5C0NC 4XR8C 3L4UA 3FB7A 1ES0B 5AOZA 2J2ZA 4L1LA 3RZCC 2RAMA 4ZBJA 2QQLL 1T0NA 3UBXA 1AHWB 4RLDA 2H2SD 4RRPG 3VI3A 2F8VA 4GQQA 5KG9B 1OSZA 4K8RD 1CG9B 2NY0C 2WLIA 2NY3D 5AOMA 3RWDA 3AWEA 4YE4L 5LAPA 3MODL 1G7QB 3HMXA 4KU1A 2HWZL 3EJUA 3L2NA 4ZFZB 4LPTA 5LCVA 5IQOA 5G4MA 3EF7A 1ZHBA 2J8UF 4QPEA 5B1KA 5I0XA 1HQ4A 1MCPH 5DRWA 3NJIA 1IC0A 2H9GB 2FHBA 4J3OG 3T8VA 4QGYA 4EI5D 5J89A 1T03L 4PWJA 1BGXL 3OD3A 4ES9A 5DURD 4Y1AD 1NEUA 5KVGE 4L37B 4G9FB 1TF4A 1HKFA 5CZKA 3DVNB 2X4OA 3F5WB 5KJ4A 5TE6H 4LDLB 4FYRA 3K8MA 4LESA 2CNYA 1X5MA 2KERA 2XG4A 4IHOB 1D7DA 3H9SE 4DGIH 4UZGA 5AVRB 1LDPL 1INDL 4FXKB 5FYKE 3BP7A 3L5XL 3L9EA 4JFDD 5EOCJ 3QNZB 1U92B 1JDAA 1PX4A 2G0LA 4HEME 4RSYA 3W56A 1JXDA 2EILB 4JUTA 2AP2A 3DJ9A 4LSVL 1LEGB 4XMTA 3QI9A 2K70A 4K94L 5TQ2H 1MJ7L 2EIZB 1S9VB 3CZGA 1KCRH 2NY4B 1OSYA 2JCCE 3L17A 1QLEB 1NMBL 5I71B 4W9DC 4Z7UB 2FD6L 1IT9H 2J1KA 4NQDB 5ABZA 2CU9A 4LNVA 4UTBH 1H8SA 3KBFA 4OCWH 4UINL 5E6RB 2NZ1A 3DVFA 2W60A 3FUIA 5E4AA 2DB8A 4J3OD 4K4KA 1PF3A 1B0WA 2D3JA 1IV8A 5BRZD 1RJYA 1ZLSH 3I75B 1PSKH 2G4GA 5DK3A 4QY8A 1E3FA 4X5XA 3S3PA 1IVLA 1GHFH 3U2SA 3WKML 2ZSWA 3H7BB 1HC1A 4NO2A 4F8QA 4LNRB 1GY1A 5C7ZA 1MFDH 3FSZA 5GGSB 4OFPA 4YDLC 3SPVA 3RFZA 1UA3A 2HKFH 2B5IB 4OZIE 1K5NA 3HB3D 3MACH 2WGXA 4OCXL 5DJ8B 5HI5D 2JIXD 3MJ7B 1B0GA 5D7SH 1XB8A 2X44D 3ATDA 4MD4B 1CLYL 4PWIA 3SBRA 3SOBL 2CMRL 5DMKB 4GKOA 4WI6A 1NCCH 1F8TL 3DWTA 5E5UB 3DURB 4KO9A 4I0KA 5BJTB 4F9PC 4PJEE 4W4NA 4C83A 1KIRB 4TSCH 2ZIDA 2IXQA 1OGTA 5I66A 4MSWB 3VDCA 3WFEL 2P42B 2WHVA 4G70B 2XJKA 1MVUB 3T0ED 4HH8A 2WWMC 1ZS2A 4NUJA 4HUWA 1OAZH 3FU3A 4LFHD 2DIJA 3APMA 4U7SA 4XMPH 3TNNA 4G7QB 3VXUB 4RZKA 5HXMA 3U9WA 1BXAA 4P4KA 5C09E 3HNSL 1X7QB 4NWUL 2PYFB 4E9XA 5A40E 5L7XH 2CRMA 5FYKH 5HY9B 1K6QH 1V54B 4N2KA 2VW7A 3Q8AA 3IMRA 1CS6A 1WICA 2AGJL 3MV7E 3QWOB 3T77A 5IW6A 3CN4A 2VDRB 2ZYSA 3ULUD 4Z0BH 1GS6X 1JWMB 1P5UA 3QXDB 2DMHA 2VR3A 2C4XA 4FERA 2ENSA 3I6LD 4UT6H 5D70L 4E9WA 2J5WA 2EZ0C 4WJG3 5DRNA 1ZVNA 3C2AL 1JG9A 3MNDA 3UDWC 2OK0L 1A3RH 1TQSA 2VR4A 1J0ZA 1OD7A 1E2ZA 3FU5A 4PWEA 4HKJB 2ZCHH 3LXAA 4H1LA 4Y88A 3TO4C 1A9VA 3LZQA 3U30C 1GC1L 3P30L 4B97A 3CUPB 1PCXA 1WBZA 2F0CA 3BUTA 1LO5B 2FX8L 2YIHA 3TESA 5DK0A 1YQVL 3ILPA 4OCRL 4TULH 5FUOL 2Y5TB 3ZUNC 3OGOE 3BSZH 3WEMA 4BDVA 2G30A 1MW0A 2C1PB 1A6WH 3QORA 1EZSA 1T22A 3SPJA 4HPOH 1F6AB 1AJ7H 3I3EA 5TDNB 4DKFH 3FT3A 5GRWA 1RERA 4XNQA 2ZCLH 3SGDI 1E43A 2CDFA 4QRQA 2X89A 4X5WB 2E7DA 3LH2L 3S3CB 3II2A 3QDHA 4U3XA 1A7PL 2L7JA 3MGTB 4PR5B 5GZNA 1M7DA 4AJVA 2JI3A 2WN3A 1MRCL 1O9WA 1I9IH 2HVJA 2E59A 3HUJE 5IFHL 1P84J 3CFKB 1BYOA 5JHLH 5KYYA 1K2DA 5HDOA 4F8TA 3SDXE 4LIQH 3TJEH 4AYDC 4LVOC 3DNKA 3DBSA 3EDKA 3NUKA 3VQ2C 3WUWA 3D30A 4YHPA 3CFCL 4N86A 4PJBB 1HINL 1QFHA 5A2FA 3CXHJ 3RWFA 1NGQH 3BP5A 3GSOA 3IDYB 3O9WB 4XH2A 2VH5H 4URTB 3X11A 5AVUB 4D0CA 5IIEA 2EVHA 1CIUA 3MRRB 4IBSA 4UMGA 3GTNA 4X8JB 2P5WE 5HHXL 3LZFH 3QDMB 4AMWA 3JBG7 1OAYH 1M7XA 3BAIA 4KVPA 3K8KA 1WYJA 4YZWA 5C0RH 1RZFH 5G2NA 4DK6A 1KFAH 3D48R 4LCWD 5EO0B 4IBLT 5DJAA 5CBAB 2ZXCA 1EHXA 3SKUD 1IKFH 2DTML 1GOHA 2D7PA 5GGTL 4FNTA 4IEFA 4F8OA 4OLXL 4JLRB 4MDIB 4Q6IC 1KTRL 3BP6B 4X4YB 2AJUH 1YN6B 1WHPA 4GSXA 3HPJA 1BJ1H 1QOKA 1PZAA 2B2XL 4MNHB 4L5FL 2Z31B 3BZ5A 3BEVB 4Y19B 2FO8A 4HIIA 5GGUB 2QEJA 2B9AA 5J06A 1DCEA 2OMVB 1RK0A 5GGVL 4UM9B 4UZUA 2XFXA 5C6PB 4GI8A 2VQ1A 4I3GA 1DSWA 2ZX6A 1ACZA 5K39A 3F05A 1RFDL 1EO8H 3OR7A 4IGBB 4NKMB 1MY5A 3GBLA 2BY0A 4TN9A 3DO4A 1AZRA 3PYCA 1KXHA 2OYPA 2V3FA 35C8L 3FB6A 1A6ZA 1MKFA 2P4AB 2C8NA 2WSDA 2E74C 1EEYA 2NX5A 3MROA 4V11A 1BFVL 1UB5A 4YXHH 3MUHL 1TKWA 4K23H 4X7TA 4Y4KA 1J1OL 1G7IB 3VH8A 3T2OA 1EV2E 1AO7D 2DQHH 2HFFA 5ICZB 7FABL 1FIEA 4GIPD 4PFEA 5LBGA 1DFBH 3CZFB 4DGYL 1BQUA 4Q9BA 4XP9L 1I1CA 3F58H 2Q0ZX 4H8WH 1IC1A 2Y06L 3CSTA 5FYLH 3ML8A 4FQ1L 5KSAA 4K3EH 3U48A 3BVTA 4BWUA 2KUTA 3TA3B 1KBGL 1CYGA 1IGYB 3ZPDA 3BGFB 3NTCH 1OEZW 5GJSL 4ONGL 3PWUB 4GP8B 3P2BA 4JPVL 2Z9TA 1MXGA 4HGWB 1V8HA 2XBTA 3S8WA 5ITBH 3K74B 4XNXH 3FDWA 4KUZL 5T1MB 2WYZA 2ZXQA 3F8UB 4H8VA 4LVHC 4L05A 3JQOB 1DJWA 2BDNL 1UD8A 3WL9A 3QJRB 1YMMB 3KPLB 4G1EB 4LDEB 1PZSA 1JMZA 3K2KA 3L1OH 5E6UB 1ZIAA 3BUYB 2YMOA 2CO7A 3BN3B 2HJLB 1CICC 5C70A 3T1WA 4X98A 5F9JB 3FONB 1IZKA 1IGFH 2A9ML 4QO1B 1FL5A 2Y24A 4JFOA 1M9SA 4XN9A 4P46A 3F7PC 4F2ME 1RHFA 1U95B 3B9KB 2BWQA 3SBWA 4ELMF 3MLWH 4YAQA 3BE1H 4HAFA 5F1SA 4OV5A 2ADFL 5DYFA 4G80A 5DUMH 1VZHA 1KWGA 1N59A 1DSFL 3KDMB 1OOWA 3M07A 4WQOA 5BUGA 4ZOBA 1ZGLB 5LJYH 4LL9A 2BK8A 2A74B 5DJZB 3AABA 5JO5B 2V17H 3L7FA 3ARED 3ZRFC 1C16B </