2CR6A

Solution structure of the ig domain (2998-3100) of human obscurin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
115
structure length
115
Chain Sequence
b'GSSGSSGLVQGRRVHIIEDLEDVDVQEGSSATFRCRISPANYEPVHWFLDKTPLHANELNEIDAQPGGYHVLTLRQLALKDSGTIYFEAGDQRASAALRVTEKPSVFSRSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA1556 protein
publication title Solution structure of the Ig domain (2998-3100) of human obscurin
rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 14
structure length 115
sequence length 115
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cr6A01
1T22B 4QXUL 3SGDI 3GSQB 4PJDB 2ADJA 5C0BD 4HPYL 1I85A 2YSSB 3GSOA 4JKPL 4NKDA 3DO7B 1TLKA 5HVWA 4QT5A 3CJJA 4QLRA 4WEUD 5IHUH 4R97B 1Z9SA 4ZFZB 1DN2A 3D3VA 2X7LB 3WFEH 4BSVB 1N59A 2OTUB 3GRWH 5ESVB 1S7UB 3KPSA 3L95A 3C08H 5DEGB 2CLVB 2VXUL 2FZ3B 4MAYC 3CSGA 4JN1H 5DF0A 5BO1L 3KR3H 4XPAL 1RUMH 5T3XE 4G80B 5C9JB 1IC7L 4CNIB 4NUGH 1A0QH 5FCUL 1MFDH 5EBWB 5TQ2H 2JELH 4MLSA 5IP4A 5C0FA 3ARDC 1CGSL 2VLKE 3BESR 2FH8A 5KSBF 4FQJL 5JO5B 3A6CH 5J8OA 5IB4B 2CLRA 3RWGB 2OI9C 2G2RA 3FFDB 5JHLH 2R0ZH 4YDJA 2CDFB 2YUVA 3QDGD 2P5EE 5E4EB 3PWUA 4UTAH 3WNPA 5HGHB 2WIIB 4M93C 3E8UL 5I19L 4JZJC 4PGBB 5IM7A 2ORBH 1QFUL 1M1SA 3MLYL 1A5FH 5LG1A 4X8XA 2ZOLA 2IFGA 4ORGA 4PJ5E 1V7NL 1AGBA 1PKQA 1Q0XH 3DETC 2HFFA 4KQ4L 3STBA 3BKMH 5GS3A 4KTYA 1JIBA 1XIWD 3MNZA 1DUYB 1CDYA 1KJ2B 1Z3GH 1T20A 3NFNB 3U9PL 3C87A 5DMGD 1OL0A 4J4PA 1OAXL 2CO6B 1K8DA 4LLDB 4HF5H 1NMBH 3EDJA 3B9VA 2BNUA 3UPCA 1A1OB 1W2KT 5DD1H 4P59H 3RU8L 2FGWL 4XTRD 4I2XA 5CEZE 4ODHH 1CXKA 4UQ2A 1HI6B 3ZYOA 4PRID 4G6JH 1UKTA 4UUJA 1OY3B 2UYLB 3PG2A 4JHBA 4PGEA 4XNZC 3L3JB 3WS6C 4YR6A 2BXZA 4MD4B 5IOPB 3GO1L 1MRCH 4MAUL 5B3JE 3ULSA 4P46C 2VIRA 5DJDB 4GRWB 1ACYL 4U49A 3R8BB 5E5MA 3STZA 3QEUB 4YHPA 1YJDH 4N0RA 3TPUB 1PY9A 4YHIB 2R0WH 4UOJA 5DD0L 1JL8A 3HPJA 1ZHNA 4YHOH 1OAYL 1JBJA 3TYGL 2EC9T 1CGXA 4HAGA 5IMOB 2GEEA 3GJFK 4GG6E 2GJ6A 2EDBA 2IAND 5HDQH 3DMMB 4M7KH 3DLQR 2N7AA 3RBGA 1KCKA 1N2RB 3TNNA 4U1SB 2IGFH 3T0WA 2IPUK 2VAAA 4WI7A 2NW2B 1BVLB 2WBJB 3X3GH 2R56H 4FXGA 4J8RA 4WW2B 3LEYH 4PJAE 1NC4B 4HV8B 5GS1C 2GITA 1K9TA 3QIBC 3U1SL 5E8DH 4X4YA 4L29A 3UZQA 3MREB 4LF3B 2OL3A 5EBMA 4XNUH 3UDWC 4P57A 1C12B 5K33A 3RWIA 3FQTA 4P9MH 5AWNL 3MR9A 1UKSA 3QSKB 3T1FB 4U6VL 1QO3B 2D4FA 3GSUB 4RA3A 1SY6H 2V5RA 4K7PL 2E27H 4NQEE 4KGJA 1FO0A 2GK0B 3HI1B 3RVXC 1K5NA 5HYFA 2A6IA 1NANI 2HJLA 3Q0HA 4TSBL 2NY2D 2Z31A 1D5MB 1X9QA 5HGGS 5DA4A 1FC2D 3U4AA 2O5ZH 2UVFA 1WBXB 4XP4L 5DUPH 4P5KA 2QJDA 2V2XB 2P43B 4NQUA 3V5DA 2FBJH 5FA4B 4N9GA 1FH5H 2XA8H 4C83B 5TJWK 2J3SA 4TSCL 3U9UA 2P5WE 3QRFM 4F57L 1BF8A 1FL3A 3U0WL 1RJYA 4UDUA 1WZKA 1CDUA 1WAAA 5CWSB 5DMIH 3PWJA 2DN7A 5D7IF 3OB0H 5D1QA 5HVHB 3HUJB 3BQUC 3MBXH 1RY7B 1P6FA 4Y4HB 2HTLD 4P3WA 5KW9H 3M8OL 5KVDL 3MV7D 2Q7NA 5A16A 5IWLA 2R0LH 1F45A 2MNUA 3UO1H 2DQCH 2NNAA 5I74C 1AI1L 1JJUA 2D7OA 2G9HB 4M5ZL 2DLFH 3OB8A 4ZQKB 4ZPTB 5J11B 1QFWI 3CGTA 4K3JH 1NMAH 1G7PB 4NQCD 3RVTD 2XG5A 4PJGB 4GW4B 4ACPA 2OP4H 5E6ID 4IRJD 4RZCB 3BH8A 2IPUG 1I9RH 3VFUA 4OZIB 3CFBA 2HH0H 4WFGD 3T0AA 2OXHA 2VWEC 2JJWA 1Q0YH 4Q9RL 1PX4A 3QQ9C 4XVUD 4XBPB 3UTTA 4M6AA 3MRMA 4HJ0D 3ZDYF 3WFBL 3B4NA 5DHVH 1F2QA 3D85B 2QQLL 3C60D 1PVHA 2H2SC 3NZHL 3LQAC 2NXZD 4HPOL 4KKCD 4WENB 4Y1AE 3QR2A 4WI3A 4LSUL 4OCRH 3CDGB 3JZ7A 4OFDA 1OTUC 1IAOB 1MY5A 4OLYL 4HX1A 4OBSA 4K8RC 2VUOA 3R8QA 1LP9B 3D39B 1WVZA 1U93B 5D7JC 4MDIB 3P40A 3B2UC 1L0XA 1BIIB 1OSZB 1YPZF 5E2WH 1XZ0A 4EI6B 1VENA 2EKJA 1RURH 3U30C 1UM6L 1YZZA 5D2LE 4JZNA 1ZLVH 2JIXA 4WFED 5FKAB 5GGUA 4LLMA 2WUCL 2ZPKH 1RJZA 4NN7B 1D6EB 3MRQB 5IJVB 4QNPE 3MV11 3NIDF 4GKNB 3P4MB 4JO1L 4LLUB 1KIPA 2FATH 5EU4B 2HKHH 3IJHA 4IS6B 3WNKA 5IV2B 1JTTA 2PO6A 1GPOH 5DUMH 5K9KA 1B4JL 4MZ2A 3L3IB 3MJ9L 3ZE0F 1VKXB 4GG6A 4O5LH 2QSCH 5F6IB 3OAUH 2ED9A 5IMMB 1QFWL 4QRUB 4APQC 6FABH 3P4NA 3B6SB 3Q2CA 4HIIB 4BFEA 1WBYB 5B38G 1DLFL 5BZDA 5DTFB 1VPOL 3V8OA 5IFAL 3PL6B 2X89A 5DD5L 3OX8B 4CW1B 3VFWB 1KCSH 1MH5A 2XTLA 5GZOC 1FZJA 5HY9A 4DKDC 3V4UH 2DQTL 5E99H 3TCLB 1JGUL 2HT3C 3H9SA 4JHWH 5GIRA 1RZ8A 5CP3A 4HIEA 3V5HA 5MEOA 2BRRH 3ETBF 1FDLH 1O7VA 2OR9L 2NY1C 1TVDA 4L4VE 2BSED 1WCQA 1UG9A 3MO1B 4HGMA 5EU7C 2VDOL 2EXYC 3MUY1 1TTUA 4QCIA 1OHQA 3L7EA 1FLRH 3V6OC 5FO8B 5HDOA 3I6GB 3TWCL 4N68A 4Z7NE 3RDTB 3DUSA 4QRRD 2EYRB 4HWZB 5D7SL 4XAWL 3KPMA 1JHKL 4NWUL 5T1LA 2AJXH 2VXVH 1JZ2A 2DQEH 4LVHC 4NJ9H 35C8L 5F3HA 1YDPB 1T1XA 2P5WA 3GMOB 4Y19B 1ED3A 5CZVH 4N1HB 3E2HC 1JNLL 1NCCL 4HBCH 3KYKL 2HG5B 2NY3C 1MJ8H 4BA8A 1ZT4A 1PBYA 3BT2L 1S7QB 5DHYB 4FQIL 3MUZ1 4OKVA 2P8MA 4RX4D 5ANMB 4XP5L 1YEEH 2CD0A 4CADB 3QPXL 5IESH 4TTGA 1DQLH 2PCPB 4RMQA 1CDIA 4RFNB 1AJ7H 4U1MA 3FT4B 1MWAL 1LNUA 2QBWA 3CVIH 5FK9A 5I30H 1FORL 1T03H 3OKEB 1MVFA 4QHUA 3OGCB 3S35L 5LBSH 3PWLB 4W4OA 4RAUA 3VD3A 3SDAD 3HNVL 3RUGB 5I1EL 5LXGL 4L3CA 3OKKA 1HXMA 3QXWA 4M61B 4PJ7E 25C8L 1EAJA 1F4WH 1PFCA 3DPBA 5DDHA 3DRTB 1M05B 4DVRL 3O8XD 3QDMD 3C8DA 4RGNB 4OCSH 4WU5A 1KJVB 3FQRA 4KPHL 5IQ9A 1FAKT 5D7LB 3QFJB 4ZOCA 3ZLQC 2C7UA 1UJ3A 4D3CL 1DEEB 3GBMH 3IAPA 1G7JB 2C3XA 4ZS6D 1GGIL 4ZDHB 1IVLA 2UUDH 4YAQB 4Y1AA 4CU6A 2V5YA 2I07A 1P53A 3D0LB 1Y18A 1KN2L 4TULL 3QNYB 4LRNH 2J8OA 5AD0A 2ADGB 1XR9A 3IAGC 2IPKB 3QO0A 4PJ9D 1A14L 2PTTA 4OZFG 3GMQB 3MYZA 2CMRH 2COQA 1K4CA 2L4OA 5CIPH 4ZS7H 1IAMA 1OM3H 5KSAC 3P9LB 4OTXL 5T1MB 5D2LA 1F13A 1INDH 1RV6X 4GMTH 3U4BL 3DX6B 3X12B 5E8EA 4PD4K 1YC8A 2J8UF 4X6BA 4XI5C 3WUWB 4PRPD 3KXFA 3CXHK 3MMEA 5D7KD 3SE8L 4KU1A 1UT9A 1VFAB 1Q9OA 5DGRA 4AIOA 5BMFL 2EDOA 3DTXA 3WEXB 4HKBA 3S96B 3O6KL 1BEYH 4IOIB 4YHLH 1M6OB 4X8JB 4HXAH 2FGZA 4QTIL 4KK5D 3M1BB 3S36L 5BQ7B 1MQ8A 1AGFB 5C0AD 5IG7A 1Q94B 4PV8A 3O2DA 2YRZA 2LTQC 1NGPH 4OZGB 1P4IL 4B53A 5KAQF 4KUCF 4BSWB 1UA6H 3QHZL 4RAHA 5JW4N 2Y36H 5D1XA 1XR8A 3VW3L 1IQDB 4GQ9L 3G9VA 1XCTB 5EG6C 5FGSA 2RBLA 5EU6E 2J6EA 4FQCL 3VXUA 4XMLL 2VYRE 4HJGA 4PLKD 1UB5B 3T0ED 4FQQA 3VFGH 1J0IA 2CGRH 4Y4KA 2YUWA 4RMRA 4LASL 2JJSC 1EBAA 4JG0H 4HIHA 3NCCB 3LQAH 1FFQA 4PRHE 5KVFH 2R2HA 5EUOB 1TJIH 3DVGA 2H3NA 1CFSB 5FYKD 4PUBH 1TQBB 4M02A 2A6KB 5E6YA 3H7LA 1IEAA 3LKNB 4G6FB 2MJWA 1RZKL 4BZ1L 3WKML 4HK3N 2AABH 5FGBA 5C0NC 5JORA 3PNWB 1G6RH 3BRDA 2ATKB 1X5AA 2V7NA 1FBIH 4O2CA 4F33A 4YXKL 1I9IH 4HH9B 1G7LA 4MJIB 5K9OA 2Q76A 1S7RB 4NKIH 2W65B 3FRPG 3MOAH 3S6CA 4WEBL 1FGNH 1X7QA 3RWEB 2BOBA 5I0ZA 2BOCB 4U1KA 4OZHF 4W70A 5LAXB 3RGHA 1NCUA 4WY7H 4NZRL 3ARRA 4ISVA 1NC2A 5CCKH 1BD2D 1NEZB 4JFHD 1AHWB 1OPGL 2APWA 3PWVB 2G60H 3DX8A 3WJLA 1KBGH 4H0IA 4X6CB 3QIUB 1JWMA 1EO7A 5HJ3A 3Q6GL 4G9FB 3UXFA 2DLGA 3MRNA 5EDXA 2Z35B 1NBQA 4QXGH 3LQZA 3UAJC 4M1DH 2MTPA 4YPGA 4PJ7A 3QXDB 2W60B 4OI8A 5IGXH 5JPMA 4HFWB 1RUAL 4WFFD 1CBVH 5I1KH 3GJFA 4P3CH 3BKCH 3TBWA 4ELMF 1BOYA 5CBEA 2ADFH 5MEQB 3NOIA 1A4KA 3B9KB 3LMJH 1JPGB 3SPVB 4KI5D 4FMFA 3CVHB 3MJ7B 2ILLA 4Z7WB 1VEPA 1DSFH 4W4NA 1I1CA 4LHJB 1DLHA 3DURB 3LD8C 3TGXA 2NYYC 2OTWA 4JAMA 2YD2A 4ZUVB 3CDFA 5DFVC 1DANU 2QQQA 4X6FB 1NLBL 2DWDB 2YPKB 1B6DA 2AI0L 4JM2B 3CUPA 2I5YL 3NH7H 2IJ0C 4P4KC 3MLUH 3KPNB 2YD6A 3G6JB 1X5JA 2X4UB 4MGXA 5BVJB 3QJFB 1J8HD 1PSKL 2VDLL 3IDGA 3HLAA 4Y5XC 4E0RB 2Q87A 2Y07H 2BY3A 4RRPA 1QYGL 1UJTA 5I1HH 1EEZA 1MREL 4GRLD 5ESQB 5TDNB 1HHGB 4Y16A 1V3JA 3LEVL 3P0YH 4KRMB 2MCPL 1NBZB 3SCMD 2B2XH 5FYJH 3HI6L 2NW3A 4F37F 3WO4C 2XRAH 1C08A 4KKAD 3G5XB 1KG0A 1RZIB 2HRLA 3TYFB 4DGVH 3BGMA 1EEQA 4V1DE 5C0DA 3RJDA 1HEZA 4H88H 2EZ0C 5D5MF 5J6HB 1S7VA 3CFKA 3RKDD 4YZFF 3TBTA 3AC0A 3GRWL 1JN6B 3BX7C 4Y8DC 2GQHA 3VRIA 3VXPA 3C08L 3IFLL 5JOPD 5IB3B 1GSMA 4P5MB 3KR3L 3U79A 5EU6A 2C3VB 3DVNB 4PJFA 5CJQH 5CGYD 4F7TB 2YUZA 1CQKA 4YHZL 1I8MB 4PJDE 1IGYA 1P7QA 4MB5A 1V3MA 2OTPA 2OR8A 5DMKA 3T8XA 2EH7H 2JJTC 3W82A 2P47B 3MA9L 4NO2A 4PRHA 4F7EB 4KJWC 2IEPA 3A6CL 4NBZB 3EOAA 5E24E 1YEKL 4OFYA 2HYMA 1UYWL 1I3VA 2AJUH 1FE8H 4LNRA 3VGDA 2R0ZL 1I85C 3OF6D 3UYOD 2WBJC 1U8QB 3FB6B 1UEYA 2AK4E 4WW2C 4LSRH 8FABA 4OSUH 2XA3A 1DBKH 5MHSD 3HZMB 1A6UL 1UWEH 1CLOL 1A5FL 5IVZA 5C09B 4YGVA 1MAKA 2OK0H 4QRSB 2AJ3B 2FHCA 4MSWA 2O5XL 1CDCA 4M6NL 4G42B 5DQ9A 1IGCL 4KV5F 3FOLB 2X1WL 3BN9D 4FTVB 3LRSA 2VXTH 1SJHA 3VDBA 2YS4A 3RL2A 1IKFH 4FABL 1FCGA 2MKLC 5CEXB 4PY8J 3DGGB 1TZGH 4YUEL 1IGIL 1HKLL 5L88L 3OKYA 1PGRB 2Y9RT 3UTSD 1RULH 3EYUH 4BQ6A 5ETUA 5KSBA 5JXEA 3VMOA 2GW5A 5HHMD 1MSPA 3SN6N 4QHNA 3VGEA 4Q9BA 5DJAA 3B5TA 3RY5A 4I0KA 5JR1L 1JWUB 1I3RB 1EEYB 1LK3H 4Y5YB 3LN5B 2R0WL 4HWEH 1GYAA 4I3RL 4WVRA 3F7PC 3NCJL 3NFPB 4O9HH 3ZE1F 3OWEA 3VFSB 1QA9A 3DV4B 4LVEA 5DGQA 4UILH 3I9GH 2H8PA 1CK0L 1EJ6A 4OD2B 2GAZB 2XZCH 4NZTH 3FB8A 5DC9B 4J4PC 5I1CH 4X5WA 1WWBX 3BD3A 4LP4A 3QZWG 3E6FB 1WFOA 3BIKA 4S1SL 5FKPB 1JGVL 1HSAB 4ELKA 2C4XA 3EYOB 2VDRH 2XY1A 4KXZI 2Z91B 1WLHA 4LVOB 4HWBA 3KGRA 4P5TD 4JFEB 5DVLA 1P2CA 4JE4B 4GUPA 5H2BB 1MQKH 1JGLL 1RJLA 3IU3B 1GXEA 1F8TL 3GGWA 1MIMH 2R39A 5F7EL 5LJYH 3AUVA 4F3FB 1C5DA 1OT2A 3D0VA 5J06A 2A73B 4IDJL 4N8VG 4Q6IB 4OV5A 2YUXA 1G0YR 1MPAH 3NIDE 1AFVH 1QSFA 2E7CA 5KAQG 3QISA 5DUPL 4YPJA 5B38B 3EDDA 3BZEA 2I60H 2XOTA 3BIBX 3MRFB 1XF4A 3IJYB 3OKMB 3M45A 1EEUA 2BHUA 4JCLA 3QUMA 1X5IA 4QTHA 3N1MC 4YHNA 1SYSA 1CFNB 4WO4D 4V1DA 1J7VR 1CLZL 5DMIL 5C08A 3S5LB 1IJ9A 3MCG1 4KRPC 1WEJH 4ODBD 3C2SA 3SE4A 1CD9B 4NZUH 5HYJA 2Z8RA 1WZ1H 4TVPL 1JYVA 4OM0H 2J88L 2Q20A 3O2VH 5CKGA 1A3LH 1CIUA 4RDQF 2DLFL 2VLLA 5C0EB 3MRIB 3RZCB 2ATPB 4K3JL 3KPRE 5F21B 2X6MA 1MJ7H 4K2UH 2R2CA 3VWKD 4QF1A 4XCFL 5DO2D 3EKCA 4RAVB 2OP4L 3ELAT 1JHTB 1N0XH 1N8ZB 2AEQH 5FA3B 1S9YA 3VFVA 1EHNA 3N1GC 5GGQL 2R2EA 3HUJE 3L5WA 1GZQB 2BFVH 2VO5A 3Q48A 3P9MA 4MXVE 3VWJA 4DN3H 1DE4A 3HR6A 1K8IB 2AK4A 3PL6C 3CMOH 1H5BA 1JK8A 1Q0YL 3BPCA 3DI2B 2OZ4H 3GI9L 5EPMA 4JKWA 3TN0D 1INEL 3DIFB 2CKNA 5C3LD 1U8KB 3HFML 4GKZA 2X9WA 2Z4QA 5H35B 3QDJB 4GBXB 4GO6B 1RZJC 3NPZB 5D1QC 2KH2B 1KCUL 1F4AA 2LAAA 3W5NA 3FT2A 4L3ED 1R5WB 1XEDA 4F37K 1KJ2H 2YC1B 4XZUA 4PJGE 5ALCH 5IWLC 3HAEA 4P2QD 5DURD 3FQUB 5IHZA 2C1PA 5M7QA 4QHKJ 3ZKNC 5HVFB 4OZIE 4F7MA 5DT1L 2A1WH 1QR1A 3ARFA 3LKRA 4K3EH 3HR5B 5C07B 5FO7A 1U95A 1LO5B 1B6UA 5EN2B 4X9GA 5MP6H 2V17L 4C56A 3CPLA 5E2WL 3FRPA 2YKLH 2MHAB 5DJYB 2VDMH 2GSIA 5B8CA 1D5XB 1OWWA 4OAWA 2A0LD 2E7HA 3QEQD 4GRWH 2IPTL 4QRPD 3V4PL 3K2UL 3DROB 4PJIF 1JI2A 1VFOA 2DMCA 4R26H 4UIKL 1LP9E 3D39E 3U46B 4Y7MA 5I1JL 5D2NA 2HVJA 3ROOA 2HKHL 5IB2A 2R9HD 4B41A 3TBYB 5T1KA 1KC5L 1GPOL 3LKQA 4UU9B 2F54B 1S7XB 5C0GA 3C6LB 2E9JA 1U8LB 2WM0A 4GAJH 3A67L 1Y6NR 4MJ6A 3IDMB 1H0DB 2NY0D 4H1LG 4XCYA 1WC7A 5EOCH 5JUEL 3ULVL 4OZFB 4HIXL 4JY6B 2IBGA 3TZVA 3GSVA 3P0GB 4RGMC 1JV5A 1NCWH 1T5WA 1Y6KR 3BP5A 1A6TA 4LCCB 1U8OA 1T0MA 4HHAB 3U36A 2Y5EA 3MV9D 3N9GL 4I9WD 1FZKB 2A6DB 4OLZH 4Z7VB 3QWRD 5E99L 1YPZA 1NJ9A 4JFPA 3NIFF 5HSFA 2PW1A 3JV5A 1S7SB 4FN0A 4E9LA 5F88A 1RZ7H 3WE6A 2NY7H 2D7TL 3CZFA 4JZOB 2JCCF 2YPLA 4GAFB 1T04B 5GSVA 1KJMB 3FN9A 4FFWD 1F4YH 4MA8H 5DEZA 4OIIH 3ARBA 5GISH 3CD4A 4NIKB 5EZLA 1P1ZA 1XT5A 3MZGB 1SBSH 1E0OB 3OG6B 2PO6C 1I1FB 3SO3B 5I1IL 4ZNEE 3HS0B 3HKFA 3JSSA 3WS3A 4WI9A 1PEZA 5EO0A 2FX7H 3QDGB 4XT1C 4ZXBA 1LD9B 2DQUL 5MENA 1NGQH 1AC6A 4NM8H 3OKDB 3C5ZD 1WWWX 1JWSA 1AGEB 1ZVYA 3TO2B 5E8NB 5KN5A 2VXVL 4AT6A 2VZOA 3KPQB 1HHJA 4NJ9L 1U8PB 1MLCB 5CZVL 1NFKA 2AXGA 4G6MH 1NDGB 1MCKA 4LSVH 5DJXB 1ZA3B 5L7XL 1V5JA 1L9MA 4ODUA 4ZTPH 1XGQA 1U36A 1E4XH 2J1KA 3PJSB 1PKOA 1PLGH 2Y06H 3QWOA 5F1IB 4G7YL 3V6BR 1LEGA 4MA3A 4Z7OE 3WHE0 2XZQL 1NH6A 3FQNA 4D0BA 4LIQE 4EXKA 3JWOC 3CVIL 4K7PX 4POYA 3ARUA 4XPHL 1G9EA 2DOCA 4WEMB 2CKBB 4OD3H 2P8PB 3TLRA 4GRMA 3KPRA 2WAHA 1BBDH 2Z92B 3MUGA 3P2TA 4JRYB 1R3LA 3BVNA 3OV6A 1K85A 5J56B 3FHQA 2EDQA 2CXKA 3ARDD 4HG4K 5E56A 1U8JB 3QYCA 3LV3A 3WMSA 4AY0A 1R24A 5C8JA 4QOKB 4MCZA 2XG4A 4HUXA 1WQVT 5FUOH 4LHUD 3MNVB 2Q6WA 4J6RL 2DIJA 4BK4A 2FCBA 1FFPB 4YFDB 1ADQL 4Z0XB 1U2CA 4NHUB 4S10A 2I25N 4HMDA 5GRUH 4XC3H 3I50H 5C2BL 1IFHH 4LCWA 2IANB 2PYFB 3TJEL 1MCQA 4JVWA 5IMKB 2CRYA 4OZHE 3I2CH 3PDOB 4Z76B 1KT2B 1T1WB 4I4WB 3MLZH 2BNQD 2VITB 4JREB 1DN0A 4NO3B 4WHDA 5JIHA 1A1MA 4RGNE 5D1ZB 5CSZA 4POUB 5D7LE 3L7FA 5IVNA 1FCCA 3BP7A 4W4OC 3QFJE 5EOCJ 3LKOA 3T0DA 1ZSDA 4H26A 3BGAA 4U2YA 2RAMA 1MCCA 2OL3H 1CXIA 4MLIA 1FZOB 4PREB 3T77A 2AV1A 1U8IB 1K2DA 2NTFA 4ELME 2CJUH 2X4TA 4KJYA 3DJ9A 3CLFH 2P45B 3CLEH 1AKJA 3GIVA 1KLUA 3UC0L 1BEYL 3V5KB 5BJTA 1ES0A 3IF1A 1A1NB 1TMCB 3IDIA 1NGPL 5DRWA 3BO8A 4WTXA 5DQDH 2P24B 5JNYA 4E5XB 1LHZA 2H32B 2ZNWA 4X9FA 1B2WH 2GY7B 4PY8I 5E1AB 1ZA6A 4NQTA 4BFIB 3MV7B 2CGRL 3OJDA 1P4LB 4PFEA 1RZJH 1Q9KA 4DUVA 4KHTL 2V2TB 4U1IA 2D7PA 1VDGA 3PV6A 1RQ5A 3EDEA 2XKNA 1HKFA 4LEOB 4NZJA 1QLFA 1IRAY 1HQRB 3EW3B 3HNTL 4PUBL 2BJML 4K8RL 4N1EA 3MCLH 5MEPA 4OZGE 4QRUA 1CD1B 3ULVF 4NQCB 2NX5B 2OS7A 2J8UA 3EJZC 3U2SB 4IRJB 3TA3A 4Y2DA 1KIUA 1I8KA 2AABL 5LCVL 4P4RB 3RVXD 4GG8B 3S34L 5I16B 1YN7B 3IKKA 3P30L 4RFEA 4YBHA 3BH9B 1EGJL 1KXQE 1XGTB 2BC4A 2ITDB 1HOCA 1WV7T 3I6LE 1LWRA 1FL6B 4N8VA 1WIOA 1UWGL 5C0CA 1JRHH 4JFFE 5D1XC 4WWKA 4LMQI 4RDQG 3HG1A 2BSSA 3I85A 4L8DA 4YDVA 4YZFE 3VA2C 3UROR 1YUHB 3MLRL 1X5HA 4AIXA 1PD6A 3RNKA 4Y4KC 1KEGL 3B43A 5CCKL 5KOVC 4PJHF 3QIWB 1NAMB 2RQ8A 1YMME 2IBZY 4Q9CA 4UT6L 4JDVB 1A7QH 3GSNL 2HRPH 3WHXA 1BOGB 1MVUA 1NLDL 2ESVA 4J12A 4MJIE 2AKRA 3MJ9A 3ZE2F 1AXTH 2F19L 1XGRA 1W0WA 4DGIH 1IQWH 3F12A 3FB5A 4X6DF 3W9DB 3QG6B 1CT8B 1MCSA 4HZLA 4KDTA 5FGBC 5ADOH 1M71B 4NRXA 5L6YH 1VGKA 4FP8H 5EOQL 5HDBF 4KZDH 3I02B 4D8PB 4L4VD 1V3KA 2VZ3A 1UCBL 4GH7B 4BELD 3MLWH 1QD0A 4Q58C 5GJTH 5KS9B 1LE5B 4PJ8B 3L9RA 4XC1H 4X6CE 1L7IH 4JO4H 3QQ9D 1A9BA 2EO1A 4G9FE 4KAQH 4K71B 3FZUC 1A3RL 3QCVL 1A4JA 1DFBH 4Z5RA 2PTUA 4OZHA 3RZWA 3NABH 4MJ5B 1IC5H 3MXVL 2H2SD 4M61A 4D9RD 3WJLC 4PRBB 1X5FA 3ARPA 3T65A 12E8L 4X7CC 1F4XL 5D93C 1MHHB 1RSFA 5DRXB 3S35X 2RCSL 4P48A 3ZKXB 4NHCH 2ZUWA 5D7JD 1T7XA 5CD3B 1QFOA 5KVGL 1CFQA 4K7FA 3B2UD 4MXWL 3L3OB 3MGAA 4Z7WE 1WFTA 3TO4A 3EJYC 3LPGA 1ORSB 1WK0A 3GDBA 4LNVA 1CI5A 5F9WC 2C1OB 5DEFB 2W59A 1OLLA 2BX5A 3QZWB 3TT3L 5CP3H 4YIQB 4BZYA 3P0YL 3JWOH 1D5BA 3BGFC 4ELMA 4CMHC 2VLRD 3O3EB 3JXAA 5ID0B 4G8EA 5CP7A 2X70B 2QADB 4QRRB 1NL0L 2JJVA 3G6JE 3SDDA 1LEIB 3B9DA 5EO1B 4P23D 2DM4A 1DBBH 1QBLH 4NT6A 4K07A 1V05A 3L5XL 4UIMA 2EE2A 3LS5H 5I8KL 2NLJA 3WNMA 1WBZA 3BPNC 4QHKI 5CEYB 5DRZA 3ULUL 2PXYD 5I17B 3WN5A 4CGTA 4M48L 4XGZA 2PYEE 5ENWB 1VCAA 4H1LA 4JPWH 5KSUB 4XCNB 5DK2B 3RQ3A 1MFEL 4HUWA 2FJHB 3KPPB 4H5SB 5ACLA 4PG9A 2NY4D 3TIEA 3VFMB 3ROLB 2YEZB 1J1PH 3TFKD 3QG7H 2NXYC 4KUZH 5GZOD 4X99A 3CXDL 4JFYA 5GGVH 1UB6B 4WNQB 5J6GB 2G5BA 1AY1H 3PQYB 5DQJA 4CVXA 4WUUD 4Y16C 3SDAB 3E6HB 1GZPB 2BDNH 4RA0C 4Z77A 5IB5A 4Y89A 3FO0L 4HK3J 3JUYA 5I15L 2NY1D 1JNJA 1NUDA 1HZHL 1DBKL 2GTZB 4HUVB 2DLHA 3FO9B 2EXYD 4N9OB 4URTB 1MJUH 1G9ML 3QDMB 2VZTA 2OK0L 1S9WA 3S36X 3BWUC 5EOTA 1CGYA 1HIML 3KPOA 1F90L 4JFFA 3F7VA 4LLYA 4R6UA 2OJEA 2ZSWA 1FN4A 1BF2A 5I8CA 1R6VA 4ZAKD 2EDTA 4BYHA 2PN5A 1MAMH 5JHDD 5DR5L 1CTOA 1K4DA 3GMLA 4X7SL 4XHJD 1NCBH 3VG9B 5FV1L 4YDIH 5HHPB 3RGVB 4LGSB 3HE7B 1MFCL 5F71A 5T1DH 1YMMA 4PJEB 1ZS8B 5C09E 3RWDA 2ZOKA 4LSQL 1CICA 3GNML 3CX5J 3VGGA 5I2IB 4YFLI 1ITCA 1G7MB 1DQJB 2AS5M 4N0CC 4PGZA 4UTBH 2IFFH 5F6HJ 3FTGB 5FYJD 2DF3A 4JJHA 1IM9A 4KVNH 3CSYB 2H41A 1QG3A 2I24N 4HWEL 5F89B 4JFXA 5ICZA 1I7UB 4I3SH 4PRPB 4KTDH 4BQCA 3EHBC 3OZ9H 5FO9A 1WFUA 2RJMA 2XQBL 3O3DA 4UILL 5IF0A 1F6FB 2EE9A 4O4YL 1KIQB 3Q5OA 2DQIH 5I1CL 2UY7A 4NKQB 2XN9D 4Q0XH 1Q9WB 4QY8A 3N0PB 2FB4L 2YD9A 1FLTX 2DL9A 4IBLT 3IJSB 3VXSA 3BYTA 1MHEB 1Q1JL 2V9TA 2XWJA 4AENA 1YEFH 1YNTA 5ICXB 4A6YL 4WV1B 1IL1A 1MWAB 5IB1A 3NPSB 3KNBB 4HT1L 5JXEC 5KVEL 4AQOA 4YWGL 2AXFA 1OAZL 4ZODA 5CGMA 3FQWA 4GBXC 2ZJSL 3TVMD 5IVXB 3RNQB 1W72A 4PRNA 1MF2H 2HFGL 1HHKA 4DVBA 1BM3H 3VXRA 3QQ4A 4UDTA 1CZ8H 1EVTC 2BSTA 4PJIE 1MPAL 3U7YH 2CLZA 5INCB 1EBPA 2W0PA 2W9EL 1XH3A 5J3HC 1SEQH 1KCVH 1U92B 3HC0A 3FFCB 1NCAL 5TE4L 2Y5TA 1BLNB 4Y8AA 1JGDB 4F15B 2NY5L 2JJUA 4G9DB 4PRDA 2QHRL 2YK1L 1I3GL 3D69B 4XI5D 4OCMC 4JPIA 1TZHA 2X4SA 3X14B 4Y5VB 1GC1H 1YN6A 4MXQC 4FQLL 5K9QI 5CZKA 4P2RA 4F58L 4LKXA 4Y4FA 1FFRA 4FQHB 3SOBL 3H0TB 5E4IA 2CUIA 2A83B 2AV7A 4FFZL 1D7FA 1WZ1L 3VGBA 1T3FA 4PRAB 3BP6B 4OM0L 2PYEA 4D9QD 3KPLB 3WFHA 2D0FA 5D5MB 43C9B 3NIFE 4XMPL 5D71H 3TP4A 1QNZH 3B8SA 2B4CL 2L0DA 5I1GH 1F97A 1WZLA 1W8NA 1LO2L 2JCCE 3G5ZB 3MRJA 4JKMA 2AJZB 3D87B 4Q97A 4NZDA 3RFZC 4QWWC 4LPXA 5C0IB 4MHHI 3LEXA 2NR6C 5ICYB 1YY8B 3N1PC 1D5ZA 1GH7A 4OF7A 1A7OL 1W0VA 3I75B 4MB4A 5I9QC 1IE5A 3ULUF 2VC2H 4OJFL 5JIKA 1R3HA 2P44B 3MBEA 4WU7A 2DYPB 4LPWA 1T6VN 1KCRH 1ZHLA 3B2VL 3WIHA 1OGAB 4MS8C 5F7MC 4R90H 1FJ1B 4Z78B 5CS7A 4KI1A 4LAQL 4KKNA 3SE4C 3ME0A 5HYSG 3GJFH 1WTLA 2X9YA 5IT2H 4IMKA 1J5OL 1BAFH 1CU4L 5GGSB 2EIZB 2J2ZA 3RA7H 3L6FB 3HB3C 1L0QA 1U8HA 5I8EA 1C5BH 1NGZA 4AEIL 2FJGB 5MP6L 4IMLB 3MGTA 1BHGA 1RK1B 5LQBL 2H1PH 3TH2T 4ZTOL 1EO8H 3QDJE 4YE4L 3VH8B 5JIPA 4OUUA 4R8WH 5FUCE 5C86A 1P7HL 3VWJC 5GGRY 2CDGA 1H5BC 5DI8A 3G6DH 3BPLB 1SVZA 2YPVH 3QB7C 4FFYH 3UJTL 4LLAA 3QP3A 3GM0A 4BH7B 3K81A 2UWEF 5BRZB 4GRLB 4GS7C 4RISH 5C07E 3QQ3A 1B9ZA 1J05A 3FT3A 4LPCA 3UAJD 4MA1C 2FRGP 5F7DA 2FLRT 1BVKA 5LGJA 3QNXA 4DAGL 5M94B 2BVUA 1NQBA 3ZYZA 3D1MC 3RY6A 3C9NA 3ARFC 3MRHA 1G9NC 3WDIA 1LDPL 2FJFB 4HEME 4YHMH 5ESAB 3P77A 4U1GB 2BVQB 1KFAL 1EDQA 3DX7A 5B8CC 4NPYA 2CK2A 3CH1A 4ZFGH 5ID1A 3HI5L 1PDKA 1TJGH 4QRTB 3MRDB 4MNGB 4PJXB 2X4OB 5C0BE 1L6XA 4HCRL 4D0DA 4OLVL 1FYTB 4UNTA 2NY7L 1HQ4B 2Z93A 1QBBA 1YQVH 4L5FL 3BFOA 1WGOA 4FQXA 4LCYA 4R96A 4MA8L 4HK0B 1JMXA 3JV4A 5L2KB 4OCXL 5D2NC 4P4KD 5GISL 1I1RA 3UPRB 2Q1EA 5A2IH 4MMXC 1CFVH 4PJIA 1BQHB 1QRND 4RWYH 4I8DA 1DBMH 4XBGA 4BSJA 4JREC 1CLYH 4CJ0A 3WXVH 4I0PA 2JK5A 3OGOE 1OGTB 1FVEB 2BVPB 1H3TA 2FEDC 5D1ZC 4HUKB 3TZVC 2O61A 5HYQA 4I48B 2AJSH 4D0CA 3QH3A 3VXMA 1B88A 2DTMH 4UT7H 1P5UA 2IBBA 1OF2B 5GS2H 1FFNA 3WJJA 4G8GD 2R69L 5I8OH 4G7VL 3DRQB 2HT4C 4FA8A 4F7CB 2DI8A 5BS0A 3QRGL 3QEHB 2GY5A 4GOSA 5JW5B 2W9LA 1N6QL 2EZ0D 2PNDA 4YDLC 4OLWH 4F80A 4Z7UE 3BP4B 3QDGE 5SWZD 3BEWA 3V0AC 1IKNC 1B0RB 3ZDXE 2W0FA 3D6GA 1G9NL 3O41A 4XRCB 3ARBC 3O6LH 1C5CH 4NP4H 3UTSB 2Y4SA 1UXSA 1NKOA 2C3HA 2DKMA 2JCCA 2VISA 5L2JB 4YXLH 3RRQA 3U7WH 1FNGB 1KULA 4EOWH 2HJFA 4ZXBC 2A38A 3FN0H 3H3KA 4YFLF 3SJVA 2D03H 2GYSA 3QUKB 2BSRB 1JNHA 4M6ML 2VDPH 3IFPB 2P8LB 2WBJD 1DL7L 2FEEL 3CCHB 4M3KB 5CMAA 3UYRH 1NC4D 1ZLSH 3ILPA 3U0TA 4OB5H 3QUXB 4XC3L 5DJ8A 3UBXI 4WI2A 5EBGA 3NFSL 4PRIE 1IFHL 4EI5A 3WLBB 3VXQA 3DARA 4JRYE 3D3VD 3MLVH 3I2CL 4DCQB 3NGBC 2VDQH 4EN3B 2X1QA 1B4RA 4NRYB 1F11A 4IOSD 1RIVH 2DRUA 4CU8A 1CF8H 1S8DB 1F58H 4N5UA 1DQML 4NKMB 3MJ8A 4J2XA 3F5WA 4MD5A 3S4SG 2QR0B 4R4BA 1TTFA 1E4WL 3JV6A 2YBRA 3SEPA 5H8DA 3O81A 4P5TB 1HN1A 1LO3H 5C0RH 4O51B 4ODTH 2FIKA 2IADA 4MQ7A 2HLAA 1CGTA 2H9GB 5A2FA 3GHBH 2APVA 1AXIB 3Q3GB 1TVHA 2J4WH 2OL3L 4HWBH 4S0TD 3G04B 4V2CB 2IANE 2WK2A 1DEDA 4LSPL 3HMWH 3QHFH 1FG2B 4G8FB 1AGDB 3TV3L 4NO0A 3UTPD 4UV4L 3IXTB 1U42A 2AGJL 3MACL 4HEPG 4K3GA 3WIFB 3D2UB 2CJUL 4K23L 1FO0L 2K9UA 3VU2A 3OJMB 2ZKHH 2A77H 3PWPB 2X05A 1WZMA 1MJJB 3GHEH 2C5DC 4IJ3B 3KYOA 3FO1B 4LAJH 2Q86B 1H9VA 3O4LB 5D6DC 3T0XA 4JY4B 2GT9A 5ACMA 4ZUWB 5DJ6A 5EFIA 1VESA 1ETZA 4OZFH 5I6XC 5IK3A 4KTEL 1EXUB 5D6CA 3PGCB 4R9HA 5ERWB 5F70A 3MRRA 1ONQB 5GGRB 5KSVA 4POZC 5I66B 1MOEA 2AEWA 1ZEAH 4MA7L 1KPRB 3KJ6L 1AQDA 2ZUVA 5BZWA 3VFNA 1G7QA 2DLEA 1Z0MA 1NBVL 1M4KA 4LSDA 2K7QA 5C0BA 4GFTB 2YZ8A 4DZ8A 1U8LA 4H25A 4W6YB 2VDKH 4TUKH 5T3XL 3RVVC 5C7XH 4PJCE 1UENA 3EYVB 5AUMB 4OBRA 1FRGL 4MCYB 4HQQH 4DZBA 4I13B 3D85D 2Q8BH 5IR1A 4C57C 2QKIA 1J87A 1VGEH 2E7MA 4JB9L 5JZ7D 3CFEA 1AD0B 1IM3B 1IGJB 1WF5A 3G5YB 3L3GB 4GXVH 3V52L 3MV7E 1A7RL 1FVDB 3MV8B 3TN0B 5FHBL 3OXSA 4WCYL 4JG1H 1JRHL 2GJ6D 4WHCA 5DFTA 5F1KC 3HCVB 4JN2B 3VCLB 3AVEA 4M5YH 3GSWA 4OI7A 2DWEB 4NQCE 2NX5E 5J9PA 4XCCH 5GJSL 3QULB 1GGBL 3BDXA 4P2OB 1TCRA 1QSZA 4R7DA 4JRXA 4XNXL 1EZVY 3OR7A 4WRLA 2VXSH 4Z7UA 1LO0H 4D9LL 4WFGE 4OQTL 1G6VK 5TDOA 3RAJL 2HRPL 3V6FB 2M2DA 1F42A 4NKOB 4NUJB 4ZO6A 3VXOA 3O11B 1N3NA 3ECBA 4YFEA 1AXTL 1OVZA 2WQ8A 1G9NH 3CU1A 1AC0A 3TA3C 3BXNB 2E6QA 1T4KB 3MROB 5ADOL 5CEZL 1QLEL 4KKBC 2PUQT 4JKPH 3IKCB 5E8OA 1XIWA 2UZYB 1MAJA 3ET9F 2CSPA 4MJ2A 1EZVX 4XH2A 4KY1L 3H42H 3EOBB 4WWKC 2ICEB 5DK3A 1QTYT 5AZEL 4U0RC 1DVFB 3PL6D 1L7IL 1VFBA 1DBJL 1L9NA 4GKSB 2VXUH 3GUTB 3O3AA 2VABA 4PRIA 2NY0B 4XPAH 4YC2C 2RFXA 3WD5H 1RFDL 4JO2L 1IC7H 1AO7A 5FCUH 1H3PL 1IC5L 4WFEE 3DHMA 4CVWA 3TJHC 5H37G 5EULV 4NQVB 4PJHA 2GTWB 1CGSH 3R06A 3QEGL 2YRLA 4FQJH 4AIZB 5T5FH 4R4ND 3DBXA 3MV9B 4NNXA 5KS9E 4YO0A 5HYSA 1TZIA 1WT5A 3VGHA 3BZFB 5K59E 3IFOB 1A6ZB 4C59B 1EHXA 2X44D 4KDTC 1RIHL 3Q1SL 3BW9B 3FQXB 5IEHA 4NGHL 1H8SA 3VFOB 2ITCA 1CD8A 2LV4A 3EBAA 5EU3A 4X6DA 3RWJB 3OQ3B 2XY2A 2X10A 4LQFL 4ESKA 4PV9A 5I19H 1X5ZA 2X2YA 4WUKL 4HKXA 3S88L 1QFUH 3IRZA 3MLYH 4DQOL 2DJSA 4Y19D 3VG9C 1JF5A 1V7NH 5DHVB 3FAWA 4KQ4H 3TT1H 3AFLA 4LCIH 4U7MA 3UTTD 4BUHA 4OI9A 3PP4L 1T1ZB 3U9PH 2ERJB 4PJBB 1MELA 3GMNB 1OAXH 1JPTL 2ZUSA 4JR9L 3GM8A 5B22A 3LSOB 4RFOL 1T0NA 4Z18A 5A2KH 5L8JB 3UMTA 3SGDH 1NFDB 2V5TA 4PP2A 3BWAB 2IQ9H 2EECA 3E3QE 5HPOA 1PJ9A 3GO1H 4MAUH 3TO4C 2LU4A 4ERSL 3W0WA 4QRRE 4E41A 4MAYB 1ACYH 1ADQA 4KUZL 1T7YA 4JANB 4TUJB 1SM3L 4RGND 1FL5A 5GGVL 4PJCA 2BVYA 3BUYB 1CR9L 1UM5L 3QQNA 4LFHD 1YEGL 5D7LD 2JIXD 1DQDL 2IMMA 1MLBA 1QBML 4U2ZA 4DKAA 4UB0H 1R3JB 5FDWA 3T2OA 4XPFL 4GW1A 5IROA 3BKJL 5CJ8A 3X11B 1OAYH 3ARDB 4X98B 3PGDB 3TYGH 1QQDA 2A2QT 1ULVA 3B9AA 3SDDC 5DD3L 5EO9B 4E42B 5JLZB 5DUBB 3FKUS 5E0QA 2PO6D 1XGUA 2OI9B 4QO1A 3FCTA 4LEOA 4LLWA 4YHYC 2YZ1A 5LGHL 3WN5C 4M93B 3U1SH 4JZJB 1A6WH 1MAML 3IDNB 4A2MA 1X44A 4PD4J 2R23B 4QHMB 4S1RH 3MRLA 4M8QB 5DD6A 5E6IA 4MX7A 3AY4A 5K93A 3H7BB 5AWNH 2M8XA 5T1DL 5E2VL 2I9LA 4YNYA 1MRDH 3EO1A 4U6VH 3CXHJ 1KIRA 4S1DC 1I1AB 4K7PH 4U1JA 4NNYA 3QDME 2EYTA 1HH9B 5JIIA 4M7LL 3PABB 4ODXB 1VERA 2WANA 3O3BA 2WINA 3UTOA 1OD7A 2D9QB 1ZHBA 4ZPVA 4O2FA 4TSBH 3T4AA 3ZYIA 1P7KB 1U8NB 1AH1A 3IB4A 3C5SB 3C60A 4XP4H 4X4ME 2H6PA 3SY0B 4RNRA 1H15A 1ORQB 4XNZB 2A6JA 2AAVA 3OXRB 4I5BB 5E00B 2OQJB 3FO2B 3IXAA 4HGWA 3QUYA 4MJ4A 1NAMA 4F57H 3Q6FA 1RJCA 4P46B 4PJEE 1C8PA 5E94A 5FYLH 2VNCA 4KKLD 4DUWA 4KVCL 1IEBB 3DXAA 3VA6A 5T1LD 5GGTA 2GSGA 1M7DB 2EKSB 3M8OH 5KVDH 3CFDA 1VSCA 4JQIL 4CVZB 2XKUA 4PTUB 4EIZC 4XVSH 4M5ZH 3O2DL 5I71C 1CICC 1I7TA 3DX9A 3MYJA 3KYNB 4PRPE 3N85L 4G6FD 3QAZC 5B3JF 3ZKQD 5D7KE 4NC2B 1EGJA 3LKSB 2J6EL 2B5IC 1I8LA 2XZZA 3IETB 4EZMA 5GS1B 1T83A 2CDEA 3EUUA 3QIBB 3S3JA 3DVFA 3LN4A 1DQTA 4XMKL 1OCWL 1X6LA 1T5XB 5DJ0B 4Q9RH 1F6AB 3RPIB 4MJID 3KLAB 5E8PB 2UWEE 4TOYL 4ODWB 3QFDA 4JPKL 1Q9LB 1BQUA 1KPVB 4LBEB 4N0UA 5F93C 2QQLH 2IQAA 2JB6A 3NZHH 4HPOH 1XF2B 1EMTL 3QCUL 4LSUH 5K9QG 1PQZA 4TSAH 4OZ4B 3NCFB 4OLYH 4OIAA 1G7IA 3REVB 1MHCB 1HHIA 1U3HC 5IVXE 4PJAF 2R1XA 3N06B 5SWSB 1FVCA 4YBLC 3AS0A 4EDXB 2YMXL 1F4HA 3CFJA 1NANH 5D9SA 5CUSL 1RZKC 3MJ6A 3WCYA 3X13A 3BPLC 1E6OL 3QIUD 5FYKE 4DN4L 3GFUA 4HIJA 5DYOA 2C1OA 1KLGA 3FOMA 4LGPB 1U58B 3MLTA 2DM3A 4Q7DA 5C0JA 2Z8WC 3MRPA 2EIDA 5ADPL 5HHQA 1UM6H 1ZGLB 1MNUL 5T3ZH 1BX2B 5JPNA 1QNZL 2G75A 3HZYB 3UYPA 1QP1A 3BQUB 2WUCH 5EC2A 2BVOA 5E5RB 4F7PA 3BRGC 2R1YA 5L9DL 4MHHG 4LCUB 4NQDA 3WBDA 4UNVA 3VFTA 5HHNB 4JO1H 4NO5A 1XGYL 4PTTB 4JFZL 4W68A 5I74B 1F3DJ 3LCYA 3B9KD 4W6WB 5EUKB 3C8KA 3OJVC 1B4JH 4PLJC 2ADIA 5GRJH 5J89A 3MJ9H 3THML 5FM5M 1GGCL 1AR2A 3KXFD 3K7UA 1BMGA 4LKCA 4GJTB 1BD2E 1QFWH 4JFHE 1A7NL 4Q6YA 4HW6A 2JF1A 4U6XB 4QRQA 4MMZC 5DWUL 1DLFH 4Y4FC 4MD0A 5GHWL 3GBNL 3S7GA 2KZ1B 1S7WA 5C3TA 3V0VB 2DQGL 3RA7L 3KS0H 2F53B 2DQTH 5I18L 3HPLA 1JGUH 2XV6B 3C2AL 3VXUD 3RPKA 5HHVL 1EK3A 2OR9H 1EO8L 4WFFE 1BQLL 1IARB 3O8XA 2X1PA 4I18A 3TC9A 1HDMB 4PY7A 1MCNA 5D7JB 1ERNA 2ZCKH 4O00A 4KI5E 1MRFL 1FNEB 3BJ91 4GXUM 3G6DL 4JGUA 3TWCH 5GRWA 4K94L 4TQEL 1UACH 5KANI 1G6RB 2R4RH 3K8MA 2B39A 3MBEC 4KROC 5E2UL 5D7SH 1PW3A 4XAWH 2VQ1B 5E08L 2VLME 1JHKH 3U30B 1KYOJ 1YEHH 5HGAA 4IHOA 4RBPK 35C8H 1T7ZA 3NTCL 4TUOA 4BH8A 4U6HB 3EOYG 2YN3A 2VLRB 5E9DA 5EZJA 1NCCH 4PJ9A 3S4SB 2EDNA 4IMKC 5AZ2L 3VFRB 3KYKH 4OFVA 1U8MB 3P73A 1AD9B 4U6YA 3BT2H 4OCWL 4FQIH 3P11L 5E1HB 3REWB 4KJPC 4XP5H 4YHML 1N5AB 3QPXH 3DYMA 1ZOXA 1ZWIA 2YXMA 4NJAL 3U0PB 2GJZA 4CJ1A 5IEKA 5KBNC 2QSVA 1MWAH 5TF1L 3GSNB 1I4FA 1CWVA 2BK8A 4MNQB 1EFXB 4APQB 3S35H 2PW2B 2FR4B 1PYWB 3A6BL 4LSSL 5I1EH 5LXGH 3OKOA 5J1TC 5ISZB 2VLJA 4NM4H 1YQVL 3STLB 3OKLB 2P7TB 1BFOA 3AXLB 25C8H 4XNQB 3HMXL 5E2JA 3W11C 4H1LH 4XPTL 3OG4B 4X4XA 5C09D 1CG9B 2HT2C 2W0KA 3T0BA 1J9CT 4DVRH 2ICWI 3RWCB 3TNMB 2XNAB 4KPHH 5DS8B 5C0AA 1R3KB 4EN3C 1Z5LA 1I3UA 4WUUB 3BZDA 2E7BA 4D3CH 1BFTA 3EJYD 2UWEA 1BZ7B 5C6TH 3DO3A 1GGIH 2CRIA 4FTVD 2NY1B 2Q7YA 4PGCA 4KK9C 1HH6B 5EIVA 4MNGE 3RY6C 5BVPL 1Z9OA 3T0EA 4FOMA 1N6VA 5HVGB 2R0KL 5C9KA 4UT7L 3NCYS 4S11A 5I8OL 5GZNC 5IJKA 3GSXB 2FSEA 4EJ1C 1MCRA 3AREB 2HVKB 5JHDB 4LVHB 5DSCA 4LPTA 4L8BB 5F7KC 4OT1L 4OTXH 3E2HB 5MHSE 4FQXC 3HRZB 3U4BH 2NY3B 4NP4L 2DBJA 4IOFD 3CC5A 2AK1L 3KS0J 4EOWL 5FHAL 4Z7NF 1HE7A 4I0PC 3K8KA 4JVPA 2XYCA 5ALBL 3SE8H 2ZUTA 2ICES 2NXYD 2WLYA 3GK8L 3EGSA 1QLRB 3K2MC 4LRIA 5BMFH 3OJ2C 3GEWB 4MNHA 1NCDL 3O6KH 4S0SD 3UBXG 4A6YA 4PR5A 3BZ4A 4QTIH 3S36H 5FF6B 1BD2A 3D5OF 3U48A 3DI3B 1BJ1H 4UV7H 3QHZH 3WJJC 1ZHKB 2BP3A 2PETA 3UTSE 4GQ9H 5F9JB 1A47A 3AU1B 2JE8A 4FQCH 4JFED 1NDMB 2EXWD 4XMLH 5ACZB 4BJLA 3PDDA 3W9EA 5F3BB 4ZYKA 2AEIT 2A9NL 2PF6A 4LASH 3OHXB 2HMID 5DRNB 3QA3B 2EIBA 4JFOB 3RWFA 1BZ9A 4NRZA 2D7NA 3O6FA 4O2EB 3MCKA 1UXWB 3H6JA 5HGBB 1QSEA 3QXAB 5C0RL 1HILB 1R5VA 3LB6C 4ODTL 4DFHA 1DQQB 2R1WB 3NZ8B 3GSRA 4X7TA 4PJ7F 4Q2ZB 4HWBL 1RZKH 2J5LC 4BZ1H 3NMEA 2DLIA 3QHFL 4OFYD 3MA7B 3MOQA 2CUHA 5BV7C 4PB9L 3MRKB 2CIIB 1XCQB 4JHAL 4JQXC 4YXKH 4P2OC 5KSAB 3W39B 1W72H 4ALAL 5IIEA 3CZJA 1G1CA 4FQ2L 3K74B 4EI5C 3O2WL 2FL5B 1MCPL 5GS2D 1Z6JT 2X1OA 1MUJA 1I7RB 4WEBH 2MSPA 5TGBB 5SX4I 3G5VB 4WHTA 1YNKL 2WBKA 2E8ZA 4O58L 3O9WC 1TQCC 3EHBD 5J1AB 2VE6A 4NZRH 4M43L 3EYSH 4N90D 4G8IA 4U1LB 1J1OL 1QVOB 5B4MC 3RZCD 1J8HA 1OPGH 2HJKB 1ZTXH 3QUML 1FIGL 2B1AL 4DK6A 4MWFB 2VR4A 2B1HL 4LL9A 4QYOA 3Q6GH 2LTQB 1ZGLP 4KQ3L 1N5YL 1TIUA 3GB7A 4YQXL 3B3IA 5TDPB 4OQ1A 4HC1A 3O4LE 2VDKL 3SCMA 4TUKL 1PZUB 1L0YA 4MVBC 1BP3B 3R1GL 1JGEA 5JXED 4JLRB 2YA0A 5FECA 4CRPA 1VHPA 5IKCB 1RUAH 4HQQL 3QDJD 4GBXD 5JMOC 3IDJA 4ZFOA 1IGML 4HKZB 1TENA 2X4RA 4XP9L 5GRYA 1CS6A 3K4ZA 3VFPB 1A21A 3PHQA 3QNZB 1AGCB 3C5JB 2A74A 4JJ5A 2V7HA 2WIMA 3MFFB 3OKNA 5EWIL 1K3ZA 1K6QL 1ZT1B 4JG1L 2XTJC 1IT9H 3VG0L 5C07D 1IAKA 3DUHA 4WTZA 4ZUUA 5T33L 3MNWA 4ZUTB 5I1DA 1NLBH 2X4QA 2H26A 3IGAB 4M5YL 1EHAA 2AI0H 3RVWC 1AQKL 1T21A 4XCCL 2E3VA 2F58L 4LGRB 2EYSB 3WIHH 5A2JH 1FV1A 4OF0A 1XF3A 4EDWL 1U6AH 1UZ6E 3OF6A 3PP3K 4X83A 3K1DA 3VXNA 4RMTA 1PSKH 1VACB 2VDLH 1A7PH 3P0VL 3W81A 1F5WA 1VEMA 4HDIA 1OARL 5IUSA 3P4LA 1CFTA 1MREH 2J7LA 1TNMA 1IAII 1KNOA 3Q5YA 2F54D 3C6LD 4L3EE 3LEVH 1RZGA 43CAB 2MCPH 5HHOB 3O0RL 3HI6H 4U1HA 2R4SL 3RHWF 5MERA 4P2QE 1T1YA 2DI7A 3H42L 4NQSA 5EU5A 3C6SB 4QWWD 4X6EA 5F72S 1B0GA 2NR6D 1CFBA 5E03A 4OCYL 2X09A 2BNRB 3QPQC 5CFHA 1FZMB 1U91A 1NUNB 3IFLH 3KLDA 4HCRA 4HS3A 2EC9U 2PTVA 3L1OL 3QI9A 3WD5L 1ND0B 4XXDA 2N7BA 4YHZH 2OXGA 5L2JA 4JQVA 3QEQE 4QRPE 5FOBB 1AP2B 1INQB 5ELIA 2F74A 2OSLB 3MA9H 2BSRA 1KENL 5T5FL 1SYVA 3LD8B 4W81A 3IS0X 1YEKH 1JHLL 3B9EA 1UYWH 4HUMB 2OCFD 2D31A 3GMRA 1BBJA 3ULVC 1MI5B 1F3JB 2HFEA 1XIWC 1X3DA 4F2MA 2B0SL 3SDXF 3ARZA 2WV3A 5DMGC 4OGAD 1JFQL 5ECJE 1A6UH 4DCQA 3HZKB 4P4KB 1CLOH 4HUUB 3FB7B 3AB0C 4NRYA 3OSKA 3EIFA 2WLZA 3D18A 4IIQA 1CE6B 1QRNB 2O5XH 1D5IH 2FYYA 2V5SA 4M6NH 4Y5XB 3TT1L 1ZT7B 3FJTA 4LCIL 5A1AA 1IGCH 1YYML 4ETQA 1I1AC 3PHSA 1U2HA 1E27B 1R5IB 5FB8B 3MV9E 2EDDA 1T0PB 4I9WE 4FXKB 4CN4A 3VXTB 3TBSA 1CDGA 3BEVA 4BZ2L 3MRBB 3DV6B 3EYFB 2I9TA 1RU9L 3MRCB 2DM7A 3EO0B 2GUOB 1D9KA 1VADA 4FABH 2YD3A 1IAIL 3WO4B 4HG4J 5SWQA 4YUEH 1IGIH 1HKLH 4G8GB 4JDZA 5L88H 2CRMA 1V3LA 1WT5C 4JRYD 2IQ9L 3F65A 2ARJA 4LLVB 3AM8A 4J1UB 3GKWL 1MFBL 3SKMA 3MGOA 1T80A 1OB1A 5SWZB 4QXTB 2YOCA 4OGYL 4JFQA 2DD8H 3KYMB 2BMKA 2D7QA 3TH3T 5JR1H 4PJBE 4QOKD 1MCHA 4RQQA 4L8SA 3PWNB 4ZSOE 4NSKB 2IMNA 2NCMA 3QDHA 5INDB 4L4TA 1E28B 4I3RH 4UB0L 4WO4A 1J0KA 3NCJH 3JTSB 5I66A 1NFDE 3LKPB 4D94A 3AAZB 4AMKL 5HPMB 1CK0H 4R3SA 3OR6B 3QCTL 4OCLC 3ARQA 4EUPG 2ADJB 5B39A 1IGTA 4S1SH 4R7NA 4XB7A 1TDQA 3CSPA 1N7MH 3GSOB 4UAOC 1JGVH 1A8JH 1FAIL 1TPXC 4NKDB 2L7JA 1BVZA 1TTGA 5BV7H 3VRJA 5D1ZD 4QT5B 5J12C 1A6WL 4I0CC 3TZVD 1EIBA 4PJDF 4YBQD 4S1RL 3VWKA 3D3VB 5JXAL 1YA5A 2D2OA 5TPWH 4R4FL 1N59B 2NY2C 3WIIL 5HI3D 2HFTA 1MRDL 3KPSB 3L95B 4M7JL 1JGLH 3U6RA 1G7HA 1AD0A 5TFSL 4RIRA 1F8TH 2HT4D 5F7EH 5F1OB 2IG2L 2HLFC 3I3BA 4IDJH 2UZIL 4BKLA 1HYSC 1BWWA 1FG9C 5C0FB 2VERN 1LQSR 1WISA 4I77L 4L3EA 3ZT7A 2BHYA 5C6WH 3SE9L 1A6VL 1LMKA 1RK0A 2CLRB 3MRGA 2FO4A 1ODAA 5F9OL 1JYXA 3PXHA 3UTQA 2G2RB 4P2QA 4M9PA 4YDJB 2BNQE 1CGUA 3FN3A 4LEXL 2FWOA 1CLZH 5CJOH 2NZIA 3PWUB 5FYLL 5MEND 2CR6A 2X41A 5F1NA 5IM7B 7CGTA 4WI6A 3ILQC 2ZOLB 4ORGB 5E6IC 3TH4T 4JM4L 5CBAA 3AY4C 1AGBB 1PKQB 3BHBA 4F9PA 2HFFB 4TVPH 7FABL 3UBXA 2J88H 4XVSL 15C8L 4LDLB 3MNZB 3QEQA 1OP9A 4QRPA 1S7TA 4X9HA 1T20B 5FEBA 1K8DB 4EBQL 2P1YA 2VLKA 4XVUC 2NX5D 5AEAA 3EOBA 4XCFH 2BNUB 4EVNA 3C60C 4IM8A 4I2XB 4KKCC 5F7YC 5GGQH 3WLWC 5I75C 4UQ2B 2DKUA 2P5EA 4UUJB 4PGEB 3T2NL 1T66C 3DSFL 3GI9H 4YR6B 4KK8D 1INEH 4KXZH 3QUYC 3HFMH 3U4EA 3ULSB 3BRFA 2VIRB 4R2GB 4U1NA 4X5XA 2KDGA 4PJ5A 5BXFA 5E5MB 3STZB 1MIEL 4YHPB 1KCUH 4NN5C 3RHWK 2O5YL 2IH1B 4EXPX 2VSCA 4OQTA 4TSAL 2SEBA 2M1KA 3TIDA 4OIBA 4GRWF 3HPJB 3QWRA 3BSZH 4XWOD 1ZHNB 2E8YA 4ZO9A 3QIWD 2XIDA 4S1QL 5DT1H 2GJ6B 4LCWD 4M62H 1KB5A 4RRPG 3OAYK 4FMKA 1GHFL 3LQMA 2V17H 5HI4C 2QQNL 5IBUG 2IF7A 3TNNB 2VAAB 3TM6A 1NGXA 4POZD 4FXGB 4J8RB 2ZUXA 1I8LC 5JDSA 5T3ZL 3T3PF 3CIQA 2GITB 1T83C 3I6KA 4X4YB 4X7DC 5JW4R 4L29B 2IPTH 2R2BA 4KRPB 3V4PH 3K2UH 2OL3B 4RMSA 2QV2A 1I1YA 5EBMB 3QUZA 4XNMA 1OTSC 1KACB 3C5ZA 3RWIB 3FQTB 4UBDC 3ARGA 4UIKH 4ZSOA 5SWSE 3DNKA 3MR9B 5I1JH 4N0FB 3RX7A 4PJ8D 1BZQK 2Y7QA 1YEJH 4LIQL 3BD5A 3ZTNL 1KC5H 1UZ8A 1FO0B 3RVVD 1WJ3A 4OF3A 1K5NB 5GRJL 2MFNA 3S8WA 4LQ1A 2A6IB 3A67H 4ZFFA 2HJLB 3F7YA 3R0NA 3BAEL 2Z31B 4GAYA 5JUEH 3ULVH 4HIXH 5TE7L 2MQ0A 5GGVY 1AKJD 4HFUH 4P5KB 5FXCH 4M8VA 3HC3L 3V5DB 1E4KA 2GHWB 1OAUL 4PJAA 4N9GB 3X3FH 4TTDC 3RL1A 1OAQL 3U9UB 1KTDA 1KF9B 4DOHB 4UINL 1FL3B 3N9GH 1RJYB 4H8WL 2E9WA 4UDUB 4X5LA 2N56A 3K4DA 3PWJB 4HXBL 3E3QC 5D1QB 4Z8FL 2V2WA 3W2DL 2D7TH 3X17A 3ZKMD 1HSBA 4NQEA 4DTGH 5A16B 5FDYA 2VKXA 5GS0L 3VMNA 4LHUA 2NNAB 5L0QC 3HUJF 2ZCKL 5KANG 4MXVF 5H94A 1YY9D 1U3JA 4FFVC 5I1IH 3KAAA 2XFXA 1JPFA 3JTTA 6CGTA 1LO4L 1UACL 3L3HA 2QADD 2W92A 2R4RL 2DQUH 4WGVB 1ACZA 2F53E 2RR3A 3WSQH 3AREC 3BH8B 1P84J 1YEHL 4U7SA 3VFUB 5TF0A 4D9RE 2BNQA 3CFBB 1NBYA 2DTSA 5AYUL 2KQMA 4PJGF 5L7XH 3UTTB 3MRMB 4OZIF 5C0CD 4WWKD 2GFBA 4G7YH 3HG1D 2EDWA 2XZQH 4KUCD 5IFJA 5F44A 4XCEA 1A9EA 1UVQA 3VDCA 4XPHH 4HX1B 3O8XC 4I18C 1F02I 1TVBA 3PQYD 4XX1E 2ED7A 5JW3L 3V6ZA 4RGMB 3JBG7 4LOUD 2RB8A 3GMPA 4NM4L 4ZS6C 2VLRE 2ESVD 1CDHA 3KLHD 3SQBA 1XZ0B 2K3TA 1H8NA 1LP9F 2WZPD 4IRSA 3ULUC 1AIFA 2YD5A 4JZNB 1I9EA 4J6RH 2JIXB 5GGUB 1U9KA 4LLMB 5DJCA 5EC1A 1RJZB 5C6TL 1ADQH 3BI9X 2BVEA 2MWCA 1FNSL 1KEML 4PJ9C 2V5MA 1DDHA 4MNQE 3HE6A 5C2BH 1UCTA 4N0YL 1KIPB 3IJHB 3TJEH 3UTZA 2PO6B 5CD5C 3RGVD 3HE7D 5K9KB 2X4NA 3RWHA 2F8VA 1X4XA 4L8CA 2R29L 2HKFH 4GG6B 4DGYH 2WMPA 2FX8L 1KN4L 4M3JA 4WUUE 3P4NB 1HNFA 5ITBL 4X0KA 1BGXL 1G9MC 5BZDB 3H9HA 2Y6SD 3M07A 5EU7E 5GSRA 1MH5B 4M7LT 2XPGA 4OUOA 3R4DA 2AEPH 1FZJB 5HY9B 5TH2A 1Y6MR 5KTEL 1JI1A 1UM4H 3H9SB 5GIRB 1RZ8B 1O5DT 4HIEB 3V5HB 1C7SA 2B7DT 5MEOB 3ZT6A 3F58L 3RTQA 4H0HB 1JE6A 3G6AA 32C2A 4ZNCD 3QO1A 1P4BL 4QCIB 3UC0H 3BOVA 3L7EB 5JHDE 1S9VA 3T0EC 3TBVA 2IALA 3SDCA 5CIPA 3MZTA 3NAAL 4UV7L 3DUSB 2VQTA 1KTLA 1PAMA 5IJKC 4PIRF 3KPMB 4WDIA 3ZL4L 1ZLUK 5T1LB 1LE9A 2QHLA 1I9JL 4Z7OF 5F3HB 2EDLA 5IFHL 1T1XB 4WJ5A 3RJQB 2P5WB 1EAPA 3L5IA 4OF5A 1ZVSA 4KHTH 1RHHA 5FYJE 4EUPA 4FNLL 4PLNC 1ZT4B 2D7MA 2P8MB 3HNTH 4L4VA 2BJMH 4K8RH 4JCMA 1SJXA 4P3DA 3FFCD 4U1MB 5DVMA 1NFIA 3FAXA 4GMSL 2EH8L 1LNUB 3D25A 4NQXA 4HKJA 5FK9B 2BCKA 5LCVH 4LRIC 3HAEG 2XN9E 3R0MA 4QHUB 4XWGL 3S34H 3P30H 1XF5A 4RAUB 1KTKE 1EGJH 3HZVA 1U0QA 4L3CB 1S5HA 1W72L 1HXMB 3OKKB 1UWGH 2EDRA 1E6JH 5DDHB 3KWWA 1HHHA 5IHLB 3RUGF 5CLWA 4WU5B 4ONHA 3FQRB 1GRWA 3GIZL 3NIGE 5IQ9B 3MLRH 1JF1A 4TN9A 1M7IA 3ISWA 3HTLX 1I7ZA 2C7UB 1S5IL 1UJ3B 3HA0A 5CHNB 1KEGH 5IQ7L 3EYSL 3DYOA 5CINL 1ZTXL 4Y1AB 1KPUA 4UT6H 4DKEL 3O6FC 3GSNH 1CCZA 2NY5C 3F62A 1NLDH 2I07B 2VQ1A 1Y18B 5I1LA 4CN1A 5HGDA 2F19H 3UP1A 3LIZH 5AD0B 1XR9B 4JO3L 3SHSA 3QO0B 3MQIA 4JFDD 4L1HA 2M26A 5HI5D 1CVRA 1LK2A 3CDCA 5DJ2A 1CICD 2PTTB 4BQBA 2DBLL 3VFRA 5EOQH 3SDXE 4KC3B 1K4CB 2GCYA 1OP5K 2DYPD 1C1EL 4XNYH 1UCBH 1YMHA 1OGAD 4P23A 3GKZA 5D2LB 3NN8A 5EZIL 4S2SA 1IM9D 1I8IA 5E8EB 4KGLA 5DJZA 1PZ5A 4QHLA 1C16A 4GW5B 4X6BB 2AJVL 2PXYA 4JKLA 3WL9A 1CLCA 1IBGL 2LU3A 4C4KO 2B4CC 3P4OA 3V95A 1S78D 1VFUA 3SKNA 2X4PA 4D9QE 3KXFB 1A3RH 3QCVH 3MMEB 1Q38A 1IT9L 2VLMD 1CE1L 4R0LA 5L8LB 1Q9OB 3MXVH 4CMMA 3DTXB 1A6AA 1FFOA 4HKBB 12E8H 5C1MB 1F4XH 4JY5L 3WIHL 5JOFA 5IG7B 4PV8B 1U3HD 4YHKL 1U6AL 2RCSH 4ZUSA 3T4YA 5D1XB 1XR8B 5D96C 4EIGB 4G43A 3SCMC 5KVGH 2EO9A 4IRZL 3P9WB 4MXWH 1A7PL 3IFNH 2HWZH 3VXUB 4WW1A 4HJGB 4OZGF 4U3XA 3IYLW 3AMKA 1SJEA 3FONA 4FQQB 3KHOA 4Y4KB 1OTTC 5BRZD 1KSRA 4HIHB 3GMMA 3TT3H 2R2HB 2EC8A 3G08A 4AEHL 4D2NA 3DVGB 2H3NB 2HN7A 3VGFA 3P3YA 1HXYA 2YA2A 3PE9A 4FZ8L 4ZAKA 1KB9J 5CGYC 1IEAB 1NL0H 4GLRI 1OAKL 1T6WA 2FHFA 5E6ZA 2EE6A 2LVEA 5I8KH 3L5XH 5JORB 4PLJD 1HWHB 5JOEA 2ARJQ 2V7NB 4O2CB 4F33B 3EYQD 3ULUH 2ZP0T 1HCFX 1A7BA 1CL7I 1KYOK 1VEOA 1G7LB 5K9OB 4M48H 2Q76B 3HMXA 2Z9TA 2VH5L 4P2RD 1FYTD 2OM5A 1MFEH 1X7QB 3MLSH 4OD1L 2BOBB 4LLQA 4U1KB 5L2KD 3NVQA 4HGKC 2K7PA 4ISVB 1NC2B 3CXDH 1OP3K 5A43C 3HNSH 2JB5L 3LY6A 3DX8B 2HP4A 4KZEL 4BFGA 3FO0H 1UQSA 5HYEA 3BN9C 5I15H 1CTNA 1GJIA 5D93B 1HZHH 1JWMB 5HJ3B 3ZYJA 5IMLA 2AJYL 2ZSVB 3GJEB 1RPQA 2XN9A 5I1AA 2LQRA 3UJIH 4PBWD 2VZ1A 3MRNB 1H3WM 1YNLL 2XWBA 1G9MH 1YECL 2W91A 1D5IL 4RGOL 3LQZB 4X6CF 4FQ1L 1HIMH 4YPGB 5H37H 1F90H 1W8OA 3IVKA 2XWTA 5TE6L 5JPMB 2CIKA 3MBED 5F9WB 3QI9C 3GJFB 3TBWB 4LDOB 5CBEB 1DQQA 3VI3F 1NMCC 2IAMA 2MPAL 4JQVC 4X7SH 5DR5H 4HS6A 1A4KB 3MXWL 2V9QA 1OQXA 3BGFB 3TVMA 4CMHB 1JUFA 1MFCH 5HHXL 1LILA 1DLHB 1NKRA 2MKWA 3L3DA 2FX9H 1QBAA 1NGWA 2OTWB 4JAMB 4LSQH 5KVMC 1QRNE 3GNMH 4L1DA 3O45A 1YEDA 4M7ZC 4Z7WF 4KFZC 3BPNB 1KGCD 2DD8L 1Y0LA 4X9IA 3CUPB 3C09C 1MCJA 3NA9L 5FOJA 5I76A 2NZ9C 1DUZA 1KJ3H 1IC4L 4XAKD 4C4KT 2KL6A 3SDXA 1SMAA 2VL5A 4IIQC 4AM0A 4JM2F 4HLJA 2DL2A 4J3UA 3IDGB 3HLAB 3QUXD 4UT9L 4M6OL 2XQBH 1RZFL 4ONOA 2EEBA 4G8GE 4O4YH 5D4QA 1BJ8A 4AH2A 2NXYB 2HT2D 3PHOA 3VE0A 3G6JF 1EEZB 2ICWA 1ZKAA 4NN6C 2Q3ZA 5IBUB 4ODSL 1XGPA 3L3KA 4EN3D 4Y16B 5SWZE 4PYHA 2FB4H 4ZO7A 1N7ML 4GRWE 1D9KC 1FGVL 3WFCH 2NW3B 3B5HA 1C08B 4KK9D 5BV7L 1KG0B 5MI0C 1Q1JH 3UZEA 4A6YH 3BGMB 3RIAF 4U7KA 1DBAL 4NDMA 5C0DB 4KHXL 1MCIA 4UQ3A 1HEZB 4AL8L 1TETH 5TPWL 3SKOA 3AM8C 1WCBA 4HT1H 1S7VB 3CFKB 2DMKA 5KVEH 3TBTB 4YWGH 3VRIB 3VXPB 5JQ6L 2ZUYA 1OAZH 1OLZA 4R2GC 1A2YA 5BCAA 2UY6A 2ZJSH 5GZND 3T3PE 4L8SC 5EU6B 5FUZL 2HFGH 4PGDA 4PJFB 2DJUA 2QSTA 1IGYB 1P7QB 4WO4C 2UVEA 3AROA 3V0WH 5DMKB 2W9EH 3D2UD 4XPBL 1LEKA 3T8XB 2IH3A 1NCAH 4OFPA 5TE4H 4NO2B 4PRHB 3PWPD 2NY5H 4HUNB 3EOAB 2QHRH 3O4LD 3QJHA 2YK1H 1I3GH 3D3VE 4L9LA 3VJ6A 2EDEA 4LNRB 4KDWA 1NGYA 1V7ML 4PG2A 1YEIL 4NYLA 4KK6D 5CJOL 8FABB 4TNWF 2D3VA 4MDJA 4FQLH 4HBQA 3W5MA 3EFFA 5CJXA 4Y88A 4F58H 4J23A 3LS4H 5IVZB 3VWKC 4YGVB 3M17B 3SOBH 4P49A 1FSKC 5EBLA 3DUUA 5IW1A 5DK0A 1QEWA 4MSWB 3WDJA 1T22A 4FFZH 3AGVA 3VXMD 4YK4C 5DQ9B 3GSQA 4PJDA 2K1MA 1SMOA 2YSSA 1B90A 4XMPH 3LRSB 3DO7A 2B4CH 1SJHB 4K9EL 3UTPE 2AVGA 1LO2H 3RL2B 4ZFZA 2Z31C 2X7LA 4BSVA 4MZ3A 4ZOBA 3N1QC 2OTUA 2DIAA 5ESVA 1S7UA 5DEGA 2CLVA 2FZ3A 1A7OH 3WNOA 2BHZA 4X7EC 3MV8D 4N8CL 5ETUB 1PKQE 2FBOJ 5KSBB 4G80A 4OJFH 4CNIA 5C9JA 3N50A 1EFQA 1VFMA 5EBWA 4HC1H 4QHNB 5CZXC 5DJAB 1S9XB 3B2VH 1IMHC 2YR3A 4LAQH 1Q72L 3QDAA 4U33A 5JO5A 1R3IH 5IB4A 3MLXL 4P2OD 3RWGA 3BSZL 1RVFL 4F9PC 1J5OH 1CU4H 1QA9B 3FFDA 4I2XE 1OT1A 2CDFA 2H8PB 2O93L 2EDYA 1RUKL 4M62L 4AEIH 3FB8B 4OGXL 3IDYC 3NCBB 5HGHA 3UCRA 2WIIA 4X5WB 1EPFA 3AS1A 2VRAA 4PGBA 4HJJL 1EVUA 5LQBH 3O9WD 3BIKB 4ZTOH 3UPAA 3SQOL 1BECA 4YE4H 2XACC 5B4MD 4ELKB 3JWDL 1DUYA 1KJ2A 3NFNA 4NNPL 4AQ1B 3UJTH 1P2CB 2P46B 2Y23A 2VOTA 4LLDA 4GUPB 1RMFL 1RJLB 1PX3A 3T3MF 2GJ6E 1YEJL 5KJRH 3NACL 1DVFD 2QQKL 3GGWB 1UADC 1A1OA 1C5DB 5CILL 3D0VB 4NO0D 4B50A 1HI6A 4ENEC 4OV5B 5JA9A 1CXHA 2UYLA 4DAGH 3L3JA 1QSFB 4MD4A 5IOPA 3LOWA 4HFUL 3BZEB 2CRZA 4NBXB 1MCFA 5DJDA 1LDPH 1REIA 1XF4B 5I9QB 3X3FL 3QEUA 4ZG1A 3LAFA 3PGFH 1JZ5A 1GIGH 3QUMB 1KFAH 4QTHB 4YHNB 1SYSB 2HTKD 3TPUA 4YHIA 4V1DB 3O4OC 3HI5H 1UWXK 4GQPH 1AXSB 5C08B 4CDGC 3HC4L 2WWMC 5CJ5A 3V7AE 2CKBL 1MEXL 4HCRH 4OLVH 1X4YA 4GSDL 2NY6C 5IMOA 2BY2A 4L5FH 3QUZC 4DTGL 5HYJB 3DMMA 3C5ZC 3ARGC 1IZJA 4OCXH 1N2RA 2WQRA 5BOZG 4U1SA 4C54A 2NW2A 1BVLA 2WBJA 2VLLB 5C71A 5DLML 5SV4A 4DK3A 4WW2A 4FG6C 1NC4A 4HV8A 1T2QL 2ZG3A 1ZVHA 2W9DL 1RD6A 4QF1B 4DOHE 3MREA 4LF3A 3DOSA 1WAAE 4K7PY 3WSQL 1C12A 3INUL 4NOBA 1S9YB 3VFVB 4U05A 4ZOAA 2R2EB 3L5WB 3VWJB 3P9MB 3T1FA 1DE4B 1QO3A 3GSUA 1E4KC 2AK4B 1H5BB 1JK8B 4BQ8A 3BPCB 5EA0L 1UEMA 1ZANL 2GK0A 3HI1A 5EPMB 2R69H 4G7VH 4GKZB 2Z4QB 3QRGH 2WWKO 4GS7B 1N6QH 1D5MA 3QPQD 4KMTL 3FT2B 2VTFA 3V4VH 1WBXA 4MA1B 4OFIA 4XZUB 4MAYD 2V2XA 5D7IB 1HINL 5FCSH 4LARH 2YD4A 3RIAK 4DWHA 3HAEB 5FA4A 4JRXD 4C83A 5IHZB 2C1PB 1L4IA 1NEZG 3ALPA 4F7MB 4Y19E 1QR1B 1QFWM 2ZWLT 3ARFB 3LKRB 5FO7B 1U95B 5CWSA 4HULB 4C56B 3CPLB 1HWGB 3UTTE 3HUJA 4Y4HA 3HN3A 2GSIB 3KVQA 4RMVA 5B8CB 5ANME 2AQ3A 4M6MH 4OAWB 2P42B 3ULVD 4J3SA 1KLFA 1DL7H 3H3BC 2G9HA 5E95B 2C4FT 4ZQKA 2A9ML 4ZPTA 4PB0L 2AXJA 4Z7QF 3NFSH 5D2NB 3LZFL 1G7PA 2HVJB 3ROOB 3RUGE 4PJGA 2DQJH 4GW4A 5IB2B 5T1KB 3BE1H 3LKQB 4RZCA 3I3EA 3DETD 5C0GB 3DGCR 4TNWK 4OZIA 3C8HA 3K46A 1I1AD 2HKFL 4MJ6B 4DGYL 4XCYB 1WC7B 1DQMH 2F8XC 1AO7D 1E4WH 3TZVB 4XBPA 3GSVB 1JV5B 4LVNC 1T5WB 4YXHL 1EX0A 1J1XH 3BP5B 1A6TB 3D85A 1U8OB 1T0MB 1N64L 5SX5K 3U36B 4BFBD 2AEPL 3CDGA 4IRSC 2IH1A 4LSPH 1RUQL 4F8QA 1P9MA 1IAOA 5F7UA 1YPZB 3TV3H 1NJ9B 4YDLB 4JFPB 1UM4L 2PW1B 1LP9A 2VSDA 1UJ3C 3D39A 4UV4H 1U93A 5F88B 4P46D 2AGJH 3MACH 3WE6B 4MDIA 4K23H 3CZFB 1FO0H 2WW8A 1JZ3A 5GSVB 2YPLB 1BIIA 4Z7VF 1OSZA 2DDQL 3HE6C 2WP3O 4YX2L 3ARBB 4EI6A 5EZLB 3RI5F 5D72H 1P1ZB 5IW6B 3VMPA 1RUPL 4KTEH 3WS3B 5EO0B 5FKAA 1J86A 4ZXBB 4RBPH 3H9YA 5EZOL 5MENB 3UJJL 3WFDH 3TPKA 1D6EA 3MRQA 5IJVA 5FIEA 1JWSB 3H9SE 3CDYA 4MA7H 5KN5B 4AT6B 1NAML 3KJ6H 1HHJB 3P4MA 4GKNA 4LLUA 4P9HC 4Z7UF 1GAFH 4N0FA 5EU4A 2AXGB 4IS6A 5E2TL 5IV2A 1NBVH 4YJZL 5GGTL 3WKNA 4GXUN 2CK0L 3QIBD 3ZDXF 4JGJA 4ODUB 3L3IA 1XGQB 1VKXA 4L3AA 3QWOB 5T3XH 1FNHA 1LEGB 4MA3B 5IMMA 3NGBB 2FD6L 1FRGH 3W0WD 3B6SA 4LU5L 4E41D 3FQNB 4HIIA 1WBYA 4D0BB 3RTQC 5DTFA 1GL4B 3PL6A 3ORJA 4N5EC 4ZNEA 3OX8A 4JB9H 4CW1A 2KQNA 3VFWA 1NEUA 4GRMB 3KPRB 3V52H 2HLFD 3MUGB 1A7RH 1R3LB 3BVNB 1OSPH 4WFHD 1HYSD 3SDCC 2D4DA 1M7XA 3OPZL 3TCLA 1R0AL 5FHBH 5SWSD 2WWKT 5KZCD 4WCYH 5EORL 5EUOE 1EH9A 2VDNL 3LV3B 1E6JL 1R24B 5C8JB 2OJZH 4MCZB 4HUXB 3MO1A 2Q6WB 3RBSA 3RX5A 5E7BA 3ZTJG 5GJSH 1P69B 3EO9L 3VRLE 1GGBH 4AEEA 5FO8A 4XNXH 3S37H 3I6GA 2EDXA 2VXQL 4I3GA 3PUCA 3BQUD 3KDMB 4D9LH 4OQTH 4OLUL 3RDTA 3ILQD 4LCWB 3RAJH 4PS4L 2EYRA 4HWZA 3O6MH 2DQDL 5GRVL 5I6XB 4TRPL 2EE3A 1DN0B 3LIZL 1UC6A 1YDPA 3GMOA 1KB5H 4Y19A 5AAWA 1ZMYA 2B20A 4NCDA 1A1MB 5CEZH 1EHLL 4BM7A 5CSZB 1QLEH 3L7FB 5DZOA 3BP7B 3ABZA 2HG5A 1FHGA 1PG7L 3IT8D 4G3YL 4PP1C 3LKOB 1S7QA 5DHYA 4XNYL 4FQPA 2RGSA 5ANMA 4KY1H 1ZSDB 4CADA 4H26B 4X9BA 3VD9A 3WLWD 3PDGA 1GGUA 2PCPA 5AZEH 3FT4A 3ZHDA 1T66D 1DBJH 4TPRL 3OKEA 3OGCA 1JNNL 3T77B 5FYKU 2AV1B 3PWLA 3QUYD 2F53D 1K2DB 2NTFB 3RUGA 2X4TB 4KJYB 1RFDH 4JO2H 4DFIA 1H3PH 3VI3E 3DXAD 4XHQA 1AKJB 3GIVB 1KLUB 4JPVL 5DC0A 5BJTB 1OTUD 1ES0B 3DRTA 1M05A 3IF1B 1NCTA 3QEGH 1KJVA 4K8RD 3IDIB 1IGFL 5DRWB 5D7LA 3BO8B 3QHTC 2QTEA 3QFJA 4NFCA 5JNYB 1DEEA 1QPPA 1G7JA 1P6AB 3DVIA 1RIHH 3IFNL 3Q1SH 4ZDHA 2HWZL 4PJCF 2FNBA 4NGHH 5HI4D 4YAQA 4G5ZL 2YD8A 4KMQA 1ZA6B 5A3IC 2WP3T 3KXFE 3V7MA 4XP1L 3OJDB 5I73C 2DQHL 4LQFH 3D0LA 4WUKH 1Q9KB 4P23C 3S88H 4U1IB 3PV6B 1S3KL 2XXCB 3QNYA 4DQOH 2XKNB 5C92A 2ADGA 1QLFB 3SGEI 2PXYC 4K3DL 2IPKA 4JRWA 1OTSD 5MEPB 5D8JL 4UBDD 3GMQA 3PP4H 1QHOA 1T2XA 4FXLA 2J8UB 3TA3B 3WYRA 4Y2DB 2D0GA 3P9LA 1JPTH 4R0LC 1I8KB 1NAKL 4JR9H 4TYUA 5T1MA 1KV3A 3VXUE 2NY4C 4RFEB 3G9AB 3DX6A 2CXGA 2AW2A 4RFOH 4OF8A 3X12A 2NMSA 3TFKC 1JTOA 1NSNH 2BC4B 1HOCB 1NUFA 1P84K 4MNQD 3EJJX 1EFXD 4M03A 5TQ0L 4APQD 4K94C 3VGAC 3WUWA 4GKOA 4N8VB 3S5LG 4HMCA 2BZDA 5C0CB 4WWKB 1GGYA 5ISZD 3HG1B 2BSSB 4U0RB 4L8DB 4YDVB 3MLSL 1VFAA 1TXKA 3MUJA 4TTDD 4ERSH 3WEXA 3S96A 3RNKB 4IOIA 1M6OA 4YC2B 4X8JA 5C6PB 1SM3H 3ZDZE 3M1BA 3HNSL 5BQ7A 1AGFA 1CR9H 1Q94A 1UM5H 2HT3D 1YEGH 1DQDH 4OZGA 1QBMH 4BSWA 4XPFH 1JZ6A 3WHXB 3BKJH 1IQDA 1MVUB 2ESVB 1XCTA 3MUHL 4NQDD 3LPWA 1QACA