2O5XH

Crystal structure of 1e9 leuh47trp/argh100trp, an engineered diels-alderase fab with nm steroid-binding affinity
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
QVQLVQSGPELKKPGETVKISCKASGYMFTNYGMNWVKQAPGKALKWMGWINPYTGESTFADDFKGRFAFFLETSATTAYLQINNLKNEDTATYFCARGTTIVWAMDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chimeric antibody Fab 1E9-DB3
publication title Closely related antibody receptors exploit fundamentally different strategies for steroid recognition.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2006-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2o5xH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2o5xH02
1U36A 5D1ZB 5D7SH 3NPSC 4DFHA 3BAEL 4Z5RA 4TOYL 3T0EC 2FRGP 4DKDC 4MX7B 3ARGA 2LU7A 1L4IA 1JWMA 5IESL 1I3UA 3P4NB 2LU3A 4KGLA 4LSRL 5HI5D 1FG2B 1SBSH 1D7FA 1GGCL 3MBEA 3L5HA 4I18B 1FVCB 5D72L 3ECBB 4D8PB 2P24A 4N1HB 1BBDL 4OCNC 5E1AB 3VCLB 4MNGB 1T66D 3CFDB 1LO5B 1VEPA 5TH2B 1H0DA 5HHQA 5D2LA 5C8JA 4LPVA 1XGPB 5E9DA 5HYQA 4P4RA 5E1HB 5LGHL 1U93B 4D9RD 4LSVH 5DJCB 4YC2B 1FE8H 5EOQL 1FJ1B 1LVEA 2G2RA 3Q1SL 5DGQA 4ZXBC 1MCDA 1MCOH 3K2UH 1IZJA 4EUPH 5D1QC 5TFSL 4L3ED 1WFOA 4UTAL 4U4BA 5C6TL 3VGGA 5SX5H 4WU7B 1OAQL 3RU8L 1UJ3A 5EC1B 4EKXA 5KANI 1AGCB 1I1AB 3U9PH 3VG9B 5F88B 2GUOA 3WIFA 3SDYL 2F19H 5E94B 1YA5A 1S7SA 3CSPA 3LZFH 4TNVK 1KB5A 3ULUC 5E5MA 4UT9H 5JPMB 3O6FA 3MREA 5FA3A 5C3LD 3BQUA 4YH6A 4JGMA 5DD6B 2XZCL 5GS0H 1AR2A 4I3RL 1T0MA 5BO1L 1HILB 4KV5E 5SX5K 1ZLVH 3QWRA 1KEMH 4CMHB 2DMBA 1I9JL 1XCQB 4LLAA 4IRSB 3AU1B 4PJHF 4U0RC 4OGXL 1O0VA 3E6FA 4X9IA 5FM5O 4FABL 3P30H 1LP9F 4KVCL 2Z92A 1K2DA 1S7RB 5I66B 5F8RC 3MV8D 1C5CH 5BXFA 4UIMA 5DHXB 5KSAD 4XP1L 4PJXE 5FUOL 1JNLL 2J4WH 1CF8L 3NZHH 4XP5H 4LQFL 4YHPA 4K71C 1YEGL 1AI1H 3JV4A 5IFHH 4GXUM 3A67H 3P11H 1ZLVK 5I1HH 1IEAB 4MQXD 1R3KB 3ARBA 5A40E 5HYSB 1MOEA 4KI5F 1JYNA 2A9ML 1S7QB 4BH8A 1X5KA 4OI7A 1MHEB 1ZA6B 4WUUB 3B3IB 3OZ9L 1HQ4B 3QJHA 3TBWA 1E6OH 1A7BA 1GAFL 2OJZH 2Y1VA 5HHOD 4J12A 1JGLH 1JPGB 1KENH 3VWKA 4OD1L 4F9PA 3LQZB 3K7UA 3OPZL 1V05A 5GRVL 1LE5B 2HFFA 3RNKB 1OAYH 1PKOA 5TQ0H 4PG2C 5JW4R 4ELMA 2XIDA 1JNHA 4KMLB 1B4RA 3HG1D 2LU4A 5L2KB 4RISL 4BQCA 1D5BA 3S5LA 3FO2B 3DETC 5TF0A 2G5BB 4NQVA 4O2EA 5C07B 1U8IA 3IDXH 3MYJA 3S5LG 5IMLB 1QR1A 1JUFA 4HPYH 4MNQD 1BX2A 5BRZD 2LE9A 4OCSL 5AUMB 4CNIA 5ANMA 2E9BA 5DLMH 1ORQA 4KH2A 4RSVA 4MWFB 3MRLA 4I0PC 4FQ2L 4NO2B 4OZHF 4HEPG 4LSSL 3LKPB 3QA3B 2AK4E 1JBJA 2W9DL 3WN5A 1BIHA 4QHNB 4Y7MA 4OF5A 4XVUD 2F53B 5CJXA 2NY4B 3MMEB 4M8QB 5IHZA 5EU7C 1E27B 2V9RA 4ODUB 1EHLL 3MRJB 3B9AA 4RAUA 4AEEA 4F7EB 1NANH 5LWYL 4MJ6A 2RFXB 1UM4H 1WFTA 5IB2A 5I19H 1FNSL 2W9LA 3MGOB 4NQED 3ZSTA 3T3ME 2JB5H 3MFFB 3QPXL 3IJHA 4XVSH 4NZUH 5JQ6H 1CFQA 3MXVH 4QRUA 3UJTH 4RAVA 2Y6SD 1E28A 2HTKC 4HUMB 4JM2D 2ZPKH 4X4ME 4NZTL 3GK8L 4DEPC 1RUKL 3OKMA 4F37F 1B9ZA 4JPKL 1W72A 4AJ0A 1GHFL 4MNGE 4NO0A 5TDOA 1NGZA 4UOW0 5F7UA 1JHKL 4OFYA 1FSKB 1NANI 1MCEA 2A2QT 2IPUK 3O2DA 1MIEH 3MOBH 4PJHA 1T1ZA 3EO0A 2BERA 1R3IL 2FBJH 4PJBA 5DF0A 4FQXA 4QCIA 2PN5A 3B9KD 1LP9A 1XEDA 5SWSB 1S5IH 3RTQD 4OF8A 43C9A 5HVHB 2DLEA 3TNMA 3UMTA 3KR3L 2PYEA 5LG1A 3WDHA 3JWOH 5F9WC 2GCYA 5GZOC 4H20H 2EH8H 1RZ7L 4APQB 5DHVA 5JZ7D 5HXMA 2VLLA 4YIQA 4M43H 4JFOB 4S1QH 5ESVA 3VFVB 1GC1C 3J8F7 3EJJX 1ZGLM 2O26U 1QKZH 2IQAA 3GBMH 5I73C 1U41A 1J8KA 4R8WL 3RZWA 1P7QA 1RIUH 2BVOA 1QFHA 1SY6H 4U1GC 1I8LA 3IJYB 5DRZA 4F57H 5JA9A 5JW5A 3GJFA 1Z5LB 1SJVA 1MPAL 1R5VA 2W0PA 3WFCH 3U4EB 1K9TA 4TTDD 5J6HA 4I2XE 1BAFH 3RBGA 3DMMB 5EOCH 2BC4B 4WI6A 1UXWB 1U6AL 1T4KB 1EPFA 2D0GA 1LD9B 4UMGA 1A4KB 4KI5E 1N2RB 4LPTA 3TGXA 4M03A 3IJSB 2AV7B 5GGSB 1S8DB 1LDPH 2DQHL 4LCYA 4CGTA 1LE9A 3D3VA 3MRMA 4PJ7F 1MI5E 5E0QA 2J1KA 5E2UL 1S9VA 3DBXA 2YK1L 1IC5L 3BW9A 4UT7L 1KIRA 2IF7A 2JJUA 3P9MB 1F02I 4KRLB 3GSOB 2VTFA 2ZG3A 4HJGA 2EXYC 1A7OH 4OD3L 1P9MA 1IFHL 5BJTA 1IGML 4RGNE 5CSZB 1FO0B 3KPRA 3D39E 4QRSA 2YPLB 4F7CB 5CZKA 3S88L 5I6XC 4W68A 3NCFB 3PJSB 1GZQB 5L2JB 3VA6A 3W9DA 2XZAL 4OZHE 2RCSL 2ORBL 2ARWA 4AT6A 5MI0B 4HUUB 2ZUWA 3P0VL 1PY4A 1OHQA 4HWBH 4L9LA 2FX9L 1FH5L 5CWSB 4DZBA 3GSVA 4I77H 5FYLH 1EHXA 1JPST 1RZKL 3U79A 2EEBA 1CLYL 5E6IB 1XF3A 2GQHA 1CGTA 4QXUL 4YUEH 5IMMB 2I5YH 3ARFC 4P2RA 5FUCC 2HKFH 4U7KA 1JRHI 4C59B 5CJQL 3TFKC 4X98B 4XPBL 2NY1D 5SWZE 3V8OA 1AQDB 1MHCA 2D31A 4Y4KD 4OF3A 2GSIA 4YHLH 3MLUL 5EPMB 1F3DJ 4Z7WF 5F3HB 1BP3B 4XBEL 4M62H 3CFBB 1WCBB 3TT3L 3O0RH 4MAUH 1S7XA 2VISA 4FQQA 4PJ5E 3H7BA 5ISZE 4UU9A 3QXAB 2DWDA 3O9WA 1X6LA 4JRYA 1I7TB 3G9AB 4EN3C 2VXQH 3TN0D 5GRJL 5HVGB 4RMUA 3FOMB 5ACLA 4HKZB 3PGDB 4G6AC 5I8EA 2IQ9H 4HDIB 3BVNA 2BMKA 5FUZH 1YMHB 4ISVA 4XPGL 5CILL 4XMKH 4XPTL 1GGIL 5FAAA 3BJLA 5I1GH 4X5LA 1CLOH 1AIFA 5C6WH 2V17H 2EDLA 1Z2KA 4K2UH 2KBGA 2ZOKA 3QB7C 2YPVL 1DN0B 2DICA 2ICEB 3OJDB 5FO7B 1U8NA 5T3XE 2CK0L 4F3FB 1RAMA 4DN4H 2VL5A 3P4OB 4K3GA 3OKLA 4MJ2A 1F90H 4JQIH 3TCLB 1K8DA 2UYLA 4LLMA 5KSVB 1QLEL 5JR1H 1IAOB 1J8HD 2YWYA 3D0LB 2R1XA 2JJSC 4LRIA 5SWSE 3QXUA 1HHHB 3QHZH 1VPOL 2BDNL 1F8TH 1MJ8L 3O41A 1T04B 4GMSH 4R4FL 3DROA 3T0XA 1IKNC 1F3JA 4IIQC 4YAQB 3E3QE 5J11C 5C7XL 5AAWA 2CLRA 5IMOB 4IJ3C 1AP2A 1I3GL 4FQIL 5IFAH 3RZCA 1U42A 2IADA 1M7DB 1NLDL 4PRHD 3ARDA 5DTFA 1AHWB 1KJVA 1BLNA 3FQNA 3U30C 2EEDA 4GAGH 4G8GD 4YDLB 1KF9B 5DHYA 1CU4L 4XBPB 1FGVL 5JW4N 4L5FH 1HSAA 4ENEC 5I0DA 2Y07L 1OGAA 3SDDA 3HC0A 2DN7A 3P9WB 1Q1JL 3DUHA 5T1LD 4OIAA 4HUVA 1RHHA 1BZ7B 4GRLD 4LHUA 1PZ5B 1D9KD 1MREH 4JFDB 4UILL 1T1XB 4LHUG 2ZCLH 3SGJC 2DI9A 2FH6A 2CDEA 1VFAA 3LB6D 1QNZH 4PUBH 1CR9H 3CK0H 3BIBX 1PD6A 2R56H 4P57B 3OKNB 3UTZB 1MCPL 4MA8L 2QQKL 3QUZB 4UZGA 1G6RH 3MRRB 3U9UB 1E4WL 4F7PA 3L3IA 4WHTA 3C6LD 5K9OB 4ZXBA 1FNGA 2A6DB 4NO3B 1DBKH 1G7PB 4Z7WA 4L8DB 3KYKL 5ADOH 3S4SA 5I76A 3QIUB 4XX1G 2DYPD 4GSDH 5E08H 1G9MC 1IC4L 4H26B 2YPLE 2W9EL 4L8SB 3S4SG 3CXHK 4KY1L 3DTXB 5I1CH 4LASH 1NDGA 4XNXL 4P2OC 5DJYB 3MRDB 3RX8A 5ICYB 1S9WA 3IDMB 2VE6A 4JR9L 1A47A 2XXMB 4KKCC 4XNQA 2IFFH 5C0BB 4NCC1 5GISL 1JZ3A 1S7UB 3T4YB 4XCEA 3I6GA 5JMOC 4KMTL 1MCRA 1MF2L 2P7TA 2AJYL 4MS8D 2VLKB 3KPQB 3U82B 2FEDD 1A6UL 1TQCC 1DFBL 2BNRA 1KCUH 5IQ9A 3PDDA 3M8OH 4HS6A 3AXLA 3U46B 3C9NA 4KK8D 1KPRA 5EZLA 4CBPA 4NZJA 4WW2B 1NEUA 3X11B 5DDHB 1OSPH 4QOKD 1NGWB 4P48A 5J12B 4LEOB 3QFJE 3T2NH 1AGBB 3Q5YA 4ELMF 4P46C 2F8XC 3B2UD 3T2QA 4QHMB 4PJ8C 4O51A 4P5MB 1I7RA 9CGTA 2A6IA 1AGDA 3QFDB 5DWUL 3S3SA 2UWEB 2X1XR 4PRAA 5I8OL 4D3CH 3WSQH 3WXVL 5B8CC 3G5VB 4LSQL 3GHBL 4M7ZC 1NC4B 1EEYA 3OXSA 1A2YA 3BXNA 1QRKA 4A6YL 4M7LL 3D69B 5ALCL 4G9FB 1WAAF 5I8KL 1M6OA 3FN3A 4OQTA 1INEL 2OBGA 4FP8H 1E4XH 2XA8L 3GMPA 1ORSA 2W07A 2HJKB 4MJIE 5F7YC 5FM5M 3T4AB 3B6SA 3CVHL 1CFTA 3LD8C 1FL6B 4IOIB 3AREA 5F1IB 2LQRA 4JFFB 4PG9B 3TH3T 3U0PB 3S7GA 3T0WA 5JDSA 5L8JB 5I16B 1N8ZB 2ESVE 1S7WA 1KLGB 2BFVH 4F33B 1R3HB 1AY1H 3HMXA 5IVXF 1VKXA 1UKTA 3EYVB 3MRFA 1GGUA 3MUGA 1C1EH 1SMAA 2V5SA 1CD1A 3HZYB 4YPJA 3QEQD 5HGAA 1PKQB 2OK0H 4NC2B 2DQGH 1E4XI 1MFAH 4YBLC 4JZJA 3BDXA 1UC6A 3FFDB 4ZQKB 4NWTH 4OKVA 2FIKB 3EO9H 3UTPD 1YNTA 2A9NH 4R96B 1T20A 4RMRA 1QR4A 1FPTL 2VC2H 4FHBD 4XPFL 5ETUB 3NH7L 4MD4B 3K2MC 1RIHH 1UT9A 3DVNA 5IJKC 1BVZA 4HXBH 4JFYA 4ZUVB 3SDXB 1PSKL 5DZOA 1CN4A 2E6JA 1B0RB 5C08B 4Y19B 3VMPA 4NQDB 3IRZA 5HHNA 3H9HA 4QXGH 5ITBL 4JKPL 3E0GA 5DC0A 3T0ED 1LEGA 1GZPB 5KVGH 2QR0B 3B2VL 4G6KH 3TJEL 3S8WA 3MLZL 3PF2A 4JN1H 4JDTL 2O93L 3T04D 5C0AB 1ODAA 3VXSA 5EH1A 2JJVA 1UH4A 3L95A 1QLFB 5F7DB 3L6FA 2YBRB 3QG6B 2GJ6E 5DO2D 1CGXA 3RUGA 5E8DH 3UYRL 2BSRB 4G8FB 3MRKB 2QHRH 4X5WA 3VFUB 1ZHNB 3DYOA 3F65A 4CKVX 2EDXA 4P5TC 4HD9A 3LKOB 1N59A 4TNWK 4RWYL 3ZDYE 2VDLH 5I74C 1B88A 2XPGA 1QRNA 5D1QD 4WO4B 1BBJA 2Z4QB 5CIPB 2W38A 5IB3B 2YD3A 2A6JB 3QI9B 4H1LH 3OHXB 4GT7A 4JFHE 2XACC 3MJ7A 2APXA 1ZANL 4HH8A 3RWIA 2ZKHL 4RDQF 4U1SB 2P47B 1UVQA 2WINA 1TJHH 2EE6A 4Z6AT 5DK3A 4Y1AA 4L3CA 2VLJA 3VXMD 4WCYL 5ADPL 1VENA 2EDRA 4CL7A 3ULUD 5F9DC 4U6VH 4N0UB 3JTSA 1NCNA 3MV7A 2J6EA 3UP1A 3F5WA 3V7AE 4DKFL 4HJJL 4QHLA 4DCQB 1FVEB 3V79C 1F13A 2FJGB 1A6TA 3I75A 4PREB 4JY6B 4RNRA 1JZ8A 2JCCF 3CSBA 4BZ1L 3L5IA 2IGFH 1XGRA 1KCLA 3FFCB 4X4YA 3CSYB 3GUTA 2OSLB 3GBNL 1KGCD 2I60L 5FYKH 5HHOB 5IVXA 3DI3B 4YDKL 4U1NB 2VMFA 4R90H 5T3XH 2DLTA 2NLJB 2OI9C 2UWEE 3VXUA 1BFOA 2P45B 2Z91A 4HFWA 2E7BA 1QLRA 4LRNL 1CFVL 2B8OT 3MUHL 5HDLA 4P4KA 3W39A 3EYQC 2VXTL 3EJYC 1MWAA 4XAWH 4M7KH 1A64A 1IVLA 3HPLB 3OKDB 4JPIB 1RUML 4KU1A 1DQDH 3INUH 4IMKC 5BOZG 25C8L 1TZGL 2OP4H 3BPOC 1ND0B 1X5XA 2XFXA 1IGIL 2EC9T 1YNKL 1XGUB 5FKPA 2BVTA 5JIKA 2MQ3A 1MHHB 1TETL 1TZIB 3QDGD 1A3RL 1MAML 4J3VA 1QUNA 2VDRL 4M7JL 4MA3B 5BZDA 5TPWH 4RGOH 5KVEL 4L29A 3DVGB 1KJMB 1FIEA 3C5JA 4PRNA 4PJ9C 5IT2L 3HE6A 2A74A 3A6CH 3H9SA 4NKOA 1FGNL 2EDNA 2VLME 2ILLA 3S9DB 3MLRL 2E9WA 2DKMA 2Z8WC 5IQ7L 2QADC 2AK1H 3ARFA 1PKQE 3PV7A 3TIDB 1PVHA 3CXDH 2FX7H 3F7RA 5EN2A 3U1SL 3GGWA 3MA7B 1UCTA 3QCUH 3G6JB 3CH8A 1S3KL 4S11A 3LEXB 4JO1H 2ENSA 4I0PD 4A2LA 4XCCH 2CO7B 3KWWB 4YR6B 3T1WA 4K7FB 4YZFF 3KPOA 3LEVH 5FCUH 3U4BH 3FN0L 1HH9A 4E41B 5FHAL 4Z5RB 1A1NA 4LSUH 3QDJD 4RQQA 1RZKC 4TTGA 2NXZB 3ARGB 1JWMB 2E7MA 2N7AA 1YEEL 2AEWA 4WV1C 1P84K 4M6OL 3DO7A 3MBEB 1V7ML 2P24B 3QO0A 3ZDZF 3BZEB 4RZCA 1XMWA 4PJGF 1MFDL 2NQCA 4J1UA 4YXKL 1H0DB 5AEAA 5HHQB 2EYSA 1J88A 1F4WH 5D2LB 5C8JB 4NBYB 4Q58C 5E9DB 5HYQB 4P4RB 1QA9A 1Y6NR 4L4TA 4RDQG 2HTKD 1CBVH 3LS5L 2Y25A 1FFQA 1TITA 4Y8AA 4LLDA 3P4LA 2G2RB 5EBWA 5HHPA 1NCCL 5F9OH 3DNKA 1FHGA 5GGRB 5J9PA 2JCCA 1UJ3B 4NWUH 1LEKA 1LO4L 4BH7A 4XNYH 4JDZA 1INDH 3Q5OA 4XVTL 1MCNA 1IKNA 4XPHH 1NUGA 1W8OA 4LU5H 2HTLD 2GUOB 3WIFB 3S36L 12E8H 1V8HA 3EFDH 1ZTXL 2HFGH 5GRZA 3NABL 4DOHB 5HPMA 1KB5B 2ADFL 5E5MB 2XG5A 1T5XA 3MXWL 3MREB 3O6FB 5FA3B 3WFZA 2OZ4H 4TN9A 2MQ0A 2GJJA 5BW7C 1CT8A 1T0MB 4Y4HC 3BESR 3PQYA 2CKBA 1KTLA 1FRGH 3NFPA 3RWCA 3MV8E 3LY6A 1OTSC 1J1OH 1PEZA 2D7MA 3L5WA 2XA3A 2I9TA 3E6FB 5ILTH 3BPNC 4P3DA 3MR9A 2Z92B 3UTTD 2MNUA 1K2DB 1RFDH 5IHUL 1FP5A 2GJZA 4XP9H 3VD7A 2R4SL 2VJXA 4KFZC 5BXFB 1QEWA 4UIMB 2VYRE 3HR6A 4Z7OE 4N1CA 2W92A 4YHPB 1RMFH 3JV4B 3K4AA 4LSTH 2ERJB 5CGMA 1GGTA 4LARH 4JG1H 5HHXH 3M07A 4HIXL 5HHOE 1JTOA 2H41A 4RFNB 4BH8B 2X5PA 4W4NA 4N90D 5FGCE 4I3SH 4Z0XA 1LO3H 3TBWB 1IQWL 2AV1A 1T2QH 3D2UD 3ZKXB 4QNPF 3VXTA 3HG1E 3VWKB 1KYOJ 1UKQA 3MJ8B 4LCIH 1FFOA 1TVHA 1VFMA 2F58L 1NFDE 4K8RD 4PLKD 2HFFB 3JVGA 3PXHA 1PQZA 1FG9C 1JNHB 2NXYC 4RA3A 4ELMB 4XI5C 4F9LA 1EH9A 4HV8A 4XHJD 1D5BB 4MNQE 3S5LB 2EXYD 3RWFA 4M1CD 5BRZE 4N0CD 4Z0BH 3QULA 3F6LA 2IAND 2B20A 3QIWA 4U05A 4P2OA 4NQVB 4QRTA 1JN6A 1BOYA 1U8IB 4O2EB 3MYJB 5FXCH 1QR1B 1JUFB 5CLTA 1K85A 1HIMH 1OM3H 3QSKB 5CEZD 5F93C 2C26A 3N1MC 2G9HA 4CNIB 2XQYG 1HWGB 4PJGA 3R0NA 3MRLB 1NLBH 5GGVL 4BSVA 4KUZL 3U7YL 1MFNA 2IFGA 3CVIH 5I0ZA 4I5BA 5FK9A 2HRLA 4GBXD 3WN5B 3FOLB 3VFOA 3W0WD 3ESVF 1U0QA 1T1WA 5C71A 3G6JE 3H6JA 2NYYC 5IHZB 1T6WA 1A7RL 1YC8A 2E27H 4MYWB 4M48L 3G5YB 4RAUB 3OSKA 1U8PA 5FDYA 4MJ6B 3DV6A 4JGJA 5IB2B 5FGSA 4P46A 2BY1A 3GKWH 2JELH 4S1RL 4E41E 2GAZA 1H8OA 2Q8BL 1ZHKA 3IJHB 1KJ3L 1NL0L 1CFQB 3O11A 4C4KT 4QRUB 4RAVB 4NN7B 2ITDA 1E28B 4P23C 4LDEB 4Y4FA 4FTVD 1GOFA 5CZVH 2OTWA 1JZ7A 3OKMB 2WLZA 3DX8A 1W72B 4EN3D 5KZCD 4NO0B 5TDOB 4MLIA 3ZMRA 5KBNC 1NGZB 4KK9D 4JPWH 3VGFA 1FO0L 4LQ1A 4LK4A 5AD0A 4G6AD 3LKRA 1ZGLB 4JRXA 3WFEL 5KVMC 5E9DE 4M4PA 1T1ZB 1LEIA 3EO0B 3KLHC 1GSMA 4NHCL 2YZ1A 4PJBB 5D9SA 4FQXB 4QCIB 1LP9B 3DV4A 4G6MH 4ZMAT 3SE4A 4MGXA 43C9B 3KJ4C 5D7IE 2DM7A 3TNMB 3LS4L 1BZ9A 3UPRA 4MXWH 1WBXA 2PYEB 2XZZA 3U7AA 4X4XB 4XC3L 3ULVL 2JK5A 1PYWA 4UNUA 1AQKL 4X0KA 1ZT7A 2GCYB 5F1OB 5E03A 1DBAH 1FNLA 5DHVB 4NC1C 5I9QC 2VLLB 4YIQB 1ACYH 3MLXH 1BJ8A 5ESVB 3DX9A 3IAPA 1NUDA 2V2TA 2VDQH 1OARH 4DOHE 5F71A 1MFBH 1YPZF 3FCTA 3UC0H 2IQAB 1SJEA 1FC2D 2Z9TA 3V8CA 3BYYA 2KL6A 1P7QB 4WI2A 1AO7D 3QUYD 2BVOB 2Y06H 2P5ED 1MCWW 5DRZB 5JW5B 1QSFD 2KQNA 3MRBA 1IAMA 3GJFB 4KKBD 5EO1A 3LKSA 3KVQA 1R5VB 5J6HB 1IJ9A 3C2AL 1G7MA 1WEJH 5H37H 2RBLA 1LO0L 4UINH 3M1BA 3NCJH 3KG5A 4AMKH 3AC0A 2VAAA 3KDMA 1DCLA 2H32H 4J7RA 3BE1H 4QNPE 1LE9B 3D3VB 3MRMB 1TJIH 2DWEA 1CLCA 4RX4A 3EDJA 1JHLL 5F9JA 1CGWA 1A5FH 1KEGH 1S9VB 3DBXB 3EOBA 3BW9B 1KIRB 3VD5A 3TA3C 3RIAK 3T3PF 3AB0B 4C56D 5EUOF 4HJGB 4DAGL 1NUFA 2FD6L 3HZKB 3S35L 2CIIB 1MJ7L 5I15L 5BJTB 1NPUA 4YK4B 5F96L 2DQJH 2K1MA 4OTXH 4OLUH 1VEMA 3LMJH 4K94C 4QRSB 2XZQH 2EDDA 1MFEL 1ETZA 4FQ1L 2Y5TA 1KCRL 1NBQA 3SCMA 3W9DB 3KPMA 4UV7L 1J5OH 2YR3A 3AY4C 4YXLH 5TQ2H 4O02H 2Y9RT 3WDJA 5FKAA 1N7ML 4AT6B 3TPUA 3IT8D 1LDSA 4DTGL 3BX7C 4L9LB 3TYFA 3MCKA 4DZBB 1F4YH 3GSVB 3BRDA 5TE6H 1RUPL 4OB5H 2AQ2A 2VZTA 3RAJL 1XF3B 4UI2A 1J0ZA 2DLHA 3LKNA 3LDBC 4M8VA 3D18A 4P2RB 4KKCD 1NUNB 3NA9H 3NZ8B 1TXKA 1LMKA 3MGAA 1MHCB 1KCSL 2GSIB 4OLZL 1DBBL 3GNMH 1H3GA 2YUWA 4WTZA 5JXAH 4M5ZL 1S7XB 5E99L 2VISB 4FQQB 4MAYD 4HQQH 4HUKB 1IGYA 4WTZG 2DWDB 3O9WB 3UJIH 2WK2A 4JRYB 3MZTA 3DXAA 3TVMC 3OQ3B 3QDAA 5FYKU 1DQLH 3SBWA 1UZ6F 4JM4L 2NCMA 5F1KC 3H9ZA 5I8EB 1J0KA 2EDEA 3BVNB 2BMKB 2GT9A 4MJ5A 4ISVB 4PJ8D 1U95B 1YPZA 1MUJA 3PNWA 4I4WA 3UO1H 1AIFB 1NSNL 5DJZB 5GPRA 2ZOKB 3SKJH 1UWGL 1HYSD 3VH8A 1U8NB 4I18C 1J8HE 3GKZA 1JF1A 2BSTA 2CMRH 2P46B 5I30L 1KBGH 1FBIL 4IHOA 3DVIA 4IMKA 2VL5B 1UYWL 3SDCC 1L7TL 3VH8G 2D7OA 1VA9A 1K8DB 2UYLB 4LLMB 2A73A 4CAGA 4TSBL 4PJBE 1BD2D 1DEEA 1KXTB 1P4BL 2R1XB 5I1IL 3D0VA 5MERA 2HWZH 1IM3A 3UTSD 2D03H 1PG7X 3IDYC 4NM4H 4YC2C 3O41B 3WXWH 3MODH 3DROB 1J12A 4M5YL 3BOVA 1F3JB 2FEEL 5DEGA 5F7LB 4HCRH 3WKML 4PRHE 3TESA 4JG0H 4RBPH 2XY2A 1RVFL 2NX5A 2CLRB 1AP2B 1MAJA 1MFCL 4G8GE 1C16A 4D9QE 4PFEA 3MFGB 1OP9A 3RZCB 2IADB 1EGJA 2RQ8A 3ARDB 5DTFB 5KJRL 2DQFB 1KJVB 5E24E 1CVRA 1BLNB 3FQNB 1I8MA 5EUOA 4YFEA 1YMMA 5AAMA 1NCBH 2J8HA 5I1EL 5DVOA 5I8CA 1FV1A 3GIVA 4EZMA 2W0FA 1ERNA 4PRIA 1HSAB 4NM8H 4W70A 1NGQH 1OGAB 3VWJA 3L3OA 3SDDB 2MKWA 3NPSB 4MLSA 3HC0B 2DLIA 4DW2H 2Z31D 4NFCA 5IWLC 1RHHB 4RBPK 4HUVB 4LKXA 2VN7A 4AL8H 5D7KD 3QQ4A 4IRZH 1QYGH 5HHVL 4JRWA 4LHUB 3I2CL 1ADQL 4PJEF 1CTNA 2R4RH 3IRPX 5GSVA 1X9QA 1JGUL 5DQDH 4PJAF 2CDEB 1VFAB 1CE1L 4QY8A 1EUTA 5DD5H 3PL6D 3BSZL 4Y5YA 2QSVA 5BVPL 2RR3A 3QO1A 4LOUD 3QEGH 3SE9L 3O6MH 1N4XH 5C9JA 1T03L 5BS0D 4ZAKD 3EYUL 2GY5A 1TVDA 3UBXI 1IL1A 1MCKA 1IM9D 5A3IC 3CAFA 4F7PB 3MPCA 2D3VA 5T33H 3ZE0F 1F11A 4QTHA 4ZXBB 3V4UH 3HI5H 4HIIA 4LCWA 1N3NA 5CJ8A 5IW6B 4Z7WB 3M17A 1P4IL 3S4SB 1Q0YL 5I76B 5BVJA 3JV5A 5EBGA 5D5MA 4OI8A 3NFSL 4JLRA 3VFSA 4WIQA 5J1SC 1NDGB 1O5DT 1F4XH 4PRPA 5JOPD 2ZJSL 3HFMH 1S9WB 4HS3B 5DYOA 2VE6B 4P5TD 1FFNA 3OX8A 2IH3A 4XNQB 1NBZA 2KQMA 2HN7A 1NBVL 4W6XB 3IFOA 5D70L 3I6GB 4HLZG 5BW7A 1FZMA 1I1YA 4YHYC 5A1AA 2P7TB 1B6DA 2FNBA 3PG2A 3QXVA 5E4IA 1UWXH 1NKRA 4KHXH 3TYGL 2BNRB 3GSUA 4XMLL 4ZOAA 4WUKL 2HLFD 5IQ9B 4KQ4L 3AXLB 4LVEA 1TCRA 3C9NB 1KPRB 2AEQL 5EZLB 4LVNC 6FABL 1RURH 1J10A 2H1PL 1QSEA 2X4QA 4P9ML 5KS9F 1NAMH 5EUKB 2YRLA 4NKMA 1UWEL 5JW3H 3VFNA 3BN3B 4HUNB 1M1SA 2X4RA 4O51B 2YSSA 3PE9A 4M1GL 4K71B 1I7RB 4LLQA 2A6IB 3X3FL 1RZGA 5DUBA 1KELL 3EDEA 3V6OC 3VG0H 2WSKA 4G6FB 4PRAB 1FVDA 3GZKA 1UWXK 3ILPA 1BZQK 4FQLH 1EEYB 4OCXL 3OXSB 5D2NA 4UDUA 1A2YB 1GVIA 3A6BL 3BXNB 3NCYS 2E3VA 3SE8L 1UXSA 5DUPL 2ZG2A 4JY4A 1WT5C 2HLAA 1M6OB 1IAIL 1S7TB 1WICA 3O2WL 4X8XA 3D85D 1BJ1H 3GMPB 1RZIA 1ORSB 3B6SB 1CFTB 3V2AR 1EEZA 3FQRA 3QYCA 4RRPA 3AREB 3EYQD 5FA4A 1J1XL 4JFPA 4HC1L 4EQ3A 4RRPG 5C86A 3ELAT 4Q0XH 1HN1A 5JDSB 4YNYA 4U2YA 2WP3T 3N85H 4G7VH 4NZDA 1S7WB 5CUSH 3QEQE 4PJEA 4AQOA 1F58H 5JOEA 4Y5VC 5I18H 1KJ2B 4QGYA 1T21A 4PJAA 1VKXB 3UEZA 2E7HA 3KPSA 4HF5H 3MRFB 5F7NC 3UTPE 3MUGB 1A6VH 2APWA 5EOCJ 1UA6L 2BZDA 1CD1B 2AJUH 3U0TA 5HGAB 1Y0LA 3L3JA 3GO1L 4CVXA 4OKVB 4YXHH 1YNTB 2FO1A 3QDMA 5E8PA 1T20B 1FIGH 3V6FA 3RA7H 4PJ9D 3U7WH 2KKQA 5GS2D 5DD3H 3C2SA 2ATKA 2WWMC 4X7TA 1CICA 5D7JC 3DVNB 4WW1A 3S3JA 2OMBA 4YO0A 1MY7A 2X9YA 1FNEA 4TPRH 1QFWM 3A6OA 3QRGH 1F2QA 4JFYB 1TENA 4AYFA 1DUYA 3GDBA 1PZUB 1MCIA 3T0EE 2GIYA 3C8HA 5MEOA 2VQTA 1G7QA 4N5EC 4ZSOA 2WIIA 1QVOA 1Q94A 3J7HA 4QRRD 4R9HA 3QRFM 3H9HB 1NCTA 4S2SA 1RV6X 1JRHL 4CN4A 4DEPB 4XC1H 1LEGB 3I50L 2R69L 1E6JH 4NCC2 5TJWK 3L7EA 4NN5C 3VXSB 4KKLC 1NCAH 5JQHC 2OL3A 1NMBL 3L95B 2IBZY 3L6FB 3WD5L 1BVKA 5GGTL 3V6ZA 3RUGB 5BOPA 4POUB 4S0SD 4HIEB 1JPTL 4LF3A 5DA4A 1I7ZA 35C8H 4HG4J 2ZG1A 3K46A 1XF2A 3CFCL 2FDBP 3D9AL 1N59B 4Z78A 5L8LB 3PGFH 3RY5A 3EHBD 4OZGE 4CU7A 1XIWA 3KJ6L 5D7LD 3ARRA 3VFTA 3ZDXE 2XPGB 2QTEA 1U8MA 1X3DA 4CU6A 1QRNB 2EYTA 5F9WB 1BBJB 1BM3L 4ALAH 2V5TA 4FXKA 1JVKA 3KYMA 3NIDF 3VXME 1CL7L 3MJ7B 4S0TD 3QPQD 4NPYA 3ULUE 2VXSL 3RWIB 1JNNH 3C08L 1FYTA 5FF6A 1UVQB 3FONA 4Y1AB 4L3CB 2VLJB 2E8ZA 4XNZB 3FB7A 3MZGB 4U1GB 3JTSB 3MV7B 3WFHA 4ZD3H 3F5WB 2MFNA 5ESAA 5F70A 4QHLB 1CDBA 4Y4HD 1A6TB 3I75B 4YWGH 4RNRB 1KGCE 3CNKA 4CJ0A 1XGRB 2DL9A 3H42L 4LCUA 2ITCA 2V7HA 2FGWH 4ONFL 1W0WA 1B4JH 1DQQB 1EDQA 4K55A 5A2KH 5IVXB 4OJFL 2VDOL 1BMGA 1YY9D 5TDNA 5E2WH 4YHMH 2X70A 1FNFA 4P9HH 1BFOB 1WWWX 4X7EC 2Z91B 4JFEA 4HFWB 1QLRB 2DIBA 5LXGH 3GRWH 4WI4A 1EFXA 4JHAL 5HVWA 4P4KB 3W39B 3X12A 4OBSA 3S34H 1MWAB 2J8UF 4JPVH 2D0FA 1YECL 5HD8C 1HKLH 2F5AH 4MB5A 5TGBA 4MA7L 1TVBA 2LVCA 5EU6A 3JWDH 4PJIE 4PY8I 5GGQH 3WHE0 4NKQB 2IAMD 2XN9A 2XFXB 5JNYA 1WGOA 3MA9L 2AS5M 5FKPB 4XNUL 2JIXA 1Q72H 5DFWH 5L6YL 5T1DH 3NAAL 3AY4A 2EKSB 5C0EB 4ZODA 1KB5L 2NXYD 5BZDB 2OLDA 5EZOH 3BIKA 4JO4L 4L29B 4UT6H 3VI3E 5IF0A 4S1DC 3B5TA 1G7LA 3U48A 2VITA 3C5JB 4PRNB 3HE6B 1IKFH 2A74B 2DIJA 3H9SB 1A7QL 4NKOB 5FV1L 2GITA 5IVZA 3TPKA 4HX1A 3ARFB 2DTML 1N6UA 5B3NA 4NIKB 2EIBA 2VL4A 3BKCH 4KUCF 1JYWA 2R0LH 1P7HL 2HJFA 3H3KA 3E2HB 5EORH 4JDVA 3QDJE 3SQOH 5M95B 2EEAA 4J4PC 4PLJD 2PTVA 5DMYA 3KPOB 4JFZL 5EU7E 3P40A 3V52L 1HH9B 2VLRA 3PP4L 1A1NB 3O2VL 3PV6A 3TO4A 2JLLA 4RQQB 1ZVSB 4PGBA 3OB8A 3QUMB 3SDAD 5T1KD 4XGZA 1CQYA 2YWZA 1OAZL 1RUAH 3DO7B 1MRDL 4WGWB 1IILE 3QO0B 1U8JA 1FLTX 4RZCB 5MP6L 2MCPL 4J1UB 4YBQC 5INDA 2BY0A 4U31A 2EYSB 1TLKA 3FRUA 4L4VD 4BZ2H 1OTTC 1QA9B 2ARJQ 4L4TB 5C0NC 3HAEA 3MNWA 3VE0B 5BQ7A 4P23D 3HB3C 3THMH 3MLWL 4HMCA 4LLDB 4OCYH 3RUGE 3SDCA 5EBWB 5HHPB 3HAEG 1N5YH 3DI2B 2R0WH 3SGDH 2CUHA 5HY9A 4D0CA 4CRPA 5J9PB 4Z7UE 2JCCB 2P8MA 1T22B 4AIOA 3QUZC 1LEKB 4BH7B 1WBYA 4JDZB 3KLHD 3FAWA 4YBHA 3LQMA 2BCKA 1QBMH 4ONHA 2YKLL 1BOGB 4JB9L 4K3EL 4KJPC 1ZHLA 4XB7A 1B3JA 1S78D 5J11B 3PWJA 4ZUUA 3QIUC 4ZO9A 3RHWF 3ARWA 3WIHA 4JFXA 5HPMB 2X6MA 3KAAA 3BDYH 1T5XB 4NSKA 5D71H 4CMMB 4F80A 1YN7A 3Q3GA 5E2VH 2DQUL 1CT8B 2J8UA 4XWGL 3U30B 3SGDI 2IBGA 3GSNA 1K5NA 2C3WA 4HLZH 1V3LA 2A83A 3PQYB 2CKBB 5J3HC 3UTTE 4Y1AE 1KTLB 3NFPB 3RWCB 3OWEA 2YD5A 3L5WB 4IDJL 3MV7E 5FO8A 2I9TB 3RDTA 3GMMB 1X5IA 4P3DB 3TT1H 4DN3H 4HXAH 2GJZB 1AFVH 1RZJL 1T7YA 4GH7B 1A7PL 1FFPA 2NY7L 4KVNL 3F12A 4WEBL 3SN6N 4BJLA 1QEWB 3QG7L 1U58A 4FRWA 2VSDA 2AI0H 3WE6A 4P49A 5IGXH 3TLRA 4WW2C 2VN4A 4XWOD 1T80A 5F44A 5DURD 4N90E 4ZFZA 4DFIA 1W72L 4FQJL 5I2IA 4S1SL 4I48A 4JY5H 2VDNH 1BVLA 3NFNB 3SQBA 1OW0A 3HR5A 5CGYC 3O2DL 3F58H 1VB9A 5EOTA 3X17A 4Z0XB 2AV1B 1RD6A 1YEHH 4U7MA 5F1SA 3VXTB 2PW1A 4B41A 3TWCL 4MXQC 4PBXA 5A2JH 4OAWB 1FFOB 1TVHB 3CU7A 2IANE 4JCLA 4MHHG 1BEYL 1PQZB 4U1LA 3TA3D 5JLZA 3RKDC 1GIGL 5C09A 4LEXL 3RWFB 5CEZE 4LPXA 3HC3L 4YHOH 4LHQB 3QULB 3QIWB 4FFYL 4NQSA 1TZHA 4P2OB 4XBGB 2PR4H 3EIFA 4O4YL 4QRTB 1JN6B 5D1XA 4DGYL 4KRPD 5A16A 1UM6H 4U3CA 3STZA 1IGFL 5DMIL 2G9HB 2BHUA 2E7LA 1UB6A 4HWEL 1PBYA 1TPXC 4PJGB 2DAVA 3CFIC 4OLYH 1WIUA 3W0WE 4BSVB 3RVWC 5AG9A 2QSCL 4HJ0D 2BRRL 1SEQL 2QQLH 1TQCB 4I5BB 1DSFL 5FK9B 2EXWD 3CLEL 4NCDA 5FUCE 1CFNA 4LAQL 3VFOB 1T1WB 3O8XC 2Y4SA 5FGRA 4QTIL 5HGBA 3EZ8A 5ABDE 2IALA 2XKSA 1U8PB 3A0OA 3DV6B 4CUCA 1A7NH 5EA0L 4P46B 5L7XL 4GLRH 4UBDC 4OIIH 5J1AA 4RIRA 4PJ8B 5GRUL 2G75A 1MRCL 2GAZB 5I17A 2X4OA 3R1GL 3ZT5A 1EXUA 1SQ2N 4JKWA 4M3JA 2BNQA 1YQ2A 3U83A 3V6OA 4EI6A 3AAZA 2ITDB 1AD0A 4M1DL 1KG0A 2GEEA 4GW4A 3PWPD 4Y4FB 1L0QA 1P5UA 3T2PA 2OTWB 3P0YH 3OAZH 1ZXQA 3DX8B 5GRYA 1YJDL 3TVMD 1KCVH 4M6NL 5IBTL 3MRGA 2KDGA 4MB4A 4V1DA 4ZTOL 2ZNXA 3FL7A 4C54A 5D1ZD 3LKRB 3OF6D 4JRXB 4Y16A 4OZFA 4G5ZH 2YS4A 4L4TE 1LEIB 2VWEC 4GLRI 2F54A 3OAUL 1HZHL 2R0KH 3LD8B 4HZLA 1T5WB 2FB4L 5D9SB 4FZ8L 4MJ4A 4ODWB 1HKFA 4QRPA 1G7JA 3WLBA 4PJFB 5DVMA 1BZ9B 5TE7H 3UPRB 1WBXB 3ULUH 2BJML 4OLWH 4PB9H 2ICWI 4FZEH 2JK5B 1PYWB 3TP4A 3OAZK 4RFOH 2Q7YA 4JZOA 4WWID 4YQXL 3F7QA 4X0KB 3O4LA 4Y5VA 1ZT7B 1QFUL 3BKML 5CJOH 3JWOC 1DEDA 1OWRM 2D0HA 1MVFA 3DX9B 1BQLL 2V2TB 2OTUA 3ZL4L 4YBLB 2HRPL 3FCTB 1JGDA 1SJEB 1QSFE 1TFHA 2PYFB 5KVDL 5C0GA 1YUHA 3STBA 5J56B 3DVFA 4N8CH 2ZCHL 4OLXH 5D7JA 4M6MH 3BYTA 4XAKE 1WF5A 3MRBB 3R0MA 5EO1B 2R2CA 3LKSB 4JQVC 4OLVH 1W2KT 1G7MB 4PR5A 4OCLC 1YZZA 1AJ7H 4MCZA 1U8OA 2RAMA 2ARJA 3M1BB 4LFHG 3CZJA 4Q9RH 3S6CA 2VAAB 3KDMB 2N56A 2Q87A 3BI9X 2KZ1B 1DBJL 2YN5A 1KN4L 1IGCH 2DWEB 4U33A 4YFLF 2AW2A 3WFBL 4C56E 1CZ8H 5F9JB 4IRSD 3T0VA 3EOBB 5E2TH 3MLVL 3X3GL 1RZFL 1EMTL 2AKRB 4X6DE 2VDKL 2HKHH 1OF2A 1DQML 4ODVH 4BUHA 4BSJA 4Z8FH 1SHMA 4MZ2A 2MQCA 1M71A 1FN4A 3FO0L 3UAJC 1ETZB 3LPGA 4HAFA 1KJ2H 3SCMB 5I74B 3VD9A 1RJLA 4PJDF 3UZEA 5C2BH 1AXTH 4F58H 1IRAY 4R3SA 3KPMB 4YE4H 5DZLA 5ACZB 3I3BA 4LSPH 3GHEH 1GH7A 5FKAB 4RMVA 3TPUB 4WUUD 4BM7A 4J3WA 4PY7A 1SYVA 2AJXH 3TYFB 3VMNA 5B38A 4TULL 4X7SH 3TEUA 3VRLF 5E2JA 2EYRA 3QUXC 4PLOB 2DLFH 3DIFB 1H5BA 3EOAA 5B38G 3LKNB 3E8UH 3G6DL 1NAKL 1X5HA 1H3WM 5L2KD 4K7PL 1U3HC 4TNVF 4UNTA 1I4FA 3LQAH 1VFBA 5KN5B 4L8CA 3CDYA 3KPNA 4PGCB 5C07D 3NIFF 3KNBB 4UDTB 2FX8H 1ZLSL 1IGYB 2WUCL 1A21A 4P59L 5DD0L 3T0AA 3DXAB 4BYHA 3WNOA 2A77L 3KXFB 4UV4L 4FQHA 4KQ3L 1LK3L 1Y6KR 1ZA3A 2CDFA 4B7LA 1FLRH 2FGZA 2DBLL 1CLZH 2CUIA 2GT9B 4MJ5B 5C0IA 5E8NA 5IFJA 1J0YA 3IAGC 2F53D 1Q0XL 1MUJB 2NXZC 2NY4D 2UZIH 3HMWH 3PNWB 5DS8A 3FZUD 3OR6A 2IWGA 4ZOEA 3PHQA 3VH8B 1BD2E 4UB0L 1JF1B 2BSTB 4NP4L 3R8BB 4IHOB 4JRXE 3WFDH 2V9TA 4CJ1A 4K3HA 2NY0C 4KJQC 3BPOB 3WO3B 2A73B 3MJ9H 3NCMA 3D0VB 1IM3B 5GSRA 2NTFA 4PJFE 3BZDA 5C1MB 4PRBA 2HH0H 3V5KA 4UIKH 1OAXL 2WBJC 4GUPA 4YX2L 2MPAH 4DVRH 3MLSL 1NGYA 2EO1A 4PJ9B 2NX5B 4AIXA 4BELD 4ZFGH 1C16B 3CFEA 1J1PL 1SJXA 3ARVA 1YYLH 2QADB 1DANU 4ETQA 3O4OC 3HCVA 4NJAH 4H5SA 2YD9A 4XCFH 5SWSD 5EUOB 1I8MB 1YMMB 2A6KA 1XF4A 4OCWL 1NCDL 5IM7A 3WS3A 4G3YH 5I8CB 1FV1B 5D7KE 1B2WL 2G60H 4J4PA 2VXUL 4NFBA 2W0FB 3BQUC 2O5XL 2ENYA 4PRIB 4TSAL 3L3OB 1UADC 4GAJL 4JO3L 4APQD 5K59E 4PJDA 1MAKA 4LKXB 3QQ4B 2IH1A 2WWMD 1D5IH 2DQIH 1C5DA 4H8WL 4HBCL 3SEPA 2PKDA 4K8RH 4HSQA 4I0KA 4RA0C 4GG6A 1V3JA 2J7LA 4HT1L 3C60A 3OG4B 5GSVB 5BS0E 4QXWA 4QY8B 5IEKA 4Y5YB 3QEUA 4OQTL 3QO1B 2PNDA 4K3JH 4N5ED 4TUJA 5E8EA 4BKLA 1C08A 4ZFOA 4K23L 3VGDA 5C9JB 2BP3A 4YHKL 5FYJU 2X4PA 2O5ZL 1IL1B 5CEZH 5GHWH 3DMMD 1F11B 4QTHB 2F5BL 2AP2A 2UZYB 3ARBC 4HIIB 3FHQA 1AR1C 4LCWB 1MRFL 1N3NB 4X7FC 4RFNC 4EUPA 2ZCKH 1VFOA 1Q9KA 1JZ4A 1Z3GH 4ZO6A 2JF1A 4HGMA 5DC4B 5BVJB 1FQ9C 5EULV 5D5MB 4AEHH 5KSBF 4XPAH 5JOPE 3ZKXC 2H2SC 4JLRB 3VFSB 15C8L 3HMXL 3VRLE 1VDGA 4WI7A 4F9PC 1RU9H 4LAJH 1RIVL 2VSCA 4PRPB 1C7TA 2ZUVA 4GMTH 2E5EA 5DYOB 1HSBA 1X6NA 1FFNB 3OX8B 2IH3B 1NBZB 1P1ZA 3MOAL 1WFNA 3PIQA 1MCQA 5DD1L 2AXGB 1UQSA 2HN7B 1VGEH 1D5MA 3IFOB 4NUGH 1WBZA 2WWKO 1I1YB 4OSUH 1RJYA 4DQOH 4NNXA 5B21A 4Y4HB 2X89A 3CCHA 2YPLD 4HMDA 4EOWH 1IZKA 1CGSH 4JJ5A 3RNQA 1F6AA 4OM1L 4N8VA 4GKNA 1TCRB 3QUMH 2BRQA 1D6VH 3BPNB 1QSEB 4N8VG 2X4QB 1YQVL 2A0LC 3ULVD 4NKMB 1KTDA 4NKIH 3MQIA 4YDIL 3QQ3A 3EYOA 4H88L 4WY7H 3VFNB 4K9EL 5CJXC 2X4RB 1PW3A 2YSSB 3O6LH 4LLQB 5E6ID 5DUBB 2FJFA 5HDQH 3KXFE 4WWKA 1FVDB 4RAHA 5IBLD 2XQBH 3ILPB 3L7FA 3VFGL 3PUCA 4TQEH 4PB0L 4X80H 1WWAX 1WISA 5D2NB 3HUJE 2AJVH 4UDUB 4Q9QL 1XF5A 3P9LA 2IG2H 1DTUA 1NDMA 3WIIL 1UXSB 2HLAB 4JFQA 5DMKA 5EZJA 3MX0A 5F6IC 4HWZA 2ZUXA 2DDQH 1RZIB 2DKUA 1MVUA 1NCWL 1EEZB 1H9VA 3FQRB 4O5LH 4LLVA 4MDIA 1UCBH 4PJCF 5FA4B 1K8IA 4KK5C 4Z7VE 1WZ1L 2YOCA 4JFPB 1OAKL 4N1EA 3OGCA 3RY6A 4L1HA 5J57B 1XZ0A 4YNYB 1T2XA 4QHKI 4OKDA 4U1JA 4GRWE 3G04A 4PJEB 2C4XA 1GC1L 1T7WA 3CLFH 5ALBL 1T21B 4PJAB 3K74B 3KPSB 1RULH 3ZT6A 2Q1EA 1CXKA 2UY7A 3U0TB 1AXSA 1CVSC 1Y0LB 3L3JB 1AGFA 4NNPH 4Y8DC 2Q76A 4CVXB 1OTUD 3WJLA 2X1OA 1GPOH 4G7YH 3NTCH 3O3DA 3IXAA 2J6EL 3QDMB 4LNVA 3V6BR 5E8PB 4S1DD 1K6QH 1DLHA 3RX5A 2D4DA 3V6FB 1FORL 3O8XA 2XTJB 3C6SB 5FHBH 5GJTH 5DJXA 3AROA 2ATKB 4QLRA 1YMME 1CICB 4X7TB 5CSGA 4KI5C 3RVXC 4XP4H 4YO0B 1FNEB 1ZSDA 3MRCA 4ODXA 4PRIE 4NQCB 4AZ8A 2R9HC 4QRRE 1DUYB 4JVPA 1A0QH 1UKSA 2ZOLA 4NKDA 3HNSL 4KPHH 4ZPVA 1I8LC 2W65A 2IPUG 1C5BL 5MEOB 4KI1A 1G7QB 1NMAH 3IGAA 4ZSOB 2WIIB 1KB9K 1QVOB 1Q94B 2R1YA 5CD5C 3BAEH 1YNLL 4TOYH 3C8DA 4BFIA 2ZSWA 1DQJA 4P23B 3NGBC 2AABL 5IESH 4WJ5A 3SJVA 1MWAL 3L7EB 4RGNC 4LSRH 4IOSD 2DOCA 3ZE1E 3LOWA 1GGCH 2EE3A 3C5ZC 2EECA 2OL3B 2D2OA 3ZE2F 5D72H 5E5RB 1BVKB 2CH8A 3V6ZB 1BBDH 4Q2ZB 4PS4L 5GIRA 4D9LL 1YEJL 2YUXA 4LF3B 1I7ZB 4NZRL 5D7LE 2PO6C 4P2QA 4Y2DA 1WIPA 3REWA 2DKSA 5BZWA 4JFDD 4LCWE 2VR5A 3KJ4B 4HZAA 5LGHH 3FRPA 5C0ND 2ZUQC 4WI3A 5EOQH 3W11D 3HB3D 3AB0C 1XIWB 4OFVA 4A6YB 5D5ME 3VFTB 1YJDC 3Q1SH 1U8MB 1XF1A 4LDOB 1QOKA 5TFSH 5C0CD 3FRPG 4UTAH 1CCZA 2EYTB 2DQCL 2OR9L 5C6TH 5CAYB 1OAQH 5I9QB 5D8JL 3RU8H 5C92A 4FXKB 3KYMB 4OUUA 2CGRL 5DJDA 3QUZD 1R3JB 3TZVA 2RB8A 2N4IA 4NPYB 3CDFA 5K9KB 1Z9SA 5D96C 2YRPA 3L3KA 1FYTB 1I3RA 1EO8L 4ODTL 5FF6B 4GOSA 3SDYH 4U6XA 3QIUD 4L1DA 1SY6A 3K81A 2X41A 2WUBL 5ELIA 1VESA 3WFHB 4EI5C 5B39A 1OCWL 2XZCH 5ESAB 4I3RH 2C7UA 3VXRA 5BO1H 4PJCA 3HC4H 3BPLC 1ROWA 3HI1A 3BGFC 5LBSL 5B39G 4JFHD 1I9JH 4OT1L 4QXTA 1QSEE 1SYSA 5C0BD 2ZUSA 4TYUA 4OGXH 4LCUB 4MVBD 2ITCB 4FABH 1W0WB 3FB8A 1V7NL 4KVCH 3DX6A 2R39A 1XH3A 3BEVA 2VLKD 2C3VA 4KV5F 4Y2OA 5TDNB 1HYRC 4GKZA 4XP1H 2FHBA 2X70B 5FUOH 1JNLH 5HYJD 1CF8H 3O9WC 4LQFH 1YEGH 3BFOA 3RGVC 1EFXB 1ZAGA 3X12B 4MZ3A 1A3QA 1RI8A 3KPLB 1CXIA 2A9MH 1G7HA 5TGBB 4GXVL 1LGVA 1TVBB 2VR9A 2DD8L 3OZ9H 2WMPA 4PJXF 5EU6B 5CGYD 3ZYOA 5DJ6B 1GAFH 2AXFA 2XN9B 1BQHA 2D7PA 4X6CF 5JNYB 4U1HA 2B1AL 2JIXB 4OD1H 3GEWB 4MXQD 2X4SA 3WEXA 3OPZH 3X14A 2PXYC 3QXWA 1BQHG 3LV3A 1NC4D 1KFAL 1YDPA 5IP4A 1JP5A 4AM0A 4RISH 5TDPA 3MROA 2R0ZL 3BIKB 5JXEC 5IF0B 5JHDA 4G9FD 1G7LB 4HWBA 2VITB 2BY3A 4LRIC 1QG3A 3ABZA 3QUXA 2GITB 5IVZB 4HX1B 2CKBL 3LDBB 5MENA 4P3CL 2VH5L 3G08A 4OCSH 1WSST 3B9VA 1U3HA 1LO2L 4JFFD 1CDYA 1K3ZA 4UUJA 4FQ2H 2FLRT 5GRVK 4LSSH 1HHKA 1N64L 4OV5A 3RVWD 5ERWA 5TF1L 2W9DH 2Z35A 1VACA 3ARDC 2VLRB 4IS6B 4HMEA 3PV6B 3TO4B 4NQCE 2P42B 4PGBB 2VABA 3WV0A 2I07A 2AERT 1EHLH 1NKOA 3BH9A 5IB4B 4LP5A 4XGZB 3SY0A 2AEIT 4XH2A 5LWYH 2APVA 2MSPA 4U49A 1W8NA 1FNSH 3SDDC 3ZE2E 4ZSOE 4L4VE 5F9AC 1JI1A 1UACL 2Y23A 1CGUA 1U8JB 1MQ8A 3QPXH 4YFLI 5INDB 4QT5A 1HK6A 3G5XA 3FRUB 1R6VA 4N8PA 4NGHL 3HAEB 3MNWB 4NZTH 4X4ZA 2MOVA 3GK8H 5BQ7B 3LRSA 1RUKH 2XKNA 3GJEA 5DEZA 3T3MF 4JPKH 1G9ML 3SDCB 1GHFH 5C08D 5HY9B 1JHKH 4Y19D 4D0CB 4NQDD 1EUUA 2DRUA 4MMZC 2P8MB 3QHFL 2DMCA 3IDYB 2O5YL 1WBYB 3EOTL 1R3IH 3ZYIA 3ORJA 2BCKB 4ONHB 2WBJA 1E4KC 2MCG1 1LK2A 1P2CA 2ADJA 1ZHLB 5C0AD 1KOAA 3MRIA 1M4KA 4ZUUB 3KR3H 4PP1D 2GFBA 4NC1E 4JFXB 3GMRA 2B1HL 2HYMA 3DWTA 3MO1A 4NSKB 4NBZB 1YN7B 4MQ7A 1RZ7H 1EJOL 3Q3GB 2FATL 2CUMA 3RVVD 2J8UB 2Z93A 4JZNA 2FLBT 5M7QA 2XWBA 3GSNB 1K5NB 3OJVC 2A83B 1CDCA 4NRXA 3UJJL 5KG9A 5AYUL 6CGTA 4PJXA 2LABA 5IMKA 4NQXA 3RDTB 4R8WH 4WO4D 3RWDA 5IJVA 3QI9D 4U1MA 4ZDHA 3JUZA 1FFPB 3F12B 4AEIL 1HHGA 5LQBL 3TIEA 3UYOD 2P5WD 3NN8A 1MPAH 3WE6B 3VXPA 1CDUA 4ZFZB 3V0AC 2EDQA 5I2IB 3BDBA 1BVLB 3U4AA 1BQSA 4G6JL 2EDHA 4XCNB 3HR5B 2DQHH 2EC8A 5EOTB 4OZIE 1C8PA 1EHAA 4K3DL 2EC9U 4X6CE 1CI5A 3HZVA 1G6RA 2HT2C 1IC1A 2PW1B 2D7TL 2CSPA 3U0WL 4H8WC 4Q9CA 5E2UH 2YK1H 1IC5H 4GRWH 4UT7H 4KZEL 1PGRB 3BP6A 3FFCD 5AZEL 1CWVA 2OJEA 4U1LB 3ZTNL 5CCKL 5JLZB 4HK0B 5C09B 4OD3H 1RUQL 1UB5A 1IFHH 1IGMH 3BHBB 5EIVA 4NQSB 1TZHB 3G9VA 5GS2H 1WTLA 4JO2L 5DA0B 5DVLA 2EIEA 3S88H 2AK4A 3BKYL 3LHPL 5A16B 3UAJD 3AREC 3IU4L 4TNWF 3STZB 1NC2A 3KHOA 1UB6B 4JQXA 2XZAH 4OGAD 2HJLA 2RCSH 3NCBB 3IETA 4YEFA 2ORBH 4O58L 4YHYB 4M61A 2W91A 3NOIA 3P0VH 3I9GL 2XNAA 2FX9H 1FH5H 1SM3L 1G9EA 2WWKT 4IOFC 1CFNB 1XR8A 4X9GA 1RZKH 1I9IL 1CLYH 3QQ9C 3S97C 4LVNB 4QXUH 5HGBB 4OLEA 4JZJC 2IALB 4W4OC 4D2NA 1HHJB 5CJQH 2VDPL 1ZT1A 3SE3A 4XPBH 3PDOA 4X4MA 4NUJA 2LAGB 5J1AB 4RIRB 3MLUH 2G75B 3PWPE 5I17B 5BV7B 2X4OB 4AH2A 1EXUB 1LHZA 4MNGA 4XBEH 2C4FT 3CFDA 3SO3B 2BNQB 3TT3H 2NY5L 1A14L 4EI6B 3AAZB 3MBXL 3S37L 1AD0B 3EOYG 1I8IA 4GW4B 2IBBA 4KHTL 2BOCB 3IF1A 3ZKNC 3AS3A 5GRJH 1JF5A 4FQCL 4V1DB 1MJUL 4HGWA 4E41D 4Y16B 5EZIL 4OZFB 4K9EC 4XPGH 5CILH 2DJUA 4XPTH 2X4NA 1GGIH 2NXZD 3ARGD 1YEDA 2F54B 3AS0A 2H6PA 3HA0A 4HZLB 3EYSL 1I1AA 2YPVH 1JFQL 4QRPB 3BH8B 1G7JB 5F88A 1Y18B 3WLBB 2FR4B 3VFWA 3MBED 2CK0H 1DBML 32C2A 4DGVL 2VZ1A 2VXVL 5F21B 2EDOA 3T2OA 4JZOB 2Q7YB 3BRGC 3O4LB 1QLEH 4M4RA 3MUY1 4Y5VB 5CS7A 5EBLA 4LMQE 4X5XA 3L9RA 3PDGA 5E9DD 1VPOH 2BDNH 5I1KL 1CK0L 1MJ8H 2OTUB 4R4FH 4PY8J 4G9DA 5B4MC 4IRSA 1JGDB 1A9EA 1TTGA 2DI7A 5F7MC 2DLGA 4I2XA 1YEKL 2NZIA 5C0GB 5C7XH 1YUHB 2R15A 3HNTL 1OWWA 3FTGA 1AXIB 1I3GH 5D7JB 1S7RA 4BFEA 4FQIH 3N0PB 1T83C 3F7VA 1NLDH 5GZND 2GI7A 1J11A 1TQBC 2Q8AL 1XR9A 5DT1L 3V4VL 1HINL 5IW1A 4KK6C 4LL9A 1II4E 4PR5B 2AQ3A 1CU4H 4XNZC 1MI5A 4MCZB 1FGVH 1U8OB 3OJMB 2VIRA 3S36X 1UM5L 3PWUA 5KTEL 2ARJB 5DI8A 3O6FD 3ROLA 3BQUD 2Y07H 4LSDA 3G5ZA 1DANT 1Q1JH 1YYML 3B3IA 5CINL 1O7SA 5I75C 4BFBD 5DJ2A 1K4CA 3QWRD 3TCXA 1JPGA 5CP3H 3Q2CA 5FEBA 2QL1A 3WL9A 3GSRA 4NN5B 4UILH 3Q6GL 3C5ZA 3D39A 1IAKB 5IBUG 3HI6L 5F8QC 3QQNA 3MNZA 3QIBA 4QEGA 1OF2B 5F7EL 2PO6A 3FO1B 4OZHA 4NDMA 4LIQL 1GGYA 1MCPH 1A02N 4MA8H 3PGCA 4GQ9L 2QQKH 3OG6B 2EZ0D 1M71B 1E4WH 1FN4B 4P4KC 4WUUE 1RJLB 5DJAA 4PP2A 3CZFA 4R3SB 3ARBD 1OPGL 1JWUB 2ED8A 3KYKH 3IDGA 3ARQA 3VW3L 2R29L 1IC4H 4PY7B 1SYVB 2W9EH 4H1LA 4KY1H 5SWZA 1ES0A 1EGJL 5B38B 5L2KE 2DQEL 3VWKD 2Z0BA 2EYRB 4H1LG 1H5BB 4M8QA 1UGNA 4JR9H 5K93A 3EYFA 3GMNA 1MCSA 4PGEA 1T89C 3MRJA 5C07E 5HI5C 5GISH 4DUVA 3VRJA 4PJ5A 5ISZA 5K9JL 4EI5A 1I4FB 4GQPH 3HE6C 1VFBB 4JAMB 4L8CB 1IT9L 4KMTH 2Y5EA 1MF2H 3KPNB 3HPJA 1T66C 2AJYH 3GB7A 3MFFA 4TSCL 4FA8A 1A6UH 3TBTA 1DFBH 1PG7L 5T3ZL 3MRPA 4HKJA 4QWWC 3DGCR 2JJWA 2YUZA 3E2HC 5FYJL 3I6LD 1DVFA 2F53E 1WZLA 4PTTA 4EQ2A 1ZA3B 2A0LD 2CDFB 2BNQE 3V0VA 1HNFA 1BIIA 2VZUA 5AZ2L 5C0IB 5E8NB 5IFJB 3VXQA 2L7JA 2IPKA 3GSXA 3RGVA 5DS8B 4OM0L 2CK2A 5DWUH 2VERN 5I8OH 1JPSL 1J05A 3PHQB 3WXVH 3K4ZA 4LSQH 3GHBH 1U9KA 3TBYA 3DSFL 2HT3D 4A6YH 4M7LH 5ALCH 2FWOA 3ILQC 4XVJL 5I8KH 1S9XB 5F89A 2XWTB 1BQUA 1INEH 3C8KA 2QJDA 2ADIA 2XA8H 2PXYA 5GSRB 4QRPE 2NTFB 3N06B 3SOBL 1R5IA 3AFLA 1JGVL 3CVHH 4YHIA 5ICXA 4PRBB 3V5KB 3CDGA 5DRXB 5CKAA 4NJ9L 5F97E 5JXEA 4GUPB 3K3QA 4NO0D 2R8SL 1MHPL 4KK5D 4H25A 1NGYB 4OUOA 3U2SA 4OFYD 3VJ6A 2H9GA 3CFEB 3GI9L 1A8JH 3BT2L 5MEPA 1H15A 1CD8A 5KSAC 3HCVB 1YEFL 4FQXD 5HSFA 4H5SB 4KDTA 1Z9OA 2B0SL 1GCFA 2PETA 2A6KB 1XF4B 4PJ7A 5IM7B 3WS3B 3GMOA 4WHYH 2PYED 3LIZL 5JUEL 1FPTH 4XPFH 2ZUTA 3NH7H 3MV9A 3ES6A 5JW4Q 4D9QD 1U2CA 2IH1B 4P2YA 3N9GL 4UOW1 4ONGL 5JMRA 4DVBA 1C5DB 8CGTA 4Q6YA 1JWSA 5HPOA 4HHAA 3PWLA 3RVXD 5J8OA 4GG6B 2M2DA 1CFBA 2WQRA 3C60B 4P5KA 1P7QD 2H2PC 2C1PA 1PSKH 5IEKB 3MRNB 1Q8MA 1A3LL 3JXAA 1GGBL 3IFNL 4JREB 4UQ2A 3QEUB 1J86A 3QUKB 1TJGL 2EDJA 5K9QG 4TUJB 3MRQA 2XTLA 4FFVC 1C08B 5E8EB 4ZFOB 4BKLB 2QV2A 5CSZA 1I1FA 5CD5D 3BGMA 2X4PB 4JKPH 1ULVA 5ITBH 1CXLA 4ORZC 2VUYA 3S96A 3B2VH 3TJEH 3MLZH 2OX5A 2BVEA 4JDTH 5C0CB 1KN2L 3TF7C 1DE4B 4EUPB 1SJHA 2XRAL 4DGIL 1Q9KB 3TBSA 3RWJA 1QFWL 4UTBL 3UYRH 5ICZA 3D3VD 2CRMA 1CFSA 1RHFA 5ENWA 4ZFFA 5JOFA 4ONOA 3ZHDA 1E4KA 4WHCA 3MJGX 4XVUC 2ADGA 1HSBB 3JVGC 5HBBA 4RWYH 5D4QA 1TCMA 1VFUA 4FXLA 4F9LC 3VXNA 1P1ZB 4OFDA 4GKOA 3PIQB 1L7IL 1UQSB 1PY9A 5C0RL 2OZ4A 3QIWC 1WBZB 2LVEA 2VRAA 4J23A 1RJYB 3KPRD 4NNXB 5A43C 3CCHB 3KS0J 1KC5L 3QFJA 4WI8A 3TM6A 2EDTA 3BD5A 3W2DL 4JJ5B 2ICWJ 3ZDYF 1F6AB 1ZANH 5J1TC 3MLYL 3ULVE 2Y6SC 4N8VB 2ZKHH 4GKNB 1Q9OA 3L1OL 3TJHD 2Q86A 5ADPH 4WCYH 2YXMA 1KTDB 5ID0A 4ZS6D 3GIZL 1M7IA 3QQ3B 3NIGE 3EYOB 5HYJB 2WBWB 4DKFH 1ZHBA 3Q48A 4HJJH 3BPCA 2FJFB 3FQUA 4XP6L 4WWKB 1I9EA 4P2RD 3FMGL 3B9KC 4BZ1H 1XCTA 2ID5A 1RJZA 1ZKAA 3L7FB 3OJDA 2OL3L 2VOTA 4MJIA 5GRXG 1R5WA 1XF5B 3GBNH 3P9LB 4I9WD 2I60H 1FZJA 3Q0HA 1NDMB 4YDKH 2GTZA 2C5DC 3EO1A 4JFQB 4NOBA 5DMKB 2X9WA 4P99A 4J8RA 3TC9A 4HWZB 1UJTA 2CLVA 4XTRC 1WZKA 1FCGA 4Y4FC 4LRNH 2ESVA 3O9WD 1CFVH 1MVUB 4JRYD 2C3GA 3V0WL 3FT3A 2VXTH 3GSWA 4LLVB 2HVJA 4MDIB 1K8IB 3RIAF 1RUMH 5BMFL 3OGCB 4OFPA 2R23A 2UWEF 1ZVYA 2BOBA 5E7FA 1XZ0B 25C8H 1TZGH 3VMOA 4LCCC 3T0BA 4U1JB 3G04B 4HS8L 3LVEA 1IGIH 1HI6A 1YNKH 2X4UA 1M7DA 4O9HL 5E6YA 3SE4C 1TETH 1TPXB 5E5UB 1A3RH 1MAMH 3T1FA 3VGEA 1P4LA 1AXSB 4OF0A 2WLYA 3VDAA 1AGFB 2VDRH 2Q76B 4M7JH 5E7BA 3P73A 5KVEH 5CP7A 3O3DB 3BRFA 2EDWA 3IXAB 5IT2H 1DLHB 2CD0A 4HIHA 3O8XB 1FGNH 5FECB 1RK1A 3MLRH 3JUYA 5DJXB 5DRNA 5IQ7H 4NC0B 4W4OA 4CDGC 1ZSDB 1I8KA 3MRCB 3U1SH 4ODXB 4OCRL 1S3KH 3IXTA 4IRJA 1NH6A 3DHJA 2ZOLB 4ZPVB 3U36A 3ZHKA 1IBGL 2W65B 2J88L 4D0DA 3IGAB 5CEYA 3RZCD 2UVFA 3FN0H 3OKNA 2R1YB 3C5SA 5FHAH 3UTZA 3ARDD 3WS6A 4CDHA 4KZDL 2GJ6A 1OVZA 4GG6E 4BFIB 2ZSWB 1DQJB 5L88L 3BWUC 1QHOA 3DLQR 3S98A 4GS7C 1XAUA 3U9UA 4WJ5B 3VFRA 2AXJA 3SJVB 1YEEH 3D6GA 2CJUL 4MXVE 1X4YA 4KJWD 4M6OH 4EDWL 1G7PA 3EJZC 2K7QA 1OGAD 3SDDD 1V7MH 4JFDE 4K94L 3VXOA 1MFDH 2Q3ZA 5GIRB 4YXKH 5LCVL 1PJ9A 1IGTA 2P49B 5T5FL 1P53A 4ZOBA 4LHUD 2GY7B 3QCVL 3FT4A 4NRZA 2VKXA 4P2QB 2NY5C 4Y2DB 4EBQL 3REWB 2ZUUA 5C0CE 5BZWB 4WDIA 2PTUA 3LS5H 7CGTA 1AKJA 4R6UA 4PBVC 2NY1C 3B43A 3L5XL 1NCCH 1DR9A 4B5EA 5J7CC 1LWRA 4GO6B 1LO4H 1ONQB 4OUUB 5DJDB 4R7NA 2VUOA 4WNQA 4RGMC 3SCMC 4XVTH 3TO2A 4ZXBD 4XXDA 1EAPA 3H2WA 2B5IC 4JJHA 3S36H 3L3KB 2HT4C 1I3RB 4ZO8A 4PV8A 4JHWL 4U6XB 3SPVB 1FAIL 1ZTXH 2QBWA 3NABH 4U1KB 4YHZL 1Y6MR 3BEWA 2ADFH 2XYCA 4ODBD 3MXWH 2N1KA 1T83A 2GSGA 2P5WB 2ZP0T 5C0BE 5B39B 2RJMA 3RL1A 1CQKA 5ITFA 2C7UB 3VXRB 4ERSL 1KXQE 4GW5A 1A6ZB 4QF1A 4PJCB 1WAAA 4R2GC 3SKNB 3HI1B 1ED3A 3PHSA 4AEFA 4IDLA 4QXTB 4PTUA 1SYSB 2VLKE 2CIKA 4X9BA 3SO5A 1IQDA 4HLJA 3RQ3A 1ZE3C 1Q9LA 5H37G 3FB8B 5HYJE 3QXDA 1ZWIA 2H32A 1MQKL 3DX6B 3HE7A 1A6AA 3OKEA 1XH3B 3BEVB 5IHUH 1N6QL 4UOJA 3T08A 2C3VB 2R4SH 2YHGA 2Q6WA 2OQJA 2BNRD 4GKZB 1DLFL 5TE4L 1KULA 5J13B 2FZ3A 4P9HC 1BGXL 2IPTL 4KDVA 2HJKA 4U3HA 2Y72A 2DI8A 4GRMA 3REVA 3SBWC 4HIXH 1A1OA 2BVYA 3KLAA 1JZ5A 1T1YA 1FL5A 7FABL 4XRCA 4PG9A 1OQOA 1G7HB 1A6PA 4ODSL 3U0PA 2UUDH 4Z7OF 3JWDC 3QH3A 2AJZA 2AXFB 1BQHB 1EHNA 3SGKC 3LH2L 5IG7A 4TUKL 4WRLA 1P7KB 4G6FD 2X4SB 3WEXB 4G9FE 3X14B 1QO3A 3V4PL 2F58H 3LV3B 1OB1A 1YDPB 2CKNA 2RGSA 3WIHL 4OFKA 4AM0B 5TDPB 4G8IA 2DIAA 2GW5A 5JHDB 4CVWA 3QNZA 4R96A 1P6AB 5ESQA 3RVTC 1PLGL 1I85C 3ARPA 3WDIA 3JWNC 3QUXB 4JFFE 1RK0A 3GSNL 1NFDF 2CLZB 3MV11 1X5YA 4MD4A 2UUDK 5MENB 3EGSA 5MHSE 4JKMA 2EIZA 4PD4J 4JE4B 1T89A 4FNLL 4KMQA 4R4BA 1RQ5A 3G08B 4Y5XC 3ARED 2B2XL 3CU1A 4Y0GA 2AEPL 1U3HB 3DETD 4LVOC 2ZSVA 3IU3A 3LB6C 1LNUA 1KYOK 1HHKB 5GGVH 3EFFA 4ZUVA 3K8LA 4OV5B 4KUZH 3U7YH 2EDFA 3MNVB 5ERWB 2Z35B 2LV4A 1VACB 2HVKB 2VNCA 3TNNA 4ZOCA 4BSWA 4ZNEE 2EKJA 4HH9A 5CKGA 2VABB 5EO9A 4L3AA 1A7RH 1FDLL 3JBG7 4JHBA 2I07B 2MMXA 4M48H 3BH9B 5H35A 4K07A 3SY0B 4XH2B 4GAFB 4L3EA 4ZUSA 3LN4A 4EDXA 3VWJC 4S1RH 3CMOL 1EBAA 1NGXA 2B4CL 2IC2A 3QG6A 2Q8BH 5DK2A 3G6JF 1KJ3H 4AG4L 3BP5A 1NL0H 4QT5B 3G5XB 3SDXE 3HS0A 3QDHA 5C08E 1YN6A 3NCYP 4Y19E 4NQDE 1FZOA 3LRSB 2XKNB 3GJEB 4KRMB 1MELA 3MOQA 4JM2F 2NY0B 4Y5YC 2JTDA 2FECL 2V5RA 2VWEE 2LAAA 4PBWD 5HVFB 4KTEL 1FO0H 5HDBE 3WFEH 2YN3A 5C0AE 3OR7A 4MS8C 5GGSY 1MCBA 4KTYA 5K33A 5SV3A 1VERA 4O2CA 4NHCH 3QJFA 3OHXA 5EWIL 2WBJB 5IROA 1LK2B 1P2CB 2ADJB 3VXSD 4HCRA 2WZPD 3MRIB 3LS4H 3L3DA 3O81A 2MTPA 3ARSA 5D2LF 2GFBB 2FYYA 4BK5A 1AH1A 3GMRB 4XC3H 3ULVH 3KLSA 3MV8A 3MO1B 1AQKH 1H3VA 5K9QI 4YHNA 1L9NA 4OGYL 5KSAA 4MQ7B 3O4OB 3MTRA 4ACPA 2Z93B 4JZNB 3LEYL 5D7IF 2XWBB 3ALPA 2FJGA 1DL7L 2WIMA 3QCTL 3ZKSD 1S7SB 4M93C 5KG9B 1RPQA 1YEIL 4QHKJ 1EEUA 4PJXB 4ZS7L 5B4MD 1EO7A 3BQUB 1EBPA 5IMKB 1QRND 3UBXA 2P5WE 4NQXB 5GZOD 3W9EA 5LGKA 1JV5A 3RWDB 5IJVB 5KVFL 4FFZL 2OSLA 3UTOA 4N0FA 5BV7L 3HNVL 4U1MB 5HHOA 4ZDHB 5J06A 3UBXG 1XGTA 2BVPA 3TIEB 3GM8A 1MNUL 3NN8B 1N6VA 4N0UE 3VXPB 2EH7L 3C2AH 1CIUA 1BWMA 5SV4A 4KK6D 3HG1A 4Y1AD 2VLJD 1LO0H 3RWEA 1IC7L 1ZEAL 2R2HA 2E6PA 1NFDA 2GKIA 4JPIA 1I9RL 3MV7D 2D7NA 3MACL 2VZSA 1EO5A 2X1WL 3FFCE 4KTDL 4MNQA 3HZVB 4ESKA 4KWUA 1JHLH 5BRZA 2AJSL 4M3KB 3K1DA 3ARBB 5DUML 1MIML 2VDML 5D2NC 5DR5L 4TUOA 4WEMB 3VD4A 3QJHB 3OGOE 4OD2A 1DQTA 4DAGH 5GJSL 3ZYZA 2FD6H 3DUSA 3S35H 4DKAA 2H8PA 1MJ7H 1UB5B 1G7IA 5I15H 3DURA 5F96H 3I02A 5KAQF 1T0PB 1FYHB 3VXUD 3V5HA 3DRTA 4ODHL 4LKCA 2AK4B 1J9CT 2D9QB 4MSWA 1MFEH 3BKJL 4FQ1H 1AD9A 4EXPX 4P4KD 1KCRH 5JORA 1NC2B 4XP4L 2NY6B 4UV7H 2HJLB 5JHDE 3MA7A 4NQEA 3OKOA 3IETB 1DN2A 2D9CA 1I75A 1N7MH 3VI4F 1G1CA 4M61B 3IFLL 3K0WA 5EO0A 3GI8L 3K8KA 4DTGH 3IVKA 3LN9A 1F6FB 3DRQA 1BX2B 5MENE 5DVNA 5D93B 5ANMB 4BK4A 4E41A 3FQWA 1ORQB 4JM2A 1RUPH 1XR8B 3RAJH 5KOVC 5FOJA 4JEGB 2JJTA 4R4NC 1OAUL 4HPOL 2GK2A 1ZT1B 1NAMA 1AE6L 5JIHA 3R8QA 4CADA 2IEPA 3PDOB 4NUJB 1KCSH 1G9NL 4OLZH 3EDKA 1DBBH 5DO2C 3HE6D 2XTJC 3CX5J 3TV3L 3BZEA 3H9SD 5LAXA 2X7LA 4HAGA 1CICC 4AH2B 1WWBX 4M5ZH 5J89A 3ARFD 5E99H 2XY1A 3EDFA 3B9KA 1I1CA 3RTQA 1TMCB 3TFKD 4QWWD 1I8IB 2YMXL 3IF1B 1GXEA 1EA9C 2DQDL 1KIPA 1XFPA 2QQNL 3MCLL 4JM4H 1QPXA 5D7IA 1NCUA 4HGWB 4PYGA 1R0AL 5F6IB 1XGYL 4EEEA 3RWHA 5GGRA 1IEBA 4CVZA 1B90A 2X4NB 2IBZX 1YEDB 2H6PB 1G1YA 1NSNH 4LGPB 3JV6A 1UWGH 3O3AA 3VFWB 5D2LE 3NACL 1A6WL 1DZBA 32C2B 1FBIH 2I26N 4U7SA 2LFGA 4DJMA 1EAJA 5I30H 4PJHB 3WMSA 1UYWH 3JSSA 4N0YL 1L7TH 2QSQA 3F8UB 4L4JA 3HN3A 4LCCA 3WUWA 1EK3A 2W59A 3ILQD 3D25A 5B3JE 1WITA 4TSBH 3H3PL 5EBLB 2OXHA 1P4BH 4X5XB 5I1IH 3L9RB 3WUWG 2D7QA 2BK8A 4X9FA 4L4TD 1HCVA 3IKKA 3HC4L 4OBRA 4TRPL 1XIWC 4M5YH 3VGAC 4G9DB 4BZYA 4ZTPL 4AIZA 4I8DA 3SKOA 1A9EB 3AGVA 5I1JL 3WKMH 4I2XB 1RVFH 1WVZA 4PJBF 3ARUA 1REIA 4E0RA 3FTGB 1BFVL 1T0NA 3T77A 3ZTJH 1MFCH 4U6YA 2CRZA 3F7VB 5AWNL 5C0JA 3O6KL 5KJRH 1XR9B 5KW9L 5IW1B 2X40A 4POZC 2APBA 3VFMA 5I1EH 1MI5B 1U3JA 2VIRB 3PWUB 5DI8B 4TVSa 4UAOC 3ROLB 3G5ZB 2I24N 5KAQG 2FEEI 4F15C 2Y36L 3NGBB 5HHVH 5DJ2B 2P8LA 1K4CB 4XAKD 1F3RB 3PQYD 3K80A 5LVEA 4HGKC 2XOTA 2NY3B 3I2CH 4RGNB 5IBUB 3WL9B 3MJ8A 3GSRB 1ADQH 5JHLL 3C5ZB 3D39B 4ENED 1U3ZA 4Z7NF 2F15A 1NGPL 4LCYB 1JGUH 3QZWA 4Z95L 1CE1H 2H2PD 3MNZB 1QBLL 3BSZH 3QIBB 3WKNA 5BVPH 2PO6B 3QZWG 4OZHB 4NDMB 4MA1B 3SE9H 2GTWA 4MCYA 4FFVD 1T03H 2HFEA 4J6RL 3EYUH 3PGCB 3MYZA 1WFUA 2ZUQB 2DQTL 1C12A 2OXGA 3N1GC 4XMPL 5DJAB 3V9FA 4FN0A 4PP2B 4R26L 3CZFB 3FO9A 3H8NA 1P4IH 4Y4KA 3IDGB 1Q0YH 3VI4E 3N1FC 3KPRB 2A1WL 4HFUL 5C0FA 3NFSH 1TDQA 1S7VA 5DMGC 4KAQL 4H1LB 4ELME 2AGJL 5SWZB 1ES0B 4O00A 5IR1A 5L9DL 3FOLA 5D96B 4TVPL 2ZJSH 4H0HB 1X44A 3EYFB 4G43A 3GMNB 4PGEB 2I27N 2ZZUT 4FS0A 3TN0A 3G5YA 4N5UA 3GBLA 2B7DT 4PJ5B 3VRJB 5ISZB 3QNYA 1NBVH 5GS3A 4EI5B 1H3PL 5D7SL 4E5XA 5D70H 5ANME 3LQAC 3QIWD 4HUXA 4X99A 4P2OD 2P8PA 3HPJB 1JL8A 3I6LE 3GB7B 3BPLB 3BGFB 3B8YA 2WBKA 3TBTB 3TYGH 4XMLH 5CZXC 3MRPB 4KROB 1WV7T 4HKJB 4WUKH 4KQ4H 1SBSL 3B9DA 2D31B 5HTSA 3IDNA 2AEQH 2VQUA 6FABH 2LTQC 3DHMA 2H3NA 4FXGA 4Q6IA 2H1PH 1DVFB 3BUTA 4P9MH 1LQSR 4PTTB 1ZLWH 1J8HA 3V0VB 1UWEH 4ZFOL 1BIIB 3H7BB 4UU9B 3TO4C 1ZGLA 3VXQB 4M1GH 2IPKB 3GSXB 3RGVB 3X3FH 5DGRA 4LSVL 3FB5A 1M05A 1KELH 2EDYA 3GRWA 1FE8L 4WI9A 4X6EA 1MCOL 1J05B 2HTLC 3K2UL 3L3HA 5HJ3A 4LDLB 3TBYB 4P46D 2YA0A 4OCXH 1QBAA 3A6BH 1Z0MA 3SE8H 4X4XA 2FWOB 5DUPH 3SGKA 5F89B 1IAIH 4PRHA 2P43B 1WZMA 3O2WH 3C8KB 1ZLWK 3U9PL 2ADIB 2PXYB 4G8GA 1R5IB 2F19L 4OZ4A 4XTRD 4Y4FD 5FGBA 4YHIB 5ICXB 2J12B 3CDGB 3LZFL 3OKLB 4M6AA 4PJHE 4UT9L 3AS2A 1J1XH 2JKXA 5FDWA 4H25B 4HC1H 5CIPH 3U2SB 1I85A 5HHMB 1LP9E 3VJ6B 1EERB 1N5AA 1T2JA 5GS0L 5T1LA 4JRXD 2H9GB 4GRLA 1EZVX 2FH8A 5MEPB 1KEML 2FIRT 2PYEE 1D9KA 1H15B 1CDIA 2OR7A 4Y5XA 4WFED 1UA6H 1WJ3A 1IAII 3P30L 4PJ7B 3GMOB 3GO1H 3F7PC 1C5CL 2J5LC 2J4WL 3NZHL 4XP5L 3MV9B 3ES6B 2BSSA 1FNAA 1AI1L 1WC7A 1OSZA 5IFHL 5DHYB 1JZ6A 3A67L 4DVBB 3C6LA 2ZUYA 1JWSB 3P11L 4U1IA 4HHAB 3PWLB 5I1HL 4LNRA 1KACB 4K8RC 4Z7NE 4PLKC 2EICA 1JZ2A 3RDTC 4ZG1A 1UEMA 3C09C 2VO5A 2DYPA 5HYFA 4P5KB 2C1PB 5FB8A 1E6OL 4XHJC 2OJZL 1KLFA 4UQ2B 3UTQA 4M1CC 4PGJA 3HZKA 1JGLL 4N0CC 2CIIA 1KENL 3MRQB 3AM8C 4H0IA 1I1FB 3BGMB 4OQ1A 1JRHH 3DYMA 4Z76A 3LKQA 1OAYL 3S96B 5TQ0L 3I50H 4WFFD 2R69H 4QRQA 1F4HA 3D3VE 1SJHB 3NMEA 1OW0C 1NMBH 1D6EA 3TBSB 3RWJB 3EJZD 3WD5H 2B4CC 5GGTH 3BUYA 3IDXL 4HPYL 1N0XH 5ICZB 5EU5A 4PLNC 1JPTH 1CFSB 3L3IB 2EE9A 3GM0A 4QO1A 4GBXC 4RX4D 4WHTB 5ENWB 1CGYA 1FNGB 4ZFFB 5JOFB 3RKPA 1EFQA 3CFCH 5DLML 2ADGB 3D9AH 3DGGA 4QOKA 3KPRE 3KJ6H 3VXNB 3R06A 3NZ8A 2FHFA 1BM3H 1OP5H 5D1XC 1PFCA 5DFTA 3QFJB 1CL7H 4OZGF 2E7LC 3SCMD 3ZDXF 2VXSH 1UM4L 3C08H 5I19L 5EIQA 5IVOA 1Q9OB 4XCEB 5FO9A 2HT4D 1F5WA 2JB5L 4XT1C 4HG4K 2Q86B 4KJYA 1FZKA 4XVSL 4NZUL 4KK9C 5ID0B 5JQ6L 2P4AB 4P2RE 3MXVL 1M7IB 4HS6B 2Q3AA 1ZHBB 2AQ1A 3UJTL 4ELKA 3ULUF 3CUPA 1IGJA 2ZPKL 1OL0A 4WFGD 3BPCB 1U95A 1GYAA 1OP5K 3FQUB 4R2GD 4I9WE 3DX7A 5DJZA 3HKFA 1XCTB 5FYKE 3ZO0A 1RJZB 3H42H 1CL7I 4MJIB 4R0LC 4ONFH 1R5WB 4K7PX 1FZJB 1MIEL 3IDIA 1Z0NA 3MOBL 5BV7C 4OJFH 5CJBA 2VDOH 5A2IH 4JRYE 1AGDB 2GTZB 3BP7A 3SO3C 2DB8A 2W60A 3EO1B 2FBJ