2O5XH

Crystal structure of 1e9 leuh47trp/argh100trp, an engineered diels-alderase fab with nm steroid-binding affinity
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
QVQLVQSGPELKKPGETVKISCKASGYMFTNYGMNWVKQAPGKALKWMGWINPYTGESTFADDFKGRFAFFLETSATTAYLQINNLKNEDTATYFCARGTTIVWAMDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chimeric antibody Fab 1E9-DB3
publication title Closely related antibody receptors exploit fundamentally different strategies for steroid recognition.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2006-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2o5xH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2o5xH02
4LCYB 4HV8A 3SY0B 5FGSA 4LSSL 1J88A 1T5XB 1MUJB 5JW4M 5IGXH 4MA3B 3FTGA 1CU4L 4M6AA 4LFHG 1J1XL 4MS8C 5CZXC 3RBSA 3VGDA 4LCIH 4WHTA 1ZTXL 4R97B 5I1GH 1PBYA 4NKMB 4NBZB 2P44B 2R4RH 2AK4D 5ICYA 3MNZA 3LEYH 4QOKB 1RMFL 1SEQH 3RDTD 2BNQD 2XICA 1TITA 4OCRL 3ROOA 4OD3L 4NRYB 1GGTA 1JGVL 2RBLA 1CFVL 3T2PA 3VXMD 1T80A 3HRPA 3NAAH 5ESAB 1IGMH 4I3GA 1ZHNA 4R4FH 5JO5A 1CQKA 5CINH 2HJFB 2VL5A 5IEKA 3VFMB 4YHNB 2WW8A 4OF6A 2W9EL 5EU5B 3O4LA 2X1OA 2D4FA 3QUMA 4A2LA 5ESVB 2XT1B 2WBJA 4WEBH 4Q2ZA 1I1FB 1HINH 1JV5B 3GKWL 4DVBB 4GG8A 5ISZA 5IHLB 1KXTB 1RUQH 2WINB 5HGBB 4WNQB 5I74B 5IWLC 4JQVA 4EI5A 4MS8D 4PJ9C 2IJ0C 3QXDA 3L7EA 2R1XA 3KPSA 1KPRA 3OPZL 2EDHA 5BW7C 3O11B 3WFBH 1D9KD 5FCUH 1D5MA 1T1XB 1W72L 4NFCA 4OZGB 3TBVB 3IKCB 1GL4B 3P73A 4NDMA 2IANA 2A9NL 5EIIB 4L3EA 1VEOA 1LEKA 2P47B 4OF5A 3B43A 3C8KA 1BX2B 4KC3B 5E1AB 5CP7B 3MMEB 2EO9A 3FHAA 5AAMA 5IROC 1QNZH 4BZ1L 3U2SB 1UVQA 3SPVB 2M26A 2XKNA 3TYGL 5SWZD 4TQEL 2HKFH 1RZJL 1J12A 5FXCH 1KFAH 3RAJH 3QFJB 3QDMD 5SWQB 4HZLA 4H0GA 3WIHH 4I48B 3FQUA 3IETA 4ZO6A 3BKYL 5DRXA 3QJFB 3LQMA 4ZOEA 1P1ZB 2A6IB 3MZGB 3O6FA 3VD7A 3GBML 3GHEH 3U79A 2VTFA 4P3CH 1NLBH 3R8BB 4GAGH 2HLAB 2H32H 2X1WL 1AJ7H 4YQXL 3L9RA 5ILTH 5GGVY 2VLLA 1R3KA 4N90E 5M94B 4MDIB 3IU4H 2OZ4H 1CICC 4OGXL 3IFNL 1MCNA 2Y07L 35C8L 3JV4B 4PJ9D 2G5BB 3O3AB 3PWLB 4E5XA 1CLYH 4KTDH 1Z9SA 4K8RH 2A77L 3VW3H 5IB1B 4P49A 2P24A 4KMTL 4R7DA 5EU6D 5I1AA 5EBMA 3PIQA 5F93C 4Y19A 4QRPE 4GRWF 2QSTA 3BD3A 5IF0A 3CXDH 1WISA 4JM2F 5AUMA 4ZUTB 2NW3B 4JKPH 1XIWA 4HFUL 4HK3N 1KB5H 3MJ8A 2H2SD 5DHVB 4XMPL 4ZOBA 1BQLL 1IGIL 1CFNB 5D96C 2E7HA 2MQCA 4XXDA 2IWGA 1A3QA 2VUYA 4LHQB 4D0BB 3DGCR 1HKFA 2FZ3B 3NBNA 1G0XA 2OTWA 2KPNA 4RMRA 3WMSA 5BS0B 3S3SA 3EJYC 3BVNA 3NA4A 1YA5A 2F8VA 2GHWB 2VLRD 1QSEE 3KPQB 2QADC 3CFBA 3LN9A 4OD1L 4CW1B 5JA9A 3MOBL 3X13A 3SKMA 4LU5H 4IRSB 4M43L 2KZ1B 1TETH 5I1LA 1C5CL 2BVPB 3BPCB 4XAWH 3U9PL 2BMKB 4JN1H 1F6LL 4OZHA 4Z78B 1CICD 5HVGB 2ERJC 2R2BA 3TBSB 1M6OB 5L6YL 2BNRA 1YMMD 4QTIH 3EDFA 1FG2B 5T1KA 5I66B 1DQQA 1BOGA 3OR6A 4JQIH 1JMZA 1WZLA 1JJUA 2ARJQ 5C08D 5D7KD 1A4KB 4Y5VA 4LMQE 3RGHA 4DFHA 1RK0B 3TT3L 1PX3A 4EXPX 1EHXA 2BRRH 3ARUA 4K23H 5D7JA 5KVEH 1PZ5B 1V05A 4RGOL 1B3JA 2DKSA 2ZUUA 4OQ1A 5D2NE 5C8JA 4WW2A 1IVLA 1MWAB 4JLRA 1RUAH 5FB8A 2EICA 5DTFB 3IDMA 3LS5L 3UO1H 2XWTA 4GRWB 4LMQI 1A14H 2OJZH 4GW5B 4PTTA 5SX5H 5L0QB 1C5DB 5E8PA 4OV5B 1YPZE 3RZCC 5C3LD 1VACA 5DSCA 4P4RB 1L9NA 1I8IA 1NPUA 4CNIA 1ITBB 5CCKL 3VWJB 1ZEAL 1Q1JH 3FO0H 4MAYB 4N0CD 2V2WB 5AWNH 1YECH 1UM4L 3VRLE 1Y18A 3R1GH 4PJDF 2H32A 4J3OC 2Z8RA 4M9PA 1KTDB 3EJYD 5FYLD 2P5EB 2QADD 3DVIA 4G5ZL 1SEBB 1BECA 2OZ4A 2YPLD 3BKJH 2EXYD 3MYJB 3OKEB 3ZT6A 3F58L 4LSUH 3RTQB 5CS7A 4U6YA 4L29B 3SDAB 3WL9B 4YBQC 4MQXD 5ITBL 4PJHF 1A2YA 2VZTA 3GJFK 3NCFB 3KJ4C 4DN3H 2ADFL 4ONFL 2VZOA 5B38G 2XZQL 3CSGA 2ZNXA 2PO6B 3CX2A 4XNXL 2VLMD 4KKBC 2ED8A 2FHBA 1BQSA 5DUPH 1VGKB 2ATKA 3UDWC 3RGVC 4D2NA 1DFBL 5GRJH 1SY6A 1JZ7A 4HLZH 2V6HA 4G6KL 2IFFL 1BD2E 2Z0BA 3C2SA 3NH7H 4JPIA 4KJQC 2XXCB 4WU7B 5HYSG 2R15A 1EBAA 4X5XA 4ODHH 4PJCE 5HYSA 3RZCD 5KSAA 4ZNEA 3QIUB 4PP2A 1PD6A 3OX8A 1GIGH 4PJEF 3K1DA 3P3YA 1A0QL 4M6NL 4M02A 4UAOC 4RQQB 1YUHB 2JCCF 3MRHB 4M1GH 4QHLA 5C0DB 4JCLA 3BI9X 3RY5A 4W81A 3PDOB 4MHHI 4BFEA 3RJDA 5E6IA 3PNWB 3UZVB 2VDMH 2D2OA 3O45A 4OUOA 4LHJB 1JNLH 1R3HB 5TPWH 3S96A 5FYLL 4YBQD 2MHAA 2CLRA 3DV6B 4CN1A 4PJBE 2YD3A 2PCPB 3CMOH 3IFOB 4P5MA 5C09A 5DVNA 1QRKA 3CFIC 2WSKA 4Z9KB 3O0RH 3WEXB 4KKBD 2XN9A 1IT9H 4HKZA 1NC4D 3C5ZA 4ONOA 3DJ9A 3RL2A 3RGVD 4X4XA 3BJ91 3QDJD 1JP5A 1WEJL 4ZD3L 5CZVH 1N5AB 1UB6B 4MB4A 5C0BD 4HG4J 1B2WH 4P5KA 3WHXA 4KJQD 1XR9A 1JGLL 2OXGA 2R1YA 4HMEA 3PQYA 1N59B 2Q8BL 3MXVL 3C5JA 2R2HA 1QFUH 2I9TA 3QNYB 4LLQB 4FQHA 1M71B 3MZTA 3MJ7B 5ID0B 2EDNA 4AEHH 1HEZB 5T1MA 5E6YA 3D6GA 1FLRH 5FA4B 1MCDA 4PJEB 1DBAH 1T20B 3BN9C 2JCCB 4JRYA 4JZJA 1K4CA 3VD9A 2QR0A 3S34H 5HGHB 5BJTB 2X4NB 1UEMA 1NGQL 2XG5A 3LHPH 1F2XK 5ESQA 1EXUB 4HX1A 1CQYA 2IPKA 3NCCB 4NQEB 4HLZG 4TSBH 4ZFZA 3AAZA 1ACYL 1A3LH 2CUMA 3DXAA 2RHEA 1IQDA 5KS9F 3GGWB 5C9KA 1N64H 3MV8E 4HG4K 1SBSH 3G6DL 3QHFH 2BHUA 1J18A 1R5VB 1JHLH 1T22B 1HZHL 2OJEA 4MAUH 1G6VK 4PJXB 3UTTB 4IRJA 5K59E 4GKZB 3LQZB 1MAKA 3HNSL 2VXSL 3FO1A 2HFTA 4JO3H 2BSTA 4MNHA 2JIXB 3D2UD 1TZGL 2DQEH 3IXAB 3S35L 5HHQB 4P46C 4PJFA 3BN9D 4HIJB 1HHJB 4K3GA 5EN2B 2OQJA 1FJ1B 2I07A 1JGDB 5KSBA 3KVQA 4MX7B 1OAXH 5GRZA 3I2CH 1QVOA 1C8PA 1FNAA 4S1RH 3PDDA 1JF1B 2FCBA 3VRIB 4ZFGH 4G6AC 1AIFB 3W9EB 4JDVA 4F2MB 1TTGA 1I3RA 2ILLA 2H26B 1ZA6B 4GKSA 4ELME 1QBLH 3MR9B 4L8DB 1H8NA 5D1QC 3T2QA 2ED9A 3BH8B 1RIUL 2A83A 1MHCB 3BZ4B 4M6ML 4NN5B 5F89A 2BOCB 1NCUA 2ZCKL 3OXSB 5KS9B 3AM8C 4EOWL 1A5FH 2HJLB 3F62A 5GRVK 5HYIA 1J8HA 4JR9L 1YDPA 3RKDC 5GIRA 1HYRC 5FOBA 3KNBA 3WIIL 3CD4A 1N0LA 5JPMB 2BC4B 5DJ0A 3MJ9L 4U1HB 4UV7L 4QT5A 1RJZA 1A1OB 4Z0BL 4YO0B 1KEMH 3C08L 3SGDH 2BCKA 2I25N 3IAPA 4E0RB 1HWGB 4G9FA 1MLCB 3SKJH 2C7UA 1SJHB 2DDQL 3NFNB 1IRAY 2UYLB 3L1OH 3NCBB 2P1YA 4LIQL 3K4ZA 1KB5B 3A6CH 2X70B 1UZ6E 2ADIA 1OD7A 4G6AD 1B0GA 1N8ZA 5L8JB 4XP5H 5B3JE 4CJ1A 3KXFB 4X7SH 4M8QA 3RX5A 1DBML 4UTAL 5D1QD 3QG6A 1IAIL 4OCLC 3PP4L 4JM4H 2GT9A 1AI1L 1UM5H 2GCYB 4PS4H 1R3LA 3G5VA 1LP9E 1EHAA 1YEKH 1VFBA 4UT9L 4XC1L 3QYCA 5TQ2L 2RJMA 1OL0A 3RKDD 1F58H 2EH8L 3OKKB 2WUCL 3AREA 2ZUWA 2CXGA 3QQ4B 3J8F7 2PYEE 3RL1B 2WWMC 3ZSSA 4EN3A 6CGTA 5JW4Q 2QHRL 3GJEA 4MNQE 4WV1C 2FJGB 4NO3B 3W2DH 4Y5XA 3BP5B 3GK8H 3H9SB 5J12C 1EAJA 1N3NB 3OKNA 4H25B 4ZUVB 4PUBL 4LLMA 1MVUA 2H1PL 1QSZA 4GOSA 3ARBC 1QA9A 1HSAA 4FQQB 5AYUL 1DTUA 1R0AL 2YZ8A 5DJXB 3DHMA 3E3QE 3J7HA 5LAXB 2EYTB 4YHPB 1NGWA 2IF7A 3PL6C 1ZTXH 1NMCC 4R4BA 4YXKH 4JPKL 4C83A 3GBLA 3C87A 3B4NA 2DN7A 3KPOA 4N90D 5BQ7B 3T65B 3DSNA 4GAJL 2XA8L 5D2LA 3DIFA 3K1KC 2N56A 4LDOB 2XXMB 1RMFH 3FRUB 4OAWB 1XF2A 3O2DH 4OJFL 2Z35B 4U1LA 1I8MB 1BFOB 4OD3H 4HS6A 4Y4KC 5D7LA 5FDWB 2VMFA 3CH8A 1QLEH 4P4KA 2EKSB 1IM9B 2NY1B 5BRZA 5I73B 4QRPD 3VFWB 3FQRB 1WFTA 2DQDH 4ZQKA 1SYVB 3ZKNC 1FL5B 3IDGA 4AEIH 5D2NC 4YDIH 1F3JB 2WWMD 4PRHD 2VLKA 3VXTB 1XGYL 3VGAB 4YEFA 3JZ7A 3PWPE 5KSVB 3VFNA 1NFDF 3QIBD 2HMIC 4S2SA 5ERWB 5EC1B 2HP4A 4L1DA 2Q7YA 4AT6A 1E4KA 3ARBD 2C1OB 1F4XL 1FVDB 3DWTA 5FO7B 3VFPA 2IPUG 3MFFB 1YEHL 5LGKA 3HPJA 1RZ8A 4PJAA 2GITB 4WI3A 1P2CB 1QSED 4PB0L 3PL6D 5IMMA 1JGEA 3IYLW 5FCSH 3MRIA 3WHE1 3NN8B 1CGYA 3OPZH 2WWKT 4CVXB 1T83C 3ES6B 4F9PC 3K4DA 1UH3A 1T5WB 5I8OH 2EDQA 1W72H 3MBXL 3BZDA 4JHWL 1JPSH 1AGEA 4L8SC 4K7FA 2ATPB 1JYWA 5J56B 1TFHA 2XACC 5DVLA 3QULB 1CTOA 1V3MA 4Y4KD 5H8DA 4HGWB 4LVOB 2DIJA 2APFA 5E24E 4BZ1H 4J1UB 4NNYB 4YUEL 3VXUA 1FFNA 4XBPA 3ZKND 1RZJH 1ZA3B 3IRPX 1NAML 1CL7L 4XWGL 3QT2A 4ZSOE 4KKCD 3MRQA 4QHNB 4XP9L 5IG7B 2DI9A 5FUOL 1IC5L 5F3BA 3LRSB 3NMEA 2YD6A 2DLFH 2X1QA 4LSPL 4PJ8D 5I0DA 2MCG1 1HIML 2W1NA 3BP7B 4D8PB 1XGQA 4GT7A 1TPXB 3NPSB 2HMID 3HI1B 4YE4L 1BFSA 5T1LA 3IDJA 4CMMA 5CD3A 1REIA 4JFFB 1NFDB 5ID1A 5E03A 2RFXA 3P4OA 4HIIA 5KZCB 5JOEA 4LL9A 3IFNH 2Y07H 5H94A 4LLUB 3H2WA 4L4TE 2CLVA 5C71A 2ICEA 4X6EB 4DZBA 2P4AB 4X7TA 1D6VL 5ANMA 2UVFA 4DW2L 4OFKA 2F53E 2J2ZA 4GQ9H 1G6RB 4TRPH 3IDYB 2VWEE 1E27A 2ICWB 5JHLL 1KCSH 5KVFH 3NTCH 2FYYA 3OKLB 2W07A 5HYFA 3GM8A 2AJSH 3V4PL 4WGVB 1OTUC 4HIEB 3D39E 3K74B 3QCTH 1O7VA 3MA9L 1RZ7L 1YYMH 2BVOB 4PRPE 4R0LA 5M7QA 3M8OL 5F7LB 3KJ6L 1UKQA 4HXAL 1UZ8B 4XPFH 1RK1A 5E8NB 2ENSA 1QR1A 1F90H 4NRZA 4PRAB 1BD2D 4MA8L 4NM4H 4ELKB 1DN0B 3NIFF 3LEXB 4OD1H 5IW6B 3V5KB 4KDTC 1N6QH 2OYPA 3EYUL 4R9HA 4Y7MA 4Z7OE 2NY4C 5DRNB 3VXNB 2HTLC 2QQLH 1MFDL 2CH8A 3MRNB 2B0SL 4OCXL 1C5CH 1CZ8H 1BGXL 1F8TH 4ZFOA 1JHTB 5EO0A 1DLHA 4WWKC 4KRLB 1FNGA 1WV7T 1P4LB 4GMSL 4J8RB 4JFQB 5AD0A 1W72A 3GUTA 1S7UA 1LO0L 2YS4A 1RZKC 2MQ0A 2R29L 2VXTL 4I0CC 5K93A 4U1NA 1CDUA 5AYQA 4YAQA 1U3JA 5I8EA 2AK4A 1YEIH 1V3JA 1FQ9C 4PJIF 3BKCH 4PFEA 5FK9B 3MGOA 2QQKL 3NCEB 2BNQA 3RDTA 3GIVA 3UTSE 3SBWA 1LHZA 4EI6B 4U7KA 4AM0A 4LLWA 4HKBA 1RZGB 1NGYA 1LO4L 5HDBF 3S88L 4F8QA 4RGNB 1OTUD 5IBUB 3W11C 1UJ3A 1NGXA 3VXMA 3MRJA 2EYRA 2AI0L 1QRNE 4MXVF 3VWKC 1R24B 2Q3ZA 5FO9A 2A6DA 4Z7QF 1SJEA 1LD9A 3MNVA 5CCKH 1ZEAH 2AXHA 4F7EB 5E8EB 3L95A 4X0KB 1UM4H 1J0HA 3HC3H 2X4UA 5J0BA 1PLGH 1FNLA 5C9JA 3MGAA 5DUML 3QEQB 2YPVL 4PB9H 4RZCB 1AHWB 2VAAB 3P9MB 2IALB 4J12A 4OCYL 2NY4D 2HTLD 1YMHB 4OZIE 1RVFL 3FCTA 2VXUL 3AU1A 1PKQA 4XP1L 4XNYL 1NMBL 2X4PB 3W39B 3QH3B 1O5DT 1U8LB 1JF5A 3VI3E 2R0WH 3GMNA 3NIDF 1DBJH 2ADFH 4ONFH 1D9KA 2DL9A 4L8BA 5TE4H 5LKNA 2XZQH 4TNVF 1INQB 5T3XH 4HZAA 4NRXA 4NWUL 2MTPA 1EH9A 4UQ2B 5I1EL 3WFEH 3F7PC 1DFBH 2E5EA 1FGVL 1I8KB 4NGHL 4PJIB 1OSPH 1PG7L 4MJ5B 3W11D 4NZDA 5C0GA 5CSZB 4XCCH 1GGUA 2IFFH 3VWKD 3KR3L 5SWZA 3S37L 2Z31C 4YXLL 3MV8D 1W0VA 3C09C 2C5DC 3RNKB 1YY9C 3QDMA 2VYRE 5DD5H 1OD9A 4O5LL 2X4QA 3FQNB 4JHZA 4N5EC 4JY6A 3KLSA 3MV11 3BESR 3LSOA 4NBYB 4X99A 2FB4H 3WO3B 4X9IA 1FL6B 3V9FA 3LKPA 4XVSH 4TUJA 4LRNL 4G7YH 4F7PA 4RAVB 4G6JL 2JF1A 5FYLH 1A9EB 4HKJB 3ULUH 1T1ZA 5IWLA 4C4KT 3N9GL 4OLWL 1CXHA 1JPFB 3F12B 4PJ9A 3CZJA 4NO0D 3ULSB 3EO9L 3IT8D 4L8CB 2YBRA 2YD7A 3L5HA 5BW7A 1MAJA 4OI8A 5E8DL 5TJWK 2XFXB 3PV6B 4M7KL 5EU6A 3C2AL 3LB6C 4M3JA 1RZKL 1U8KB 3QEUB 2ZOLB 4G80B 2E9JA 3MLRL 2BZDA 3EYFB 1I7TB 2ESVB 3WJJC 5MI0B 3U4EA 3KPLA 5CEYB 3KYNB 1YNLH 5IROA 2VE6A 4ZD3H 4QYOA 4Y5YC 2GJZB 2MKLC 3Q3GA 1FO0B 4LASL 3QJHB 2DQUL 5MP6L 2Z31D 4BSWB 1JK8B 2Q8BH 2SEBB 3MXVH 1YY9D 1BFVH 3TA3B 2PXYC 2YUXA 4M7ZC 1WAAA 1BWMA 4N5ED 5D93B 2VLRA 2CLZB 1T1YA 3DX7A 3PHOB 4HD9A 2E27L 1JPGA 4KV5F 3KPNB 2VDRH 3BDYL 3OMZA 4LQFL 4XCNB 2CDEA 5D72H 4YHIA 3GSNB 1CICA 2UWEF 3VFTA 2XQYK 3CK0H 1KLUB 3RWDB 3BT2H 3T0EE 2OBGA 5GXBB 1EO8L 4FQ2H 1YMMA 4KI5F 1T2JA 4LEXL 4O2CB 5GZNC 1QO3B 4HK0B 4XRCB 5IR1B 3CFDA 2X09A 3DHJA 5KSUB 3QI9D 4FFWC 3BEVA 3LB6D 5C08A 2CDGB 5TDNA 2G9HB 1KV3A 5KJRH 3CLFL 3E3QC 1MCWM 4X80H 1QR4A 4KUCD 3L3DB 4HPYH 4WUKH 5DJCB 1JCKA 1IGFH 4POZC 5DK3A 3MLZL 1MLBA 2CKBB 2CGRH 4X6CA 3SDXA 3VXSB 1CBVL 4HULB 4OKDA 3ARYA 2Q86B 4F7TA 1HZHH 1UXSA 4WUUB 2A0LC 3RRQA 5GS2D 1PSKL 3UP1A 3GRWH 3OXRB 2JJVA 4HF5L 2AJZB 3L3GB 2PXYD 1FAIH 3HNSH 2CO6B 3RI5F 1XF1A 3MRDB 1CDBA 3GM0A 5ACZB 5T3ZE 4RFOH 2YPLA 2FGWH 1Z0NA 3P9LB 5EO1B 2PYED 4ODXB 3TCLA 4LNRA 5EU4A 3D0VA 2EE6A 1XGRA 4LARH 2VAJA 1CR9L 4JO1H 3NGBC 4MNQD 1GZQA 4P99A 3TBWA 1SQ2N 4TSCH 2OSLA 4Y2DB 43CAB 4XWOC 5C07E 3V6ZB 5DJ2A 5IEHA 2G5RA 1KTLB 1E6JL 2NY0B 4RIRA 1LE9A 1KF9B 5GZND 1W8OA 5D1XD 4OF3A 2UWEB 3SKNA 4AMKL 4FFWD 4UDUA 1MCLA 5FA3A 5TF1L 2ZG1A 5LBSL 1LO2L 1IC1A 4N68A 3TO4C 1AY1L 1TJIH 1S7RA 5J1SC 3DLQR 3HC4H 2XYCA 1AE6H 3OGCA 5I75C 5EZLB 1Z6JT 1N4XH 1LWRA 1NANI 5DZNA 4POZD 4AG4H 4GBXC 4EOWH 3KPTA 1RJCA 3LKSB 4X98A 5EBGA 1KIRB 1NEZA 3RZCA 2QV2A 1E4XI 3QAZC 1WZ1L 2YUVA 5DO2C 4JVUA 4YGVA 2E6PA 5D6CA 6FABL 1CFSA 4UV7H 2VXVL 4ZS7H 5HY9A 3C08H 1HH6B 4WVRA 3ZE0E 5F1IA 4UDTB 3KLDA 1BLNA 5HDQL 3RU8L 4YHML 5E9DB 4L5FH 5TE7H 5DS8B 3BMVA 1X44A 3BD4A 2IMNA 4HH9B 1AGCA 3PWPD 5FUZH 4I2XA 3NA9H 4XWOD 4EDXB 5D7IF 4LK4A 2X1XR 3DURB 3ILQC 4NQCB 1FORL 5D71L 4OSUH 1D5BA 1SJVA 2GJ6B 1NC4A 1NKRA 1I7ZA 3TO4D 3UDWA 4Z7UF 3SOBL 3RGVA 3TESA 4PJ7B 3QDJA 3IGAA 4KZDL 4MVBC 2MPAH 5CWSB 4P59L 4X9FA 3QHZH 2VH5H 1UWEL 4XC1H 2ZSWA 5C0EA 4X5WA 1Q0XH 5HDOA 5C0BA 5TQ2H 3NVQA 4ETQA 4U0RC 3ARDC 5A2FA 1WZKA 3LKQB 3E1F1 3JTTA 4LHUB 1U91A 2EH8H 5GJTL 1A4JA 2WUCH 3PGCB 5DO2D 2DTML 3TWCL 4IIQC 2JB6A 4U6HA 1N7ML 1CYGA 3QUZC 3OJDB 4S0SD 4BSVA 3HB3C 3G5XB 1L7TH 4D9QD 5J1AB 2IG2L 2GFBB 5CLTA 3HMXH 3L5WA 3KYOA 3GMMB 2VKWA 1Z5LB 4NQSB 4EUPA 4L9LB 3MROA 2VISB 2H1PH 2BY2A 2GSGA 3P11L 3LS4L 3NCYP 2AS5M 2P5WE 2NY2C 1ZVSA 5AYUH 3OWEA 3KS0H 1TIUA 2FD6L 4BFIA 3NZ8B 3ILQD 3I6GA 2GUOA 1TJGL 2ZUXA 1EHNA 3PWUA 4I3RL 1OVZA 2P46B 3RKPA 4ZUSA 1BQHB 2NZIA 5D7IB 4DCQA 1KBGH 4GRLD 1FV1A 4GAJH 1H5BB 2ARWA 4PV9A 1P7QD 3ET9F 3HI6H 4MVBD 4ODVL 4OJFH 1JF6A 4OT1H 4L4TD 1UJTA 3CDGA 1X7QA 3CH1A 4H1LH 4M5YH 4O2EA 3LN5A 2WZPD 5DQ9A 2V5SA 2F5AH 3ZL4H 3MJ9A 3QQNA 2IH1B 4MNGE 5I6XC 4HT1L 1KN2L 3MO1B 4Q7DA 2YD5A 5CSGA 3WO4B 5GSRB 3QUZD 3D39D 1L7IL 1XGYH 3HB3D 1KLGB 2VITA 3D2UA 4V2CB 1AP2B 4YZFE 1E28A 3V8OA 4PRPD 1OTTD 3DVGA 1GGBL 1I1CA 1S7QB 3MRBA 3MRMA 1X4XA 3KPPA 4X4ZA 3RVTD 4FQCH 4TULL 5I1HH 4OZGE 4L4VA 2B1HH 2NY2D 4QF1B 4QTHA 3NZHH 5GS1A 5K9QI 1U3HC 3STZB 3D69A 1QFWH 4BKLA 3C6LC 4PB0H 4QXTA 4FQXB 2VSCA 3T08A 4Y4HB 3O3BB 5E7BA 4EQ2A 4B7LA 4RFNC 4EZMA 1AKJD 1MIML 5MENB 2L0DA 2IBBA 1FRGH 3UCRA 3VGBA 1GOFA 2H6PB 3UTZB 3DOSA 1S7SB 2BXYA 4JAMA 5I76A 4KDVA 1MFCH 3LMJL 32C2A 1UYWH 5E5UB 2X4OB 2GTZA 3IDXH 1CE6B 3UTSD 3U0PA 4HV8B 2ADGB 4XWGH 2BSSA 4U6XA 1AQKL 2P8PB 3VXRB 3FTGB 4MD5A 4I77L 4OI7A 1LK3H 5JMOC 1U8HA 5SV4A 1QRND 1HIMH 4WHTB 1TENA 4UINH 3MRGB 3S4SG 1KENL 3GB7A 3S4SA 3QPQC 4LPUA 2YMXL 5ICYB 2FEEL 1KB9J 5CGTA 1ZLVK 2Q1EA 1FFRA 5C0AE 1U3HD 4HUXA 3ROOB 3GSOA 5CZKA 3C6LD 3U0TB 3EYOA 3EJZC 4K94C 3RBGA 5GHWH 1B0WA 5J13C 2A6JB 4H1LG 5D1QA 4NKIL 4KVNH 4H1LA 2R0LH 2GJJA 4R96A 1D6VH 4DW2H 5JO5B 4U1GC 4LSRL 1CLCA 4YHLH 4HHAB 1OAZL 4H8WC 5IEKB 5GGRA 4PGCA 3V6BR 4HKXB 3O4LB 1KSRA 3V4VL 5DQJB 1S5HA 2ITDA 2DLTA 4HAFA 4LCCB 5FO8A 4HXAH 4GG8B 2YA1A 4HK3J 4Z7WB 2YD9A 2VJXA 3UYPA 1YNKL 1LDPH 4MXWH 1IGCH 4MCZA 3T0AA 1IEBA 3QXDB 1KB9K 3L7EB 1J5OL 3KPSB 4MJIB 1KPRB 2YEZB 1ODAA 2YSSA 3EYUH 4JG1L 1D5MB 4OD2A 3QPQD 1MFDH 2B0SH 1AGBB 5JDSA 3ECBA 1G9ML 4NDMB 2IANB 3QUYC 4L3EB 3L3JA 3RP1A 5F71A 3O9WB 3C8KB 4NWTH 5EFIB 4S1DC 5CJQL 4HS3A 2APTA 3EJZD 3QIWB 4JFZL 3H9HA 3LDBB 4M1DL 4WI8A 4U1KB 4XNZB 3BYYA 1VFUA 1NBYB 2DKUA 3T1WA 2CJUL 1FIGL 2LAGB 2VDQL 3T0EC 2VABA 5E00B 3LIZH 5EBLA 4LVHB 4HZLB 1FP5A 2V5TA 1MCPL 3S88H 2AXFA 3IETB 1G7QA 5EUOE 1NAMA 2YN3A 3QQ9D 1XGTB 3ARGB 2P5EE 2VDKL 3OJMB 5DRXB 3WFHA 1KPUA 2V5YA 3E2HB 5EH1A 4QRPA 2J3SA 1ORQA 2QQQA 4WW1A 3O6FB 3F6LA 1F45A 4OZHF 5MEPA 2J4WL 1JI1A 3HRZA 4PRHA 3L9RB 5L8LB 1R3KB 2QHLA 4WV1A 2R23A 3V79C 4URTB 2KQNA 1B88A 1V7NH 5EWIH 3B5TA 3QIBA 4KY1H 4E5XB 2L4OA 1PQZA 1VFOA 4AEFA 1M05A 1UH2A 3ARBA 1MRCL 2G75B 1E6OL 1HNFA 1MFEH 1Y6KR 3MRFA 2C3VA 3BPOC 2BY0A 4JFHE 4Y19B 2BSED 3QUYD 1QLFA 5GGVH 1QSEA 1NMBH 4S1SH 4NZUH 3PL6A 4KMQA 5D5MB 2FATL 2O5XH 4S1DD 3S35X 2G2RA 2ID5A 1IEAB 3OAUL 2WANA 3WUWB 1WWBX 2LVCA 5DJ8A 4LAJH 4K94L 1QSFB 5I1EH 3T0ED 4HSQA 1GRWA 4YR6A 4Y4KA 2OTWB 3EYVA 4LPWA 3TLRA 4KPHH 3IF1A 1F00I 4NKOA 3IKKA 1DVFB 3QWRD 3CFBB 4QNPF 4H8WL 1FE8H 2BY3A 3HN3A 4ZAKB 5D2NA 4YXLH 4U6VH 5CP3H 5HGAB 5I1LB 1DCLA 5J9PA 2XOTA 1G9NC 1FVCB 5I16B 2AJYL 4O5LH 1HOCA 2FJHA 4MJ6A 1NCCL 4PJ8A 3VFGL 1YPZA 1B4JH 1P5UA 2WBKA 1HCFX 3K0WA 5DHXB 3T1FA 2BNRB 2LTQC 1M7IA 2NW2A 1BOGB 3SN6N 4LAQL 3TJHC 3DV4B 2IGFH 3EOTL 4KXZH 2DQJL 1S7WB 4XB7A 4EXKA 4Y5VB 3KG5A 3LZFL 1OAQL 3N9GH 1U8OA 4OLWH 1JYNA 5T3ZD 4Z77B 4JLRB 3ZDZF 5FB8B 3SGJC 3EO9H 3BWAA 5KVMC 4F3FB 3LPWA 5D1ZD 2XWTB 4PTTB 4GG6F 4JN2B 4KUZL 4YPGA 3V52L 2R69L 4M7KH 4LCUA 1FSKB 3C5SA 5F7KC 3OR7A 1OQXA 4G8FA 3T0DA 1VACB 5DSCB 1I8IB 5C07D 1OY3B 4R2GB 3MNWA 5HHVH 1A8JH 2AKRB 3QDGB 4X83A 2D31B 4OM1L 1EUTA 3OKDA 4QHKI 4Y8DC 3DETD 4DZ8A 3JUZA 3VE0A 2X4TB 4K7PL 4X7CC 1DP0A 1BP3B 5JIPA 3MACH 1VCAA 2JCCE 2DQUH 5MP6H 1T0NA 1BMGA 4FFZL 4OFDA 1I9RH 1A2YB 1BD2A 3TH3T 3IAGC 3TNMA 3O8XC 2FIKA 4PJCA 5EOTA 4CMHC 4FQIL 4NQEE 4KI1A 3ARFB 3CLEL 1DQLL 4KTYA 2AXJA 2E27H 3TJHD 4KKLC 2XWJA 3EYQC 4YLQT 5SX5K 4M1CC 3Q6FB 5KTEL 3BDYH 4YH6A 3A67L 2ATKB 1S9VA 3CFEB 4MDJB 3TZVC 4R97C 3ZSTA 2EDYA 1EO8H 4XCYB 3B9KD 1OWRM 1NGPL 1IAKB 3TPUB 2OMBA 3EOBA 1BIHA 4HWNA 3S9DB 5T3ZL 5HYEA 4DEPB 2X6MA 5IMOA 2YWZA 5BZWB 3GJFH 3DVNB 4PJXE 4MSWA 4PJBA 3GNML 4LVNB 3UTTE 3T77A 4PP2B 3CLFH 4GG6B 4WY7L 5EC2A 1W0YT 4IDJH 1ZT4B 1TJHH 2QKIB 3CSBA 4UT7L 5CP3A 1MCJA 3W0WE 1CBVH 3MLWH 5HI5C 1TCMA 5E6IB 1AQDB 3O45B 3S96B 3BZEA 3GSQA 3BP4A 4NFDA 5DVKA 4PYGA 3B6SB 3OG6B 4O51A 1WVZA 3VMNA 2VDNL 4B5EA 5GSVB 3I50L 3O8XD 3WFDL 4P5MB 4KDTA 1G9NL 5ALCL 5DI8A 4Z76A 5FM4A 5F1OB 2NY6C 3PWVA 2XN9B 4HKZB 3D9AH 4NO5A 4XBGA 1HILA 2DRUA 4ZUWA 4X4XB 4G42A 2AAVA 4L1HA 3TZVD 1NCAH 1NEUA 3FB5A 4YHZL 5JUEH 5DJYB 2E9IA 1OTSD 4AMKH 3WHXB 5FF6A 1XR9B 1UM6H 4NUGL 2FO1A 2P5WD 3PQYB 3T3PF 3C5JB 3Q6GL 1KN4H 2R2HB 1PAMA 3I6KB 3WE6A 2AGJH 4PJFF 2AJVH 3LD8B 1I75A 5T1MB 1A9BB 5KSBF 1ZLSH 1XF4A 1EAPB 2HT2C 3LCYA 5TDPB 1EGJL 4WO4C 2YXMA 2Z91A 1ZSDA 3VWKA 5HI5D 3AFLA 3MV8A 3E0GA 2C3XA 1EIBA 4M5ZL 1K4CB 1SM3H 2QR0B 1AGFB 4OFIA 3R06B 6FABH 2WIIA 5BO1L 1U8NA 2GK2A 1LEIA 3EDJA 5I71B 3O2WL 3QO0B 2NPLX 4JE4B 5GS2H 2IPKB 4P0DA 4A6YH 1JHKH 5HDQH 4YHMH 2NNAA 5K9JH 2NY6D 5IHUL 3NPZB 2B8OT 3AB0C 5ADPL 1T4KB 4RBPH 1QG3A 3WLBA 1FGNL 4NO0A 2VB5A 3GJFA 2JTDA 3EO1A 5I1JL 1PEZA 3DX8B 1IKNC 1FORH 4HWBL 5D71H 4X6BA 4LSQL 1J1OL 1RHHA 1X5LA 3C9NB 4XP6H 3V6FB 5FFLA 2UZYB 1JNNL 1LK2B 2OJEB 3GSWA 4IRJB 1T0MA 2DTSA 4DKFL 3BO8B 1WIUA 5KOVC 1A6UL 3NACL 3FO1B 2BSTB 1A7NH 4JPVL 2HT2D 1RFDL 4WO4D 4RNRA 2O93L 1U8PA 3H9SE 2NXYC 1JGUH 2Z31A 2I07B 3MLTA 3X14A 3TVMC 3MRKA 2DTMH 2XNAA 4LKCA 3S7GA 1FPTH 5F9OH 2V5RA 3MC0A 2DJ4A 4FNLL 1JZ2A 1DQJA 1S7VA 1X5XA 2IG2H 5IMLA 4IRSC 3BJLA 4GMTH 1I3RB 1DBKH 2CK2A 1CDIA 1QZ1A 1AC0A 3WXWL 4P2RB 4XNUL 3OZ9H 2AK1L 4XPBH 4U1SA 4YFEA 1YEEL 1U93B 4YIQB 1U58A 1I85C 1CWVA 4U31A 5CD5C 1MIEL 5IB5B 4QWWD 4YNYA 1Q9KA 2FD6H 3SGEH 3TBTA 4GW1B 3ZKSD 1FNSL 3F5WB 1JWSB 1TJGH 2IAMC 3QI9A 4M62L 4I3RH 2FLBT 1WICA 1J8HB 4CDHA 1OP9A 5C0AD 1HHGB 5DMKA 4PR5A 5FOBB 1UWGL 1XGUA 3WJJA 2PTVA 4AIZB 3PGDA 4QT5B 3K2UH 1NDGA 2VDOL 1ZWIB 1QFHA 3JUYA 4Y5YA 3BIKB 2NXYD 2EH7L 5CJOH 4HT1H 4DKDC 3VWJC 5IESH 1LP9A 3HE7C 2MJWA 3HR5A 2PXYA 5AAWA 4WFFE 4A6YA 2I60L 4LPYA 1ZANH 2FHFA 3REWA 3VH8B 2ADIB 4I13B 1B0GB 1N8ZB 2PTUA 4PREA 1IAMA 3X12B 3DMMC 4IRSD 3WJLA 1GGBH 2YD2A 5D2LF 2PYEA 4M8QB 4KHTL 5J4MA 5SX4I 5INDA 1F3DH 4UIKH 1U6AH 4MNQA 3ZDXF 4KROB 3ZE1E 2E8YA 1BZQK 4D9LL 2GT9B 2PTTB 5CD5D 3G5VB 5CAYB 4LKXB 1MH5A 1YC7A 3BGAA 3FB7A 5DVMA 2VO5A 4X6DE 5D1XA 1GXEA 3HC0A 3U46B 4E41E 1FFOA 1U9KA 3MUJA 1MIMH 3S97C 3AREB 5L9DL 1G7MA 1LDSA 4YWGL 5JOPD 1DL7H 4Y88A 4CKVX 4EN3B 4YBLB 3GJEB 4DOHB 2D03H 1U8IB 3NCJL 2C4FT 1HN1A 2OXHA 4TPRL 4OQTL 1J0JA 4Y5XB 4KVCL 3LMJH 2A6KA 5A2IH 1D5IL 2WBJC 1F42A 3ROLA 3VWJD 1YEFL 3FO2A 3HE7D 5FYJE 1MVUB 1HSAB 5L88H 2IPUK 4ODUB 1MCBA 3L5JA 2P5ED 4I77H 2I9LB 4LFHD 5IKCB 1WBYB 2EDTA 1NGWB 3QDAA 4MB3A 2HWZL 3RVUC 3DMMD 4NKDA 4XP4L 1H3UA 3TCXA 4N0YL 4DQOL 3GMRA 2OCFD 1KENH 3HZYB 3S37X 2YMXH 3BZFB 3PWPA 3T8XB 1FZJA 3OKOB 5CBAA 4YHOL 5DRWB 1KCKA 3FB6A 3UJTL 4U1LB 2QSCL 3CDFA 5DJ6A 3T2NH 4HS6B 4UV4H 5IFAL 3PJSB 2PO6D 1T2XA 4Q74A 4JFHD 2QTEA 4H20L 4QRSA 3TO4A 3IFPB 3GMPB 5I30L 3ELAT 2O61A 3FOLA 5F7DB 3STLA 4LSRH 1XR8A 2VLKB 1F6AA 5DMIH 2X9WA 5DWUL 1Q9LA 4MXQD 4N5UA 1ZV5A 3EFFA 4D9RE 4EIZC 1MWAL 4D3CH 4R4NC 2VC2H 4ODTH 4ODWB 3VFNB 2W0KA 3CVHH 4OLYH 25C8H 5FHBH 4S2SB 2DQCL 3IJHB 2Q7YB 5J6HB 1YEJL 3NIGF 2ZJSL 3VFVB 3OJVC 5HHME 5I1DB 3HPJB 4P2QE 1YY8A 4RRPA 3CGTA 3U4BL 1QLRB 4XZUB 5DZOA 5F21B 4N0FA 5FKAA 2KDGA 1JGEB 2X44D 3EHBC 3IXTB 1KXVC 4IEFB 3G9AB 3MRIB 4LSVH 1J5OH 4KZEH 5DJZB 4ZSOA 5TE6L 5FYKL 5IJVA 4JG1H 1LO5B 5IVXB 1MHEA 1YNTB 4O58L 5IVOA 4XCEB 1G9MH 1XGPB 4OGYL 4K7FB 1WBZB 1XIWC 5JZ7C 1EZVY 1ES0A 2RAMA 1CFTB 2F8XC 3M1BB 2FECL 5E99H 4WEMB 4U7SA 4GRLA 2AJXL 1VERA 1I7UA 5T5NF 1P7QA 2BOBA 3DI2B 3FT3A 3PXJA 4YX2L 4JJ5B 3UZQA 4L4TA 4Q9QH 1S7TA 3N85H 5JW4N 2W38A 3AY4A 4LPCA 4R4ND 4OF7A 1KTKE 4PRNA 3BH9A 5EZOL 1CXEA 2ICCA 4NYLA 3P77B 1C7TA 4CMMB 3X11A 2XZCL 2J4WH 3UYRL 3UJJH 3QUML 3BGMA 1UACL 3QUZA 5DYOA 5KG9B 3D39A 4Q6IB 3TIEB 4HIIB 4V1DB 1R5IB 5GISL 2R0ZL 4PRPA 1I7RA 5B39A 2DI8A 2ZUQC 1ZHBB 1DANT 2VDLL 1N6VA 2XQBH 5E6ZA 4OTXH 2CLVB 1C5BL 2ICEB 5FKPA 4LP5A 1MRCH 1OGAE 5A43C 1X4ZA 1QYGL 5D7JC 1E6OH 3HNVH 4NQVB 4WW2C 3WIFA 1KEGL 1EEQA 4NQED 4PJIE 3U7AA 4NC2B 1HHIA 3R0NA 5JZ7D 2FATH 5DC4B 4LBEA 2DQHL 3EDDA 2E7LA 1GAFL 3V0WL 1RY7B 4ZODA 3KWWA 1AKJA 1CXIA 4R0LB 1JYVA 2UY6A 2R0KH 3BDXA 5E2VH 4NN5C 1I1RA 3CVHA 3FONA 4ACPA 4D94A 4LPTA 5A3IC 4PLKC 1A1MA 1SBBA 1QR1B 1JZ6A 5EZIL 2QBWA 4AL8L 1PEWA 2YD4A 3FOMA 2FX8L 4A2MA 4W4OC 3IDUA 4H26B 4OFPA 3U30C 3UTTD 1MY7A 3UTSA 1I9EA 3L3KA 3K7UA 3MA7A 1P4BL 1FC2D 4K8RC 4KH2A 2ITCA 4POYA 2VL4A 5HVFB 4K3JH 4XNMA 2JIXD 4LCIL 4HWZA 2Z9TA 3DI3B 5IB4A 5I1GL 3W0WD 1L0QA 5DGRA 5F9WC 1K5NA 1NCCH 1QRNA 3QHTC 3TPKA 3D25A 2CIIA 2I26N 2R4RL 4KRPB 5BZDB 4YAQB 5FM5M 5I8EB 1SEQL 3HCVA 1B0RB 4Z5RB 3I75B 5D7JD 3O6LH 1XMWA 3MGOB 5DD3L 5KN5A 2BNQB 3OTTA 1TXKA 3DRTA 3LZFH 1FFPA 2ESVE 1MQKL 1OSZA 2O5YH 2ZCHH 1WK0A 3HAEB 4AM0B 4HKBB 3C6LA 2CRMA 5TFSL 3U1SH 3QXAA 1IGML 2PW2A 1UJ3B 4OZIA 3MRJB 2EYRB 3EIFA 2GTWB 5CINL 3V4UH 5FO9B 5ICXA 2DI7A 1LD9B 4JCMA 3REVB 5A3ID 1Y0LA 4PLKD 2ADJA 3V2AR 3FQTB 2XWBB 4JEGB 1ZAGA 4N9GA 3ZKXB 4MLSA 5C9JB 3MBEB 4LOUC 1BAFH 4WEBL 3IDIB 1HINL 4DKAA 2K3TA 4K8RD 4NHUB 4FMFA 1ZHLA 4IRZL 3E6HA 4K71C 3GMQB 4J3WA 2DWEA 3F8UB 4NIKB 1X5IA 3GMNB 4FQIH 3S8WA 1CD1B 3CLEH 4L8BB 2VLJB 1EK3A 1OLZA 2NY7H 4JO4H 4X7FC 5KTEH 1TVDA 4NRXB 5HHNA 4F58H 5I1KH 4ZPTB 4BA8A 1JWUA 3V0VA 5T33H 5IOPA 1Q72H 3MRRA 1QNZL 4D0CA 5FGBC 3X3GL 4PY7A 3VXSE 5C0GB 2YPKA 1MHPL 3GKZA 1KJVA 2HKFL 4D0DA 2E9WA 3RWFA 3CVIH 2AQ3A 5SWZB 2WBWB 1KFAL 4WUUE 3RAJL 1WAAF 3ZYIA 3GNMH 2AJUH 3WIHL 4WY7H 4ISVA 3F7YB 4MQSB 2VZ3A 3WNNA 4MMXC 3D3VB 4CBPA 1R3JA 3GHEL 3BEWA 2WUBL 4LOUD 4MD0A 4P3CL 4RDQG 1NLBL 4KDWA 3LSOB 4X99B 2FJFA 5AEAA 4PRBA 3IU4L 2OZ4L 4G8GB 2WWKO 1XF5B 3M17A 1CLYL 4KTDL 4HMCA 3H9SD 2VDNH 4K8RL 3L3HA 4PJ9B 1R3IL 4PBWD 3EGSA 3RVXC 2YBRB 4UNTA 4U3CA 4WFEE 1FLTX 2HN7B 2UWEE 1A6ZA 2EIZB 4Z7VB 5EU6B 3RIFK 3MCKA 4JGMA 4XH2A 5K33A 4KI5E 2EDFA 3CXDL 3QZWB 1ORSB 4I4WA 1IM3B 3QUYA 4NPYA 2CRZA 2FNBA 1SMAA 3GMLA 4X6CF 1WT5C 3S36X 4JKPL 1KB5L 3KPLB 2PETA 5HJ3A 5IK3B 1A6WL 2EEAA 4M7LH 3DVFA 5C0CB 3QEGL 1J86A 4WI5A 1OF2B 1ZVYA 4F37F 2F19L 3U6RA 3MV9E 3TIDA 1BIIB 2A73B 3T0EA 5DQDH 3HTLX 2VDPL 2BP3A 3Q6GH 1KT2A 1JE6A 1UB5A 4L9DA 1HYSC 1P7KA 1ADQH 5C0JA 1IM9D 3QWRA 2VLRB 1WC7A 3GSUA 1EGJH 1T1YB 3BDBA 4LU5L 2BRQA 2FHCA 3LN4A 1K8DB 4TSAL 4NJ9H 1TETL 2XZAH 4FHBD 4OCNC 1UCBH 4JVPA 3QRFM 4XAWL 4BK4A 4JN1L 3I02B 2CDEB 4YHIB 1JUFB 5CILL 4J4PC 3HNTL 3O2WH 3PWJB 4QTIL 4Z7NF 1NLDH 4JQIL 3QISA 5D8JL 1I1YA 3RVXD 4R3SA 4YXHH 2JELL 2WNGA 1HE7A 4X8XA 3RWIB 3IS1X 2GJ6E 4WFFD 5C08B 2BRRL 2BVQA 4K23L 5IHUH 5KVEL 3B3IA 1MJJA 3UJIH 5ADPH 4AJ0A 3VFOA 4PJ7E 1RUAL 4FXGA 3VD3A 3UO1L 1AR2A 1A14L 4MA7H 3P9WB 3U36A 5I1JH 4XX1E 3FMGH 5D1ZA 1EMTH 5DFVC 1MLBB 3LQAH 5IB3A 4X6CB 3QWOA 1J1OH 4QRTA 3VG9B 1RUMH 4F7TB 5D96B 3QUXB 1JNNH 1CE1H 1Q1JL 4HIXL 3IDYC 5C07A 3R1GL 3IFLH 1HYSD 3RZWA 1A6UH 3DUUA 5ECJE 4E41D 2KQMA 5MEOA 3BKJL 3KDMA 4K2UH 1S9WA 4OLUL 5EBWA 2Z4QA 3VXOB 2YPLB 4PV8B 4HUWA 2K7PA 5FGCB 1F4AA 4ZO8A 4Z0XB 5CMAB 5EU4B 1D6EB 2GI7A 2H45A 3BW9A 1XGRB 3FQWB 2EIBA 1GZPA 3P4NA 1GZQB 3TBWB 1DSFH 2Y5TB 2Y4SA 2ERJB 3DX6A 4J4PD 4DN3L 1U0QA 4XT1C 3LKRA 5DJ2B 5IEHB 1SYSB 4F7CA 1BQUA 5FYJD 1B90A 5HVWA 5DUPL 2V9RA 3WXWH 4XNUH 2FLRT 4N0UB 4HGMA 2K1MA 2IBGA 1T21A 4RAUA 3B5GA 2DLEA 5KZCD 5LQBH 1S7RB 3HZKA 5A2JH 1JPST 1MIEH 3SGJA 2W0FB 1H3WM 3V5HB 3JTSA 3B9KA 4HUVA 5DFVD 2EC9T 1QPXA 5CLWA 2V7NB 4ODHL 2ZKHL 4X98B 1JMXA 1NEZB 3RZCB 2FRGP 5TH2A 1EGJA 4IMLA 5DD6A 1CD0A 1UWGH 2X4SA 4M1GL 5D6CB 5A2LH 1ITCA 2QEJA 1EEZB 5HY9B 4HIHA 5HGDB 2G60L 5T3XE 3GSRA 2VDML 5IFHH 5F1IB 5DR5H 1LNUA 4AQ1B 2C1PB 4GKNB 4YHYC 4PGBA 4KGLA 4P48A 5K9OA 4LLYA 4UZGA 4YGAB 4D9RD 1BZ7A 3QQ3B 3G6AB 5FUCE 2DQGL 1BWWA 3HE6B 3SY0A 4X4YA 4GW4B 4U2YA 1T04B 1MUJA 1IT9L 5HHMD 4MA3A 1D5BB 5MENE 3CUPB 4PLOB 5F6IC 1NDMA 4P2QD 4HWBA 2APVA 2XQYG 5FYJL 3TZVA 5F1SA 4ZDHA 4RCAA 4FQLL 1QEWA 4NKMA 1JZ4A 5GRWA 1T6VN 1NBQA 3H7BA 4HUKB 2ZSWB 4OF0A 3ULUE 1KIUA 5CKGA 4ZUUB 2P5WA 4ETQB 1I9IH 1NCBH 1Q94B 2BERA 1A4JB 2BX5A 4AEHL 4NRYA 5J06A 3O6KH 3VXRE 1FLRL 5J11C 1DBAL 4C57C 3WD5H 4BSVB 5ESAA 4K9EH 4KJWD 4PTUB 4KK8C 4TPRH 4OQTH 3VGFA 4PGEA 2DWDB 2JJSA 3L5WB 3ALPA 3KYOB 2HJFA 4EUPB 2NX5B 5DHVH 4KHXH 4YHNA 3VFMA 3LHPL 5E8OB 4BH7B 1P5VA 5EU5A 5F9DC 4MNGA 3T0XA 3ILPB 4WEUD 3UBXA 4TSBL 4FABH 5ESVA 3MRPA 1I9JH 1TQBC 4OZFB 5JW5A 1A3LL 2W60A 4XP4H 1XH3B 4P57A 4DQOH 4B53A 2MNUA 2WINA 5HGBA 1MAML 1N64L 4WNQA 4X9GA 1X5AA 4OBSA 5TQ0H 1SBSL 1NJ9B 5FYKU 3V6OE 3HG1B 4PV9B 5HHOB 2ZCLL 5D7LD 3O3EB 3QO1B 3UJTH 3O11A 5C7XL 1MNUL 3Q48A 4O2EB 1X7QB 1T1XA 4PP1C 2YRZA 3LN5B 5DQ9B 1P4IH 4OZGA 5IFAH 3H42L 4DVRL 4MAUL 3IKCA 1OGAD 3MRCB 4OI9A 4Z6AT 5EIIA 3QXVA 4H20H 1A7QH 1UGNA 1BX2A 5ADOH 5MI0C 5E1AA 5CP7A 1ZMYA 3MMEA 5E2UH 5GGTH 3MOAH 1PX4A 5IP4A 4Z7WE 2DQEL 2C26A 3VJ6B 3ABZA 3TC9A 2VITB 3D2UB 3T0WA 2ZP0T 1E28B 5LJYH 2NR6C 4MJIE 1OAXL 3WKMH 3MRBB 3MRMB 1E4WH 4GRWH 3I2CL 2DQCH 3TA3C 5SWQA 4S1RL 2IC2A 4GSDH 4I48A 4ZFGL 1CVRA 2Q20A 2IANE 2CIKB 3QJFA 3RWHA 2A6IA 4BKLB 1QBLL 2HLAA 3S3PA 2GIYA 4NM8H 4F8TA 5LG1A 2FL5B 5JW3L 1PKOA 1HXYA 4PJGE 3OKMB 3FQXA 4O58H 3JV4A 3HPLB 2G5BA 3O3AA 1A5FL 3PWLA 5ENWB 2LABA 2NXZB 2OM5A 1IKNA 5IB1A 4PP1D 2BSRA 2XTLA 1M7XA 3VFSA 2HTKC 1AH1A 5C0AA 2GTZB 2R56L 2P8MB 4OQTA 3CC5A 4U3XA 2DLGA 5C6PB 1CDGA 2NW3A 4YX2H 1OPGL 2ZNWA 3SO3C 1JBJA 2NTFB 4MD5B 5DHVA 3QB7C 5F7UA 3OF6D 2R9HC 4P46B 2NR6D 3BKML 2HVJB 1X5GA 4AIOA 1TVHB 2AJ3B 2Q87A 3TNNB 1A6AB 4PG9B 5EZOH 4D0BA 3K8KA 3TA3D 3GB7B 2FZ3A 1C12A 4JY4B 4XVJH 4Y19E 3D18B 1UACH 2Z92B 5DJAB 1X5KA 3BUYB 2X1PA 4HUXB 2A1WL 2R0ZH 2W59A 5D5ME 2DIAA 1HHHB 1MOEA 4IRSA 4X7SL 3W82A 3ZT7A 3CX5J 5EG6C 2BVPA 3BPCA 4JM4L 5D1QB 1PY4A 1TNNA 1UM5L 2BMKA 4PS4L 1A64A 3RDTC 4R96B 1QYGH 1I85A 1QSFE 1YEKL 4OFVA 1M6OA 4G43A 4QRUB 2NY0C 1FG2A 5I66A 1RZJC 3FT4B 3FFCE 4NNXB 1F58L 2DQHH 1ZLVH 5DMJB 5GGTA 2FH6A 3V0WH 1A4KA 3EFDL 3H3BC 1RK0A 2HTKD 5C86A 1PZ5A 2ITDB 1QBBA 1MWAA 7CGTA 2ZOKB 3O3DA 3D1MC 5GGQL 2EE2A 4GW5A 3W2DL 1C5DA 3VXSD 4IHOA 3GK8L 3H3PL 1A6VH 5EZIH 2R9HD 4MCZB 4YC2B 4AL8H 2FX8H 4O9HL 1NKOA 4P4RA 1JRHL 4WUUD 1EZVX 3V5DB 1QACA 3VWJA 1WTGT 3HE7A 4WI7A 5GS3A 4OD2B 2V2WA 1YZZA 1A6TB 1P4BH 4LEOB 3PWNB 1WGOA 1IAII 5EUOA 3ECBB 1A22B 5EOQH 2P5EA 3CX5K 1I8LA 7FABH 2FIRT 5IHBA 3L3JB 4YXKL 4OZ4A 3HMWL 3VGHA 3DMMA 3VDCA 3MYJA 1D9KC 1BJ1J 3EO0A 4L29A 1P6AB 3WL9A 3RA7L 2CQVA 4XPGH 4NFBA 3O2DL 4Y2DD 1U8MB 4KJYA 3L3IB 3P4LA 5DD3H 4NQTA 4JFEE 2NY0D 2VABB 1ZT7A 1OOAA 1MQKH 1A21A 2V2TB 3GSNL 3QDGE 4WFED 2PNDA 4AENA 1QLEL 1NC2D 2PO6A 5TFSH 4DWHA 2J8UF 2DQDL 4KI5D 1VGKA 4AEIL 4YDIL 1ORQB 3C60C 2UVEA 5CJ5A 5I15H 2GSIB 1P6FA 1YPZF 4G3YL 1OB1B 4QNPE 5CGYC 4PRHB 4QGYA 4WDIA 4WV1B 2R23B 4M7JH 4J7RA 2LAAA 1QQDA 3VRLF 5J12B 5FIEA 3ZHKA 3MV9D 5JXEC 1INDL 4Y16C 1PQZB 4IOIB 4YPJA 3ARBB 1YUHA 4PY8J 5EORL 3MRHA 5C0DA 4IRZH 3PDOA 4DUVA 4RWHA 4KKNA 1QLFB 3EZJB 1QSEB 1CGVA 1H0DA 2EC8A 4JDTH 3PNWA 4ZFOL 1KJ3H 3PL6B 3CU1A 3TEUA 1R3HA 1MELA 5I8OL 3U7YH 4C59B 5DURB 4PJ5E 1JPSL 2P49B 4ORGB 4C56E 2FO4B 3DV6A 3STBA 4KK9D 4IM8A 2FR4A 5DJ8B 2PCPA 3TV3H 3IFOA 3TF7C 5EPMA 4GG6E 2UUDK 3BD5A 3MV7E 3K80A 4RISL 2H2PD 4Y4KB 2H2SC 3WS6A 3DROB 3IF1B 3X3GH 4DN4H 3WEXA 2GJ6D 5CIPA 2W65B 1MHPH 4TVPE 1HQ4A 5EIQA 2DBLH 3C60D 3TH2T 5D2NB 3N1QC 1CIDA 2J8UB 1BBDL 3JV0A 2DLFL 3KPRB 2BFVH 5CGYD 4PJCF 5J9PB 1N5AA 1CXKA 4AIXA 5E1HB 1M7DB 2C4FU 4MJ6B 2HRPH 1QFWI 2WUBH 4HUMB 1M7IB 3C8DA 5IB2B 5JXED 4Y16D 1JNHB 2X5PA 3QNYA 4LLQA 3L3OB 1HEZA 2YHGA 4FZEH 2D4DA 3ZDYE 3TBYA 4JFDB 5FA4A 3FHQA 2JK5A 2JCCA 1R3IH 3AVEA 1YEDB 5CBEA 4PJBF 1AXIB 4OCWL 2V9TA 1MI5B 1UKTA 4N0RA 4GQ9L 5HGHA 4RMWA 4QCIB 4LCUB 1U3ZA 2CDFB 3C5SB 4TRPL 4GLRH 3OR7B 5I8CA 4G8FB 2DYPD 1EXUA 1FN4B 4L8SB 1KCSL 5KVFL 3NTCL 3QEHB 1K6QH 1CL7I 2AJSL 3MNWB 3CSPA 4NQEA 4XPAL 3QCTL 1CDHA 1ZE3C 1DQDH 1YYML 1A6WH 3UPRB 2AERT 3SE9H 3QEGH 3VE0B 2LE9A 3GGWA 3CZFB 4X6FB 2F19H 1JN6A 4XPFL 1S9XB 4OKVA 4J3SA 4N0CC 1T0NB 1F90L 2VDPH 5JPNB 1F5WA 4NM4L 2C3GA 1R5VA 1N6QL 3ULUC 4KAQH 5FOJA 1FZKB 1T22A 1ZGLM 2FIKB 4PJCB 4PRIE 5EOTB 2EXYC 4PJXA 3UTTA 3MLYH 2QQLL 4GKZA 4TSAH 4HGKC 3LQZA 5F7WC 4C58B 1K3ZA 1CZ8L 4P9MH 5I9QC 1F8TL 4MQXC 5BMFH 1RZIA 2MQ3A 2CRIA 4JJHA 5JHDB 2JIXA 3S36H 5CILH 5T3XD 3W0WA 3HNTH 4JKLA 1HHJA 5EN2A 1FJ1A 1JGDA 2DQIL 5D8JH 2WQ8A 1IE5A 4MX7A 5JXAH 1YEIL 1DEEB 2JELH 3BKCL 5GRUH 3PABB 4WGWB 4K55A 1JF1A 3R8QA 3VRIA 1JFQH 2DM7A 1CFBA 4MSWB 4KU1A 3W9EA 4N8VB 5EC2B 1RIHL 1M1SA 3EW3B 3BRDA 4G8IA 4DFIA 1WQVT 2HH0H 5M95B 1ZA6A 4JPWL 3WIHA 3MR9A 4L8DA 4JM2B 1MREH 4JO2L 3GI9H 5MEND 3BH8A 1MHCA 1OW0A 2B2XH 1OQOA 4HIXH 3V6OC 2BOCA 3BZEB 3HC3L 3GSQB 3P30H 4MD4B 4JRXB 1PLGL 5IUSA 1RUPH 3PE9A 4JZNA 3ULUD 4PB9L 5T5FH 4W4OA 3MLUH 4OLUH 1U42A 3EAKA 1IQWL 4YBHA 3I3BA 2D7MA 5IJKC 1V7MH 5FEBA 3BXNB 5JPMA 4LCCC 1J87A 1INEH 4P2RE 4U1HA 4W6WB 1BHGA 2YD1A 3VXRD 5IVZB 4NO5B 1NUDA 5DEFB 4XBGB 4WWKB 5BCAA 4YDJA 1HILB 4U1MB 5EU7E 4E0RA 2R0WL 1DBJL 1MLCA 4G7VH 4FXKB 5TE4L 1SJHA 5IFJA 4OUUB 2UYLA 5B38A 2W91A 5FV2A 4CADA 1CCZA 5T3XL 1J8HE 1KJ2B 5KANG 2YN5A 1KB5A 4HDIB 5FF6B 4YEEA 3WFEL 2X70A 3OB0K 1C08A 1DN2A 4XGZB 2Q8AL 1CS6A 2D3VA 1OSPL 3FAWA 3KPMB 3UTPE 2ZUTA 3WE6B 2VN4A 4XCCL 3QIWC 1SHMA 4CU7A 5TDOB 1XF4B 4TOYL 2EDDA 4XNZC 5FYJU 5MERA 2F9BT 2ZKHH 3VWKB 2GCYA 1VADA 4R6UA 2M2DA 5BOZG 3MV8B 5DD5L 3RHWK 2D0FA 5AZ2L 5HD8D 5C0IB 5BVJA 4LPXA 4PLNC 3B2VL 5IQ7H 2WIIB 3B9AA 1U8NB 1JNJA 5ACMA 2FB4L 4PY8I 3QNZA 4GUPA 2DMBA 4P5TB 4XVSL 2G60H 4KK6C 4PJDB 3OKKA 4G7YL 3LV3A 3QQ4A 1S9YB 4PGDB 3RL1A 1F2QA 1UEYA 3ULUL 2NNAB 5EO9B 3WS3A 4I9WE 4F33A 5GRYA 2FJGA 1LGVA 4KQ3L 4NO3A 4P2OC 5CJ8A 3WLBB 3GBNH 4JB9H 3H9SA 1XCQA 4Y1AD 4PJHB 4MJID 3MSPA 1G7PA 1ZS8A 4H25A 4LCWE 2DQGH 1UZ6F 2EDLA 3SQBA 4X6BB 4YDVB 3S5LB 1RHHB 4KUCF 1PW3A 4FQQA 3WSQL 1HHKB 5DJXA 2DIBA 3O9WD 5LAXA 2EYTA 4YHPA 1T0MB 5FYJH 1YNLL 1EPFA 2F15A 4FQLH 5FGBA 3KYKL 3ME0A 5HI3D 4DOHE 3QIWD 2N7AA 1LP9F 5H35B 4RNRB 3T65A 4G6MH 2P43B 1BFVL 3SDYH 4OAWA 3INUH 3SDCC 3U0WH 2Z35A 4P23C 5FAAA 1I8MA 4KXZI 1BFOA 1WJ3A 2XNAB 1KCUH 3LVEA 4RSVA 3DO7A 1MFAH 3ARGD 1DQJB 4RBPK 5IIEA 1DVFC 1G6RH 1IM9A 3THMH 1K4DA 3VFWA 3FQRA 4KK6D 2VDRL 3G6JE 4ZAKC 3PHQA 1F4YH 5D72L 4UB0H 2I27N 2N1KA 3VXTA 3CK0L 3TFKD 1EFXD 3BT2L 5GS1C 1U58B 4FQ2L 4FQ1H 4P2OD 1OP3H 5IQ9B 3G5ZB 2Y06H 4GXVH 4YNYB 1Q9KB 5EC1A 5ERWA 2J6EL 3IDNA 1JWMA 1AD9B 2EDRA 2C1OA 1OM3L 4U4BA 3CDYA 1RJLA 5KJRL 1X9QA 4X80L 4JVWA 1MAMH 3L6FA 3BOVA 3F7QA 2GITA 4LDLB 1UFUA 4HPYL 3BN3B 4WUKL 1WLHA 1WT5A 1IGFL 2ZCLH 3PGDB 2CGRL 5C3TA 4I3SL 3QXWA 4CVXA 2ZZUT 3ES6A 5C7XH 1MNUH 1FH5L 3V7AE 1AD0A 4LLDA 2A74A 4Y5YB 4CN6A 4QHMA 3H42H 4DVRH 1FSKC 2X2YA 1FAKT 3L5XH 3GRWL 1QSFD 3KHOA 2ATPA 2FX9L 2FX7H 3SDCD 1FAIL 4P23D 1V3LA 1YQVH 4NCC1 1CVSC 3HR5B 4HGWA 4M7ZB 3FFCD 4QEGA 4X6DA 3FRPG 4O2FB 3HFMH 3DO3A 4RFOL 3REWB 5F88A 1DVFD 2UZIH 3FRPA 4E41A 4J1UA 2AVGA 4NNYA 2FGWL 4PREB 2RCSL 1F3DJ 1ZA3A 4ZAKD 5IW1B 4LARL 2N4IA 4JO1L 5DDHA 3DSFH 4L4VD 5IVXE 4TSCL 4NJAH 3TJEL 1ZXQA 3CPLB 4MNQB 1T89C 3S6CA 1JYXA 4R7NB 4J4PA 1RZFL 3BP7A 4D8PA 1EDQA 2LV4A 1NFIB 4JANB 3ARFC 3FB7B 3VGEA 2R4SH 4ZPVB 3Q5OA 1IMHC 5F97E 3FAXA 1FFOB 1TJIL 5MEQA 3VD4A 3HC4L 5JW3H 1AE6L 2ZUVA 3H9ZA 2VSDA 1G7MB 1N4XL 5F7YC 2VZSA 4AG4L 1BZ9B 5HHPB 1LO3H 1T7VA 4X6EA 5F96H 1F11B 5DMYA 1MEXH 3T0VA 1BPVA 3BP6A 4MYWB 4WI2A 3DUHA 1ND0B 2R56H 2KUTA 3ROLB 1NCNA 2VQ1B 3FO2B 4JFED 3ZYZA 3OKLA 3QDGD 1FFQA 4XNQA 4ZS7L 1VSCA 4HIEA 1CGTA 1OPGH 1FNEA 5L2JB 3HS0B 4V1DE 4UQ3B 2BVOA 5ETUB 3D85D 2Q6WB 2MFNA 2OI9B 3BKMH 4L5FL 5TE7L 3QFDA 1UZ8A 5GJSH 1YEGL 2DM3A 3PGFL 5E8NA 4L3AA 2DQTH 5FUZL 3NGBB 3NA9L 5EU3A 3SJVB 1B4RA 3PWPB 4QRRB 4ELKA 1FZJB 5L2KB 3LH2H 1T66C 3V5KA 1YQ2A 5IW6A 3ARFD 1BEYL 2A1WH 4OSUL 5DRNA 3MRNA 1DDHB 3O41A 1SMOA 4P2QA 4J8RA 3TO4B 2B4CH 2MPAL 4JRWA 1OLLA 2YA2A 3QHZL 5I75B 2O61B 4EEEA 2VH5L 3FOLB 4X8JA 1Q0XL 4GBXB 4PJ5D 3EFFB 3VMOA 4C56D 1K2DA 4UMGA 2VXQH 4PPTA 1HXMA 3EFDH 5FK9A 4KTEH 2OR9H 2XTJE 3QAZB 3ESUF 4JKKA 4EI6A 2OR7A 3MV7D 5IBUG 3SDDB 1L7TL 2MCPH 3M45A 5GGQH 1KLFA 1TVBB 1AFVH 4NP4H 1U95B 3HMXL 1FZMA 3H3PH 3QIBC 5F9JA 4TVPD 3CFKA 4W68A 1S7XA 2YRLA 1C16B 1HDMB 2XA3A 4O9HH 4N0FB 5FKAB 1BBJB 2ENYA 1JRHH 3AXLB 2PR4H 5DD1L 4F7EA 4HJJH 5E8EA 4X0KA 4UNUA 1FO0H 4XMLH 1T03L 2GK0B 4Z7OF 4AK1A 1J10A 2HG5A 5EULV 1T66D 4RZCA 1AHWA 5JLZB 3FN0L 3AMLA 2VAAA 3P9MA 1E4XH 3HMWH 3BGFC 5HI4C 2IALA 2F74A 1VFMA 3T4AA 5D7SL 1KBGL 1VESA 3F6IA 3RA7H 3HI6L 1I7UB 1RIVH 2EZ0C 2X4PA 3QH3A 5JNYB 4OT1L 2BOBB 4M5YL 3KGRA 3WYRA 4AH2B 2F5AL 3RVVC 3ZL4L 3GSNH 5BXFA 4KKAC 1S7TB 2EC9U 1GJIA 3LPGA 1RI8A 3IVKB 4FG6D 1INQA 1OGAA 1N6UA 2YWYA 3SQOH 1WCBA 3ARDB 1QBML 3EUUA 2LU3A 4KKCC 4KQ4H 3OQ3B 4IIQB 4PJIA 4MJ5A 5CHNA 4G3YH 3QUZB 5DYOB 3D39B 4PJ8C 3W9DB 5CSZA 5JORA 2HFGH 2VQTA 4NN7C 1U8JA 4O4YH 2J5LB 4FQCL 3HUJE 3CFJB 5B39B 2OTPA 3VA2C 5I1HL 3DUSB 3RNKA 4OB5H 2IBZY 2CKBH 2LVEA 1INDH 3BSZH 5HPMA 2B1HL 2VLJE 1U2CA 2R1WB 5A16B 3FQNA 3NZHL 5EORH 2NY2B 2OP4L 4JREC 1QFWL 2PUQT 3WIFB 1KELH 2GQHA 2IH3B 4PRID 1MHHB 4DGIH 4Y0GA 3LY6A 5E95B 3BPLB 3MUHL 5HI4D 1HHIB 2ORBH 2OL3B 1EX0A 4UI2A 4LBEB 1CDJA 1DUYA 1A9EA 4G8EA 1FRGL 4HKJA 1AKJB 3OAZH 3FT2A 1JPFA 2F58H 2EZ0D 2MSPA 3F12A 1H3PL 3ULSA 3QRGH 3RWJB 3FONB 5F7NC 1U41A 3JVGC 3RVVD 4RISH 1MFCL 4O02L 4KKAD 2XFXA 3PV6A 4LF3B 1UYWL 2EDWA 3D3VE 3IDXL 1U8KA 3QEUA 5I6XB 4B7IA 4G80A 4OM0H 3EYFA 3MREA 3L3KB 4EIGB 1P9MA 2MKWA 4RA3A 2ITCB 1BBDH 4G8GE 1LK3L 3MXWH 1ZLUK 2GJZA 3QPXL 1A3RH 1KACB 4HWZB 3QXTA 5IB4B 4WFHE 2P45B 3OF6A 4G9DB 4UINL 3N1MC 3ULVE 3D25B 1EHLH 4BSWA 1JK8A 5B4MC 1IL1A 4S11A 2CSPA 3TA3A 4Z7VE 1BOYA 5EU6E 3H3KA 4QXWA 1GGYA 4NQDB 8CGTA 4YDKH 2NY5H 4BQCA 5IV2B 3IAQA 2VOTA 5KN5B 2CLZA 1FFPB 1U3HB 5IHZA 5GHWL 3O2DA 3C6LB 4MA1B 3KPNA 4KVNL 5C0CE 1MJUL 5EZJB 2R0LL 4P2RD 4XCNA 5F1KC 2PW2B 2X7LA 2FH8A 4OCWH 5FHAL 4RFNB 5I19L 3GSNA 4JKWA 1VENA 4TUOA 3OG4B 1KLUA 3RWDA 2K7QA 4YHLL 1MCRA 1D5ZA 3UPAA 4O2CA 1QO3A 1ZK9A 4XRCA 4XPAH 3E6FB 3NFPB 2QSQA 2XZZA 1ZVHA 5DA4A 1RULL 2DLHA 2D9CA 1KIPB 3L3DA 1J1PH 2Y1VA 5JR1H 4YBLC 4JFOB 1KCRL 1LDPL 1B6DA 4MXWL 1IGCL 3RIAK 2FEEI 2P8LB 3ISWA 3VXSA 2J8HA 1G7IB 2WP3O 4JQXC 3O3UN 4WUUA 2IFGA 2VERN 4IDLA 5B4MD 3OXRA 2AJZA 1IAOB 5DLML 3GMOA 3L3GA 3CXHJ 4U1JB 5C08E 4LSTH 2R2EB 4MJ4A 1T1WA 5I18L 4BK5A 4NWTL 5HHNB 3QDHA 1RPQA 5ACZA 5LGJB 5IOPB 5T1DH 4KRMB 4D0CB 4HAGA 2DQIH 5EO1A 4ODXA 4HBCH 4I9WD 4L3CB 2YPKB 4NUJB 4R90H 4D0DB 5DC0A 4F7MB 4Y2DA 43CAA 3LIZL 2EDXA 4U1GB 4XPTH 3V6ZA 4DGYL 2Z8SA 2X9YA 3RFZC 1KTLA 4LCWD 3GSXA 1RIHH 1NC2A 1HKLH 2UWEA 4HUUB 1BFTA 2LFGA 1CGXA 4GRMB 4JPWH 1R3JB 4BQ8A 5IB3B 4JO2H 4K3EH 3K81A 1DUZB 5GGUA 2J1KA 1AO7B 2YPLE 2BY1A 2FJFB 5FGCE 3WUZA 3TN0C 1FYTE 3UTQA 5EZLA 3C6SB 2X42A 3N1FC 1IBGL 1V7NL 5GS0H 3LKSA 5EWIL 3QG7H 4KY1L 3CXHK 1S8DB 2PW1A 4XBEH 4F57H 4NBXB 4KJPC 1KPVA 3MV9A 1IQWH 1FVEB 3MLVL 1A6ZB 1MFEL 2VLME 3MUZ1 1Z2KA 2F8OA 1UWXH 4N0UE 4XH2B 1D5XB 5GGVL 4FP8H 4S1SL 4NZUL 4I4WB 4U0QB 2YK1H 5BV7H 2O5XL 4UDTA 1WSST 3MRLA 3WXVL 1TDQA 3G5YB 5HJ3B 1QSVA 2ZUYA 4Q9BA 3HZMB 3RUGE 4WI4A 3U6RB 1ZHKB 3I3DA 2F5BH 4JDZB 3TIDB 2Q8AH 1SVCP 2AV1A 3T0EB 3RWCA 4KPHL 4YFLF 1UB5B 8FABB 3SKOB 4ONHB 2GJ6A 2APBA 4TOYH 3ZYJA 1KJMA 1FE8L 1WC7B 3LN4B 4U6VL 4DAGL 3C60A 1CT8A 4S10A 5LWYH 4PJ7A 5EIVA 3UROR 3AROA 4B0MM 2YC1A 1XT5A 3TN0D 3WN5C 4OCSL 4ZYKA 5HXMA 5CWSA 4ZTPL 4XX1G 1F4WH 5AZ2H 4NSKB 1JTTA 1B4JL 3B2VH 4BZ2L 5BOPA 5E08L 4LHUG 3IJYB 4WTZG 3LKOB 4KJPD 3LKQA 2IGFL 4WTZA 4Y16A 5JXEA 1DQML 3PGCA 3ZE0F 5SWSB 5FGRA 2BVQB 4Q6IC 3B3IB 1I3GL 2EEBA 2X4RB 3G5XA 4KQ3H 5J1AA 4I5BB 5B8CC 3G08A 3GMMA 1Z5LA 3DBXB 1OT1A 4NQSA 3U36B 3QI9C 4L9LA 2VISA 2XPGB 3X3FH 3QWOB 1I3UA 3WSQH 4PYHA 2VUOA 1KYOJ 2ZSVB 5E5MA 2DYPA 5HHVL 5C07B 5CJBA 1HNGA 1BQHG 1XZ0B 3ZTNH 3KYKH 3AS0A 5AG9A 4BJLA 2C4XA 3MACL 3IJSA 5GGRY 3LEVL 3QBTB 3UZEA 3KDMB 5MEOB 1S9WB 3T3MF 2IPTL 3RWEB 2Z4QB 1FZOA 5HVHC 5ALBH 2NX5E 1QHOA 4CU8A 1I9RL 2JLLA 4ZOAA 1Q9WA 5JOFB 2IH1A 3DX6B 3VXPB 1ONQB 5KVDL 3WJLC 2Z93A 1A1NB 2LTQB 2XTJC 3MO1A 4FQJL 2PN5A 4M48H 4MQ7B 5J1TC 4I0KA 1UT9A 3NFSH 4NOBA 2DAVA 2VNCA 1KLGA 1T21B 4RAUB 5B3NA 1AP2A 5DK0A 4JY5L 4V1DD 4Y4FC 1X5ZA 5HHOE 3HG1E 4I18C 3D0LB 1S7QA 4APQC 1ACZA 1KYOK 1WFUA 2Q76B 2GY7B 2W0PA 5D1XC 2J6EH 5HYJB 1OT2A 1CGSL 2PYFB 3CFCH 1OM3H 2EIDA 2Y9RT 43C9B 1HH9B 4WCYL 4TNWK 3MGTB 3H6JA 4NQXB 4QF1A 3P4MB 2F54E 1Q38A 5TH2B 1IILE 4IDJL 3STZA 1TJHL 5DD6B 3CJJA 1EBPA 3F65A 4OLZH 3O3BA 4I3SH 3MLWL 1CXFA 3GSVA 4QHUB 1FH5H 2NQCA 5MENA 3GSRB 3B83A 2NTSP 3U9UB 5I1CH 2FX9H 3AS3A 1CLOL 5E4EB 5K9OB 1Q9OB 2FWOA 2ZG2A 3QXUA 3ZKXC 3WNLA 1KC5L 5ICZB 3MBEC 4NN6C 3TO2A 1ZT1B 5GRXG 3P0VL 2X4OA 3O8XB 4CMHB 2XTJD 1CE6A 1HSBA 1K85A 1IZJA 1GPOH 2RCSH 3SGKC 4X4YB 2ADGA 4YZFF 5C0NC 4Z95H 3SO5A 3D9AL 5JDJA 2P8PA 3VXRA 3DNKA 3VCLA 1R6VA 1ETZB 3TJEH 1YYLL 1NCAL 1NDMB 4CU6A 4RGMC 4Y4FD 4OZGF 3GIZH 3TZVB 3BHBA 1RZFH 4ZDHB 5JUEL 3RVWC 5D70H 1QEWB 1UC6A 3H8NA 4P3WA 5F7EH 4KRPD 3MRGA 3SCMB 4APQD 4FTVB 3H7BB 1IGTB 1UM6L 1A7RH 4MLIA 2P5WB 1KN4L 2AGJL 4YDLB 2AEPH 2FBJH 1EA9C 5DJDB 2AJVL 4WTWA 1TCRB 5AZEH 1ZLSL 3PV7A 3U0TA 5CSBA 4YFLI 1LE5B 3ARXA 2A6JA 1Y6NR 3RWGB 5C0FA 2R2CA 4PGEB 1SM3L 2BJMH 3V6OA 4ZTOL 3BIAX 2IADB 3P0YH 2E6QA 4HHAA 3WNMA 5DK2B 5KAQF 4QXUH 2Y7QA 1XFPA 4HKXA 3MBED 4MNGB 3UBXB 4YHKL 4FZ8H 4A6YL 5DQJA 4Z8FH 1JHKL 3MRPB 3U7WH 5K9JL 1OARH 5JW5B 5IJKA 2W60B 5C0ND 2H8PA 1TQCB 4LCCA 1GOHA 4P57B 2NY6B 1FL3A 1YEGH 3PGFH 4Z7WA 2J6EA 3AC0A 3HZVB 3B9EA 5CZXD 4Y1AA 3ULVC 3RVWD 3LRHA 1JL8A 4MJIA 2YEZA 1MF2H 2L7JA 1BEYH 4XP6L 2VLJD 1MCHA 3WNOA 1AGBA 4GRLC 1W8NA 5J6GB 3BAEH 1AXSB 2CK0H 1I4FA 1T7ZA 3O9WA 3L7FB 1GYAA 5EFIA 3WV0A 1CI5A 1A7NL 3GRWA 4R26H 1IC4L 1PVHA 3QIWA 1R5WB 1YJDH 3AY4C 2OK0L 4U1KA 1JGUL 3B8SA 3TT1L 4WO4B 1NBYA 5HSFA 4HH8A 1T6WA 4PJGA 4X4ME 4NO2B 2VWEC 1IARB 5E00A 1FPTL 2R39A 5F9OL 1T7YA 3QCUH 5CJXC 4UUJB 4S1QL 1BVLB 1XGTA 3ARGA 3D3VD 1IEHA 2D9QB 3RWHB 1OTTC 2EDKA 2HFEB 4GMTL 2B7DT 4G6FB 1PJ9A 1DBKL 3RVTC 1S78C 4UU9A 3BQUB 3OZ9L 4XPBL 1G1YA 4QOKE 1EFQA 4G8GD 3KYMB 5DD1H 3AB0B 2JB5L 1HXYB 2DM2A 1EFXA 1YC8A 5JA8B 1T03H 4P2OA 3FQXB 4WFHD 2W9LA 1TNMA 3Q1SH 3S98A 3ULVD 2J88H 2E7LC 3FN0H 2GW5A 2NY3B 4LDEB 2BSRB 1I1AC 1WWAX 4UTBH 3EOAB 3CSYB 2G75A 5D7SH 1CG9A 3VFSB 1CK0H 5C0AB 4RFEA 2YRPA 2HT4C 4POUB 5D6DC 1LEGB 3CC5B 4XAKE 1PYWB 3K2UL 2E6JA 5D5MA 1EEYB 3P0GB 3T04D 4PRHE 1CN4A 4Z7UB 2X9XA 3HLAB 1IEAA 5C0CD 2QSVA 2V7HA 5B21A 5DFWH 3WUWG 1OAUL 5CJOL 1GC1C 3VG9C 3WUWA 2EDJA 2OTUA 1SY6H 2F53D 3GO1H 2NXYB 3QUXC 5IESL 5D9SB 4IJ3C 4JFYB 5EUOF 1QSFA 5BV7B 5DRZB 1AGDA 5IM7A 5GRVL 1QBMH 3SDCA 4JZOA 4P23A 3TVMB 1C12B 1ZANL 3UBXI 3FFCA 1FYHB 3JWOH 1VFAB 1ZKAA 4ODSH 4N1HB 1DVFA 1CLZH 2V9QA 5ABDE 1KCVH 1XEDA 1G9MC 2APWA 3F7VB 1S78D 4ZAKA 5C6WH 4UIKL 1U6AL 5HGAA 4LNVA 3EYSL 1FVCA 5I16A 1FIEA 4TVPH 1IGYA 3OV6A 2OP4H 4G43B 1OAYL 3QA3A 2N7BA 5JQ6H 3FKUS 1SJXA 1DE4B 2D7TH 1I1AD 3DV4A 2IAMB 1S7WA 1EO7A 2IEPA 2EDOA 3ULVL 5DUBA 4M7LT 1H3VA 1FDLH 4N8PA 4UIMA 2HT4D 1DL7L 2Y36H 3QFJE 4S0TD 4Z77A 12E8H 5E2TH 2J8UE 3ZE2F 4Q9CA 1H3PH 2D03L 3KPRE 2DB8A 3O3DB 5GGSA 4F3FA 2D7QA 1QFOA 4JN2A 4O02H 4IHOB 4WFGE 3QUXD 3MUGA 4NCC2 1QFPA 5L88L 3HMXA 3HE7B 4JFEA 4KRNA 1NCWH 2AKRA 3QDGA 4U05A 4XCFH 5KW9H 2D31A 5LCVH 4HS8H 5DHYA 5EUOB 4JFDE 2KKQA 1NMAH 2X4TA 3QPXH 3D85A 4OZ4B 4XHQA 3DMMB 4FRWA 1PY9A 3DYPA 1FYTD 3EO0B 3SE3A 1MI5E 1QD0A 3MNZB 2B1AH 1T89A 3FL7A 4NHCH 1MJ8H 4KJYB 3T2NL 4PGJA 4GO6B 1GSMA 3HE6C 4UV4L 5LVEA 1ZT7B 3ARFA 4MWFA 4AENB 1VKXA 1MJUH 2IMMA 3Q6FA 1ZHNB 4Q97A 5FHAH 5I19H 4HEPG 2AP2A 4XPHH 2IBZX 1WIPA 3CFEA 4MDJA 2VL5B 5DT1L 5DMIL 4XCYA 5BS0E 2Y72A 3QQ9C 1IAKA 4WDIB 4D3CL 3TPUA 1W0WA 1D7FA 2VC2L 4ODTL 3CVHL 4PJ5A 3FB8A 4OLYL 1MCEA 25C8L 5FHBL 5SX4H 4C56A 5F6HJ 1QQDB 3PF2A 3QUMB 4LP4A 4P9HH 5BZWA 3DVNA 2WBJB 1RULH 4Q2ZB 4GG6A 3Q5YA 2B20A 1CGUA 3MV7A 1GC1L 1ZT4A 5ISZB 1W2KT 2QKIA 1UCTA 2J7LA 3K8MA 4AYFA 5JHDE 1KCRH 4YK4C 1KNOA 4EI5B 4HUNB 4ERSH 2R1XB 1H0DB 4LSVL 4KZEL 1AQDA 1BF2A 4KFZC 5IBLC 4CUCA 5E94A 5C6TL 5DLMH 4I0PC 2DS4A 3B6SA 3P73B 3ZZ1A 1K8IA 3FFDA 1LEKB 2DMKA 2FR4B 5I18H 5GSVA 2NZ9C 5EPMB 4ONGL 2DMCA 3HE6D 4QXGL 4GRWE 1WIOA 4XXCC 1NAKL 1OGTA 2YOCA 1CF8L 2Y6SC 1UVQB 5E99L 1BJ1H 2XKNB 3O4OC 5CIPB 1HQ4B 3HA0A 1CDCA 4DGYH 4Q9QL 1JPTH 5C70A 3N85L 4JRXE 3FQUB 5DJYA 4PJXF 3S3JA 2YR3A 1P7HL 4ZO7A 4HBQA 3GHBH 2UUDH 4MQTB 3UJJL 3I6KA 2VLLB 1A9BA 4UOJA 2DQFA 1FG9C 2BK8A 1EAPA 1F97A 1IBGH 4X7EC 5TDPA 3TBYB 5E2WH 2XQBL 1XF3A 1H9VA 3DTXA 5IT2H 4OTXL 1XCTA 4U6TA 2JK5B 1GOGA 5IBLD 5I73C 5CBEB 2P24B 4R7DB 2NX5D 4WW2F 3MLVH 5I1AB 1AGFA 5EBMB 3PIQB 3R06A 4I0PD 3HNVL 3ZKQD 2FECI 1MRDH 3A6BH 3QO0A 5IF0B 5I8CB 2NZ9D 2QQNH 3O2VH 5AUMB 4PRIA 3RJQB 5D1ZC 3WXVH 1XIWB 4CJ0A 3MJ8B 1VHPA 2Y6SD 2FBOJ 1UKSA 3TM6A 1T4KA 2R0KL 3T4YA 5E2VL 5E70A 4XXDB 1QP1A 1JN6B 5HHOD 3HG1D 3ETBF 4OKVB 2NXZC 1PZUB 2H3NA 3DX8A 3N06B 4XHJC 3DETC 4CVWA 2ZG3A 3BVNB 3QSKB 3C9NA 1OWWA 1U8QA 2A38