4ALAL

Structure of dengue virus diii in complex with fab 2h12
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
DIVMTQSQKFMSTSVGDRVSITCKASQNVRTSVAWYQQKPGQSPKALIYLASNRHTGVPDRFTGSGSGTDFTLTISNVQSEDLADYFCLQHWTYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ENVELOPE PROTEIN
publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
source organism Dengue virus 3
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2012-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4alaL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4alaL01
2P5WB 4PUBH 5CBAA 3DRTB 5HBBA 2HN7B 1PVHA 5DHYA 3PP4L 5D1ZD 3V4VL 1X3DA 5JW5B 5LWYL 4QO1A 1QBBA 4HJGA 1EGJA 3WNLA 2X4QB 3QDGA 1OAYH 1C7SA 2LAAA 5FM4A 3VFTB 5D2NA 4N8VA 1HI6B 3MV7B 1EXUB 2XN9B 1KLUA 1YNKL 2VMFA 3LV3A 5D2NC 1SJHA 5E8DH 1EH9A 1S78D 4RDQF 4LMQE 5FB8B 3VXMB 3LEXB 4ZUUB 3RHWK 1I75A 1KJ2L 1X4ZA 3VG0L 5DD0L 5AAWA 1A47A 1AKJD 1ZWIB 1IC7H 4Q7DA 1FNLA 2P5WD 4FMFA 3OXRB 5F1SA 1A9BA 4LLUB 3KPLB 3MYZA 2XA3A 1RIUL 4GS7B 4JHAH 1ZLVK 2O5XH 3RBGA 1XIWA 1CFSB 3IU4H 2BOCB 1TVBB 2J1KA 1SY6A 5K59F 1CN4A 1W0YT 1XIWC 5KVFL 2NX5A 1BMGA 2ZUYA 1T89A 3MV7D 5CBAB 4OFIA 3RGVD 1T83A 1T89C 4N8CH 5D1QA 2Q6WA 4Z95L 1T83C 4HJGB 3VXMD 1OCWL 5B39A 4ZOBA 1IGYA 5D1QC 4ODSH 3EJJX 3QDGB 5L9DL 1X6NA 2D7NA 3FT3A 5D2NB 1KLUB 4H0GA 4F3FA 3LV3B 4PS4L 3UJJL 1SJHB 2Y1VA 5F7LB 2ATPA 1QBML 1ZHLB 2JJVA 4AY0A 1M7IA 1KJMA 5I1IL 4OGYH 5F70A 4PGBA 4ZS7L 2DQCL 5AUMA 3T3PE 1A9BB 4PRIE 3WV0A 2X6MA 3MOAH 3QA3A 4K8RD 4QHUA 2HMIC 1XIWB 5C6PB 1O0VA 4PGZA 5CGMA 2FR4A 3QDGD 2PYFA 1NFKA 3P77A 3NACL 1Y18A 4UBDD 2YRLA 2ZCLL 2OQJB 5D1QB 1LEKA 2Q6WB 4HUNB 1OARL 5B39B 1IGYB 2XZCL 4GRWE 1JNHA 4HKJA 4KGLA 1NUFA 4I77L 4G5ZL 1UVQA 1FO0H 3FT3B 4GOSA 3WMSA 3UBXA 5IB3A 4AH2A 4KROC 4UOW0 5I1EL 4HUMB 1C5BL 4LQ1A 2ATPB 2GJJA 4MZ3A 3SKMA 2M1KA 3WIFA 2ESVE 1MNUH 5C0BA 5GZNC 4LLMA 1KJMB 2DWEA 4OZGA 1UADC 5CEYA 2ZUXA 4AZ8A 4PGCA 4OGAD 4OTXH 4PGBB 5AUMB 4JQIL 5FUOL 5DUPL 4M7KL 3QR2A 1XF3A 3QA3B 4I48A 1IAIL 4QHUB 1J0JA 3TBTA 3UXFA 3TP4A 1JWSA 1NC2D 1Q0YH 2FR4B 1A7QH 2YRPA 2PYFB 4H88H 1N6VA 3U4BH 2AERT 1T80A 3P77B 3T3ME 1Y18B 3TIDB 2ARJB 5I1KH 4LFHD 4E5XB 4K23L 2NY6C 4DUWA 1ITBB 3IXAA 1WEJH 1LEKB 3GUTA 2YK1H 1D6EA 2ZCHH 3FRPA 3G6JA 1JNHB 2HAZA 4HKJB 4D0CB 1MIEH 2HT2D 3MGTA 5FGSA 1UVQB 4ORGB 4KROB 4PLJC 5JW4N 1FGNH 3F8UB 5IB3B 1FIGL 2P49B 3H9YA 1PG7W 2CDFB 1ZV5A 5HHME 1RUQL 3MFGB 3SKMB 2AJSL 4PJDE 3BZ4A 3LDBB 3WIFB 1G7HA 5B3JF 3RWDA 5C0BB 2P8MA 2DWEB 4OZGB 2EH8H 5CEYB 4P49A 4PGCB 3FFCE 4S1QH 2W9LA 1ZLUH 1B90A 4P2OA 1YEKL 2P45B 1BREA 1F11A 2HVJA 1ZHNA 5FYKL 4UV7H 4P2OC 5BZDA 1XF3B 4I48B 3TBTB 3MRQB 5HHNA 3AFLA 1JWSB 1CICA 1MI5E 3NCFB 5GIRA 2XTLA 2YD1A 2P42B 5C0IA 1X5YA 1MJUL 3BIBX 1NGQH 3DHJA 2ZPKL 1IKNA 4TNWK 4Y19A 1J18A 1IKNC 1D6EB 1W72L 3CFCL 4K07A 3CAFA 3G6JB 3ZE2F 5IWLA 3PDOA 3MGTB 2W9DL 3LQZA 3EO9H 2DJUA 4HH9A 3CH8A 4LCCC 1WIUA 1IAKA 4BZYA 3TBYB 3TGXA 1EO8L 2DLFH 3MBXH 5FIEA 3QG7L 3K8MA 5F3HA 2D7QA 3VRIB 1MCDA 2P8MB 1YNLL 3O4OB 4P2QE 2R0LL 2YD6A 1F45A 3I84A 3KXFE 2Z92A 1BF8A 1YN7A 4ZOAA 3GHBL 3QHFH 3BKMH 4P2OB 3LS4L 5K9JL 2VZUA 3MRJA 1ZHNB 4UQ2A 1L7TH 4M7JL 5BZDB 4JPKH 4LSVH 1QNZH 5HHNB 3MRFA 2MTPA 5GIRB 1CICB 2XWBA 4F57L 2XZZA 4ERSH 3MODH 4NUGL 2CIIA 3RWHA 2BJML 3BUYA 5C0IB 1TNMA 4GRMA 2BSTA 2H32A 4Y4FA 1K85A 1MAJA 3BPNC 4V1DE 4Y4FC 4Y19B 3O8XA 3V0AC 1UWEH 2IPUG 3O8XC 4D0DA 3PDOB 3GMNA 1H8SA 4ONHA 5GRWA 3HNVL 1JRHL 3LQZB 5IIEB 1DUYA 2HFEA 4Z8FL 1IAKB 3SCMD 4RQQB 2EEBA 5F3HB 3HZYA 1UH4A 3QPXH 3I9GH 1CICD 4EQ2A 1TIUA 3ZHKA 1EFXA 2A74B 2Z92B 4X7CC 2RAMA 1N5YL 1YN7B 1OWWA 5GGTA 4JHZA 5SWSE 4KMTL 4HXAL 4RFNC 4CGTA 4L4VA 1JGUH 4J23A 5DJ2A 4KKLD 4Y19D 2K9UA 2A0LC 4JKPH 4EIGB 2VC2L 4CVZB 1CVRA 3H9SA 3MRFB 5HTSA 2XWBB 1MQ8A 2CIIB 3RWHB 3BUYB 1MPAL 3V6ZA 4DTGH 5CAYB 1MRFH 4GRMB 1HWGB 1T4KA 2H32B 3BQUA 3BOVA 4JJ5B 4PLKD 3BQUC 3O8XB 1CGVA 4D0DB 3D39B 3GMNB 4ONHB 1ZVHA 4LLVB 3I50L 5CEXA 5I0ZA 1A7RL 3ZDZE 3NTCH 2HFEB 2YMXH 3QWOA 2AKRA 3BKCL 5FDWA 3HZYB 4M93C 5D6CB 2R15A 1EFXB 5LXGL 2GITA 3BPOB 3H7BA 4YZFE 5HJ3A 4RFNB 1KJ3H 3P9WB 5GZOC 1J0ZA 1RPQA 2VUOA 1DANT 5DJ2B 3BVNA 3RBSA 4BFIA 1MCWM 3H9SB 1Q8MA 4NP4L 3D39D 5FYJD 3ESVF 1ZGLM 2PF6A 4TSAH 1I9IL 3MLUH 2EDQA 3V6ZB 4BK5A 3UPAA 3MACL 1T4KB 3MCLL 4ELMB 2E6PA 1EMTH 3ZE1F 2DAVA 3QDMD 1BIIA 1D5BA 1MELA 1EFXD 4I2XB 4UINL 5CEXB 1N7ML 5IVXA 4YDKL 4M93B 4FQXA 5ANMA 3QWOB 1HSAA 2AKRB 3SN6N 4C58B 4XPGL 5FDWB 4FQXC 4M62L 3H9SD 2HT3D 3QCUL 2X44D 3VFGL 2GITB 3KAAA 3H7BB 5HJ3B 5BV7L 1EJOH 2R0ZH 1HWHB 1VKXA 1CFQA 5KTEH 2A77L 4P5KA 3RRQA 2OR8A 3BVNB 3ME0A 4K71C 4XB7A 2A73A 4BFIB 2YPVH 3UTSA 1JGLH 3PWPA 1RUAH 5C0RL 2P8LB 1E28A 2CLVB 4IM8A 5CZVH 1G9ML 1W8OA 3GRWH 4M1CD 4JFEE 5HYFA 2OP4H 2UY6A 5T3ZH 1ZS8A 3GNMH 4DFIA 5FOBA 3G5ZA 3Q6FA 2BOBB 4UTAH 5DR5L 1BIIB 3G08A 5ESQA 3IDGA 1AC0A 1FZKA 2BSRA 3BE1H 5IVXB 4U1GC 4BM7A 4FQXB 5ANMB 1JZ3A 2FBJH 1WFOA 4JREC 4S1DC 4LSDA 3RUGF 1JE6A 4OQ1A 4AK1A 4PJGF 3ROLA 3QXWA 4U6HA 2Y36L 4L8BA 3F6LA 5TF1H 1VKXB 1F5WA 4YBLC 2RQ8A 4N0UE 3REVB 4P5KB 1IC5H 1UJ3A 1C1EH 4PJHA 4HWEL 3BJ91 3N1MC 4J6RH 5E8OA 3RY5A 3U83A 2F15A 3HUJA 2A73B 3PWPB 3GKWH 1I7ZB 1E28B 1E4KA 3CXDL 4EUPG 3AXLA 1E4KC 1NMBH 4IOFD 3GO1H 1Z5LA 3F12A 2XFXA 1ZS8B 3QWRD 3HI1A 5FOBB 3G5ZB 3QUML 3Q6FB 1UCBL 2JB5H 5ESQB 3IDGB 4PV8A 1FZKB 5HDQH 4Y16C 3U1SL 4EI5C 3QNXA 4OZIA 4D2NA 2G60L 3WHE0 1MWAA 3ZKXC 2BSRB 3GM8A 1JMZA 3CX5J 1BPVA 4FMKA 1IAII 4JREB 3B9DA 4KZEL 3UPRA 1RUKL 1L6ZA 4PJCA 3D48R 5DQJA 3ROLB 1CZ8H 3P3YA 4L8BB 3FKUS 2DQTH 1OM3H 3X17A 1ZTXH 5I8KL 5F7HA 5F1IA 1UJ3B 4PJHB 2AJVH 5E8OB 4JFFA 3HUJB 3WD5L 4AENA 1U3YA 4BA8A 4UIMA 3QRFM 3GI8H 4LGPB 1Q0XH 3MRKA 3V52L 2E3VA 4QRUB 2RFXA 3ISWA 5DLMH 5KSVB 4RMUA 1MFCL 2H2SD 1NUNB 1Z5LB 2XFXB 2X70A 2HKFH 3GJEB 4S1DD 1RJCA 3HI1B 5HDBF 1FSKB 1IM9B 4Z7WB 4A2LA 4KXZH 1PSKH 1MUJA 4PV8B 4ZAKD 3QIUC 4UTBH 3ZKXB 5HVHC 4OZIB 3QNXB 4PY8J 5EB9A 3QNYA 5LGHL 2FDBP 2XICA 2BXZA 1D5IL 1T1XA 3SGDH 4LSPL 2B5IC 1RZKC 4XC1H 5GS0C 3UPRB 1U2CA 4LVOB 1JHLL 1IGTA 4PJCB 3T65A 5DQJB 5DMKA 2APVA 1IAOA 4JQVC 4ZOCA 4Q9RL 5F1IB 3S88H 1PG7X 4Y2DA 1JFQL 3DI2B 1AXTH 4JFFB 1IM9D 3ARBA 4AENB 3T8XA 4OM0L 3RL2A 1MJ7L 3KPQA 4NQEA 3LN5A 4Y2DC 4UIMB 1T6VN 1S8DA 3ARBC 4M1GL 5TFSL 3MRKB 4K7PH 2RFXB 1DBAL 3RL1A 1YY8A 2ARJQ 3JZ7A 1Z0MA 5C3TA 3P0YL 2DBLL 2X70B 2W0FA 4J4PD 4J8RA 1BQLL 1XF1A 4I13B 4O4YL 5HPOA 2Y06H 1WWWX 1MUJB 4LPXA 4WFFD 4G7YH 1JTTA 5DUBB 3SDYL 2WZPD 2KL6A 15C8H 1V3MA 1MCPL 4Z7UE 35C8L 1U8JA 4GG6A 1PBYA 3QNYB 4JO1H 2AXJA 1MCIA 5CCKL 1T1XB 4JFFD 1NJ9B 1OD7A 4L5FL 5FYJU 5J06A 1IGTB 3T65B 1HIMH 3N1PC 5DMKB 1IAOB 4Q2ZA 1CTNA 3HAEG 3E3QC 3VE0A 4PJ7E 3PDDA 4Y2DB 4POYA 4L4JA 3ARBB 3T8XB 4DZ8B 3RL2B 3MC0A 3KPQB 4NQEB 1FL5A 4TSBL 1HHJB 5BMFH 1KENL 1S8DB 1F4WL 3RL1B 3UYRL 2UUDK 1YY8B 1QEWA 2OS7A 4X80H 5FUZL 3OKYA 2DYPA 3OAYK 4NQCE 1DBJH 2W0FB 4J8RB 3F7QA 2Y07L 5F6IB 4WFGE 4CVXA 5H8DA 2UVFA 3CFBA 4DKFH 4FFYH 1HXYA 1S9YA 3QEQA 1U8JB 4K55A 3X12B 4GG6B 3OZ9L 7FABL 1BP3B 4NO0D 3QFJD 1D9KA 1MJJA 4Y2DD 3LKOB 1D9KC 4NQED 4BUHA 3K74B 4HIIA 5IJKA 4JGMA 2WUCL 4TVPE 2VDQH 1OPGH 1QFPA 3QIBA 4Q2ZB 1U3JA 3ULVL 3VE0B 2D0FA 2EDDA 3QIBC 1BZ9A 1FNGB 3B4NA 4NQDE 1J12A 1OTUD 2F58L 1UZ8A 2MCPH 4DOHB 1FL5B 2XACC 4PJEE 2YS4A 5J6HA 1QEWB 2R39A 3CFJA 1GJIA 2DYPB 1ORSA 4OLVL 4QHNA 2VITA 4OFYA 4AM0A 5T33H 3WFEL 5EUOE 4CVXB 5E0QA 3CFBB 5HHQA 5J57B 4LDLB 3FQWA 1BVZA 4GMTL 5DD3H 5T1LA 1HXYB 1S9YB 1E4XL 3QEQB 3THMH 2XY2A 1OTTC 4JM2B 4L29A 3DX7A 3W5NA 2R2HA 4GKOA 3SKJH 1D9KB 1MJJB 4K94H 4X9GA 2EIZA 4NKIH 1HDMA 5D2LE 4HIIB 3GBMH 5KW9H 2CO7B 4OZ4A 4CVWA 2MHAA 3EOTL 3IS0X 5JHDD 1AQDA 1P5VA 4LSRH 1BZ9B 1GGBH 3EDKA 3F5WA 4X7EC 3PNWB 2OXHA 2QSCH 1UZ8B 5B21A 4H5SA 4FXGA 5CJQH 1AC6A 2XZQL 1XGUA 5J6HB 4LCYA 3CFJB 1EUTA 1L6XA 4JM2D 1ORSB 4RMQA 5FEBA 4OD3H 5TE4L 4AM0B 4OCRL 4YUEH 4HKBA 1T03L 5HHQB 3FQWB 3D85A 1EO7A 1DP0A 3SKNA 1N4XH 4O02L 5T1LB 1R5VA 2KZWA 2EIBA 4L29B 2DLEA 2NTSP 2R2HB 4KRPC 4MB3A 3IFLL 1JL8A 4M48H 3DMMA 4X9IA 1A7PL 2EIZB 1HDMB 3D1MC 3MXWL 1F4XH 2IGFH 1S3KH 4OZ4B 4DAGH 3RQ3A 5M7QA 3BAEL 5AZ2L 5EG6C 1NAKH 5I8EA 1AQDB 4OFYD 5MENE 4I3SL 5BO1H 1UJTA 3F5WB 3LH2H 2JIXA 3WFZA 4M02A 4XPBH 5I66A 4H5SB 5EBGA 4FXGB 4P9MH 5T1LD 2BRQA 1XGUB 3DSFL 3L3HA 4LCYB 1IC4H 4QXWA 3RA7L 4EJ1C 4N5EC 4JN1L 3Q3GA 1LILA 2X10A 5ILTH 2X4TA 4RGMB 1U8KA 3GKZA 1FRGL 4HKBB 2DI8A 2RIKA 2XG4A 3D85B 3GSOA 5CIPH 3SKNB 4S1RL 5ETUA 1R5VB 2Q3ZA 3ULUH 1J1OL 2V9QA 2AJYH 5JUEL 5I19H 4WO4D 4GAGL 3DMMB 2VN7A 1V3LA 1RV6X 3DOSA 3U46B 2EXYC 1M05A 4G9DA 3IJSA 4PJFA 3RWCA 3V0WH 5I75C 2DQJH 2AJUL 5JIIA 4PRHE 5K93A 2B0SL 5I8EB 1UM6L 3ZO0A 3KLDA 2ITCA 4KU1A 3MUZ1 2D2OA 5IESH 2GUOA 1Z9SA 2JIXB 1N8ZA 5HI4D 3ZDYE 2P5EE 5I66B 2OMBA 1YNTA 2NY0D 4P5TB 1H3VA 4XZUB 4FFVC 2WBKA 3TCLA 3L3HB 2PYEE 1YPZE 3QISA 3QXVA 2VQUA 3Q3GB 3JV0A 2X4TB 1U8KB 3DMMD 2YWYA 2HVKA 2KKQA 4Z0XB 5SWSD 3DIFA 1CDYA 3Q5TA 2C4FT 3GSOB 3UO1L 3QBTB 4UB0H 5ETUB 4CBPA 3TF7C 1LNUA 4HEPG 2ZSWB 3EZ8A 4ZODA 3E6FA 1BOGA 5I75B 1I8KA 5MEPA 4OSUL 1ZT1A 4XPTH 2UY7A 4P5TD 4G9DB 2ZKHL 2Z8SA 3IJSB 4PJFB 3W11C 3RWCB 1S7VA 2DQHL 1GIGH 4O9HL 3CDGA 4JDVA 1EZVX 3HI6L 3B2UC 3FO1A 1S5IL 2ITCB 2GUOB 1G7QA 1N8ZB 2I5YH 4K3JL 3MRCA 4KVCL 3AS3A 5ACMA 3MRRA 1YNTB 4JFDA 4WEBH 4XP4L 3TCLB 2OR7A 3ZE0F 3TIEA 4LIQL 3WO4C 1H3XA 1CXLA 2EXYD 2HVKB 4BZ2L 3DIFB 4EI6A 3KWWA 2WSKA 3N85L 4TOYL 3RVWC 1JK8A 4XPHL 1AFVL 4HIHA 4ZDHA 5D72L 1NEZG 2XOTA 3T0EE 4N68A 2F5BH 2WBWB 4YE4L 3TH2T 3E6FB 4KK9C 4OF0A 1BOGB 1N6QL 1I8KB 1RUPH 1UA6L 4FFVD 5MEPB 1S7VB 3GSQA 2A6JA 4XNYH 3CDGB 4P5MA 4JDVB 4QXGL 1N26A 4LRNL 2E9JA 3PP4H 3EBAA 1VEMA 3V4VH 3FO1B 4LLDA 4UV4H 2O5ZL 1V8HA 4Y1AD 5LWYH 1F00I 1G7QB 3WDHA 3MRCB 4EVNA 3MRRB 3S4SA 2ICWI 5E9DE 3FMGL 2ED9A 4XNZC 4F37F 1MIMH 1YNKH 3TIEB 3WFHB 5A1AA 1S9XB 4MB4A 1KJ2H 3V8OA 3W11D 4B53A 5FHAL 3W0WA 5DD0H 4EI6B 3KWWB 1JK8B 2XIDA 4HIHB 3B2UD 4ZDHB 3TVMA 2YC1A 4R2GC 1FO0A 1RIUH 5L2JA 4PTTA 3TVMC 2WW8A 4LSTL 4D3CL 4H1LH 3QO1A 5F6HI 3VFPB 1NL0L 3VXRA 3GSQB 2A6JB 2ARWA 5C7XH 1D5XA 1W8NA 3V5HB 5GRUL 3CVIL 1VFOA 4LLDB 3CJJA 2BCKA 4J3VA 4Z95H 1OCWH 4XNZB 2Y7QA 4NUJA 4EVNB 5L9DH 1UEYA 1MCLA 3S4SB 3PE9A 4HULB 2WLYA 2EKJA 2DI7A 1PZ5A 5IW1A 3AS0A 4KDVA 1OHQA 3BP4A 3AB0C 4PS4H 2K3TA 1U8IA 2CUMA 3VD3A 4CU7A 2FL5A 1QBMH 1NBVL 3KDMA 4JY6A 3W0WB 1VADA 2JCCA 4QNPF 5I1IH 2YUXA 2E27L 5I1CL 1YMMD 3MOBL 4HD9A 4RISL 3KPSA 1J1PL 2DQCH 1L0YA 3TVMB 4RBPH 2YC1B 2D9CA 4NQTA 1FO0B 5L2JB 2C3GA 4ONOA 5JQHC 4DK3A 3QO1B 5CEZE 3D3VA 4RGNC 4HEME 5CJOH 3INUL 3TLRA 3NACH 1D5XB 4FNLL 1TDQA 1QLFB 1BJMA 1H3TA 2ZCLH 1PDKA 5FKPA 2Y9RT 2BCKB 1KIPA 1OARH 4D0BB 3W0WD 1E4XI 2Y7QB 4NUJB 4QHLA 4I77H 4G5ZH 3AB0B 4E41D 4YJZL 1PZ5B 5IW1B 3PQYE 2Q7NA 3CVHL 3LRGA 1U8IB 5I1EH 2CIKA 2FL5B 5CBEA 3IU3A 3SEPA 2Y6SC 4DKEL 1LWRA 2B7DT 3CLEL 1F6AA 3KDMB 4JY6B 4UQ3B 1LP9E 1VADB 2J8OA 2K7PA 4KC3B 2C3WA 3VXOA 3KPSB 4B5EA 4N1EA 5DJXA 4HWNA 5FECA 4JQIH 2VL4A 4TUOA 1MVUB 5DUPH 4M7KH 5E6IA 2BVEA 4F9PA 4RGNB 4J3XA 3DXAA 4ZXBA 3D3VB 5E6IC 2F74A 3UTPD 4F9PC 4ZXBC 3MNVA 2QSQA 1T1YA 3CK0L 4UUJA 4MXVF 3QJFA 4O58L 1D6VL 2AQ1A 1KCSH 1KIRA 3IRPX 4MHHI 4PD4K 4K23H 5FKPB 1NLDL 3FONA 4JANB 2DRUA 5DEZA 1KIPB 4P46C 4L3EA 2XKSA 5ALCL 1JZ6A 4QHLB 5JNYA 2IQ9L 3BDXA 3NGBB 3KPSD 2F54A 4F8TA 2VTFA 3C5SA 1FIGH 2GHWB 2CIKB 5F1NA 5CBEB 3IU3B 2AJSH 1A7NL 3QJHA 1F6AB 2EDOA 3WLBA 3D3VD 1IFHH 3S37X 1X6LA 5C0CE 3VXOB 5DJXB 5FECB 1YEKH 5I1HL 4TUOB 5FYKH 1A1MA 3C6SA 5E6IB 2ZG3A 1X5FA 3K4DA 1NUGA 5EZJA 3B8SA 3DXAB 4LSUL 3LPGA 2F74B 3O2VL 5K59E 5JA8B 3MNVB 1T1YB 4HK3J 4BJLA 1MJUH 4NN7C 4UUJB 1H9VA 5IGXL 1TVDA 3QJFB 3D9AL 1KIRB 1QQDA 2BY1A 2ZPKH 5KSBF 3FONB 5EDXA 1W72H 3CFCH 4L3EB 4PBWD 4PJ9A 5C86A 1GRWA 4BH8A 5JNYB 2W9DH 5FO8A 2F54B 4IJ3C 3C5SB 4WI7A 1YC7A 1EO8H 1UH2A 1RZ7L 2B4CL 5F1NB 3FO9A 1U91B 3QG7H 1WZLA 1JNNH 2DBJA 2IFGA 3QJHB 1I7TB 2VWEC 3WLBB 3VXQB 1OGTA 1J0YA 2R0LH 4YPGA 2KZ1B 3GHBH 4FQIL 5K9JH 5IEKA 5GGTL 2CKBL 1A1MB 4M7JH 3C6SB 3KYKL 4LVNB 5EZJB 3VFWA 1XF5A 4L3ED 4F57H 4NUGH 1V7NL 5D8JL 4IRSA 5HI5D 2GSGA 2R2CA 3H8NA 5LCVL 4IRSC 2MQ0A 4R4ND 2QSVA 5IFJA 3QYCA 3PWJA 2WP3O 4L4TD 4CJ0A 4PJ9B 3BKJL 4ENEC 3CGTA 1E27A 3NIFE 4BH8B 1K2DA 3HNVH 5FO8B 1JRHH 5C09D 1H15B 4Z8FH 1CXFA 3MUHL 3BKYL 3HC4L 3FO9B 1WITA 3SDAD 2EKSA 4I1NB 1OGTB 4YPGB 1PX4A 5DVKA 4Z18A 1N5YH 2Z4QA 4XVUC 5J3HD 1IRAY 2ICES 3C6LA 4KMTH 4HXAH 1MHHA 5F7EL 4F7PA 3OAUH 3B2VL 2VC2H 2W0KA 1FAKT 2EO1A 3VFWB 1SVZA 4PJ9D 5DJ6A 3EFDL 4KMQA 1MPAH 3ORJA 4IRSB 4NZRH 4OCYH 2GSGB 4RMTA 3QQ9D 3JV5A 2NR6C 5IFJB 3JWOH 5FYLE 3PWJB 3FZUC 2YA2A 4GBXA 3ARGC 1U8HA 5FGCB 1E27B 1L4IA 1U58A 3MUGB 3WS3B 4KGJA 3C09B 3ZLQC 3DJ9A 5BRZE 4GBXC 3BDBA 1GZPA 2MQ3A 3I50H 4PP2A 1A7RH 3C9NA 1FPTH 1DFBH 3CPLB 2CK0L 2VDRL 3GRWA 5IB5B 3D87B 2CLRA 3ILPA 5BXFA 2EKSB 3Q6GL 2NY3D 3QEGL 5LXGH 1WBXA 2Z4QB 2CUIA 1JYNA 1I1CA 3L7FA 1MLCA 3C6LB 1MHHB 1ZLVH 4F7PB 1KXQE 4ZTPL 5IW3A 1HEZA 4NCC2 1UZ6F 4Z7QE 5DEGA 4MA7H 3UPCA 4NP4H 5DJ6B 1UKSA 2EICA 5L6YL 1I9IH 3FO0L 1LQSR 2EE3A 4XPFL 4D9LL 3MCLH 5H37G 1I8IA 4WW2C 3EYUL 3T2NL 4GBXB 3IDIA 1U8HB 3IDXL 2ERJC 2HWZL 1U58B 3ZE2E 3R1GL 1MCWW 4OZHA 1GZPB 4KZDL 1CXHA 4PP2B 1N7MH 1Q1JL 3C9NB 4G8GA 1CE6A 4UOW1 4YDKH 3C6LD 2CH8A 1F8TL 5D7LE 3AS1A 5MI0B 1KTRL 4XPGH 4M62H 3ILPB 4TVPH 5IFHL 3KPRE 1BD2E 3QCUH 1B0GA 1FYTE 5MEND 3VFGH 4KKAD 1P7KA 5BV7H 4GRLA 1J0KA 3L7FB 1RK0A 1MLCB 2A77H 2CO6B 3FZUD 4GRLC 5F9WC 1HEZB 4ZNCD 3RVTD 4FFWC 5C0RH 2AEIT 4UU9A 3UBXI 1G9MH 3BRDA 4BQCA 32C2A 12E8L 3C08L 1I8IB 2DS4A 5BW7A 3CUPA 4QCIA 5D5MF 1MCRA 5CUSL 3NH7L 4NKDA 4HIEA 4WW2F 3OQ3B 2CPCA 2ICWJ 3IDIB 4D94A 1J5OL 5CD5C 1V7ML 3NIDE 4OZHB 2JF1A 4YAQA 4S2SB 2H45A 4F8QA 3P40A 1MWAL 4G8GB 1CE6B 5CS7A 1CE1H 3VRLE 2GCYB 1RJLA 3RI5F 4OZFH 1ZGLA 4BFBD 3CC5B 1JUFA 2GSIA 1DQQA 5DO2C 1B0GB 2Y36H 4IRJC 1P84J 3U30B 4FQJL 4QXUL 2CMRL 4GRLB 5IBTL 5KVEH 1KN2L 4OUUB 1A14L 1RK0B 5F9WB 2EDNA 5I9QC 4OCMC 1TTUA 4HWEH 1J8HE 5F6HJ 3PWLA 5J1AB 4MNGA 4HUVA 4M7ZC 4F80A 2NZ9D 3ZYJA 1WC7B 3W2DL 3CXDH 4UU9B 4P4KA 3S36X 5EA0L 1JYWA 3SDDA 1DQLL 32C2B 4G6JL 4FTVE 4G8GD 4P4KC 4G6ML 4MS8C 4E42A 1M1SA 3CUPB 4QCIB 3DURA 2H2PC 4PJIF 4ZPVA 3NN8A 4NKDB 3QUMH 4AEEA 2UWEB 4HIEB 1UCBH 5GJTL 3OJVC 4WY7L 2VE6A 1ZLSL 3U1SH 2X1XR 4JRXE 2VDPL 1S7SA 2G60H 4YAQB 1AD9A 1FVCA 4GW1A 1SJEB 4XP1L 5JIHA 4ELMF 3UTTE 2O5YL 1RJLB 5GS0L 3L1OL 1ZGLB 3FN3A 4KZEH 1IEAA 1HHIA 1RUKH 4PLNC 2GSIB 1M7DA 4BELD 4OB5H 4NFDA 5I9QB 1C5CL 3UZEA 5I8KH 4NN5C 3ARVA 1J1XL 3WD5H 1MFEL 3PWLB 4MNGB 5EO0B 3V6FA 4HUVB 3CMOH 3RGHA 3V52H 4XCNA 3OKDA 4JFXA 2NY5L 3SDDB 4ETYA 1MFCH 3RNKA 4F37K 4HBQA 3NBNA 4E42B 1AE6L 2CR3A 5HDOA 3DURB 4ZPVB 3ZE1E 3NN8B 2QEJA 1A1OA 1I4FA 5E2TL 4MMXC 1BLNB 1TMCB 3MOQA 4JZJA 2QBWA 5HD8C 1S7SB 1AD9B 2CDEA 1FVCB 4HXBL 3T2PA 4GW1B 3ARWA 4R4BA 3VD7A 4XH2A 5LGHH 3B8YA 3KYMA 1D5IH 2KUTA 4LSPH 1UM4L 3CFDA 4HC1A 1IEAB 1HHIB 1JHLH 1BBDL 1I8LA 1M7DB 1YJDL 5CINH 2YUZA 5EZOL 4I0PD 1I8LC 2DKMA 3SDDD 5KANG 4Q9RH 5INCA 1JWMB 3OR6A 5E9DD 3QI9C 4JRYE 2R1WA 3C2SA 1JFQH 1NFDA 3ESUF 3V6FB 4OM0H 1MJ7H 1U8OA 5IFAL 1T0MA 4M1GH 3RU8L 3HNSL 3OKDB 5DS8A 1DBAH 4JFXB 1RK1A 4OLXL 3RNKB 1DEEA 3P0YH 2DBLH 1CD9B 5A2FA 2XWJA 3FN0L 2NW3B 1VACA 4WNQA 4O4YH 2LTQC 1A1OB 1I4FB 3D18A 3KLHD 4I9WE 4JZJB 2W59A 3SDYH 1CD1B 1MCPH 35C8H 2EEDA 4YHYC 1KG0A 5IG7A 2CDEB 5SX5H 3TBSB 4R4BB 4XH2B 5CCKH 5I8CA 1DQDL 2VABA 3KYMB 1C16A 1U3ZA 3B9AA 3CFDB 1F6LL 3OSKA 3QNZA 1T2JA 2NY1B 1GOFA 3RUGE 1MHPL 1EEQA 5JMOC 1MF2L 1FE8H 3WCYA 4ALAL 5INCB 1U95B 2BVTA 3OR6B 3GI9L 2CLZA 1ROWA 4GKSA 4AMKH 4BZ1L 2R1WB 3AMLA 4HH8A 4TSBH 1U8OB 1AR1D 1KENH 3S3PA 3U7WL 1T0MB 1F4WH 4PFEA 3UYRH 5DS8B 5IBUB 1FCCA 1RK1B 4K94C 5FUZH 1DEEB 1XFPA 3WFCH 3DROA 2LTQB 2WBJA 2XWJB 4AYFA 2Q3AA 4WNQB 4U6YB 2C5DC 2WBJC 3D18B 3UZQA 2NY1D 4ODVL 1DVFA 4JLRA 5IG7B 4L8SA 8CGTA 1KG0B 1CCZA 4LPWA 3OZ9H 5I8CB 1U92A 2VABB 4L8SC 3V6OE 4EDWL 3AAZA 3ZKNC 1LO2L 1C16B 3OKNA 1DL7L 2NY4B 4J3OC 4Z7WF 1DDHA 5JZ7D 2IBZX 5JIKA 3QNZB 1R3HA 3MMEA 4TULL 4QRPA 3OXSB 3CNKA 3L95A 5DMJB 2WUCH 5L8LB 3S5LA 4Y4HB 4J3WA 3ULVH 5ID1A 3RVXD 2CLZB 3WDJA 2IAMC 4GKSB 4R8WL 1I1YA 2F58H 4UDTA 2VLRA 1AQKL 4LPVA 2QLVB 3WJJC 1AGFA 3O0RL 3QHZL 4OLVH 3DROB 2DM2A 2WBJB 3DVGB 3OMZA 4AEHL 3WFEH 2NY4D 5DJDB 5EU6E 5HDBE 2QHRL 1NPUA 3OG4B 4OKVA 3DLQR 4YQXL 2PW1A 4GMTH 1DVFB 2RR3A 4JLRB 1NFIA 1E4XH 3RPKA 4L8SB 4AQ1B 4Y4HD 3EYVA 1SMOA 3L3IB 3FT2B 1ES0A 3I2CL 3AAZB 5EBWA 2X9XA 3SGEI 3OKNB 5EU7E 4KHXL 3E6HA 1DDHB 3PHSA 2OZ4L 3RTQA 1UYWL 2ESVA 3M17B 3UMTA 5IQ7H 2X4OA 3HKFA 1R3HB 3MMEB 4QRPB 3RTQC 3L95B 4WUUD 4CKVX 5F7UA 3H7LA 3S5LB 3EOTH 5CIPA 5ID1B 3SDXF 3EYQC 5C3LD 1ZHKA 2YD7A 4AIOA 4LCUB 1I1YB 3T3PF 4M5YL 5GGSA 4UDTB 2VLRB 2J2ZA 3ULUC 4APQA 4JO3L 1DVFD 3MBEA 4X9BA 2XZQH 3FOLA 5E5MB 3S35L 2WM0A 1AGFB 3CFEA 1ZANL 5A3IC 3MBEC 1Z9MA 4PJ5E 5TE4H 1BM3H 4OCRH 4EBQL 1KV3A 2BC4B 4O5LH 3NA4A 5DMIL 2PW1B 4QRPD 1NCNA 4O02H 2I60L 1NFIB 4GRWF 3EYVB 3TA3B 5DJAA 1ES0B 4HZLA 3RKDD 2LVEA 5EBWB 3IFLH 4OI9A 5CEZH 3E6HB 5JMRA 5L88H 3LKRA 1WFTA 3RTQB 1A7PH 2VLRD 2N7BA 3MXWH 5I1LA 4PJ8A 2X4OB 5IUSA 5MHSD 4PJXE 3A6OA 4PJ8C 2NW2A 3EGSB 1ACYL 4FQ1L 4XBEL 4X6CE 1BQHG 3BAEH 5CIPB 5AZ2H 3FL7A 1A7BA 2FEDD 1ZHKB 4I3SH 3TBVA 4RMRA 5GGSB 2BNRE 4G80A 4MCYA 3BP5A 2HT4C 3ZMRA 4APQB 4QTHA 2JELH 2IEPA 2WIMA 3FOLB 3DSFH 4P23A 5CILL 3CFEB 3TA3D 3RA7H 1DEDA 4JN1H 2BVOA 4P23C 3F7PC 3HR5A 1FRGH 1KB5L 2EE6A 3RVVC 1BFVL 4N1CA 1JGDA 4GG8A 4S1RH 2V5TA 2VISA 3IJYA 4UZGA 5DJAB 1J1OH 4HZLB 2DL2A 2OL3L 5JUEH 4YNYA 3D0VA 4GAGH 5HHMB 3LKRB 5JORA 3EIFA 5DFVC 3VA6A 5KVDL 4PJ8B 1J88A 4NYLA 4XC3L 2BMKA 4APQD 1TETH 4OFDA 4U0RB 4PJDF 2AJUH 1G6RL 3F7VA 3S9DB 3RZCC 4JM2F 2B0SH 2BXYA 5BQ7A 1UM6H 5JLZA 3MYJB 2Q87A 1MFBH 3TBVB 4UOJA 4M3KB 4NRYA 1P6FA 4G80B 3BP5B 2IBGA 4IOIA 3M07A 5D7KE 3SQBA 3QZWA 4QTHB 5C0AA 4P23B 4NC1E 1NSNH 5J13C 2BVOB 2V5YA 1JGEB 1XR9A 3HR5B 3IJHA 3NCMA 2GQHA 4N8CL 4WEUD 3UO1H 1JGDB 4GG8B 3I6LE 5EO9A 3EYFA 2RHEA 4QOKE 1FNHA 2J4WL 2VISB 3IJYB 4ODSL 2BK8A 2GIYA 1OQOA 4YR6A 1SJXA 4YNYB 3D0VB 4PREA 1X9QA 3NPSC 4LSQL 4UT6L 5JORB 4OSUH 1S5HA 2BMKB 2YZ1A 3WE6A 2CR6A 2X4RA 4GH7B 1B6UA 3JBG7 1KJ2A 3X13B 3F7VB 5GGRA 1KGCE 4O9HH 3O6FC 2VZ3A 5BQ7B 4KJYA 3RVVD 5JLZB 3HI6H 4OGYL 1S5IH 4F9LA 5EC1A 4NRYB 3WUWA 4F15C 1IEBA 2E7LA 1KOAA 1AO7E 1YYML 3ARDD 4K3JH 3S96A 4KVCH 4IOIB 3QZWB 2E7LC 4H1LA 4XP4H 4ZSOA 5C0AB 1AI1L 1G7JA 3K2UL 4LIQH 1XR9B 2X4UA 5DFVD 5ABDE 4TSCL 4BZ2H 3IJHB 1K6QL 1Q9KA 5EO1A 3AREC 3N85H 4XNQA 4RFOL 1GXEA 2W0PA 5EO9B 4TOYH 2AXFB 2AK4A 4XPHH 1AFVH 4QLRA 2FNBA 5D72H 4YR6B 3NPSB 1A6AA 2OLDA 2J8UF 4PREB 2E7CA 3MJ6A 2XRAL 1N6QH 1UA6H 4HDIA 1S5HB 3WE6B 2X4RB 2M26A 1KJ2B 4MAYC 4WFED 5C0AD 5GGRB 3OJDA 3DHMA 2HTLC 2W60A 4DGYL 1J86A 5HHOE 3RIFF 2Z93B 4KJYB 2UV3A 2R2EA 2O5ZH 4OTXL 3PHQA 5EC1B 3ES6A 4XBGB 3WUWB 2DL9A 3S96B 1XGQA 4KK8D 1D7FA 4MNQE 2V2WA 2UUDH 1OB1A 2EO9A 3O3EA 3ABZA 3FMGH 3OAYH 4H1LB 4ZSOB 3VFSA 3T2OA 1H3UA 1G7JB 3O45A 2X4UB 3RI5K 1GAFL 3ZSSA 3B9KC 3MNZA 2B2XL 5FGBA 5FK9A 1FBIL 1Q9KB 4XTRD 4JGUA 1GGIL 2G5BA 1WEJL 4XNQB 3IFNL 1T6WA 5FGBC 2AK4B 2X4PA 2XZAL 4KTYA 1XT5A 1A6AB 1KCVL 2LABA 1CXIA 3ZDZF 4D3CH 1L7IL 3QPQC 2FECL 1NL0H 4HDIB 4MB5A 4KK5C 4LVEA 2Z35B 3HB3D 1XCTB 4R26L 1CGUA 4LDOB 3OJDB 3IVKA 1S7WB 2W60B 5L0QC 4WENB 3MJ7A 5GRUH 4YZFF 2R2EB 2C1PA 2BDNL 3PHQB 3ES6B 4PJAA 1XGQB 2V2WB 4KWUA 1OB1B 4KJQD 1AHWA 3O3EB 1XGPA 4M61A 2AK4D 1WTLA 1AHWC 5AYUL 3KR3L 5HPMA 1KLFA 3O45B 3GSNH 4DGIL 4N0CD 5DA0B 1I3RB 3IB4A 4YDJB 3FFDA 3MNZB 5FK9B 2VZTA 2E27H 5I1CH 2G5BB 1OAZL 3MOBH 4RISH 1J1PH 2GT9B 4WI5A 2X4PB 2VDML 3S36L 4QTIL 3KYOA 4FA8A 2MCG1 3MBXL 3MZGB 4P3CL 3INUH 5L0QB 1EK3A 5KS9F 2VLMD 5CP7A 3IVKB 4FNLH 1JNLL 3MJ7B 4N0UA 2VH5L 1QTYT 2VLKE 1MSPA 3VXTA 2C1PB 2PNDA 3QHFL 3BISA 5L2KE 3LD8C 4PJAB 5CGYD 3UTTD 2XY1A 1AHWB 2WWKT 1XGPB 4MNHA 4LSVL 2BY2A 4M61B 3K4ZA 3PV6A 3ZE0E 1B9ZA 4L3CA 3PWVA 3CVHH 4P3DA 3QXUA 4UMGA 1EHLL 2LVCA 1NMCC 4DKEH 4GFTB 3CLEH 4WW1A 3FFDB 3IAGC 2BVYA 3SKUD 1CDJA 4KTDL 2MKLC 3DNKA 4PJBE 1ERNA 4IDLA 4GO6B 1AGEA 1T2QL 3GGWB 2NZIA 4ODBD 3N06B 1B4RA 5C0JA 1CLCA 3KYOB 3RJDA 2FYYA 5CMAB 4WI4A 4LCWE 4MQXD 2DN7A 4ZPTA 5HI3D 1JJUA 3CK0H 5CP7B 1AD0A 4O58H 3C5ZA 1QLEL 3WFBH 1A6TA 1D6VH 4X98B 2PTTA 5E8EA 2EYTA 3VXTB 1NLDH 3LD8B 4HPYL 4KI1A 4XNMA 2IQ9H 4MNHB 3PV6B 1MCFA 2HYMA 4L3CB 3PWVB 1NMCB 4P3DB 6FABH 3VGGA 4DTGL 1A7NH 4XI5D 1RFDL 2F9BT 3MUY1 1DZBA 1W72B 1LO0H 5SWZE 1IBGH 5I1HH 3FOMA 4LF3A 4D8PA 3RPIA 5C0JB 2WMPA 4YH6A 4K7PY 4UILL 5FYKD 1MAMH 1X44A 2FYYB 4DUVA 4LSUH 4RA3A 2CXKA 5IK3A 3O2VH 4ZPTB 3NAAH 3MRMA 1AD0B 3MLZH 3Q1SL 3QP3A 3C5ZB 2HTKC 4NO2A 5IGXH 1AY1H 3D9AH 2PTTB 3VG9C 5E8EB 2EYTB 3ZTJG 3MNWA 1KJ3L 1TZHA 5T3XE 2VXUH 4XNMB 1UWXK 3LAFA 4XMPL 1SQ2N 3WN5B 1OTSD 3HPLA 1CLYL 4R0LA 1S7XB 2B4CH 4R4FL 4R0LC 1KFAL 3MLUL 1FG2A 2EIDA 1AGBA 1GSMA 1UGNA 4KJPC 4JZNA 3VH8G 2PETA 2O61A 1A6WL 3JWOC 3ZSTA 3FOMB 3C5ZD 4FQIH 3UP1A 5GGTH 2CKBH 2J6EL 3EOAA 3LCYA 3RPIB 3IAPA 1IZJA 2DJSA 4CVUA 3KYKH 1Z9LA 1CGXA 5D4QA 4EOWL 4LHUB 5IK3B 1V7NH 5D8JH 3AS2A 3K80A 4XCEA 3VG9B 3MRMB 3VMOA 5LCVH 1K9TA 4NO2B 5CHNA 3QQNA 1BWMA 1IGJA 4PJ7A 4QHMA 4MA1B 3MNWB 1EJOL 2R0ZL 3KYNA 3BKJH 4GAYA 2I26N 2PR4L 4G8EA 1RZFL 3HPLB 2P5WE 4PGEB 1OQXA 1P4IL 4BQ9A 5E8NA 4NQCA 3HC4H 4LBEB 1NBZA 3GRWL 4N9GA 1FG2B 3ARZA 1AGBB 2OP4L 3RY4A 4LHUD 5T3ZL 3MROA 2G75A 4JZNB 4WIQA 1TQCB 2O61B 5TDPA 1VB9A 5DZNA 3MV7E 1T0NA 1ZVYA 2HJKB 2L4OA 2XN9E 2YZ8A 5E95B 2FLBT 4XMKL 5F7EH 4Z7UF 3MJ8A 3B2VH 3VXME 3BE1L 2LU7A 1VFAB 1S7UA 4R97C 3L3DA 2ZUWA 4MA3A 2OCFD 3EFDH 5D1XA 2OI9C 4XCEB 5F96L 4BSVA 3OG6B 3RHWF 1ZXQA 5D1XC 4K3HA 4YHPA 1UB5A 4MXVE 5LGKA 2UZIL 5CHNB 1IGJB 4PJ7B 4WFHD 4QHMB 5I1GH 1QHPA 4FN0A 4NQDA 3KYNB 4OLEA 2XTJB 5DHVA 1IC5L 1DSFL 5FUCE 3HZKA 1JWUA 4G8EB 4RMWA 4PJEA 3CXHK 3NCJL 1ADQL 2D31A 5E8NB 2CK0H 2VDRH 3GMLB 4NQCB 3WLWC 2O93L 4N9GB 4ZTOH 5INDA 5EUOA 3U4EA 3MROB 3QDGE 2G75B 3QEGH 4NOBA 5AG9A 2RCSL 5TDPB 1T0NB 3TNMA 4ZTPH 3F62A 3SQOL 3MJ8B 4R97B 4KRLB 3VMNA 1RJYB 2JJSA 1S7UB 2OI9B 2XTJD 4MA3B 3SGEH 4OZFA 1R5IA 2JJSC 5D2LA 2EDEA 2E9IA 3E0GA 5TE7H 5L6YH 3FO0H 4BSVB 3MV11 4YHPB 1QRKA 1UB5B 5BV7B 2AVGA 2K7QA 6CGTA 1EERB 4NGHH 3KG5A 1CGTA 1CLZL 5KSBE 4PRPD 4HFUL 4NQDB 3EYUH 3VXNB 1ZTXL 2HWZH 2AJVL 3HZKB 3R1GH 1JWUB 3BN9D 4PJEB 4KZDH 2X1OA 1Q1JH 4HK0B 2YR3A 1F8TH 2D31B 2NYYC 3GI8L 1H3GA 2FECI 3IF1A 5T5FL 3EDEA 3LEYL 3QEUA 2NXYD 5FDYA 5INDB 2HA1A 3U4EB 5IFHH 5C2BL 2HKFL 3QUMA 2A1WL 4KH2A 4ODWA 4QRTB 3MPCA 3IETA 2D0GA 1JPSL 4F7MA 3TNMB 3ZDXE 2X4SA 2AV7A 4NZDA 5AAMA 1RZGB 1G7IA 4OZFB 1S7QA 4OCNC 2IC2A 4QXTA 4XC1L 1RURL 12E8H 5D7IB 1QBAA 5CUSH 1P7QA 1J5OH 2EXWC 1NLBL 3DX6A 3VDCA 1V7MH 2FX9H 5TGBB 2VLJB 3NFPA 3G5XA 2ZWLT 1MWAH 2DQIL 1G7LB 1EUUA 3WL9A 3IF1B 5FYKU 4AT6A 2GJZA 3QEUB 3SDCA 5E1HB 3KPOA 3SDCC 1WAAF 5JW4Q 2BP3A 3QUMB 4ODWB 4FQJH 3P9LA 4QXUH 1QR4A 3IETB 1JI1A 2CMRH 4HIXL 4WI2A 2ZNWA 5IBTH 1KN2H 1A14H 2MPAL 4F7MB 1BECA 4G7YL 3AROA 4Q9BA 2X4SB 2PN5A 4MSWA 2AV7B 5E2JA 4YWGL 1UWGH 2YEZA 1G7IB 2ZUVA 2QADC 1S7QB 4OAWA 2Z8RA 2VLJD 3W2DH 5AG8A 4QXTB 5EA0H 1DQLH 4G6JH 1HIML 4G6MH 1I1RA 4GQPH 4N8PA 4QYOA 1GYAA 1GGTA 5GJTH 1WGOA 3BZDA 4XHJC 4C83A 2P5EA 4PP1C 1ZLSH 2VDPH 1DANU 1M71A 3HE7A 2IH1A 3G5XB 2ZP0T 5DJYA 3SJVA 3X3GL 3DV6B 3WL9B 4NHCL 5C70A 5GS0H 4YGAB 4AT6B 2GJZB 3L6FA 3SDCB 3QDAA 3KPOB 4HC1L 4M03A 3TBWA 3BGFC 1G9NC 3G6JE 5CJBA 2VERN 4TNWF 1HYSC 3S34L 3OF6A 1C5CH 2DM4A 1E4WL 4ZNEA 3QUYD 3RIFK 5IMMA 2H6PA 4P2RA 4MSWB 4M4PA 2ICWA 1MFEH 3EDFA 1UZ6E 2YEZB 3GM0A 1JPST 3LOWA 4OAWB 5ICYB 4HJ0D 4YBQC 3TESA 4MHHG 5DSCA 3W9DA 2NY5H 1MHEA 1BFOA 1AE6H 5FA3A 5E24E 3L5XL 1T3FA 4WEMB 3GMOB 5E2TH 4C83B 2HG5B 2P5EB 1HCVA 5E6YA 3GFUA 3I75A 1M71B 3HE7B 1OW0A 5DJYB 3OB8A 5F7NC 3SJVB 4G8IA 3U9PL 4TNVF 1OW0C 1KT2A 4O2EB 2AJXH 2VR5A 4XWOD 2HP4A 3L6FB 4KI5D 4HS6A 1JF1A 3ETBF 4Y19E 5FFLA 4CMMA 1WFUA 1YPZF 3TBWB 3GIVA 1FORL 1BBDH 1YJDH 3U7YH 5EZOH 4CN1A 3DECA 4F7EB 3VGFA 4YPJA 4DCQA 5F7MC 4BQBA 5IMMB 3T0EA 4P2RB 4Z7VA 4KAQL 3F58L 1NGYB 1NKRA 2Y5TB 2OTPA 1CTOA 2ICWB 3O9WC 3T0EC 4FZ8L 2PO6A 3UX9B 5ITBL 5IFAH 3SKJL 5DSCB 2PO6C 2DMKA 3HNSH 3W9DB 2A6IB 1B6DA 3HE6A 3HE7D 4HKZA 4K94L 1IEHA 4OLXH 1MHEB 1GCFA 1BFOB 3L3OA 3HE6C 3GBML 1Q9LA 5FA3B 2V6HA 3FN0H 1IQWL 3FTGA 1T3FB 2AXHA 2BVPB 2VDNL 4FABL 3MA7A 1CDIA 4XVSL 3I75B 4XCCL 2QHLA 3OF6D 2R9HD 4LLWA 5ADPL 3EFFA 4G8IB 3LKPB 5LBSL 1DQDH 1KT2B 4WU5A 4P2RD 3B6SA 5CJQL 4HS6B 1JF1B 2UWEF 4CMMB 4YBQD 1NGWA 1UEMA 3L5WB 4HMDA 3JUZA 3OB0H 3D39E 1MHPH 5FYJE 3FT4A 1MF2H 4ALAH 1HNFA 4P9HC 4YHNA 3LB6C 2FD6L 1I9JH 4Z7VB 2YSSB 4BZ1H 5GSRB 3RVUD 4KUZL 3MCKA 3QDME 4U1NA 2PO6B 2ZSVA 1A4KB 1MVFA 1AXIB 4RX4D 3U7WH 4HKZB 1A4JA 5IEHB 1XCQA 2FIKA 3L3OB 4Y5XA 3UEZA 4YHOL 1SM3H 1Q9LB 5CZXD 2PXYC 1KTKE 2IANA 2WV3A 3NZ8A 4NQVA 5DXWA 4Y5XC 4DAGL 3FTGB 4DVBA 3LMJH 3H9SE 3L3KA 3MA7B 4EN3D 3RWIA 4ODVH 3LH2L 4G7VL 4LLWB 3EFFB 1MAKA 2EYSA 5JOPD 3FQUA 4WU5B 4XMLH 3B6SB 4ELME 1LO2H 4H0IA 4MJ5A 3T4YA 1A6UL 5HGDA 4JO4L 1NGWB 2PO6D 1INDL 1B88A 3FT4B 4TULH 4I2XE 3EJZD 3TNNA 4MLIA 4LHQB 3KJ4C 1F2XK 3LKQA 5KSAA 2R2BA 4R8WH 5BVPH 3ULVD 3MCKB 5KOMC 5KSAC 4MQTB 4U1NB 2ZSVB 3OR7A 5C0EA 1AQKH 2AJYL 4NM4L 1A4JB 1J87A 3VWJA 3O0RH 3QHZH 1XCQB 2FIKB 2A9NL 4XRCB 4Y5XB 1J7VR 3VWJC 1A9EA 4NQVB 1DUZA 2IANB 3NZ8B 2AI0L 5DD6A 4DVBB 1Z6JT 3ALWA 4YQXH 4NSKA 4G6AC 2IBBA 4OM1L 4U2YA 5GGVY 3PQYA 1ZHBA 3FQUB 3Q5YA 3QXAA 3I2CH 2FH6A 3DETC 2XA8L 4KHXH 5EU3A 1U42A 3T4YB 5HGDB 4NZTL 4N0RA 2OZ4H 5C07A 1UYWH 2EDWA 2FGZA 2XKNB 3ZL4L 5HGHB 3EHBC 43C9A 4HAFA 1CF8L 5B39G 4LQFH 3TNNB 5IVXE 5JPNA 3LVEA 3LKQB 2IAND 2HRPH 2R2BB 3ARSA 4M5YH 4AG4H 1EEYA 5C0EB 4LFHG 2NY2C 3LHPH 4JO3H 2HH0H 5MP6L 4JKMA 2APBA 3S35H 4WWID 5C9JA 1ZANH 4HG4K 5H35A 3MLSL 4NPYB 1A9EB 1WCBA 4PB0L 4EBQH 5DD6B 1GIGL 4ODXA 5M95B 3EO1A 4NWUL 5I30L 1FYHB 4NM8L 4NSKB 4M8QA 3G04A 4G43A 2I60H 2M8XA 4NOFA 5ISZA 3PQYB 1ZHBB 2I25N 3QXAB 4B0MM 2YWZA 5EU3B 1KYOJ 1NBYA 2N56A 4K2UH 5DEFA 5C07B 4N5UA 4HFWA 5CD3A 5T3XD 4Z78B 1ACYH 5C08A 1LP9F 4FQ1H 4XBEH 5JPNB 4XGZA 3VGAB 4U2ZA 1OAUL 4NZUL 4CJ1A 2IALA 3T4AA 5K9OA 3TPUB 1WBZA 4NBZB 5FKAA 2F5BL 4ODHL 43CAA 1FDLL 5DVMA 1A3LL 1ORQA 3WIIL 1MCQA 5C9JB 4ZUWA 1RUPL 2BX5A 1ZLUK 4DVRL 1WCBB 1OGAA 3PGFL 5TDNB 3CFKA 4XNYL 4ODXB 1KB5H 3EO1B 5C07D 2Z0BA 3QWQB 1BFVH 2DLHA 4DFHA 3G04B 4G43B 4UV4L 1YEJL 3EJYD 5ISZB 1N64L 2VB5A 3CDCA 3R06A 3KPTA 2OL3H 1J8KA 1NBYB 4CADA 4Z7WE 1MIML 5DEFB 5KVDH 5B22A 4HFWB 4XC3H 2AS5M 1BFTA 4OZIE 2EZ0D 1G6RH 5C08B 4XGZB 3LKSA 3U6RB 3BPLB 5D96B 3CCHA 2V2XA 2IALB 3T4AB 5K9OB 3CX2A 1WBZB 3QUXA 4PJCE 4YDLC 5FKAB 4WFFE 1PLGL 1T7XA 1F3RB 1CDBA 43CAB 3QUXC 4HUXA 4CUCA 5SV4A 5ISZD 1ORQB 3VJ6A 3QT2A 3BP7A 4ZUWB 5LQBL 3BD5A 4UAOC 3HN3A 5HYSA 4POZC 1OGAB 1FNFA 3C8DA 3SO3C 5C7XL 4JFFE 2XN9D 1HXMA 5E1AA 5DHYB 5DK2A 4GLRI 3DBXA 4JKLA 1QP1A 4P2CG 5FM5M 5HGGS 5C08D 3OGOE 3G9AB 2DQEL 2J4WH 1OY3B 3R06B 3DSNA 3V7AG 1KNOA 5F89A 5DMGC 1TCRA 1LD9A 4HGMA 4N8VB 4LSQH 4UT6H 1A7OH 5HHVL 1KN4L 3JWDL 5ERWA 4N90D 3LKSB 4RWHA 4F58L 4C55A 1OGAD 1TITA 5J1SC 3SDXE 5C6WH 3CCHB 2V2XB 2AAVA 1YYMH 3QUXB 3LIZH 4M1DH 1IL1A 4PY7A 4YXLL 4HUXB 4DEPC 5DWUL 3VJ6B 1AI1H 3BP7B 4FXLA 3K2UH 4LDEB 2VXSL 1FH5H 5DVNA 3KJ6L 3O6LL 5HYSB 3QFJE 2D03L 5SWQA 2NX5B 5CJOL 4LMQI 3U0TA 5ACZA 4TSCH 4KKBC 1HXMB 1K6QH 5E1AB 4NQEE 1WVZA 2P24A 5DK2B 1T2XA 3DBXB 4RFOH 2XT1B 1EA9C 1SMAA 2Q86A 4U7KA 1M7XA 1NDGA 3NIFF 5BVJA 4HMEA 1KNOB 2AP2A 4YK4C 5F89B 2FJGA 1TCRB 1LD9B 4A2MA 2BHZA 2XRAH 4F3FB 2OTWA 3GSNA 5ERWB 2EDBA 4KY1L 2YD3A 2FSEA 2BVQA 1XIWD 3QO0A 4LNVA 1X5JA 1M7IB 5IBLC 2HRLA 4DGYH 5C2UB 2YBRA 2NXZC 1HZHL 2RGSA 1C7TA 2NX5D 1AIFA 3GDBA 5L8JB 5EOQL 3CIQA 4U1HA 1FVDA 5EOTA 4LPTA 3D25A 1IL1B 3WNPA 5D1QD 4PY7B 3E3QE 1RHHA 4JQXA 1IT9L 1N0XL 1PX3A 3RDTC 3PWUA 2X9YA 4JQXC 3FHQA 5SWQB 3U0TB 3S98A 1GAFH 3T0WA 4MVBC 3B83A 2B2XH 1KCSL 4DOHE 1FBIH 2P24B 1GGIH 1I1AA 3IFNH 1OAXL 3M1BA 4LAJH 4KFZC 2Q86B 4U1SA 1I1AC 1I9RL 2XZAH 1NDGB 5JHDE 2HFTA 2I24N 1KCVH 5D7LA 1IE5A 1LVEA 2FJGB 4GQ9L 1L7IH 3UBXB 2OTWB 3CVHA 4AH2B 3GSNB 4DKDC 1BD2A 4RAVA 4WV1A 2HMID 1FYTA 2NXZB 2FSEB 2BVQB 3QEQE 3QO0B 4R26H 4WGWB 4WV1C 4LLMB 1IFHL 2YBRB 2SEBA 3KYAA 2C4FU 2BDNH 4U1HB 1FVDB 4X4ME 1LE9A 1S9WA 4HLJA 3MLWL 3UZVB 3D25B 3HNTH 4Z7QF 4B41A 1RHHB 3NFNA 5AYUH 4XNUL 3KR3H 3PGCA 1CBVH 3D69A 3PWUB 5DQDL 4DGIH 1PGRB 1ZGLP 2LE9A 4KROD 2NY6B 4XPAL 3GJFK 4MJIA 3OV6A 3S97C 4N0YL 5GZND 1I1AB 1OAZH 3IXAB 2M2DA 3PIQA 2YD9A 1MFNA 1CR9L 3M1BB 3GUTB 2F8OA 5C0BD 1NAMH 3V5KA 4LPYA 2VDMH 3O11A 5D7LB 3S36H 5E08L 2R23A 4LCCA 4QTIH 3HRZA 1RQ5A 3DGCR 4ODTL 4Y7MA 3CVHB 3BWAA 2PTUA 4RAVB 4WV1B 2CRZA 4P3CH 1JNNL 3BZ4B 1G7HB 5BJTA 3RWDB 1U8PA 2VQ1A 1GGYA 5IR1A 1HE7A 1JNLH 1WZ1L 2SEBB 2VH5H 1FNAA 3FO2A 1WWAX 2NY6D 2QV2A 1F11B 1GOHA 2HVJB 4YIQA 4LOUC 1LE9B 3TZVA 1H0DA 1DN2A 1I1AD 3P30L 1KEML 3P2TA 2IPKA 3TZVC 3VXSA 2E7BA 3NFNB 3PGCB 4PLJD 4KMLB 3D69B 4TNVK 5F97E 4OUOA 1EHLH 2R69H 5F7DA 1I3UA 4ISVA 4X7FC 1RD6A 3NCBB 4MJIB 3PIQB 4KTDH 2A6KA 3NIDF 1C08A 3V5KB 4C54A 1T2QH 3O11B 2R23B 4LCCB 5DRWA 3MGOA 2J8UE 3HRZB 4P2OD 4HH9B 1UQSA 4W81A 3VRLF 3BWAB 3D2UA 4L1DA 3UAJC 3REWA 5HVGB 2B4CC 4GAFB 1H3PL 2XWTA 5BJTB 1U8PB 2VQ1B 1VSCA 5IR1B 1QLEH 2LQRA 1NANI 4PRBA 4HPYH 1P4BL 3BDYH 5FOJA 2V7NA 1U8LA 2CKBA 3MRJB 4YIQB 4OLYL 4UQ2B 1H0DB 3OAUL 5CKGA 2IPKB 4Z5RA 3VXSB 3RFZC 3QHTC 3BEWA 4S0TD 3WKNA 1CK0L 3QUZC 1WF5A 1SYVA 4LLAA 4OCYL 4NZRL 3BPNB 5F7DB 4FQCL 5DJ0A 1JGVL 1RFDH 2BSTB 2Y23A 4Y4FB 4ISVB 1IKFL 2X41A 3JWOL 4L3AA 3MRLA 3O3DA 2A6KB 1C08B 4HQQL 3BX7C 3VD5A 3C8HA 4KPHL 5DRWB 3MGOB 2DLIA 2PUQT 4UILH 3WO3B 1DUYB 1FPTL 1UQSB 2ZG1A 1DFBL 1N5AA 1FN4A 3D2UB 4NJAL 4PIRF 1P1ZA 5E7FA 3REWB 3E8UL 3KPPA 4YDVA 4Q6YA 3LY6A 3VXSD 2UVEA 2XWTB 3Q1SH 1H3WM 4PBVC 5HXMA 4WHYG 5FF6A 4C56A 5BOPA 1VGKA 1Y0LA 4PRBB 4X8JA 2P47B 1OWRM 4PR5A 4JRYA 4HT1L 4YEFA 1IC1A 2V7NB 1U8LB 2CKBB 4Y4FD 4MXQC 4E9LA 4MD0A 4L4VB 3QCTL 3BRGC 4XMPH 2APWA 3T04D 3O8XD 4PJFE 4Q6IA 4Z5RB 2VDOL 4MA7L 1CLYH 3BEWB 4L1HA 2WUBL 4Q6IC 5F7KC 5GQBA 4R4FH 1KFAH 1SYVB 2NMSA 4OV5A 4P2YA 1A64A 4NCC1 5FCSH 5DJ0B 5C92A 3BQUB 3L3GA 3UTQA 3D2UD 5D93C 4X8XA 1UM5H 1HK6A 3C5JA 4M4RA 1A6WH 4JR9L 3MRLB 3O3DB 4DQOL 4UT9H 2A38A 4C59B 2J6EH 4Y1AE 5I74C 3RX7A 1QO3A 1OOAA 4EOWH 1FN4B 2A0LD 4L4VD 2BNQA 2QQKL 3RUGA 1T1ZA 3KPPB 5D7SL 4PJGA 4YDVB 2C3XA 1A1NA 5KS9E 4TVPL 4G42A 4C56B 1Y0LB 1SBSL 4X8JB 4U1JA 4PR5B 2ADGA 3N1GC 3BQUD 3DWTA 1WFNA 2PR4H 4MD0B 3WXVL 1RZFH 4ZFFA 5DVOA 4Q6IB 4GUPA 2F8XC 1P4IH 1X5KA 1NCDL 4LLQA 4OF3A 4OV5B 3FQTA 3IRZA 3I02A 5D93B 1NGPL 1IGCL 3UTQB 1F4YL 3QDHA 3ILQC 1LHZA 3TV3H 3C5JB 1D5BB 1UKTA 3BSZL 3GIZL 5I74B 3CLFL 4DN3H 4XMKH 4C56D 5GZOD 3V6OA 3ZZ1A 4S11A 3MLXL 4WTZA 2AW2A 5IJVA 4U3HA 3V6OC 4B7LA 1QO3B 3CZJA 1CE1L 1CGWA 2BNQB 1HSAB 4PJGB 5F96H 2IJ0C 4L8DA 5TQ0H 1A1NB 5IT2L 2UZIH 1FC2D 4U31A 4HS8H 4U1JB 1EAPA 2ADGB 4XNXH 2NY7L 1CFQB 4RMSA 5B4MC 5KVEL 4K71B 1DSFH 1DQTA 4FQLL 4Z0BL 1YMME 1KCRH 2ED8A 3CX5K 4ZFFB 3GMPA 4JGJA 1T5XA 3NCJH 3UTSB 3ZYZA 1ADQH 4LLQB 1F3JA 1MCNA 3FQTB 1ZLWH 1QSEA 3TFKC 3I02B 2AABL 5ALBL 5DVLA 5EU6A 5T1MA 4FQXD 1I85C 2BNQD 1NUDA 1A02N 2RCSH 3KPNA 4Y16A 3G08B 4EI5A 1TXKA 2VXVL 3VI3E 5KVMC 3SQOH 4GXUM 5A2JH 1LO4L 4U1GB 3CSGA 3IGAA 1T66C 4HK3N 5IJVB 3TO4C 1C5DA 3G5YA 5J4MA 3W0WE 3OJMB 1KB9J 5EU7C 2LV4A 1MCBA 1Q72L 4E41E 2IQAA 4L8DB 1NCTA 4C4KT 3UTSD 3PWPD 1XGRA 1OP9A 4JAMA 2ORBH 4NJ9L 1R3LA 3MV9A 2VQTA 4OB5L 4U6HB 2VL5A 4YBLB 1EAPB 1CLZH 3VWKC 4YFLF 4HFUH 2J7LA 1VENA 2VXTL 3I3BA 1PQZA 5B3NA 3GMPB 1TQBC 1T5XB 3SHSA 3CMOL 1QLRA 4UIKL 1F3JB 1QSEB 4RAHA 5T5FH 3E2HC 3LEYH 3AXLB 3EYSL 5EU6B 3F12B 5T1MB 5C2BH 3UTPE 3T0XA 2A1WH 3QIUA 3KPNB 1OT2A 4Y16B 5DRXA 4KKCC 4MGXA 4EI5B 3BD4A 1D3CA 5DC4B 1JPSH 4F7CA 5CFHA 1GGUA 2Z9TA 1Q9OA 2FHBA 1NC4A 4WHDA 3IGAB 1MWAB 1C5DB 1HKLL 1WWCA 3PXHA 1AH1A 2IQAB 1KELH 3KPSE 1RURH 4NNPL 4U49A 1MFAL 1XGRB 4JQVA 4JAMB 4MXWL 1R3LB 3MV9B 4ETQA 3K0WA 2VL5B 5CINL 1BVLA 4X6DF 1YEDA 2Q8AL 4HLZG 2IWGA 5CP3H 1NLBH 3D3VE 3VFVA 1TQBB 1PQZB 4W68A 2C26A 4U4BA 4Y16D 2EDKA 4RAUA 1YZZA 4EI5D 2DQIH 3E2HB 1QLRB 3ARQA 2MWCA 2P7TA 3P4OA 2FEEL 1IAMA 1F3DH 1G9NL 3CZFA 2NY5C 2XG5A 4AEIL 2VKXA 1FFPA 1R3JA 3QIUB 1NCWL 5DRXB 5HVHB 4HIXH 4U6VL 3K2MC 2MPAH 4F7CB 1RZ8A 3OKMA 1P6AB 3VXUA 3MV9D 5FO9A 5H94A 1R5WA 1Q9OB 1K8IA 2AJZA 4I4WA 1NC4B 4YWGH 1TJGL 2AV1A 2B5IB 4UT7L 4X4YA 1YA5A 3ARRA 3QCVL 4PJXF 3QQ4A 2FB4L 3CXHJ 1BVLB 1YJDC 1FE8L 5DK3A 3VFUA 4JG1L 4F33A 4X6CF 4K7FA 1U41A 1G84A 3VFVB 4KKCD 4AMKL 4XX1E 2FHCA 3QIUD 1FC1A 4OQTL 4YC2C 1LO3H 4RAUB 3X3GH 3FAXA 2YKLL 1JRHI 3LN5B 3LEVL 3QXTA 4NHCH 4NC1C 2P7TB 4P57A 1D5MA 3P4OB 5IP4A 3H42L 5TPWL 5EC2A 2VRAA 5JXEC 3CZFB 4HC1H 3QIWC 4L3EE 3WFCL 5GS0D 3M8OL 1QSFA 3B5TA 1FFPB 1R3JB 4MDIA 3S34H 4GLRH 1E4WH 4KK6C 1RZ8B 1CDCA 3OKMB 5E8PA 3VXUB 5H94B 5FO9B 1R5WB 4I4WB 1K8IB 4D9RD 2VJXA 3NZHH 4L4TE 1LGVA 4FQ2L 4X4YB 5IMOA 4JFPA 3ARBD 5C09E 3ULSA 1B3JA 4F33B 3L5XH 4K7FB 4RCAA 2PW2A 4HAGA 4YC2B 2EE9A 4YHKL 4RFEA 1UC6A 3U9PH 5HDLA 1WICA 3HZMA 3TT3L 4JKKA 5D7IF 1PKQA 4ELKA 4L9LA 3HG1A 5EC2B 3LKNA 1EO5A 4L9LC 1URLA 2AEQL 1FORH 2EDTA 1QSFB 4IRZH 4P9HL 1TFHA 2DMCA 3WYRA 1P9MC 4KAQH 3F58H 3ZKQD 3IFOA 3ET9F 5B38A 1AXSA 5I18L 4FZ8H 1Z9OA 5ITBH 4RGOL 5IMOB 4JFPB 3OKKA 3QRGL 3UROR 3OKLA 3P0GB 5IQ7L 4H8WL 3ULSB 1SHMA 4GSDL 2XQYG 1IQWH 1OP3K 3QIBB 5FHBL 2DYPD 2VDNH 4FABH 2PW2B 1PFCA 4MNQA 4XVSH 1QSFD 4XCCH 1DLHA 4KK6D 4Q74A 4RFEB 5ADPH 4PGDA 1QVOA 3HZMB 5LBSH 3G6DL 5F7FA 2AK1L 3U7AA 3PUCA 1PKQB 4ELKB 1MH5A 4L9LB 3HG1B 2PKDA 3QEQD 3LKNB 5DZOA 5FGCE 1FZMA 4QHNB 2VDLL 2VITB 3GBLA 3IAQA 1WAAE 1BM3L 2LU3A 1D9KD 3N9GL 4O5LL 2FD6H 5EH1A 3IFOB 4QY8A 4YO0A 2L0DA 1AXSB 3QIBD 4KUZH 5B38B 3DX7B 3PL6C 1KPRA 5CEZL 3OKKB 2OZ4A 5L88L 2FCBA 1P53A 3OKLB 1U9KA 3TCXA 2IADA 5HGAA 4YHOH 1RIVL 1O7SA 1QRNA 2G5RA 3HG1D 3K81A 2MHAB 4FQHA 3O4LA 3MV8A 4MNQB 4GRWH 1DLHB 4G7VH 1BJ8A 1CDUA 1QVOB 2ITDA 1ODAA 2VLLA 3ZKMC 5E2WH 1MH5B 1OTTD 2JELL 1N3NA 5DJCA 1A6UH 4JO4H 2XKUA 2H1PL 1BF2A 2DD8L 1FZMB 3V7MA 3VFNA 1INDH 1LEGA 2HLFC 2ZUSA 4DZBA 2AQ2A 3CDYA 3S4SG 3OTTA 3PGDA 4QY8B 4YO0B 5EIIA 4KRPB 5F44A 2KQMA 4G3YH 3D6GA 4EUPH 3B43A 3L3JA 4NM4H 5E4EC 5HGAB 2A9NH 4AEFA 5I8OL 2WQRA 1TETL 3MX0A 1QRNB 2AI0H 4FQHB 1YDPA 3O4LB 4RZCA 3MV8B 4ZS6C 4BKLA 4YXHL 4MD4A 1MFBL 3WUZA 4OM1H 5F7WC 4ZOEA 3D85D 2ITDB 2VLLB 1BEYL 1N3NB 5DJCB 5AD0A 2XA8H 2B1HL 5I6XC 4LARL 4KRPD 4NZTH 1NSNL 3ZL4H 3VFNB 4WGVB 1LEGB 1KB5A 1CF8H 4OZHE 4DZBB 1X7QA 1GVIA 1PEZA 4W6YB 4A6YL 4OT1L 4G8GE 1AGCA 4PB9H 4Y4KA 5I15H 4HIJA 1QRND 5DI8A 4Y4KC 5EIIB 3O4LD 4WJ5A 3QAZC 4XVJL 2OL3A 3MV8D 4S0SD 4ZO9A 1BZ7A 1HHKA 2JIXD 3L3JB 5MP6H 3ZKMD 5GHWH 4NQXA 3MLSH 1M05B 1G6RA 2VUYA 2BHUA 4N5ED 1IQDA 4PB0H 3UC0L 5I73C 1NANH 4NWUH 5I30H 4NM8H 4DK6A 1GGCH 4MD4B 4HWBL 1L0QA 1UT9A 5JPMA 2RBLA 3AVEA 4ZUVA 2CRMA 5I6XB 1Q9WA 4TPRL 4WWKC 3TJEL 4CW1A 5AD0B 4KJWC 2WWMC 2UWEE 4LKXA 2FZ3A 3TPKA 2EDLA 1KB5B 1Z3GH 1X7QB 4FQQA 4JFYA 5SWZA 3GMMA 1AGCB 5GXBB 4Y4KB 4U7SA 2R56L 3IYLW 4HIJB 3QAZB 2VXQL 4PJBF 1OAUH 4NZUH 5DI8B 2EC9T 1NCAH 4ZS6D 4WJ5B 3GSWA 4OCWL 3V8CA 1LNUB 2OL3B 4ODHH 3RY6A 4Z76A 1JYVA 1BZ7B 1QOKA 1HHKB 1KPVA 1FDLH 5I2IA 1A3LH 3WIIH 3NA9L 5DJ8A 3RY6C 1CFVL 2FEEI 4QWWC 1ZT1B 2C3VA 4NQXB 5I73B 4DVRH 1G6RB 3PGFH 1K4CA 1IQDB 3MR9A 3ECBA 5I1AA 4MNGE 2EDJA 4ZUSA 3TN0C 4GMSL 2ED7A 1CFTA 1YEJH 5JO5A 1OLLA 1N64H 5JPMB 3Q5OA 2BY3A 4ZUVB 4OF6A 4XX1G 1Q9WB 4CW1B 4HUWA 4JFDB 3WO4B 4LKXB 3HA0A 2FZ3B 4RRPG 1RIHH 4I0CC 3FB5A 5E4IA 3JV6A 4JVPA 3T2QA 2W92A 3HAEH 2OR9L 4M6OL 5E70A 4FQQB 4JFYB 3RWEA 1XH3A 5SWZB 3U0PA 1YEHL 2ID5A 4NNYA 2OSLA 4OIIL 1IGMH 4KHTL 1RHFA 4YGVA 1LDSA 3GSWB 5D1ZC 5TH2A 4HF5H 1PLGH 4Z76B 1XGYH 3R0NA 1KPVB 1Q38A 5EUKA 5I2IB 5DJ8B 3DO3A 4XXCC 5LQBH 3O6KL 2C3VB 4GAJL 4HCRL 3VDBA 1YQVL 5SV3A 3KLAA 1K4CB 4JFDD 3ECBB 5EZIL 5I1AB 1WT5A 4P5MB 5FYLL 4AL8L 4ZUSB 1S78C 5HYJA 2J5LC 1CFTB 1WT5C 1AKJA 5JO5B 3FN9A 1UG9A 2DQEH 3DUSA 4BQ8A 3RVWD 1S7TA 4HUWB 3BZFA 5HGBA 3AMKA 3AGVA 2VR4A 5HHVH 2WWKO 3GMRA 1KN4H 1P69B 3FB5B 3JWDH 3JV6B 3GSNL 4KK9D 3MREA 3T0DA 4Z7NE 3RWEB 3VFTA 1XH3B 3MV7A 1EXUA 3RGVA 4F58H 4NNYB 3LPWA 1AJ7L 5DTFA 1P2CA 1CIUA 2CRYA 4R2GB 3RGVC 4YGVB 4JFZL 1ONQA 3VXMA 4ZUUA 1DN0A 3HR6A 4PTTB 2D7TH 5IF0A 4YXLH 5EUKB 1YEEL 5ESAA 1GC1H 5C0NC 5DWUH 4JO2L 1S7RA 1YEFL 2VXSH 2YD8A 3MSPA 3WIHL 3KJ6H 3O6LH 2D03H 3VXRB 3BGMA 4IIQA 2J5LB 1UB6A 4UNUA 4PG9A 1CD0A 1CFSA 5HYJB 4GS7C 4IIQC 4DN4L 4GKZA 4ONFL 4HBCL 1AKJB 5CLWA 2VZ1A 3UJTL 3QQ3A 4N9OB 4JG0L 3DUSB 4I18A 4EIZC 1S7TB 1X4YA 3BIKA 4X4XA 4I18C 4R2GD 3BZFB 5HGBB 5J0BA 2YPLA 3H0TA 3BP4B 3TVMD 3GMRB 2I9TA 4K8RC 2P48B 2FGWL 2ADJA 4MA8L 4KY1H 5KG9A 3MREB 1IVLA 2JCCB 1MCJA 3RGVB 3VGHA 1HZHH 5DTFB 1P2CB 3VXRD 4UBDC 1NAMA 1IZKA 5EOQH 1ONQB 1ZHLA 2GFBA 2EIEA 1DN0B 5HYJD 1KTDA 1QPXA 5IF0B 1EBPA 5ESAB 2NQCA 1IT9H 1N0XH 1S7RB 4OD2A 3MLPA 1G1CA 1KACB 3C87A 3BGMB 4IIQB 1FLRH 5KSBA 4RIRA 1UB6B 4PG9B 1T7WA 1U93A 3WFBL 5FM5O 4GW4A 4P46A 4GKZB 4G9FA 4R90L 2GJ6A 4WUUE 4JY4A 1OAXH 3NFSH 2IMMA 3OL2A 1YYLL 3A67L 1I9RH 3QQ3B 1RY7B 4I18B 2DIJA 2EDYA 3JUYA 4OGAC 3BIKB 4X4XB 4Q9CA 2OQJA 4GQ9H 2YPLB 3H0TB 1ZOXA 6FABL 5C0ND 2I9TB 1NC2A 2ADJB 5KG9B 5J56B 4YX2L 3T1WA 4RGND 3S35X 5MEQA 1BX2A 4OFVA 1LO0L 1NAMB 1IBGL 2GFBB 1W2KT 1KTDB 3MLWH 5EN2A 4LASH 4QRPE 2N7AA 3OPZL 3WXWH 1MAML 1FAIH 1X4XA 4ZQKA 4OD2B 4XNUH 1Q94A 4ZXBB 3IS1X 3BUTA 2HT2C 5DQDH 5HVFB 3HS0A 5KSBB 3NAAL 4RIRB 2YPLD 3MLZL 4XPAH 5EULV 4AJ0A 1AY1L 1H8NA 1U93B 2VLRE 4GW4B 3TJHC 2Y6SD 4P46B 4R96A 4G9FB 5MHSE 2GJ6B 4N0YH 5EPMA 3VCLA 4JY4B 1CR9H 2VXUL 4OBRA 2X09A 1DE4A 2DICA 3TIDA 2ARJA 2E8ZA 3DVNA 5DQ9A 1JZ2A 2ICCA 5E08H 4E5XA 1B2WL 4M43L 4ODTH 1DBBL 4W4OA 5EWIL 1DBML 1CG9A 1NC2B 4W4OC 5E6ID 4D0CA 2ENYA 1WTGT 2C1OA 4ORGA 3DXAD 4ZXBD 5MEQB 1CVSC 1WZ1H 4PY8I 1BX2B 5J6GA 3RJQB 2CDFA 2XPGA 3KS0H 3T77A 3ZDXF 4P46D 4K9EC 4G9FD 2GJ6D 2JKXA 5EN2B 3LDBC 1UFUA 1KEMH 3P30H 4MYWB 5L7XL 5ICXA 4ZQKB 1Q94B 3CSBA 4JPVL 4NN7B 1EZVY 3GSVA 1RZJC 4OGZA 1QSVA 3HS0B 2F54D 1L0XA 3ULUE 1RULL 1TJHH 2BNUA 1WWBX 5GGVL 2QL1A 3MRQA 3BFOA 1QQDB 4R96B 5T1DL 5E94A 2FX8H 5EPMB 2B1AL 3VCLB 4X6FA 3K8KA 1DE4B 5E6ZA 5HHXL 1QFWL 1OD9A 5DC0A 3DVNB 5DQ9B 5EFIA 4IJ3B 5F93C 5JIPA 3N0PB 4LGSB 2I9LA 2VDKL 5DHXB 4LLYA 1CG9B 1H3PH 1FFRA 1RMFL 5BOZG 2C1OB 3RX8A 2IG2L 4IS6A 4WRLA 5J6GB 3TBYA 3ELAT 1P4BH 1FNSL 2XPGB 1G6VK 3TJHD 1JN6A 1II4E 4OFPA 3ARPA 3T77B 2J6EA 5IEKB 3VRIA 1U8NA 4OLYH 1ZSDA 4I3GA 5ICXB 3O4OC 4N0FA 1CK0H 1XF5B 3V4PL 4L8CA 3MGAA 4OZGF 5GRYA 5I1JL 3DUHA 3GSVB 3SCMA 2HFGL 4G6KL 2BNUB 4FQCH 5EBLA 3SCMC 1JGVH 5KANI 1JCKA 1IKFH 3BESR 5E94B 5I1GL 3ARGA 3MLYL 4X6FB 2Y4SA 2J3SA 1F2QA 4CRPA 1CICC 4HQQH 3ZYIA 2GYSA 5EFIB 4KPHH 2X89A 1K2DB 4WI8A 1XEDA 3CU1A 2I9LB 4LLYB 4NJAH 4KKLC 3E8UH 2Y5EA 1ETZA 4ZTOL 4ZD3H 5J9PA 5IWLC 3G6JF 1IGIL 3KPMA 5IIEA 4IS6B 3GK8L 5GS2H 4BSJA 4NRZA 2MFNA 4IRSD 4RQQA 4HT1H 1JN6B 3EKCA 5EIQA 1HOCA 4PLKC 1U8NB 5DUML 3QCTH 1ZSDB 4ENED 2A74A 2VDOH 4N0FB 4TRPL 5F9AC 4L8CB 5L8KB 4Q0XL 2WUBH 4XWGL 3SCMB 2Y25A 5TE7L 1A3QA 1VFUA 3IT8D 5D5MA 5EBLB 4CVZA 3LS5L 4WW2A 5ACLA 4NGHL 1W0WA 3ARGB 5F1KC 4W70A 2D9QB 4JR9H 4WFEE 5C0AE 2W07A 4DQOH 4ODUA 4XVUD 2AJ3A 2DIAA 4JJ5A 1FVEA 1ADQA 4FOMA 2QQKH 5GS3A 3D39A 1VHPA 2BRRL 1U36A 5D7SH 1ETZB 4ZO8A 1RZIA 3VFMA 5J9PB 2CLRB 5BXFB 4LLVA 3KPMB 1FV1A 4NRZB 3WNKA 3A6BL 1SBSH 5SX5K 1WBXB 2GY5A 2CQVA 4P3WA 2NR6D 3SE8L 1HOCB 5D6CA 3QDMA 4LGRB 4X6BA 1J10A 2MOVA 5DHVH 2DF3A 3WXVH 3ARGD 3RWFA 1XF4A 2BHYA 5DEGB 5DGQA 3DGGA 4GBXD 4I5BA 5BZWA 3GBNL 3BPOC 1NCDH 2X89D 1NQBA 2NCMA 3OX8A 5D5MB 1HILA 4PJIA 1NGPH 1IGCH 4FQPA 3D0LA 2IF7A 1F4YH 4WW2B 1P84K 1W0WB 2ERJB 4LNRA 2HT3C 1MRDL 4ZSOE 3BSZH 3GIZH 5T3ZD 4XP5L 2FX9L 4ODUB 3CLFH 5C1MB 2AJ3B 3NMEA 5IBUG 4ELMA 1FVEB 3MLXH 3BMWA 4NKMA 3QDJA 4OJFH 2DQDL 4LPUA 4YDIH 5TDOA 1RZIB 1YEIL 2F53A 4I2XA 4PRDA 3VFMB 5IT2H 2AK4E 3PP3K 1FV1B 4IRJA 1A21A 2R4SL 4KV5E 1YUHA 1P7KB 4M1CC 2NY7H 3CDFA 3QDMB 4K3EH 4X6BB 1L9MA 4FQLH 4Z0BH 3LQAL 3RWFB 1XF4B 1GPOL 1UWGL 3DGGB 3O2WL 4I5BB 4ZO7A 5BZWB 3PV7A 2DM3A 2D7OA 2R0KL 1CL7L 3OX8B 2AABH 1HILB 4PJIB 5ALBH 3D0LB 3UDWA 2P8LA 2CLVA 4LNRB 4XXDA 3UDWC 4WCYL 5CP3A 4LKCA 2VLME 2DKSA 2VXVH 2QSTA 5FA4A 1LO4H 3WSQL 3BHBA 1A2YA 5F9OL 4GRLD 4NKMB 3QDJB 3FCTA 3HZVA 2BOBA 5TDOB 1MJ8L 4QRRA 1Q72H 4FFWD 2F53B 4PRDB 1P5UA 3PABA 1JUFB 4IRJB 1DQQB 4NJ9H 1G7MA 1IGFL 1YEGL 4ESKA 5DMYA 1QSZA 1YUHB 4IOFC 3QWRA 5HSFA 3RWGA 2VXTH 4M7ZB 5LKNA 5CD5D 1FHGA 2NNAA 4KVNH 1FIEA 1JZ4A 4X7SH 3REVA 1I9EA 4UIKH 2FBOJ 2IFFH 3GJFH 4P4KB 1KC5H 4TUJA 3S5LG 2Z91A 3SPVA 1AR2A 3QDJD 5I1DA 3EYSH 3O3BA 4PJAE 1MRCL 3IDJA 1FCGA 1I7ZA 4XXDB 2DB8A 3Q2CA 5DO2D 2F53D 1SVCP 5BS0A 3KLSA 2NPLX 4LKCB 5DURB 4M6NH 2DIBA 2YD4A 3AY4A 4IRJD 5DJZA 2VE6B 5FA4B 3AY4C 4WI9A 3BHBB 1A2YB 4M3JA 5KZCB 1CS6A 1HKLH 3FCTB 3HZVB 1LE5A 1K3IA 2AJXL 1PY4A 4QRRB 4OF7A 3VA2C 3PABB 4NNPH 4WVRA 1MFAH 4MXWH 1G7MB 3U7YL 4P4KD 2H2SC 5IQ9A 4MS8D 4NN5B 5IVXF 2Q8AH 1JPTL 4X9FA 3QI9A 3V5DA 2H2PD 1GH7A 3RWGB 1XF2A 4ZAKA 3A6CL 1UENA 2NNAB 4FP8H 1JV5A 4ZAKC 5IKCA 3L5HA 5DURD 4QGTA 5M94B 3VW3L 3N1FC 4XCNB 4TUJB 1H8OA 3T0AA 2Z91B 3SPVB 9CGTA 3P4MA 4LL9A 1G9NH 1QYGL 1UJ3C 5FYKE 5I1DB 5KZCD 5DK0A 3O3BB 3BW9A 3IDJB 4AEIH 4QRRD 1NCWH 4QRUA