3WD5H

Crystal structure of tnfalpha in complex with adalimumab fab fragment
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
214
Chain Sequence
EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDYADSVEGRFTISRDNAKNSLYLDMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of the inhibition mechanisms of adalimumab and infliximab in treating tumor necrosis factor alpha-associated diseases from a molecular view
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Tumor necrosis factor
total genus 41
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2013-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wd5H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wd5H01
2GAZB 2X4NB 1W0YT 3CLEH 4XCEB 3B9DA 5JORA 4I2XB 5EBLB 3UEZA 4UT9L 1YN7B 4EN3B 1U3JA 3D0LA 1PY9A 4ZUTB 3C60C 1A6VH 4R96B 5K9OB 1U8HA 2FR4A 1IAII 3CC5A 2EYSA 3RL2B 3L3GB 5AYUH 1DVFB 1CTOA 1CVRA 2H6PB 2ORBL 1IVLA 4QOKD 1ZT7B 3SCMD 1W0VA 5DEGB 3DX6B 1U8OA 2VQUA 3I6LE 4XC3H 2DRUA 1U93A 5CUSH 4X7DC 2NXYB 1OLZA 1A2YA 3B9VA 4NFDA 2NY4C 4UT7H 5E9DE 1EHLH 3QG7L 5BOZG 2DQGH 2O61A 4BQ9A 5HHOE 2DLTA 4WI5A 4LEXH 4JM2D 1OLLA 4LAQL 3MV7D 2JIXA 3QZWB 4NJ9L 3QEGL 1P9MC 3L3KB 4R8WH 3VI4E 4LLQA 2VSCA 4TYUA 3WJLA 1XF3B 3OL2A 5IK3B 5JQ6H 4LPWA 3U1SH 3FT4B 3PGDB 3PXHA 4FTVB 2XKNB 5BZWB 1RULH 1S7VA 5AAMA 2F53B 4PJCA 4HIHB 1MH5B 3RVUC 2X42A 5IVXE 3HG1B 2KDGA 4MDIA 1IGYB 4CADA 5TPWH 4D0DB 3QEGH 4QNPF 3OKLA 1YN7A 2HFEA 4HIIA 2IMMA 2X5PA 1V8HA 2EDTA 5L2JB 4P46C 4QRPD 3RVWC 1CFTB 4TTDC 4PJ5B 3VRLF 3L9RB 3VFTB 3UTTE 4JO3L 4PBWD 3TVMB 5T3ZD 5HDBE 1IJ9A 3SGDH 5L8KB 1W0WB 3QXVA 1BD2E 1J1OL 4LLMA 1A02N 2Y36H 4LVNC 5DWUL 3M1BB 5FYJL 3TGXA 1V7NH 1LP9F 3SDAA 3QUYB 4LSQH 2DIJA 4JHZA 5MI0B 1G6RB 4JG1L 3T08A 2OI9B 4L4VD 4TUJB 2X6MA 4ISVA 3CK0L 5F6HJ 1AE6L 4Y16C 1UYWL 2FRGP 1Q9LA 5DJZA 4L3ED 2W9EL 1X5FA 3KPOA 5I66B 2ICWI 2EDEA 5C0AA 4LLWA 2DF3A 3ZDZE 3DECA 3DXAE 3AM8A 2DLFL 3AB0B 5MENA 4Y89A 4PV8A 3O3DA 3S5LG 5F70A 2L4OA 5J6GA 4J1UA 3NVQA 3QXAB 5FXCH 1B2WH 1DQJB 5A2IH 4O9HH 1B0GA 2VZ3A 3LIZH 1KGCE 3ZDXE 1IZJA 3B2UD 4S1RL 2DM2A 4YNYA 1N6UA 4TNWK 3MFGB 3RVTD 3D39E 3SJVA 1R3LA 2YMXL 1HHJB 2YUWA 5SWSD 5B38G 3N06B 5I15L 2PCPB 1N59B 4MXWH 1F3JA 1QSFD 4ACPA 3BGFB 1CFSB 1X6NA 1A4KA 1JF1B 4MCYA 2YN3A 1A9EA 3NPSC 3IDYB 1MFAH 3HLAB 1X5YA 2GJ6E 4FZEH 2AV7A 1QLRA 2CLRB 5B22A 1UENA 1H15B 4YXKL 3E2HC 4QRSA 2JCCE 1DUZB 5E5UB 1D9KD 2R0WL 4XBGB 5CINL 3EDJA 3O2WL 4X4ZA 1XGPA 3QZWG 2HJKB 2C3HA 2XY2A 3MR9B 4FMFA 3MUGB 2VWEE 3JV6B 4OAWA 4P2OB 4JG0L 3NIDE 4M8QA 5E7FA 5C07B 4YC2C 5TPWL 5ANMA 4PJHB 4LOUD 2VAAA 1RZFL 4Y19B 1UCBH 1R3KB 5D5ME 3C60A 2OP4L 1OGAA 2AXFB 3TESA 1I9RH 4KKAC 4HZAA 4NQEA 1H5BA 1RZFH 3BI9X 3OX8B 1YEEL 1W8OA 1DQDH 3VRLE 2FNBA 5DUBB 1K85A 4I77L 1P53A 5IESH 3V5KA 5IUSA 1G7HA 1UWGL 5IBTH 3QUZA 4Y1AA 3VU2A 2D4FA 1QFUL 3GBLA 3HG1A 4PJGB 1T22A 5C0EA 5DJXB 2HG5B 4R0LB 2BSRB 8FABA 3EYUL 3WDHA 3L1OL 1BVLA 1OD7A 4MS8D 1JGVL 5DSCB 5F9WB 4DZBB 3WJLC 4RGOH 1P7HL 3PWJA 4LEOB 1Y0LA 1VFMA 1OTTC 4PP2A 5CJXA 3RVVD 3QNZB 3W39B 1B88A 4WEBH 3L1OH 3FO0H 5I18H 4WWID 5CD3A 3O45A 4NN6C 4Q2ZB 3STBA 3VXQA 3Q5YA 1OPGH 5EULV 4AH2A 5I1GL 4N1CA 1BLNB 4DK3A 5FGCB 1I8KA 1SJHA 2VXTL 5DQ9B 4M3KB 2MSPA 2B2XL 4AENB 3WDIA 5BJTA 3V6BR 1ORSA 4QRTA 2JK5A 1SY6H 1EGJH 5DHVB 1BX2B 2X09A 4O9HL 3G5ZB 2J6EL 2NYYD 3FO0L 3CVIL 5E4EC 3RJDA 2DDQL 3MLTB 3SHSA 3QCVL 1FNAA 3WIHL 2JK5B 2IPTL 1N6VA 1I1YA 4JQIH 2C9AA 3N50A 3C5SB 2XTJE 4XP4H 5E8DL 1F2XK 3V4PL 4QEGA 4HS6A 5C08D 5J3HD 3OAUH 2ZSWA 5IF0A 3IJHB 1T5WA 1HOCA 5C3TA 5FM5O 1MEXH 4JFXA 3SCMA 1AO7B 1XFPA 5IEHB 4YX2H 1IAKB 3DVIA 5DQJB 5GRWA 1P5VA 3Q6GL 1NCWH 4QWWC 1Z9MA 4KFZC 4XNYL 4GW1A 1I8IB 2AJYL 5INCB 3TIEA 2X4UA 3ZT6A 4GG6E 1HWGB 2PW2B 3C6LA 5DFTA 3EFDH 1MF2L 2I60L 4H8WH 3U7WL 1VEOA 2C3VA 1CU4H 3KNBB 5MEOB 4X7EC 1QVOB 4P4KA 4ODWA 4U6XB 4OLXH 4YE4L 2R2EB 1TNMA 3V4UL 3MRDA 4JFDA 3FRPG 2FBJL 1A0QH 1J0HA 5D1ZC 3BZ4B 3FO9B 3K8MA 3RPIB 5HD8C 2NYYC 4NP4L 5FUCC 4N0UB 1OSPL 2VLKA 2XG5A 3IYLW 3C6SB 3S3PA 4WWKB 4R4FL 3RNQA 1LMKA 1L9MA 4HK3N 5B3JF 1O5DT 2WQ8A 2ESVA 3F12A 5C0CB 2WW8A 3SO5A 1LE9B 2YD9A 2XZZA 4DFIA 5I8EA 4W4OA 4IDJL 1HHIB 5IFHL 2YSSA 3WFCH 4PRDA 3QNZA 1UB5B 1KCVH 4X9FA 3VGGA 3DUUB 5EIIB 4F8TA 5T1MA 3GSWA 4NBZB 4F33A 2X44D 5BVPL 3DVFA 3B5GA 1AD9A 5L88H 5FF6A 4CMHB 1G7QB 5J1AB 5JPMB 4IOIA 2KUTA 4ZSOA 2CUMA 3MRQA 1T0MA 1Y18A 3GKZA 1YEGL 4X6CF 4KI1A 3IXTA 2BDNH 4NUJB 5DYOB 1J05A 2YRZA 1ZSDA 2VLRA 3HPLB 2PTVA 1MVFA 5DD3L 2DM3A 4OLUL 1E6JH 4F33B 1JZ2A 2H41A 1I9IL 4XCFL 2NY6B 4OI7A 4KV5F 1YDPA 4TVPL 2DQJH 5EOQH 3TCLA 3JV6A 4QHMA 5E94A 3LH2L 2P49B 4HAGA 1IILE 2EDDA 1ZHLB 3PP4H 4ZXBA 1S7XB 2D4DA 1UVQB 2IMNA 1I1AB 2F74A 4YXHH 4JRYE 3H9ZA 4PYHA 5EA0H 1WQVT 4MWFB 5TGBB 4U0RB 2ZG1A 2I9TB 5IFJA 1BOGA 1E4XH 3S96B 3QB7C 3QIWD 5DQDH 1DN0B 2V2WA 5I30H 3FFCE 1UM4L 5AAWA 3AC0A 4HUKB 1EHNA 4NNXA 3J8F7 1UQSB 2NY7L 2UUDH 3IETA 3ZE0F 3QG7H 4P59L 2R9HD 4XBPA 1GZQA 3QH3A 2NW2B 1IEHA 2J12B 2JJVA 3N0PB 5CCKL 2DB8A 4QXUH 4ZPVA 3UJTL 5ADPL 5LBSH 4JANA 1NL0H 1G0DA 1OW0A 4O00A 1IAKA 4XP1L 1HINH 1KPUA 1HHKB 5DRNB 1RULL 3QXDA 1CICD 1JNNL 3UYRH 5DC9B 2XWTB 1HXMA 3ILPA 1F58L 1JPTL 3B5TA 3C2SA 4TPRL 5J3HC 4CU8A 3BDYH 5A3IC 4O02L 2FX9H 5TF1H 5L0QB 3U9PH 3RWEA 3KPOB 1FO0H 3UJIL 2AAVA 2F5AL 4WHDA 1JGLL 3GSNH 2VZTA 3CSGA 3KJ4C 1MRCL 4JDVA 4MLSA 5IK3A 1E0OB 2APBA 3PWNB 1KEML 3A67H 3STZA 5LGKA 5GGSA 4MAUL 4IHOA 4NC0B 4JFFE 3H8NA 2CIIA 1ZLVK 1WAAF 5E6IA 3MX0A 2DOCA 4WU5B 2FWOB 4PJBB 4YDKL 1YEHH 3AUVA 1V7ML 4WIQA 4H1LA 3G5XA 4TQEH 2ITCA 4P4KC 3W9DB 2ESVD 4NFCA 4FQLH 2VLRE 1XCTA 1D5BA 1NDGB 1NMCC 1Q1JH 5ESQB 3W11C 1A7NL 3NPZB 2BOCA 4X7TB 2ATKA 4TQEL 4NHUB 5TDNA 1G9NL 4OFKA 2Q86A 3U83A 4AYFA 2BY3A 3HNVH 1A14H 5F96H 1U8PB 3P0YL 1J5OH 1BVKA 1QA9B 3MMEB 5F7WC 3BWUC 4MD0A 4N68A 2AI0H 1JRHL 5JIHA 3UZVB 1I7TA 1FNGB 5F8RC 5JORB 5F3HB 5B38B 2XN9E 1KSRA 2PYEB 4X7TA 3TZVC 1T6WA 3QQ4A 1XR9A 3FT4A 3PGDA 4MMZC 5IV2B 2HJFB 1A7BA 1EO8H 2LV4A 3MOAH 2VXUL 3F58H 1FFRA 1A6TB 4MQ7B 4R0LC 1INDH 4MD4B 3HMXA 5C8JB 4HPOL 1SEQH 2DQUL 4K8RH 1IL1A 2K1MA 2YBRA 1ZHBA 1CFBA 3O4OB 2A83B 3D2UA 1IAIL 5DJCA 3RUGA 4MD4A 3P4OB 1PAMA 2D2OA 3GUTA 1BIIA 1NLBH 4FA8A 4K2UL 5GGTA 3VDBA 1IMHC 5I1JH 4CDGC 1DEEB 3UMTA 3LEXA 1N3NA 1EPFA 3ZDXF 1LO5B 1VKXA 4Y8AA 3W5NA 4NQDE 3EO0B 2NR6C 3L3GA 3QIBC 3U2SB 1TZIA 2EICA 1D7FA 3OKMB 4NQDA 2A2QT 2YUXA 2QADD 1NUNB 2MQCA 4I0PB 3OAUL 5DS8A 1NEZA 3FQTB 1A47A 2V2XA 2IFGA 1NMBH 5E1AA 3QDJA 1QBBA 3K8LA 1L4IA 4LF3A 2PN5A 5IW1A 4UT6H 4RMRA 32C2A 4YDVB 2OTUA 3RZCD 2Z35B 2W92A 5IM7B 3QEHA 2XICA 5E70A 2KBGA 3V79C 5E03A 2H26A 4FQHB 3FN9A 3ARQA 3H3PH 2Z31B 3QI9D 5J13C 1RURH 1FORL 4XGZB 1I3GH 4R7NB 4JJHA 1CL7I 5D7KD 3I2CL 3WKMH 2B5IC 1E4WH 3VFGL 3VG0H 5KN5A 5F97E 3DUSB 1KB5L 1RURL 2I24N 4MGXA 3BDYL 4ZUWA 2Q6WA 3MRCA 4NO2B 5GS0L 4I13B 3DSNA 2Y6SC 1H3TA 1AGBA 2C4XA 3PHOB 5HGHB 1S9XA 2APFA 4RDQG 4RISH 2AXGA 3KDMB 3D1MC 1J0JA 3IDYC 3SDAC 1KENL 1AXSA 2PTTB 3THML 2E7LA 5K59E 1AI1H 5ABDE 1Z6JT 1NDMA 5CJOL 4MAYC 1PKQB 2R15A 1K5NA 1LVEA 2EDRA 4NWTL 1CIDA 1R3IH 3QQ9C 4GBXB 4P2RB 3WSQH 3HC3H 1RV6X 3LKRB 2DD8L 2MCPH 1HIML 3QFDB 3I6LD 4YC2B 5KSAB 1M7DB 4KK8D 1TJGL 2G5BA 4ODVH 2EDYA 4NN6B 1LEKB 1FAIL 4GW4A 1A1NB 3VXRB 1ZHNA 3NFNB 2NZ9D 5I6XC 1U3HD 3BQUD 3T0EC 3AS0A 4K7FB 3BO8A 1AJ7H 1HH6B 1X5XA 2BVYA 2X4SB 1Q94B 3VGEA 4GKNA 1QSVA 1XF4A 2DTSA 3TIEB 3MUHL 4UDTA 4OZHA 1I9IH 3HA0A 4DFHA 3MLXH 4PY7A 1DUYB 2IH3A 3TBSA 5KS9A 4GKZB 1FO0A 4X4XA 3AU1A 2GW5A 4WW2C 1HSAA 5DVOA 1S7RA 4S11A 4URTB 1J8HE 2YEZA 5TE7H 3BP5B 4OLVH 1ES0B 4KJYB 1ZWIB 4JKLA 1K8DB 1KJ2H 2BNRE 2EDOA 4FFYL 4QRPE 3IDJB 4LGPB 3KPMA 4UDUA 4WWKA 1U41A 2AW2A 1S3KH 2VLRB 4IMLA 4FQ1H 4RGNB 1MQKH 2BOBB 4R3SA 1UZ8B 4RAVB 3C8HA 1YPZA 3WXWH 2BNQD 4XPBL 1TTFA 5ESVA 2A6JA 5C2UB 1NCTA 4OKDA 4E0RB 1JGEA 3ZKXC 3O9WB 2OMNA 3UC0L 2NY3B 4MSWB 2DQHL 2VR5A 1IE5A 2RHEA 3HZVB 4OGAC 4GXVH 4U1JB 1A64A 3QBTB 3L5WA 2ZPKH 4HG4J 5I1HL 5D93B 3MPCA 3PWVA 3NN8B 2VXQH 3DO7B 3D69A 3QIWB 5DJ2A 4GW5B 4HUUB 5TQ0L 4OFDA 1T1XB 1Z0NA 4OD2A 2ZOKA 4PP1C 5IM7A 3V52L 5JW3L 3QIBD 4BFGA 4FXLA 5T1KB 4LLAA 4B50A 3QIWA 32C2B 1YN6A 3QA3B 1WBXA 2NY2C 2VC2H 4M1GH 2LU3A 1A8JH 4HLZG 4O2CA 4OLVL 5JQHC 4NQXB 2P5WD 1PYWB 3EFDL 1GZPA 3PWUA 3WO3B 3BXNA 4ZO6A 1GRWA 1OSZA 4LL9A 4LVHC 2DI9A 4IMKA 1OD9A 5CJXC 4P5MB 4X4YB 1LEIA 3CFDA 1BGXL 3I50L 5C09A 5BJTB 2G60L 1H5BB 2FIRT 3SN6N 1QBLL 4KHXH 1O0VA 4FQXD 2FJFA 4JY6A 1T0PB 4KMLB 2A0LC 5IBTL 4OIIH 4X6CE 3P4OA 2BHZA 5IQ7L 1FGNL 1IL1B 5I17A 4EUPH 2Z4QB 2GFBA 4B41A 1VADB 1KTRL 3O2DL 1DFBH 1MHHA 3CDGA 4PJ9C 4P23B 5EU7E 2ATPB 2MHAB 4HCRH 2EXWD 2ICES 4ZPTB 1T1WA 2ZUUA 4BZYA 4CN4A 3JTSB 2AJUH 4JVPA 3VXMA 3GMRB 4U1JA 5LQBH 5E00A 5D6CA 5D8JL 1B0WA 4R0LA 2X4TB 3RDTC 1I1YB 1CDYA 1IGJA 1IEBB 3CJJA 4KK9C 5BXFB 1XT5A 1LEKA 1MCWW 2HKHH 3B9KB 5CP3H 1JPSL 3GNMH 4P2RA 2BFVL 4HXBH 1ORSB 3QFDA 4Y4KD 1RJZA 3E3QC 4PY8I 1CVSC 3EOTL 2OK0H 2ITDB 5IB3A 4J8RB 3RDTB 3MJ9A 3RUGE 2PTTA 4PRAB 4Y19A 4B7LA 4RRPG 5IW6A 1S7RB 4ZDHB 3BZDA 1OQXA 1QACA 4BQ6A 1T0NA 2MWCA 5F1NA 1IKFL 1BF2A 3IS1X 3GB7B 1Y0LB 3BX7C 4WGVB 2XA8H 5CSGA 4X9HA 4NRYB 2P8PA 2Y5EA 5IQ9B 5IESL 4PJFA 3DURB 1A1OA 2QKIA 1UXSB 2IALA 4PJIB 1EIBA 4EI6A 1KJ2L 4MAYA 4WVRA 3MODL 3MTRA 1XIWA 4HCRL 3MGTB 3MA9L 2X4OB 3CU7A 4YUEL 3SGEH 1A1NA 3VWKB 2MMXA 4M00A 4XVUC 3PQYA 2EIBA 1KLGA 2APVA 2ADIB 4GH7B 3FQUA 1HILB 3FB7A 4M1CC 4HZLB 3OKOB 3T77B 1EMTL 1SHMA 4G8GE 1IC4H 3R1GH 4X6FA 3ZKSD 1JV5B 3MXWH 1U0QA 3GSQB 4FS0A 1DANU 2QQKL 4KKAD 4MD5A 3ILQC 3L3JB 2MCG1 4JM4H 2VDKL 1S8DA 1WZ1L 3C87A 4LRNL 2K7PA 3VGBA 3QDHA 2IBGA 1EGJA 3T1FA 3L3JA 3IJYA 4JN2A 4JRXE 4L29B 1R3JB 4PS4L 2EZ0D 5DMKA 3REVB 3SDCC 4XTRD 5C0DA 3GKWL 3ORJA 1D6VL 3C5ZA 4X5WB 5DS8B 5DA4A 4D9LL 5MENB 4FG6C 1RUQL 4OZHF 1EEZA 1TZIB 3BEVB 3O3AA 2P47B 1ZT1B 2WIIA 3E8UL 4KK6C 2Y9RT 2YD4A 3VXPA 5A2JH 2J7LA 3WFZA 4WY7H 5I19L 4F7MB 2R39A 1TVBA 5CJ8A 1NCBH 1ZVSB 3THMH 4MWFA 2OS7A 3HR5A 5DHVH 2QR0B 3IDMA 3MRIB 3V0VB 4Z7WB 1FZJA 2RCSH 2ICCA 3RGVB 3RGHA 5DD1H 3K4DA 1P9MA 1L6ZA 1AKJA 1AGEB 3RGVC 1L0YA 5EOCL 3FB6A 5MHSD 1P6AB 3RJQB 2VZOA 3LPWA 1QYGL 3LZFL 3D25A 3O2VH 4XMKH 3HC3L 3INUH 3JWDC 4OFVA 1YEFH 4UV7L 3P77B 5EBWB 5EB9A 4XWOD 1J0YA 1QHOA 4HGKC 3VXOB 5DJYA 3I3EA 3RY4A 4X4MA 4WEUD 1KT2A 3X13B 3C8KA 1NFIB 1BVKB 1NBQA 1SJEA 4QY8A 2PYFB 3IFLH 1WZKA 1ITBB 4HJJL 5ID0A 1MJ8L 3DGGB 4I0PD 2NTSP 2GTZB 3QUXD 2QL1A 3N1FC 1T1WB 4KVNH 3V6OC 1WITA 5D2LF 4D9QE 4GRWF 5DMIL 3UXFA 2BVPA 4X7FC 3TO4C 5JUEH 1ED3B 1NGWA 3MACL 4ZTPH 2JKXA 1A6PA 4B53A 1E4XI 5LGJB 5DJDA 3VH8A 1ZHBB 5JDSA 3SOBH 2Z31D 3OJDB 1PW3A 1H3GA 5F71A 2HFFB 5K9JL 5E6IB 4L4TA 5DD6B 4AM0B 2ZCKH 1CGVA 1F6FB 4U3XA 4OV5A 4RGMC 4G8FB 2OI9C 1J0KA 9CGTA 1N4XL 1U91B 1TMCB 5HHPA 4OFIA 3RAJH 2YZ1A 3CFDB 1C5CH 5HYJA 3R8BB 4FQQB 3V2AR 4F8QA 5GS0C 1DBJL 4XPFL 4XI5D 4Z0XA 1NMBL 4L4VB 4S1SL 1AP2B 1A1MB 4LSSL 2QLVB 1URLA 1R5VB 1S7SA 1OWRM 4LVOC 4U1IA 3BZEB 3D0LB 4WTWA 4KKLC 5TDNB 2EIZA 5EUOA 3P77A 5EBWA 4AZ8A 5E5RB 2W0FB 1RD6A 5CJQH 4GAYA 4DN4L 1P4IL 1KPUB 2DQFA 5IVZA 1B3JA 3X12A 1DBJH 1XGYH 4XPFH 1JNHA 3DX9A 3FONB 4PGEB 2JB6B 4FP8L 3REWB 5JXED 3CXHJ 2O61B 1QBML 3R0MA 3TO4D 2J8OA 2MPAH 1QR1B 2YPVH 2AGJL 4AEHL 4OLWL 2CIIB 2EZ0C 3BT2L 1AGCA 2SEBB 4KPHH 4KMQA 2O5YL 3QEQB 4CVUA 3SDDB 3V6FA 3FQRB 1OAYH 4RFOH 4EJ1C 1HH9A 4NQUA 5EZJB 3O3AB 3I85A 2GUOB 1RUKH 3H3PL 1O7VA 5TE6H 3PABA 2XZQH 3BIAX 5B39A 3CSPA 1NPUA 1YECH 4NCC1 3TO2B 4HBCH 5C0DB 3CLFL 3RWEB 2YS4A 4RGNE 5E8OA 3VXTA 2EXYD 1T83A 3O4LE 4J3XA 2H2SD 3QEUB 4QHMB 4JFFA 1C5DA 4IIQC 1MJUH 5KVEL 2RCSL 1H5BC 4OCMC 1HXMB 3PL6C 1JYWA 2ZWLT 3DBXA 1BD2A 1J0ZA 1E6OH 2FSEB 3VGFA 1MCBA 1IGIH 4UDTB 1NBYA 1A5FL 2PXYA 4YFDB 5HHME 4GKNB 1CBVL 2BRRL 5IR1B 1ZSDB 4OFYA 1SQ2N 4LKCB 5ESAA 4LSTH 2DBLL 4KDVA 2V2TA 4I2XE 3M17A 2MPAL 4MJIA 3M45A 4M7LH 1JFQL 3KPTA 2EC9U 1T89A 2HT2C 3OKDA 2AABH 4NWUL 4F3FA 2ESVE 3OZ9L 3Q6GH 2FZ3B 2CJUH 1LDSA 3MV9B 5BO1L 2VE6B 3LKRA 3TZVB 4L9LC 1U8MB 4S2SB 3E6HA 5CCKH 4HMEA 2RIKA 1HI6B 1ZHLA 5D1ZD 5E7BA 2OQJA 2CUHA 5EUOE 1GSMA 4EVNA 5I17B 1HXYB 1IM9D 5JHLH 2VH5L 3H9YA 4AY0A 1U8QB 4YFLF 1ZEAH 1OTUC 5C07E 5JZ7D 3UPRB 4ZQKA 2ZSVB 5MEPA 1C5DB 1HDMA 3C6SA 5HHXL 2NY5H 5HGDA 1IC1A 3O4OC 4LP4A 1L7IL 4PFEA 3HNTH 1LEGA 2R29H 1UKTA 1CF8L 4P4RB 1NMAL 1CFNA 3GMQA 3RA7H 2A73B 4PTUB 1A9BB 3X11B 5IJKC 3WSQL 4UILL 1BBDH 1D6EA 4O5LH 5FECB 3UTZA 3ZE1E 3ELAT 3GRWH 4MXVF 4QXUL 5C9KA 5ADPH 5IMOB 2GJ6A 1DANT 4KV5E 4HWEL 4YK4B 4DWHA 1CFSA 1TNNA 5T3XL 1IC4L 3R1GL 3RNKA 2GCYB 4QHUA 3HAEA 1KIQA 2DICA 2PO6C 1WCQA 3MLVH 4LSSH 2ATPA 3SGEI 4ZSOB 1YMHB 5DFVC 2OL3H 2X1OA 4YHIA 4PJDF 2IPTH 3D85B 2H26B 3RZWA 3C6LC 3UTTB 2KQMA 4PJEB 4WJ5B 3P9MA 5ANME 4YDIH 5IF0B 5A1AA 1BJ1H 3TLRA 3T4YA 5D1XD 2XXMB 1YNTA 4V2BA 5GGTL 1A6WH 1GHFL 4MJ4A 4PRNA 1GC1C 4QNPE 2VXTH 3MRKB 3VFGH 3BRFA 1MHCA 3MUJA 1FGVL 3WFBH 2F8XC 4UIMA 3T65A 4ZO7A 1I3GL 1XGTB 1F3RB 1QFWH 4P9HH 3B9AA 5TQ0H 3DVGB 1NGZA 3O11A 4HF5L 4F7PB 3FCTA 4GFTB 3QIUA 2NXZB 4NKQB 4FFVD 5AYQA 5CD5C 2ARWA 3ZE2E 3U0WL 2HJLA 4W4OC 1Z3GL 2Q3ZA 1CD0A 5CBEB 1FGNH 4UIMB 2FX7H 1U8NA 5D7KE 1XZ0B 5EU3A 3VFSA 4JY4B 1XGQA 3MRFB 5L9DL 2JJSC 3GHEH 4GOSA 4YIQB 3QUYA 3QUXB 1F4YH 3ARRA 5CKAA 4E41E 3D2UB 3HFMH 2HVJB 4ELMB 3DV4B 2MOVA 4PGEA 5EBMA 2AK4E 3C09B 5ETUA 4YHLH 4TRPL 1FE8L 1OM3L 5T5FH 4TSCH 2R2HB 3RNKB 4X80L 1MSPA 3QO0B 5ACLA 4KZDL 4M5ZL 3FQXB 5FDYA 1A3LH 2Y5TB 1FZKA 1EEYB 4RAVA 3CX5J 4J3WA 1FH5L 4P2QB 1ADQA 1KCRH 1AP2A 1WLHA 4E0RA 2GK0A 3MLTA 1H3XA 3WS6C 2DQCH 2JJUA 4JM2C 3CXDH 1D6EB 3AMKA 4OFYD 3QHFH 3EDDA 1KIRB 4XCNA 4G80B 3VMPA 4G8EA 3BIKA 3U36A 1NAMH 2Y7QB 4F7PA 1AJ7L 3CXDL 1BGXH 1T66D 1FNEA 3I50H 2CGRL 2EH7L 4OFPA 2AXFA 3IDXH 5C0GA 4KQ4L 3P4NB 2GJZB 1HXYA 1G7PB 3WN5A 4OCYH 4M8QB 3Q6FB 5JDJA 2QQLH 2OQJB 4UMGA 1XCQB 1DLFL 15C8H 5JW4N 3O45B 4Q2ZA 5DD0H 2XWJA 3P9MB 4Z5RA 4TULH 5L7XH 4U6VH 1ZHKA 3LV3B 4B0MM 4YHMH 1KXVC 5EU4A 1Q9WA 2D7TH 8FABB 4JM4L 1QRKA 2AV7B 4Y5VA 2AEQH 1HH6A 3TV3L 2YD3A 4NOFA 3OB8A 4PTTA 5JXAL 4JFQA 3BKYH 1J8HD 3O8XD 3CFEB 4N8PA 1JGUH 5FA4B 3GSUA 3QXTA 3DVNB 1UH2A 3MJ8B 3SJVB 3RQ3A 3ZO0A 4L8SB 1U58A 2D0HA 4HMDA 5D71L 3EJZC 1DQLL 1A9BA 1M7IA 1S9YB 5J06A 3CFKB 3BKJL 2ZJSL 4P5KA 5D2NE 4XNUH 5J56B 3C60B 2BNQE 1INEH 4XHJC 3OB0H 3TF7C 5BW7A 4POYA 5DFWH 1P5UA 1KUMA 3ZKMD 4ZQKB 3O3UN 3ROOA 5FKAB 4LARH 3HR5B 3QCUL 3OKKA 4K55A 3ULVH 4GBXC 1MAMH 3NACH 4U7KA 1VFAB 1T1ZA 2CR3A 5ICZA 5KTEH 3VD5A 3QJHB 5CEZD 5GJSH 1ZT1A 2FB4L 5JIKA 4M43H 5IHLB 4KGJA 1BOGB 4JKPH 4I3SH 4DKDC 2P1YA 5DMYA 3BJ91 3MJ7A 4RIRA 2NY4B 3QSKB 4Q6IB 4MJID 4LAQH 4PJFB 1BP3B 1F3JB 1N0XL 3MV7B 1G6RA 2XWJB 4PLOB 3Q1SH 4Z7UF 2BERA 4OGYL 3IU3B 1VFAA 3GUTB 2P5EE 3B8SA 1C12B 3BQUB 3TBWA 5BMFH 4C55A 4XC1H 5D5MA 2VDQH 4PYGA 4JQVA 2LQRA 1QBLH 2P5WE 1MNUH 2JB6A 1YYLL 3U4EA 4DUXA 5L9DH 2OR7A 4Y16A 1SMOA 4HLJA 1FNFA 4ZMAT 4F37F 2JJTA 4OKVA 3L9RA 1C5CL 3VFTA 3AXLA 3U46A 1KJ2A 3PE9A 3D48R 5EA0L 1NEZB 4NOBA 1U58B 1BZ9A 4APQA 1QHPA 4D0DA 3O2DA 1A21A 2N1KA 1F45A 2GHWB 1IGJB 3RHWF 3HS0B 1MCSA 4WNQB 2X10A 5JW4R 4KTYA 3QRGH 4OZFH 2X4TA 4I8DA 43C9B 5EU5A 2XV6B 4C58B 1UB6B 4JPVL 4Q97A 5EZIH 5B39B 1CDBA 4G9FD 1FQ9C 1ACYH 1LP9A 3TT3L 2XQBH 2ICEA 5HHVH 2HRLA 4MAYB 4ODSH 4OV5B 3W82A 3V7AE 4UU9B 8CGTA 2ORBH 2QKIB 1EAJA 1JTPA 3EYOB 4NO3B 3H42L 5IEKB 5K93A 4NQCE 5IB2A 3QRFM 3BKYL 2VQTA 5H94A 2ZCLL 5I1IH 1JZ4A 3DX8A 1CFQA 3LKPA 2UWEA 5L88L 2Z0BA 1E27B 2WBJD 5GRVL 4I9WE 4OGAD 5I1DB 2A1WL 2QBWA 4V1DA 1ZT4B 4WUKH 2V7HB 4JG1H 1AD0A 3IDIA 4Z7NF 1YEKL 5L0QC 2Z92B 2FJHB 2ENSA 5D2NC 5ID1B 3CC5B 5T5NG 1NFIA 5J7CC 1UGNA 1QFHA 1J8HA 3NMEA 5KSBB 3OKLB 1T03L 3EOYG 2GK0B 4WDIA 4EI5A 2D9QB 2FCBA 3S4SA 3SE3A 1PQZA 4CNIB 3QDGD 3N85H 1A6ZA 1J0IA 4QRUB 5I1CH 1YN6B 3QPQC 1C1EL 3TNNB 1KN2L 3ZKXB 1MHEA 1QSZA 2NZIA 4YDJA 3VD4A 3WS6A 1NCDH 5LXGH 3QZWA 3O6FC 1LD9A 4ELMA 3QIBA 5IMKA 4KJQC 3L7EB 4KJQD 1N7ML 5CMAA 1R5IA 3IDMB 4F2MB 5LVEA 4RMVA 5BQ7B 4KAQL 4OF6A 4PD4K 1XMWA 1CZ8L 4G8GD 2LU4A 4QTIH 4PGCB 4X80H 1K3ZA 1OP5K 2I07A 2WIIB 25C8L 3UTZB 5HGAA 2W59A 1JGDB 2VLKE 4CAGA 5T1DH 4UBDC 5TJWK 5KVGL 4YGVB 4WV1B 4OSUH 2HFGH 3CVHB 1IGFL 3FO2A 4JRXD 3SBWC 1ZS8B 3O3BB 2XYCA 3RWCB 1MLCA 5HGDB 1OAZH 4FQ2L 1P7KB 1X5KA 3GO1H 3X13A 3KPNA 1AIFB 4HLZH 2DS4A 5JOFB 4XAWL 2DL2A 2EYRB 3F8UB 3ZHLA 4X7SL 4PGBB 1TJGH 3LQAH 2HRPH 3MREB 3SE4C 4PRID 3QCVH 4NC2B 3QWQB 2VABA 3IVKB 5HHMB 4R8WL 4WU7A 2DJ4A 4PB0H 1FFPA 1Q0XH 4GSDH 1MREL 3PQYB 1T7ZA 5B39G 2HT2D 3SPVB 5KSAD 1NBZA 3FQUB 2M2DA 3O9WD 5ITFB 5FGBA 2G75A 1WBYB 4NNYA 2X89D 1KLUB 4XVJH 3SDCA 2OK0L 4DVBA 4JM2F 4LHQB 3C6LD 4NC1E 3GMOB 1CFNB 1PBYA 3QO1A 3X11A 4EQ2A 4XZUA 3S8WA 4NDMA 4JO3H 5F1KC 4PJIF 2BHYA 4KQ3H 4HJ0C 5GHWH 4U2YA 2NY0C 3K3QA 1BM3H 5E94B 1WC7A 4OM0H 1X5AA 1N26A 1A6UL 4KTDL 3NCYP 2EDHA 3QO1B 1UM4H 3TBSB 1AQDB 4AL8L 4MDJA 3RTQC 5CGYD 4HEME 4I4WA 4L5FL 1HZHL 4D9QD 1HI6A 2E9JA 1RJYB 4KK8C 1ZE3C 4K2UH 1A7QH 4M7LT 3ULVL 1HYSD 3GMOA 4NJAH 1HHGA 4XP5L 3MO1B 2CDGB 4PJCF 3VFOA 5F7MC 2R1YA 5SX5H 5HYQB 3OGCA 4JJ5A 4U3CA 3AREB 4PJAF 12E8L 5CINH 2CIKA 3STLB 2XFXB 3EYQD 5J1AA 4XMLL 2FBJH 3BD3A 5C70A 1JCKA 1BWMA 4RMQA 1LNUA 3QULA 4M7KH 1RHHB 4UQ3B 1D6VH 3K2MC 4XCYA 3GSOA 3RZCA 4LARL 2ESVB 5LG1A 1KV3A 3HE6C 3LDBB 1LO4H 3VRJA 1TZGL 2RBLA 1XGQB 1LK2A 3MRFA 4G8GA 1U42A 1N7MH 5KSAC 1P4LA 1VA9A 1XGRA 5M95B 3S37X 3PHOA 4QXGH 5HGHA 3UAJC 5FV1L 3C2AH 4M8VA 1NAKL 2EDQA 4BJLA 1CFVL 2B8OT 2NX5A 4O2CB 4N9GB 2P5EA 3RVVC 1JGDA 2R4SL 4JPIB 2B39A 1KJ3H 3LZFH 3AS3A 4PRNB 2BJML 1VFBB 2UWEF 3QO0A 3UC0H 3BVNB 3UTSD 2D0FA 2BDNL 4ZUSB 4JB9L 4WV1C 4HBCL 1YEGH 3F7VA 4PJ8D 1T4KB 4PIRF 2NW3A 2CKBH 3KR3L 3WLBA 2X70A 2ED8A 3HI1B 4JE4B 3UTTA 5CSZA 5MI0C 3MREA 5IJKA 4WY7L 3WUZA 1PJ9A 5D72L 4UOJA 4JPWL 1RK0B 3TVMA 3FONA 3K4ZA 5E5MB 3S35X 2HWZH 3VFNB 4G6ML 1UJ3B 4HWNA 2JCCB 3QUXA 3O4LD 4FQCH 5GGRY 5DVKA 1K4DA 3U7WH 4JZOA 2J8UE 3L5JA 4DW2L 4XNQB 5LAXA 3KYKL 4U6HB 4M62L 4OZGA 1HINL 5F7HA 3DSFL 5GGVH 4NM8L 3W0WB 5F7YC 4M6NH 2HH0L 3SY0A 4HG4K 2L0DA 1CD1A 2FLBT 4JO2H 4OQ1A 3T2NH 5HHMD 4OCSH 2HFFA 3QUMB 4M02A 1P2CA 1CLZH 4KJYA 1FFOB 2RR3A 4W68A 4LMQE 3TYFB 3LN4A 2FYYA 2GJJA 2XN9B 1W2KT 3U7YL 4AH2B 4PRHB 2KZ1B 3ZTNL 5IWLA 3D3VE 3H0TB 4HUNB 5EC2A 2PO6A 3LN5A 1T2JA 4WO4D 5ICXA 3QIUC 3TBVB 3T4AA 5JW4M 4I0KA 5E6ID 1KTKE 1DFBL 5FK9A 1YJDL 4AL8H 3ZT5A 1DQQA 1T20A 3RIAF 1GXEA 3BO8B 2ICEB 5B3JE 1H15A 4KTDH 1EGJL 5C0EB 3IU4L 3K4AA 4ZAKC 5F3HA 1JN6B 4W81A 4G7VL 1S78C 2ADGB 4M48H 2NY0D 4JDTH 2H3NA 4ZUTA 3MLZH 1JMZA 3V6ZA 5KJRH 3KHOA 1HHGB 2YUZA 4HJGB 4BSVB 4E5XA 5DJYB 4CJ0A 3WO4B 2W38A 1A6AB 5GJSL 4OLUH 3HB3D 1BD2B 4GLRH 4QRRD 1OP5H 1JWUB 3KLSA 4PJHA 1RIHL 3HZKA 3Q3GB 3PXJA 2R0LH 2VLJA 2FGWH 5JXEA 5TDOA 1WICA 1R3KA 2ICWJ 1S5IL 3E2HB 4K94C 3P73B 4PJHF 3BUYB 3ECBB 3B43A 4Z7UE 3SDXF 3U4EB 1NGQH 3KLDA 1HK6A 3F65A 1EVUA 2VLJE 3VG0L 4QRRB 4MJ2A 4JRXA 2FWOA 3MV8B 5C0IA 1WT5A 4NUGH 3LQZB 1OTSC 2ZUQB 1AGBB 3ULUF 2QSQA 5BZDB 3VXME 4QRPB 5AD0B 4LSPH 5DRWB 4YFLI 1MI5B 1JYVA 2DJUA 3OPZH 5EWIH 2DLIA 4WFHD 2PYED 4PJIA 4LCUA 4OCXL 3ARYA 1CL7L 4H26B 4NHCL 4M9PA 1ROWA 5A2KH 1N59A 5CZKA 5FM5M 3C5ZB 4C56E 1ZAGA 2GTWA 3AAZB 3LQZA 1HSBA 2R0KL 3X14A 2X1XR 3GSXB 4IIQB 4OIIL 1VCAA 3GMPA 3QFJB 4ZDHA 3L95A 3CZFB 4PUBH 3CK0H 1FL5B 1T21A 4FFWD 5KSAA 5I8CB 5F7DB 5T1DL 2Q7NA 4G8IA 3ARTA 2X89A 3S7GA 1HHKA 3TWCL 2R4RH 4YHZL 2VAJA 2CRIA 4BA8A 1OAXH 2UY6A 1NC4D 1UACL 1BECA 4HJGA 1J1OH 1H3WM 4CN6A 1T21B 4H25A 4NO5B 3QXAA 4LGSB 1U2HA 4K7PL 4U6TA 5H35A 3EBAA 1OP3H 2ADIA 1JUFA 2YWZA 5JLZB 5D7SL 1QD0A 1FIGH 3NFSL 1D5IL 4WV1A 1L7TL 4J3UA 1C7SA 3BD5A 3QDME 1XGUA 1I7UA 1LO3L 4Y2DC 3ETBF 3N1PC 1Q9WB 2AK4D 2VR4A 3LSOA 1NCDL 3DIFB 1YQ2A 2AJ3A 3MCLH 4Z7NE 3BZFB 5KW9L 1O7SA 3BESR 2P8LA 4LSVH 1U8IB 4DKEL 3DSFH 4Z76A 5E0QA 1N6QL 4JO4H 4HGMA 4XB8A 5J1TC 3PIQA 4P46B 2WM0A 4LIQL 3LN4B 3S5LB 1G7PA 4KRPD 1LDPH 3B3IB 4OCRH 3CX2A 4E9LA 1MLBB 1LD9B 2PUQT 5CHNA 4JQXA 4PJ8C 3P73A 3FN0L 5E95B 3WXWL 3LKOA 1AHWB 3SDDC 2CPCA 4Y7MA 4X8JB 4UV4H 4GRWB 5DRZA 3V5HA 1DDHB 5TDPA 4RBPH 2FEDC 4S1RH 4ODTH 3ZKMC 4IRZL 4LVNB 4LMQI 5HDQL 2AXJA 4BM7A 4PRHD 5GHWL 1HNGA 3ARDA 1HEZB 2EH8H 3GMLB 2OL3B 2B1HH 3WCYA 4PR5B 3FQXA 4RNRB 4CUCA 4QHLA 1EEYA 1MIEH 2FIKA 5DK0B 1JBJA 1BFOB 4PRPB 5H37H 3QCTL 2ILLA 3GJFH 3NIGF 1NEUA 4JFDE 3SKUD 1JI1A 4Y4KC 1CXLA 5E8EA 3WL9A 3JTTB 5TE6L 3VGAC 3CU1A 3HUJF 1ZXQA 3S3SA 4NZUH 1OT1A 2X4QB 5L6YH 4HUUA 1RUKL 3SQBA 1TDQA 1VEMA 3W9DA 5GZOC 5IROA 5CSZB 3NA4A 1HQRA 4XXCC 4HWEH 2HTKD 5GGUA 2P8MB 5GZNC 5HPMA 4J7RA 4QXGL 3IJHA 1QZ1A 1NGWB 4FQXA 3CLEL 2D3VA 4BZ1L 2Y06H 1CCZA 3TH3T 1F58H 1JPTH 2Y36L 5DWUH 3ALPA 2VZ1A 1S7UB 4R9HA 2VLKB 1JK8B 1JZ3A 4Q0XH 1IARB 4PJ9D 4JAMB 1KB5A 2DM4A 4G8EB 2MCPL 3VWJC 2MNUA 5ALCH 4D2NA 3OKNA 1WZMA 4EXKA 2OM5A 1LEIB 4Z78A 3IGAA 5KZCD 5LBSL 4JKWA 4L9LB 4NJ9H 1K6QL 3L6FA 2BMKB 3CAFA 2J4WL 4OGYH 3RI5F 5F93C 5BMFL 4IEFB 2VKXA 1WEJH 3VXSA 2AS5M 4XP6L 3VRJB 3MLSL 5DRXA 4XVTL 3A6BH 4UQ3A 2YHGA 3VW3H 3DX7A 3GSOB 5LGHL 1UCTA 2VTFA 1KACB 4OTXH 1S7WA 4G6FB 3WBDA 3G5VA 3JV4A 4WFFD 4CU7A 3K0WA 3WHE1 4DW2H 1I3UA 1T7XA 1U3HB 5BRZA 3GMNA 4HUXA 2XG4A 2GCYA 5JR1L 4ONOA 1CBVH 2P5ED 3VFPA 1SEQL 2YMXH 4XP9H 4OM0L 5F9JA 4G6KL 1F00I 2VH5H 4KKBD 5H8DA 5F9DC 2XNAB 4Q9RL 1R0AL 3VWKA 3FQWA 5FYKL 2R8SL 2YPLA 4MNGA 4GG8B 3V8OA 1F8TL 3T2NL 1DCLA 2AK4A 1U8LB 3CCHB 5M94B 3GJEA 1RZJH 3T0XA 4JZJA 4D9RD 4DTGL 3QQ9D 2FEEI 3EKCA 2D31A 1DQLH 1KJMB 3RVTC 4MA3A 2VLLB 4V2CB 3QHTC 3RU8L 4AENA 5JOPD 1NGPH 4FRWA 4KHTL 2DQHH 2DWEB 4NCDA 2EEBA 2RJMA 5ERWA 1IC7H 4QF1B 5C08A 5E4EB 5ISZB 2AEQL 3RFZC 4EVNB 3CPLA 4YHNA 3UAJD 1UC6A 1FO0B 4X4XB 1MAKA 3EHBD 1U9KA 3HPLA 3OHXB 1IGCH 4EN3C 4FABH 3S37L 5GRUL 5D2LA 3HLAA 3BEWB 1B2WL 4NKOA 2UVEA 2Q1EA 1KLGB 1LK3L 1WBYA 4KVCL 4KK5C 2V2TB 3MBED 5GPRA 2CMRL 1B4RA 4OBRA 2EIEA 4MVBC 4LCWA 1TQBC 2DLFH 2PW1A 3SE4A 1UA6H 3ALXA 5GGQL 3QIWC 4LRNH 5HYSA 1P4IH 5JIPA 1OGTA 5F1IB 1PX4A 5FO7B 3DURA 2YRLA 1YQVL 4JGUA 2LVCA 1H3VA 1VACA 2E3VA 3D0VA 1CE1H 1Z9OA 4RA0C 1RUQH 4D9LH 3GK8L 4BSWB 4AEHH 4I48B 1V3MA 7FABL 4HD9A 2XY1A 2F54A 3QDGE 2H32A 4MA1B 3WKNA 4N8CL 1HQ4B 1WBZA 2DBLH 1OGAE 4NC1C 3TZVD 4IOFD 5DK3A 4Y2OA 1CLOL 3TPUB 1TVDA 4W6YB 3VFUB 1PG7L 4J4PC 3NCBB 1AXIB 1RQ5A 1CE6B 4KI5F 4MJIB 4EQ3A 3IAGC 1WISA 1NEZG 3AVEA 4RISL 4XNXH 5MP6H 5D2NA 3GMMB 5DMIH 4L4TE 1MVUA 3P11H 1FPTL 1J8KA 3ARFB 4FQHA 1IZKA 5FUOL 3CDGB 4ZNCD 4UOW0 3PF2A 3GM8A 3T3MF 2EDLA 2JCCF 2UYLA 1JPSH 3ESUF 3GNML 3REWA 3DUUA 5ALBH 5EIIA 4XNMA 3NN8A 1OF2B 3IFLL 2Y06L 1I85C 2PKDA 4ZFGL 2EYRA 1HN1A 1GH7A 3B9KD 1JPFA 1EO7A 2BSED 2F8OA 5KSBA 5DHYB 1Q0XL 4ZFOA 1FZMA 4L4VA 4Q58C 2IQ9H 1ZLWH 3GBNL 5I0DA 3U2SA 1EXUB 4G6FD 4YGVA 3BHBA 1JL8A 4GAGL 2X05A 1DBBH 3W0WE 3H42H 1XF1A 1RY7B 4G9FB 3DVGA 3O11B 1LO5A 4YDLB 3BN9C 2UZYB 3WN5C 1KPRA 2O5ZL 3KLHC 2AJZB 4XAKE 3LKPB 4XH2B 5E2WH 2BSSA 3FO1B 4WW1A 1YC8A 4K94L 3PV6A 5DJCB 2J3SA 3KXFD 1JHLH 1HQRB 2Z9TA 5GRXG 4P59H 2VN7A 3QXWA 4I18B 4O4YL 2D7TL 5INCA 3EO1B 3B2VL 5T1LD 4I3SL 3RBGA 1U93B 4PV9B 4AEFA 4UTBL 3STZB 4RMSA 1CG9A 1NMAH 4NRXA 3RY6A 2AV1A 2R29L 2BSRA 2D03L 1F5WA 4JFYA 1JNJA 1PQZB 2JIXD 5HD8D 1CF8H 4BKLA 4CNIA 4DAGH 4XCCL 1V3KA 2I25N 2O5XH 5ID0B 1G0XA 2ID5A 1D5ZB 1P4BL 3NH7H 2VDRL 3FT3A 4RRPA 1GC1L 1U36A 2Z31C 3HRZB 1MNUL 2XZAL 2MTPA 3LPFA 3L3IB 1WF5A 2VUOA 5EBLA 4POZC 3MMEA 1M7DA 3AB0C 3MZTA 4BKLB 1BHGA 1FL6B 1DVFC 2V17L 4FTVA 1CICC 5T33L 3VFVB 4NHUA 2ARJQ 4FQIH 5I1DA 2ZG2A 5GGQH 4MCZB 1EDQA 5IIEB 2QSCH 3KPQA 4XI5C 3CIQA 4OAWB 1XIWC 5D7LA 3HC4H 1JIBA 4Q74A 5CAYB 1UADC 2J1KA 3C60D 5GS2H 4XBPB 5F88B 3FB6B 1A5FH 4ODUA 3X14B 4HC1H 1FYTD 4M1GL 3BPOB 5CEXB 2BHUA 3TZVA 1I7ZA 3NTCL 3C08L 3RWDA 4NM4H 3FFDA 4Y5YA 4DQOL 5KSBE 1I8MB 5C0ND 2BNUB 4PJXE 5H37G 3WE6B 3UJJL 3MLYH 1MOEA 3VGDA 2AQ3A 3BPNB 4JREC 4G6AD 5FCSH 3EGSA 3CFCH 1BBJB 1NUFA 4EUPA 4XPAL 5JTWA 2FX7L 4G42B 4A6YB 4OJFL 4KRPC 5KVEH 2A74B 2IG2L 5FO8A 1J11A 4NIKB 3R4DA 4IDJH 3HZMA 1KJ3L 3HMWL 2C3XA 1DZBA 1YUHB 4XPAH 5E2TH 1RI8A 5EO9A 2VKWA 5D1QA 3RWJB 2AP2A 4AIZA 5CJBA 3TP4A 1FZOB 3ARVA 4KROB 3MLRH 4YDLC 5C6PB 1M7IB 3T1FB 1RZJC 2VXVL 4J2XA 2YD6A 1FCGA 5D1QB 3HZMB 4R6UA 2GI7A 2FEDD 1JTTA 3O8XB 2V5TA 4MJ6A 3HI6L 1ETZA 5JW4Q 2H9GA 3QI9C 5LQBL 4XP9L 3RIFF 4BH7B 5CFHA 3P4LA 1MVUB 3UTSE 4EUPB 1A3LL 4OD3H 4F80A 1ZS8A 3O3BA 3ARBA 3PGFL 4KKCD 2QQLL 3DYMA 3JV5A 5IB5B 3EO9L 5IWLC 3EOTH 2Q7YA 2YRPA 4HV8A 3TO4A 3EJJX 1LO0L 1QLRB 1T1ZB 2BFVH 2CLRA 3O6LL 5SX4H 2BCKB 4PRPD 1CYGA 1DQQB 5J11C 4MCYB 4MMXC 1NAML 5ELIA 4LCIL 5CZXD 5BQ7A 4MQTB 1FVCB 2H1PL 5J89A 4M48L 2OR8A 1GC1H 3I3BA 2BSTB 3IJYB 4UILH 3P9WB 1RSFA 3OV6A 3L3HA 4L3EB 2GJZA 3ZSSA 1MHPL 3CSYB 4K3EH 3IAQA 1MWAB 5KANG 2X1PA 2J8UB 5EO9B 4L5FH 3X12B 4X0KA 3WIHH 3KPRE 2IANB 2CLZA 5K9QG 5JQ6L 1G7MA 3HE7D 3ESVF 1ND0A 4MDIB 3BZEA 5JHDA 1BM3L 2F54D 4MLIA 5IFAH 1WCBA 4N1HB 4HQQH 4PV8B 5MEOA 1AI1L 2YC1B 2F53A 4W70A 1EH9A 1EFXB 3D3VD 3V52H 2A77H 4TVPH 4PTTB 1QLEH 2X2YA 1FV1B 5HYJB 3RX7A 1DLHB 1HKLH 4U1HA 4QT5B 5E9DB 3HB3C 4HUVA 3VGAB 4G43A 3S88H 2J6EA 4EIZC 4KI5D 1QPXA 2WWKT 3Q48A 5ACZA 1QFWL 3EJYD 5I15H 5DVNA 4F7TB 3MLPA 4OCLC 4ZO8A 3RDTD 3KPQB 4FXKB 5SX4I 4CRPA 1D9KB 4GMSH 5B8CA 1JE6A 4ZFGH 4LNRB 2D31B 5DEGA 5HDBF 4AG4L 2FJFB 4JY6B 4X4YA 4KDTC 5IT2H 1QSED 1DVFA 2HRPL 2HTLC 3A6OA 3MBXH 1FDLH 3ARUA 4MNQD 4G80A 2DN7A 4JB9H 2JTDA 4XAWH 4NQVA 1JN6A 2WWMD 4PBXA 4HH9B 4LFHG 5EUKB 1TIUA 4P3DA 1M7XA 1YECL 2HLFC 1ACZA 4KY1L 4OZGF 1ZANL 5EU6A 4RFNB 2JB5L 5JMOC 1MRDL 4HUWB 4K9EH 4AMKL 1QRND 1EEUA 2WUCH 1JHKH 2V6HA 4K3JL 4OLYL 5ICXB 3T0EA 1NUDA 3DV4A 1VESA 3SGJC 2IAMD 2PYEE 2ITCB 4YHOL 4BZ2H 5FV2A 5CEZH 1WJ3A 3RTQB 5KG9A 3MRBA 2EKJA 5ILTH 3CFIC 4P2RE 1WZLA 2NW2A 3O41A 2CIKB 3ZDZF 4LPTA 1IQWL 4LSUH 4P57A 3DHJA 4OD3L 1NMCB 1KTLB 3PHSA 4QHNA 3LRSA 3VXRE 3KPPB 3QUZD 4Y1AD 5CEZL 4QXWA 5I74B 5IJVA 3V5DA 1BX2A 2EE2A 4XNQA 2Z8WC 3MRPB 1NFDA 2YOCA 1KC5H 1CDGA 1S7XA 4JHWH 1A7OH 4KMTL 35C8H 4M1DH 4TUKL 2LE9A 4N0CD 2R23B 3KYMB 4QXTB 3WO4C 5E5MA 4HIEA 1T7WA 2PXYC 4H5SB 4MAYD 1CR9L 4YPJA 1NKOA 4Y4HB 5DR5L 4QGTA 2E27L 3OBAA 4P5TB 2YEZB 1U92A 5DK2B 3QDMD 5MEQA 4LLVB 4CMMA 2P7TB 2C5DC 2E7CA 4GMTL 1YPZF 4XBEH 1FNHA 4WENB 1IT9H 1PX3A 4NWTH 4ZTOL 1NFKA 1WAAA 5FO7A 3JTTA 4P5TD 5ACMA 4X6DE 5IHBA 1ZGLB 5FHAH 2Y6SD 2V5RA 1L6XA 4XHQA 5D7LD 1VFBA 2BRQA 5GGTH 3MC0A 1G7JB 4X83A 3MJ9L 2AGJH 4D0BB 3MV01 5ESVB 3GMLA 2XTLA 5DJ6A 2YR3A 4GRLB 2VUYA 3M17B 1JNNH 1Q0YL 1RJYA 4MJ5B 5FF6B 4KRMB 1G7IB 4YHNB 2WLYA 3FFCB 1RZGA 3OF6D 5GS0H 2YWYA 2F54B 4PJ7E 1F97A 3BP6A 1KB5H 5J6HB 3UJIH 1ODAA 5KJRL 3SJVE 3VA2C 1F4HA 1E4WL 3MSPA 3ARGB 3KYMA 3P30L 3RDTA 4LLDB 5DD5L 1FORH 1EJOL 5GRJL 1FNEB 5HHNB 4MNHB 2XACC 4P0DA 3ZDYE 4XMPL 4LQFH 1FAIH 4JFDD 3MROA 3UO1H 4XBGA 5SV4A 3RWCA 3WJJC 4MJ5A 4NT6A 3V0WH 3DGCR 4JZJC 4HKZB 5MERB 5EZJA 3DIFA 4J3OC 4GG8A 4OTXL 2DIAA 2XA3A 3F6LA 1JVKA 3IXTB 1XR8B 2A9NL 1KTLA 4HIXH 2N56A 5KVDL 3SDCB 2C3VB 5SWZE 1GOHA 3CGTA 2YPLD 4JY5H 4PB9H 4PJHE 4DK6A 5ITFA 5T3XH 1TVHB 1XF2B 3VFPB 2R2CA 5JPMA 5D2LB 5K9KB 5KS9E 1K6QH 1IRAY 3MRJA 2W07A 1B4JL 3EZJB 1MFCL 4RFEA 5KANI 3QEQE 5TH2A 2O5ZH 2E7BA 2GFBB 1ADQL 3OXSA 1ZVHA 4HFUH 3WDJA 4JFXB 2DWDB 5I1JL 4Y4KA 3PGFH 4NGHL 3S35H 4C56A 1VB9A 4RZCA 1HYSC 5F9OL 1J12A 3I84A 1P1ZB 2VLLA 3AFLA 1S7TA 3H7LA 2OSLB 5B3NA 1T04B 3VFWB 4IRZH 5EZLB 4JN1H 4N5ED 1KIPB 4NO0D 5IGXH 2AKRA 3CCHA 1INDL 4A6YH 3PWPE 4Z78B 3BZ4A 3RPIA 3TO2A 3KPPA 3QIUB 3MOAL 5JUEL 2UVFA 1LO2H 2C1OA 3EDKA 5D7IB 2VXVH 3T3ME 3W81A 1VGEL 1YC7A 3JUYA 3NZ8B 1U91A 2NLJB 2VDOL 4WEMB 3TN0D 4WFFE 1ERNA 5JHDD 2VXQL 4OCRL 5BZDA 1LDPL 3MFFA 2DIBA 4LASH 4M03A 3OXRA 5DA0B 3FQRA 1CGYA 1KTDB 1BLNA 5CIPB 2X4UB 3MJ9H 1A2YB 2NY3C 1X7QB 2ZUTA 2Z35A 4N9OB 4PBVC 1KJVA 4LVHB 1A7RH 4UAOB 1AO7A 2F15A 2XI9A 5HYEA 3DGGA 2B20A 4OCNC 3TNNA 2EYSB 2OR9H 3S4SB 3CFJA 3VFMA 3H9SA 3D9AL 1A6ZB 1R3HB 1JWSB 2BK8A 2EIZB 4G3YH 4KK9D 1P84K 1QA9A 3CVHA 3WYRA 1RZIB 3RWGB 5IB1B 1MH5A 1R3HA 3QWRA 4Z77A 3FOLB 5GSVA 2OYPA 2YD5A 4MZ3A 3TWCH 4LCWE 3GSRA 1ZT4A 1JGLH 1VGEH 4XP6H 4YO0B 1CTNA 1M05A 3U4BL 3LD8C 4G8FA 3QRGL 2L7JA 4JO1L 3L3HB 1OAYL 3EUUA 2R0KH 3IXAA 4FZ8L 4K7PX 1TFHA 4NFBA 1FNSL 1EZVX 4Z7UA 5I0ZA 4EUPG 4HWBA 2AJVH 4PJBA 1ZLVH 3VXSE 5CGMA 4L1HA 3FO1A 5CLWA 4PP2B 1SVCP 4GRLD 1Z5LB 1G1YA 3HUJE 1UJ3C 4M93C 3RTQD 3V6OE 3NGBB 4OZHB 4P48A 2QR0A 3MRIA 4Z7OE 1OL0A 2P8LB 2YKLH 3UO1L 3W5MA 1NFDF 1YNKH 4LQ1A 4TUOA 4Y4FA 4MZ2A 2EDJA 1EFXA 2KZWA 1E4JA 4EI5B 2HN7B 4CGTA 4OZIF 5I2IA 1FLRH 2ZCHL 3CH1B 3HFML 1WEJL 5CEYA 4HKXB 4LKCA 3S34H 2O93L 1UJTA 1ZANH 4UT7L 4Q7DA 5TDPB 1OWWA 1HHJA 1CGXA 1R24B 4PJDA 2CLZB 3SO3B 1AC6A 4HIXL 5KVDH 4MVBD 2GAZA 4CU6A 1OGAD 3VFNA 1T2QH 3AXLB 3GDBA 2JELH 1U3ZA 4I2XA 4YWGL 2CK0L 4OCXH 4UNUA 4DKAA 1XCTB 3DYOA 5HGBA 3SKMA 2XWTA 4NZDA 4YEEA 1WWWX 2X7LA 2CRZA 3G5XB 4ZUUA 5E2UL 1I7RB 1JP5A 4YXHL 3HR6A 5DUMH 3O3EA 3TBWB 4PJFE 4PJCE 3MUGA 5FYLL 1KIUA 1XF2A 1PEWA 1ZTXL 3NCMA 4L4TD 1NC4B 2BZDA 2QV2A 3VD3A 5D1ZA 4GRMA 2I5YL 2XPGA 5CBAB 3KHQA 4JFQB 2IBZY 2MJWA 3OTTA 3GJFB 4OF7A 5C0NC 1E6JL 3TO4B 2I9TA 4GXVL 1KEGH 3K74B 4KVNL 3HI5L 2GT9B 2V2WB 4XWGH 3C8DA 5HYJD 1CR9H 3LQAC 4UUJA 4EDWL 4OV6F 5D1ZB 4H0GA 3BDBA 1QO3A 1AGCB 5FM4A 4ZAKA 4RA3A 4JM2B 2J8UF 1RZKC 3RX5A 2C4FU 3ULUL 1A7PL 4GRWH 4IS6B 3VE0B 5D7JB 4BUHA 1BBDL 4KK6D 3G9VA 3KPRB 4WRLA 1T80A 4UI2A 3NPSB 1W72B 5FCUH 4ZTOH 4Q9CA 4HKJA 4Y16B 3DMMB 3MBEA 1R5WB 2OJEA 4RGNC 1J05B 3CH8A 5TE7L 1R24A 3V7MA 3CDYA 4F9LC 1TENA 2XFXA 3IF1B 5EORH 2QSCL 4OUUB 2NY6D 5BXFA 3DXAA 3LD8B 1CDHA 4BQCA 3CFEA 1NCWL 2NZ9C 2VITA 3GBMH 1T2XA 1H8OA 3KXFA 2F5BL 2AEPL 1Q9LB 1YQVH 1INEL 5C6WH 4Y5YB 1F11B 4P23A 1I8MA 4S0SD 4PUBL 3O6FB 1K4CB 1FG9C 3MUY1 5EC2B 4YXKH 3RRQA 2Z93B 4CMMB 3ALWA 5I1CL 3MV8A 4HT1H 3FB8B 4QWWD 3TBVA 4ZODA 4OLXL 3HG1E 4YE4H 4ZXBC 5C0IB 1U92B 4EBQH 1K3IA 3EO1A 1JYNA 2VB5A 3HPJA 1CU4L 2KQNA 4K3DH 1WIUA 2X4RB 3D39B 1YNLL 4PLKD 3MRRA 5GJTL 4G5ZL 2EC8A 3MA9H 4CW1B 3RWFB 3P0YH 4ZYKB 1KLFA 4NBXB 2XWBA 5C6TL 5IG7B 2E7LC 1NFDB 5E8PB 3BN3B 1OTSD 5CBEA 2V9RA 4QYOB 1KIRA 4XCNB 4NUGL 3G6AA 1JYXA 2VLMD 4BSVA 4WUKL 4U6HA 4X6EB 3MLRL 3G04B 4FTVD 1U8HB 4NQED 4OZGB 3BKCH 4GRLA 4DVRH 3L3IA 4N0UE 2G2RA 3EDEA 1TZGH 3VD9A 6CGTA 5JPNA 4KI5C 1D5ZA 3V6ZB 5GJTH 3SQOL 1EAPB 1FZKB 4GKSA 3VRIB 3CLFH 4MB3A 3JWOL 2WWKO 4JVUA 1SVZA 1KJVB 1MJ7H 5E08H 4RAHA 2EC9T 3QDMB 4Y4FC 1CGUA 3BFOA 1RMFH 3BVNA 3ZE2F 2DQCL 4WW2F 5I8EB 3U0PA 4DEPC 1AGDA 5JOFA 1KCRL 4PJXB 5KVFH 2EEDA 3T2PA 5I1GH 4WW2A 3RNQB 2DMCA 2DYPB 3MRGB 5AWNL 5ENWB 4TTDD 3UTSA 1ZMYA 3QXUA 3VXPB 5KOMC 3NAAH 2H6PA 2A6JB 4ZD3L 3HZYA 1J18A 5E99H 3ZTJH 5BV7L 4U1KB 1IBGL 3JVGA 4QYOA 1MI5E 5FCUL 4IOFC 3B9EA 2VDML 3B5HA 4DN4H 1T5XA 1G9NC 2JE8A 1XF5A 1XGRB 4HXAH 1MWAH 3IDUA 3FOMA 1JPST 1CGSH 1PLGH 1JHLL 1DR9A 4C56B 4PJAB 4NKMA 1H0DB 4DGYL 3U0PB 5C1MB 5IHUH 3R0NA 5DJ8A 3A6CH 3O6ML 1HSAB 2W60B 2ERJB 3W39A 3MRMA 5DQDL 4WWKD 1I3VA 3I6GB 3LKSA 4DGVL 4PLJD 5C0CD 4U1NA 2D7MA 5D2LE 5KS9B 4PRPE 4PY8J 3L5WB 2DDQH 4AT6B 2LTQC 1MHPH 2IPUK 4K3EL 1KIQB 3HAEB 3HN3A 4Q0XL 4ERSL 1BIHA 4LSPL 3MV11 2XXCB 1YMHA 2NPLX 1JGEB 3BPOC 5SWSB 4K7FA 3CDCA 1WCBB 3UPCA 1T22B 1WIOA 3V95A 4JHAH 3TBTA 3DMMD 4GW4B 3QJFA 3IDGA 4IMLB 1EBAA 3LIZL 3S96A 1UA6L 3KPRD 4P4RA 5E56A 1UZ6F 3E3QE 2DI8A 4U7SA 1JHTA 2ICWB 3QDAA 1J9CT 3W11D 3ULSB 3WD5L 5DGQA 5GSRA 3BJLA 4P2QD 3KS0J 1WFOA 3ZLQC 2P44B 3PG2A 2XTJC 3BH8A 2UWEB 1GGIH 1LK2B 2GYSA 5MP6L 1W8NA 1OAZL 4ZOEA 5HHOD 5ACZB 5ANMB 4NDMB 1RZ7L 2XRAH 3UPRA 2ZKHH 5EO1B 1YEJH 4NNPH 3OKEB 1NAKH 1CIUA 2DLHA 4TNVK 2QADB 5DO2D 5FDWA 1GVIA 4ZS7L 4Y19D 1DUZA 3UDWA 2GSGB 3MRCB 4N90D 4P23C 4ZUVB 3HMXH 4NPYB 1QBAA 1BQSA 2X4SA 5J9PA 3RA7L 4YDKH 1I7UB 1OAUH 15C8L 4PJ9A 5CWSB 5E2TL 4DKFH 4Z7VA 4KXZI 5EOCH 4D0BA 1IAIH 5D6CB 1NKRA 5EIQA 5T3XD 3GO1L 1ZHNB 4JG0H 4OLZL 2R4SH 4F9LA 4FQ2H 4JDZB 3MXVH 1C16B 5JHLL 4NSKA 2PCPA 5I1EH 4OM1H 3GZKA 4H88H 4NQEB 1CD9B 4HKJB 4ELMF 5CILH 3U46B 4IRSC 1L9NA 2VDPL 4ZAKD 1ORQA 3PDGA 1QSEA 4MNQE 3KPLA 1W72A 4ZNEE 2IWGA 1GCFA 4N0CC 5M7QA 2Y25A 4NWUH 5DDHA 3IFNH 3GIZL 3ZE0E 4F7CB 3JXAA 7CGTA 1AC0A 5IKCB 5FKPB 4M5ZH 5EUOB 4NJAL 2DQDH 4M7LL 1J1PH 4NGHH 2BY2A 3QI9B 5ILTL 3VJ6A 3IJSB 1QRNE 3U1SL 1DN2A 4XPHL 4QRSB 4GXUN 4HPOH 3G08B 4S1DD 1OAXL 4OB5L 4FQIL 1BEYL 1D5XA 1E4KA 2WINB 2ZG3A 3FMGH 3VWJD 1GZPB 5CJQL 1A7RL 4OF5A 4XMLH 5TE4L 3UTPE 1RAMA 5D93C 3DXAD 4OCWH 4P2RD 3LVEA 4V1DD 5DLML 4L4TB 5DD6A 4AM0A 1SJXA 5FO9A 2M1KA 3UZQA 4BELD 3TIDB 5IMKB 3O8XA 3RU8H 5TQ2L 1F2QA 5CMAB 4YAQA 4YHPB 3SGDI 1KGCD 4DAGL 3MV8D 4P5KB 4NN5B 3DO7A 4XPTH 5MEQB 1T7YA 5C7XL 3CVIH 1WWCA 3D85D 2QHLA 3D39D 1AIFA 3PHQA 4P23D 3SDXB 4EEEA 1T5WB 1UWXK 1NJ9A 5FYKH 3MRLA 2WWMC 2V7NA 1J86A 4HS6B 5HI3C 5F1OB 2DQGL 4O4YH 1MLCB 1FFNB 1BAFL 3DLQR 4NZUL 5L6YL 1UXWB 4PJCB 5EPMB 3NCJH 3PQYD 3DI2B 1P7QD 1AD0B 5A2LH 1VKXB 1G6RH 2J5LB 1Q0YH 4X8JA 1E27A 2HLAA 1I85A 1NL0L 3NCJL 1N3NB 5KSVB 1DL7H 4LLUA 4NBYB 5D7LE 1MCKA 5F89B 1D9KA 3ZE1F 4Q9QL 4LDOB 3EJYC 4PGCA 1ZA6A 1CGWA 2D7QA 5FOBB 1BAFH 3OAYH 1DE4B 5CIPA 2XN9A 3Q1SL 3BGFC 5DI8B 1ZOXA 3WIHA 2OZ4H 2R56H 1ZA6B 4O02H 3QUZC 3DNKA 1S9VB 2P42B 1DUYA 3KPSE 2X4QA 5HGGS 1KCUH 2QEJA 2V9QA 2W9DH 5E8EB 3MYJA 1MIMH 1X5LA 4MA8H 1MAML 2PYEA 3QG6A 2IPKA 4QRUA 3QHZL 3BOVA 2VIRB 3OF6A 1QR4A 3QFJD 5IQ7H 1UCBL 4M93B 1EXUA 2W65A 4D0CA 3P40A 4WFED 1Q9OA 5A3ID 2E8YA 4P99A 2C7UA 1F90L 5EU5B 3VFWA 3C8KB 4JQXC 5C9JA 5DHYA 5IB1A 2FJHA 3RWGA 3MOBH 3V5KB 5J0BA 2VDNH 3WIIH 1P1ZA 4R4NC 2Y72A 4PJGF 3VFMB 4FQQA 3C5JA 3DTXA 5L2KE 3RHWK 4X0KB 3BAEL 4P46D 3ULUC 5F7LB 2WANA 4H88L 3OXSB 2P5WB 2XWBB 1F4WH 1MCJA 2FATH 4XX1G 1G9MH 3UROR 2IAMB 2ZOLA 4H1LB 3GEWB 2AXGB 2FX8L 1JFQH 3KDMA 4WFGE 5SWZD 3DO3A 3L95B 4L9DA 2HJKA 2YPLE 3MR9A 4MNGE 4ZOBA 1BQLH 1UACH 3MGOA 3BQUA 4LBEB 5BS0A 2ZZUT 3S6CA 2HLAB 1K4CA 3O6FA 3LSOB 3EYOA 4YX2L 1MUJA 4K8RC 2GTZA 2Z8RA 1DN0A 1B9ZA 2A1WH 5ICZB 4OIAA 4TNVF 3MXWL 2OTPA 3RY6C 4JCLA 2NLJA 4HFWB 2XTJD 1DLFH 4UAOC 4HKBB 4OZ4A 5JLZA 2R0ZL 3SE9H 1NBVL 2JF1A 1AR1C 2EE3A 2Z31A 4APQC 2FECI 3TCLB 2B1HL 4YK4C 3GGWA 5JO5A 2QQQA 5EH1A 2DWDA 3PWPD 2WBKA 2XZQL 3QWOA 1IGCL 4RZCB 3H6JA 4KRLB 1JI2A 4AIZB 1FO0L 4WI7A 4N0FB 5EC1A 5F7DA 1MJJA 4N8VA 4U6VL 4WTZA 4JN1L 3OKOA 2X9YA 1GZQB 5ITBL 2AXHA 1PFCA 2WP3O 1JZ7A 4GAFB 4OT1H 2VSDA 4A6YA 1CS6A 5IFHH 3HC0A 3L3DB 3ROLB 3CH1A 2MKWA 3F7RA 4K8RD 3O4LB 1IEAA 3U30C 4HULB 1TTUA 4KROD 1NANH 4L8BB 1FVEA 4P3CL 4MQXC 2F74B 5CBAA 4UB0L 5TGBA 5I8KL 1QFUH 3H0TA 3V4UH 4Y8DC 3BP7B 12E8H 5E9DD 5GRVK 4KY1H 2VZVA 1B0RA 2WBJB 4X6DA 4OBSA 4M1CD 5SX5K 1OTUD 1IGMH 5J6HA 1YA5A 3PDDA 1M6OA 3G6JF 3U0WH 1I9RL 4PJAE 2NY2B 3SKMB 4LCWD 1X4YA 3I9GH 4NKDA 4KJPD 1XR9B 5D1QC 3T3PF 5DT1L 2R1WA 3SKOB 1KCUL 4RX4A 3T77A 3QUKA 2CLVB 3T1WA 4LEXL 4LKXB 5DC0A 4WTZG 1YYLH 3MLSH 1GHFH 3MJ8A 3O2WH 1RMFL 3W2DL 3RWHB 4P2QA 5CEYB 4NNPL 1AFVL 2J4WH 4FFWC 3VXSD 1N0XH 5C92A 3OHXA 1LP9E 4KXZH 5C0FA 3RX8A 1S9KC 1GGCH 1NGXB 1WV7T 2AEIT 4XP4L 5FGBC 1JNLL 3JV4B 2JELL 1RK0A 3BSZL 3QCTH 5T3ZE 5IEHA 3KAAA 5LCVH 5EZOH 2H2PD 1BFTA 5DQJA 3LN5B 4UTAH 4S1QH 3QCUH 4QHKJ 4LVOB 3GBNH 5DJ2B 2HKHL 3NFPB 4M9OA 4Y2DB 2M8XA 3MNZB 3SCMB 5D7LB 1AFVH 1BD2D 5IVNA 1GPOH 3BGMA 4BFEA 1ZTXH 4PB0L 3TN0A 3NIGE 4YIQA 3WFDL 4DOHB 1UWGH 3W0WA 1EA9C 2BVQA 1YEDB 3KYNA 4YBQC 1RVFH 3FOMB 1E28B 2DQJL 4JDVB 1RK1A 4XBEL 5TFSH 3VG9C 3FN0H 1NGZB 1ONQB 5E6IC 3JWDL 3DHMA 3FFCD 3DYPA 4L3EE 1QVOA 3HMWH 1MHCB 1I75A 1NANI 4RBPK 4OCYL 4ELKB 4M3JA 4O58L 4CJ1A 1IKNA 3MRKA 2IH1B 2DYPA 3MRGA 4LIQE 3VH8G 5LWYH 3LN9A 4XCEA 3BGMB 1UYWH 4R7DA 1Q9KA 3VI3F 1MQ8A 3VXQB 4G43B 5K33A 1BEYH 4PLJC 4YHYB 1A3QA 3FHAA 3VWKC 4PV9A 4C57C 3PWVB 2GY7B 2R2BB 4UQ2B 4WHYG 3SKNA 2XZCH 4LPYA 2P46B 3GMMA 5D9SA 5HYJE 4C59B 2ADFL 3HHRB 3QUML 4ODHH 3VA6A 3VFSB 3WFCL 1D5MB 1TVHA 4PJAA 4E42B 4ZUSA 4PJGA 1VENA 2GJ6B 1UQSA 2ZUXA 2JJSA 5F7EH 4D8PA 3GK8H 5FECA 3T2OA 1UM5H 3NFNA 2L7UA 3VFOB 2HAZA 4YHLL 2FLRT 2CLVA 4FNLL 1IQDA 4PRBA 2GJ6D 2OXGA 4NQSA 1YPZB 3U4BH 4OGZA 1KN2H 3G04A 4XNUL 2DI7A 4ORGA 1AQKL 1ONQA 1A0QL 43CAB 3B4NA 3LEYL 1C1EH 2NTFA 4N1EA 3GHEL 2FHFA 5JZ7C 3KYNB 3D39A 4O58H 1T1YA 2Z91B 3BP7A 4DKFL 1QNZH 1GIGH 4P4KD 5FA3A 2X4RA 1LNUB 4OD2B 5IB4B 2AEWA 1QLFA 2EE9A 2VLRD 3TYGL 1OAUL 5F9AC 2OLDA 1FVEB 3D5OF 2A6KB 1SYSB 1MFNA 4XRCA 1K2DA 1MCFA 2XKSA 3HG1D 4U1HB 4X4ME 1V7MH 1PZUB 3VXRA 3OWEA 2CDGA 1VGKB 1YEHL 1YEJL 3EYVB 3TA3A 1H8NA 2VERN 2R1YB 3SDXE 4RX4D 4LKXA 5CGTA 4LPVA 5IMOA 1U8KA 4MJ6B 3HE6A 4YWGH 2FATL 4GBXA 2GSGA 1KEMH 4TOYL 2YZ8A 5HY9A 3KPMB 4MS8C 1GGCL 1OGAB 1DBBL 2CGRH 1CK0L 1PDKA 3QQ3A 1AHWA 2W9EH 4N0FA 4ZFOL 3MLUH 2J6EH 4Z7VF 3QWOB 4PRDB 1SY6L 2J8UA 4BUGA 3WFHB 3BWAA 3Q0HA 1MCNA 3P9LA 4QXTA 3GMPB 2AK1L 3QFJA 1XGPB 2XZAH 3QDJE 4PJDE 1CICA 1M1SA 4J1UB 4JLRA 1KELH 2IH3B 5FYKD 3PABB 1T3FB 2VE6A 3MRPA 4WCYL 3TH2T 4CDHA 2FGWL 2B1AH 4Y16D 1LQSR 4LNVA 2AJ3B 4ELME 4ONFL 2D03H 4TUJA 4IM8A 1FRGL 2AK4B 4DGVH 3QJHA 4UTBH 4GUPB 4F57L 2YA2A 3CX5K 4H1LH 4FZ8H 3OB0K 4NZTH 5BW7C 4U1LB 1C8PA 4WUUB 3S36L 4L3AA 4OCSL 4UB0H 3RUGB 5J12C 1HWHB 2OJEB 1ZGLA 4OB5H 1MY5A 4W4NA 2ZOLB 3T8XA 2VABB 1JZ6A 3GFUA 3HZKB 1KFAL 3O6FD 4M43L 1TITA 4XWGL 1MI5D 4N8CH 2IF7A 1CFTA 2OTUB 5H2BB 3QAZC 3RKPA 5F8QC 3WFEH 3BPCA 3GSXA 4IIQA 4IDLA 3C5ZD 1EHAA 2HA1A 1MCPL 4PJDB 5DHXB 5E6YA 4BFIB 4UT9H 4YHKH 4P9MH 3SKJL 1ZLUH 5AZ2L 1EO5A 1BMGA 3LDBC 4NN5C 2CR6A 2FL5A 1Q72H 1TPXC 1RZ8B 1BFVL 3U0TB 5DHVA 1WT5C 3BKJH 3FQNB 3JWOH 3V7AG 2CDEA 3ARBD 1S9VA 2E27H 3ES6B 2E7MA 2EXYC 3B6SB 3ARBC 1MFAL 4R2GB 3WLWC 3WXVL 4FQXB 4GG6A 1XCQA 3KJ6H 5DD1L 2AERT 3L5XL 1CXKA 2FYYB 2J5LC 5HVHB 4Z7WF 2EO1A 2DMBA 2VLJB 2I9LA 2KL6A 5DSCA 4MCZA 4TULL 5L7XL 4OQTH 3BE1H 3BDXA 3INUL 3C5JB 3DTXB 3VRIA 3VDCA 4PLNC 4P2QE 4HW6A 3ULVF 5E4IA 1M71B 2FR4B 1CXFA 4HWZB 4X7SH 1YNLH 3QUZB 4Y1AB 2W65B 1KT2B 2H3NB 3WLWD 3GIZH 5C9JB 3WS3B 3MJGX 1M71A 4JHWL 4YHOH 4BZ2L 3DRQB 4ODSL 1CE1L 1F4XL 2V7HA 4Y19E 5D1QD 1KPVA 1DDHA 5KW9H 3TN0C 1ACYL 3IDIB 1PZ5A 3F58L 2HFGL 3OR7B 4N90E 4HHAB 2Q8BL 4R90H 1YMMB 3MNWA 4IRJD 4YHPA 5I1EL 2X70B 3I75A 1R0AH 1X5ZA 5KSUA 1CFQB 2HVJA 2CJUL 3GBML 3OZ9H 4LPXA 5T3XE 2UUDK 3I75B 5IB2B 1ZGLM 3MZGB 4LLUB 3FB8A 5DTFB 1U2CA 2BNRD 4HHAA 5IEKA 4JPIA 4H1LG 1W0VB 4Z95H 1TLKA 3DRQA 3BYYA 4R97B 5C09B 3ME0A 1F6AA 4MX7A 5D96B 3S98A 3KLHD 1UB6A 1FNGA 4YEFA 1RU9L 4Z8FL 5I75B 1MEXL 2AKRB 5GZND 3ROLA 2J88H 4MD0B 4NZJA 3QI9A 4ETYA 4PR5A 1IC7L 3BP4A 4NQXA 3LEVH 2V7NB 3LB6C 1OB1B 4XNZB 3IFOB 3ILPB 4KDTA 1XEDA 5HJ3B 2OZ4A 3ZL4H 5I30L 4QCIA 3QXDB 3T0AA 4OKVB 3ZDYF 1NDGA 4JN2B 4L29A 4YUEH 3CMOH 1S8DB 1UEMA 3U30B 4I0PC 5AUMA 4U0QB 2OCFD 1J88A 3MBXL 1N4XH 4J12A 3ARFD 4TVSa 1PY4A 2Q20A 2QHRH 1S9WB 4JHAL 4X6CA 1IFHH 3GSQA 4OF8A 3SE8L 4WUUA 4K71C 2R69L 4WI3A 1FZJB 5I71C 4LAJH 1XH3A 5J4MA 1G9EA 5GS1B 3I2CH 5FA4A 4X9IA 2WBJC 1C5BL 1MCHA 3MV7A 4K3HA 4KPHL 4U33A 1QSFA 2UZIL 5E08L 4H26A 1ZVSA 1PVHA 2R0LL 4Y5VB 3MV8E 4PGDB 2Q87A 3MLWH 1OW0C 4K23H 1QQDA 3CD4A 1HHHA 4UT6L 4JFFD 3SDAB 3C5ZC 1TJIL 3P9LB 1WBZB 2VL4A 2A9ML 4DVRL 5DDHB 5TDOB 4UINH 2ZP0T 3KYOB 1R3JA 3GM0A 3TH4T 1G9MC 4LOUC 4LCYA 3PGCB 5BV7H 1GAFL 2C1PB 3G5YA 2EEAA 4N0UA 1JV5A 1UH3A 3DVNA 2PW1B 4LDLB 3RAJL 2CRMA 5DJ6B 5DR5H 5IVXA 3X3GH 2NY5L 3QR2A 3ZT7A 4YZFE 2PXYD 2XNAA 1U3HC 3G6JA 3HI6H 1EJOH 4P4KB 5GRJH 3A6CL 2EH7H 3SPVA 4IOIB 4DUVA 1CLZL 4ZFZA 3G6JE 1J10A 1S7QA 2DBJA 1B6UA 4AMKH 1T20B 4WHYH 3MLUL 4BSJA 1PEZA 2APWA 1I4FB 4NZRH 1MJ7L 2CUIA 4YQXL 1FH5H 6FABH 5E99L 3TCXA 5FA3B 2DTML 3QFJE 5F88A 3TYFA 5C71A 4YPGA 1LK3H 5FOBA 5ERWB 2ITDA 3DARA 3PV6B 2FBOJ 5HSFA 3N1QC 3TC9A 4H5SA 3U82B 2OR9L 4PRAA 5CIPH 1RJZB 3TV3H 1XZ0A 4XXDB 4ORGB 1HCFX 2X4PA 1RUPL 2VZSA 5F7NC 3LRGA 4MA3B 4O2FB 5JW3H 3X17A 3R06A 1WVZA 4NQDD 1TETH 2R2EA 4R96A 5GZOD 4WI4A 4GG6F 4Y4HD 3FQWB 1Y18B 2H2PC 1BFSA 4WFGD 4P57B 2P4AB 2HT3D 5KN5B 1EK3A 4KHTH 1G7QA 1VHPA 1NCNA 5D9SB 1FCCA 5F9JB 5B21A 1R5IB 4KKNA 3ZKNC 3T4YB 2VJXA 4TUKH 2YK1L 3V8CA 1CFVH 4QO1A 1CG9B 4NRXB 3O81A 3QWRD 2X1WL 2Z4QA 4NP4H 1AQKH 3HMXL 1PSKL 4KJWC 4QKXB 5I19H 5F1SA 4FQ1L 4RFOL 3EOBB 3D85A 3ARFA 2H8PB 4HMCA 3KJ4B 1TQCC 3JZ7A 5AZ2H 1NGXA 5CZVL 5J1SC 4N8VG 4WTXA 2DM7A 2XRAL 4U3HA 3P4MB 4MHHI 1GGTA 3TVMD 4OZFB 4AQOA 4X9BA 1A1MA 2C26A 4FP8H 1RIHH 3VI3E 3NOIA 2YPKB 4K07A 1MFCH 3VFUA 1I1AD 3EFFB 1A4JB 1UZ8A 2ZNWA 1FFQA 2AJSH 1JGVH 1XGYL 4ZSOE 4QHNB 3PP3K 3BHBB 1YEDA 1KB9K 1QLEL 2G9HB 2R1WB 3SKOA 3A6BL 1E28A 1A7PH 2UV3A 1RFDL 3QUYD 2H32B 5IKCA 3MLZL 5KZCB 3CUPB 4LSDA 3BPNC 4JREB 5EBGA 3OR6B 1RHHA 3GSVA 4I77H 2VNCA 4PJXA 1CXEA 4JRWA 1KG0A 4LCCB 3MRHB 2I26N 3WNNA 1W72H 4NHCH 1G7LA 4FFVC 4A2LA 4UNTA 3HI1A 2HVKA 4UU9A 4R7DB 2HJFA 1NH6A 4GKSB 5IT2L 3QQ4B 3U7YH 2XOTA 3L5HA 2DQIL 4M7JH 4F3FB 4KK5D 1FN4A 5JOEA 1ZLSH 4NQVB 1RUMH 2LVEA 1RIUH 3RWHA 2VISB 2P5EB 3MO1A 2NY3D 4YBLC 5IVXB 1U8PA 4HXAL 2G2RB 3KPSA 3BYTA 3HAEG 5E2UH 3G5YB 2OMBA 4HK0B 2QQNH 5T1LB 2BOBA 4R3SB 4JKPL 4F7EA 4FN0A 2BOCB 3OX8A 4M6OH 4D3CL 3MV9D 3BSZH 4JFPB 1FPTH 3S97C 4ZYKA 3CXHK 5I1AB 4XVUD 5IG7A 1J87A 5T1KD 1HNFA 1MJ8H 1MWAA 1JGUL 5FUZH 3S5LA 5F72S 1FVCA 3WMSA 1B6DA 1KBGL 4GSDL 1SYVB 3GRWL 4Z8FH 1IFHL 5KAQG 4R26H 1MCWM 1S9XB 4HKBA 4OZ4B 4U0RC 1VDGA 3E6HB 4I3GA 1Q94A 3FZUD 4LRIC 1WTLA 4FQJL 2BX5A 1ULVA 4I18C 1YJDH 5L2KA 3EOAB 5TQ2H 2AJVL 4ZUWB 1NBVH 1NC4A 5I73C 1N5YL 4LASL 35C8L 4M1DL 4KQ4H 4GRMB 1KC5L 4FG6D 2NY6C 5HTSA 4OCWL 5IR1A 4KMTH 3TJEL 2EIDA 3VMOA 3MBEB 3P0VH 4J6RH 1JZ8A 1I7RA 5GS3A 2H9GB 5F7KC 4I4WB 3PGCA 3G5VB 3WIFB 1NSNL 3O3EB <