3WD5H

Crystal structure of tnfalpha in complex with adalimumab fab fragment
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
214
Chain Sequence
EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDYADSVEGRFTISRDNAKNSLYLDMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of the inhibition mechanisms of adalimumab and infliximab in treating tumor necrosis factor alpha-associated diseases from a molecular view
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Tumor necrosis factor
total genus 41
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2013-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wd5H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wd5H01
1FLRH 2WM0A 3TV3H 2YWYA 3HE6B 1AO7E 4V1DA 4NZRL 4GLRH 4CU8A 5JIKA 3TBWB 25C8H 3PL6C 4P59L 1MRFL 2GJJA 4AJ0A 4PRBA 1IGYA 1JVKA 4FG6D 5DEGB 4OBRA 5A3ID 2YPLD 1MI5B 1IEBB 3CZFA 4YXLH 1N5YL 5IB4B 1MJ7H 1CDJA 1HHIA 2L7UA 4UOW1 4C56D 3O4LE 1X5HA 3QO0B 2APFA 5ADOL 3GMOB 4DVRL 4Y5XB 3TBWA 1PEWA 4OCNC 4NN5C 5D9SB 5JO5A 4PRHA 4NRZA 1EJ6A 3QPXH 1JF1B 4KDVA 4KI5D 5MHSE 4B53A 1QTYT 3WUWG 5FM5M 5T5NF 2NTSP 2J8UA 3ARGA 4Y4HB 1J1PL 2AK4D 1MAKA 3UTPD 2OK0L 1EPFA 2COQA 5KZCB 5IJKC 5KSBF 2XKUA 1N8ZA 5E24E 1DBAL 4Y5VB 3BMWA 1A2YB 3GSWB 1ZEAL 2VNCA 5IGXH 4UT9L 1QSFB 5KVFH 2RB8A 2OR9H 3MV11 1G7PA 4JG1L 1OTUC 1LO3H 3RZCA 1A14L 3TO4B 4WEMB 3QUXA 1NJ9B 4F57L 1FNSH 3AREC 3PWPB 1TFHA 2G2RA 3TPKA 5D5MB 4D2NA 2ATPB 3STZB 1YNTB 4PV9B 1T5XB 3PQYB 5F6IC 3HI5L 3QWOB 1FVEB 1S7VB 4TOYL 2ZOLB 1OAZL 3BD5A 5HHOD 1CZ8H 4PLKC 3DGGB 4Z7VB 4ZTPL 2VZVA 4R96B 4YDIL 3G5XA 1NC2B 2I07B 1FG2A 5JOPD 2AJVH 3KJ6H 4X98A 5IJVA 1CG9B 3SKMB 1BZ9B 3L3JB 4FRWA 1KBGH 2CDFB 5DGRA 5DUBB 5JW5A 4PJBE 1WC7A 2FIKB 3CVHL 3O11B 1EH9A 3VXUD 3RVTD 1JHTA 1FH5L 4PV9A 4TNWF 1MCDA 3EJYC 4GW4A 3HZKB 1LE9B 1QSFE 1R3JB 4OCWL 4Z18A 5I1LA 5DVOA 4LASH 3PXHA 4ZUTB 4AG4L 3KPPB 4UAOC 2OL3H 4M7ZC 3EYOB 1Y0LB 3DX7A 4IEFB 4RMSA 5GRVK 1IKNC 4OCWH 1AXTH 1NBZA 5FYKU 5DJDB 3TN0C 3U4EB 3KXFB 1S3KH 3MRKB 2D7TL 3LS5L 5SWZA 1BPVA 1FPTH 5IBTL 4DZBB 3BVNB 3TZVC 4Y4HC 4Q58C 3U2SA 2Q7NA 4R90L 4RNRB 2H8PB 3W0WE 2AJ3A 4ODVL 5HY9A 4U1LB 1ZHBB 1TVHA 3ZKMC 1I7ZB 3ZE0E 2IH3B 1FG9C 1ZGLA 2XZQL 3LKQA 3V5HB 4APQD 2Y36H 3MRLB 4KJQD 1T0NA 1GGBL 3HUJA 4ZQKB 2IWGA 1NUNB 2R0LH 2FX9H 4DUWA 2NXZD 4G9DA 3I6LE 4PTUB 4MWFA 2GJZB 4HFWB 4N0CC 4MCZB 3E8UH 2XWBA 2DKMA 2X7LA 4U3HA 3X11A 1JGEB 4UUJB 5FO8A 5T3XL 5B38B 5D1QA 1NMCB 3AB0B 5C0CE 1GIGH 2Y06H 2G2RB 1U8LA 3B8SA 2ESVE 5ETUA 3MRGA 3AS2A 1MHEA 5T1KB 5BW7A 3SHSA 2E27H 5IHZB 4XP6H 3T8XA 4R0LB 2P5EB 5HPOA 4I0PB 4PJHE 3VD5A 4UUJA 4NQDD 4PREB 4EIZC 3MRDA 2KZWA 1PVHA 3Q3GA 2E3VA 4XPHL 3ECBA 3TLRA 2WWMC 1ZSDA 5IMMA 2CDFA 4KXZI 1YEEH 3RQ3A 1N5AB 3HC4L 1A1OB 2J8HA 2FATH 4NO5A 5BXFB 1AH1A 2V5MA 3JV6B 4LEOB 4IMLB 4FZEH 1I1RA 1J10A 2V6HA 3KPRA 1OAYH 2ZJSL 4HD9A 1ZVHA 4LRIA 4XPAL 5JR1H 4LIQH 5EA0H 5IMLB 4NJAL 3QNXB 2YKLH 3MRDB 2A6DB 3IAGC 1FL6A 4JFZH 1P7HL 5CWSA 2DQCL 4ALAH 1N5AA 1I8MA 1RVFH 2ZSVA 3IXAB 1VEMA 2X41A 3DRQB 2V2XA 3S96B 3U7WH 5LWYH 1RIHH 1CDCA 1E6JL 4ISVA 1OGTA 4O02H 3HI6L 2GHWB 3GMNB 5F71A 2YZ8A 4NFCA 3REVA 4P23D 1RUML 3GJFK 2NY4B 3RNQB 2NY2B 1CT8A 2IQAB 4KUCD 1GGTA 32C2A 4JVWA 4NDMB 3ZHDA 3SBWA 4D3CL 2GI7A 5ITBL 2DAVA 4U6XA 4ZYKB 1BD2E 1N26A 3WJLC 4JY5L 5E6IA 2BC4A 2ICCA 3HB3D 4AL8L 4Z5RA 3IVKB 3MXWL 2AEQL 2VSCA 3M8OH 3O8XD 4M3JA 3BPCB 4XWGH 2ENYA 4LK4A 5ISZD 2PXYC 4KTYA 3X11B 1QSVA 1AQKL 4HK0A 4UV4H 2WV3A 2YSSA 3BWAA 4GRLA 5E9DA 5IV2A 3QZWG 4JQVC 4P23A 4DN3L 4L4VE 1MWAB 5E2TH 5I74C 1HYSD 3ARFA 5I1AA 5IB4A 4DGYL 3ARXA 2F54B 4EOWL 3CDCA 3BEVA 3X12B 4GKOA 4QRQB 5EC2A 3D39B 2ATPA 1I7TA 1P7QA 2DMBA 4MA7H 4CU6A 2CUIA 4UU9A 2VDQH 4ZFOL 4WW2A 4XVUC 2VKXA 3BYYA 1U2HA 4Y4KA 1AQKH 5EBGA 3RWHA 2YRPA 3PWJB 3TVMB 3MBXL 4P4RA 3QBTB 2HT2D 35C8H 3Q3GB 4BKLA 2XIDA 1A3RL 3BGAA 5F93C 1V5JA 5BS0D 3ARED 5DFWH 3T0DA 2W60A 4NO5B 5T3XD 4GBXA 4OZHE 1JNHA 1FNGA 1NAKH 2J5LB 2ZNWA 1GCFA 1FIGL 2UYLA 1NLDH 4XX1E 4FQQA 1KXQE 1ZHKA 2C5DC 4PJEA 2HRLA 4E42B 5KTEL 3BAEL 4JFEA 4UI2A 4DK3A 1ZGLM 2W9EL 2ED7A 2ZG2A 5MEQB 4NCC1 5L8LB 1WAAE 3FFCE 3KPNA 2X4TA 3VRLF 1Y0LA 3DX7B 1MF2H 1A9BA 4M6OH 4L8SB 2R23A 1OQXA 4OFIA 1FVEA 1GOFA 1HQ4A 1Q94A 1MIEH 1ZT7A 1AR2A 3QEGL 5KSAD 4R7DB 5I1EH 5ID1A 1CVRA 3BH9B 3BKCL 1DLFL 4DVBA 4NC1C 3R06B 4C57C 4KU1A 1AIFA 1MJJA 1YEKL 5IB2A 4P4KA 4XPGH 3EOAB 4FQ2L 2DQIL 3H7BA 1DBKL 3O3EB 4JPVH 1E0OB 4GG6E 5EN2B 1VCAA 3HC3L 4Y2DA 1S7TB 1MCPL 4JDTL 1JZ4A 3PL6D 4UIKH 4Z77B 1EV2E 3PGFL 4OLUL 5L2KA 2FZ3B 1UJ3A 3R06A 4OM1H 3INUL 2ARJB 4L29B 2P8MA 2ZUQB 2EDYA 3WDIA 4LKCA 4QOKA 2VO5A 3JWOC 2VE6A 3U4EA 4NNYA 1H3TA 3A6CH 1T89C 4NQUA 2HJKA 3WLWD 1KJ3H 1RZJH 4FFVC 4PJIA 2D0FA 1P4LA 3H7LA 2HT3C 5C0FB 1TXKA 2AEIT 4WI8A 2BFVH 2R1WA 4XGZB 1DQMH 5BO1H 1KLUA 1U3ZA 1OAQH 3QFJD 4Q0XL 1T2QL 4HF5H 5IFAH 3FJTA 3D5OF 5TDNA 1L9NA 1MIML 2ICEB 5E5MA 4G8GD 3VWJC 3D69A 1BVZA 2M26A 2NY1B 3ZDXF 3LD8C 5CD5C 3OJ2C 3ZYIA 1GSMA 2A2QT 4BH8A 4MD4B 4S10A 3KHQA 4J7RA 3D1MC 2JF1A 4OD2B 3OL2A 4JM4L 2NY0C 5GSVA 1D5MA 2PW1A 5HGGS 3V7AG 1ZHLA 5K9KB 2Q20A 5E5UB 4K3JH 4TUOB 2WZPD 5SV3A 5I73C 1FC1A 1QLEH 1K6QL 2R56L 3FCTB 3WNOA 5CHNB 1JYWA 3MNVA 1KJ2H 1EEZB 2HFFB 3IFPB 5EPMB 5I8KH 4PUBH 4WDIB 4Z7WB 5GGUA 1Z2KA 4K8RD 3I2CL 2R1YB 1KYOJ 1W8NA 3BMVA 1IGFH 4G6KH 2ZCKL 3ZT6A 2DLHA 3BDBA 4BH7B 3JWOL 3OPZH 1W2KT 1YDPB 3A6BL 3GRWH 4LLMB 1IAMA 3TH4T 3VFRB 2AEWA 5DJYA 2KZ1B 5C6TH 2I60L 1U8NA 3ZL4H 3D0LB 1AGEB 4HV8B 4BZYA 2F19H 1MH5A 2Q8AL 3CH8A 4U6VH 3VGGA 3OKYA 4PGDB 2FB4H 4PRIE 4W6WB 2QHRH 3P77A 4EBQL 3QO1A 4JFPB 2PYEE 1CICA 1K5NB 2HRPL 2ITDB 2AXJA 4YQXL 3EYQC 3ZDXE 3ZSTA 3MV9B 3HAEB 2YS4A 2ICWI 4F8TA 4DQOH 1IM3A 1M71B 4LF3A 2B7DT 3NABH 4QHNB 4QXGL 3QHZH 1IE5A 3LQAC 4XCNA 3U1SL 3FQUB 1HH6B 1SEBA 5KVFL 4CDHA 1RK0A 3VU2A 4ZS7L 3RWHB 5FIEA 1QQDB 1WFTA 5D70H 1YECH 2NQCA 2QQNH 3NIGE 3NVQA 4JM2B 1KIUA 1CFSB 3VGFA 3PWLA 3FFCA 5SX5H 4MXQD 4XC3L 4XAKE 1YEIL 4MNHA 1T22B 2LU3A 5LAXA 3QPXL 1F8TH 2VABA 2DRUA 4K8RC 5DR5H 4IJ3C 5K9OA 3MV7E 3QWRA 1CFVL 5T1DL 1U3HD 4MVBD 4WGVB 2DI7A 1KEGL 1U91A 3BGFC 4GG8A 4TUOA 4XT1C 4KUZL 2R8SL 5ITFB 5EBLB 2SEBA 3ARYA 1ZS8A 1RU9L 2P7TA 4JN2A 3FO0L 3CH1B 1R24A 2AEPL 2JB6B 5TF1L 1OWWA 4YHOH 2GKIA 3V0WH 4OCMC 3GK8H 4GS7B 4GG6F 4EUPA 4MA1B 1AC6A 2Q76A 4Y1AD 5I15H 3KDMB 4HW6A 4RGOH 4HXAL 1N2RA 2F5AH 5GGVY 5C0AA 1LDPL 2V7HA 5A2JH 3QHFH 4QKXB 3V52H 1Z9SA 3QDJA 2HKHL 1BREA 3GJFA 3ES6A 1OPGH 1EFXD 5D7IE 2Q6WA 3BRGC 2UYLB 3MBEB 4UT6H 1YEJL 1Q1JL 3OKEB 4CN6A 2WLYA 4HFUL 1JTPA 2AEPH 3IFNH 1HHJB 1I8LC 1KIQB 2FEDD 1OD7A 4PGDA 4F7TA 5GZOD 4X9HA 4GO6B 5EORL 3V2AR 1FP5A 4ONHA 1GGYA 4HZAA 2I27N 2P42B 4N0UB 1KN2L 1ZK9A 3E1F1 4Z7NF 3QJFA 4FFVD 4LKCB 2C1PB 4O4YL 1G7MB 3WLWC 1WTLA 1NANI 5EUOF 3MUGA 4GJTB 5L88L 2EDDA 4OCSH 4OZHF 4OZFB 5E94B 2NNAB 2NYYD 1IGMH 1A3LH 4HT1L 1L7TL 5FA3B 3RL1A 2QEJA 1UZ6E 2CD0A 3E6FB 5H8DA 4KDTC 4G5ZL 4N1HB 5E2VH 3WXWL 1OCWL 2BY3A 2FJGA 4IRSB 3S5LA 4XBGA 3CFCL 1A6AB 1LD9A 4I2XA 5EU7C 3U1SH 1ULVA 2ZP0T 4UTAL 3BVNA 3HZYA 5FYLL 1Q1JH 4UT6L 4D8PA 3BP4B 4JVPA 5A2IH 3I6KB 4KV5E 2CIIA 3QG6A 3VDAA 4JFQB 4PYGA 1IAIM 2BCKA 4AIZB 3QHFL 2EH7H 4YNYB 4HX1A 1IM9B 1LDPH 2CLZB 3OHXA 3OKMB 4LP5A 5ICXB 5KSAC 1DQJB 2GITB 1YNTA 5I15L 4L4TD 1V7NH 3KXFE 2KQNA 3OWEA 3HKFA 4JO1H 1A8JH 1SJEA 4P49A 4QGYA 1JGDA 3K8KA 3DUSB 4JO2H 4PS4L 4FXGB 4ZXBB 2NTFB 1INDL 5C6TL 4GH7B 1TETH 2NR6C 1RU9H 2Q1EA 3NN8A 2V5RA 5SWSA 3EYUL 3X3FL 2VDLH 3PGCA 2X4NA 5CBEA 5DJCA 2NY5H 2DB8A 4PGBB 3RAJH 4D0BA 1CFVH 3FHQA 2GK0B 1YEGH 1KXVC 3D3VE 1KTRL 1LNUB 3NH7H 5D6DC 3FTGA 1PZ5B 4PY8J 4XP5H 2R56H 4DZ8A 1ZWIB 4XVUD 3QHTC 3U46B 3O6MH 5E4IA 1R3HB 4AH2B 4PJFE 2YZ1A 3QDGD 5IR1B 1REIA 2J6EA 4WI3A 4DKDC 1Q9WA 5DHVH 4V2BA 5CEYA 1RIUH 1Z3GH 4EKXA 4RX4D 4HIXL 3GSNB 2DIAA 4DQOL 4LSRH 4R4BB 1NL0H 4WTXA 4L8BA 1CLCA 5INDA 4DFHA 2C3WA 4HKBA 5F72S 5AWNH 4U6TA 2PXYD 4WNQB 2R29H 1OAQL 1EAPA 5EIVA 3O8XC 2VZ3A 2XWJB 4PJ7A 1F13A 2F19L 2JKXA 3GMQB 3OXSB 2CR3A 4ODSH 1HWGB 2EDHA 3HG1E 2VQ1A 1T3FB 4CRPA 3GMNA 5JHDD 3S37X 2DI8A 1CIUA 3GO1H 2BCKB 4WFGE 3O4LB 5TPWL 5DLMH 2H26A 4M62L 5DEGA 1W0WA 2P43B 1JGLH 3KPLB 4K94C 1P5UA 5DD3H 4JQVA 4P23C 1WFOA 4LSQH 5BV7L 5C3TA 3A0OA 3BH8A 5ISZE 3JV4B 1RZJC 2P5WD 3FQRB 3RTQB 3FRPA 4O9HL 3K2UH 4ETQA 5EU4A 3FT2A 1KPVA 4WI7A 1HH6A 2X9YA 5E6IC 1A6VL 4YHZH 1J8HE 1MCPH 3IDIA 4LCWA 3GSOA 4KZDL 4QHMA 2DQIH 4G9FD 15C8H 3NACL 4FQ2H 1CDIA 3QISA 3TYGL 1PEZA 1UXWB 3T0XA 2HKFL 3CSPA 4FHBD 3FFCB 5BRZD 1P5VA 5J12B 4BELD 2X70A 3GM8A 5JIIA 4M1CC 2WP3O 4YHLL 5CSGA 1E4XL 2WWMD 4Y16B 3DO7B 4NQCE 3MGAA 3MLYH 3U4BL 5A16B 5LGHH 1CD9B 5IFAL 3Q0HA 4UTBH 1U8QA 1NBVH 1T66D 4HPYH 4Z7UB 1DDHB 3GZKA 4WI6A 5EBWA 2KBGA 1GOGA 5FKPB 3SKUD 2W60B 1UXSA 3SE4A 5B38G 1DLHA 5IW6B 4IOIB 4RIRA 3N85L 3SO5A 1XF4B 1DZBA 1KJ3L 3LVEA 3P9LA 3PE9A 5C07E 4FQXB 1CT8B 3QB7C 4OLWL 3EYVB 4CMHC 1AHWB 5DJXA 4JFEB 1OP3K 1PQZB 3AXLA 3E6FA 2ATKB 4N0CD 4U6YA 1DDHA 1RJLB 2JB5L 1T83C 3MACH 3HCVA 4KJQC 3RFZC 5HGHB 5I1IH 1RUAH 1YJDH 1VFAA 4N5UA 3P73B 3D18B 5EIIB 3WSQL 3TCLB 4KK8D 4R7DA 4MA7L 3WO4B 2R0ZH 3OB0K 4ZPTB 5E9DB 4S0TD 3RWDB 4JM2F 5F7DB 5EC1B 5I0DA 3KYMB 1QACA 1X5LA 2DDQL 3EFDH 5I18L 3NCYS 4KKNA 1G0YR 3W9EB 3QYCA 4YLQT 3DRTB 3VG9C 5F1NA 4EI6B 1MOEA 3TN0D 4CVXA 3X17A 5K93A 4KXZH 1KTLA 1H3GA 3OAUL 4JPIB 4NRXB 3L3OB 3ULVL 2AQ2A 4FTVD 5SWQA 3HMWL 5DWUH 4Q9RH 3QDME 3C8KA 1T6WA 4GAYB 3UTSA 5L9DL 1QFWI 3KPRD 4XMKH 1CQKA 1BLNB 3MUHL 4HGKC 3HI6H 1EEQA 1RI8A 1OOAA 3RRQA 1P84J 3OXRA 3TN0A 2W65B 2IPUG 5DJ0A 1KG0B 2AJZA 1LVEA 1YEFL 2ZCHH 1I7UA 4YHPA 4PIRF 1EERB 4KZEL 1WWBX 1MCOL 1XGRA 2H45A 1CU4H 3KJ4C 5EUKA 3ESUF 3AFLA 1JGVH 5L8KB 1DE4B 4ODWA 4V1DD 4M8QA 4WTWA 4DVBB 1KB5L 1NCBH 5F9OL 1DVFC 4HZLB 2BSTA 2PCPB 4JRXA 3B9VA 4U1IA 1JFQL 1NGPH 2B1HH 5F3HB 3W0WB 4GKZA 3KYKL 5CEZH 1M7DA 1WEJL 3G9AB 3O8XA 4GQ9L 4KK9C 3OJDB 3PF2A 4P2CG 5CINL 4Y88A 5ISZA 1G6RL 3RWCA 5EIIA 1BM3L 4TYUA 1ZA3A 3M8OL 5HGAB 3P30H 3C60A 3WSQH 3VWKA 3L5IA 3DXAB 3FQXA 1VFMA 3MRQB 4OLXL 3DWTA 4EEEA 1FZKA 4OB5H 2IPTH 1IL1B 1CFQA 3IJHB 1B2WH 4CL7A 4DGVH 3AY4C 2IPUK 1OGTB 2F8VA 3ARDD 5DRWA 2V2TB 2BSED 4NO0A 4L1DA 4YR6B 3BD3A 2ESVB 4XCYA 4FG6C 3G08B 4HJGA 4O00A 2B39A 3LDBC 3FB8B 4AENB 2WANA 4QOKD 5C0BD 2A1WH 3WN5A 1IGYB 5FB8B 3W9DB 2JJTC 4WU7B 4YDJA 2BSRA 2AK1H 4GBXD 2B4CC 1BJMA 1X4ZA 3HNTH 5A1AA 1BQHG 2GJ6A 5EA0L 1Q9OA 3EYSH 4H8WH 4EN3B 3NA4A 1LP9B 1KT2A 4R90H 4FZEL 1I3UA 3MA7A 5T33L 3ULVE 3BWAB 4NWUL 4TULH 3LRSB 5EH1A 3G6JA 1PZUB 1RK0B 5ALCH 4OUOA 1E4KA 3QFJA 4OZ4B 2X4QA 1R3KB 5DD5L 1M6OA 3QUMB 2YD5A 3BP6A 1UA6L 3BPOB 4JHWH 5GGQL 5J89A 2W1NA 1JWUB 4HUVA 3EBAA 3IDJB 3Q6FA 1U93A 1RIVH 4HWZB 2ZUTA 1A64A 4Q6YA 3PIQB 5E56A 3CCHA 4WEUD 2FO4A 1IGJB 4K3GA 2CJUH 1NLBH 1FYTB 1OAKH 5C09B 1F11A 1I9EA 4O9HH 4XTRC 5F3BA 3C6SB 1VA9A 2A0LC 1TZGL 4MA1C 3T0WA 5B8CB 5MP6H 2LTQB 1JL8A 5T3XH 3TT1L 4V1DE 1RUQL 2A83B 1ITCA 4FQ1H 5D5MA 5FO9A 4OFKA 1JMZA 3TT3H 1KCRL 2CRZA 4U1SB 2FX9L 1MH5B 4PJEB 3PDGA 1MCRA 1B4JL 2V5SA 4QCIA 5F89B 2R1XA 2X44D 5IHUL 3B83A 5DT1L 3VJ6B 3TBSA 5B3JE 3OGCA 2X1OA 4JHAH 5GGRA 4RGNE 5BJTB 5IIEA 1IGIH 4ZO8A 4YXHL 2HT4C 2R29L 5BZWB 4PJ7F 4Z0BH 2EYRA 1T83A 3CJJA 3FN3A 1EAJA 4P5MB 4LSUL 3GRWA 2R9HC 2PR4L 4PJEE 3UTQA 4JFHE 1OAXH 5FHAL 3L3HB 2BRQA 4Y19D 1X5YA 1I8IB 1JRHL 2HG5A 3I50L 3VI4E 2DM4A 1NPUA 3EOBB 2XN9B 4HGWB 4QRSA 2K3TA 4J3OC 3CVIL 4ZS6C 4G8GA 1BAFH 3P73A 3SE4C 5LJYH 3BO8A 5GIRB 4DVRH 4P2RE 3MCKA 1CXEA 2Y1VA 3JUYA 3Q6GH 5IVZB 5I17A 3QH3A 1NGXA 3D48R 2IPKB 4I9WE 4OQTH 1HCFX 3W11D 3V5DA 4GRWE 3P4MB 3TWCL 2XZCH 2XN9A 5DZOA 2ZPKL 4QRTB 1I9RL 3LKQB 2O61B 2Z31D 1AD9A 2BNRD 5FGCE 4LLQB 4P59H 5K9JH 3CH1A 4QHUA 5I1HH 4AEHL 4PJIB 5F7KC 2AJXH 2X4PB 4TNVK 5IFJB 3I6KA 3VCLB 1W8OA 4BZ2L 4HLZH 3PXJA 2XKNA 4IS6A 5JORA 3ULUF 4F57H 2XNAB 3MRKA 1WBYB 5SWZB 2E7CA 3L3IA 5C0RL 4JQIH 4DUXA 2BNQE 5EU7E 5BV7C 1UKQA 1J0JA 5DURD 4XMPH 2GSIB 5HGBB 4QF1A 4D9RE 5I1GH 2FYYB 1OTSC 3AAZA 3BE1H 3F12B 1HILB 1J05B 4MQSB 3DX6A 1IQDA 3VXOB 5FYLH 1QPXA 1CK0L 4PREA 5JORB 5DJ2B 1HOCB 2W59A 3LD8B 3QJFB 1WT5C 2JK5B 5A2LH 1A7NH 1IRAY 3BWUC 4H0GA 4IIQA 1RUPH 2HFGL 3CVHA 1CE1H 5CP3H 1U9KA 3MGTB 4ZFZB 4TQEL 4F37F 5J1TC 5IMKA 1JV5A 3R8BB 4QGTA 1M05B 3CC5A 4HEME 4OF3A 3GIVA 4PJXF 4AZ8A 4NZTL 4RMWA 5DRWB 2V2TA 4NKOA 2NX5B 3G5ZB 5I16B 5ALBH 3C9NA 3L5HA 5FGBC 3ZDZF 2MQCA 3HUJE 3D87B 4HGWA 2PTTA 3ZDYF 5E95B 4HPOH 1R5WB 3BHBB 5DJYB 3BIBX 4MWFB 1Q8MA 1FZJA 1FLRL 4JN1L 1BMGA 3HRZA 1OARL 2Y6SC 4HIHB 2Z35A 2BHZA 3G5VA 4HIIA 1OPGL 4PJXE 3D2UB 5IKCB 4OIAA 1HSBA 1L6XA 1MVUA 2XY2A 3S4SA 2EKSA 2N7BA 1BFSA 1AKJD 4YO0A 5GRJH 4YGVB 1KC5L 1NCWL 4O58H 3QJHA 3V0WL 1BGXL 1O7SA 1XMWA 3EJJX 1MFAL 4IS6B 1EO5A 3VWJA 1GXEA 5T1MB 1X5JA 4XNQB 2HLAB 3VRIB 1U8JA 3GBNH 3BH8B 1VFOA 2WLZA 2AJSH 3VGEA 1WQVT 1A1OA 3FZUC 2FHFA 4GMSL 2NZ9D 1KEGH 1NFIB 1KOAA 3CSGA 1JNNH 3TGXA 2ZOKA 5CS7A 1QSED 5J4MA 1U58B 4KHXH 3L7FA 5D1XC 4NQED 3BT2L 1H9VA 3MRRA 4NC0B 1IGTB 2R39A 2JK5A 4B50A 1ZGLP 3D0VB 1KGCD 2X4OA 3TNMA 4RMRA 1LO5A 2VZUA 2F8XC 4ZFZA 3V95A 2D9CA 2EEAA 3SCMD 3DRQA 3S96A 3FT3B 3VFSA 3GMRA 1HK6A 3QIWA 2OMBA 4ZS7H 4OFDA 1QBBA 4X6DB 4LSUH 1WBXB 3MV7A 2CKBH 1BECA 1UJ3C 1QFPA 3BFOA 3CDYA 1T1WB 2HVJB 4LNRB 4R96A 5IBUB 4MX7B 5E2UL 1LEGA 3GFUA 1U8KB 3SKNA 4K23L 1ACYH 4P2RA 4ODHL 5I1KL 5JW4N 1NBYB 3ARZA 3I02A 4XBPA 5MEQA 4G80A 2HWZH 2VDPL 4LLDB 5EO9A 1QA9B 4JCLA 4Q6IC 4EBQH 4NO2B 4L4TE 5JXAL 2XN9E 2VR9A 2VH5L 5DDHB 3L5JA 4ONGH 4P4RB 1LE5A 1ZHNB 3EJZC 1DQDL 3TT3L 4GUPA 4OCRH 1CS6A 1RZGB 3G5VB 3LV3A 3W81A 3TBSB 5B22A 3GUTA 4ELKB 3SDAD 3C6LD 4PRHD 1YMHA 4J3TA 4F33B 1K4DB 4P2RD 2BDNH 1LO2L 3OR6B 4JKKA 3QI9B 4IOFC 4Z78A 2YPLB 5DHXB 3QUZD 4N8PA 3WCYA 1EVTC 3VFVB 1MJ8H 3DGGA 4PRNB 3O9WA 2R2HA 1ZT4A 1EHNA 3WFDL 5DC4B 5GZNC 3OB0H 4KMTH 4X7CC 2NMSA 1FG2B 1BBDH 2YN3A 1UA6H 2R23B 2VLRD 1JRHH 1QYGL 2Q8BL 3RZCD 2V9QA 5LCVL 5DD5H 1RFDH 5IB5A 1GGIH 4X7SH 5EBMA 4JM4H 1FNGB 2IAND 4G9DB 3SDCD 3BIKB 4NC1E 1ZMYA 3O9WB 1QG3A 4QXUH 4XCCL 2IH1B 2X7LB 4HS8L 4YGAB 1WAAA 3DVFA 4G9FA 3DVNB 4JRYE 3CMOL 4X9GA 5HHOA 1AI1L 1MY5A 3DX6B 2DQFA 3D9AH 3UMTA 3DHMA 3MGOB 2CRIA 4E41E 1WGOA 3MX0A 1T7WA 4J4PC 4HUMB 4POYA 1B9ZA 1S5IL 3JTTA 1VACB 4QXTB 1NGQH 4MQXD 4NUGL 5JPNA 4NC2B 4MD5B 3V9FA 3P9LB 5K33A 5EO1B 4APQA 4MB3A 1B2WL 4XHJC 3WXVL 2DLGA 1MCIA 2X1WL 2MCG1 4KPHH 4NNYB 1R5VA 1AGBA 1L7IL 4KTDH 4GXVL 4PRAB 1I1AD 3GSWA 3ZT5A 3ULVF 1WZ1L 1XF5B 4LLDA 3MFGB 4F7PB 2OBGA 3JSSA 2O5YH 5I76B 4YPGA 2GK0A 4G6AD 1ED3B 1U8MB 3LKOB 3V0VA 3SBWC 1RIVL 1KCKA 1T2XA 3LKSB 4UNUA 5IM7A 2P47B 5HI4D 2OZ4H 5CP3A 3RA7H 3OKLB 4JREB 3V8OA 2E9WA 4D0CA 2YEZA 2PXYB 2LABA 4UIKL 4JDTH 3RKDC 1N6QL 2RCSL 3GKZA 1BOGB 2IBZX 5D1ZB 2ZOLA 2B1HL 2FIKA 3QCTH 1F6LL 5FKAB 1U8LB 1NAMH 3C5ZC 4LU5L 4WUKL 5C0ND 4YX2L 1HI6A 2EO9A 3LEXB 3NCBB 2BP3A 3RWCB 1WZKA 5ISZB 4BJLA 3EYSL 3PP3K 3ZKND 4M00A 3PHQA 1ZHLB 1IBGL 1UM4H 4BSWB 5BCAA 1YEFH 5L2JA 3ULVC 4ODUB 1FVCA 3RWGA 2VMFA 4PJ7B 3B3IB 4GW5A 4H1LB 3PJSA 3FKUS 3RU8L 1YY9C 4YE4H 4HKXB 2W9EH 5KSBA 1NKRA 1XGQA 5DI8B 5F7WC 2OL3B 2PNDA 4XMKL 4X7DC 3RJQB 4PJDE 3RWEA 4G9FB 4XCEA 5IB1B 3EZJB 2E7HA 4JY6B 1YN7B 4EI5C 3IS0X 3D39E 1YA5A 3GIZH 2Y9RT 3LSOA 2B8OT 5HHMD 5DYOA 3VFPA 4ODUA 2XRAH 3MLXH 1XR9A 2J8UB 3HG1A 3CPLA 2VLJA 4OLVL 5E1AA 5JIPA 1CXHA 3MBXH 5KAQG 1EEYA 4PB0H 4XHQA 4J1UB 4U1NB 5IK3A 3QEQB 5IW1A 2VDQL 1ZAGA 1IEBA 2HTLD 4BSVB 3LRGA 4OM0H 4R3SA 5I18H 3BP6B 5L7XH 5C92A 3GEWB 1XR9B 1KIPA 4LHUA 1D9KB 4DGYH 2VLJB 4W6XB 3N0PB 3QP3A 2JB6A 1RUAL 4FFZL 3ARVA 2PYEA 3ZMRA 5HYSB 4DOHE 3P11H 4RAUB 2AV7B 1DSFH 1ZSDB 5IMMB 3IFLH 1ND0A 4Y4HA 2CRMA 2VQUA 3IKKA 3X3GH 5C9JA 4WFHD 3AGVA 1MVFA 1PBYA 3UZQA 2B1AH 1HSAB 4XBEL 4TVPE 4X7FC 2CMRH 3LQMA 3TBVB 2FWOA 2EE2A 4Y4KD 2HTKC 3QEUB 4YHMH 2X4RB 5EDXA 1S9XA 3HAEA 4QWWD 1V3LA 1MRDL 2EYSA 2GQHA 2FJHA 3FO2B 4WO4B 2JCCB 3M17B 5ACZA 1SBSL 3BEWB 2NW2B 5BQ7B 2ATKA 4P3DA 3RU8H 4NQSB 5L2JB 4YBHA 1J8HB 2X4UA 3BZDA 4N0UA 4DJMA 1WWWX 2DOCA 3DJ9A 4DKFL 3GHBH 1IARB 1DSFL 5D7JD 1FNEA 1R3LB 1CD0A 1UQSA 1NFDF 1Q9KB 4KROD 1T4KA 2MNUA 3PWPE 4XPAH 2ZJSH 2EZ0C 32C2B 4NDMA 5SWSD 5HYFA 2CIKA 1FE8L 3C08L 2OJEA 4PJDF 2DDQH 3EFDL 4ZYKA 5ADPH 5IB3B 1UKTA 3Q1SH 4TPRH 2H2SC 4Z78B 2C26A 4PJGF 1YYMH 4RMUA 3C8DA 1EXUA 3OG6B 1KV3A 1DQLH 4ONHB 4YDKL 3CX2A 4M7KL 4H1LG 1MCHA 5JPNB 4LCIL 2WUBH 2E7LA 3TBYA 4WFFE 1KJ2B 4OZGA 4W68A 1BWWA 4NRYB 2Z93B 4M62H 3UYRH 1ZA6A 3KYNB 1A0QL 4KKBC 4CMMB 4JFEE 3U48A 3B43A 3AREB 2D31A 3T2NL 3U9PL 1ZHBA 1OTTD 4XPTH 2FRGP 1BQHB 5F96H 4JDVA 3ARFC 5I30L 2AV7A 5D7KD 4JAMB 3IFOA 3TESA 5F7EL 1XGTA 3RUGB 1SVZA 1YPZE 4LCUB 2V7NB 2PXYA 5EOQL 4UT7L 4WW2B 2GAZA 2PF6A 3B5GA 4XVTL 5I8OL 1UZ8A 4PJCE 5KVEH 2G5RA 3ARBB 4LDLB 1I8KB 3MNZA 4NZJA 4J3XA 4KJYA 4GG6A 4PJGA 4PYHA 1S7SB 2PTVA 2QJDA 1NCNA 3VD9A 3G5YB 4PRAA 1XR8B 3RBGA 5DMGC 2YN5A 1QSZA 5DVLA 3WIIH 3QCTL 3U46A 1CDBA 2VXSH 4QTIL 3LQZA 3HNVL 1K2DB 5C08E 2GW5A 4I3SL 1N6QH 1T0NB 5HI3D 4Z8FH 4HCRL 4W4OC 4D8PB 2IAMD 1AGEA 4CN1A 1FHGA 4ISVB 1P9MA 3C60B 4P4KB 5GRVL 4YHNA 3O6FD 3SO3B 2LVEA 5F9DC 3S3PA 3EO1A 5DD3L 3FQNA 4LRIC 3S36X 3FOMB 1WIOA 5DLML 4CNIB 2AK4B 4X9FA 3H9YA 5T1LA 5T3ZD 1U92B 3B9KA 3TA3A 2H6PA 2WK2A 1J1XH 4Z77A 3WKMH 3O3BB 1A21A 1G9EA 1BD2D 2YA1A 1AXIB 4TSAH 4ZAKC 5HVHC 3FB8A 2NX5E 4R0LA 2YSSB 4XXCA 3QPQC 3QR2A 3ULUD 5BMFL 4RAHA 5I1AB 1OGAB 2XXMB 3SGKA 5DHVA 2Z31A 2QSQA 3B9KB 3UYPA 1QEWB 2JIXB 3BPLB 5D2NB 4BUHA 3W5NA 1ACYL 4WEBL 4LEOA 1F4WL 1TTUA 1BJ8A 1FFPB 1A6TA 4N9OB 4Z7UF 5CZXC 1RZIB 1LO4H 2VDRL 2CKBL 3HI1B 1VADA 1KEML 3U7YH 1XGTB 3RUGA 2BRRL 4JFDA 5D7LA 2DQEH 4P99A 5HYSA 2QADB 3T65A 3KLHC 5LCVH 2VAJA 3H9SD 4S1DD 4WO4C 5DHVB 3VXUB 3K2MC 1W72L 3MV9A 4PJAE 4MAUL 5HVGB 3K4DA 3MBED 1L7TH 1B6UA 2X70B 1MRCH 2VIRA 1K8IB 2XI9A 3UTOA 2A6KB 1UWEL 4QT5B 4M7LH 4RDQG 3PWNA 1MJ8L 4Q2ZB 3DO7A 2ADJA 3H42L 3IDYC 2AQ3A 5ESAA 4GMSH 1D5XA 3RY6A 4OGAC 3SGEH 5FHBL 4FQLH 3GBLA 3T1FB 4Q9QH 2KKQA 4NT6B 2IBBA 4M7JL 4J8RB 5AUMA 4QTHB 3OR7B 1AD0B 5HI5C 5JW3L 4R26H 3K0WA 5K9QI 1U3HA 3GMRB 3T04D 5DO2D 1T22A 4JO2L 4PS4H 2VQ1B 4MJ2A 1MI5E 4QRUA 4RMTA 4DAGL 2WUCL 5C9JB 5FOJA 4ZODA 1AHWA 5DJXB 1MJJB 2FD6H 3CD4A 3KWWA 1FAIH 4S2SA 5DZNA 4ZNCD 3LKPA 3ORJA 3UBXI 1IAIH 5DK0B 4PJ9A 1CXFA 4Q6IB 1T5XA 3OZ9L 1U8HB 3PQYA 3IDUA 3UC0L 5AZEL 3WFCH 1C5CL 3ZTJH 5DJAA 1K4CA 4ZUWB 3U6RB 4M03A 3CFCH 4JFYB 1AXSB 1CLYH 3W82A 4LVEA 3QQ4B 3E0GA 4KTEH 4NQVA 5CLWA 4G5ZH 3O2VH 1CG9A 3SKMA 3U83A 4S2SB 5GGTL 1EK3A 4JFFE 2L4OA 3P0YL 3F8UB 4F33A 5E7BA 5IW6A 3HE7D 4KKLC 1FLTX 2A38A 5T1DH 4I2XB 3EUUA 4FA8A 5JZ7D 2AJUH 3MCLL 5CEXA 4OCSL 4EJ1C 3AREA 3B9DA 4LRNH 5T3ZL 3ALXA 4HKZB 5MENE 1G1CA 2XQYG 2CIKB 5LG1A 4JRXD 4HS3B 4XGZA 4O2CA 4ZAKA 1JIBA 4ERSH 2J5LC 2MOVA 4Y1AA 1C12B 3QUML 5SV4A 4JO4H 3BUYB 4DKEH 5GPRA 1UH2A 3U30C 3TA3C 3B9KC 2YRLA 3PWPD 1YUHB 4HXBH 1EHAA 1TPXB 5TF0A 4U1MA 4X6EB 2G9HB 3BH9A 5I1GL 5D1ZC 1KC5H 3LMJL 1WFUA 1ZTXL 1CGWA 2BK8A 4UB0L 2J4WH 4OJFH 4P2OD 5C0RH 2AXGB 1KCSH 4J2XA 3D25B 2Q8AH 4OV5B 1T7VA 4TTDC 3MMEB 2I9TB 4F7CB 4LPXA 4OIIH 3OAZH 5DVNA 4JAMA 1NANH 5FYLE 2UVFA 5H94A 1QRNB 4URTB 3OPZL 5C0BA 5F9JB 1C7TA 4XNYL 3P40A 1S7VA 4N90E 1XF5A 2DLEA 3I2CH 3H42H 3D25A 5CEZE 1RULH 4P2OA 3W9EA 4OV5A 3SE3A 3ILPB 3V0VB 3SDDD 2I25N 5FAAA 4XNXL 3VDBA 2ADFL 3G04A 4NZUH 3QDGA 4BZ1L 4MNGE 1I7UB 3T0ED 3EDJA 2FX8H 3SDAA 2QTEA 5IBLD 3CX5K 3S34H 1KYOK 2HFGH 1V3MA 5KOVC 1A7NL 5TE7H 4B5EA 4JFDE 5AZ2L 3HZKA 1YNLH 1NEZA 2FBJH 5EO0B 4LFHG 3CU1A 4LPYA 3C2AL 4DCQA 2HJLB 4XNUH 1OP3H 1CGYA 3U2SB 4H0HB 1UKSA 4GRWF 5GGUB 1A6TB 5IWLC 2ZZUT 3FQUA 3FQNB 1VSCA 1XF2B 5HBBA 4OD2A 4Q0XH 3FO1B 1YN6A 2N1KA 3IDGB 3L3GB 1CFNA 1H3XA 1ORQA 2PUQT 4GW5B 4H1LA 2XTLA 3LN9A 4TN9A 5IHUH 1INEL 2EIDA 3AM8C 4M6MH 4PG9A 3FQTA 4PJFB 3VWKB 4LEXH 4KVCL 3MSPA 1FRGH 1ZLUK 3P4OA 3PWNB 1RK1B 1DBMH 1MI5A 5TE6L 1IGFL 5F3HA 3IJHA 2MKWA 1HE7A 3MRPB 3WO4C 4KHTL 2CXKA 1NQBA 4KDWA 1CD1B 1YDPA 3MLZL 3CPLB 1OAKL 1GGUA 3MNWA 2X4SA 4LLUA 1MLBB 5I8KL 1ZS8B 4NKDB 2F53D 5DMIL 1KJ2L 1FNFA 1BHGA 4NKQB 3TO4D 1KB5A 4R4FL 5A16A 4TNWK 3FQWB 2YEZB 5D71H 1MELA 1C5BL 3GSNL 1XGYL 4UOJA 1I1AA 4ORZC 1AHWC 4XVSH 4XMLL 4LKXA 2VOTA 3SOBL 3VMPA 5J57B 2GJ6B 2OXHA 2B0SL 2IANA 1AO7B 2BXZA 1KIPB 4ZNEA 1HIMH 2FECL 2WSKA 4QRPE 5CJOL 2I5YL 1DLFH 3MNWB 1S7XB 4FP8L 1EZVX 1CGSH 4L8SC 4YXKL 3MYJA 4UU9B 5KVEL 2UV3A 2BX5A 1MEXL 5HYJA 4KQ3L 4LCWB 1YQVL 4MX7A 1ZLWK 4FQXA 3QNXA 4HF5L 3QUXB 4A6YH 1D5IH 4MB4A 3F7VB 2QLVB 1J1OH 3RY6C 4JQXC 3SGJA 2E6PA 2GJ6E 3W9DA 4IRJB 5HHPA 4PY7B 1FDLL 1J87A 4XRCA 2EKJA 5GSRB 3GSVB 3TBVA 1FO0L 4LSPH 2BNRA 1GC1L 3GGWA 4BK5A 1B4JH 2AV1A 4HC1H 3DSNA 4XCEB 5IB1A 3UYRL 1RURH 1XF2A 1UEMA 4YK4C 3QFJB 4OZ4A 1RJZA 1XAUA 4WUUE 2HMID 4NWTH 3EFFB 4QRPD 4IRJA 1J8HA 2X4UB 5DMYA 3ES6B 3IT8D 3WKNA 4NHUB 2CK0L 4OLXH 3CLEL 3VA6A 3BP5B 2P7TB 2ZCLH 1K4CB 2NY1D 4ZUWA 2ZNXA 4XPBL 3BP4A 5HYEA 4EI5A 1KJVB 2Q76B 1FJ1B 4I13B 4E5XA 1UEYA 4XI5D 2J6EH 4JLRB 2VDOL 4ZFOB 1T03H 2IADA 4Y4FA 2EIEA 4CKVX 5JXEA 3HMXH 1SJHB 1E4WL 3D85D 5CEZL 1U3JA 2QQLH 4F2MA 1MLBA 3BSZL 1ZLSH 1AD9B 5DHYA 3RIFF 5CEXB 5I1EL 2JJWA 3RGVD 1EXUB 1VDGA 4OGXL 3PWJA 3TVMA 3WMSA 2FL5A 4RAUA 4PLJD 2Y5EA 4U7MA 3SJVB 4H5SA 4NN6C 5DRZB 5I75C 5H94B 2FX7L 2NY6D 3RY4A 3EGSA 5D5MF 1IJ9A 2PYFB 1SBSH 1P9MC 3RUGF 1DEDA 4Y4FD 5GIRA 4KZEH 3MRCB 1MAMH 3M45A 3BN9C 3C5ZA 1KPRA 3MROA 4E41D 4MS8C 2CIIB 5C0EB 1R0AH 2VUOA 2J12B 4PR5A 1G9MC 4LBEA 3UTSD 3U7WL 4GRLD 3F7VA 2B1AL 2HAZA 4NN5B 4R4ND 3NCFB 4X4MA 4DZ8B 1HCVA 2V7NA 3OSKA 3V6BR 5J12C 5DJ8A 3VXMB 1YNKL 5D2NC 4PJ5A 4AH2A 1A6AA 5JR1L 5EUOA 3KPSD 3AC0A 3QUYD 4MLSA 2XTJE 1X9QA 2DWDB 3KVQA 3PV7A 1KN4L 4GRWB 1BQLH 1A5FL 1DUYA 2GY5A 2YUWA 2IBZY 1YEEL 5FGCB 2XTJC 3HE6C 3JXAA 1M7IA 3BQUB 4ZFFA 1HXMA 3HMXL 3THML 4F7EA 3UROR 5IESH 1IAKB 1CE6B 3DURB 5HGBA 3QXTA 1DUZA 3ZKXB 1PQZA 5E08L 2NXYD 3MV8D 5L2KB 3MXWH 3T0VA 1NMCC 3AB0C 4LVNB 1FFOA 3DVIA 2ZCLL 3MRIB 3S97C 1Z5LA 2YWZA 5IQ9A 4B7IA 4X80L 2V17H 3AMLA 5ITBH 5DQDH 4P2QB 1MHCB 3CDFA 3OV6A 3AUVA 5FM5O 1C08A 3SKJL 4F58L 5F7YC 5C6PB 1RUMH 5GGVL 1JGUH 3MLPA 1A6UL 2ZUVA 1J5OH 1SYVA 3A67L 3K1KC 4NP4L 1A6PA 2YUXA 5HGAA 3RWEB 1KTLB 4PJHB 3EHBC 3RX7A 43CAA 1T2JA 2YD1A 4CJ1A 1AP2B 3MV8A 2D2OA 4UDTA 1CFTB 5F1NB 5JUEL 1DQQA 3TPUB 4NM4L 3U0PA 4QLRA 3VWJB 3O9WC 3G6AA 1VHPA 3RDTB 1RZFL 2YKLL 1AR1C 3TH2T 5C0FA 4JPIA 4M9PA 4WFGD 3ULVH 3OAYH 4LCCC 4WHTB 1JWMB 1JZ7A 3ARTA 4KQ3H 3PV6A 4PLNC 5CEYB 1MEXH 2RFXB 5D2LB 4X6CB 1UFUA 2KQMA 3ARSA 4AENA 5FYJE 4KJWD 1HSBB 4Y5YB 5FGRA 3VFWB 1DCLA 2F54A 2I5YH 1QSEE 2XICA 4XPHH 5HD8C 1A1NB 1SM3H 2H3NB 3ARGB 4RWYL 4RZCA 4XMLH 4XP6L 4P5KA 4PRPB 3MJ8B 5D2NE 5B4MC 1LP9A 5D71L 1DLHB 4YEFA 3V0AC 2MQ3A 1CDHA 2BJMH 4BSJA 2OMNA 1PJ9A 3IS1X 3O4LA 5I1IL 1WZ1H 1II4E 1RZKC 1UVQA 1MQKL 2Y06L 3JZ7A 4KTDL 5CMAA 5HHNA 3VFUB 4RDQF 1ONQB 3WXVH 4KY1H 4WENB 4GRMB 4RA3A 3KPQA 5D7SH 4PRHE 1CWVA 2VRAA 3EDFA 4K7PX 2NW3A 1A7QL 5GS0L 1RURL 3D0LA 1EGJA 1FORL 3FO2A 3OKOA 2CDEA 1FFOB 2DLTA 4LHUG 5KSVA 3QCVL 3DYMA 1BBJB 5DZLA 1W0VB 3RPKA 3TBTA 4ODSL 3BP7B 5C09A 3AS3A 5EBWB 3ULUL 4IBLT 2VLKD 3CLFH 3F7YA 1FNSL 3QXWA 5EZLA 1U8NB 2NXYC 2X2YA 3VMNA 4X7EC 2AABL 1J1OL 4JG1H 3GSRA 4MQ7B 1NMBH 5LGHL 2GUOA 2F15A 4UBDC 2OS7A 1A7BA 1FPTL 5IBTH 2IGFH 3V5KA 1Z3GL 3TJHD 3VFGL 1GHFL 1RJYB 4OT1H 1FCCA 4FXKA 5EO9B 4YDJB 2RHEA 1BBDL 5IIEB 4HUWB 5TH2B 3S34L 1LE5B 3HS0B 1RAMA 3RVUD 1GL4B 1T21A 3EAKA 1LWRA 3VCLA 1X7QB 2PN5A 3DECA 3I6LD 1LEGB 3K2UL 3SQBA 1X5IA 5IROC 3UXFA 3TO2A 3WBDA 3FN9A 3WHXA 1JTTA 4O2CB 4ZAKB 3V7AE 1IEHA 1KG0A 1MCNA 2X5PA 1JUFB 1CICD 2LV4A 3EDEA 4MS8D 4NPYB 4B0MM 3SPVB 4Y19E 3MOBL 25C8L 1ZT4B 1DR9A 5JXEC 4Y4FC 3VGDA 4ZUUA 2DD8L 5HVWA 2NX5D 1DTUA 3PNWB 3DETD 1TETL 3BQUC 4UIMA 3S8WA 3MRMA 1VERA 1PX3A 4JKPL 4PLJC 5I1KH 3GDBA 2EDJA 1BP3B 3W0WA 1M7XA 3PIQA 5IVXE 1G0XA 1BLNA 4YPGB 1M7DB 1J18A 1WBZB 3VFNB 2EO1A 4FXLA 2AK4E 1S5HA 4EI6A 4NJ9H 3WS6A 5ICYB 3G5ZA 5I16A 4XNUL 3PHOA 4HXBL 4XI5C 1XH3A 5C08B 1J1PH 2BXYA 5C9KA 2XZZA 1RPQA 4DKEL 1E28A 2XQYK 4RBPH 1ZXQA 5EUKB 1EHLH 1G7MA 4D0BB 4MJIB 1DE4A 1CFQB 3JV6A 5FUOH 3WIHL 4LPWA 2YMXH 5JQ6L 4JQXA 1FZJB 5HHOE 5GGRB 5DJ6A 5INCB 5T3ZH 4XNXH 2VLMD 4YBQD 3QFDA 3RVWC 3IXTA 3MCLH 2OZ4A 3ALPA 1LK3H 4KV5F 4UNTA 5ESQA 3MV9D 3RAJL 4WTZG 4X6FA 5HDQH 2DLIA 4WWKB 4WW1B 1JNLH 4LHUD 1QFUL 1YPZB 1DANT 3HZYB 2A6JB 3RWJA 5L8JB 1XIWB 2VQTA 3P0VL 2XFXB 5JNYB 1S9KC 1V8HA 1H8NA 2BNQA 4GMTL 4ZTOL 2IMNA 2D7OA 1AGBB 2PO6D 4X6CE 2FEEI 4PJ9D 1R3KA 4ZXBC 4WW2F 3WS3B 4M8VA 5E8NA 2OSLA 4I0KA 2EH7L 5BOZG 3IU4L 1JWUA 5FOBA 3VW3L 4G6JH 5D1QB 3REWA 3DXAE 3MRJA 4G43A 4G42B 1ES0A 2HN7B 3IB4A 5TF1H 1D5ZB 3NIDE 5A2KH 1LK3L 4WU7A 3OKNB 4FQIH 5IKCA 3KPMA 2QL1A 5IUSA 3DMMB 4XP1H 1OCWH 1P7KB 4MNQD 5CCKL 5KSBB 1T0PB 1N8ZB 4G8FB 3LEXA 3FT2B 2XNAA 5DJCB 2H32H 4HT1H 1JHKL 1P84K 7FABH 5D7LE 3L3IB 1RUPL 3WDJA 4Z7OF 1EHLL 1CI5A 3HPJA 4MXWH 1QFWM 3QIWD 3VXRE 4HK3J 1MHPH 1KSRA 3BI9X 3BKJL 5TQ2H 1W72H 1F6AA 5CIPA 4NO0D 3TBTB 2WBJD 3VG0H 4KAQH 4PTTB 3MV9E 5EU6E 5JDSB 4PJAA 1MFDL 2DF3A 2YPVL 3O2VL 1MPAH 4QYOB 4KTEL 2ZUWA 4B41A 3U0WL 4NQEA 1O5DT 3CC5B 4HHAB 2ZOKB 3VI3F 4GKSA 1A4JB 3B4NA 1H0DB 2NY5C 4RA0C 3MRNB 1NFDB 4JQIL 4UAOB 4FQQB 4P3WA 3STBA 5D2LE 4K7FA 1VESA 2V7HB 5MENB 1CF8H 3SE3C 1FAIL 1R5WA 4NO3B 3JBG7 5E6IB 4TVPD 2ED9A 4I3GA 3MODL 4PD4J 4HUVB 4HUXB 3N1PC 2XOTA 4U6VL 4AEHH 2H2PD 3MV7B 1R3IL 4JFFB 4OF6A 3ZL4L 5C0GA 5IBLC 2XZCL 1J1XL 4OZHA 5BJTA 3GRWL 5F97E 3WS3A 4OQTL 1T7ZA 4NYLA 4Z95L 1G9NL 3L9RB 3P4MA 4XZUA 4AY0A 3V4PL 4GLRI 5CAYB 5IVXA 3KPLA 5F21B 5F7UA 4HKZA 1MVUB 4GFTB 3JVGC 1RJYA 1MRCL 2Q3AA 2PYEB 1QHOA 4S1RH 1ITBB 4OV6F 2WBJC 2LU4A 3V4UL 5D70L 1OAXL 5FHAH 1ZVYA 1NEUA 5HHME 3ZO0A 3AY4A 5IFHL 2VR4A 4U1JA 2QADC 4Z0BL 3ETBF 4D0DA 4WEBH 1TQCC 4TSBL 5FO8B 1W72B 3DV6B 2NW2A 4QRRB 5IB3A 3BPNC 2J8OA 5D1ZD 5DT1H 1JUFA 5D4QA 4Y5XA 5CUSH 4JJHA 2HG5B 3WFEL 4UZGA 5EOQH 4QHLA 3TA3D 3C5ZB 4OD1L 4E42A 2CXGA 4HEPG 4Z7UA 5LVEA 1FL5A 2R2BB 3NFSL 4HWBL 2B2XL 5F96L 1ZANH 2R2CA 3OXRB 3LQAL 3U9PH 1XGPA 5INCA 5MP6L 4TSBH 4I3RH 2QBWA 3PL6B 4MDIA 5HHOB 3K4ZA 1X4XA 1UM6L 3SJVE 4WY7H 3U9UA 1QSFA 3JWOH 4CMMA 4PJ9C 2BJML 3H7BB 3O3EA 4LNRA 3LN4B 5JZ7C 2GSIA 3TO4A 1VFAB 2P44B 2CO6B 4P2RB 4JDVB 1Z6JT 1WCBA 1J9CT 4M1DL 1N7MH 4RISL 3ZE1E 4YDKH 2DWDA 4OLUH 2AVGA 1D6VL 3EO9H 4HCRH 5SWZE 4RWYH 1ETZB 5A40E 4OTXH 2CKBB 3K8MA 1N64H 1ADQA 1YYML 4JG0L 1QLEL 3QIUD 1KJ2A 3KR3L 5ADPL 4G9FE 4UQ2A 1NC2A 4JRYA 3P9MA 1FE8H 1PGRB 2Y5TA 4Z95H 3L3JA 4R4BA 5CJXA 3KPPA 4QF1B 4HV8A 1CBVH 4NCDA 4D0CB 4NNXA 2DJUA 4P48A 5I8OH 4PRBB 1JI2A 1YJDC 1SY6L 3GHBL 1YN6B 3TM6A 4AMKL 4UINL 3PDDA 2Y7QA 4M6OL 4CVXB 3IDNA 5DO2C 1WK0A 5BVPH 1YMMD 2B5IB 3I75A 1UZ8B 1JGUL 3WIFA 3TVMD 1Z0NA 3T4YB 2ESVA 4NQEE 3HG1D 4QO1A 4XCYB 4P5TD 2IPTL 3D2UA 4KKAD 1J0HA 2P49B 1M1SA 1I3GH 3S4SB 3P30L 5GRYA 3MBEC 4QRQA 5EC2B 3INUH 3O6LL 3LKRB 4HMCA 1CQYA 3PGFH 1X6LA 1D5MB 2PW1B 4I0PC 2FCBA 2O5XL 4XXCC 5TQ2L 4R0LC 5T1KD 2W9DH 1ROWA 3THMH 3EOTL 4MXWL 3HA0A 3MJ9H 3NCCB 3NMEA 4HUUA 1J8HD 5D8JL 4M9OA 4FNLL 4WU5A 1BIIB 1NBYA 2BOBA 2DICA 4Z9KB 1JGEA 3GJEB 3BD4A 3GMPB 2AGJH 1YEKH 3GI9L 3KPSA 3QUYA 4BQ9A 5CCKH 4G3YL 4I4WB 1YEHH 4F7PA 3Q2CA 4MB5A 4FQIL 2WWKT 3RVUC 3MCG1 3BPOC 3QEGH 2C4FU 5T1KA 4Y5YC 4UQ3A 3L1OL 1UVQB 3P77B 4J6RL 1MHCA 1P53A 4PY7A 3D85A 2XRAL 3MLXL 1IL1A 5D72L 5DF0A 3CFJA 2BNRB 2BERA 4G6MH 4YFDB 1QR1A 4NQCA 3TJHC 3X14A 5JHLH 4AYFA 4HIEA 4UBDD 5ICZB 1NLDL 4BFIB 4F9LA 1MCCA 3ARRA 4JFPA 5TDPA 2VLKE 1VKXB 2A6DA 4L4VB 2CMRL 1RVFL 1HSAA 4PJAF 3B3IA 2FR4B 3P4NB 3L1OH 2DQCH 5BS0A 3X3GL 4OGXH 35C8L 1UM4L 2UZIH 1QUNA 3FT3A 3KHOA 1JWMA 1IBGH 2DKUA 3VFSB 1NC4D 4TUJB 5DC9B 3WN5B 3BSZH 2E8YA 3PWUA 5H37G 4QT5A 2DYPA 3PHSA 1YEHL 2X40A 1EJOH 4Q74A 3RHWK 1T1WA 2HVJA 5DUPH 3S4SG 3TIEA 4Z7UE 1NKOA 1ZLWH 3O6KL 2J6EL 4K94L 2DI9A 2JCCE 4MJ5B 4FNLH 4NKMA 5J0BA 4H0IA 5E4EC 1D9KC 5E2TL 3WNKA 1LP9F 3VXME 3QWOA 4NIKB 5LGKA 2DMCA 4JFYA 3E6HB 3QEQA 1UB5B 2OZ4L 3FB7B 3WFBL 1J8KA 3O6LH 1H3PL 5B4MD 3L3OA 3MJ6A 4RGNB 2DYPD 3IVKA 2IPKA 4H5SB 4PGJA 4HMEA 1N2RB 5C0AB 2Y25A 3VWKC 1KTDA 3C60C 5HD8D 3S7GA 1DEEB 1A7RL 4J1UA 4U1NA 3MRCA 3GIZL 1FGVH 1GIGL 3RIAK 4KJWC 3O0RH 5TDNB 1UYWH 2XQBL 4KKBD 3TFKD 3G5XB 4Y2DD 4Y4KB 1XCQB 4X5WB 4M5YH 3VH8B 3QXDA 1BX2B 1FBIL 2Q7YB 2EECA 4I2XE 1GGBH 1AR1D 1IC7L 2AJYL 3KS0H 2DJSA 4OFYD 3NCJH 5C0IA 2WIMA 4U6HA 3CFJB 3KPTA 3MUJA 3MLYL 4JM2C 3U4BH 4NZDA 3WFHA 3K1DA 5F89A 1L0YA 2EDRA 4U3XA 1XCQA 3LPGA 2GTWA 5HVFB 1A6WH 4U1GC 4P2QD 5M94B 2YPKA 4JFHD 2J2ZA 1SHMA 4HS3A 2EZ0D 3KXFA 4U0RB 1U42A 3HC4H 1XGYH 4KROC 5A2FA 3NPZB 1HXMB 2DQFB 4LLMA 1VFUA 1EZVY 3HNSL 5IMKB 5ID1B 1MFBH 2C3XA 1TENA 3DTXB 4P3DB 3MLRH 3ARWA 4Y16D 5KSAA 3GIVB 3WFDH 1WISA 5F9JA 5C0BB 1U3YA 4Z7VE 4R2GC 2VYRE 3TO2B 1LD9B 2MWCA 4LSQL 4Z7VF 4RGNC 4ZUVB 4MJ5A 5I2IB 3ZT7A 1UM5H 5KZCD 2XTJD 4GXVH 2ILLA 1MCJA 1JWSB 3GMLB 1ORQB 5LGJB 2Y4SA 4PGEA 3IU3B 4NKIH 3TYFB 3QUYC 3LKRA 1N0LA 5HYJD 1OAZH 5J6GB 2C9AA 8FABB 4MDJA 5T1LD 2R0LL 4MA8H 5EU6D 2DMKA 5IV2B 3G6AB 3RDTA 2Y36L 4MYWB 1ZVSA 2P48B 3QRGL 2HWZL 2VDPH 4PJGE 3VXRD 5IFJA 2YBRA 1NL0L 2A73B 2FGWL 5D7LD 3UO1L 3MXVH 5I73B 2OTUA 4G7YL 3MLSH 1RIUL 2JELL 3ZZ1A 4I0PA 2A6KA 2O26U 4KVNH 1JK8B 1I7TB 1P7QB 5CBEB 4OKVB 4UT9H 4WIQA 5TDOA 4JFXB 4MNQE 1YNLL 4K9EC 3CFDB 2IAMA 4JDZA 5D7KE 1S3KL 3MC0A 1P4LB 1RFDL 3RHWF 4YBLB 4ZMAT 4HDIB 2HA1A 2WQ8A 3QULB 1IZKA 4XNZC 1LEIA 5IEHA 1EFXB 3LEVL 4L3CB 4PJDB 2ADFH 3JTSB 3QIBB 3EW3B 2YD8A 4LASL 5FA4A 5AYQA 1BQUA 5F7FA 1IGJA 1PAMA 4L8BB 3IXTB 3RVXC 5TE4H 1GAFL 1LMKA 3SEPA 1LO2H 5ESQB 3FO1A 2AJSL 4HQQH 2VISA 3OQ3B 4WWKA 3QDJB 1LEIB 5EU3A 1N5YH 2NX5A 1LP9E 4YHIB 4ODTL 3V6FB 2ID5A 4HKBB 1JE6A 3RGVA 4LPTA 2AAVA 4Z7WA 2XZAH 3STLB 3S88L 3V79C 1HHKA 1C5DB 2APVA 1GYAA 3WJJA 3L5WB 3UJIH 5DJZA 4GS7C 1MJUH 5E8PB 4FQCH 5ANMB 4MMZC 2BZDA 3H9SA 2LAAA 4HUXA 3BP5A 4LSTH 1Y18A 5CILL 3O2DH 1PKOA 4JN1H 4C56B 5C09E 5H2BA 4X80H 4PJIF 3RKDD 1C5DA 2BVPB 4PRPE 2FZ3A 3NZ8A 2ADGB 1U95B 2AXFB 5HI4C 4HPOL 5C8JA 3BKYH 4IRSA 3QG7L 3S5LB 2P8LB 4LAJH 3WLBA 3BKJH 1F5WA 3I6GB 1WLHA 2FO1A 3PP4H 5IESL 3QA3B 5ESVB 3DRTA 4L3ED 4XNQA 2MPAL 2R2HB 2P5ED 1FZOB 3QSKB 2D7QA 3HE7A 1KUMA 5ADOH 3K4AA 1F4XH 5FYKH 2ADGA 4U7KA 3NPSB 4XP1L 2PW2B 4LCUA 4G8GE 3L3KA 1WV7T 4XRCB 1ZLUH 5B39A 2W0PA 3SDDB 3WNMA 1QRNE 3WFCL 1PSKL 3UC0H 4JZOA 1B4RA 1BGXH 2Z9TA 1OF2B 3B5TA 4R6UA 1KFAL 1LO0L 5F70A 2HKHH 4YH6A 4Z7QF 4NZRH 1C7SA 4PV8A 1EGJL 1Q9LB 1SBBA 3ET9F 4G7VL 5D7IA 1KLFA 4GG8B 1HHGB 3AXLB 1PYWA 1DEEA 2F5AL 5I6XB 1WBXA 3WL9A 1A02N 1MCWW 3SDCC 4O2EA 1MNUH 3BUYA 4MNGB 1NEZG 1XGRB 3JVGA 2VITB 4ZDHB 4GW1B 5E6YA 1SVCP 4EN3D 4UDUB 2FYYA 3I9GL 1OARH 4JFFA 2DM2A 2JJUA 4B7LA 2Q7YA 4M7JH 4P2YA 3O41B 2VC2H 1INQB 2I07A 2PO6A 3AS1A 5I1HL 4UV7L 1R24B 5T3XE 1U3HB 3HAEG 3RX5A 1H5BB 2DQGL 1R5IA 2FIRT 3I84A 1H15A 2C1OB 2YUZA 5J8OA 1U8HA 4M7LL 4OSUH 3UP1A 3GUTB 4NKOB 3ZHLA 4EQ3A 5E0QA 1XR8A 3QWQB 3WIHH 3N1FC 2NY4C 1MREL 1Z5LB 2Q6WB 1BAFL 1QP1A 5J7CC 4XPBH 5C0CB 5C2UB 4MNQA 1NDGA 1LE9A 3ARBC 2BRRH 3RTQD 3L3GA 3FL7A 4Z0XB 4MJ4A 1FN4B 3F6LA 1LO4L 4UQ2B 1HNGA 1HHHA 3LN5A 1RY7B 3TZVB 1WTGT 1UWGH 2VZ1A 4PP1C 3MFFA 1KLUB 1SJXA 1UJTA 1S9VB 1JPSL 1TVHB 3C87A 3SDDC 5D1XA 3DVNA 3VFMB 2EE6A 5IVOA 4OZFA 4PJ5E 5F7NC 4F7EB 2VXTH 3MGOA 4MNQB 3BIKA 1QQDA 1DN2A 2VTFA 1PKQB 4L9LC 2AJ3B 1VPOH 2I26N 4LPUA 2X4SB 3JTTB 3H2WA 4PBWD 3MNVB 4U0QB 1A4KA 4WI2A 3QCUH 4PV8B 2DD8H 4MGXA 1R6VA 4K3HA 3P0GB 2KPNA 2D0GA 5K9JL 4Z7WE 4G6KL 4OGZA 4N8VG 2GJZA 4HFWA 4TSCL 1RUQH 1HQRB 4YXKH 3TIDB 4JFQA 3G6DL 5C0DB 1MFEL 1T7YA 1ZOXA 2V5TA 5GS3A 4BQ6A 5KS9B 1BF2A 4F7CA 3FZUD 4N8CL 3NGBB 1YEDB 1U58A 4OZIA 4OKVA 4EQ2A 1QNZH 2NXZB 4PGCA 4JO3H 1JBJA 3WIHA 1QZ1A 1K6QH 1PW3A 3RVVD 4QTIH 4X4ZA 3H9SE 5JA8B 4EUPB 5IQ9B 4L1HA 1P6AB 2E9JA 1U8MA 5E8DL 4HUUB 3WYRA 5GGQH 5HHPB 4JHWL 1E27A 3I50H 1U8PB 4TTGA 3ROOB 4OT1L 3SQOH 5B21A 2Z31B 1LILA 1WITA 2P5WA 5ANMA 3DYPA 1UT9A 2K1MA 1I1YB 1MIMH 1NGYA 3VD3A 3MLTB 1ZT1A 1AQDA 2X9XA 3PHQB 5I1JL 1F4HA 4ODBD 4EVNA 1G7IA 1OGAE 1T2QH 4N0RA 1IGIL 2EDLA 3HE7C 1LNUA 2Y7QB 4OF8A 4OCXL 4M6ML 2EC9T 2BFVL 3T09A 4HBCH 3V6FA 4HG4K 2X4RA 4HKXA 3PWLB 5FUCE 2G5BA 4NQCB 3T2NH 4N0FB 1CLZH 3TNNB 1AQDB 3QA3A 5ESVA 2NNAA 4HC1A 1PY4A 3OJVC 1A7QH 5GS0H 3C2SA 4OUUA 3A6CL 1PY9A 4WI9A 4ZOCA 4P9HC 2UWEF 3DHJA 1TJHH 4QEGA 4LCWE 2NW3B 4FZ8H 5GS1B 1NCTA 1PG7X 3GGWB 5ID0B 1NLBL 1X5AA 2GSGB 4G8GB 2FBJL 1QO3A 5E6ZA 4A6YA 2OJZH 4WNQA 4TUJA 5TE7L 3HC3H 3VXSD 3QIUA 1X7QA 2A9NH 2XWJA 3Q1SL 4LOUD 4PY8I 5HI5D 1YZZA 3IDJA 1XEDA 4BZ1H 5FFLA 3BPCA 4WCYH 5F6IB 3EGSB 3RX8A 1Q0YH 4OGAD 4YUEL 3LKPB 1JN6A 3KYKH 3MUZ1 3VI3E 5EU4B 1RULL 4PJBB 3I3BA 2E6JA 3WFZA 4OZIB 4R97C 3MRHB 4WWKC 4NWUH 4TULL 2PTUA 2R2EA 1KB5H 2BVQB 4IDJL 1G7QA 1KB9K 4IJ3B 4CW1A 1XGUB 5I1DB 1I1AB 5CJ8A 2UY6A 3X12A 4X4YA 4HUWA 1U8IA 3HNTL 1KPVB 4WO4D 2A77L 4NQVB 5I19L 3ZKSD 3ROOA 5KOMC 3MLVH 2UWEB 3DPBA 4DTGL 2P5WB 4BK4A 1MRDH 1FIGH 1NUFA 3OGOE 1WBZA 1SY6A 4W6YB 4WUUA 3V6OE 1ZT1B 5CZXD 3UZEA 3M17A 5E9DE 3C5JA 5ECJE 2VWEE 3LAFA 4IRZL 1EGJH 2J88L 3SKJH 4F58H 1CYGA 4DGVL 4X4YB 4E41A 3K7UA 1A3RH 2XXCB 4CVZB 3IAPA 3N9GH 4JJ5B 1YMMA 1L0QA 2HLFC 4QRSB 3ULUC 3OJDA 5HHXL 3CVHB 3OTTA 1SEQH 4G8IB 4X9IA 1XF4A 3RIAF 3MRMB 2QSTA 5DD0L 5BV7B 1QLRB 5AYUH 4P46D 2C3VB 1M05A 5E08H 1Q9WB 4JPKH 4RFOL 4PJ5D 2YD7A 1ERNA 1LDSA 2VL4A 5HDBE 2AJUL 4NKMB 2DQTH 3O6FC 4PB0L 1HWHB 1MFCL 4A6YB 3QNZB 3DYOA 1GRWA 3NAAL 1JPGA 1IILE 1EEUA 1U6AH 5C07B 5DD0H 5J6HB 3D6GA 3O2DA 5TFSL 3UTTB 3WV0A 1D6EB 2ERJB 5HHXH 1OLLA 5CKGA 5IBUG 5F7LB 5AG8A 3VXPB 5C1MB 1NEZB 3N9GL 3ARGD 1WBYA 2JLLA 4MXVE 1FNAA 1G84A 5DMGD 2AK4A 2ZCHL 3TZVA 1C1EH 1J0YA 2JE8A 3T0AA 1YQ2A 1J7VR 3MREB 1X5ZA 1RIHL 4CADB 1QBLL 4NKDA 4XTRD 1DP0A 3IKCA 4ZSOB 4DUVA 1EO7A 5GGSA 4KRMB 2ADIB 3IF1B 1S78C 3BX7C 3MLVL 3C6LB 2XZAL 3KG5A 4FTVA 4X0KA 1RUKH 2CDGA 2BMKB 4R7NA 2DN7A 4HJ0D 4U3CA 5EOTB 4Q9CA 1L0XA 2R1WB 4M3KB 3O4OB 4JEGB 1BVLA 2XFXA 5JNYA 4BQ8A 3ARFD 2F53E 5BVJA 1NCCH 3WN5C 4LBEB 4JKWA 2A6IA 1FGNH 1KCUL 1EUTA 5HDLA 1ZLSL 3UCRA 2MCPH 2XA8L 3QDMB 5JOEA 4OFYA 3AU1B 4KGJA 4O5LL 1I4FB 2VZOA 2HKFH 1ADQL 5FV1L 1T03L 3OMZA 3V6ZA 3O4LD 3GSNA 3LIZH 2WNGA 1GVIA 4GBXC 4AIOA 2LTQC 3WUZA 1CLOL 4X6CA 1S78D 2HJFA 2FJFB 4ZSOE 1K2DA 2OR8A 4KK5D 2CK0H 5JW4M 1KEMH 5EUOB 1T1YA 1TJHL 4LNVA 3MJ7B 4NO3A 4GSDH 1MHHA 4F15C 1MSPA 2R0KL 1JZ5A 3X14B 5GS1A 5HGHA 5TPWH 3ARGC 1CLZL 3WEXA 2G60H 1CDGA 1XF3A 4C4KT 4KWUA 5KG9B 5J1AB 4RAVB 4P9ML 3AS0A 1FZKB 3HE6A 4NKIL 3CMOH 3WUWA 3H9ZA 1C08B 1P6FA 2CRYA 1NMAL 4Y5VC 4FOMA 4XWOD 4ODVH 5DEFA 3RP1A 2F54E 1NFIA 4P2QA 2H41A 1YQVH 4K55A 4LHQB 2P8PA 2VLKA 2ENSA 3HI1A 1V3KA 4OUUB 3CZFB 3WJLA 4LGSB 3QXAB 4QWWC 5EU6A 3GSXA 2R0WL 4JVUA 2Q8BH 1XF3B 5D2NA 1IAOA 5I8EA 1KJMA 4LLWA 2W91A 4L3EE 3QRFM 4P46C 4K7PH 3MLRL 5EULV 4AG4H 2IALB 4Y16A 1NDMB 4I3SH 2EDFA 1GPOL 2A9ML 1QVOA 2VXSL 2QV2A 4XP5L 3WIIL 2CUMA 5EU5B 5D2LA 1KJVA 2VDML 4WUUB 4N8CH 4PRPD 3UBXG 5ESAB 4G6FB 3TBYB 4WGWB 4MNHB 2E9BA 2R0WH 4Y1AB 4NT6A 4ZFGL 3KYNA 4YHPB 2YR3A 1NCDL 3LRSA 2NY5L 1KCVH 1AY1H 3SKOB 1EMTH 1TNMA 3VXMA 2QSVA 4KQ4L 3HS0A 2WBKA 3QEQE 1EIBA 2C7UB 3HZMA 2BVQA 3NCJL 4LEXL 2DIJA 1OSZA 1OF2A 2K9UA 1UG9A 4X5WA 5FF6B 3QI9D 5DD6B 1AJ7L 5F44A 2C3VA 2XWTA 1RJLA 5DTFA 1FJ1A 2DQDL 1RZKH 4O2FA 4ODHH 3BZEA 2D3VA 4R9HA 4RRPG 5FO7A 2ZSWA 3FAWA 4XPFH 7CGTA 4N9GA 4I48B 3O8XB 5IQ7H 1SQ2N 5BW7C 3MBEA 4I77H 4GG6B 5FF6A 2IC2A 4QRRA 4ZOBA 2IQ9H 3KPQB 4LOUC 1P4BH 1YY9D 4LCIH 3QI9A 1YYLL 3C2AH 1H3PH 3D2UD 3CK0L 3UTTE 2H1PL 1N59A 2RGSA 4KK8C 3T2QA 3OKOB 5EOCL 4I5BB 1JYXA 3S37L 3GB7A 3GBMH 1KNOA 4RNRA 3LIZL 5IP4A 5ICYA 1F4YL 3C08H 3L3DA 3QQ9D 3GBNL 1HEZA 4Y19A 2YD2A 3FOLB 1FIEA 2VKWA 1EJOL 5GJTH 1KTKE 5IB5B 4I18B 4CNIA 1SMAA 3BPNB 3R0NA 3V5KB 1DUZB 1FVCB 1ZV5A 2APWA 3RWGB 1B90A 4PJCB 2IH1A 4KRLB 3QNZA 4O58L 1KNOB 1P7QD 3EYUH 3FMGH 1TNNA 1TZIB 4PRDB 5GRJL 3D3VB 4MCZA 3I9GH 2X1QA 4RGMC 3MLUH 4RCAA 4AIZA 1LGVA 3T4YA 4JRWA 2YD3A 4YHKH 1DBBH 4ORGA 5DS8B 4IHOB 4D94A 3DO3A 4NN7C 3LOWA 5FECB 4XH2B 2APBA 3LSOB 1ZLVH 3H9HA 1I1AC 5EB9A 5HJ3A 4M1CD 4YZFF 1G7LA 2VXQH 2XWBB 4GOSA 5IEKA 3RWJB 3BOVA 3DUSA 5F6HJ 4ZUUB 2FEEL 1RZIA 1KFAH 4JGUA 4HWBA 3O41A 1DQQB 4J4PD 5KBNC 4IHOA 5J13B 2FO4B 4CMHB 1ODAA 4QNPE 1MQ8A 5MERA 2ORBH 1IM9D 1T5WA 1K8DA 2W9LA 3NIDF 4WU5B 4HWNA 5E2VL 3WXWH 2QKIA 4NZTH 1K8IA 1BQSA 2XKNB 3IYLW 2BOCB 1BZQK 3RUGE 4LCYA 1IGML 1CE1L 4WHCA 1PLGH 3DX9A 3OX8B 3IETA 4P2QE 2EDBA 2VLRE 1DBJH 4YDVB 4P3CL 4BSWA 4JZJC 3QUXC 4IMLA 4NQDB 3RZCC 4M1GL 1I3VA 2F8OA 4KMQA 2FWOB 4DCQB 4L3EA 1KENH 1Q9OB 5EORH 2F58L 5DRNA 3RGVB 5GZND 4ZD3H 2XPGA 1F90H 3GSRB 5IJKA 2DQHL 1I9IH 5CILH 4KRPB 1Y6MR 5ICZA 5FB8A 3FONA 3QUZC 4PB9L 3ZHKA 5J1SC 5HPMB 1BIIA 4IOFD 4U49A 4AM0B 5ERWB 3GSXB 5JIHA 1T1ZA 4N1CA 4C83B 4YQXH 2MQ0A 1KPUA 2A74A 2NY3B 4OLYH 4PP1D 3SDAC 4OLEA 3L7EB 2YPLA 3DI3B 4DAGH 5E1AB 3ZYZA 4L9DA 3RTQC 4ESKA 3EJZD 5E5RB 3U6RA 3KLDA 3RKPA 4DTGH 1EBAA 5H2BB 4YHOL 5J11C 5JDJA 2PETA 4R26L 1JHLL 4CBPA 2VZSA 3CCHB 3GKWH 4NM8L 3B6SA 3QH3B 3U82B 3L5XL 4OCLC 1IZJA 3AVEA 2Z92A 3A6BH 1FYTE 3KPSE 2DQUH 1U93B 2APXA 2CLRA 5FHBH 4Z6AT 2VERN 3U36B 3T77A 3U0TB 4N1EA 1O0VA 3NIFE 2BHYA 6FABL 5DGQA 1KB5B 5CJQH 2OTPA 3CVIH 4YUEH 3RTQA 4WCYL 3SCMC 1JTOA 3KPMB 4PJXB 3RA7L 1BWMA 4HK3N 2NR6D 4MLIA 5KVDL 4EN3C 3QUXD 2Z93A 1JF5A 5JMOC 1LQSR 2EH8H 3FQWA 5GISL 1OAUL 3F58L 4EIGB 5D1XD 5GS2H 3U7YL 5BRZE 1N0XL 5L2KD 3DX9B 3OX8A 1HHIB 4QXGH 1LK2A 1G7QB 3NABL 3QUKA 1BFTA 2NZ9C 4JHAL 1QLFB 4L4TA 5EG6C 1DQTA 3PGDB 2OR7A 1OB1B 3UO1H 1ZANL 3SE8L 5GJSH 1GZPA 2B2XH 5JDSA 1JNJA 1ZLVK 3QRGH 4FQJH 3O3DA 4X83A 4PJFF 4M61B 3F62A 5GXBB 5DRNB 5BRZB 4POUB 5BO1L 3EZ8A 3UJTH 4I1NB 4TSAL 1WCBB 2AV1B 2C3HA 1E6OH 1HYRC 1QFOA 3KYOA 1JV5B 3WFEH 1UQSB 4PTTA 1FVDA 4D0DB 2IBGA 4HIJA 2XG4A 1H3WM 1AI1H 5DA4A 4JFOB 3GSVA 1KTDB 1H5BA 4G80B 5LQBH 1YC7A 1IMHC 2ZCKH 4K3DL 1VFBA 4R8WH 1P69B 2Y6SD 2Y5TB 1GGCH 1V7MH 3DVGA 3VH8A 1SJVA 1GC1C 3NFNB 4P5TB 2X4PA 5HYIA 4LSSL 4Z8FL 2WQRA 4YHYB 2VLLB 3HCVB 1MCLA 4AEFA 1SYSB 1HNFA 1RHHA 3SY0A 4ZFOA 2OTWA 5GZOC 1K4DA 2FEDC 1X44A 3L9RA 2Z91B 3LHPH 2BHUA 5T33H 3QQ9C 4YC2C 3QDGE 4DWHA 3MFFB 4LSVL 2LE9A 1CDUA 2KDGA 5C07A 4XVTH 3GMOA 1U8OB 2DBJA 2V2WB 5D9SA 1BEYH 1WIPA 5HHQA 2VLRA 3UJTL 5T1MA 3QNYA 4LP4A 5JXAH 2A6JA 5HDBF 5HXMA 5LKNA 1TZIA 4NRXA 1FBIH 2ICEA 3SJVA 3U30B 1VPOL 3CFBB 3TCXA 5MHSD 5FDYA 4EUPG 3IKCB 1B0WA 3RVXD 4K23H 3SN6N 1NAKL 4JFDB 2ADIA 2QSCL 2IAMB 3HPJB 4JDZB 4GXUN 3MGTA 4J3VA 2VLRB 2NPLX 1G7PB 2UVEA 3UYOD 5EZIL 1A7OL 3GMMA 1OAUH 5IHBA 1VGKA 1OP9A 3UDWA 4JZJB 2VSDA 1DFBH 5CHNA 4M1GH 2EYTA 3QI9C 4M7KH 4Y8DC 5CINH 5DK2B 3VG0L 1FV1B 3BUTA 5K9KA 2AP2A 5IG7A 4GQ9H 1WEJH 4MDIB 3BT2H 2X6MA 2Z31C 4GRWH 3QDAA 5MERB 2Z35B 3SGKC 2EDEA 1KF9B 2YBRB 3QDMA 3D39D 4KHXL 2EIZA 4DGIH 1JFQH 2OM5A 1FL5B 3GMMB 3W11C 4K94H 1BFVL 1WJ3A 3I02B 4XPGL 4APQB 4PFEA 5E8NB 2H6PB 3HZVB 2X05A 3DGCR 5LGJA 1CGTA 2O5ZL 4LQ1A 1Q0XL 5E03A 3NFNA 3VXSA 5E8OA 3T3PE 3BKCH 1WC7B 3IU3A 5K59E 1RQ5A 4NM8H 1CU4L 4F15B 3BGMA 4ZG1A 1JYNA 4NGHL 4XWGL 1MIEL 2ZKHH 3W5MA 2VC2L 4U1KA 2CGRH 1D5BB 4D3CH 2VXQL 3BAEH 3HZVA 2E5EA 3MRQA 1A1MB 1BVKA 1BZ7B 1T4KB 4RGND 5KSVB 1HZHL 1AP2A 1OGAA 5KANI 3P9MB 5GGSB 5C0AD 1EHXA 4XWOC 1YC8A 2BVPA 4Y16C 5EOTA 2F58H 3V8CA 3FMGL 5ABDE 4I18C 1OY3B 1I1CA 1JNLL 2BVOB 3OKDA 5C0AE 2GUOB 2UWEE 2BSSA 3KLAB 5GJTL 1FNLA 5DJZB 4OZHB 4HCRA 1F45A 4LVHC 4N0YH 3I75B 5E8PA 1F4YH 3PQYE 4D9LH 5CD5D 3MUY1 4Y5VA 4EOWH 2VISB 4OM0L 4MXVF 4KK5C 4QTHA 3H8NA 4Q2ZA 4JM2D 3HR6A 3OAYK 4Y8AA 1C8PA 2FH8A 4GRLB 3J8F7 1JZ6A 5CBAB 2H9GA 2W38A 3ZE2E 2E27L 2RR3A 5H35A 4FMFA 5E1HB 3R8QA 5TGBB 3SO3C 2IQ9L 2AEQH 3MRFB 5FCUH 4CVUA 2VDKH 5AD0A 2VJXA 2PYFA 4HWZA 2HT3D 4Y2DC 2E7LC 2GAZB 3TFKC 5IW1B 3O2DL 1KB9J 4JANA 4S0SD 3R4DA 2OLDA 4K71C 3HZMB 1UZ6F 1UB5A 3FB7A 4N0UE 4YFLI 3VFVA 2GTWB 3VWKD 3G6JE 1OT2A 1GZQB 4HGMA 1MJUL 3B9EA 2DWEB 1E6JH 1NC4A 3MLUL 1A7PH 5BVPL 1AJ7H 5GRXG 3UPAA 2VLLA 4LLVA 3OGCB 4HJ0C 2H32B 2XKSA 4UINH 4JFZL 4KQ4H 1D9KD 4BKLB 2R15A 5FXCH 1NCDH 4BFBD 2WAHA 2JCCA 4AK1A 4Z7WF 1MLCA 3G04B 5HY9B 3ALWA 1XZ0A 1BJ1J 1TDQA 4PG2A 5I75B 4LU5H 4WUKH 4PRID 4NNXB 3HR5A 4V2CB 4C54A 2H32A 1NAML 2FR4A 3CDGA 2FJHB 4KZDH 2DL2A 5IT2L 5F1IB 1GPOH 1FFNB 1UCTA 5B39B 2I9LA 3OKDB 4Y7MA 5D7JA 4JZOB 4PGEB 3IJSB 3CK0H 1T04A 2CKNA 4RQQB 4WV1B 3TIEB 5EZJB 4W4NA 4EZMA 1OLZA 1FH5H 3ARDA 1K3IA 4FMKA 5FV2A 1MCWM 3MJ9A 4BQBA 3MCKB 2AXGA 1MCQA 2A73A 1FFNA 3QG6B 5JO5B 1OWRM 2I24N 5JHDA 1YPZA 4NOFA 4PBVC 1DVFD 4YDIH 4G7YH 3NFSH 4HWBH 4U2ZA 3W2DH 1T04B 2FGZA 4UIMB 2FGWH 3S36L 1I7RB 3QZWA 3MOAH 3QQ3B 3MJGX 3VFTB 5I76A 2HLFD 4KRNA 4YK4B 1QR4A 1ZA6B 5DMKA 2XZQH 3MOAL 5DK3A 5HTSA 2ICWA 4OLZL 1KACB 5IEHB 3ROLA 1EMTL 1F58L 2IG2L 4PJCF 5GGTA 1WZMA 3H3PL 4KY1L 1NJ9A 1LO3L 4QXUL 3MR9A 5IFHH 2DM7A 2DWEA 2K7QA 1ES0B 1ZWIA 2HN7A 3NOIA 4X7SL 4ZOAA 4FTVE 1HYSC 3EIFA 3SDAB 1NUDA 1J88A 5JPMA 3V4UH 4I0PD 3RI5F 5C0CA 1TJGL 5KANG 1T5WB 3DBXB 2P45B 3BJ91 3D85B 3C8HA 4Z0XA 1QBAA 5IMOA 1WUNT 3LN5B 4KMTL 3HB3C 2X4TB 1YEGL 1HKFA 4O5LH 4XP9L 3WD5L 4WWKD 5FYKD 3DSFH 1NGYB 1S7QB 2XA8H 1XZ0B 1RZ8A 2EICA 1JI1A 4M43H 1ACZA 5GSVB 3PP3H 4ELME 1FFQA 3Q5TA 3VFUA 1KULA 3CVHH 3TVMC 4LLAA 3VFOA 2VDLL 1FO0B 4LVOC 4PJAB 2Q86B 3DBXA 5I1LB 2OQJB 4HH9A 4I4WA 4OCRL 4L3EB 1H8SA 3RNQA 3ULSA 1RUKL 4JY6A 1R3LA 3BGMB 4C58B 4TOYH 2IANE 3PWUB 2WBWB 3S98A 4WFED 4J12A 4HIIB 1N4XH 1U95A 2F53B 5EZLB 1QBLH 2HFFA 1CCZA 2AQ1A 1A6ZB 3JWDH <