2CR6A

Solution structure of the ig domain (2998-3100) of human obscurin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
115
structure length
115
Chain Sequence
GSSGSSGLVQGRRVHIIEDLEDVDVQEGSSATFRCRISPANYEPVHWFLDKTPLHANELNEIDAQPGGYHVLTLRQLALKDSGTIYFEAGDQRASAALRVTEKPSVFSRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords KIAA1556 protein
publication title Solution structure of the Ig domain (2998-3100) of human obscurin
rcsb
source organism Homo sapiens
total genus 14
structure length 115
sequence length 115
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cr6A01
3MRQB 5JNYA 4JO3L 2IAMC 2UUDK 2Y7QB 3V6OC 1IC5L 4ZOAA 3FB8A 2YUVA 3AGVA 4DZBA 2Z31D 3VA6A 4K2UL 4KHXH 3FN0L 4N5ED 4BZ1L 5FUOH 1QRNE 4OF6A 43C9B 1MREH 3UJTH 5C0RL 1KCLA 4NFDA 1PKOA 35C8L 5DUPL 4Z0BH 3H9SE 3PIQB 3O6FD 4OLXL 5CSZA 1CE6B 2DLFL 2C1OB 2EDXA 3QUMB 3SOBL 2HH0H 2WWMD 3QNYA 3ZE0E 4P5TB 4LF3B 1HE7A 2NY2C 1JGDB 3NGBC 1Y0LA 4XXDB 5C08E 3BDYH 4P2QE 5D1ZD 4JFYA 2W0PA 3N1QC 5DJ8A 1CICC 1JI2A 4U6HA 1J8HA 1S9VA 3V4VL 2AEQH 3ARDA 3NCBB 1RUAL 4YHKL 3S88H 4TVPD 3VI3F 2ITCB 2K3TA 3REWB 3JV6A 4NBXB 4Y19B 3OPZH 3JWDC 2G60L 4GBXA 3A67L 3V5KA 1FDLL 1P1ZA 2PR4H 4E41E 1L9MA 1Z2KA 5BMFL 2R56L 3QCTH 1UJ3A 1UWGL 1X5IA 2E5EA 1U3ZA 3MACL 5EOQH 1NCWH 2ADJB 5F89A 5CBEB 3D3VB 1A6WL 2YC1B 2DDQH 4XPHL 3VFTA 5FF6B 3BZDA 5GZOC 2J8UE 1F4XH 1C7TA 3KPRD 1P7QB 3F65A 3R06B 5D7KD 3UTQA 1P2CA 1G6RA 4U2ZA 3OKEA 4L5FL 3WFEL 2ZSVA 3IDXH 1KJ3H 3NMEA 5C3LD 4NSKA 2OCFD 4HEME 4PS4H 2JB6B 2DWDB 3L3KB 3L5WB 3W5MA 4I18C 1OL0A 3R8BB 1IILE 4ZUWB 2YUZA 1VACB 3Q3GB 5F1IB 1KXTB 4KKAD 4XAKD 3NTCL 2R4RL 4YAQB 1J1XH 4OZIF 1JHLH 3F12B 1KLFA 3IDJB 3TT1H 1UYWH 1A1OA 1FO0H 1VFAA 2OR9L 3JTTB 4P0DA 1G0DA 4YHIB 3VDBA 4MB5A 5IJVA 1MJUH 1FNGB 4C59B 4LVNB 4WHTB 3AVEA 1Q94A 5MENB 5TFSL 1QRND 1D5IL 2ZUQB 2JB5L 2VDOL 4XPGH 5MP6H 1TVDA 3LHPH 5CINH 5BO1H 3UJJL 5JMRA 3QG6B 5F8RC 3H9SD 2A0LC 2YPLA 2YPKA 3H9HA 2XFXB 1M05A 3KG5A 4RBPH 3LKOB 2AK4B 1Z0NA 4RBPK 3A6BH 5FK9B 5KOMC 5F1KC 4NN5B 2NYYC 3WFBH 3KAAA 3ZTNL 4F9LC 1QRKA 5JTWA 3IRZA 4U2YA 3MLZL 4QRTA 2WW8A 5T1KD 4WO4D 1A9BB 2AJZB 5ANMB 2FJGB 4JY4B 1I8IA 3I6GA 1I1YA 4WTZA 4LCYB 4NPYB 5DJ2A 1BBJB 4BSVA 4PRNA 3GSVA 5KN5A 1IEHA 1OWWA 1BD2A 2NY5C 3G5YA 4KHTH 3BEWB 2UWEF 2A6IA 4JY5L 1U8IB 5JHDE 5KJRL 3SDAA 5E2WL 4WI9A 4GO6B 3TYGL 1NGXA 2FR4A 5E95B 2X4OB 4GUPB 4AIZB 1MHCA 4W4OC 3CGTA 3EOAA 1MIML 1W0VA 3WN5B 4N1HB 1I9IH 3P11L 5F1SA 2VZ1A 2BZDA 3TT3H 5FECA 2XQBH 4LIQE 1U93B 3G04B 2B1AH 4UB0H 2P5WA 5TDOB 1MWAL 3GIVA 5IIEB 1TVHB 4UT6H 3MUZ1 4RIRB 2LU3A 2NR6D 3KPLA 5E99H 2YD2A 1SBSL 5C0IB 3FQNB 1CR9H 5EO1B 1J1OL 2E7MA 1I1RA 2GCYB 3MA7B 1U8LA 2EDQA 3MGOB 4M7LT 4EOWH 3FAWA 4YDLC 1OHQA 2EYTA 3P9LA 4LL9A 2X4QA 3BN9C 5HHNA 1T20B 1ZSDA 2JCCF 2X10A 4MQSB 1BAFH 5I18H 4K9EH 4V2BA 5EOCL 1LP9F 5IBLC 1MNUH 5EOCJ 3SE3A 3VDAA 5I2IB 4LLWA 3U4BL 4AY0A 4BKLB 2UZXB 4LLQB 2F5AL 5IOPA 3BKJH 2P5EE 2HFFA 5B8CB 4GLRH 4U1JA 3RX7A 1JGVH 2EKSA 2RJMA 2RGSA 1CS6A 1J05A 3MSPA 1NCCL 5AZEH 5IW3A 3ARYA 2FJHA 4I8DA 1G7PA 4K23L 1WSST 4LVHC 2EXWC 5C07A 5E9DD 1GIGH 2OR7A 4QHLB 4PLJC 7FABL 4R3SA 4JQIL 1W0WA 2O5ZL 4OCXH 4WI7A 5MI0C 1B3JA 2YXMA 3JV0A 4M9PA 4XVSL 4AH2B 3M1BB 5IEKB 4NT6B 3Q2CA 4NO0D 3WL9B 3O9WC 5IVXF 3QIWD 5FO9A 2G2RA 3MBED 3S35X 5B38G 3TN0C 3SDCD 2PCPB 3SE4A 3EO0A 1X6LA 2H2PC 5D1QC 4OD3H 5DK0A 1MAML 1M7XA 3PXJA 4UQ2A 1WC7A 3GMOA 2AJYH 1GH7A 3QJHB 4KXZH 2C3GA 3BPOB 5DK3A 1HDMB 5CZXC 1U3JA 2AQ3A 3U48A 2IFFL 2Z91B 1LO4H 2WWKO 1AGDB 5JW4Q 1G6RH 2WUBL 4NUJA 4QRRE 3D48R 4OV5A 2JJSA 4WEBH 3FHAA 4JLRB 1WITA 1DQMH 5F9WB 1BWWA 2PW2B 5EU3A 4H88H 3EFFB 5E8OB 5HY9A 4OCRL 5D7SL 3WJJA 2DKMA 4Y2DA 4EUPG 4PJFE 3G08B 5DLML 4HUMB 1J8HD 4C4KO 1AKJA 2OJEA 4MD5B 1AP2A 1DQDH 5KVMC 5AZ2L 4BH8A 5I75C 3MPCA 5DMIL 1E28B 4OZIA 2CUIA 3CFCH 1JPTL 4Q6YA 4DGYH 5CGYC 4PBVC 5EUOA 5F7HA 4ZAKC 4KJYB 4RFEB 1LEIB 1CFSA 4GBXD 4M6NH 4TPRH 4TVSa 2FZ3A 1OP3H 1LO5B 2Q8AH 5GRVL 4G6FB 1I7UA 1OP3K 5KG9A 4DN3H 1KPVA 2HN7B 4HS3B 3LB6C 2Y5EA 3IFPB 2Q20A 3RGHA 2VXTL 4GFTB 3QPQD 1JWSB 4LHUG 3TVMA 4WI6A 1RUPL 3EYFA 1PSKH 3C5JB 5F7WC 1NCBH 2BSSB 5AYQA 3BE1H 1MVUA 4P23A 3BXNB 4H8WC 4FABL 2AEWA 1ZHNB 4LEOA 2C4XA 4N68A 3KWWB 4WUUB 4L29B 3IJSA 4DKAA 5K9QI 2P5WE 1J11A 4GG8A 4FZEL 4G8GE 1QEWA 4Z7OE 1MWAB 3UDWC 5GHWH 4J23A 1K8IB 4GAGH 3U79A 3NA4A 4HHAA 4RFNC 2ORBH 2CGRH 5CGMA 1KLGA 4XVTL 5I74B 4Q6IC 2N7AA 3PABB 2OK0H 1CXEA 3GKZA 5KSAB 3L5IA 4UILH 4PIRF 4WNQB 4HXBH 4F8QA 3CLFL 4LSPH 3LD8C 2DS4A 3KYNB 3TWCL 1II4E 3QRFM 2UWEA 3PQYE 3OR6A 4PJBA 3WEXB 3UTPE 4NNPH 3DYOA 1Z0MA 1I9RL 3U9PH 2A6JA 3EZ8A 1C08B 4Z8FL 1SMAA 3HNTH 1V3LA 4L3CB 3RUGF 5FGCB 4DCQA 1U8JA 4LKCA 4UAOB 1CE1L 5GS3A 1JYVA 1GAFH 1MAJA 4EDWL 1EFXA 4HKXB 4X6CB 4JHWH 1RJZB 4G3YH 4W6WB 1I3GL 2XZAL 4H1LH 4N1EA 3T2NL 3VG9B 2YPLD 1QLEH 3RBSA 4KDVA 2OQJB 1K6QL 5C0FB 3V5DB 2NW2A 3IFLL 4Q0XL 4HJ0C 4P5TC 2E7LA 1S7VB 43CAA 3L5XH 1F4YH 3FFCB 4XPAH 5DS8B 4LLMA 4HX1A 3U7WH 5E8DL 4YO0A 5GRJH 2E6QA 5B38B 4OLYL 1DQLL 4X5LA 1ZA3A 1KGCD 4XTRD 1JZ6A 1KULA 1NLBH 2EEDA 4LPVA 2EE6A 3MXWH 4LCWB 3VFOB 3DARA 5FUZL 3QB7C 5D5MF 1FN4B 4O02L 2VLKB 1JIBA 2JCCA 4LLYA 1BD2D 1LP9A 2EDLA 2XIDA 3B5TA 3BGMB 3NFSH 5ACLA 3BVNA 3WIHA 4NO5B 3O45B 1RZIA 2DQCH 2AJXL 3NIFE 2ARJB 1H5BA 1YC7A 1QSVA 8CGTA 2OZ4H 3SDAD 2GYSA 4OCMC 1OSZB 3ARFA 2W92A 4I5BA 4PJCA 1M6OA 2VC2H 4TSAH 5T1LA 1MRCH 4KU1A 5D8JL 2XYCA 4NBYB 5L2JB 4N9GA 4P4RA 3X12B 1KCRL 4PRDA 1I1AB 4Z95H 1L0QA 4YHPA 3V9FA 3X14A 3DV6A 2L7JA 1E27A 2P5WD 4EUPB 4LSRH 3VD7A 2Q6WB 4RWHA 4F33B 5HHQA 4K3JH 3G5XA 3FB5A 2AGJH 1TJIH 1GL4B 5IVXA 4QRQB 4Z0XA 2DJSA 3DX7B 2X89A 4ODUB 3W2DL 4HLZH 2XQYK 5ADPH 1P6FA 1M71A 1NMAL 4HAFA 3VD5A 3PWLA 4H20H 1WEJH 1ZGLB 4M6OH 4NN6C 1UZ8A 5SWZA 3T8XA 1LK2A 3OKNA 4OZHB 4Z7UE 4PR5A 2Z92A 3MRBB 5J12B 5EUOE 3QA3A 3NFNA 4LHUB 4TOYL 1RUQH 5HHOB 3ZKQD 1JTPA 4ELKA 3T09A 1CQYA 2MHAB 2WSKA 4LVNC 1AD9B 1HILA 2K7QA 5T5FL 4G43A 5IF0A 3OHXB 4KI1A 3QPXL 3CZFB 3X3GL 2D7OA 1IGTB 3WSQL 5F3HA 2X6MA 3U9UB 4JY6A 4HC1L 1ZLUH 4IIQA 2F53B 3P4OB 4LOUD 4WU5B 5C07D 4NN5C 1ZLUK 2YZ1A 4PRPB 1A6UH 3FZUD 1NMBH 2QJDA 4KQ3L 2EDFA 4WHCA 3EO9L 3HCVB 4JRYE 3NACH 2CDFB 3ZKXB 3FTGA 1A6TB 3T0DA 3SKUD 4R4BB 4XMPL 3MLXH 4Y4HB 5BV7L 2OS7A 3VFSA 4UMGA 3JWOL 4JZNB 1PX4A 4ZUUA 2VLRA 1T7ZA 2WUCH 1B4JL 2IH3A 2OBGA 2G9HA 4KROD 3CC5A 3W39B 4CGTA 1CDUA 3ZDXF 3SE8L 3X11B 1XT5A 2CKNA 3GO1H 3ZKNC 1HHGB 4PJBE 4GJTB 4OCWL 4XZUA 3GGWB 1WBYA 3GI8L 1G0XA 2H41A 5DRNA 3OKKB 1VADA 5GGRB 3LSOA 4QKXB 1BQSA 3PGFH 3FB7A 4PPTA 3WN5C 1LK3H 4W68A 4Y5YA 3H42H 1HYRC 4JKKA 2BXYA 1DBJH 1FFOB 4TUOB 3L7EA 4EVNA 1EUUA 2YD3A 5AYUH 5ENWA 4YNYB 3H3PL 1Q8MA 1TETL 3CU7A 4GT7A 4NUGH 25C8H 4S0TD 3BZEA 1CU4L 3B6SA 3DRTA 4KKNA 1XGRB 2D0FA 2F5BL 3Q1SH 2IAMA 3UZQA 3V6OA 2J4WH 4UNVA 3BGAA 5JA8B 2H45A 2DM2A 3MRMB 4NQXB 1IAKA 4Y2DD 1F8TH 15C8H 2IF7A 4DK6A 1I9JH 3TPUB 1BBDL 1AKJD 1JHTB 3DGGB 2VZVA 3BP4A 5DO2C 1PD6A 5EBLB 3IAPA 1MCSA 3FQWB 1LO3L 4HUKB 1NBVH 4JJ5B 3MR9A 1BEYH 1F3JB 4IDLA 3DSNA 5I66A 3MFFA 5F9DC 4UNTA 3RFZC 5I76A 2VL5A 3D6GA 4JDTL 2QADD 4XBEH 3L1OL 4E5XB 1NLDH 1BVZA 1LP9E 1J8KA 3THMH 5KSVB 2R2BA 4YPGB 5ESAA 4QRUB 3RUGA 3V4PH 1CICA 2EIZA 1RVFL 3OX8A 5B8CC 2F74A 3I50H 3QIBB 4JM2F 4I0PB 4XMLL 1FV1B 4PP2A 4Y4KB 3TVMD 4JKMA 2YRPA 4LARL 2Z4QB 3NH7H 5E1AB 4ODTH 2JJTA 4YUEH 4PJCE 4P23D 1WICA 2FO1A 3D0LB 1MCPH 1NSNH 2GITA 3P4MA 2PNDA 3O2DA 2FL5A 4W4NA 5EDXA 1KC5H 4IRJC 1KUMA 1UEMA 5B22A 4N0CC 4KPHL 3P0VL 5IGXL 5K9KB 2ZNXA 4PJXE 4OKVA 1FL3A 4QT5B 3WXVH 2E8ZA 5IVXE 1KTKE 2MFNA 2I07A 4OQTL 2EEBA 3O4LB 4QRSB 1HXYB 4HIJA 5D5MA 5L2KA 3LEVL 3IDNB 3WIHH 5IEHB 3QG7L 1QO3A 2V2TB 5A1AA 4IMLA 5SWZE 4YDIH 4PGEA 3TFKD 3R0NA 1H3TA 4M1CD 1JJUA 5J0BA 2A9ML 3TIDA 3V95A 1HHJA 3HC0B 4KAQH 3BPOC 4I18A 5BRZB 1L7TL 1MRDL 4WEUD 4Z78A 4HJGB 2VN7A 1RZJL 1Z9MA 4QXUH 4M8VA 5B39A 4OD1H 3OKMA 1EFXD 3KJ6H 3VFWA 1IE5A 1NGYA 3DTXB 3TEUA 1ULVA 4EBQL 2DQTL 2BSTB 1D5XA 5F9WC 4M02A 5FYKH 4UBDC 1UQSB 1X6NA 3CDGB 5ESQA 4PG9A 1N0XH 2BNQB 2YKLL 4OLZH 1VCAA 1HZHL 1PG7L 4S1QL 3KR3H 1QLRA 2R15A 4XNYH 3KNBA 3B2UD 4PJ5E 5JPMA 4ENED 3T2OA 5DVLA 1ES0A 4NKOA 5DJXB 1CWVA 4ZQKA 4OKDA 4N0YH 4QXTA 5JR1H 3JZ7A 5I6XB 4G80A 5BV7B 4HULB 4KDTC 5JMOC 2C4FU 3RVXC 4PJ7E 3FCTB 5J7CC 5CHNA 4F9LA 3KYOA 3QCVH 3V7AE 2ZUXA 3EJYC 5C0GA 4ZPVB 3B3IA 5LQBH 1OPGH 5JPNA 1A7NL 3WIFB 4XP4H 4JHAH 3N1GC 5EU5A 3IJHB 1SYSB 4L3AA 4MCZB 4I3SH 2YMXL 3TBYB 3ZSTA 3BDXA 5T1LD 1MI5B 5EWIL 4Z7WB 1MCKA 2D7TH 1MH5B 1WZMA 1LDSA 2YOCA 3L7FA 4M1DL 3DPBA 4HGWA 4DGIL 1YEEL 1Z5LB 1QKZL 1DANU 5DRWA 3IF1A 4XCEB 3WJLC 3UC0L 5FYKD 2H1PL 3VXSB 3FHQA 3QNXB 4CMMA 3QULA 1NUNB 2X89D 1ZANH 1CTOA 4W4OA 4OLWL 2BNUA 2EYSA 5I74C 2ED9A 1J0KA 3VG0H 1V7MH 1JZ4A 3UTZA 4ODHH 3DRQB 1FPTL 3GSNA 5F96L 2ADFL 1LO2L 5KSAC 5F6IB 3GB7A 1DQQA 2Q86A 1CGTA 2F58L 4H26B 5GGSB 3EKCA 3UJIL 3E6FB 1RUKH 5FXCH 1ND0B 4H25A 1J0YA 3SJVA 4F7CA 1OSPL 3E2HB 4RAVB 5GJTL 5IMLA 2NMSA 1YECL 4RGND 2QR0B 3DX6A 3U0TA 1M4KA 2DL2A 2VIRA 2GT9A 1GGBH 2WWKT 4ONFH 3VG9C 4WRLA 3EYQD 1QYGH 4NRYB 4WFEE 1NGZA 1QZ1A 4G6ML 1LO0H 4M7LL 3ECBA 2AV1B 1ED3A 4BH7A 4LKXA 1HHHA 4NRXB 4P5MB 3IDGB 1K8DB 4P5KB 1KJVA 4LCIL 4LVEA 4Z7VB 3SKOA 1YMMA 2JJVA 4RDQG 12E8L 3T0EB 4WFFD 2VUOA 4G9DA 3QDAA 2R0ZL 2BC4B 5TGBB 3KPTA 4YQXL 4YXLL 2JELL 4BUGA 3SDXB 3TH4T 3DBXB 2XXMB 3K74B 4HJJL 1KCUL 2FGWL 2VLRD 5D5ME 4KJPC 3MCLL 1T04A 4MDJB 3TGXA 4ZOBA 1D6VL 1AXTL 4KJWD 1NAML 5TDNA 3S98A 4OJFH 5ID1A 5KVDH 3O9WA 3VXUB 3PL6C 1ZLSL 5H35A 2HVKB 1JUFB 4JM2A 4GMSL 3JWDH 4HQQH 3JVGC 1MF2H 3TN0A 5K9OB 1JBJA 1S7RB 1VSCA 5FA3A 4UIKL 5D1QA 3O2DH 1P5VA 4R4FH 4PJGA 1L6XA 4TULH 3H0TA 2ATPB 3SKJL 1XF3B 1H3UA 5GISL 4OGYH 4AZ8A 1EAPB 4V1DE 2EIBA 2VDRL 1BQLL 4BZYA 2IAMD 4NM4H 4IRZH 4LLVA 1CFNA 4JHBA 5ICXA 2DM3A 4F37F 3FMGL 3FFDB 5F8QC 5LAXA 3DROA 3QP3A 3S5LA 4JANB 1BZ9B 5GPRA 4RMSA 4NRZA 4FQ1L 5HHMB 4O58L 3O41A 1VGKB 3GSWB 1HOCB 3DXAE 4X6DB 3W0WD 1Q1JH 2CDGA 3QQ4B 2IGFH 1A7PH 3SDDA 1NGPH 5DMKB 1CVRA 2NY2D 5HHVL 1EO7A 4QHMB 2NZ9C 2BCKA 3MNWA 1DLHA 5LXGH 1UB6B 5JA9A 1NDGB 3VFRA 3MOAL 1CICD 2ZKHH 4M61A 5CJOH 1BJMA 1G1CA 2FYYB 5F7UA 4AEHH 3GBMH 5DHVA 1U95A 4MQXD 2DMBA 1NEZA 2PXYA 2QBWA 2O93L 4JJHA 4U7KA 4F9PA 5SWSA 1RZKH 3SE9H 4PUBL 5BCAA 3U36A 3T3MF 1ITCA 4FTVE 5IKCA 3MRNB 4W70A 1DSFL 3C60B 5DT1H 3ZKXC 2H6PA 4JVWA 3T65B 3VFGL 3F58L 5GQBA 3K4AA 5GZOD 1DDHA 4NCC2 4Y4HC 5IHZB 4PGZA 1U91B 4I3RH 3MRIB 4JN2B 2PO6A 5HHPA 1SHMA 3O11B 4N8VA 5E5MB 5L2KD 4ODBD 2VLMD 3MLVL 3P4NB 1F45A 1GC1C 3G5VB 1A2YB 3H3KA 1OAZL 3U1SH 3UDWA 3A0OA 3RHWF 1D5BB 4JFFE 4GW1A 5I1GH 1RZFH 1EGJA 3W81A 4L8BB 4OFVA 5EH1A 4Q6IA 5ISZB 1B0GB 4OBSA 4NNYA 2NY5H 3HI1A 3ULSB 3C87A 3BZ4A 5C6WH 1T83C 4HGMA 4P2OB 2VAAB 3LKPA 1PKQB 2ESVE 1MCJA 3O81A 4JM4H 3SDYH 4PJ8C 4YHMH 5HDBE 5HGHB 1IGFH 3PWPE 1WFOA 4LAQH 3MRQA 4KQ4H 4XP5H 1KT2A 5GGVH 5HI4D 2O61B 3O6KH 5DZLA 1PLGH 2DJ4A 3UTTB 2P45B 1MVFA 1U9KA 3GSNH 1A22B 1Z9SA 2DMCA 2WM0A 1YMME 3DUHA 2VXUL 1U42A 4QWWC 2A0LD 2DQGL 3OF6A 3ZHDA 5I8KH 2YA0A 3QUMA 5H37G 1HSBB 4LF3A 1C7SA 1A1NB 2NYYD 1RZ8B 3BFOA 4LSSH 4WFHE 3S36L 5M95B 1JNHB 4FQJL 4XXDA 1EDQA 3S34H 2UY7A 2OSLA 3NZ8A 4JFZH 5CMAB 1XH3B 4OB5H 1NAMB 3W5NA 3RWCA 3IKKA 1EO5A 3QIBC 2VYRE 4I0PC 4Y4KC 3W11D 4NHUB 4PB9L 4O2EB 4JRXE 2CR6A 5JZ7C 3SGJC 5JOFA 1P4LB 1S5IH 4P2RB 2NX5E 5C09E 2W1NA 1FL5B 1SEBA 4PJGE 5F7DA 4KVCL 5CEYB 1G9NL 3BEVA 4FOMA 4XPTL 3QJFB 1N64L 3RKDC 4LEXH 2XTLA 5LGJB 3Q6GH 2CKBB 4FFYH 5CBEA 5EU6B 4XCNB 1X5ZA 3G6AA 4YBLB 1VPOL 4CW1B 4JQVA 4M7JL 5C86A 1CD1B 1RZ7H 1R6VA 3ULUL 1UA6H 1NCDH 5F7FA 5HHXH 4NM8L 3P77B 2JB6A 4UQ3A 4OZGF 2DWDA 3L3KA 5FB8B 3RU8H 5C0CE 3SJVD 4PRAB 5DJAB 4ZUWA 1VACA 3CXHK 4YAQA 4WI2A 2Y9RT 1L7IL 5J57B 2CRMA 3IKCB 1UM5H 2B4CL 3BN9D 1NC2B 4FXKB 2CMRL 2XWTA 3K4ZA 3JTTA 5IBLD 5I1CL 5EO0A 4YHIA 1P4IL 5CBAA 1FNGA 4OAWB 3SGEI 5CP7A 3SCMC 1QHPA 2BVQA 5MENA 5C0BE 1HEZB 2X4UA 4JN1H 1YMMD 1T1XA 3AAZB 4ZO9A 1UACL 1J0HA 1EHAA 2AXGA 1JNNH 1NFIA 3QG6A 2ED7A 2WQRA 4K7PL 3GSOA 2XFXA 1DVFA 1RIHH 2V2XB 3RX8A 3BIKB 2ZCHH 2DLTA 5I6XC 2AK4A 5BV7C 2EXWD 4NKDB 4WFHD 5FK9A 4KHXL 1UH3A 3JWOC 5FUOL 1S9XB 2HFEA 5JXEC 1MREL 3UJTL 5E00B 1MFAH 2XA3A 4Z0BL 1A9BA 1MJ7H 2FJGA 3O9WD 1TZHA 5DHVH 4YK4B 2CUMA 1JN6A 1OAKH 4JM2D 4U6TA 1QSFB 1WZ1H 4LASH 4LCYA 4F57H 3VXRB 5DEFA 3WNOA 3TN0D 1AXIB 4NPYA 1BBJA 4CU6A 5B3NA 3BDYL 2X7LB 3U82B 2F54E 3JXAA 2H2PD 5D1QD 3CDFA 1G9MH 4XRCA 4HMEA 1AI1H 5J06A 1DUYB 2AEQL 3HB3C 2RQ8A 2R8SH 3KHOA 3P2TA 2XV6B 4FQXB 3S88L 1TQBB 2D4DA 2VXVH 4IMKC 3KXFE 1IARB 1U8IA 3TF7C 3D9AH 1EJOL 1RK1A 3OPZL 5I1AB 3QUKB 1PG7X 1IC7H 1SEQH 1FORH 4H8WH 2X4OA 1CGSH 4GUPA 2PR4L 2FHBA 1SY6L 3WN5A 2R1YA 4X6CF 2W9EH 5IBTH 2AXFA 5T3XE 3QCTL 1WFNA 4N8PA 1F3DJ 4HPOL 4NQVB 3V79C 3T2PA 1V8HA 1XF2B 3VXTA 3WXWL 1NCWL 4OM1L 2VJXA 5K93A 2DDQL 1H9VA 3SDDD 4OSUL 3F7VB 3ESUF 1F4XL 3PE9A 1WJ3A 5C3TA 3QUZA 2GSIA 1IT9H 1AGFB 1EGJH 1HQRB 1YEHH 3JV4B 4MX7B 5F88B 3U0PA 5C0IA 3E2HC 3S35H 4FHBD 2GCYA 3MA7A 3IDXL 3LKRA 3KYKH 3TZVB 5TF0A 1KJ3L 2J6EA 2APFA 1MCHA 5T1MA 3BESR 5CGYD 4PS4L 2IQAB 5C9KA 4NOBA 2YSSB 2PXYD 1T20A 2W0KA 4ZAKD 5INCB 3NBNA 5SWSD 4LNRB 5AEAA 3BP7B 2QQKL 2DD8H 4R4NC 4ZUSA 4QRPB 1MCCA 4PYGA 4YXKH 1FG9C 3LKNA 5I73B 1J1XL 2OTWB 3LDBB 4U3HA 3R8QA 1DUZB 3TT1L 5EN2B 1A7BA 3LB6D 1NUFA 1UYWL 1GZPB 5IW6B 3T0EC 1QR1B 1U2HA 1X5FA 5FO7B 4C55A 1U8PA 3QUMH 4UTAH 3VW3H 3UXFA 4N8CH 1MJUL 4XPFH 3GMNB 4DN4H 2PO6D 4DW2H 2Z31B 1FH5L 5EFIB 4G9FB 2X4NB 1HSAB 2YXFA 4XPGL 4LLUB 5MP6L 4XC3H 3LHPL 5CINL 5BO1L 4IRJA 3M1BA 5IEKA 4NT6A 1K3ZA 2XWBB 1IZKA 1E4WH 1HI6A 5DHYA 3VRLF 5DWUL 3NA9H 2MNUA 2NTFB 3A6BL 2GY7B 4ELME 1KEGH 2OJZL 3I3BA 4WWKB 5FDYA 2CRZA 4F7MB 4IBLT 1FSKB 1RZJC 3K8LA 3KPSB 4OZHF 5GRUH 1YPZE 3BZFB 1RQ5A 5ID0B 1T0MB 5JOEA 1HDMA 3H8NA 2FATL 4ZSOE 2NY0B 2FECI 1N3NB 1ADQL 5CJXA 5DMGC 2IBBA 2Z91A 3TA3B 1IEAB 4MA8L 1NDMB 5KSUA 4KHTL 3O6MH 1RU9L 2J2ZA 3OF6D 1JPFB 3K2MC 3ZSSA 1FC1A 2PW2A 3O2VH 2V7NA 4HJ0D 2VSDA 3KPRB 1KFAH 4OZGA 4XP9H 2FHFA 3TT3L 4LBEB 3G08A 2NY7H 4A2LA 3PDOB 2ZWLT 1S3KH 4UT6L 3GSXB 4PV8B 4X4ZA 1N8ZA 4D0BB 1R3LB 3PDGA 5E99L 1K2DA 4KDTA 2QKIB 4QCIA 1MOEA 4KJYA 3GJEB 1CR9L 1RULH 1MCEA 2IFGA 3RVTC 1LO5A 1CCZA 5T3ZH 3T4AB 4EOWL 3EIFA 4F37K 3IU4L 3HPJB 4HS3A 1MELA 1QSEB 3IFPA 2EH7L 3C60C 1JWSA 4U3CA 3PHQA 1BAFL 4PGJA 5I18L 4K9EL 5IWLA 3T0WA 5C1MB 5DTFB 5GGVY 1MNUL 3STLB 4ETQB 3LEXB 4YLQT 3KVQA 1A6ZB 4HZAA 3BXNA 5DC9B 5DFTA 4U1GB 1QRNB 3BKJL 1F6AB 4LIQL 3DYPA 1ZHNA 2HFGH 2ZUSA 1JGVL 5BVJB 1RUMH 2B0SL 4I13B 1P7KB 2YBRB 1Q9LA 3H9SB 4L29A 4BQCA 5EORH 4YIQB 5AZEL 4I48B 3WJLA 4K7FB 5JXAH 4DWHA 3U0WH 4R0LB 1GIGL 5C08B 2X1QA 4P2QB 4MWFB 3MJ7A 1NANI 3FJTA 3PABA 2Y5TA 4CJ0A 3VXQB 4X4XB 4J6RH 5T1KB 2CIIB 1KJ2A 4UTBL 4WNQA 4P2OC 3KYNA 1IQWH 3NIDF 3WEXA 3GSRA 2Q8BH 2FRGP 4HBCL 4JO3H 2BY2A 2X9YA 4ZTPH 1QOKA 4KH2A 3BMWA 2G5BA 5E5RB 5IFJB 4E41B 5T3ZD 5MEND 5I0ZA 4OI7A 1PQZB 4O00A 2FDBP 2GJZB 5DD3H 1RMFH 5HDQH 2YD1A 4JVPA 4X6CA 1HYSC 4U6VH 2RFXA 2AJYL 2EIDA 5DUPH 35C8H 4LNVA 3IAQA 5IESH 2OQJA 1PY4A 3V5DA 1DVFD 1HCVA 4UIMA 2HJLA 2IADB 4JFEA 2J8UB 2AK4D 1A1MB 3RPKA 1YMHA 4Q9CA 1LO4L 4M7ZB 3JWNC 4TSCH 1IAII 3FFCA 5DS8A 1G6RL 2R2HB 1TNNA 4Q97A 5DRXB 3RHWK 4WEBL 1NGWB 4LMQI 1XFPA 1DQML 4U1HB 2J6EH 2CIKA 4P57A 1IAOB 3QFDB 1V3MA 2VQ1A 1MCNA 2D31A 3WLWC 4H88L 5H2BB 1AGCA 5L8KB 3CX2A 5GS1C 3MREB 2Y6SC 1JGEB 3BGMA 3P73B 2NXYC 4NO5A 1DQDL 2R56H 1AHWB 3CFCL 5A40E 3PL6A 4DGYL 4XT1C 2E7BA 2COQA 3MUGB 3ZKND 3EO1B 3SGEH 4OIAA 4RISL 1OSZA 2CXGA 5E8EB 4XPHH 1RFDH 4M6NL 4TPRL 1G7HB 2FO4A 4JAMB 4YBLC 3ZDYE 2CQVA 1DBKH 4M4PA 1J0IA 5IG7B 1AGEB 1UWEH 4DN3L 5L2JA 1H15B 3X12A 4PY7B 5B3JE 1C1EH 1N6UA 1TZIB 3LQAC 2P44B 3WLBB 4OLEA 4X0KA 2Q6WA 3W9DB 3S36X 2ENYA 3IETB 1PSKL 5FA4B 1NCBL 4F33A 2WV3A 3BE1L 4QRQA 2R39A 1AFVH 3DX7A 4ODUA 3WDHA 1IL1B 4OZGE 5HVHB 5KW9L 1KELL 2VDNH 2VLJA 3H9ZA 3ZT6A 1R3IH 4MLIA 2LVEA 4YEFA 1ZGLA 3B43A 2Y07H 1UT9A 2W07A 1NC4B 4HK3J 4JFDE 5DO2D 1VFUA 5GHWL 1OQXA 3QIWB 4GAGL 3V5HB 4MMZC 3MRBA 2OR9H 4TQEH 1RJYB 2ORBL 2CGRL 3SDCB 3DIFB 5HHOA 2OK0L 3GSQA 2BNRE 3CH8A 4KVNH 4HKBB 3TBSA 4UILL 1MHEB 1AD9A 4HXBL 1MFCH 2X4RB 5DVKA 4UUJB 5GSRB 3ZKMC 4YX2H 4WTZG 1N5YH 3L3OA 3OHXA 4TTGA 1T0NA 3CZFA 5GJSH 4B0MM 5JHDB 2IPKB 4NNPL 1CG9B 3RVVC 5JNYB 3EDJA 3S4SB 1QFHA 3U9PL 4O51B 3HNTL 1GVIA 2Z35A 3EGSB 3QYCA 4Z7WF 4DZBB 1CVSC 2F53A 3P4OA 3QXDA 4WU5A 3EFDL 4PJIF 3RWHB 3MC0A 1GAFL 3QRGH 5ERWB 2ZUYA 4JHWL 4G3YL 4IRJD 4AM0B 4ONGL 4N0CD 3MQIA 1NL0H 1QLEL 4AEEA 2HKHH 5CSZB 1OAUH 1GZQB 3QNYB 4YK4C 1MQ8A 4NC0B 2WK2A 3CVHB 2VXSH 3JSSA 4XPAL 4QOKA 3U46A 3U7WL 2GK0A 1K4DB 1EH9A 5GRJL 1EHXA 1QA9A 2C3VA 4WDIB 4RMRA 1S9VB 3QQNA 2QQQA 1QBAA 1NLBL 1G7MB 3ARDB 3X11A 3MXWL 1EMTH 4FQXC 1TQBC 5DHXB 4BFGA 3CUPB 3DVFA 2HKFH 3TYGH 4GBXB 1YNLH 4ISVB 3WS3B 3OKKA 1T6VN 1P1ZB 3ULVE 3NFSL 1MHPH 1MIMH 3O4OC 2P5EB 2R2EA 4HIHB 2DQCL 4B7IA 2WBJB 1T83A 4HH9B 1G7JB 5HYJE 4PJ8A 2OR8A 1IAMA 4PGCB 1XR8B 4KUZH 1CDYA 3NCYS 4JFEE 3QCUH 3GHBH 2VC2L 4TSAL 1MRCL 3C6LA 3QDME 4WFGD 4HFWB 2WINB 1JF1A 1SBSH 4AJ0A 4Z7VF 5FM5O 4Z95L 3UTQB 1P2CB 4EZMA 3AY4C 4X8JB 3TO4A 3OKEB 4PJAA 1KJ2H 3VMNA 4LSRL 3TZVC 2XRAL 4U33A 4ZOCA 3IJYA 3SDXF 3HN3A 3MV8E 5JO5A 3ET9F 5EBLA 2AGJL 1TJIL 3FQWA 2P8MA 2EZ0C 4MHHI 3RVXD 5EOCH 2X4SB 2LE9A 4E5XA 3EJYD 1A7RH 1AE6L 3PNWA 2BHZA 4HS8H 5I73C 5KSVA 1WEJL 1FFPB 4EJ1C 3LDBC 1F58L 1T2JA 4KRLB 1R3KB 1S7XA 3CVIH 1G9NC 3QIBA 2XQYG 1G0YR 3LQZA 1FV1A 4Y4KA 1VFAB 4HLZG 3PF2A 3MRHB 3TBWA 2BY1A 4Y7MA 2Z4QA 1RUQL 4HZLB 5E1AA 3SGJA 1E6OH 4BZ2L 1FG2B 4QRRB 3NCCB 1VERA 1UM6H 3ULUC 4O4YL 4HWEH 5E24E 4XNXL 2YPKB 3QHFL 3H9HB 4U1LB 1M05B 5K9KA 3NN8A 4AT6B 1UFUA 1BGXH 4Y16A 4QT5A 4JDVB 1P6AB 5JOPD 1A6UL 1NMBL 4QRTB 3EOTH 4PJFB 4WWKC 2VLJE 3AS3A 3NACL 1FSKC 1A21A 3IDNA 1MAMH 1N2RB 4GAJH 1XGPA 1I8IB 3MLXL 3I6GB 2D0HA 3VFPB 2B4CC 5DJ2B 1AC6A 1HN1A 3DLQR 3HC0A 4PRNB 5KSBE 5EZJA 1I8LC 3O6LH 2XG4A 2NY0C 2LFGA 5KBNC 2MQ0A 5BRZA 2WUCL 4OUOA 5FYJE 4V2CB 2PUQT 3TA3C 1CFQB 2ZG2A 3TH2T 3BPLB 4UDTB 4R7NB 3WUZA 3K2UH 3GO1L 3FOMB 3DTXA 4OCLC 1IQDA 3SDAB 2BSTA 2WZPD 1SJEA 1NGXB 4JFED 3CDGA 3BN3B 2DQJH 1BZ7B 3ZYZA 2BNQA 3EOAB 1W0VB 3E6HB 3FFCD 3VFUA 1LK3L 4I3GA 3SCMA 1DBJL 5FECB 4PJ9B 5AYUL 5AD0A 2P5WB 5IFAH 4G8GB 25C8L 4POZC 1FNHA 3Q1SL 1NANH 3KPLB 4LCWD 2DKUA 4QOKE 4KJPD 3WUWG 1F8TL 3V7MA 15C8L 5FYJH 4AENA 1G7IA 5JXEA 4KKAC 1I9JL 3I3EA 3I02A 4ZPVA 2AJVL 3PL6D 4HH8A 4CU8A 2EYTB 3P9LB 3PQYB 4TYUA 5GXBB 1NBVL 2X4QB 3AS0A 4UV7H 4XWGH 5HHNB 1ZSDB 3GMPA 1N59A 4XB7A 4Z6AT 5TDPB 1RUPH 4KI5E 2IPTL 1DL7H 4XBEL 4ODWA 2CLRB 2HVJB 3THML 3V4PL 4U1GC 5IOPB 5DA0B 2HFFB 3L95B 4XVJH 4U1JB 4PJIA 2EKSB 4RDQF 5FHBL 4IMKA 1IAIH 1Z5LA 2MTPA 3BT2H 4XHJC 3NH7L 2FJHB 3QDGA 1G7PB 3QNXA 2P49B 3RWFA 2FBOJ 1H0DA 4R0LC 4MB3A 2SEBB 3V6BR 1FCCA 2XN9E 1NSNL 2CR3A 2X1OA 2V9RA 4R3SB 4FG6C 2VLJD 4JB9H 1RJCA 1KC5L 3DRQA 4PJAE 1GC1H 3BRGC 1B0RB 2AERT 2R0KH 3QDHA 4CDGC 5FO9B 1OY3B 2G2RB 5IVOA 5CZKA 3E6FA 2E27H 2V9QA 2NZ9D 1X4ZA 3IFNH 1Q9KB 1LD9A 3NIDE 2IQ9L 5HHOD 4Z8FH 3BPCA 3EO0B 3B9KA 4H5SB 2FX9H 5FYJD 3WIHL 1MIEL 2HA1A 4HBQA 1CE1H 1M7DB 3RBGA 2EDBA 4EDWH 3HPLB 1MLCB 3UTSE 3QIUA 4KAQL 1C12B 4NRYA 4OT1H 5B4MC 3CK0H 1DFBH 2F53D 5HGGS 2EH8H 4M7ZC 3EJZC 4QXUL 3UAJC 1T5XB 4NBZB 4OD1L 4NRXA 5E8DH 1G84A 3IDGA 4P5KA 4Z7VA 1S8DA 3ME0A 5FYKL 2BC4A 1CLZH 4Y4HD 2O5YH 1N0XL 2E9JA 4J3TA 2IG2L 4QOKD 5IMKB 4YGAB 4KRPB 3KR3L 4OQTA 2EDRA 4NZTH 4Y2DB 4JREB 3LN4B 4MDJA 1I85C 1KB9J 4JFQA 5HGAA 3PWJB 2OJEB 4BH8B 3LV3A 2AJXH 1AHWC 4N0YL 2I60H 4Z7UB 3VXUA 5EUOB 5K9QG 4IOSD 4KI5D 1CFSB 4KZDL 5EPMA 3QCVL 2QADB 2FZ3B 4IM8A 1XCQB 1I7UB 4KDWA 5D8JH 5KG9B 3GHEH 1OPGL 5E1HB 1KPVB 1KCRH 4XP4L 4JHAL 1EVTC 4M6MH 5DK2A 4PJ8D 3TVMB 3GUTA 2BOCA 1GGIH 4I3SL 3RI5F 4GXUM 1ZKAA 5D72H 5DZOA 4P23B 3C6LD 3TM6A 3FFDA 2PTTB 5DD0L 4NC1E 5HVHC 3TO4D 1T66C 1FLRH 3FQRB 1VGKA 4JRYB 4DKFH 4M48H 3WUWB 4BFBD 4GRMB 2A77L 4RA0C 3HA0A 3NIGE 2VMFA 5JIPA 2V5YA 1EEUA 3QQ4A 4IHOB 3SBWA 3QIWC 4EQ3A 3MTRA 5DMKA 2IALB 1ZANL 4QHMA 5ALBH 6FABH 3D39A 1HNFA 3VG0L 1V7ML 2YEZB 3VRIA 1TJGH 4CVUA 4HPYH 1CDCA 3QIBD 2FYYA 1NPUA 2N1KA 1KLUA 3HS0A 4I0PD 4PJBB 4Y4KD 5F7EH 3VRJB 3V7AG 3RZCA 3V2AR 1T4KA 3WSQH 2A6JB 3HI6H 5L7XH 1ZK9A 5JZ7D 4AEIH 4DCQB 4LKCB 1OP5H 1EHLH 5HVGB 5I1DA 4J1UA 1OP5K 3V6FA 1BM3L 1EFXB 1XF4B 4QGYA 4MNHB 1LE5B 3AM8A 5E5UB 3RKDD 4ONFL 4PP1C 3MRNA 2NW2B 3C60A 1QYGL 3L5HA 3K1KC 1LO0L 3QDGE 2CO7B 4Y16D 5HYSA 5EC2B 4F15B 5BV7H 5IHZA 4MZ2A 3I85A 2YK1H 3MRIA 4JN2A 3JWOH 4LLMB 5K59F 2R1WB 4YO0B 2W65B 1ITBB 3CSBA 1ZA3B 4XXCA 2X41A 4CVZA 3MRKA 4EQ2A 5CEZH 2FBJH 3ARDC 1OOAA 1OARH 1Q9WA 4M9OA 3SHSA 4G5ZH 3TBVB 1C16B 3GI8H 1IGCH 1D5BA 3O3EB 4GBXC 1FZKB 4LLYB 5BRZD 5A2KH 1LP9B 4L8BA 1L4IA 3MZTA 1B0GA 3BVNB 1OTUC 1D5MB 4QF1A 4OJFL 2WBJC 5KVDL 1PKQA 1H5BB 4F2MA 2V17L 4QXWA 3JWDL 3ARFB 1WUNT 4HQQL 1MF2L 3MUHL 2F5BH 1CXKA 4PJCB 1OB1B 4NCC1 3Q6FA 2BNQD 1RY7B 5T1LB 2O61A 4RGOH 3GK8H 3HC4L 3O2DL 4N9GB 2L4OA 4P4RB 4PRDB 1TDQA 4R4FL 3SCMD 4NFBA 4YHPB 1YYML 4OGYL 4G6JL 5FV2A 1BBDH 3RL1A 1IFHH 1S7UB 4O5LH 5IB5B 2DLIA 2B7DT 4PJXB 4JRWA 4NM4L 3G5XB 4IRZL 1RHFA 3FB5B 5ITBH 3ZYIA 5IVXB 4Z0XB 4NWTL 2FEEL 1RZ8A 5JW3L 1JNHA 3ULUF 4JDTH 5JXED 1CGXA 4WENB 1DLFH 3LRSB 1Q1JL 3ZE2F 4LFHG 3DOSA 5F3BB 1CBVH 1XH3A 5SWZB 1WBZB 4U6YB 3DVNA 5CEZD 1LK2B 3BHBB 2IGFL 3OKNB 1A7PL 1DQJA 4GKSB 4HS6B 4JCMA 1NGPL 5EC1A 5IFHH 5F93C 4NHUA 4LARH 2E6PA 3ZTJH 2DBLH 2KDGA 2MPAH 5GS1A 2BVOA 5IB2B 4P2RA 4NQDA 2AKRB 2ZKHL 2AABH 5CJOL 1FL5A 5CEYA 3HB3D 4OM0H 3QO0A 3QJFA 3GBML 3MOBH 4I77H 5F3HB 5LGJA 1F3RB 2CKBA 5DC4B 5L8JB 5EU6A 4D94A 5FCSH 1RZKL 1FNSH 4IIQB 3SE9L 4OQTH 1JWMB 3CLEL 5DJ6B 2FSEB 1CD1A 4WVRA 4PJ5B 3C6SA 4WTWA 2B5IC 1JTTA 4G8EA 5DT1L 4LSVH 3P77A 4EEEA 4I3RL 4PJ7B 2CD0A 4YR6A 3OGCB 1AD0A 5FB8A 5K9JH 4ZUUB 3RA7H 3B9KD 2IH3B 1OLLA 3D39E 2NXZB 3H6JA 1RZJH 2DI7A 3BPLC 1S7QA 1HINH 3U7YH 3V0AC 3U1SL 3VU2A 3IKCA 4EBQH 3QIUD 2DQTH 3IXTA 3OJ2C 1WBYB 4OQ1A 1MLBB 5DRNB 1VADB 1RZFL 4FQLH 3LSOB 4R4ND 3OV6A 3M8OH 3FB7B 4OAWA 2AJ3A 3NCFB 4Y5YB 1PG7H 4S1QH 4PJ9C 1U0QA 2R2CA 4JM4L 3SDYL 1HKLH 4YHML 3AAZA 4OFKA 1IGFL 3QXTA 3OXRA 1JZ8A 3CPLB 3DRTB 4LAQL 3WHXB 1FFNB 4KQ4L 4XP5L 3HE7B 5GGVL 3O6KL 4YBQC 3CH1B 4D0DB 1PLGL 1BFVH 1IAKB 1T5WB 3GSNL 1N26A 4WI3A 5LBSH 1IKFH 3QWQB 5E00A 3QFJE 3R1GH 2AEPH 1A7NH 5I8KL 3ZE0F 3HE6A 3VXUD 3WFHA 4JE4B 4C57C 4X4MA 2AI0H 2DQFA 5I66B 1QSFA 3VXRA 2R69H 2YMXH 2DL9A 3S34L 5HYQB 1I7ZB 4PJHE 2IPUG 3WO4B 1DE4A 5ESAB 3QISA 4OB5L 2E9IA 5D7JA 2O5XH 1S78C 1IEBA 5D4QA 4HWZA 4FQXA 3MUY1 1YEEH 4MJ6B 2KZ1B 1YEGL 1WIUA 4XNUH 4JG0L 2UV3A 5E2UL 5I1AA 3I6LE 4N0RA 5E8PA 1SVCP 2OTUA 2EO9A 1BVLA 5DMGD 2H26B 2GITB 4OLWH 3KLHC 2FL5B 5HHMD 2EDKA 3RKPA 4NQVA 3PWNB 4LEXL 5C9JB 1XF2A 5FHAH 3Q6GL 4FFYL 3NZHH 1S9WA 2J8UF 1FL3B 4J8RB 5A2IH 4M5ZH 3MLSH 3UJIH 2HT3D 3SKNA 1MCWM 2HWZH 4HIJB 1RZ7L 4MX7A 1AGFA 1HQRA 2YZ8A 3D39D 2BXZA 5D5MB 5F88A 1UA6L 1UXWB 1OSPH 1NCDL 3RWGB 1YECH 1QO3B 4MA7L 3AMLA 1PZUB 1U41A 5HHXL 4DOHE 4IMLB 3L3JB 3TZVA 4PGEB 3ARTA 4R7DA 2NCMA 3TIDB 1HHJB 3RZCD 3MROA 4Y19E 3W82A 2YSSA 2GJJA 4YHYB 5INCA 3RU8L 4HUVB 3QR2A 4Z78B 4X80H 4R9HA 4QRPA 3CFJA 2J5LC 4NQDE 3TH3T 5C0AA 1FZMA 3G6DH 4LK4A 2OTWA 4G42B 5C7XH 4XMKL 3VFWB 2BFVL 2PF6A 1NGYB 1DUZA 1UM5L 3CDYA 5IW6A 3C60D 3D3VE 4V1DB 1FVEB 4KK5D 1OQOA 4YXLH 4L4VA 1PFCA 3GMNA 5I8OH 2BDNL 5EFIA 1OW0C 4G9FA 1QLRB 4KRPC 3KNBB 3WJJC 2X4NA 4JN1L 4Y2DC 3DXAB 4JREC 5IHLB 3OJMB 3MRDB 5JPMB 2ZJSH 1XCTA 1JNNL 1ES0B 1OGAA 4ZQKB 4DTGH 1WIOA 4YE4L 3VWKB 1RIHL 4FZ8H 1UVQA 3S5LG 1IRAY 2ZCHL 4G80B 4XI5C 1ZLSH 2NTFA 4LSQL 2FWOB 4AMKH 2BVPB 4GMSH 3KYOB 4J3OC 3ALXA 2WIIB 2ZUVA 4CL7A 1O7VA 2QADC 3PP3H 4WWKA 5CSBA 2OI9B 3B3IB 1MFAL 3PP3K 4F7MA 5JPNB 3WV0A 3N1MC 3KPSA 2VZUA 3BZFA 1OAKL 3TVMC 5GISH 4GAYB 1WZ1L 2E6JA 5ID0A 2CKBH 3I6LD 1BX2B 1I8LA 3B9DA 1MCIA 1C5CH 4P23C 1N3NA 1U2CA 3C5ZA 3FN9A 1G9ML 1IEAA 1AI1L 4FQ1H 4NKIH 3LQAH 3ABZA 1FGVH 4FTVB 1YN7B 5FO8B 2OP4H 1NEZG 3MV7A 1HYSD 2VXVL 5DRWB 4P9HH 3IF1B 3EYOB 3D9AL 3DUUB 4FQQA 1A0QH 1IC7L 1SEQL 1FORL 4P49A 4PRIE 1S7TA 4H8WL 1CGSL 1CGWA 1P5UA 3WKMH 1JTOA 3FAXA 3QEQA 2BNUB 2EYSB 3DO3A 3QT2A 2RHEA 2W9EL 5IBTL 1FNEB 2H32B 3V4UH 4LPYA 2M2DA 1DQQB 2Q86B 3FT3B 1ZTXH 2HJFA 1E6JH 1RIUL 3GSXA 4PV8A 3TFKC 4D0BA 2ED8A 2MQCA 2X05A 3WLWD 4I0KA 5HYEA 2DQUH 4H25B 4N8VG 4JFFB 3OMZA 1IT9L 1YEHL 3DSFH 5H8DA 3MNVB 2AVGA 3VH8A 2MKLC 4F7CB 2DKSA 3GJEA 3U2SA 3CX5J 4GKNB 3ALWA 4P2RD 4NQDD 2JIXB 3S35L 2Y6SD 3WS6A 3DX6B 4LQ1A 2NXYD 4LCUB 3MYZA 4F8TA 4LCCA 2ESVB 2VIRB 2GT9B 4ZFOB 5D7IA 1L9NA 1QSEA 1QBML 2I9LA 3PWPB 1K4CB 1NGZB 4GW5A 1PYWB 5EU6D 5GRZA 3UO1H 3ECBB 3LS5L 5DTFA 1ED3B 2DD8L 5E2JA 4F15C 4ETQA 3LEXA 4ZFZA 3MRPB 2FGZA 3DWTA 1SY6A 1YMMB 5K59E 5GS2H 1GGUA 5BVJA 3MLVH 1P7KA 2YBRA 5IM7A 3QUML 4UTAL 4N8CL 5D96B 4Z5RA 4XPFL 4DN4L 4MJ4A 4DW2L 5LGHL 3T77B 4HKZA 5C08A 4P2QA 4MWFA 4XC3L 3UPRA 2CIIA 3WDJA 1E4WL 3IDIB 2FJFB 4U1SA 4KTDH 1WZKA 3NA9L 4PBXA 1H5BC 1MJJB 3DYMA 4KGJA 3RZWA 1ORQA 4JM2B 5BW7C 3NCEB 4QNPF 4JRXB 3SY0A 3ARFC 1KPRA 3FOLA 2K7PA 1D3CA 1I3UA 3OKYA 4OZFG 2NX5B 5IFJA 5C09B 2VTFA 1YJDC 2NY6B 4JPKH 4PJGB 4QLRA 2GJZA 4M5YH 3H0TB 3BYYA 4X7FC 2BRRH 1CFBA 5GRUL 4D9RD 1MUJA 1HH6A 4Q9QH 2AQ1A 4JG1H 4LVOB 3RVVD 1A6AA 4ZO7A 4L4VE 2OXHA 2ZOLB 2J8UA 1KENH 2GIYA 3O41B 5DSCB 3D69A 2R2HA 1UH2A 5DRXA 2GFBA 5GS2D 5GIRB 4EXKA 1NGWA 3HNVH 1C8PA 2X70B 3RWIA 4U1HA 1UADC 3SDDB 4XCCH 1QSFD 4EDXA 1WVZA 3VXRD 1KFAL 5C0CB 4PJFF 2V5MA 4XP9L 2DTMH 3MREA 4YGVA 1U3HB 3VFRB 1I85A 4M61B 2NY7L 5D7JD 1JGEA 2JE8A 1S3KL 4KVCH 4NQEE 1G9NH 1AR2A 3MUGA 4FQXD 3PGCB 1NJ9A 3EO1A 4JO2H 4L3EA 4FQPA 1NEZB 2PXYB 5CLTA 3X13A 4NNXB 2L7UA 1RULL 4IIQC 1G7HA 1N5AB 4JAMA 5T3ZL 5BJTB 5IJKC 1ADQA 4JFHE 4KXZI 2HTKC 5C0BB 1AGEA 3GZKA 4YXHH 3ULUH 4J3SA 1TZIA 4YDJB 3KHQA 3MV7E 5IKCB 1FVCB 3WLBA 4NM8H 5I16A 3IETA 4X7TB 4IS6B 2Z0BA 4I9WD 2PO6B 5HHPB 3TC9A 5D1XA 2LABA 5CZVH 3QEQE 4Q58C 3HLAA 2W0FA 1ZS8A 1WFTA 4N8VB 4QHKJ 5TE6H 5FM8A 5KAQF 3CAFA 2NXZC 1RUML 4Z7OF 3T08A 1AIFA 3QBTB 3RWDB 4KJWC 5EORL 2EDYA 3TZVD 4LLDA 1Z3GH 5J6GB 1NC4A 4HUUB 1FRGH 1MCQA 2Z9TA 4DZ8A 5JXAL 3V5HA 5L8LB 3U0WL 2EZ0D 4GW1B 4Q6IB 4MXVE 4WWID 4QRPD 4J6RL 3KPMA 2JK5B 5C0AD 4HKBA 3BZ4B 2HG5B 3DX8A 3I9GL 4MQ7A 4UUJA 3BIBX 2IEPA 2Y06H 3GKWH 5D7IE 1IQWL 3KXFB 4L4TA 5JHDA 2IPKA 5EA0H 2Q8BL 1DN0A 1CG9A 4L4VD 4NHCH 3S4SA 4XP1L 1JRHI 1KT2B 3HE7C 4O51A 3EYVB 4ZTPL 3A6CL 2DLEA 5C0JA 3EGSA 3EDFA 4XBPA 4G9FD 5FYLE 3RWHA 5DD3L 2D9CA 1RMFL 4AIXA 5ERWA 3ULUD 5HDQL 4ACPA 4U6VL 4AM0A 1OGAD 1MCRA 5IESL 3UMTA 1QFWM 1CGVA 5D2LE 5TF1L 5ECJE 1GZQA 1FVDA 1OCWH 1IC1A 3CVHA 5LVEA 4UT7H 4TSCL 3MNZB 1K4DA 1YEIH 2OSLB 3NZ8B 4KKBC 4WWKD 2DB8A 3WO4C 1YZZA 4WDIA 3VGDA 2J6EL 4OZFB 1NFDA 3BI9X 3KPSD 3RWCB 1G7MA 1RHHB 2QQLL 4MQXC 1J88A 4YFEA 3MJGX 3CUPA 1BVKA 1EJOH 2JJTC 2NY0D 2P48B 1JGUH 5IUSA 5JOFB 4ISVA 2RAMA 3WS3A 3C5ZD 5F72S 4NZJA 3TA3D 3TCLA 1SY6H 1SEBB 1XF5B 5F7DB 2P5EA 5I19H 1F3DH 2K1MA 3BEVB 3NIFF 4HIHA 4X7DC 5IQ9A 2WBJA 2DJUA 4HH9A 4HPOH 3MV7D 5C0DA 1G7JA 1ROWA 3WXWH 3RX5A 4OM1H 4KZEL 1RFDL 4PGCA 1XR8A 5INDA 3G6AB 4OSUH 1DBKL 4ZYKA 1J9CT 1UWEL 4HFWA 2WINA 4JDZA 1C1EL 2VRAA 3RY4A 1S7WB 4X8JA 5E2VH 1YY9C 2M8XA 3LPWA 4WHYH 3NCJH 3BD4A 4POZD 4Q9RH 2NY1D 3QZWA 2P8LA 3KLDA 2VITA 3HG1A 4UQ3B 4ELMB 3AUVA 5C71A 1AFVL 4U0QB 3UP1A 4YHYC 4Q7DA 3HZKB 4KMQA 2X4SA 2QQKH 2VDNL 1EXUB 3VXME 1R3IL 2Z93A 5HD8D 4U49A 5EZLB 1FFPA 5DDHB 4NN6B 2Y07L 4Z7UF 4N1CA 1R3KA 1YPZB 5EUOF 1BIHA 4HK3N 1QSED 3P9WB 2XICA 4L3EE 5D2NA 5C2BH 4TQEL 2XWTB 3QDJA 1BOYA 3MRHA 5J11B 4ZSOB 5EO0B 4APQB 2F8VA 4HZLA 5CBAB 5DGRA 3IB4A 1RZKC 4KVNL 3GMMA 5FOJA 5CP7B 1FH5H 2BVQB 1FG2A 4ZD3H 5E0QA 1MFCL 2X4UB 2MCG1 2J7LA 4KWUA 3QHZL 1T21B 4YX2L 1T1XB 4QRRA 1N5YL 4QHNA 4RZCA 4KK6D 2AXGB 5GJSL 4MZ3A 1NFIB 1BFTA 1V5JA 3HMXL 2NTSP 5TE4H 3GSOB 4XHJD 4U1LA 1DVFB 3VWKC 5DWUH 4AT6A 1ZLWH 4JDVA 4BK4A 2H3NB 1ZLWK 1W8NA 5C08D 4XGZA 4OCNC 2OJZH 3FRPG 4P2QD 2HFEB 4FG6D 3QRGL 3OAUH 3BSZL 1Q38A 4LQFL 4PJFA 2OI9C 1NL0L 5D7LE 1PJ9A 2HKHL 3QXWA 1TZHB 1N2RA 5L9DL 1OAUL 1U36A 4IRSA 5IB3B 1JN6B 5IR1A 4NQSA 4UNUA 1TITA 3W11C 1KJMB 2VXSL 5DEFB 3LIZH 1XR9B 3VFPA 3T0XA 2VISA 2FATH 3QH3B 4I0CC 4N5UA 1ADQH 4X4YB 4E41D 2D2OA 4XRCB 4MA8H 4MD0B 4Q9BA 1CFQA 4UDTA 4PJBF 4R7NA 1RU9H 2C1PA 1NAKH 3FOMA 4FQ2H 1EMTL 3UTOA 4LDEB 4L4TE 3MV01 3IXAB 2HKFL 1RK1B 4PREA 5B4MD 4NZRH 1YNLL 2EEAA 1BZ7A 5TH2A 3EJZD 3VGEA 1MHPL 3E6HA 3UAJD 2R1YB 5KZCB 2AXFB 2EDDA 5F7NC 1KN4H 4Z7NE 2FIKB 2VZOA 1LHZA 4PJ9A 3VXTB 2B2XH 4G8GA 3T04D 3HR6A 3ARGB 4KUZL 5D9SB 3QCUL 2NLJA 4CU7A 3GHBL 3QUZB 4P4KA 2GSIB 4EI5B 1OGTB 4NJ9H 5MEQB 1KNOB 3U0PB 5CKAA 1KJ2L 1BIIB 5DQJB 3LKRB 5L0QB 2VDLL 4MCYB 4DKEH 4KRMB 1YEJL 1NFDE 3IU4H 2WBWB 1MAKA 1OP9A 5T1MB 5J8OA 4ZPTB 4MAUH 3PQYA 4L3ED 5FM5M 2HTLC 2EH7H 4NQCE 1OAQL 5TDPA 1Y18B 1DBBH 3ULVL 4ZUSB 2CLRA 2HVJA 1A7RL 1CL7I 3LKNB 4HS8L 1ZT1B 5DMYA 3L95A 4LIQH 3CVIL 1HH9B 2FECL 4B53A 2E7HA 2X4TA 5D6CA 4KJQD 1FNFA 2B0SH 1A6VH 4D8PB 1YEDA 1MCBA 1R5IB 1U8PB 4PJCF 3GMQB 5L6YH 1X7QA 3GEWB 2NNAB 5MHSE 3CVHH 5D96C 1UEYA 1ZT4A 4M8QA 1E6OL 5D1XD 4CVWA 2SEBA 4FFZL 4AQOA 1T66D 1UM6L 4HWEL 4IRJB 4K8RC 4AYFA 5T1DH 4MJ2A 3AC0A 4XP6H 4PJXF 2VR5A 4UTBH 1HI6B 5I1IH 1B0RA 1NC4D 5DHYB 1J5OH 5I8CA 1FAIH 1BGXL 5KS9E 4MD4B 4AIOA 3HG1E 4M3JA 3HMWH 4JM2C 4WW2A 4ESKA 4HBCH 1Q9KA 3QWOB 1JYWA 4QNPE 3EOTL 4S2SA 1ORSA 1CD0A 2QSQA 4M3KB 1HK6A 4H5SA 5CKGA 2Q1EA 4KK8C 3REVA 2M1KA 5IHBA 1P9MC 1J1PL 3AMKA 3BPNB 2NY6C 4F58H 4GAJL 1M7DA 1O0VA 1WWCA 5BZWB 2XY2A 2YUXA 5TPWL 3GNMH 4L4TD 3HPLA 1HHIB 3RAJH 4LVOC 1MLCA 5JHDD 3RP1A 5D2NE 1I4FA 3QDJE 2DIAA 2G75A 1C12A 3AXLA 3O6LL 4Q2ZA 2QQNH 1DTUA 3O0RH 5I1KH 3C5SB 5KSUB 1EEYA 1T5XA 4ZOEA 3K2UL 5E08L 2ZSWB 4PP1D 2UZYB 4R26L 5ESVA 1CDGA 1CN4A 1MHHA 3SDDC 2DQJL 2V7NB 3GM0A 3AREA 1EHNA 3CFDB 3A6OA 1A9EA 5IMKA 2XT1B 2KKQA 4OZGB 4OIBA 1OW0A 2VKXA 1A3QA 4P99A 1PBYA 1U3HC 3VA2C 3LN4A 5SX5H 2YRLA 3AROA 5IFAL 3FT2A 3PWJA 1FYHB 1QLFA 1F5WA 5EO9B 4JFDB 3ARDD 1N8ZB 4Z7UA 1QNZH 4PJ7F 3HAEB 1K2DB 3DHMA 4QCIB 2PXYC 4RISH 4F9PC 1GXEA 3CCHA 2QLVB 5FYJL 2KH2B 3VCLB 1XCQA 1OTUD 2P5ED 1G9MC 2WBJD 4O2CB 1JRHH 4YFLF 1CFVL 4UV7L 4XWGL 5E4EB 2AEIT 3PHQB 5E6ZA 2NY3B 4UDUB 3P4LA 4OUUB 1DL7L 1A64A 4CN4A 4HDIA 5FGBA 2PO6C 2P43B 2PTTA 5IP4A 4XVJL 3OB8A 5KW9H 5T5NF 1KELH 3FQRA 2N7BA 4OF0A 5FEBA 4JRYA 3NPSB 2AP2A 1Q9LB 3WUWA 4GRMA 2YS4A 5IROC 1IAIL 3BT2L 1IMHC 3CIQA 3QSKB 4X5WA 3HG1D 4IHOA 3VDCA 1W8OA 1JWUA 2IALA 1A6PA 2X4PB 3MJ7B 3ZO0A 3K8KA 2Y5TB 4JB9L 5EU7E 4RAHA 2YEZA 4JFXB 5C0EA 1GC1L 1XIWA 1KJ2B 2BJMH 3BP6B 5HJ3B 2R0KL 4M43H 2APVA 4X83A 3GSRB 1RURH 2E27L 3QDJD 3VRJA 4HG4K 5IV2B 1MCFA 3IFNL 5KTEH 1UENA 2ZCKH 4Y0GA 4BM7A 1OWRM 4L1HA 3E1F1 1KTLB 5GGUB 2X1XR 2G5BB 1T2QH 2FX9L 3BP5B 5E6IA 3S37X 3EFDH 4MXQC 3GBLA 1ZHBA 1JMZA 1T1ZB 3EJJX 4QRRD 1CDIA 1RK0A 4BA8A 4WGWB 1XF4A 1LDPH 4MNHA 5HYJB 1LE5A 2RFXB 4ONGH 5DUML 4IDJL 3VXSE 4UIMB 4OT1L 2HJLB 3CK0L 4JFEB 1DFBL 5GRWA 2ILLA 5EC2A 1YMHB 3LN5B 2EH8L 3QDMB 2VQUA 2XI9A 3T2QA 2R1WA 4RCAA 4OLVH 4LRIA 5AUMA 1F4HA 2W65A 1X5XA 3BKMH 4WJ5A 2CIKB 4P57B 3VGBA 2VQ1B 4MJIA 3FL7A 3MV8B 2NY4D 5DJYB 1CLZL 2RIKA 1A3LL 2D31B 2O5YL 5DUBB 3SGDI 4JPVL 1GCFA 1AGCB 3TBVA 5K33A 2UZIH 3IRPX 2WIMA 1C16A 5HTSA 3O3EA 4NZTL 1HXMA 1FZKA 4YFLI 4NKMA 4BJLA 4FFVC 4RSVA 1D5MA 4UOJA 2F8OA 2I60L 3PL6B 5BQ7B 1XGUA 4P46B 2EC8A 4OZ4B 1P7HL 5BW7A 1IJ9A 1ONQA 3MO1B 2FO4B 1CF8L 2BX5A 1OB1A 1NCAH 4JQVC 5J1AB 1AO7A 3GHEL 1D9KC 5C8JA 1TCMA 3V0WH 4PJ9D 1FL6B 4M6ML 1JYXA 4YEEA 1VGEH 4X0KB 4G8GD 2PW1A 1GGIL 1CFTA 1S7UA 3WFZA 2FX8L 3T0AA 2XRAH 5IB5A 1U8OA 4PJXA 3JTSB 5D72L 2ZG3A 4YBQD 1QQDA 4QEGA 4HUWA 5TQ0H 1FLRL 2VLJB 4J4PC 4DKFL 1KSRA 1VEMA 4M48L 1AE6H 2UYLA 2EO1A 3O3DB 4D2NA 3HTLX 1LWRA 3LRSA 1VKXA 1F58H 5F3BA 3VMPA 1WBZA 4U6YA 3N50A 3BHBA 4GKSA 4HS6A 3KGRA 3PQYD 4TUJB 1S9YA 4UT9H 3UTPD 5KSBB 4UOW1 5JORB 5AAWA 5ALBL 6FABL 1AQDB 5J11C 2IMMA 4APQC 4UV4L 1FYTA 2PYEE 3GSQB 1J18A 5A43C 1TJGL 5HGDA 3TBSB 3ZZ1A 4BZ2H 3MOQA 5IB2A 2AKRA 3D0VA 2DF3A 1VEOA 4MDIB 1S78D 3L3OB 4HPYL 5EB9A 1FNLA 4C54A 3G5ZA 1PEZA 1T0NB 4O4YH 5F7EL 2GKIA 1O5DT 4KUCF 4XNXH 1B9ZA 1JMXA 3QHFH 2EDTA 3HI6L 1DVFC 2P47B 2WBKA 4X6FA 5L7XL 1KIQA 4NDMA 2Z35B 3NFPB 3LKQA 4AEIL 3K7UA 3QXDB 1EHLL 5DQDH 3UZVB 4YHOH 4YDKH 2J1KA 3B5GA 5IJKA 3KLHD 2BSRA 2YD7A 2DIJA 1JWMA 2EECA 5DJ6A 2FSEA 4HIEB 4PJ5A 4U1MB 2FEEI 3BIAX 2LAGB 2IBZY 4XBGB 3LRGA 1TIUA 3TNNB 2YK1L 4QOKB 3U46B 2GK0B 1ETZA 4PJ7A 3F6IA 5FOBA 3JV5A 3OGCA 4NWUH 1QA9B 3ROLB 2C3VB 3K1DA 3LRHA 3T0BA 3T4YA 3ZYOA 4O9HH 4Y5VB 3BH8A 3GFUA 5CEZL 4P59H 2FBJL 5IMMB 1OARL 1ZT7A 5JQ6H 3F5WA 1CL7H 1CK0H 4IOIA 4G5ZL 4EN3B 1IGCL 1MLBA 3D2UA 5I1LA 3MV9E 1CT8B 3RL2B 4N9OB 4MHHG 2LU4A 2R2EB 3OSKA 3MJ9A 4RMVA 1R5VA 4PRBA 5HDBF 4FQCH 4X99A 1UZ6E 3MA9L 3WKNA 4PJ8B 1QBLH 1XGQB 1JPSL 3CPLA 3ARGC 3WHXA 3WHE0 1UM4H 1IKNC 1FFNA 1YNKH 5IHUL 3HE7A 3ARED 3RNKA 3QUZC 3C6LB 3EZJB 4RGOL 3RTQC 3GK8L 4EI5C 1JF1B 1Z9OA 2XN9B 3CH1A 4M62H 4D0DA 1U58A 3ARRA 4KRPD 1T5WA 3TO4B 4PJAB 5IB4B 3BRFA 3OG6B 1IFHL 5L0QC 5F44A 3C8HA 4O5LL 4HFUH 2W9DH 3IJYB 4I2XA 4MJIE 5JO5B 2AJVH 5J4MA 3WFCL 5ITBL 4R90L 4OFYA 2P8MB 3O3BA 4W6YB 4XI5D 5GGRY 2PKDA 2BHYA 5LG1A 4LAJH 5E03A 2IPTH 1SBBA 3WCYA 5HYFA 5HYQA 1I7ZA 2F19L 3UZEA 3PNWB 2CJUH 1DLFL 1BP3B 4MB4A 1CBVL 3ARBB 2A2QT 1S7XB 3QUXB 1UB5B 1EEZB 5IFHL 3T3PE 4HMCA 3LQZB 3UTSB 1IGMH 5FHBH 3TBWB 3BD3A 1V3JA 2MOVA 4MJ6A 2DBLL 2MPAL 1FQ9C 2EDOA 3BRDA 4U1IB 4PJGF 1MFDH 1AO7E 4PTTB 2H26A 2AABL 4PB0H 4L8SB 1QFOA 3Q5YA 4OM0L 4JRYD 3B2VH 3FQUB 3PWNA 4RAUA 3MOBL 3ZTJG 4I77L 5C9JA 3GMRA 5E94B 3NN8B 1FNAA 2DTSA 4Y16B 4J8RA 1FNSL 3HZMB 2FX7H 4GRWE 4ZFFB 1I7RB 1FZJA 4R2GB 1UCBH 4S1RH 2IQ9H 2FH6A 3QEHA 1UXWA 1TVBB 1XIWD 1MIEH 5DJDB 3W9EA 3BPNC 3RWGA 3SKMA 1O7SA 1XGPB 4LSVL 4BQ8A 3L3JA 4MNQE 2VE6B 1X4XA 2YD4A 5E8NA 1IM3B 2JLLA 3UBXG 5EZJB 4PY8J 3SO5A 4FA8A 5K9JL 3RA7L 4HUVA 1FYTE 4O2FA 3DUSA 4MSWB 5CJXC 5E6ID 4JZOA 1YJDH 3QEUB 4X5XA 4G42A 4OTXH 1HINL 3U7YL 3IGAA 1RPQA 1IQDB 4J12A 1N6QH 1SJEB 2XKNB 4V1DA 3NCMA 1DQTA 5ETUA 1FVEA 4FQLL 1ZA6B 4LGRB 3M8OL 4GRWH 1ACYH 1M7IB 1NEUA 3VFUB 2IG2H 2VH5H 2A1WH 3SCMB 1KN2H 1XGTB 5AAMA 1MY7A 2GSGA 2OMBA 2YRZA 2QSTA 3DXAA 1HKLL 1X5AA 3MRDA 1U6AH 3WFDH 5AD0B 1KB9K 2X1PA 4AL8H 2D3VA 2K9UA 4QTHA 4K3EH 2KZWA 1GGCH 3VWKA 2HRPL 2WNGA 5F9AC 1BFVL 2FWOA 5E7FA 4KZDH 2OXGA 2BVPA 1IGYB 5ACZB 4AENB 2WIIA 4LRNH 1G7IB 4Y4FA 5LBSL 3ZE1E 1IKFL 1E4XI 4L8DA 3SGKC 3I02B 4ZXBA 1U8HA 3OR7B 3R1GL 5SWQA 2AEPL 2BRQA 1KEML 4JHZA 1GGYA 1CDHA 5E4EC 2AI0L 3IS1X 3GMPB 4GAYA 2NY3C 1N59B 5IWLC 5IVNA 2R69L 3ARFD 5CWSA 4ODWB 4HUXA 1BX2A 3IYLW 4Y5XB 1T2XA 1AO7D 3MZGB 5DD0H 2O5XL 2WLYA 1OTSC 4NZUH 4P3DB 4PJIB 1NGQH 1F4WL 5FDWB 3MFGB 3NPSC 4FTVA 1YN7A 5FO8A 2OX5A 4ORGA 2A77H 3SQOH 4XNUL 3EYOA 1MFBH 3DUUA 3QDGB 4YJZL 3RWFB 3KPPB 1H0DB 3U7AA 4NIKB 4EI6B 1WAAE 4J2XA 1DJSA 1T03H 2R4SL 1I1CA 1JZ2A 1TNMA 3QQ9D 1BLNB 1FNEA 2H32A 2VLLB 3M45A 3SGDH 4Z7QF 1R5WA 5FHAL 5HYSG 3FT3A 5SWZD 3HR5A 3NZHL 4I2XE 3S3PA 4M5ZL 3MLSL 1RIVH 1CLYL 2HRLA 2DIBA 2Q7YB 4JFFA 1LD9B 2HWZL 1FYTD 4MMXC 3BPCB 4LU5L 3B9KB 3ZL4L 3MNVA 1GOHA 4LPWA 5GRXG 3ULVC 4GKNA 4X7EC 2JIXA 1AQKH 2EKJA 4OCYH 3ARQA 1YQVH 2B39A 4LCUA 4TNWF 3DO7A 1BM3H 4Z77A 2ESVA 4IOFD 1KCVH 4ZFOA 5I8EB 1QHOA 2QHRL 2XZCH 3QIUB 4OFPA 3PWPA 1CDBA 4LPCA 2DQEH 3WNMA 1K4CA 5EU4A 2LQRA 1PYWA 3MBXL 4X80L 2HTKD 3MRPA 3G6DL 3BDBA 5C7XL 4PJ5D 5DF0A 1S8DB 5GGSY 4KKCD 1N4XL 4KY1H 3QXAB 5DZNA 5KANI 1KIPA 2IC2A 4B5EA 5F1NA 1EK3A 5I8OL 3E3QE 1WTGT 2J8OA 3LCYA 4JO1H 2YA1A 4RNRA 3T77A 3C09B 3UBXB 2ZJSL 4JFQB 1INDH 5HDLA 2NXZD 5HGAB 4NO3A 4WO4A 4DKDC 1RI8A 4DTGL 3CXDH 3LV3B 5GS0C 3IDIA 2FJFA 4FZ8L 3STZB 4ELMF 1ACZA 1MJJA 2V17H 4P46C 1SYVB 1ZHLB 5F21B 4AMKL 1TENA 3D2UD 3V0VA 5EPMB 4JRXA 1X5YA 3NCYP 1NCTA 1K85A 3J8F7 3O3AB 4WIQA 2JJUA 2YA2A 2NX5A 3HC4H 1P9MA 5C09A 4HV8A 1YPZF 1WBXB 1KTDB 2Y1VA 5IVZA 5ELIA 5DK2B 1YYMH 4YDVA 5IW1A 3GUTB 4A6YA 4G6JH 1L0XA 2BOCB 2CKBL 3ETBF 3GJFB 1WIPA 2ID5A 3HE7D 5LWYL 2AAVA 4K94L 1C5CL 2ZOLA 4NWTH 3PXHA 1G7QB 2BOBA 5CJ8A 5JW3H 4NKIL 3B9EA 1PG7W 3LQAL 5DSCA 1FGVL 2OP4L 5GIRA 4P9HL 2X70A 5I1EH 5JDSA 1TTFA 4OFYD 1A0QL 3B9VA 1JGLL 4YWGH 3WKML 4NC2B 5E70A 3V52H 4WW1A 1A02N 4MA3B 3EOBA 1IVLA 5C0CA 3D39B 3VRIB 4KKBD 3T0VA 1U3HA 5JIHA 5LJYH 3V4UL 3WMSA 2CLVB 3VD9A 1ZTXL 2GEEA 3O2WH 1E6JL 3HS0B 1KLUB 3GI9L 4TVPE 3RZCB 4NYLA 2DQUL 1T4KB 3PGCA 4WFED 5CD5C 3EW3B 4JPWH 3DSFL 4J7RA 4NNXA 4G7VL 4BYHA 4DEPC 1N5AA 3WYRA 1ZMYA 5BJTA 5I1DB 4J1UB 1CTNA 4HKJA 3CLEH 4X6BA 4WY7H 5C0BA 3V6FB 1RSFA 5MEOA 2PYFB 1ZWIB 5KVFL 2P8PA 4YDJA 3O8XC 1FVCA 2GI7A 3BQUA 4PJDF 4DVBA 5DXWA 2EE2A 4LFHD 5HYSB 3UO1L 4X7TA 4IS6A 1H8SA 2RR3A 2EDHA 5D7KE 5CD3A 1F11A 2Q87A 5M94B 4XWOC 1YY9D 4CVZB 5SV3A 3BO8B 4Y5VC 3VJ6B 1L6ZA 3MRKB 5HI5C 2FH8A 4X7CC 3RWDA 5IROA 1C5DA 4MVBC 4ODXA 1Q9WB 5J6GA 4HUUA 2GY5A 1X5GA 3SN6N 3NABH 2Z8VC 4EN3C 4KI5C 1SM3L 1JHKH 4PJHB 5FV1L 2F54A 4G8IA 1T1WA 4HWBA 4XAKE 2JK5A 4QF1B 2HG5A 2XNAB 4KTDL 2VR9A 4F2MB 5KVGH 3P40A 4DVRH 4V1DD 3KXFA 5GZNC 1QFWL 3ARSA 3ILPB 2LVCA 2R0WH 3EYVA 1U92B 3Q6FB 5EOTA 3N06B 2HLAA 1TJHH 3C6LC 2V9TA 2VDQH 4JPKL 4XPBL 3VI4E 1X5JA 4M5YL 3TO4C 2H32H 3DXAD 2BRRL 2Y4SA 2DQHL 4Q9QL 3RL1B 2P7TB 4JG1L 3H3BC 1YYLH 4QHKI 2IPUK 3VWKD 1F42A 3WNPA 3GSUB 4XAWL 4KMLB 2EDJA 4ZO8A 1T22A 5ILTL 1KENL 4YHLH 1CLCA 3MNZA 4Y4FD 2XTJC 1T6WA 4ZXBD 4QXGH 4BQ6A 5MERA 3HNVL 3LEYH 4DOHB 5J3HC 3ARBC 3QUXC 3DVNB 4OZFA 1DQJB 4PJEF 2CDEB 5EC1B 4XCCL 4F7EB 3QUYB 4BELD 1OT2A 1RHHA 3PG2A 1YEGH 2WLZA 4KUCD 4R8WL 4JG0H 1B6UA 5GS1B 5E2UH 2DTML 2BVOB 1A7OH 4NQDB 3MRJB 2APWA 2NXYB 1XF5A 4L8SC 1A4KA 1GOGA 3QO0B 4FTVD 4HW6A 4JO2L 4FS0A 3ZDYF 4EXPX 1RV6X 1F2QA 4Y16C 5HI3C 5B3JF 4I4WB 2HP4A 2ZCLH 5GGTA 1D9KA 4R2GC 3C6SB 5B21A 4YXHL 4K8RH 3ROOB 3UYRL 1S7WA 4LGSB 5FUCE 4ALAH 4G8EB 2H8PA 4MA7H 2C7UA 1E4XH 2ZUTA 4ELMA 4JFFD 4YR6B 5CZVL 1AD0B 4RX4A 2PTUA 1CLOH 5FCUH 3HZKA 5TE6L 3OJDA 2CK0H 4N0FA 1QP1A 4J4PA 2JIXD 1EXUA 5EZLA 5DDHA 4XMKH 1S7QB 1Z3GL 2BFVH 2ESVD 4A6YH 1YPZA 1FRGL 4XVUC 3IXTB 2EE9A 2X9WA 3PWPD 2HTLD 1WF5A 2FEDC 2CSPA 1VFOA 1BFOA 4ZSOA 3HZYA 4APQA 4F7TA 3TIEA 4ZUVB 3PWVA 2AJ3B 2BDNH 5F70A 4NJAH 4NC1C 3EUUA 3K81A 4CN6A 1T21A 2Y06L 3TNMA 3GKWL 1BF2A 3HUJE 3OXRB 3PWUB 5EA0L 2R29H 4YE4H 2ZG1A 4NHCL 4PRIB 1I8KA 4LSQH 3WIIH 5E9DE 1YNTB 3VGFA 2H3NA 2C3HA 3ES6B 1OM3L 4K8RD 4BFIA 2F9BT 3PJSB 5IK3A 3HE6B 3T1FA 3U4EA 1OF2B 3WFHB 1KYOJ 5IB3A 1FFRA 1DEDA 4HCRA 2DQFB 3WD5L 1OCWL 4YC2B 4DAGH 1KJMA 4UT7L 1XR9A 4JRXD 2H9GB 4KKLC 3RIAF 2R23B 1YEIL 3QH3A 2GJ6A 4J3UA 1DE4B 4Y5XC 1PVHA 1WQVT 4KK8D 2GW5A 2NX5D 4X4YA 5C09D 1T7VA 5D7JB 3IFOB 2NY6D 4MD0A 1IEBB 1QVOB 4PLKC 3MRRB 2GTZB 4HWZB 4N0UE 1OAYH 1V7NH 3VH8G 4FNLH 3IXAA 4RMTA 5EIIA 2OL3A 1NMCB 1JGUL 4IEFB 3ULVF 5E8PB 4PJDA 2OTUB 4YHZL 1BVLB 5FYLL 3RVUC 1KCSH 3EDEA 3MLUH 3O4OB 4CADA 5I19L 3QI9C 5JLZA 4DUXA 4XH2A 2FIKA 4H1LA 1S9WB 3D85A 3LKSB 2OTPA 1KOAA 5DVOA 3ARGA 4Z7QE 1RIUH 5D9SA 1IKNA 3OB0H 1UKSA 3SKNB 1CD9B 3RTQA 3OB0K 3ARVA 4EI5A 1OGTA 5C0CD 5MEQA 1KNOA 1QFPA 3IAGC 3B9KC 4HWBH 4ZTOH 1U3HD 2I5YL 5E2VL 3CX5K 3NCJL 1J8HE 5DEGA 1BIIA 2UVEA 4P2CG 5DQJA 4Q9RL 4MCYA 1EJ6A 4G8FB 3I6KA 3RWEB 3K3QA 4R7DB 4JZJB 4ZPTA 3SO3B 3QIUC 4Z9KB 3U30B 1QBMH 3MROB 3DETD 3ISWA 4JQXC 1WCQA 2VXQL 3V6ZA 3LS5H 1Y18A 3MRCA 5F97E 1WT5A 4WHYG 2IBGA 3CFJB 5C0AB 1FZMB 5T3XH 4RFOH 5C0BD 1QTYT 1ZT1A 1HH9A 3TLRA 3JBG7 4WGVB 1TFHA 2YN3A 3BD5A 2OZ4A 5C2BL 3BQUD 4D8PA 2AK1H 4OGAC 1U8QB 1R5IA 1OTTC 4L4VB 2R9HC 3GMQA 4LPTA 3CFEA 2NNAA 5LGHH 1PZ5A 3P0GB 4ZD3L 3C09C 2I26N 3Q48A 1XCTB 1OGAB 1VESA 3DMMA 4OZFH 3ZLQC 5TE4L 4X98A 3ARZA 5A2JH 2VWEE 1MFEH 1UVQB 3SPVA 2I9TB 2M26A 4MD4A 4TNWK 2BMKA 4PJEA 2I25N 1AGBB 1E4JA 2OMNA 3C08H 1BOGB 4KTEH 5AWNH 2F54D 3OAUL 3QWOA 3UCRA 5J1TC 1ZHKB 1DR9A 1AH1A 4IJ3B 5CEXA 5CLWA 4NQEB 3CZJA 2BVUA 5BZWA 4QTIL 5KSBF 3KXFD 1DBMH 3LIZL 1HHIA 2BK8A 1Q0XH 3S7GA 3H2WA 3OGOE 3C5ZB 2A6DB 5GGTH 4MXQD 5J1SC 5T3XD 1AR1D 3C5SA 1D5ZB 3MUJA 3PV6B 4ERSH 5A2FA 3FRPA 3MV7B 1NAKL 2YD8A 4FQ2L 2ZSWA 4HLJA 2YPLE 1Z9LA 3HMXA 4FQQB 5F1OB 4NZRL 3SBWC 3DVIA 4ODSL 1S7TB 1J87A 3FN3A 5EIVA 2E9WA 1BQHA 4LPUA 4ZUTA 2HT3C 3CFDA 3FO9A 4H0IA 3QEQB 1UGNA 3VD4A 1KN4L 1NKRA 1EAJA 3AFLA 1EO8H 2RB8A 1KGCE 4D0CB 2B2XL 3BWAB 5TQ2H 2FD6H 2VABB 2C26A 2HJFB 1W2KT 5C6TL 5CUSH 4JFDA 5EO9A 2NY1B 5J6HA 5DR5H 4KTYA 3RZCC 3HAEA 1RJLA 4L9LA 3P30H 4NJ9L 4QY8B 5F9JB 3VH8B 3U2SB 1BD2E 2BNRA 2GJ6E 1R24A 1X44A 4FFVD 4A2MA 2IH1B 1BMGA 3VCLA 1F00I 3SGKA 2F15A 3BUYA 4DKEL 4LCCB 4ZNEA 3T1WA 5T33H 4O2CA 5I17B 3AM8C 1WWAX 3S37H 5D7IB 2DQIH 4MAUL 1J86A 4K7PY 3ARWA 1WISA 2I9LB 3N0PB 4KI5F 3RRQA 5I71B 4GW5B 1LE9A 2BSED 4UDUA 1GPOH 3F62A 4G6KH 4KK5C 4OUUA 1YEFH 4FQHB 2F8XC 1DBBL 3FQXB 4PJDE 4ZFZB 5JW4M 1D9KD 4MJ5A 4NGHH 4XXCC 2EYRB 1A6VL 3S4SG 5FAAA 4FXGB 5IM7B 5CCKH 3JUZA 5D2LB 4HIIA 2MMXA 1YUHB 4BSWA 1A47A 4HCRH 5L6YL 4Z5RB 3CVHL 3ZDZE 3WO3B 2Y23A 2ZZUT 4RX4D 4HKZB 2X4PA 4PJAF 4XNZB 3L3IB 5BZDB 3MLWH 4J4PD 3UPRB 1URLA 3NAAH 4HUNB 5T1DL 4JFXA 4X6EB 1XGYH 4XP6L 3BP6A 5I1IL 3I9GH 5HJ3A 4U1SB 1J5OL 1FAIL 3EYUL 2UVFA 1ORQB 5BXFB 3HMWL 4MAYB 4NO2B 4QYOA 1ZAGA 3SY0B 3BW9A 2OL3H 5IV2A 3L3GB 1KPRB 4APQD 3FOLB 4XP1H 1KTLA 5GGUA 3A6CH 3QXVA 2X44D 1KB5A 2HLFC 3FRUB 3BP5A