3WD5H

Crystal structure of tnfalpha in complex with adalimumab fab fragment
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
214
Chain Sequence
b'EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDYADSVEGRFTISRDNAKNSLYLDMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor
publication title Comparison of the inhibition mechanisms of adalimumab and infliximab in treating tumor necrosis factor alpha-associated diseases from a molecular view
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2013-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wd5H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wd5H01
1BF2A 3RDTD 3H42L 4O9HL 4P2RD 4X7SH 3MUHL 4U1MB 1MHEA 4GG6B 4M7LL 4YHML 2A9MH 2E9JA 3QJFA 5CGYD 1CR9H 2GY5A 4NQED 3FN0H 3OKDB 5DD0L 2WZPD 1RZ8B 4QRTA 3D6GA 3QDGE 5IB5A 2XN9D 3B2UC 3B43A 1T4KB 3MRLA 3QQ4A 2EKSB 1F3DJ 2GFBA 1T03L 3MXVH 2IGFL 4DUXA 4Q7DA 4OJFL 1EGJA 3OJMB 3ELAT 4PJCE 2VDMH 1SVCP 4OF6A 3ARFD 1QPPA 1ZHKB 2CJUH 3TJHC 2VZ3A 4ZXBA 2XY1A 5IFJA 2Q8AL 2KZWA 3S4SG 3EYFB 4RGOL 3OG6B 5JW4R 1E27B 4J3OC 4ZSOB 1NJ9B 4XP5H 2AVGA 4RFOH 4Z0BH 4DN3L 5B39A 4XMPH 4JAMA 3ZT5A 2YXMA 2OTPA 2J6EH 2Z31A 5EORL 2OJEB 4RMUA 5D7LA 3FRPA 4X0KB 1CK0L 4JKKA 4E5XB 3VE0B 2DLFH 2IADA 5I8EA 2ZG3A 4NRZB 1IQWL 1FVCA 4R6UA 2HA1A 1XIWB 2JB6B 3NCCB 1KCUH 2HTLD 3O11B 5AYQA 4JPVL 5BMFH 5EN2B 3PHSA 1ZKAA 1HIML 3CXDH 4ELME 2DMCA 3RWEA 1I1AB 3V95A 4EJ1C 3PE9A 2WBKA 4KRPC 1WICA 4OGYL 3TV3H 5FF6B 3MMEA 4KPHH 1Q9KA 5LKNA 1FNEA 1FL5B 4XXCA 4TTGA 3GNMH 1FRGL 5TE7H 5DJ0A 4KK9D 1CD9B 4LCWA 4NN6B 1S7UA 5E4IA 4IOIB 3RDTB 1YY9D 4P2RB 5FM8A 1U3HB 1DVFA 2VZSA 5FUOH 3NACL 1BJMA 4LKCB 4C58B 4GW1A 3QHZL 5C6WH 4MXWL 1N3NA 2XN9B 4HFUL 3QULB 3UYRL 3TO4C 1A0QH 5E94A 4ZFFA 4S10A 4HMEA 2ICES 4RBPH 5EU7E 1P7KA 4G8GA 1O7SA 3O3BB 1QG3A 2Z92A 1KJ2A 3AUVA 1BQHB 3A6OA 4PJXB 2GT9A 3D2UB 1A7RH 4Y2DA 2I60L 3GBNH 4WI9A 1CLCA 4HC1L 5DVNA 2HRPH 3I50H 3QUYC 1IFHL 1NC2D 4NQUA 5GIRA 3ZKMC 2J8UF 3RVXD 3QG6B 1N0XH 3ARWA 4XNXL 4YBQD 3HPJA 4WI4A 3Q1SL 7FABH 2KBGA 3QPQC 3HR5B 1IAOA 3LKRA 5MENB 1NGPH 2APXA 3NN8B 3S3SA 1TPXC 2H45A 1IGTB 2ICWA 1JRHL 4OBRA 5A2JH 3QUML 1BX2B 2BSSB 3V5HB 4NQCA 35C8H 2PETA 2E27H 4LARH 1ZT7B 5DHVB 4FTVE 3SHSA 4MA1C 1HHKB 5FYKU 4AZ8A 1A4KA 5JHLH 5E2UH 1H3TA 1XF3B 4HWBA 5DC4B 1HDMB 5GS0C 3MV8A 3GHBL 1DEEB 15C8L 4LVOB 2BY1A 2IQ9H 1I7ZB 2H8PB 4OLVL 5LGJB 4MA3B 2D2OA 4YQXL 5F3BB 3OR7B 3S98A 3G6JA 2VQTA 1FNFA 4ZPTA 1KNOB 3BPNB 3LB6C 4ZOBA 4X6CB 3JWNC 3TVMD 3QDMB 3B9KD 3G04A 3FB6B 2UWEF 3DRTB 4HXAH 5IMKB 1KCKA 4Z77B 4IOSD 5HHMD 1U8HA 4L8BB 3U36A 4AIOA 2VKWA 3H42H 4O9HH 3BH9A 4H5SB 5I19L 3TC9A 2F5AL 4YHMH 4XWOD 1OGTB 5ID0B 3FO2B 5KSBE 5DD0H 1F45A 4YHYC 1BZ7A 4HXBH 4LLWA 3WFCL 1WBYB 1R5WA 3P0GB 1T03H 1YC7A 2VDLL 3MYZA 4P2QA 1BZQK 4D0CA 3U9PL 5I15L 3B2VL 1TTUA 4QOKE 4N1EA 5IWLA 4TNVF 2Q8AH 1KTDB 2MKWA 4RGOH 3FOLA 4HPOH 1GOFA 5JW4N 4GG8A 1S7SA 4G6FD 4NDMA 2DL2A 4FFWC 1OSZB 5I74B 3MNZA 1YEDB 5GS0L 4UUJA 4Y4FC 5EORH 2C4FU 1LK2B 4RWYL 4G6KL 4OQTA 2DWDA 3V4VH 1CK0H 3RWFB 4H20H 3G9AB 1WCBB 5J8OA 5CZXD 1EEYA 3L6FA 4S11A 1IQWH 4PJHB 2DKMA 3MV9E 3BW9B 4YFEA 3DVNB 1S3KL 3GSNL 4X5XA 3VGHA 2BERA 4UIMA 5HVHB 2VSCA 1JNJA 1HIMH 3GIVB 1QRND 4NKMA 4ZUSA 1S9WA 1HYRC 5J6GA 2FZ3B 5C3LD 4OZIE 5C6TH 1GAFL 2IAMB 2WINB 1SYVA 4BSJA 4OGYH 1YY8A 5GS2D 5DD5H 1FRGH 1MELA 4JO1L 3UAJD 5DZLA 3STBA 2NY6D 4CN4A 1AE6H 2Y07H 3MCLL 2R0LL 5CJ8A 1I1FB 1IM9B 2LFGA 5F21B 4HJJL 4KJYB 2B2XL 3CCHA 2OYPA 4N0UB 5KN5A 3NACH 5DGQA 4L4VB 3QFJE 1JHKH 4G7VH 4P46D 3QHZH 4KUZL 4U1KA 3GKWL 3WNLA 4I0KA 5B3JF 4HFUH 3L3JB 3UYRH 5ESVA 4MD4A 1QHPA 2G60L 1N59A 2WUCL 3NH7L 4P48A 1A14H 3BZEB 1NGZA 4NNYA 3LDBB 4U4BA 4CMMB 1OL0A 2X5PA 3O4LA 2EO1A 3O4OB 2O93L 1JHLL 5CJOL 2XTJB 4OFYD 5T3ZD 1RJYA 5DC0A 1UJ3C 1AH1A 4HHAB 2FEDC 3JV6B 4HC1H 1G9NC 3KPTA 5DFWH 3JV4B 4P23C 1T3FA 1IFHH 1JWUB 5HYIA 4NO0D 4K2UL 3ZKQD 4XPGL 4HT1L 5K59F 4CN1A 3DXAA 4MMXC 2HG5A 2CLRB 4GQ9L 1WTGT 3WFDL 1X44A 1YNKL 3OKNA 4LCCB 4XNXH 1I3RA 4GAGH 3FQWB 3O41B 3LEYL 4LSQL 4Z7OE 3DETD 5F7EL 3TBTB 3ZYIA 1IGJA 3CDGA 1OARH 1IC1A 1G9MC 1JRHH 3QEQE 4O2CA 4P4KD 1MCFA 1QEWA 3QUMH 1KGCE 3VFVA 4OCNC 5F1SA 1S9YA 1MCJA 1VGKA 5I75B 2FEEI 5IG7A 3BT2L 5J57B 4HS8L 3TBYA 2PKDA 3WNPA 1FG2B 1VCAA 2F19L 4Z7VF 4D0BA 2AXFA 3I85A 4ODUB 1QR1A 2IH3B 4MJIA 4LRIC 4NRXA 3FT2B 5EDXA 3VFRA 1X5HA 4JR9H 3GHBH 2NY6B 43C9A 15C8H 4PJDF 3WXVL 4OLVH 1TVHB 1LNUB 3X11B 3I6GA 5J9PB 2XZAL 1W0VB 3IU3A 4U6YA 3WS3A 1U3ZA 4P46B 4PG9B 2E6QA 1NDMB 2YBRA 4JANB 3GMLA 3GKZA 5E6IA 1WT5C 1G9NL 2DI7A 1TITA 4YDIL 4FQXC 1ZA3A 1ZAGA 3H2WA 4JFOB 5EUOA 2P5EB 4HBCL 2QL1A 1L0QA 5I19H 1FFNB 1JGEB 4V1DA 2PYED 4KJQD 5LAXB 4M48L 2X9YA 2AK4B 3HS0B 3KPOA 2VDOL 1HILB 3WKMH 3WFCH 3QEUB 4X9HA 1GCFA 2VLKD 4PV9A 1ZWIB 4RAUB 4CGTA 3RA7L 1G9ML 3LSOA 3EFDL 2W9LA 2VDLH 5FYLD 1HXYB 2VR9A 3E6FB 1CFTB 5D2NB 3V6OC 3QIUA 2HYMA 2IBZY 3X13B 4F7MB 3B2VH 1KG0A 2GK0A 4R3SB 4OZHA 3LCYA 4KDTA 4OSUL 1H3WM 5DD3H 5HI3D 2HFGH 2F5BH 4PJ8C 1DQDL 1KYOK 1SBSL 1PX3A 2BSTB 2NY2C 3OHXB 3L1OH 1Z2KA 4R4ND 1PBYA 3LD8C 5DJZA 3KJ4C 5GS0H 2BHZA 5IP4A 3W11D 5H94A 2KQMA 43CAB 3NZ8A 1NMCB 1XGYL 3RVVD 4G6KH 5DRZB 1ZSDB 1UKQA 2VAAB 2AGJH 3O6KL 2ZSWB 3SDDA 1EHLH 2VXVH 1AGDA 1HSAA 2X4SA 5HYEA 1WAAA 4B41A 1NBQA 1AY1H 4NQVA 4DEPB 3CFCL 5HVGB 3V6FA 2H9GB 4B5EA 4BH8B 3ARYA 1I4FA 5D7SL 5F7YC 1KPUB 2W91A 5EU3A 5EIIA 2ZOLB 1JYVA 2ZKHL 3GMRB 5C0AA 2BVOA 5AAWA 2C1PA 3F58L 3W5NA 2WM0A 1NLBL 5ITFB 5DR5L 5I8CA 4S1DC 1YN7B 4IOFD 1PD6A 4JO1H 3UJIL 4EN3C 4ODWB 2FHBA 3MCLH 2R0LH 3LKQA 5CEXB 1F5WA 2W0FA 4L3EE 4CDGC 4QKXB 2ZUUA 2BY2A 4HJJH 3H8NA 2AERT 2B2XH 4K3JL 1I8LC 2PYEB 2VL5A 4U3XA 1U8KB 3STLB 4DGYL 4HUUA 4KUZH 3GKWH 1YYLL 1PQZA 4ZAKC 4ZMAT 5GGUA 3T0DA 2VLKB 4LK4A 1T1ZA 4JPIA 2G60H 3U9UB 2WUCH 3NH7H 5C9KA 3MFFA 4JFEE 4GMTL 5HI4C 4JFZH 5DMGC 2O61A 5DVKA 1OM3L 4PJAA 2FBJL 4Y88A 1DBAH 2X4UB 2VUYA 1KJMA 2G75B 3HMXH 4KQ4L 3N9GH 1AGBA 1NCCH 1MWAB 4K2UH 4MDJA 2V7HA 4XPGH 3U0TB 5C0EA 1GGUA 2VQ1A 1IAKB 4GQ9H 3WFDH 1YNKH 2GITA 2OBGA 2MPAL 4RNRA 3EZ8A 4LSQH 1L9NA 4OD1L 5F7EH 3BKJL 3HI6L 1D5XB 4K71B 4I18C 4UT9L 3ZHDA 4JJHA 5I6XB 1I8IA 1JPSH 5J12C 2ADFH 3B8YA 2W59A 3S36X 4RZCB 5BZWA 3QEGH 1F42A 2BOBA 5F8RC 1GPOL 1K2DA 2V7NB 3BT2H 4HS8H 1KCSH 3KYMA 3KLHC 2ICWJ 1OAXL 3D5OF 4KTEH 1UM5L 4OKVA 5F1KC 1QD0A 1BVLA 1JV5A 2LTQB 1T5WA 2X1PA 2N56A 1CFVL 3IJHA 4R7NB 1G6RL 3D3VA 3IFOB 2C3WA 2VLLB 4MVBD 1R3JA 5F70A 3WXVH 3O9WC 2V5RA 4I2XA 3WNOA 5L8KB 1JRHI 2J3SA 3VWKB 2XZAH 2YPVL 2VZ1A 3DECA 3T77B 5DRWB 4ZYKB 1M71B 3L95A 3IS1X 4Q6IA 4ZDHA 3ULVC 3W9EA 3QIBA 1YPZB 4GRWE 4M4PA 1G9NH 5DHYA 3MRRB 3VFGL 4F37K 4JFYA 5C07D 2V17L 1XMWA 5I8KL 2YD2A 3EJYD 3WSQL 1IAIH 2IFGA 4N8VA 4M48H 1IGFL 2EXWD 4P49A 2YC1A 3K1DA 4YDLC 3GGWB 4ERSL 2VDOH 2WIIA 1HHJA 5DMKB 3CFJA 5HHPA 5CP7A 4LLDA 2A1WL 5D1ZA 1ZE3C 3H7BB 4OLWL 3MUJA 4WI2A 1UXWA 3EFDH 4AM0B 1FAIL 1U3YA 2CMRL 4K7FA 1KYOJ 3P9WB 1G7QB 4GRWH 3V0WL 1EHAA 3VXSD 2ZPKL 1LO3H 5ACZB 5BV7C 3HZKA 3SDCC 1S5HA 4XC3L 5GZNC 4JVUA 3QNXA 2WSKA 5C0FA 1SBSH 1XR8B 3T2QA 4WEUD 4M7LT 3E6HB 1XGYH 1BFOB 3BQUC 4QXWA 5GGSB 3L9RB 3O8XC 5E5UB 1Y18B 4U3CA 3L3DB 4YBLB 1CD8A 2BVPA 2NX5E 3VRIB 1N8ZB 3O6KH 2Y36L 2D4FA 3PGCB 1DUZB 3ULVL 3CFCH 2ZUWA 4KQ3L 3T4YB 5D7SH 3BN3B 1L0YA 3T8XB 2M26A 2ZKHH 1RHHB 2PXYC 1EXUB 3F58H 2ZG1A 4MXVF 3VFWB 1JNNL 1NLBH 3ZHKA 5DR5H 4K3GA 1SEBB 1QFUL 3BI9X 4RGMC 1U95A 5DDHA 1U8JA 3C8KA 4PJFF 2JIXA 1T6WA 4HF5L 3MRNA 2JJVA 4POUB 3C2SA 3IRPX 4Y2OA 4UU9A 4RCAA 1FO0B 4LPTA 1A7PL 4JPWL 2GTWB 4MAYC 5C07B 1JK8B 5CKGA 4K3JH 1FBIH 2V2XB 3P4MB 4Z0XA 2IBBA 3OTTA 2W92A 5E6ID 3BDYL 4DGYH 2FJGA 1FE8L 1OTTD 4LDEB 5BV7L 5KTEL 2C7UB 4A6YB 2NY7H 3MV7B 2XWBA 4I4WB 2XA8L 1Q94B 1ZHLB 1CXLA 3SDXE 1DFBL 4AQOA 4GMTH 3GSVB 4ZUWB 4WW2F 5C86A 4MSWA 3H3PH 3ZT6A 1ZVHA 2R23A 4MZ2A 3VXSB 3MLTB 4XVTL 2FBJH 1ITBB 2VLMD 2YPLD 4P5MB 4OGAC 2LQRA 1CZ8H 1FNLA 3VFSB 3VXPB 5FCUH 4WENB 1LE5B 1J0KA 3DMMA 4U1HB 3DO7B 4MXQC 1S7RB 4WFFD 1MI5A 5C0CA 5E8EA 4QHNA 4XPFL 1S7TA 3MOBH 3QG7H 2Z9TA 1S7QB 3TZVA 2ZWLT 1BVKB 3D69A 1P6FA 2VISA 4MNHA 4F9LC 3HI6H 4GAFB 2NYYC 3RBGA 1IEHA 1LD9A 2FD6L 2FB4L 2X4NB 4ORGA 2AEQL 5IFAL 1NUDA 3QYCA 4YHPA 2OK0H 2D4DA 4OD2B 3REVA 4Z7UF 4QTHA 4BFEA 3I02B 5F6HJ 1J8KA 2R2HA 5J06A 1UM5H 2IC2A 1VFAB 1Z9MA 4MA7H 5DTFB 1P6AB 3SCMC 4L9DA 4JY4A 5IOPB 5C0AD 5FGCB 1FHGA 1D9KD 2IBZX 4OF3A 4RFEA 4DGVL 2CLVA 4GJTB 3PQYE 1D5MA 1FP5A 3EJZC 3CK0H 3JWDC 3VDBA 1SVZA 4PJIF 4PRHB 5J1TC 4Q58C 5E5RB 1RK1A 4QWWC 5I1KH 4BKLA 2YD8A 5C7XH 1J9CT 4Y19D 2Z91B 1MUJA 2R56H 1AC6A 5T1KA 3MBEA 4YBHA 1NBYA 1WWWX 3RZCA 1B3JA 3V7AE 5F7HA 4DGIH 2FX7L 3QDJB 4JFPA 5KANG 2E7MA 3WSQH 3M17A 5EBWB 1T2XA 5F7DA 3WXWH 1IGFH 4CJ0A 4P2OA 5F71A 4TPRL 1SYSA 3TBWB 2Z8VC 5D7JA 1RIUL 4R90L 3OPZL 4UQ2B 4PP2B 3MCKA 3O3DA 2YPLB 5F7UA 1XCTB 2A1WH 5BZDA 5DD1H 1UM4L 4OLWH 4LKXB 2D7OA 3C6LD 3W2DH 2X9WA 3RNQA 3GRWL 3MLWL 1VKXB 3V7AG 4H1LG 3V0WH 4DOHB 2KL6A 4HCRL 3SBWC 2W0LA 3ULVE 4JN1L 3IFPA 3RUGB 2E3VA 4H1LH 1CWVA 1BJ1H 3ZZ1A 2DDQL 1IAII 3L3IB 4GKZB 3ARVA 2D31A 5DQDL 5ADOH 1HI6B 4J6RH 2OR9L 3PWJB 4E41D 4TYUA 5IR1A 5CP3H 4P57A 2NXZD 3SE9L 1RJZB 4RMWA 1J0IA 1MCEA 1VFBB 1J0ZA 1GZPA 4XP9L 1RK0A 2ZCHH 3H9SE 5GS3A 4ETQA 5JHDD 3D0LB 4MD0B 4S1RL 3JWDL 1NAMH 5F9JA 4FHBD 5MHSE 1F6FB 4XCFL 5FECB 1SEQL 4RSVA 1D3CA 5D1QC 3ULVH 1QHOA 4N5EC 4N68A 2GKIA 1D9KB 3OF6A 3QUXA 4CAGA 3DRQB 5I18L 5D5MB 1D5BB 4WU7B 1NCWL 1UEMA 4BFIA 3MRCB 4KI5D 1P84K 3CVIH 5HYSA 1G7LB 4HF5H 1DQTA 3LEXA 4NKDA 1I9EA 3LMJL 4JFDA 1JZ2A 1P1ZB 1IKNC 4PJ9D 3OKOB 1FORH 4L8DA 1FL3A 5IMMB 1A7PH 4PRAB 5KSAB 3ULUF 4JPWH 5EWIH 5ESQA 4HZLA 1UB6A 1A6VL 5FGSA 4JFQB 5HHOA 3QZWG 2JE8A 1FE8H 4NKIH 5GJSL 5BV7H 5KTEH 4EDWL 1CLZL 3CU7A 2HJLB 1LDPL 4U1LA 5KVFL 3MOQA 3JBG7 5MI0C 2NW3A 2XA8H 1ZLVK 1FNGB 4WTZG 3HE7D 4U1GC 2AI0L 1LE9B 2GSIA 1GVIA 2XNAB 4NJAH 4LIQL 3DBXB 4XVTH 4HQQH 4WO4C 1J1PL 5FM5O 3C8HA 5GRYA 3VFOB 4MQXD 2QQLH 2X4QA 4F2MA 4E0RA 2XKNB 4LHUD 5EUKB 4Z5RB 1MCDA 3BGFB 3WFBL 4E41B 1FFOA 4KJWC 2ADGA 2NXZB 2HTKD 3BMWA 1M6OB 3EOBB 4O5LL 1XZ0A 3ZMRA 2A6JB 3WE6A 3PWPB 4NKQB 3D85B 4WRLA 2NTFA 1KBGL 2L4OA 4G9DB 5JPNA 4KI1A 4JB9L 2FIRT 4MZ3A 5F1OB 2FD6H 2FB4H 3NCYP 5EOQL 3RVWD 4N9OB 3VXNB 3EW3B 4JGJA 2YK1L 1OAYH 1Q9LA 3RL2B 4IMKA 3U2SA 4QXUH 1IGYA 1LP9A 4HUVA 3KPLB 1ZXQA 2E7BA 3GMPB 2EE9A 5T1LA 3OKYA 3FB7B 1CGWA 5A3ID 2Y5EA 4YHIA 3QA3B 4XX1E 1AC0A 4YDVA 1QSED 2EDNA 4L8SC 3KVQA 5FO7A 4KH2A 3KS0H 5JQHC 1OD7A 1RUPL 4DGVH 2B5IB 5AG9A 4L3CB 3SY0B 4ESKA 5IHZA 5EIVA 1A1OA 3OGCA 3STZA 3MNVB 1J1OL 3BPOB 3S3PA 4PJ5A 2IBGA 2YUWA 5E7BA 1R3HB 3S4SA 4RX4D 1HH9B 1T7XA 5E6ZA 3JWOC 1YEJL 5EU5A 4J4PC 1RUKL 2HT4D 4N8PA 4XX1G 5F44A 2J6EA 3D39E 3WDIA 3QDGA 5J1SC 3BN9D 5J6HA 4LSSL 3WUWB 3HTLX 5DJ6A 4NOFA 5T1DL 3OAYK 5E6YA 4PJCA 3SGJA 1W8NA 4KK8C 4OCWL 3B6SB 4TPRH 3P4OB 4PJ7F 4ZUUB 1CXEA 1RIUH 1AR1C 3OPZH 3IDUA 1XIWC 1VACA 3G6AB 5EPMB 2FO4A 4YHKL 4HUXA 3O2WL 1UM4H 1U91B 2BVYA 2BMKB 3FFCE 1MREL 3MLWH 5D2LB 1LEKB 2B4CC 1H15A 2BDNH 1SY6H 4Y5YB 3GJFB 4PLKD 4NKOA 2AV1A 3O6FB 4U7MA 4JN1H 1I1AC 1AXSA 1CFQB 1WJ3A 5DEFB 2HKHL 4PRBB 1LO2L 2OR9H 4OFDA 1UEYA 5KANI 3LQZA 2BNQA 4I9WD 3SE9H 5D93B 5KS9E 1I3VA 1MI5D 2X1XR 2LE9A 5C0CD 1T83C 5ICYB 4OZGB 5EIQA 4KROD 4WI3A 5JO5B 1KCVL 2VNCA 3BJLA 4S1RH 1U3HC 3ARXA 2BNRD 5BS0E 4M61B 1FDLL 3GHEL 2BK8A 4PJBE 4ELMA 3IGAA 2EYTA 4XCFH 2X09A 5DJAA 1W0YT 2I9LB 3JWOL 4BJLA 3QI9A 3FZUD 1P84J 3GJEA 4MCZB 3CSGA 5IMLB 1OP3K 4CMHB 3KYNA 3NABH 3FQNA 4AEHL 3UYOD 1WQVT 1JF1A 4XNMB 3BUTA 1NCNA 4Z95H 1NCWH 3VH8B 4NSKB 1FJ1A 5TJWK 5JXEA 4PJGE 3CPLB 5I2IB 4J3TA 4PGCB 5IT2H 3NGBB 1A1NB 5MEOB 3LS4L 1YQVL 4YHNB 3PUCA 1WC7A 4MB5A 4ZS6D 4X7TB 2GUOA 4HEME 4MYWB 3RWCB 4P5TD 2AEPL 1BF8A 4LIQE 4X5WA 4JFFA 3UC0L 1N4XH 3AU1A 2FNBA 1A6VH 1UVQA 3E2HB 4FP8H 3RL1A 2AEWA 3CFDB 4XAWL 2MCPH 4EDWH 3GIZL 1CLZH 5EH1A 1LDPH 1ZHNB 1OTUD 1LO0H 2HTLC 3O2VH 2VYRE 4P9ML 3ZDYF 1HN1A 4HIXL 1KLGB 2KZ1B 4LLMA 3NCBB 4IIQC 3D1MC 3F7YA 3MA9L 2BVTA 2C3VA 2VLJD 1C5CL 2IALB 1N5AB 1XGQA 1J1PH 2NLJA 5EA0H 3U83A 4DKFH 1MVFA 5FA4A 4MJ5A 4PGDA 1B0WA 3N1FC 1NLDL 3QXDB 2V2TA 4DKAA 4PJEE 4NWUL 1VENA 4LVOC 2COQA 1GHFL 4O5LH 4Z7WB 4KROB 5E9DB 2G5BB 1YY9C 5J3HD 4U7KA 3FFDA 4PBXA 2X10A 2VDPL 2BNRB 3N1PC 2QHRL 4NM4H 2JCCB 3BPNC 4XRCA 3IXTA 2RFXB 4JB9H 4R2GB 4U1IB 4ZNEA 4FTVA 4GKNB 4K3EH 3ROLB 3ARRA 1J5OL 1EBAA 2YK1H 4HBQA 4AQ1B 4XMKH 3WLWC 1VHPA 2VN4A 4EIGB 1FZKB 1QVOA 2VOTA 4TOYL 4BH7B 3FB8A 5EBLA 3U79A 1NFDB 5EZJA 2NMSA 3MRBB 3P73B 4DCQB 2JJSA 4XVSL 1J12A 5SWZA 2P8PB 2EECA 1NPUA 1RUPH 4KRNA 5EB9A 2YA1A 3IJYB 1CICA 3ILQC 1I9JH 1R24B 1T7VA 5DO2D 5HGDB 3RVXC 4KUCF 2W1NA 4YBQC 4POZC 3VJ6B 1J1OH 3IF1A 5IMOB 3MR9B 5CD5C 1QSFE 5I66B 3K8KA 5CBAB 1K8IA 5C08E 1A2YB 4ZTPH 3PXJA 5IJKA 5KSBA 4KKAD 5JR1H 1WIPA 4XCCH 4YEFA 4GG6E 5AUMA 4AT6B 5KG9B 1DBKH 2WIMA 4LSSH 5I73B 5HHOD 5T1DH 4R0LA 1UENA 4JZJB 2JJUA 3T04D 5E8DL 3IDXL 2VL4A 4QY8B 3HG1E 4OCWH 2UV3A 4ZD3L 4NC1C 2VLJB 4HH8A 4D3CL 4B53A 4HPYL 3CH1A 3NTCL 4YHKH 3TWCL 3O2WH 5A2LH 1YDPB 5L2JA 3DX6B 1BIIB 3FO0H 4ZFOB 3QB7C 3U7WL 4JM4L 1ZA6B 5HVHC 3MNWB 3S3JA 3RY6A 1RZGA 2DTSA 4OD3L 4MJ6B 4MNQA 2CRIA 3MLRL 2IAMC 3VFTA 4L1HA 3QO1A 3NFPB 2HKHH 4M1CC 1IGIH 3CDFA 2CDGB 1LEIA 2JK5A 1I7UB 3HB3D 4ELKB 5INDA 1M7IA 1JI1A 1FSKC 1LO2H 2WBJD 1FFRA 3MV9A 3K7UA 2GW5A 4GRLC 3VXOB 1T20A 5DD6A 5ESAB 1TVBA 3C5ZA 2O26U 4HJ0C 2JF1A 1DE4B 1A9EB 3NIDF 5LCVL 5IB2A 4DUWA 2OMBA 4QRRB 2LV4A 3JWOH 4R4BA 3DURA 4Y5XC 4Q9QH 1OWRM 1A6ZA 3MJ9L 3TBVA 2XQYG 2ERJB 2OSLB 2MTPA 1RZIA 4OCSL 1CDJA 3LDBC 1RZJC 1IAMA 4WDIB 3O4OC 2DB8A 5T1LD 5DQJA 2XTJC 4P59H 3C87A 1CXHA 3IFNL 3I2CH 1YA5A 1MCRA 2DQHH 1TZIA 1AD0B 4UBDC 1V7NH 4P2RE 5FK9B 32C2A 1QKZH 2N7BA 5LWYL 4RAHA 1UXSB 3IDJA 2HAZA 1YEHH 2CUMA 4JM2B 2AEPH 5HD8C 3ECBA 3H9HA 2FR4A 1CBVL 3N50A 3LRSB 2MQ0A 2NY0D 4LCCC 2B4CH 3OXSB 1T0MA 5C2UB 1F4YL 4I77L 2XPGB 2BVEA 2Y6SD 2I9TB 3QR2A 3MUZ1 4H25A 2FIKB 2QLVB 1S9VB 3QUMA 3BP5B 4F7CA 1R5IB 3F7VA 2WMPA 5CD3A 5TF0A 4PJXE 2H1PL 1CFSA 4HIXH 3TT1H 2XKUA 2EC8A 2MQCA 2YEZA 5K9OB 4IRJD 4EUPB 2DRUA 3MA9H 3L7FA 2DKUA 4D9LL 1HINH 3OXRA 4QRSA 1C5CH 4HD9A 3MJ7A 4Y1AA 2OXGA 3HCVA 3TO4A 1JNHA 2D03L 2WBJB 1NLDH 1UYWL 3KPSB 2CK0L 5IVXB 2NNAB 5CAYB 3DHMA 2C26A 1BQHG 3BD3A 5DURB 5KVMC 4NUGL 1GHFH 5CMAB 3BFOA 1Y0LB 5KSUA 2F74B 4PREB 1MHHB 3OX8B 1RZJL 2JELL 5MENE 3ZYJA 2VDPH 5I76A 4I48A 2QHRH 5EG6C 3QNZA 3HC0B 1YYML 4HS3A 4MQSB 5SX5H 1BMGA 4KKNA 1MF2L 2YRLA 1NMAL 5C0JB 1J5OH 3MRJB 1JGDA 1IZJA 1KCRL 4K8RD 3AM8A 3VG9C 1IEAA 5KVGH 4M8QB 4N0CC 5GRJL 3RWIA 2ITCB 4R8WL 2A6KA 5B38B 1T1WA 2X89A 4M9OA 4M6MH 4QT5B 5JDSA 1TCRB 1R5VB 3QH3A 2GEEA 4Y4KB 4Y4HA 3ZSTA 4APQB 3OKLB 2OTWB 3A6BH 4X6CE 3QBTB 1AHWA 3MRKB 3KPQB 2NY0B 3QDME 3VMOA 4WWKA 4WEBL 3S9DB 1L7IH 5DUML 1D5ZB 5MEQA 1KB5B 1QQDA 3P77A 5DHVH 2E5EA 5IKCA 3CZFA 1MFAH 3F5WB 1HSBA 2CRMA 3MRGB 4YPJA 2PCPB 4G7YL 1RV6X 1KELH 4LLVA 5E5MA 3AY4C 1NMCC 1MRCL 1SJEB 4RIRB 4XHQA 1OTSD 3HC3H 4FFYL 5D1XD 4Z7QE 1TETL 4IRJB 3L3HA 3IDXH 1BOYA 4ZD3H 4G8EA 3V4PL 4D3CH 4HPYH 2BHUA 1JPFA 3NTCH 1DN0A 4DEPC 4FZ8L 3QJFB 1MCWW 3U7WH 4JM4H 3OKEA 4EVNB 3GUTA 2HFEA 4QRTB 3S35L 5M94B 3QQ4B 3O6LH 5A16A 5EFIA 2J8HA 2MOVA 4GSDL 4YJZL 4LPCA 1F6LL 5DRXB 2GAZA 2XQYK 3VXRD 5F96L 3RI5K 4CJ1A 2CXKA 4X8JA 1TQCB 3P30L 4LBEA 2FH6A 3C60D 2OJZL 4XBPA 4NC1E 2C5DC 1X7QB 1T66C 4PJHE 3T65A 4F33A 3OR6A 4KJQC 4PIRF 4KJPD 4PLNC 4Z7NE 3NIGF 3QDHA 2XKSA 5LCVH 4AMKL 2XT1B 3WIFA 3KPRB 1FZJA 2DBLH 5SV3A 4JCMA 1JL8A 4KKBC 2IADB 3MYJA 4OBSA 2YPKA 3MJ9H 4RAVA 4EKXA 3W5MA 4TNWK 4KKLD 4NQDD 4JREB 4L3EA 3BEVA 5L8JB 4I1NB 3DSNA 4LASH 1LQSR 3DV6A 3HMXA 1V3JA 1HWGB 2F54B 2I24N 3O6ML 4N0UE 2P8LA 3KXFD 5LWYH 2X4PA 4E42B 2CKNA 1PSKH 4L4VE 1FNEB 1CBVH 4U49A 1E4KC 1F4YH 3BH8B 3O81A 5D1XB 2HVKB 3RPIA 3QJHB 3EDFA 4K71C 3D0VA 1F3RB 5DHXB 2H6PA 4TVSa 5TDOA 5DSCA 2WBWB 3V8CA 1MRDL 5MEPA 1N26A 2YD6A 3T0BA 1MFDH 4NYLB 2H2SD 2XTJE 3L7EA 1N3NB 4KFZC 2D9CA 4LLYB 1LK3H 2AJXL 4QOKD 1A3LL 4F58L 1H0DA 4D9LH 5GISH 1U93A 3DIFA 2LTQC 1FZOB 1UH4A 4J23A 2Z92B 5L2KB 5JUEL 1H3PL 3DVGB 2D03H 4PGBA 2Z4QA 3ZL4L 3VXRB 4Y2DB 1UZ6F 3FT4A 4NUGH 4NM8L 3VWKC 1ED3A 5GJTH 3ARGC 1RZJH 1QO3A 4P4RA 3B2UD 2VIRB 1NQBA 2CKBB 1UJ3A 2AQ3A 3BKML 3PDOA 1DJSA 4K7PY 2J12B 3CLEL 3GM8A 5GQBA 3GZKA 3MV9D 2DAVA 4XCYB 1MF2H 3QWRD 4HUMB 4LSUL 3TJHD 4JDVA 1MIEL 4X6DB 5IF0A 2UWEA 2PTVA 4U31A 2ICWB 4HLZH 2QR0A 4NQDB 3WO3B 5GRJH 4M6OH 4NQCB 4LOUC 4AH2A 3GFUA 2VERN 1T21A 2DQJL 2YZ8A 4LPUA 1EUUA 3Q2CA 4PS4L 2JB5H 4XBEL 3KXFB 4LDOB 3BUYA 4QEGA 1T0PB 1CF8L 5CHNA 5DUBB 3MZTA 1A5FL 2ZZUT 4WEBH 3FRUB 5IK3A 3MV8B 4FN0A 5DUMH 4CKVX 3QFJD 3RY5A 5EO1B 2F53D 3L5WA 5IGXH 5IQ7L 4ZPVA 3BGMA 1HXMB 2OTUA 2P5EE 3G6JB 5GS2H 3L5XL 5JLZA 1MEXL 4Y89A 3FHAA 5GSVA 2AK4E 2H32B 2BNUA 1M7DA 4KRPD 4L5FL 4MD5B 5ISZD 1FZMA 4S1QH 4FFYH 4ZOEA 5DA0B 4AEFA 1YEKL 1U8HB 1OSPL 1TETH 2ZCLL 4QOKB 4QCIA 4YBLC 5EUOF 3UTTE 1NGYA 2MSPA 5CEYB 4PGEB 3TYGH 3V4PH 4QXGH 2FLRT 4FZ8H 3PP3K 4Q0XL 4Y0GA 5D2NE 4FQXA 1RZKC 1U8LB 1IEBA 2D0GA 3LH2L 3RPKA 1O7VA 5I30L 3S35H 4U1SB 4LLWB 4W6XB 1IGCL 4PYHA 1R5WB 2V2WB 5IFHH 3GMOB 1ORSA 1J0YA 4YX2L 3BZ4B 2JKXA 1U8IA 1P2CA 2YSSB 2IJ0C 3ARDA 4D0CB 4TQEL 3DX7A 3TO4D 4GSDH 5FYJL 2D3VA 2R1WB 2DIAA 1LO4H 5J89A 4RQQA 3DGGB 1BVZA 3IKCA 3QEQD 3U30B 3MA7A 3U82B 1KGCD 4QLRA 3FOLB 3P30H 4R4FH 5JW3L 1ADQH 3KWWB 3NIFF 1A7OL 1MQ8A 1PG7X 4P2CG 3ARBA 1NGQH 4NDMB 3H0TA 1B0GB 4ZOAA 4NNPH 3HHRB 3MNZB 3NPZB 2EXWC 3N1GC 3QUYD 3ZKMD 3IU4L 2EH8L 3PGDA 4NFBA 4PJ8A 5F89B 1OP5H 4AMKH 5HHQA 2DWDB 3C5SB 1U3JA 5CGTA 4EDXB 1L6ZA 4PY7A 1WITA 4Z78B 3VDCA 4L8CA 1ZANH 5DK2B 1EEYB 1ROWA 3L6FB 3MV11 3QPQD 3TEUA 3CSBA 1WAAF 2QHLA 3GSWA 5IQ9A 4BZ1H 5HGHB 4DKDC 2LU3A 3EYOA 3I9GH 3FQTB 2ED8A 3I84A 5HHXH 2EICA 1U9KA 5D71H 1NCAL 5TH2B 2F53B 5BOPA 2F58H 3IJSB 3U4EA 5J6GB 4IM8A 5D5MF 4F8TA 1PKQB 5I9QC 1SYVB 2N1KA 1NDGA 5KZCD 3LEVL 1XF2B 4TVPL 2WWMC 3MO1B 4KRPB 2ITDB 5ISZB 3SDXA 2AABL 5E8PA 1U8OA 4N0FB 4XC1L 3MLPA 5GS0D 1CU4H 3FO1B 3HMWL 1MRDH 5JIHA 2FATL 2K1MA 5JIPA 4OLXL 4V2CB 4U1KB 5BVJB 1EO7A 2YD3A 3L3GB 1TFHA 5ESVB 4MD4B 1P7QD 1A3LH 1QOKA 4M7KL 4F58H 4PRIE 4X4XB 3M8OL 4TSAL 1G0DA 4LRNL 3T3MF 5HGBA 4NUJA 4J1UA 5L9DL 4JZOA 4NNYB 4C59B 5B8CC 4QRUB 4Z7VA 1FFPA 1EK3A 5JUEH 1QA9A 1CQKA 4EI6B 4C83A 4XP6L 3ZL4H 4PJAF 4O2EB 2DMBA 3WNNA 4WUUA 3OB0H 4NM8H 2DYPD 1AD9A 2X42A 3MRMA 2X4TA 3O3AA 1QP1A 4PJDA 4JHWL 1BBDL 4BQ9A 3F8UB 3DXAB 1H9VA 2HG5B 3KYOA 3CLEH 3JSSA 4QYOA 1A02N 1I3RB 1MFBH 5DVMA 1YQ2A 4P5KA 1XT5A 4DKEL 1MWAH 3O2DA 2VITB 1DQLH 1U42A 5DFTA 2BRRL 3SKMB 3OL2A 2X05A 3IB4A 1QEWB 3U7AA 3FQUB 2UUDH 1V05A 5HYJA 4HWEH 4NN7B 3GBLA 4TSBH 2XQBH 5CSZA 1A7BA 1NSNL 1PYWA 1OWWA 2DQJH 3MX0A 3BRDA 4Y4FD 5HSFA 1VFOA 2VZOA 5BVPL 2UYLB 4HFWB 4LNRB 2ICCA 3BEWB 5KZCB 4L3ED 2M1KA 5KVEL 4KI5F 3S6CA 3VFRB 4MA1B 3ESVF 1YPZE 2W65B 4JO4H 4PR5A 1KN4L 5HGAA 3ZE2E 5IQ7H 5CP3A 4YFLF 1REIA 1X5KA 1S9XB 1W72A 1I7TB 1AGEA 3L5XH 4WUKL 1NC4D 1DQJB 3LN4B 4TTDC 4UI2A 5DS8A 3O9WA 4HS6B 3E1F1 4JFED 4L5FH 2Z35A 1NEZA 4XCEB 5FYJE 1CT8A 1NBZA 3U0WL 1NAMA 1OSPH 2FYYA 3T2OA 1P7QB 4N8CL 3GSNB 1MLCA 3CXHJ 4BQ8A 2EDRA 1U8MB 2DWEA 3MGTA 1VB9A 4Q0XH 3E8UH 5TFSL 3BGAA 4HK3J 3KPOB 4JKMA 1D9KC 4TNVK 4ACPA 3QXAA 1E28A 1SJHA 5I30H 1OP5K 4C4KO 4H88H 1IGCH 4PV9B 3K8MA 2DYPB 4MCYA 3GI9L 4YX2H 4YHYB 1LILA 4GAJH 1ZLUH 3B5TA 4YO0A 4TQEH 1NUNB 5FYJH 3UO1L 1JNLL 1C5BH 2GK0B 4UZGA 2DTMH 4LLQB 4OZHB 4PFEA 5FOJA 3EZJB 1MHCB 1BEYH 2EC9U 4MLSA 1QRKA 5F8QC 5BCAA 5KSAC 4G5ZH 1T1YA 2R2CA 2HT2D 3GM0A 4O2FA 3VFPA 4IDJL 2FEDD 4LCYA 4IS6B 1MH5A 3SDCA 4P23D 3NZ8B 1G7IA 3IU4H 2EH8H 3QZWA 4TVPE 1R3LA 4M62L 1YECL 4Y4FB 5ANMB 2HLFD 4NO2A 4JO3H 3CFEA 1AGDB 1HSAB 2X4SB 3RX5A 2VXSL 1RPQA 4NQVB 1JZ4A 3BQUA 3MPCA 4WW2C 4WTXA 1P9MC 3N85L 4N90E 2VH5L 1MRFL 1JWMA 1K8DA 5JOFA 2IH1B 3PL6C 3NCEB 4NQTA 3OAZK 2VDKL 3P0VL 2IMMA 2NY5H 4DZBA 2DLGA 5C07E 3BGFC 5I8CB 4WEMB 3UBXG 2NXZC 1RZKH 1CGVA 4JQXC 1DQML 3LEVH 1PZ5A 3IDYB 4TVPH 3QHFL 3FN9A 4K7PX 5JA9A 2VXQL 3LKQB 4XC1H 3L3OA 1KN2L 3MV7E 4L9LB 1UWEL 3WEXA 2V5SA 1QBML 2APWA 3B9AA 1CDHA 2Q7NA 3HMWH 3MRHA 2PO6C 2FATH 2ADJA 2DQIL 2MNUA 4PY8I 1FO0H 4MAYA 3TIEA 1PQZB 3TNMB 1VEOA 5T3XL 1QFWM 1GH7A 1T1ZB 4JPIB 3UDWA 3LKNA 4M7KH 1HQRA 3FONA 1RZ7L 3M8OH 4TSAH 5KAQF 4LRNH 5B22A 6CGTA 4CN6A 3ZE0F 1OT2A 4EXKA 5L9DH 5D72L 4C54A 1UWGL 1G7MA 3ZYOA 2O61B 5HDBE 5HPMA 4MNGB 4A6YH 2VMFA 1G84A 3MCG1 1BOGA 2B5IC 1KJMB 4LSVL 2UVFA 4HKXB 4ODHL 5TDNA 3MROA 3NZHL 4B7LA 3NAAH 4JHWH 2NX5D 3VG0L 4NZTL 4QRPB 4P23B 5I1JH 3IVKA 5I1IL 2GITB 3AVEA 2BY3A 2DQCL 4RNRB 4S2SA 1XF4A 1M1SA 1ES0B 2KKQA 3R0MA 4DKEH 2JCCF 2QSQA 3WS6A 3C08L 2QSVA 4WHTB 3I3EA 4G43B 3VXMD 5BZWB 3ABZA 4PGJA 4RWHA 4PJ8D 5FGCE 2NY2D 5DI8A 3B4NA 1J0JA 4J2XA 4TSCL 4MQXC 1TTGA 4OKVB 2A73B 1DUYB 5GZOC 4LF3B 1BVLB 1B4RA 1TJHL 5J13B 3DOSA 4QRQA 1CN4A 1SY6A 2Y7QB 4PRHE 5KVEH 5BQ7B 1MVUB 2J88L 4JY5L 4Y5YC 3D39A 1HZHL 3O6FC 1NMBH 3SGEH 3QQNA 1KN4H 3MLVL 1G7HA 4Z76A 3SCMA 4WW1A 1B2WL 4G42B 4YAQB 3QDJE 3BP7A 4WUKH 4OAWB 2EYSB 3RVWC 3SDYL 1QZ1A 5E56A 1JPST 4P9HC 2DICA 4D2NA 2W9EH 1LEGB 2A6IB 3AXLA 5D7IB 3KLDA 2WK2A 3MBXL 4S1DD 4OF7A 3U0WH 2YPLE 4GXVL 1OT1A 2HMIC 4JFYB 4N8CH 1CI5A 1RHFA 4EN3D 4Y8AA 5IV2A 4KKCC 4U6XB 4PRNB 3CC5A 2OZ4A 4N8VB 1NL0L 4HIJA 2WWKT 4LU5H 5TFSH 2I5YL 4DOHE 4GBXD 4LCIL 1IQDA 3BZFA 4CMHC 4AG4L 4WI7A 3CFJB 4GO6B 5CP7B 4LLDB 3RUGE 4C56A 5KS9A 1EEZA 3GI9H 2DQFA 2PYFB 1UXWB 4UT7H 4ZAKD 3T4AA 2NXYB 3S5LB 1TVDA 4HX1A 2YA0A 5I1LA 3QQ3B 1KTKE 4QHMA 2OI9B 2NX5B 5BS0A 5LBSL 3NGBC 3HZYA 4NC0B 3R4DA 1G7JA 3CIQA 4HIHB 5DK0A 4NHUA 5DMGD 1Q0XL 5TPWH 3HZKB 1FV1A 4ONHB 3SO3C 3G5YA 4MAUL 3VMNA 3D9AL 1AXTL 3QNXB 4IDJH 4W6YB 3E2HC 3VXMB 4KZEL 1QFPA 1PLGL 3F6IA 5LXGH 1BFTA 2EYRA 3UPRB 4BA8A 1MIML 5E7FA 4PJGA 1HHHA 4HWNA 4HKBA 1KIQB 1YECH 3EGSB 4LVHC 2BVPB 5FO8A 1XGRA 3C6SB 3PQYD 3QUZD 1CDBA 3GSOA 1MCWM 1YEEL 4YIQB 5TE4H 5EO0B 3AREC 1EEUA 3KJ6L 1MRFH 4OKDA 2CXGA 3HN3A 2B7DT 4D9RE 4NOBA 4OQ1A 3TP4A 1XAUA 2VDKH 1K3IA 2ENSA 2W0KA 3EYUL 3MRPA 5D1QA 1KTRL 1ZS8A 3C09B 4ALAL 4PRDA 4MQTB 3QQ9C 3JTTA 3C8KB 2R4SL 1DQMH 2JIXB 1UKSA 4LQ1A 3QHFH 5E1AA 3NMEA 2B1AH 3ES6B 4GUPA 2UY7A 2AXGB 1KN2H 2Y1VA 1UWEH 4YC2B 4EN3B 3MQIA 4R2GC 1QBMH 5BXFB 1XGPA 4NGHL 4KZDH 5EC2A 4XNQA 1NCUA 5GGRA 2CRYA 3UJJL 3BISA 4GBXB 2QQQA 2X7LA 5C71A 4Z6AT 5IBUG 3EOAB 5HYQA 2DKSA 3ULVD 4FFVC 2Q76B 3I6LE 3T3PE 1G6RB 4E41E 4GAYA 1D6VH 2E6PA 3QEHA 5GGQH 4DVBB 4Z7UA 2FWOB 2FECI 4KTYA 4UOJA 1HKLL 4MSWB 1FNAA 3DV4B 3TBSA 1HHIB 2WWKO 4MMZC 3PWPE 4KAQL 3U0PB 3H9SD 3EAKA 4Q2ZA 4LSVH 3K74B 3W0WA 2Y4SA 4ODHH 2IQAB 4WJ5B 3DMMB 3CMOL 2NY4D 2W60B 4N9GA 4WO4A 1KEGH 1CGYA 3VG0H 1LWRA 1U8NA 4NZTH 4JDZB 4JLRA 4AK1A 5I0DA 5J0BA 3TZVB 3OKMA 1R6VA 3ME0A 2VLRA 2VISB 4MNHB 3TYFA 4OLUL 1FVDB 4JRYD 5IB1A 3C08H 3MGAA 3QUZB 4K94C 5FAAA 2EXYD 4QNPF 1AP2A 4KXZH 4JZJC 4I18B 2A9NH 5GZND 2AJUL 1CXKA 2SEBA 2VB5A 4WFGE 3SKJL 4UQ3A 4UTAL 1IC7L 3ROOB 1LP9F 2C1OB 3UP1A 3HR6A 1YC8A 1CE6A 3VXUB 2DM3A 3GK8H 1TJHH 1J88A 3O8XD 2VN7A 4U1MA 2WNGA 4GG6A 3EO9L 4JY5H 5TGBB 4JY4B 4XPHL 2LABA 5DMIL 5J3HC 5FOBA 1N5YH 3OKDA 1RUAL 4XTRC 1RZ8A 1D5MB 1T4KA 2EKSA 4DAGL 2PXYD 5CFHA 5CIPB 3SDYH 1MJ8L 1RK1B 1NFKA 3QCVH 4DVRL 3HI5L 4D94A 5E08L 1MCQA 1QFOA 1ZHKA 3KPMB 4OM1L 4OCXL 3C9NA 4P2YA 4OV5B 4GXVH 1PG7W 5T1KB 2EDHA 4RA3A 3EYFA 5IEKB 4ZSOA 4NFCA 5H37G 2A77H 1NJ9A 3SGEI 3M17B 3PWVB 4PUBH 3QAZC 1UADC 4PJCF 5D2LE 2I5YH 3TFKC 3RX8A 3WUWG 4DUVA 1SYSB 5D7JB 3G5VA 2ICEB 4AG4H 2ERJC 2OJEA 3D48R 1Q0YH 5BZDB 4X0KA 3H9SB 3JTSB 3DTXA 2IPUG 4E5XA 4K94L 4X4YB 4OGZA 5C0DA 1IVLA 2Z0BA 2Y06H 3ALWA 2W9DL 2I27N 2HFFA 4NRZA 2NY4B 3ZDZE 2PTTB 2FX8L 1PGRB 5LBSH 2JB6A 4OLZH 4OZGE 3BP6B 1N6VA 3HA0A 2EDQA 1F3DH 4ZFOL 4LDLB 4JM2C 2E7LC 5EN2A 2D31B 4GH7B 4JRYB 1AXTH 5C0RL 1MAML 3DARA 3GJFH 1E6JL 1GGBL 3O45B 4OGAD 2CO7B 5HGGS 5KJRH 5FF6A 3D25B 1HEZB 4KZEH 2WW8A 4ETQB 1PLGH 1X5LA 3SE4C 4DQOL 1C12B 2RBLA 3SQOL 4MXQD 5ID1B 5FXCH 3KNBB 4ELMF 1NGWB 2CLZB 1TNNA 4P9HH 4ZUTB 4IOIA 3RDTA 3O8XB 1QUNA 4P2RA 1JTOA 3D87B 3CVHL 1T04A 2A6DB 1KLUB 4LKCA 1ZLWK 4W4OA 2EIBA 5INCB 1XEDA 4NP4H 2RQ8A 1KPVB 4YXLL 2XN9A 3QULA 4ALAH 1QLFA 2PXYB 3D39D 5HYSB 1QLEL 4XHJC 5M95B 4LCUA 2A74A 3VH8G 3O3BA 5MERB 1J10A 1BQHA 3LPWA 2X9XA 5EZOL 2V9RA 3SCMD 3D2UA 3J7HA 4ODSH 2E7CA 2YMXL 3HUJB 1F3JB 2VZUA 3VI3E 2DD8H 2GSGB 1CCZA 1OD9A 4IMLB 4MGXA 3QIWB 3FFCD 4PRPD 5IROA 3QG6A 4JG1H 2BX5A 5EC1A 5GS1A 5L6YH 4QWWD 3HR5A 1YMMD 2NW3B 1IC4L 4X6BB 3PIQB 3CH8A 1S8DB 4LVEA 4DZ8B 1BAFH 5MENA 3NN8A 1RUML 1HKLH 5JQ6L 1OW0C 3GMNA 2GSIB 4Z7WE 5E9DE 1KXTB 2BSSA 3V5HA 4U1NA 4Y4KC 3H3KA 3S36L 4AYFA 4KAQH 2H3NB 2EKJA 2BNRE 4NWTL 4APQC 4F2MB 4E0RB 2X4QB 3N1QC 1OY3B 1X3DA 2ADGB 5DHVA 4KMTL 1NCBL 2F15A 3O0RL 5EZLB 2VR5A 1MHPL 1AQDB 1XZ0B 2H2PC 1XF3A 2HKFH 4TUOB 3CNKA 3AAZA 4H26A 3WE6B 1HDMA 3UTQB 2NTFB 1T0NA 1JYWA 1I7ZA 2H8PA 2KDGA 4MA3A 1HQ4B 1NFDE 3OR7A 2FSEB 2AJZA 1KNOA 1RIVH 4IRJC 1H8OA 2AJSL 2AJUH 4X6CA 3AFLA 4KRLB 3QDMA 1U8QA 1IC7H 3FB6A 2RB8A 5E00B 3DRTA 5T33L 1BQLL 4YGVA 5C09B 3QSKB 4NFDA 4WHDA 3UEZA 1VPOL 4H5SA 4NHCL 3EO9H 4QHKJ 3DX8A 3QHTC 4FQLH 4XPHH 4YDVB 5ID0A 1OGTA 2X1QA 5FO7B 3FO2A 4HGMA 5DMIH 5CINH 1RUAH 4N5ED 2VR4A 1GJIA 3EDJA 4KXZI 1DSFL 4DAGH 4ZXBC 2EDLA 1EV2E 1NC2A 4PJ5B 1MJ8H 3M45A 4DVRH 1TQCC 4PRPB 3F7RA 3DYMA 5E2VH 5KSBF 2IPKA 5E08H 3J8F7 5EU5B 3BKYH 4OM1H 3GSQB 4OCXH 3U48A 3IT8D 4OF0A 3CDCA 1YMMB 2OR7A 5F9DC 5I1HH 5GGRY 3S88L 1GOHA 4JY6B 1OSZA 1KOAA 2VRAA 1YEDA 1J1XH 5J7CC 2R2BB 1LK2A 5F1NA 2M2DA 4UDUA 3Q5OA 3KLSA 4JREC 3RWFA 5D70H 4HWZB 4K94H 1WCBA 3LRGA 1T22B 5EO9B 2P5WB 2OL3L 4PJHA 5CKAA 3BW9A 1M05B 5GGTH 3DVNA 4NKOB 3RZWA 2AV1B 3FTGB 3GSXB 1BWWA 1AXSB 1I8KB 1Q72L 1GZQB 1TNMA 2DQTL 1EIBA 3MACH 4XXCC 2EO9A 4P99A 5C0RH 1X5GA 1MAMH 4WO4D 3UZQA 2BNQB 4ODTH 1E6JH 1OTSC 1GGBH 2LAGB 2WINA 3BIBX 1BJ8A 3NVQA 4W6WB 4QRRE 4DQOH 1EGJL 4KJWD 1DVFC 5E2TH 1CTOA 2YOCA 4G3YL 1RIHL 1I1FA 1QFHA 2RCSH 4JG0H 4OZIF 4KJYA 1H3UA 2UZIL 5DJAB 4N0UA 3QI9B 3ZDXE 4HKZB 3GJEB 3MLSL 4XH2B 1QSFD 4WCYL 5M7QA 4QF1B 5C08D 1WLHA 4ODVL 5CILH 3E3QC 3PHQB 4I3SH 1F11B 3ZTJG 2WLZA 4Y2DC 4RRPG 4P3CL 3CD4A 3BZEA 4CMMA 2GYSA 3ZTJH 1J18A 2MKLC 5L88H 4W68A 1WC7B 5EZOH 3U46A 3SGKA 4UAOB 3HG1D 3PV6B 3OZ9L 4X5WB 2YMXH 3MOAL 3M1BB 3JV4A 3S96B 1JWUA 5FO9B 4K55A 4M4RA 2GIYA 3TNNA 4DFHA 4WU5A 4J7RA 5DYOB 4PJEB 3EDEA 2CLRA 5FDWB 4AJ0A 1BBJB 5E2JA 5F97E 3FQWA 2G2RB 2QJDA 4NZJA 1CLYH 4KKLC 4W70A 1IC4H 3TBTA 3TF7C 3DX9A 4J4PD 5AZ2L 2DN7A 3KPSE 1R3KB 1RUMH 5IVXE 5DC9B 2BFVL 3ZO0A 4H0GA 1L7TL 3S37H 3V5KB 3S36H 1XGQB 1MPAL 4Z7OF 4RDQF 4NWTH 4EUPG 5GRUL 5B21A 1WZMA 3MRIB 4M7JL 4AEEA 4KK8D 1FG2A 5IB4B 2OX5A 1INDH 4MJ5B 3V4UL 1KT2A 3FCTB 1AR1D 4NPYB 1QRNA 1A4JA 1XIWD 4ZTOH 4ZODA 4EUPH 5HY9B 4LSTL 4ODUA 2IH3A 3O0RH 1RD6A 1DTUA 5TF1L 3FT2A 5BW7C 3WL9A 3GB7A 1BLNB 5I0ZA 1KJ2L 1L9MA 4BUGA 2B1HH 3IXTB 4K3DL 1TVHA 1I1AD 2Y72A 1LNUA 3X11A 1BP3B 3G5XB 4LHQB 4Z8FL 1WFUA 4AIZA 3ZKXB 2AJSH 4P46A 1TENA 4PG9A 1NDMA 1AR2A 2XG4A 2C3GA 4JANA 5A2IH 2HT3C 1JF5A 4HAGA 1BQLH 5T33H 3SE8L 1OB1B 1VSCA 4WY7L 5C08B 1JFQL 5DEGB 4L4TD 2R1YB 2XWTB 4JFOA 1U3HD 4LGPB 2P5EA 4U7SA 1VPOH 2WLYA 5DJ8A 5L8LB 4HK0B 1Z9SA 5LAXA 5SWZB 2AK4A 5B38G 2HRLA 1YEFH 3PWNA 5IW6B 3HZMB 4OFYA 1HILA 1RMFL 5IB3B 3HG1B 3QEUA 4L8SB 3MREB 3F7QA 4NZUL 4RAUA 1ZWIA 1QR4A 1LGVA 1UC6A 3U30C 1HXYA 4NO0A 1ADQA 2P43B 3E6FA 1UH2A 3WHXA 4X6FB 5D2NA 4MWFA 4F7MA 5F3HA 3D2UD 3KPNB 4R3SA 5AUMB 2J4WL 3QNYB 4HWBL 4E9LA 1CYGA 1B4JL 4UDTB 5I17B 4KHTL 3P4NA 1KB5H 4N0YL 3HRZB 1ZT4A 4R0LB 2BSTA 2YD7A 5DEZA 1W2KT 4P4KA 5SWSD 3TJEL 3FAWA 3OG4B 1FLTX 1T89A 1XF5B 3F7PC 5DRZA 1ZSDA 5F9AC 3LVEA 5MEND 1JGUH 4OUOA 3E0GA 2CIIB 2VAAA 3MRQA 2ZSWA 1H8SA 2YA2A 4MNQB 5ADPL 4IRSD 2ENYA 4M3JA 2H9GA 1VGEL 5EOCJ 1Q72H 3QRGH 4BH8A 4OZ4B 1KPUA 2NCMA 3GMRA 4UILH 4F3FB 3VD4A 2LU7A 3Q3GB 1WFNA 3G6DL 5ITFA 1NBVL 3UPAA 3KPRE 2BVQB 1WVZA 1YN7A 3P9LB 1TVBB 4KHXL 3BWUC 3C5ZB 4ODWA 4G3YH 3T0XA 1CFNB 5CEXA 3BRGC 4L4TB 4JKPH 2EDFA 4AEIL 3ZSSA 4JRXB 5B39G 3W9DB 1MY7A 1MFNA 2BXYA 2PYEA 3QDMD 4K8RH 3FRPG 2F54E 4WGWB 4WCYH 1UG9A 4YXKL 1P5VA 1QFWH 2VLKA 4OQTL 1B88A 5DQJB 3WLWD 3SDAB 1IM3A 1DDHB 1R3IL 3U9UA 3WFEL 5JOEA 1C08B 4P3CH 3A6CL 1EFXB 4P3DB 5FM4A 1FC1A 1TZIB 32C2B 3PDDA 3LHPL 5ALCL 3IYLW 3OZ9H 3T0WA 2G75A 3HAEB 3K2UL 4LSPL 2ARJB 2PF6A 3CSYA 1BPVA 3ILQD 5E4EC 1MWAA 1EDQA 3PG2A 2JJTA 5SWSB 5JPMB 2EDYA 2GJ6D 4POZD 1D6EB 1IAKA 1X5AA 2WANA 4H25B 5CD5D 1RSFA 5L2KE 4M93B 5CD3B 3CFBB 4K07A 1D5XA 3E3QE 5AZ2H 4XWGL 1CFSB 4KVNL 5BRZD 3VXRE 4NN7C 4LHJB 2N7AA 2YEZB 2BP3A 2BFVH 3HNSH 1A7NH 5EU4B 1L7TH 4RZCA 4FQHB 5DJ2B 2FCBA 3T0ED 4IRSB 3X12A 3W82A 1MPAH 1UCTA 4IIQB 2V7NA 5GRUH 2C4FT 4M7JH 5SV4A 3KDMB 5TDPA 3V4UH 4JKWA 1V8HA 2XZQH 4XZUA 2B39A 5ENWB 4R7NA 5KSUB 1OLLA 4X6DE 3IFOA 1YNLH 2OM5A 2VLLA 4I48B 4YE4H 1KJ3H 5LVEA 4NQDE 3QNZB 2IAMD 4M1CD 4NQCE 4Z8FH 2L7UA 4YUEL 1WUNT 1BM3L 3T77A 5DRWA 1KLFA 3JVGC 1M71A 2CKBH 3EIFA 3EO0A 1YPZA 1IM9D 1WF5A 3KXFE 4GRLD 4WVRA 4WY7H 3MRRA 3RWIB 3IXAB 4X4ME 1MQKL 3U4AA 3MV8E 4M7LH 2V5YA 4L4VD 1T1WB 2ESVD 1A8JH 4HJ0D 3OJDB 3QH3B 3B9DA 4OIAA 3S7GA 5CZVL 3G6JE 3GGWA 4GRWF 3SE3C 3PP4L 1N64L 3G08B 4QTIL 2R9HD 4NNXB 5DMKA 3BP4B 1AHWB 1TZGL 1JZ6A 2ADIA 2IGFH 3H7BA 3P11L 1GC1C 4WWKB 4OJFH 4AM0A 5DJXB 1G7QA 2CIKA 2GJ6B 2XTJD 4YNYB 4GKSA 4HWBH 2IFFL 4YZFE 1JGVL 4FMFA 1TXKA 5GGVY 4UBDD 5E5MB 3DROB 5JZ7C 4N0YH 4NT6B 4DN3H 5BRZB 5HD8D 4RISL 1XR8A 3T0EB 2HJKA 2A83A 1JHTB 3SDDC 1OQOA 2DLEA 3E6HA 1F6AB 4P2QE 1BFOA 1S7VB 4NZDA 2H32H 1UA6L 5GGSA 3L9RA 1J05B 3I6KB 1Y18A 4PBVC 3L3DA 4HMCA 5C0NC 3VRIA 1N8ZA 3GUTB 1CGUA 3PGCA 1DBML 2E9IA 1DUZA 5F88B 1T2QL 5ADPH 3GO1L 3I3DA 2BCKA 4JPVH 2GCYB 4JGMA 3HE6B 3T4YA 4XT1C 3T8XA 1RHHA 4YLQT 3BIKA 3WD5L 3IDYC 1WZ1L 2EDXA 2BSED 3PNWB 3G6DH 5AG8A 4LMQE 1NBVH 1SEBA 1N7ML 1A6AB 1FSKB 4LBEB 1JMXA 1WSST 4L9LC 2Q7YB 1RI8A 4XBPB 2MHAB 3MLXL 1VA9A 3VI4E 4F33B 3KHQA 3P2TA 3OR6B 4GRLB 1GC1L 3BKCL 3SKNA 1FO0A 1VFUA 1WWAX 4MA8L 3T2NL 2GTWA 5C07A 1JK8A 3F12B 2ZSVB 2V2XA 3P4MA 2ESVB 4ZQKB 2F53E 2X70B 1HCVA 3IAQA 5KW9L 2B0SL 1OAUL 1PKQE 4MXWH 4LNVA 5CJXA 1NFIB 4OLYL 4RAVB 2WV3A 4TULL 5IM7A 4YXKH 5ICZB 4Y5XB 4A6YA 2P5ED 4OQTH 4X9BA 3BEVB 4I4WA 5ISZE 1Q94A 1R3IH 1ZHLA 3BD5A 3WFEH 3RKDC 2Q8BL 3A6CH 2AK4D 4ZUWA 4N0CD 3TIDB 3WJJC 2HT2C 5I16A 1EO8L 4Y5VA 5C0BD 3VXSA 3LHPH 2I60H 2X4PB 3MLTA 2YWZA 3UTTD 4BSVB 4AY0A 3SDXF 1ZMYA 3FT3B 5DVOA 4X99B 1LE5A 2J8UB 3DO7A 1KJVB 1S7RA 2K7QA 3D0VB 3VCLA 4D8PA 1QFWI 3Q1SH 2ATKA 2HLFC 5TDOB 1MCCA 1VFMA 5DSCB 2PN5A 5AD0A 1BVKA 1YN6B 2YD1A 4XWGH 4I0CC 1BWMA 3NCJL 2O5ZL 3CX5J 4HSQA 2VXTL 3CU1A 2X4NA 4GRMB 4O58L 1YNTB 4OLEA 1WK0A 3U6RA 4Y16B 1U93B 1P69B 1JTTA 5J13C 3GSRA 2VQUA 4OD2A 4XXDB 1RJLB 3DXAE 3I02A 4KGLA 5HYFA 2Z4QB 4PLOB 5I1AB 4PYGA 3FT4B 2C4XA 4YWGL 4M02A 4R7DB 2R1XB 5GHWL 1ED3B 2EEAA 3LY6A 1QO3B 4P4RB 1VERA 1WBZB 1ETZA 3TPUB 3QFDB 4YQXH 2F8OA 4U2ZA 4LPWA 4Q9BA 2P44B 2XFXB 2YWYA 1ZHBA 4FG6C 4JDVB 1MLBA 3LV3B 5IF0B 1U2HA 2UWEB 5I1GL 4ONGL 2Q20A 5HPOA 1WISA 1GGIL 3MLUL 4FXKB 4DTGL 4X98B 1T66D 1FL6B 5F9OL 1MQKH 3VG9B 2F5AH 1T21B 5D1ZC 5EBWA 1WFTA 4HIEA 4UV7L 1ZGLA 5CZVH 2NXYC 5C0BB 3TBWA 3PP4H 1N64H 2MQ3A 4UQ2A 4PP2A 2OI9C 4KKBD 4LL9A 3UTTB 2YPLA 1XCTA 4WIQA 2BC4B 2EDKA 4LKXA 3U9PH 5I15H 3S8WA 1MJUL 2XICA 5FKAB 1NKOA 2DQEL 2OTUB 2JJWA 2QADB 2CGRL 5I71B 4ISVA 1CL7L 2V9TA 2IAND 4PRID 3V6BR 1JGVH 1RURL 4UB0L 4GKZA 3QXWA 3INUL 2BNUB 2MMXA 1HI6A 2ICWI 3PWJA 1FZMB 1QLRA 3L3KB 4HGKC 4DJMA 5L0QB 4G80A 4JQVA 4RISH 1RJZA 4FXLA 4X9GA 4YPGB 3VGGA 4QCIB 1VFBA 3X3FL 4RWYH 3ULVF 1I7RB 1U92B 3EKCA 2ATPA 3EHBC 2BOCB 4MD0A 3CX2A 1UA6H 2I07B 1UB5B 4OCRL 1A22B 2CK2A 3P0YL 1HE7A 3IDGB 4OZHE 1S3KH 3GSNH 1DBMH 2CR3A 3C09C 2HJFA 1D9KA 2PW2B 4F15B 5JDJA 3S97C 4PY8J 3HFML 1GAFH 5D5MA 1D5BA 1N2RA 5K9QG 2O5YL 1MCLA 3MRCA 5C8JB 4YC2C 1G7LA 3F65A 5ANME 3MLXH 1FGVL 4PD4J 1P1ZA 1C7TA 1ORQB 3I75B 4Y19A 1GC1H 3BKCH 5IMMA 3VWKD 4HLJA 1HCFX 3ARGD 4GBXC 4PRAA 1NGXA 5KSAA 1JP5A 3T2NH 4X80L 3PGDB 3ZHLA 1AIFB 1CD1B 1INEL 1W0WB 2DIJA 2E8ZA 1BD2D 4M3KB 4PY7B 4K23L 3QXVA 2B0SH 1KPRB 1MCPL 5DJCB 1OAUH 4TULH 2E9WA 3GSWB 4PLJC 2HJLA 1F8TL 4JN2B 3C6LA 4ENED 4V2BA 4CW1B 3NFSL 2Q8BH 1FNGA 4NO5B 3R0NA 1JHLH 2E9BA 3OBAA 3PXHA 5CJOH 5FYJD 5EBMB 4LOUD 1EO8H 2XNAA 3DMMC 3DBXA 2C9AA 2IANB 4PRIB 4MHHG 5DRNA 5D8JL 4BM7A 3MSPA 4Z5RA 1E6OL 5KOVC 4E41A 4HT1H 3TZVC 1KACB 2XACC 4JQXA 1S7WB 1M6OA 4LMQI 1N6QL 3LEYH 3RAJL 5JHDA 3QUZC 1JTPA 4XNYL 3GEWB 2OMNA 3PWPA 4X5LA 1B6UA 2EZ0C 5JOPD 4MNGE 1IC5L 1GGCL 4EZMA 3PHOA 2O5ZH 2VXTH 1DBBL 3ULSB 1C8PA 4DWHA 5JORA 3RQ3A 5C70A 3VXNA 3GMQB 1JYNA 8FABB 1AGFB 3ZTNL 4G9FD 4J1UB 1KULA 3SKOB 2F19H 3IDIB 4Z7VB 1FFPB 3ZE1E 1CE1L 3LKOB 4QRPE 4C83B 1SJVA 1A6WL 5H2BA 5GXBB 3GMPA 3FB7A 4R97B 4YWGH 1TMCB 3VWJD 2P47B 3QA3A 3IDNA 1AD9B 2BJML 4TVPD 3O3AB 5KSVA 5DUPL 4PJ9A 1PDKA 4L3CA 4U6TA 3ARGB 3SY0A 4QYOB 3WUZA 3NA4A 4MDIB 2R29L 4I13B 3MNVA 4P5KB 1BD2B 4N90D 1R3HA 3V2AR 4KMLB 2PUQT 4G8FB 5I1GH 1HH9A 1ERNA 4YDIH 5FB8B 4OCYL 5GRVL 1GGIH 5E24E 4P2OC 4HBCH 1I1RA 3DYOA 3LZFL 4UINL 4DTGH 5D7JC 5HYJB 4OB5L 4KGJA 5F9OH 3LS5L 4YHOL 1NCDL 2UVEA 3HE7A 3ARQA 3FB5B 4I2XE 4UV7H 2P24A 3B6SA 4ZUUA 2NY4C 3PABA 1YUHA 2RR3A 3RA7H 1G9MH 3MV7D 3FHQA 5K9KB 5EPMA 3TH4T 1U91A 5T5FL 2HLAB 4LHUA 4WNQB 5D7IE 1H5BA 3MRDB 1MJUH 1LEKA 4Y5YA 3GJFA 4HAFA 1W72B 5C92A 3O6FA 1AGEB 2X6MA 3EYQC 4OSUH 4IHOA 1CFQA 2CD0A 2EXYC 2HP4A 3X17A 1RURH 4PRBA 1DQDH 1EMTL 3TO2B 4LEOB 1UWXK 3INUH 1NEZB 3AS0A 4CDHA 4CVXA 3KPPB 1A3QA 2FYYB 2WWMD 5C3TA 5ICYA 4OZGA 3X3FH 1F13A 4O51B 4G9FB 4C57C 1P4LB 5JO5A 1P7HL 1BECA 2X4OB 3MGTB 2QKIB 4OCRH 4M61A 3S35X 4NBYB 5IBTL 2XWJB 3FAXA 2Y5TB 1E28B 3CSPA 4N8VG 1HOCB 3LIZL 5KS9F 3V6OE 1CG9B 2F8XC 1GRWA 1YEGL 3V5DA 3VWJB 1RZFL 2I9LA 1WBXA 4J8RB 1QSEA 1CDGA 4MCZA 4NCDA 2FL5B 3UBXB 4RMTA 1EERB 1CS6A 2ORBL 3K2MC 3VXME 2QSCL 3AROA 3HFMH 2YUZA 3S5LG 2EH7L 4PJBF 3VH8A 2LVCA 4YR6B 1I9IL 4YDJA 3VRLE 4PGCA 3UJIH 4O2FB 1F4HA 1A1NA 4RX4A 4XPAL 5MEOA 1FGVH 2G9HB 2NW2A 4YDKL 4LCYB 3DSFL 3QIWC 5EOTB 1S7XB 1MH5B 4OTXL 5CLTA 3RWCA 4HDIB 1FN4B 4PRHD 4PJGF 1R3LB 5J4MA 1NKRA 4K23H 4PTUB 4WFHD 1YYLH 4BSWB 3VXTA 3CFDA 3LKPA 2EEDA 5I1EL 3CFKB 1ZHNA 3QDJD 1DLHA 1K8DB 5K9QI 1LO5B 3BE1L 3NFSH 1KIRA 4I5BB 3WFZA 1JI2A 4OFVA 5D6CA 1OM3H 5LJYH 1OQXA 2GJZB 1IGML 2AKRA 2DQDL 3V8OA 4KQ4H 1PW3A 5I9QB 4LAQL 4JJ5B 1FPTL 4M43L 5ACLA 3QXDA 5GSRA 4FNLL 3LN5B 2HH0L 2BSRA 3WEXB 2MPAH 3RAJH 2L7JA 4OD1H 1K4CB 3BKJH 2BNRA 1MCBA 4PTTB 4UT9H 4CNIB 1ZLVH 2JCCA 4OCMC 1GGYA 1MFCL 1AO7D 2ARWA 3EFFB 3TIEB 1IC5H 1GGCH 3UX9B 3GMMA 4PJEF 4U1IA 4TTDD 3P4LA 1DBBH 1HWHB 1TQBB 4GKNA 3ROLA 3LKNB 1HQRB 3FONB 4HW6A 1GPOH 4FABL 2ID5A 1FZKA 1OAXH 4MHHI 4BH7A 5HPMB 5DWUL 1A6WH 3ZT7A 5DJYB 1NFDA 5B8CB 2VAJA 1CFVH 1G6RH 4F7EB 3P73A 2R4RL 1YJDC 1BQSA 5AAMA 4DCQA 3T1FB 2BJMH 3MROB 2P8PA 5J1AB 3IJYA 1TIUA 4XB8A 5HGDA 2YPVH 4X9FA 4P5TA 1U6AL 3VJ6A 2CDFB 5E8NA 5IMOA 3MR9A 5I66A 5CBAA 5H35B 4D9RD 5JNYA 3VXUE 1XH3A 3KR3L 1A2YA 4HUWB 2D7TL 5FYJU 5DT1L 4OCYH 5KSAD 5T3XD 4HGWB 3BVNA 3VFGH 3ZYZA 5CCKL 3SGJC 4AT6A 2V17H 5I8KH 4OB5H 5DI8B 4YHOH 2RJMA 3NBNA 4JZNB 4ERSH 4JZJA 3PWLB 5CSBA 2Z8WC 2Y23A 4QRQB 2VLJA 5GGTA 1SBBA 4GG6F 3U7YL 4EI5D 2YD9A 4RMSA 1FAIH 3X3GL 5T5FH 3DX6A 1BIIA 4ZFOA 2CMRH 1ZA6A 3VD5A 3BHBB 3MNWA 5F7MC 2ZPKH 4Z76B 4WW1B 4FQJL 4MJ6A 5HDOA 3PL6D 1AKJD 3C5JB 4NQSB 1G7PB 2OXHA 3NFPA 1J7VR 2CDGA 2AW2A 3I6LD 1JYXA 1I7UA 2VDML 4XC3H 4ELKA 4GKOA 1AO7B 1K3ZA 3OAYH 5FGBA 1YJDL 3PV7A 2FJHB 5CJQL 5CIPH 3VXOA 3PWPD 5IV2B 1IKFL 3CC5B 3D85D 1NAKL 5ESAA 4RFOL 2VE6B 4MS8C 1WIUA 3QI9C 4XMPL 1PG7L 1IQDB 5IBTH 1HYSD 2Y36H 3BZFB 2J6EL 3LOWA 4XVUC 1DE4A 3MJ8B 1JN6B 4C56B 2PO6D 4KQ3H 1BZ9B 1YEGH 4WFEE 1RZFH 3UTZB 4OIIL 4QRRA 4JRYE 4QXTB 1ZT1B 2BHYA 2DLHA 5JXEC 2ORBH 3TGXA 1JNNH 2OSLA 4XBGA 2QSCH 1QFUH 4XGZB 1G7JB 5DLML 1P53A 4EIZC 5BMFL 2WQ8A 1I9IH 4NHUB 5K93A 4PJFB 4UAOC 3P9MB 3TA3D 2DI9A 4PP1D 4WFGD 3CXDL 1G6VK 4H0IA 4XMLL 5T5NF 1A1MA 2NY3B 4XPAH 1AD0A 1PEZA 5FK9A 1ODAA 3DSFH 4WTWA 1UXSA 4OTXH 1Z0NA 2E7LA 3V0VA 3FQXB 2YRPA 3DUSB 3LRSA 3GNML 1XR9B 4R96B 5IBUB 5DVLA 4HKBB 2XPGA 3BDYH 1OP3H 3WIHL 2EIEA 1ZV5A 1XGRB 5IW3A 3SE4A 2I9TA 4X6EB 2FIKA 3ISWA 5I1EH 4EI5B 3BP5A 3UTPE 1DFBH 3RKPA 4KMQA 5CEZL 1VESA 3PJSA 3BE1H 4WW2B 1TZHA 3MRPB 5K9OA 4F7PB 4EUPA 3HUJE 1A0QL 4PRDB 3PL6B 1C5DB 1AKJB 1U8PA 2DQDH 3PDGA 5GZOD 4L4JA 4U6VL 5E1AB 1PKOA 2XV6B 4GUPB 4PJXF 4M43H 5HYSG 2WBJA 3D18A 3KPSA 2Q3AA 3KLAA 5IVXA 4B0MM 2NNAA 5EU6D 8CGTA 3O6FD 3QCTL 4XPFH 5CMAA 1Y0LA 4J3UA 4W4NA 1XGPB 2FEEL 4PREA 3OX8A 3I50L 1FH5L 5FKPB 5GGRB 2DIBA 3JUYA 3ZKXC 4IBLT 1MFCH 2ZUQB 1Q9OA 3WV0A 1Q38A 2X41A 2PO6B 5IJVB 1IILE 2AEQH 5IFAH 2GQHA 5C0JA 4N0RA 3MRJA 4GAYB 4U05A 4Z7UB 2HMID 1UQSB 5GRVK 1MFEL 5DWUH 4KKCD 4RGNC 4M8QA 3RTQD 3CJJA 3TA3B 2R4RH 5B38A 3W0WB 1OW0A 2E27L 4QT5A 1WIOA 1TCRA 1R5VA 4S0TD 2LU4A 3IDMB 4TUJA 5CWSB 2DJ4A 3VFUB 5DJDB 3OKLA 2OTWA 5IJKC 4PJIB 1A47A 5T1MA 3X14A 1OF2B 2WQRA 1D5ZA 2VLRB 5C09E 3C8DA 1KB5A 2VABB 4PG2A 3RGVB 4WV1A 3KR3H 2AV7B 1K4DB 2D7TH 1CVRA 5DT1H 2FHCA 4F9PA 4R0LC 3HPLA 1JWSB 4X6CF 2PCPA 5HHNB 2FX7H 4OZFB 3TPKA 3EBAA 1UZ8B 4HXAL 4RIRA 1X5FA 4AL8L 1CE6B 2EE6A 4IRJA 4D0DB 1II4E 4R90H 5HJ3B 3UTSB 1KTLB 2EDTA 3RY6C 4MX7B 1SM3L 4PJ5E 4OUUA 3U7YH 2CSPA 5AEAA 3GRWH 4PRPE 3X3GH 5MP6L 3REWB 5FOBB 1FCGA 1XGUB 5CGMA 4EVNA 3ARED 4Z7QF 4HCRH 4HXBL 5EU6B 1YMME 4FQJH 4JO2L 4I0PB 2GTZA 2DDQH 1A6TB 4IJ3B 4OFKA 5DQDH 3EYVA 2D7MA 3QQ9D 1YJDH 5DRXA 2Z93B 1U41A 3C9NB 1P5UA 4LVNC 3C5ZC 4XP9H 1ZVYA 5E9DD 5CJQH 4HPOL 1CQYA 2P5WE 3TH3T 1IKFH 3JWDH 4OGXL 1NAKH 1X7QA 3ZKSD 1PG7H 4KK5C 3F6LA 4R2GD 3G5VB 4LPYA 1QYGL 1SEQH 2FJFA 4NCC2 3RTQB 5J11C 1L4IA 3DTXB 3V4VL 3KPRA 4OIIH 4H20L 5C0DB 4ONFL 3SDAC 1DANU 2VZVA 2HFFB 4PJHF 2BNQE 1PAMA 5I18H 4FFVD 2HVJB 2APBA 4PPTA 4CVZA 5DLMH 4Z7NF 4AENB 3ALXA 3FQRB 4YK4B 5CEZE 3TCLA 5FA3B 3LMJH 3AS2A 4XMLH 2F54A 2DL9A 5C6TL 2VDRL 2BZDA 3SO3B 1DQQA 1AGCB 2P48B 1RFDL 4E42A 3KHOA 1Q9WB 5DD5L 5HI5D 4H8WC 5D6DA 1Q1JL 5F7NC 3MRFB 5CSGA 3BH8A 1FVEB 1AE6L 2Y07L 4M93C 4K7PL 5D1XA 2HVKA 1F58L 5GJSH 1Z3GL 3WIHH 3QJHA 1QBLL 5E8OB 2H41A 1M4KA 5KVFH 4IEFB 4LVHB 5D9SA 1T04B 3ILPA 1JHKL 4G7VL 5CEZH 4IRSC 4JFXB 1QSZA 2ED7A 4NQEB 4NYLA 2A0LC 2EE2A 4QGTA 3AREB 1ND0B 2AI0H 4LLYA 3VW3L 2XY2A 4LIQH 4JFFE 1J8HD 1QLFB 4S1SL 1A14L 4LCUB 5F72S 3FO9B 2A74B 1FZOA 4J3SA 2VDNL 2Y9RT 3B9EA 3HI1B 4X8XA 5L2KA 3WFBH 3ARFB 4U6VH 4M1DL 3DVGA 4L29B 4O00A 3RWDA 3SJVD 3VXRA 1SQ2N 2P8MB 3V6ZB 3QCTH 3IETB 3C60A 4XTRD 3QUKB 1KC5L 5IIEB 1FH5H 1GIGL 1KBGH 1KXQE 1IL1A 4PB9L 4XP4L 2VIRA 2CKBA 3H6JA 5EOQH 5EC1B 5ETUA 5GS1B 4GAGL 4U1JA 3AM8C 4XCYA 3RJQB 3RWGB 1JZ5A 4X6DA 1OARL 3UTOA 3Q0HA 1VEMA 1YEIL 3WJLC 4H8WL 3O3UN 3GMNB 4NQDA 1MFEH 5F1IA 3WIIL 1IE5A 5CS7A 1SMAA 3W39B 4U1NB 4Y4HC 7CGTA 4NQXB 4HH9B 4QRRD 5I1DA 4OV6F 3TFKD 2IMNA 1AHWC 4H0HB 2QQNL 1S78C 4PV8B 4G8IB 1FNSL 4WWKC 4ZNEE 3RWJA 4FQPA 3SPVB 3KGRA 3KXFA 1FLRL 4GW4B 1MOEA 5DUBA 3AAZB 4H26B 4X4MA 3FRUA 4JR9L 4LSDA 1HK6A 1T0NB 5EO1A 1X5JA 1YEJH 2ZJSL 3TN0D 5BW7A 1RUKH 1HXMA 3BO8B 4N1CA 4FMKA 4JM2D 1KENL 4NO3B 2J5LB 2AJZB 4ZO9A 1DN2A 3T0EC 5SWZE 4RGNE 1U8QB 2H32A 4MD5A 4YGVB 4HV8A 1WZLA 2Q86A 4AL8H 4QOKA 4PJ7B 2BRQA 1J8HB 2NY1C 5CEYA 4PGEA 1SM3H 1U58B 4EEEA 1S5IL 4RMQA 3DX8B 3FOMB 1MREH 1U8LA 3HE6C 5MP6H 3SJVB 4X7FC 2E7HA 3WKML 4U1SA 2V2WA 5EULV 3GMOA 2R39A 4JO2H 3BZ4A 3WHE0 4CRPA 1NC2B 4DK6A 1HH6B 2M8XA 2YSSA 2ZOKB 1FYTD 3ESUF 1ZVSA 1JGLL 2AXJA 2R1WA 2IPKB 3KPSD 2J2ZA 4GFTB 4XHJD 3DGGA 5DURD 5C9JB 2H26B 4GS7C 3Q6GL 3CVHB 1KCVH 3QWRA 5DD3L 3KWWA 2HFGL 2F5BL 4OGXH 3WLBB 1FDLH 1OGAD 1X5YA 1CFBA 2YRZA 3L1OL 3PWUB 3ZKNC 4F7TA 1B0GA 3GHEH 4MNQE 3BRFA 25C8L 4OZIA 1QYGH 4U6HB 4A2MA 3K80A 3QAZB 5F1NB 5F89A 2R9HC 4UDUB 3C5SA 3B3IA 1B6DA 4EDXA 4Z78A 5DK2A 4ONFH 3JV0A 1PVHA 4AEHH 2AGJL 4G6AD 1XGTB 1EHLL 2VXVL 3GSUA 1AY1L 3M07A 2Q6WB 5HGHA 2OQJA 3VFMB 4HC1A 3FQTA 5IVZB 3GI8L 4GW5B 3QFJA 4O4YL 5TH2A 2F53A 3LS4H 4L4TE 1YQVH 3TN0B 3IJSA 4Y4KD 1PKQA 4JRXE 2VDRH 4APQD 4RBPK 2IEPA 1RFDH 4KUCD 4LP4A 3UC0H 1XF2A 1Z5LA 3TVMB 1Q1JH 3MO1A 3B9KB 2ITDA 5ISZA 4UT6L 1ZTXL 2WP3T 1RQ5A 1C16B 1EAPA 4K7PH 5HHMB 3RNKA 4N0FA 2H2PD 1F58H 1Z3GH 4XAWH 1QBLH 3BZDA 4OFPA 3GIZH 4HIIA 3FO1A 1WEJL 3VRJB 4P9MH 3MFGB 2W38A 4Y16C 3HZVB 4MQ7A 5BVJA 2NR6C 1BGXL 5E0QA 3L3GA 3VW3H 1RU9L 3OKKB 4S1SH 4X4XA 1JZ3A 3EO1B 1FYTB 2VDNH 4QRUA 4JFZL 5ELIA 4M1DH 5SWSE 2OS7A 3NFNB 4EI6A 4NWUH 5SWQA 3U46B 4O2EA 3QEQA 1T7ZA 1DBAL 3QWQB 1I9RL 1A9BB 3HMXL 3N9GL 1KC5H 4XNZC 1NCCL 1GIGH 3WN5B 1OGAB 4PB9H 4G6FB 4XP4H 3TNNB 3HAEG 4WU5B 4ZXBD 1I8MA 2P7TB 3QUYA 1YMHB 4Y1AE 3HAEH 4MJ2A 2R2EB 3DX9B 1C7SA 2PR4L 2VITA 4TOYH 1T7WA 1JPSL 1YEIH 4EXPX 4H8WH 1AQKL 3UYPA 2ADFL 3SKMA 2Z31D 5D7LD 3WIIH 3FQUA 3QEGL 1XCQA 3KPRD 1GSMA 1B0RB 4XVSH 1KCSL 2QQNH 1KT2B 4KTEL 1FNSH 1QRNB 1A4JB 1K85A 1TTFA 1INQA 2UYLA 4HFWA 4LNRA 4RDQG 4I3GA 5IW1B 4P3WA 3BEWA 1FLRH 1M7XA 5HDLA 1OOAA 3WL9B 3GB7B 1AI1L 2QADC 5I71C 1T5XB 2Z8SA 2W65A 4EBQL 2F54D 2ZJSH 3L5JA 1S9XA 1I7TA 1KENH 5L0QC 4AIZB 3SGDH 1DQJA 1SHMA 3LN4A 1I1YB 4P0DA 1HNGA 4HS6A 1YPZF 4XCEA 3DWTA 4LCWD 3ZE2F 3WFHB 2OL3B 5E8DH 3MXWL 3R06A 1P7QA 2WP3O 4HJGA 2FH8A 3JVGA 1DVFD 2VC2L 1MHEB 3GSNA 3DHJA 3RIAK 3TWCH 3VGAB 5DJ8B 1IAIL 1S5IH 1U8MA