4ALAL

Structure of dengue virus diii in complex with fab 2h12
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
DIVMTQSQKFMSTSVGDRVSITCKASQNVRTSVAWYQQKPGQSPKALIYLASNRHTGVPDRFTGSGSGTDFTLTISNVQSEDLADYFCLQHWTYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
source organism Dengue virus 3
molecule tags Immune system
molecule keywords ENVELOPE PROTEIN
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2012-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4alaL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4alaL01
4JFDD 4QNPE 2CLVB 4O58L 1I8KA 3CFEA 3OAZH 1ZT7B 4DN4L 1MWAH 3DTXA 3T4AA 1PZUB 3LB6D 3VXUE 2WAHA 1RUPL 3MUJA 4K94H 1KYOK 5DDHA 1CYGA 2DBLH 3ZL4L 2PXYD 3D18B 3RU8L 1FDLL 2VXVH 3O45A 3VG9B 2CGRH 1G1CA 1JHLH 4UDTB 2HJKA 3V95A 2B39A 5F9WC 4KTYA 1YUHB 4X9HA 3HNSL 4Q6IA 4ZUTA 5J3HD 4G8FB 1ZWIB 3BKCH 3CUPB 5J57B 4V2CB 5E6IA 1TQCC 3JV6B 4D8PB 3WBDA 3SJVD 3QWQB 5HHOA 4WU5A 3L3OB 4FABH 4BZ2H 3QNYB 3C09B 4FTVB 2F54D 3QUYA 3BZFA 1A7OL 5LBSH 4HUNB 1IEHA 4OD2A 5FXCH 2DQGH 5EU6D 2VDKL 1OLZA 3RWFA 1AO7D 3DROB 2V5MA 1KJ2L 3O9WA 1CZ8L 5GSVA 3RVVC 1D9KB 5B3JE 4G9DB 4ZYKA 2NW2B 4LCCC 1JGEA 3RWGB 4X8JB 3N1MC 3P0GB 4H5SB 1F90H 5HHVH 4TUOA 2D31B 4L9LA 4Z5RA 3LKNB 4YHMH 1PZ5B 4K8RH 3X11B 2X7LA 4QY8A 1RUML 4PJBE 5FB8A 1IFHH 1OCWL 3U7AA 5HYQB 4HUMB 1CE1L 4Z76B 1QP1A 3STBA 4L8CA 3E6HA 1CFQA 4IRJB 4KJYA 1KXQE 2I07B 4F3FA 2AK1H 2W9LA 1DUZA 1H15B 3NACH 3LB6C 5IESH 2VC2H 3MREB 5CJQH 2CDGA 1UJ3B 4FFWD 1A6PA 4WWKB 4FFVC 3DI2B 4J8RA 4EBQL 5BQ7A 3ISWA 1G7JB 1PJ9A 1XMWA 4KJQC 1BBJB 1H0DA 2P5WA 4KMLB 2FCBA 2ED7A 1UCBH 2H26B 1QYGH 1TIUA 2XWTB 3AC0A 1I8LC 5SWZB 4R26H 4KJYB 3VGAB 3P11H 4WFHD 5CUSL 4ODHL 4I0CC 1RU9L 4UQ3A 4IRSA 2QSQA 3PJSB 4R4FH 4OGZA 3DV4B 3FRUB 2YPLA 4JJHA 4LVOC 5HYSB 1U9KA 3WL9B 5JDJA 3ZSTA 3GJFA 3MLZH 3FAXA 5IFJB 5DMKB 1DVFB 4HJGB 2P8LA 4GKZA 3MLRL 1AGDA 5D1XA 1JPTH 3LN9A 3D25B 4JR9L 1UQSA 2DM3A 4KUCD 4PRPD 4UMGA 5EZOL 4MNGA 1BM3L 3FZUC 4M8VA 1ZA6B 1XGQA 4P5KA 4YAQB 1ZLVH 3ZTJG 1XGUB 3BWUC 5I76A 4NQCA 4DUXA 2EDEA 1C08B 4OD2B 3QIUA 1I1FA 4RA3A 2MHAA 3GSXA 3QPQD 2GJJA 1I9RL 5MHSE 3I50L 4OKVB 1DQQB 2E8ZA 2X4TA 3DURA 3BQUB 4FN0A 4N68A 1S7SB 4M43H 5TE6L 3RY5A 4WHYH 3HZKA 3HS0B 1IT9L 3QIUD 1P4LA 1KNOB 3EW3B 5D5MB 4NRZB 4PD4J 2OS7A 3WFEL 2Z8SA 4MNGB 3RY4A 2C3XA 3MRDB 2VTFA 4XXCC 5IVXE 3WNLA 3AM8A 3ARUA 1JL8A 3CK0L 1U8QA 2FYYB 3MBEA 1MFAL 1NLBH 3SJVA 1RJZB 3B8YA 5FHBH 5HHOE 1O5DT 5HYFA 4ZFFA 2CLVA 1DP0A 2WINA 1TVHA 1RZKH 3QA3A 5C0RH 2I25N 2ZOLA 1FLRH 4PBWD 1YNKL 5EH1A 3ZHKA 5BS0B 5KSBA 1CG9B 3MLWL 2H32A 4NRXA 1D5BB 2V17L 1E6JL 1SBBA 2EDDA 3JV5A 1RHHB 3TBVB 2OJZL 1L0QA 1RZFH 43CAA 5JXAL 2GTZA 2HVJA 5C6WH 1MLBB 1WCQA 3MGAA 5BO1H 2BNUA 1SM3L 2WUBL 4OTXH 5D7JB 2JKXA 4JCLA 1UJ3A 3FO0H 3S3JA 5DS8A 1JBJA 1LK3H 3ESVF 3W11D 3T2QA 1YC7A 4FFZH 4CDHA 1FFPA 3H0TA 1W8OA 2B2XH 1E4XI 4XP5L 5MERB 3R0NA 1S8DB 1HKLL 4BFGA 4AL8H 5F7MC 5JOEA 3GO1H 2VERN 3SEPA 3KYOA 1RULL 4HLZG 4HS3A 4GAGH 4EI5B 3KAAA 3GMQB 2H2PD 1VEOA 2GK0A 1TFHA 2F5BL 1HINH 1UXSB 4GG8B 4HKJB 3HNVL 2DJ4A 1MJJB 4XPBL 5E5RB 3L3HA 3PDDA 3T3MF 3U36A 4XP1L 4BSJA 1Q94A 4UT6L 1J1XH 1Q1JH 4A2LA 1JGEB 4JPWH 5FUOH 1VCAA 1AC6A 2I5YL 5DURD 4DEPB 5IB1B 4X6CF 5ALBH 4M9OA 1NC4B 4QXUL 5IBTL 4NHUA 1J87A 3C5JB 2PYFB 4AG4L 5ICZA 4Z95H 1G7MA 4NJ9H 5HGBA 2FL5B 5LGJB 3DV6B 4QHKI 5KW9H 4WJ5A 5CFHA 4JKMA 3BEVB 3P4OB 3PQYA 1WLHA 2CLRA 1EZVX 4BA8A 3IDNA 3LN5A 3X3FL 4XHQA 5GRYA 3NTCL 4XMLH 3LKRA 3GRWA 1JNNH 1JGUH 2OZ4L 4U1GC 2R23A 5GZND 2C3WA 4JRYB 3GSQA 1BHGA 2ZJSL 3DETC 2NLJA 4PUBL 4QGYA 1WFNA 4AENA 3KG5A 4PJBA 3SDXB 1KTDA 3D18A 4I3RL 1I1FB 5HYJA 5HGBB 3B9KA 2BNRD 4NWTH 3PXHA 1NCWL 4ONHB 4HFUH 3SE4A 3ARGD 2D3VA 3GHEL 1AFVH 4U1KB 1AP2B 1T0MA 1IEAA 4F15C 5M94B 4KKAC 1A7PH 2FZ3A 2XICA 1N64H 2Z9TA 3VXRE 5HVFB 4A2MA 5FGBC 1ETZB 4HIHB 5EOTB 5D2NE 4ONFL 3ABZA 1Q0YL 5ANME 2R4SH 3CX5J 5J1TC 1SYVB 3GMOB 3DX9B 5T33H 5E2UH 3S4SA 3ARSA 4L4TA 2IFGA 4RX4D 3T1FA 4PIRF 2X42A 1KPVA 4S10A 1FSKB 2CLZB 4M7LH 5E2VL 2OTPA 2AK4E 2VITB 5KSVB 4Y19E 5C0BA 3SJVE 1HHHB 4R96B 1WICA 5KS9E 1KC5L 5L88L 3MLXH 4QEGA 2YBRA 1L6XA 3AROA 3GMLA 3DARA 1NDGA 1IQDA 3MJ9H 1VPOH 1C5CL 4P57B 4APQA 3B83A 1UG9A 3IDIA 3V4VL 2J6EL 3VGBA 3QJFB 1QZ1A 3BH8A 1XF3B 2DMBA 2DOCA 4XC1H 5HGDA 1OAQH 3VH8G 1WBZA 2AV7A 2G5BA 4TSBL 3OB0K 1DQDH 1EVTC 4F7MB 3EDDA 1RJLA 1SJXA 1KPRB 3FB5B 2AGJL 3NA9H 3Q2CA 2P5EB 3EOTH 1HOCA 4HX1A 3TGXA 3TNMB 2A0LD 3MQIA 4ZS7L 5A2KH 2AJUH 5L0QC 2VR4A 3KPNB 4KK9C 3TFKD 1TPXB 3MRBB 1QSZA 1L7IL 4U1HB 1CE1H 1ADQH 2CRMA 2H32B 3MBEB 4NRXB 3RHWK 1M6OB 2JE8A 4UDUB 4OLVL 4R4FL 4WO4C 3M1BA 4PLJD 3LS5L 5IR1B 3V6FB 1NFDF 3BP5B 4HS8H 1FVEA 1LP9F 2HAZA 4OLZH 4JY4B 2IGFL 2OZ4A 1MVFA 1KLGA 2GKIA 5ITFB 5CZVL 2X89A 4G8EA 3CFIC 4K3HA 1Q9KB 1P6AB 5FHAH 1EO7A 4N9GA 3MPCA 4EBQH 4JHWL 1VKXA 4L9DA 3L1OL 4FQHA 3BZEA 2J1KA 1VFUA 2IPTL 3HAEG 3QG6B 1KNOA 2R2EA 3VXQA 2OXGA 4EIGB 4LEOA 4J3WA 5E0QA 1B0WA 4O51B 5E99H 2YWZA 3SHSA 5F9JA 1X5FA 4UT7H 4YHZL 4G7VH 1RY7B 3PWUA 5I16B 3P30L 1WEJL 1NL0L 1R5IB 1WTGT 2QADC 4IRSD 3AUVA 4PV9B 4YHNA 3TT3L 1A3QA 2LVCA 3QNXA 1YY9D 1AD9B 2WK2A 1FSKC 1FAIL 3HE7D 5GGSY 4CW1B 3IGAB 4RDQG 1YNLH 3G6JF 3S37X 4D9RD 4TNWK 4ZTPL 3S6CA 3VXTB 2FWOA 2ZUYA 1PEWA 5J56B 5AZEL 2DQTH 4G8IA 1HDMB 2Z91B 4WHTB 3QUMB 4RNRA 1G7IA 4Y19B 4HGWB 5BZWB 5JQ6L 4MAUL 1I8MA 2P24A 3VXRA 3LEVH 4GXUM 5B38B 1EZVY 2JJSC 3LVEA 4HC1L 1CFSA 5E5MA 1NGXB 4KJWC 3B8SA 2P44B 2E7LC 4YXLH 4G3YH 1JZ5A 3IETB 4YC2C 2H3NB 4LU5H 2BOBA 2CGRL 3MUGB 3SE8H 4NC1E 4NYLA 2B7DT 4IOSD 4P3CL 4BZ1L 2CUIA 1P84J 3GK8H 1V7ML 4OTXL 1MCFA 4DZ8B 1E28A 2BVYA 1BZ7A 2OX5A 5FO8A 1GGCH 5I73B 4X99B 1K9TA 3RZCD 4NBZB 3DYPA 2IG2H 1XZ0A 5A43C 2B2XL 2R39A 3V6BR 1UB5B 1V5JA 3OAYK 1DCLA 3BPOB 1IAII 1FE8H 2EXWD 2X70A 1JN6B 2F54B 4HXBH 2G9HA 1FNAA 1HEZB 5EU6B 1G7LB 2IPUG 4NNXB 1J8KA 3O3DA 1JMZA 2CSPA 2NYYC 3OMZA 3X3GL 5IMOB 3UBXI 1E28B 3HI6L 1AHWC 3MLVL 3UZEA 5B22A 3FFCD 3WO4C 4Z9KB 2VXQL 5IHZA 4JPVH 3O0RH 3DO7B 4U0QB 3PG2A 4IIQB 4HDIB 1U8HA 3DVGB 2Y6SD 3ARWA 3ARRA 1A21A 1J10A 3HR5A 4GW5A 2YZ1A 1IC4H 5LVEA 1OOAA 5DZOA 3C2AL 4KROD 4MA1C 5FF6B 4FA8A 5F9WB 1VADA 5CGMA 4G80B 4KK8C 3U9PL 4YQXL 1G7HA 3CDYA 3LQAH 4F37F 3TIEA 5TJWK 2Q6WB 5CSZB 4JG1L 1FN4A 1NJ9B 1OD7A 1GOHA 3CUPA 5IVXF 5INDB 4HKZA 5GRJH 5I1IL 4LCIL 3AS0A 1V3MA 2ZP0T 1M05B 3WCYA 3CVIL 4X98A 1FYTA 1NGPH 1YNTB 1BJMA 3TVMC 5E8PB 4KKCD 1I3GL 4DVBA 3MRHA 4M6NH 5FYKD 3VFVA 3ARED 3JWDC 4WDIB 5FYJL 3HNTH 5AYQA 4E0RA 4CN4A 1JF5A 2O5ZL 4G9DA 5EPMA 4JM2F 4TPRH 5HXMA 1XF3A 1OGTA 4LEXL 3R06B 5HGGS 5I75B 4ZNEE 1FG9C 4APQB 3IB4A 4PJ9D 2BSRB 4JZOB 1QFHA 4NGHL 4HW6A 2W9DL 1JHKH 5BS0E 5DWUL 3VJ6B 3PABA 1NMAH 2MHAB 3GSXB 4TSCL 5JQHC 4XP4L 5IQ9A 5DD3H 2PTVA 3L3OA 3W9DB 2FEDC 4XWGL 2ZOKB 1OAYL 5T3ZE 2QQLL 2JB5H 1DQML 2OTUB 3HMWL 2EH8H 5L88H 3OGOE 1A7PL 1K4CB 2BHZA 4I0PA 4PTTA 4LKCB 3AU1B 1T3FB 1MCPL 3RZCB 1A14L 4H1LA 5E6ID 3U46A 3QO1A 3EOAA 4OZGB 5KAQF 2FBJL 2A6KA 1I1AC 5DURB 5HHOD 3CC5B 4Z8FL 5FUZL 1J18A 1KB5L 2FB4H 5F8RC 5DJXB 2BDNL 4HXAH 1JGLL 3D3VB 5TH2A 4P9MH 4MX7B 5HDBF 3H3PH 1D5XB 4JFZH 4K7FB 2VL4A 4JKKA 3HG1E 1IM3B 1RZ8A 2NXYC 3JV0A 4QOKB 1H0DB 2NZ9C 4APQC 3BGFB 4MQTB 5ILTH 4GXVH 4EDWH 3BQUC 1KJ3H 4WW2B 3CDCA 4JPIA 2CO6B 1T03H 2R1WA 4YUEH 4QWWC 4ZPTA 3WIFA 4XPGL 3MNVB 3VA2C 5TQ2L 4LIQL 4ZXBA 5C0IA 1RIHH 2QL1A 2HFTA 3A0OA 4NRYB 5GGVL 2EIZB 3FB8B 3UJJL 1F6FB 1CT8B 3JXAA 1I1RA 2CKBH 1QBLL 4TOYH 3DMMC 4FZEH 2XTJC 4ZPVB 5BXFA 3O3EB 2XWJA 1JZ3A 2CJUH 4XPTH 5A2IH 2LU7A 4RIRA 4Q9QL 1H8SA 3K8KA 3NVQA 3QXTA 4GG8A 3NCJL 4HKJA 5D5ME 2P45B 1TTUA 2F5AL 5D2NB 3VFNA 4OV5A 1Z3GH 5I8CB 1JFQL 4OCXH 5CP3A 3DBXB 3SCMB 4JO1H 4OM0L 1E6OL 3RDTD 1CLYL 1U8MA 3F7VB 3HMXA 4HH9B 5HGHA 5IHBA 1ZGLM 3LD8C 3I6LD 2BHYA 2Q20A 5A3IC 4FQ1L 4KTDH 3WS6C 4L3EA 1JZ6A 5T1MA 3MUZ1 1LEGB 1AGEB 4PJXE 4PJAB 4JFPA 3VXQB 1PLGL 3D85D 5TFSH 1FPTL 4HD9A 3TO2A 3H42H 4G7VL 1N3NA 1YDPA 4LDOB 4Y4KB 3QDJA 3OG4B 2BC4A 5L6YH 1VFBB 1WITA 3NTCH 3HZMA 4TUJA 4XZUB 4OZGE 5D70L 2NNAB 3O6KL 4IJ3B 1BREA 3UTZB 3GMPB 3IDGA 3CGTA 3QDME 1CGXA 4NO0B 1Q0XH 4F7CB 3BHBA 3HB3C 3BPCB 1NBZB 1SEQL 4JO3L 1HH6A 2BVPB 4OCWL 4D0CA 4ODTH 3ZKMD 1IL1A 4ODBD 5H37G 4Z7WF 3BYYA 5EBWA 3EOAB 5CJXA 1U8QB 3RX8A 3VXUA 3CC5A 4H8WC 3EZ8A 4H8WL 4ZO6A 4I9WE 3TM6A 1QFWI 3K0WA 5ESQA 3QO1B 2MOVA 1CFNB 4JFEA 3TNNA 5JOFB 1MJUH 3GMPA 4G6KL 3VRJB 2MQCA 3ES6A 4YE4L 1AGBB 2X9WA 3NH7H 5HY9B 2HN7A 5IHUH 2F53A 1DBKH 1H8NA 1R3JB 1ZGLB 3VJ6A 3MJ6A 1TJHH 1S7SA 2BK8A 4KMQA 1IAOB 1S9YB 2DLHA 4HCRH 3FT3A 4XVJL 3K81A 2R0WH 3BGMA 3OB0H 1QHPA 3VGEA 3C8DA 1XR9A 1I7TA 4U6HB 5C2BL 4F7TA 1FJ1A 4NQED 2XRAH 4F9PC 5FECA 4JDZA 3GI9L 4JRXA 1T20A 1BX2A 1FNGA 4L4VE 5CHNA 1MWAA 4HWEH 5BS0D 1RK1B 2FGWH 1EPFA 4G5ZL 3WE6A 2EC9T 3QQ3B 4WI4A 3Q3GA 3U7YH 4LSSL 3VRLE 2BNQA 2X44D 1NCUA 3RUGA 1SY6H 1C12A 5CD3A 3QQ9D 3BO8A 3VRIA 3ULUD 4S2SA 1NC2D 2DQIH 3D0VB 3QIBB 4XVUC 3U0PA 5I8EA 3LSOA 5C8JA 1MCHA 2FHFA 3E2HB 1CTNA 1JWUA 1FNHA 2BY3A 3KJ6L 3PWPE 5C09D 2YR3A 4C4KT 5HHXH 1UWGH 4PRPB 4IOFC 4UIMB 3BSZL 5T1DL 2APTA 2GUOB 4LDEB 2P5WB 1FRGH 3LEYL 3LZFH 4HIEA 3QCTH 2R15A 4JKLA 1IC4L 1MCSA 4PGBB 5B3JF 3B3IA 3SDYH 1TJGH 1U6AH 1HZHH 2A6IB 2ITCB 3LS5H 1IGMH 4OSUH 4OLZL 4DOHE 2VR9A 4JFPB 1RUPH 5IBUB 1IMHC 4ZS6C 3LKSA 2CR6A 2I24N 3IDJA 2VDRL 2QQKL 4NBYB 1IGFL 4JG0L 3MBEC 1TNNA 3DUHA 5JPNA 3TH4T 1U8IA 2VDMH 1I7ZA 2HJLA 1I7UA 1ZT4B 2BY2A 4O02L 4YO0B 3D6GA 1JHKL 5E2WL 5J11C 4B0MM 4G8GB 3LV3A 1T4KB 2FL5A 5LGJA 3FN0H 1BAFH 4MNHB 2ICES 2LVEA 1U8PB 3PQYD 1P4BL 3PE9A 4BSWB 3MYZA 1E4WH 2APVA 2XZAL 1GGBH 1OTTD 5JZ7C 1FIGL 1FL5B 4Y5YB 5DJXA 4ZYKB 3L3HB 3U36B 3FKUS 4AJ0A 5GSRB 5FYLE 2NW3A 2DBLL 3ZL4H 3MV8A 3FCTA 3V0WH 3L95B 2GITA 1U3JA 1UKTA 1DANU 3U1SH 4YHML 3SO3B 1A6VL 5DUML 5F96L 3ZKQD 5DD3L 1CFVH 3DGCR 1S7TA 2EYTB 1ORQB 1S7VA 2ZSVB 4LLAA 2F19L 4LHUA 4XVSL 5K93A 3NAAH 5FOBB 3S5LG 1N2RB 2JTDA 3VI4E 4OCMC 5J1AB 2Z4QB 2PF6A 4NUGH 1U3HC 4N0CC 3ZDZE 1QSEA 4R0LC 3QIBC 4JLRB 2QQNH 3RDTA 1ODAA 4NZTL 5DMGD 2Z35A 2R56L 4E41E 2FB4L 4G43A 3DTXB 3IFLH 4LSDA 5TQ2H 4X7TB 4JZJB 5I1JH 1RIHL 5E1AB 2JJSA 4TVPH 1E4KC 4PS4L 5ITBH 2DF3A 3KXFD 5DQDH 1OL0A 1JPFA 2LU3A 2A73B 1BBDL 4PJXA 4JFYB 4N8CL 1CGSH 1OCWH 4OGYL 5E8NA 1R5IA 1UZ6F 1NAMH 1KJ2B 5GGRB 1JRHI 2YD5A 4UBDC 3WDJA 3FO9B 1S7RA 1ZVHA 4Y1AB 1HXYA 2AXHA 2KZWA 4HKZB 4LPXA 5GQBA 1T20B 5I0DA 4HF5H 4U31A 1MCJA 3B9DA 3ARBD 1CD9B 5HJ3B 4RA0C 2FX9H 2C1PB 1RZJL 5CKAA 4OF6A 4NKOB 2IBZY 3GMRA 4QF1A 4Y4KC 2QEJA 1ZWIA 1BF8A 5DEGA 2EYSB 1E0OB 5BVPH 3PWPA 2A6IA 2ZPKL 5GZOC 2ICWI 2NTFB 1QBBA 2R0ZH 3G08A 5JDSA 2NY4B 1UCTA 4KHTL 5KVDH 4ODSL 1XGRB 4WUUD 4J3OC 4XBEH 2VDLL 1TNMA 4FQJH 5C07B 3G6AB 1JWSA 5KS9F 2WIIB 3MTRA 1OT2A 1WUNT 3ZTNH 5DHYA 5JXEA 5C0AB 4MB5A 1E6OH 1T22A 2GQHA 1I8KB 4XVUD 4YHKH 1C12B 1P53A 4JFYA 4MNQD 4N1HB 3QIWD 4QXTA 2DL9A 4JFHE 4JFFB 1GYAA 3ROOA 5GGTL 4ODTL 3DHMA 1EMTH 5GIRB 3PQYE 2X4UB 4JRXE 1X3DA 2QSTA 4GXUN 3LPWA 4UINH 2Q6WA 3HUJE 1IKFL 1TENA 4GRMB 3M17A 4NN5B 3F12A 2OI9C 5FOBA 2PW2A 2ZG3A 2DTMH 4Z7OE 1QVOA 4R7NB 4K94C 5FKPB 3NH7L 2EYTA 2R9HC 3OGCA 2ZCLL 3QUXB 1PSKL 2PCPB 1OPGH 3MRRB 2P8PA 4UV7L 1N7MH 5KG9A 3U9UA 3ES6B 3O3UN 4XVJH 3SPVB 3B43A 3TN0D 4HGWA 3WLBA 4Z76A 2P42B 2DMKA 3P0YH 4CBPA 3O4LD 2AVGA 2VSDA 4LSUL 4ZDHB 1CWVA 1CD0A 3CCHA 1I4FA 1MFEH 1BPVA 4JREC 1N6UA 5K59E 3DNKA 4KDWA 5IQ7H 4XNZC 3CH1A 4NQTA 5DRWB 3FQXA 4MJIB 2DD8H 4H5SA 2AJ3A 2BVQA 3ARGC 3WXVH 3GSOA 4X6DB 1GH7A 2IH3A 3HPLA 5CP7A 3ARFC 2KUTA 1KJ2H 4PB9L 3RJQB 5D2LF 5LCVL 4NCC1 4PJBB 3Q48A 4NQUA 9CGTA 1FNFA 2AK4A 3SKNB 4A6YA 4HCRL 1INDH 1D9KD 1CXIA 1WISA 4UT6H 3MOQA 4UV4H 3GIVA 2YC1B 3H2WA 4P2OD 1I7ZB 1P69B 2HJLB 4J4PC 1AY1L 4YO0A 1RUQH 5D7LD 1QFWM 2QQQA 3D3VD 3OAUH 1LDSA 1YY8B 3L9RB 3VXOB 3IDNB 3LN5B 4FG6C 1UWXK 2X4PB 3G5XA 4AL8L 1XCTB 5D72H 1X5AA 3GBNH 3MV9A 5CEXA 1V8HA 3WXWL 3MZGB 1RFDH 2XWBB 5GJTH 1T89C 5F7EL 4JKWA 5I17B 5IFHH 1LE9B 1U8MB 5KSBF 1KUMA 2PXYA 4FMFA 1JNNL 3O3BB 4JY4A 1EHNA 3GMMA 2XQBH 4L8DA 3C5JA 1VA9A 1CR9L 2NCMA 1G84A 1OAXH 5E9DE 5J6HB 5D6DC 4C54A 3KPSE 1CS6A 2PO6B 4AG4H 1JGVH 4IBLT 3LS4H 5DQJA 3PXJA 3V8CA 4OM1L 1QSEE 3TBYB 2R9HD 5SX5K 2A0LC 1G9NC 2QR0B 1VFAB 4OSUL 4YH6A 2P8PB 3BMWA 4QOKE 4NRYA 4AH2B 1OQOA 3HCVA 5DO2C 2A9ML 2YUXA 4TNVK 5F72S 1EO8L 4OCNC 1UWEL 3GB7A 5KOMC 3IU3A 4PG2C 1WWCA 2JELL 1MFNA 1QD0A 3VFSA 2R8SH 3MLRH 1AGFB 2B20A 3PABB 1SJHA 5E4EC 2YWYA 3FB6B 3SGEH 4M62H 1PQZB 4P46C 4DGYL 3M07A 1T04A 1HKFA 1XF2A 4U05A 3UJTL 4PJ8A 15C8L 3R0MA 5MEQA 1G7PA 1J1OL 4G42A 4KAQH 4HS6B 4LHUD 1F11B 1JZ2A 1F45A 4ZFOA 3UTPE 4HHAA 4UB0H 1D5XA 4K7FA 4M5ZL 4XBPA 1RK0A 1IAKB 1X9QA 2Q8BL 1AXSA 1ED3A 4YIQA 1JYNA 4M43L 2ORBH 4JVPA 4X5XA 4HUVA 4POZC 4XCEB 5EOQH 2E9WA 3T4YA 3VXMA 4FQCL 4WUUB 3F8UB 1OAKH 3HB3D 5JMOC 4HIHA 5E6ZA 2V6HA 5KJRL 1EFQA 1A9EA 1IEAB 4I5BB 3O41B 1A6VH 2QADD 3V7MA 2CDFA 3VGFA 2UUDK 3JV4B 4LBEA 4CMMB 2GW5A 2XG5A 3NFNB 1KC5H 3UEZA 5D7LE 4ACPA 5IROC 4TUJB 1YEGL 4NUGL 5E2TH 4JFXA 5IQ9B 1OB1A 5T3ZL 3GI8L 5INCB 2HT4D 2IBGA 5BRZB 3EYOA 5HHNB 3LHPH 4P2CG 3DECA 3GUTA 3N0PB 1TTFA 4KUCF 2X89D 4TSBH 1SJEB 3NZHL 3FHAA 4PJ5E 3IVKA 2R2HA 3QUML 2IH3B 3RWHA 4BQBA 1F58H 4RRPA 3SDCB 1HHKB 5FYKE 5BO1L 1T83C 5GRVL 2R1YA 3HHRB 3K4AA 1FO0B 1K8IB 4NSKA 5FA3A 5IMOA 5ICXB 4ZUSA 1XGTB 4LAQL 4Z6AT 3GGWB 5HPMB 1CIDA 1GXEA 1J0HA 1TVDA 1ADQL 3IXAA 3MLTA 4KUZH 2WMPA 2DB8A 1T1XA 2AW2A 4MD4B 4Q7DA 2H9GB 4Q6YA 1Q94B 5E99L 3CFJB 1BQUA 3GSVB 3QQNA 1AQKH 2D7NA 2PO6A 3CSGA 3ARDD 4GRLB 4OLWL 4OZIB 4AIZA 3BH9A 4Q2ZA 1X7QA 1IM9D 1MVUA 1PG7W 2X4QA 4GAGL 5C0CD 5DD5H 1C5BH 4GRWF 2A6DA 2AJVH 1DUYB 1IGCH 4K7PX 1FAIH 2QBWA 5HYJB 1FN4B 3VWJC 4Q0XH 1LE9A 2HTKC 4GUPB 4TYUA 1XIWB 3CH8A 5ISZE 5T1LD 1WZKA 4KKBD 1F6AA 2DYPD 1KTKE 1CICC 5HHXL 2Y07L 5AZ2H 5KZCD 3B9KC 1UACH 4RWHA 2OLDA 2AXFA 3ELAT 3QI9C 5C0IB 5B4MD 2OR8A 3U6RA 3PDGA 4P4RA 1SVCP 4TVSa 1CFSB 4M1GL 5E5MB 3A6BL 4EN3D 4ZPTB 4LRIA 1AD0A 4U7SA 5C0CA 4LCWE 3SDYL 3X17A 2D9QB 2E8YA 2R0KL 3RI5K 2ATPA 2DQCH 2CPCA 4Z7VE 1JMXA 4L8SB 5EFIA 3ULVC 1M7XA 2YD2A 4QOKA 3F58H 4WY7L 1ZLSL 3MROA 3L95A 4C58B 4F57L 3SKNA 4A6YB 3ZTNL 5JW5B 4JQIH 2X09A 5I8OH 1S9WA 4YXLL 1NBYA 1IZKA 5ACZA 2UYLB 2UWEE 2RBLA 3IJSB 4PJCF 5JHDD 3P4NB 4BK4A 1BFSA 4JRYD 4BH8B 4MNQE 1T22B 2DQTL 2HLFD 1MJJA 3O4OB 4CW1A 1ZA3B 2DIJA 2EDNA 1HI6A 2ZSWB 35C8H 4MD0A 1Y6KR 4U2YA 5EB9A 1T5WB 4CNIB 1AFVL 4ZAKC 5GSVB 3LEVL 4RFNB 2ITDA 3VGDA 3V5HB 2NY1B 2CKBB 4Y4HC 3ULSA 5SWZE 5K9QI 1SQ2N 4ORGB 3T2OA 2C4FU 5E70A 3VI3E 2DTML 5GPRA 1Q0YH 2WSKA 4RMUA 4JFOA 3TLRA 3VXME 3OJMB 2ESVE 3DXAA 5EA0L 1CICD 4YGVB 1XF4A 1OPGL 5C0JA 5I1LA 1YMHA 5E9DA 3JWDH 2GFBB 4XMKH 3MLVH 4CU8A 2HTKD 4O5LH 4N9GB 3DRQA 4YGAB 2DAVA 3T0WA 2X9XA 1XCQB 4KI1A 4HIEB 3I9GH 4J4PA 1CE6A 4XVSH 4NKQB 4NNYB 1HXYB 2NR6D 2ILLA 1FGVH 4PJHB 2HTLD 5EU7E 4PRHD 4MSWA 5D8JH 1HQRA 2EO9A 2AABH 3SKUD 3B2VH 3WXWH 4FNLH 3OX8B 2AJXL 4PR5B 4PJ9A 5ADPH 1PEZA 2R56H 4PGCA 2BSTB 4CADA 4M6OH 1FYTB 1JPFB 4X80L 3CFCH 3BRGC 4FXGB 4JEGB 1Q9OA 4UQ3B 1AGCB 3L3GA 5F9OL 1G6RL 4OD1L 2IH1B 3QH3B 2QHLA 5CHNB 2KKQA 2ZCHH 3O4LB 4RMQA 4I3SH 3IKCA 3FO2B 4NQDB 4P46A 4D0BB 4K7PY 3ZLQC 4IDJL 3PWNB 3HZYA 5FO7A 1JTPA 4DN3L 1J0YA 1F6AB 5D1ZA 1E4KA 1BFTA 1BEYH 1BOYA 4JFOB 4KJWD 4LKXA 3TIDB 2AQ2A 1CVRA 3U9PH 3QUXD 5JIHA 3P9LA 4HJJH 5I1LB 2EDRA 4PJ7E 3IXTB 3MCKB 5IVZA 1J0JA 2KPNA 4LCIH 1KV3A 1D9KC 2XFXA 3BE1H 5FHAL 4AEFA 3VW3L 1KLGB 5EZIL 5DK0A 4L4TB 3L5WA 2XACC 4KKLC 3O6FC 3HAEH 4KY1H 2OTWA 3PGCA 4LASH 1I85C 3O6FB 2JB5L 2FO4A 2GT9A 4ISVA 3B5GA 1S9WB 4CKVX 4B7IA 3WJLA 3QCVL 4WW2F 4DKDC 4N8VA 4OIBA 1XZ0B 3FT4B 1JNJA 3TV3H 1MH5B 1A6AB 1XH3A 2VL5A 4P4KB 4YDVA 4UILL 5LXGH 1LO4L 2AEPL 4OZ4A 3W11C 3OKLA 2V9QA 4PJ5A 3KPRB 1ACYH 1QBMH 4YWGH 1A4JB 3MNWA 3VRLF 4HXAL 1BLNA 2DLGA 4BKLB 2FDBP 5D7SH 2K7PA 4ELMF 1EUUA 1WT5C 2AEQL 2VOTA 1OSPL 3KGRA 4P2RB 4LKXB 5F7LB 4NQVB 5J1AA 4KRMB 12E8L 2CDFB 2I60L 1P7QB 5ILTL 3VXSE 1ONQB 1SYSA 3KJ4B 1E27A 2VDKH 4PRHB 1NUDA 4OQTH 3VD4A 1I8MB 2DRUA 5IT2H 3QULB 3OKKB 2W59A 3IRPX 3PHOB 3HZVB 3MV8B 3V8OA 1PSKH 2NX5D 4Q9BA 3WSQL 2O5YL 5GSRA 4YXKH 4WUKL 2XTLA 4ELMB 3QNXB 2HG5A 4UAOB 4X8JA 5BV7H 5DMYA 3C9NB 1DQTA 2J4WH 1XAUA 4XCYA 1NC4D 1AH1A 3KYKL 4NUJB 3P11L 4KHXL 5DFTA 5E6YA 2PTTA 1MF2H 2OBGA 2Q7YA 4PRBA 5T3ZH 3WNOA 1SVZA 4QGTA 5K9QG 3KPOB 1GAFH 1Y6MR 4RMTA 1MHPH 3RVWD 2N7AA 4PJCA 1O7SA 1INQA 5IW6B 2P1YA 3QXDA 3A67H 1UM5H 1XEDA 2F74A 3MRFA 3DX6B 4MA3B 4P2OC 1CLYH 1WCBB 3DO3A 4WTZG 5FYKU 3CVHA 1KTLA 4FQXC 3FFCA 4P23B 4R6UA 2YA1A 4L4VA 2CLRB 4OLUH 3CPLB 4EVNA 1T2QH 5FCUH 4FQ1H 1LGVA 3D39E 1A9EB 2B4CC 2CKBL 3QCUH 4PJXF 4NO2B 3KLAB 3SKMA 4BFIB 4C56A 4WCYH 5D1QB 1S7WB 4R26L 4DKFH 4EEEA 3BUYB 2BNQE 3JV4A 1FVEB 1ORSA 1G6VK 4AZ8A 4M1GH 4NFBA 4Y2DC 5CINH 4NHUB 1F4WH 1J11A 5D72L 1MCBA 3T09A 4OI9A 2AXGA 2HH0L 4GQPH 5SV4A 1B0GB 1JI1A 2AEIT 3EJZD 3SDAB 4YHIA 4OJFL 5EZLB 5CGYC 5ABDE 1O0VA 4P48A 5FYKL 3I6GB 1Q9WA 4TUKH 3TNMA 4CDGC 4CVXB 2VZ1A 2C7UA 4L4VB 3KPRD 4M1DL 2LTQC 5T3ZD 4XRCA 1Z0NA 4K3DL 3VD5A 1RZGA 2X4PA 2YD1A 3RX5A 1UACL 3RL2A 4PJAF 5FYJD 4ZFOB 3C5ZA 4D9LH 5E03A 2JLLA 3ARFB 4LSPH 3GMNA 3TC9A 2RFXB 3NIGF 1S5HB 2BC4B 4HWZB 3EYSH 4PJGF 1CU4H 1GGIL 2IFFH 3GJFH 4U1MA 1BQHB 3P4MA 1MJUL 2CIIB 3MZTA 4OD3L 4GT7A 5D1ZD 1HSAB 4MDJB 1U95A 2YSSB 4L3EB 1FDLH 2JELH 1P7KB 4MA8H 1A6WH 1FFOA 1TJHL 3NMEA 1I75A 2AQ1A 1NFDB 4ZD3L 1K3ZA 4LLVA 3KPSD 3VH8A 1D5MB 5DWUH 1YEIH 3MV7D 2A1WL 3QEUA 3T1FB 3MUHL 2BSSB 5F9DC 2YMXL 4Z7UE 1LP9A 1QKZH 1YEFH 2GAZB 5DJ2B 4MXWH 4PJIE 4QHMA 1QEWA 4PJ8C 1B9ZA 5L8JB 4MS8C 4V1DD 3L3DB 3H3BC 3MV8E 3T3PE 4PRHA 5LGHL 3BHBB 1FC1A 4R4BA 4DKAA 3OKOA 1MAJA 2X6MA 3M45A 1SYSB 5EBMA 4QNPF 2Y9RT 3RU8H 5HHQB 2BXYA 2H8PB 1KB5H 1QVOB 1X5ZA 1NCAH 1RZKC 5D7KD 4XXDB 3VWJA 5F1IB 4JN2A 4U1GB 3KNBB 5I1CH 3TPUA 1H3GA 1M71A 1U8LB 5IB5B 5FM4A 4PRDB 2R1WB 3C6LB 1EFXD 1AKJD 1FGVL 4PLOB 1MH5A 1XH3B 1ZK9A 2NY4D 4P5MA 5D7KE 3HPLB 5DT1L 1J1PL 3WHE1 3JZ7A 4P2RD 1HHGB 4LSSH 1GPOH 1U91B 1TITA 3X14A 5F6HJ 4HK3J 1MOEA 1NUFA 2HT2C 3FT4A 3OKYA 5IESL 5D1XB 4PJCE 4OGXH 1B4JH 4ZAKD 3JWNC 5A2FA 2VDRH 1KOAA 5T3XD 2BJMH 1MCQA 3D0LB 5DJ8B 4AT6A 3EO9H 1LEIA 3VMPA 4XCEA 3VW3H 3FONB 2A6JB 4PUBH 1JHTA 1RUKL 2GK2A 4GKNB 1LO0L 3HN3A 5ALBL 1IC5H 3PGFH 3KYMA 1FZJA 2XFXB 2OP4H 5BCAA 4QHNA 5IVXA 4C56E 2IWGA 1DBMH 4LASL 1QR1B 4EI5C 2C1OA 4RMSA 4KK9D 1AI1L 4PJ9C 1NDMB 3T2NL 1KJMB 4J3TA 3MO1A 3NACL 3OR7A 1G7JA 3DX6A 4ODUB 1SJHB 2GHWB 5KSBE 3VDCA 4ZNCD 4OF3A 1K3IA 4FQ2H 4OCXL 5D7JC 2PW2B 3GMNB 3C87A 4G8FA 4JO1L 3WKML 4HBCL 3ARQA 4FQPA 3WNKA 3RL2B 4UT9H 5TDNA 2O61B 4LPUA 1CXKA 5BZWA 1AGCA 2XNAB 2A9NL 3P4LA 3C9NA 3LMJH 3BZ4B 1D5BA 1REIA 1AQDB 3ZT6A 2EDYA 2YUZA 1KFAL 2OCFD 5HGAA 3BI9X 4PY7A 3ORJA 4KC3B 2DBJA 3VG0H 4XNQA 2AAVA 3W9EA 5SWQB 1MRCH 3IYLW 4JZJA 5EIIB 1OGAA 3HTLX 5E1HB 1J8HB 1RUAH 3MJ9A 4FZ8H 2YD7A 1QLFA 1MCOL 3QDMB 3CFDB 4JY5L 4EOWH 4P2QB 5I1JL 1EEYA 5FAAA 3S34L 3KLAA 2AGJH 1PGRB 3ARPA 4PS4H 1LO5B 3L5XL 3MRJA 5DUBA 3AXLB 1QBAA 5FK9B 5E2VH 5GZOD 3PP3K 3RUGF 2YKLL 3PUCA 2UY6A 4HLZH 4HKXB 4RBPH 4U1LA 5FGBA 5GISH 4PJIA 5C70A 4LQFH 3HC4H 5C08E 4LRNL 2FJFB 3KR3H 1BGXH 3UPCA 2PW1A 5C08B 4OUUA 2V17H 3SDDA 5F7HA 3V5KB 3N9GL 4JZOA 4OKVA 1FG2B 4XP6L 2FX9L 5IKCB 3N1GC 2J8UF 2VL5B 4ZFOL 2YOCA 4OF7A 5C0DA 5J11B 5IW3A 1U2HA 2ICWB 5EUOB 1UYWL 1ZA6A 5DZNA 4F2MB 3CX5K 1PYWB 3KXFE 4QTHB 2CXKA 4KI5C 3F7YA 1B2WL 4FQLH 4NWUL 5CD5D 4AT6B 4PBXA 5E1AA 4OLEA 4ETQA 3OHXB 2EDOA 4NOFA 4PJDB 4KHTH 2D7OA 3SOBH 2HFFA 4YDIH 4PJ8D 4HWEL 1TPXC 4E42B 3MODH 3KPMA 1U42A 4OFIA 3HMXL 3T3ME 1KEGH 1RULH 3E3QE 5CIPA 3DX8B 4HJ0D 2OJZH 2XXCB 1NUNB 3WFCH 3SDXE 5KANG 1VFMA 3MFFA 3KVQA 5FYKH 1EIBA 3UDWC 2NPLX 4LLMB 4X7DC 4JHWH 4XPBH 3M8OH 5CSZA 3KPPB 2P49B 4AEIL 3OV6A 2ZKHL 4NC0B 4ESKA 5GXBB 1FYTD 3O11B 2X41A 3GJEA 1G6RH 4OD1H 1KGCD 4Y7MA 5GS2H 3OAZK 4TVPE 2NY5C 4WWKA 4LVNB 1C16B 1VGEH 1ZHBA 2XYCA 3TBTA 4IDJH 5JQ6H 3P9MA 5K33A 1K4DA 4G6MH 4HDIA 1NMCB 3DX8A 4PRHE 3B6SB 2NW3B 4P4KA 4UOJA 4YDVB 1HZHL 4IEFB 2FJHA 1A1NA 3GSVA 3UBXB 4NHCH 4YJZL 4JRXD 4HK3N 3S4SB 3QPXH 3MYJA 1MCDA 1T1XB 3IJYB 1LK2B 4D9QE 3BW9A 5AYUH 4RAVA 4TN9A 3DIFB 2R69L 3C08L 4YHKL 3F6LA 3F7YB 1U8PA 4OCRH 2NXZB 2APWA 4K3DH 4M61A 2VXTL 4HFWA 1ZEAH 5GGTH 1E4JA 5B39B 3EYVB 3PHQB 1V7NH 2L4OA 4TUOB 1FFOB 2YMXH 5EDXA 1W72L 4NO3B 1KB5B 4EI5D 5LQBL 3RY6A 4FXLA 1CGTA 2HKFH 3DPBA 3IDYB 3LV3B 4G8GA 3MCKA 4LLWA 3FZUD 5IKCA 1CU4L 4LF3B 1N4XL 3ULUF 4HC1H 1KLFA 3EDKA 3BEWA 8FABB 3P77A 4HGMA 3ZKXB 1AE6L 3C5ZD 4UILH 5LXGL 1TQCB 3OJVC 1DBBL 4X4XA 5JLZB 4O2FA 4HZAA 4NO0D 5DVNA 1RZIB 4O2CB 5JHDB 2NY7H 1QFOA 4CGTA 3MRLA 4BQ6A 4L4TE 1UJTA 1W0WB 3DX7A 4OAWB 4WU7A 4AY0A 4M7LL 3VXUB 1NCWH 4DAGL 1T1WB 4UTBH 3T0EB 1B88A 3BVNB 1CDYA 4NKDA 4LSRL 5JW4N 3ETBF 4OQTA 4N5ED 5L2KD 5A3ID 4Y16D 4PRNA 1BQHG 3RIFK 1I8IA 4PLNC 2XPGA 1HN1A 1YYLL 2FLBT 4OZHB 2YK1H 3HFML 4KMTH 4QHLB 5LWYL 5BVJB 1TVBB 5IFHL 5KN5B 5EO9A 5I30H 4GW1B 3RL1B 1WSST 2Z93A 1QSFD 4EUPA 5A40E 4S1SH 5GGTA 2BJML 1P4IH 1T04B 4Y5XC 4A6YH 1INDL 3NA9L 2MKLC 1WBXA 2VR5A 3ILPB 4YFDB 4WUKH 4C83B 4HPOL 3IFPB 3MV7B 5MERA 3VU2A 3H9HA 2NZ9D 2RHEA 3OAUL 1WC7B 2D0FA 1N5YL 1EAPA 2AJSH 1I3GH 5I1HH 5EWIH 1Z6JT 2IPKB 3GBNL 3WS3B 2DLFH 4PJFA 4PJAE 3EKCA 4EQ2A 4PV8B 1ZOXA 4YNYA 1MLBA 2VZOA 2XTJB 4LVNC 2VLKB 1A7RH 2C1OB 4MLIA 1H3PL 4WGWB 1CN4A 3MRCB 2VDQH 5AUMA 4KRNA 4IOIA 4QWWD 2H1PH 2DWEA 2OXHA 1VACA 2WZPD 5DK2B 1IC5L 3K2UL 1G9ML 5MEOA 2KZ1B 2VLJA 3LN4A 5BXFB 3CSYA 3WYRA 4LHUG 1LD9A 1ZGLP 1NGQH 2V7NB 2DICA 4YBLC 2IQAA 2W0FB 4NP4L 1N6QL 2XOTA 5I8KL 3QDGB 1WZ1H 4Z77B 4N5EC 1F6LL 1WEJH 2VAAA 2XKNA 3ZKNC 1J0KA 3MXWL 4HIXL 4P2QE 3MV9B 5CEXB 4LSQH 1AIFA 1OSZA 3Q6GL 3VE0A 5CILL 2P46B 1MCOH 1P1ZB 1UZ6E 4U1IB 3S34H 1BIHA 4WV1B 4PJCB 5EBGA 1DLHB 3D87B 1YQ2A 3PQYB 3L5JA 2R23B 1KIQB 4V1DE 4ZSOB 3CU7A 5TDOA 1JYXA 2COQA 3WUWA 4MQXD 3PWLA 1W0VA 3MV7E 5T5NG 4KZDL 5C0BB 3CD4A 1IGTA 5E8OB 4XWOD 3VG0L 4KPHH 4NDMB 2IANE 1GSMA 1KJ3L 1GGTA 3TBWA 5C9KA 4LSVH 1AGDB 2J8UB 3DLQR 3OR6B 1GC1H 2YXMA 1NCTA 2DTSA 3GMOA 3DSFH 3U2SB 1JGLH 4IMKA 4X5XB 1BJ1J 1DR9A 1PD6A 3EOBA 3QUMH 5DC9B 3UO1H 3FMGL 5K9KB 3VFWA 3JSSA 4W70A 6CGTA 1YEIL 3I3BA 5HI3C 2IPUK 3NFPA 4I1NB 3MRKB 3MJ8A 3EYUL 2NY5H 3QFJE 1FFRA 5C6TH 3J7HA 5BMFL 4Z78A 1RAMA 3IDXH 4QXGH 1XF2B 2YS4A 2ZNWA 3VGAC 3H9SE 2G2RA 2DMCA 3MA9H 3B9KB 1WZMA 4LPTA 1TCMA 3HE7B 3MXVL 2EZ0C 4IDLA 1LO2H 5FGCB 1T89A 5IMMB 3VFGL 4WWID 1MJ8L 1C5BL 2IPKA 2N4IA 4GRMA 5JXED 1CK0L 2CD0A 1EK3A 1Z3GL 3OTTA 4Y1AE 2UZXB 1IQWL 3MLYH 3S8WA 1D3CA 1WC7A 4M9PA 4R0LA 4GFTB 1W72B 1HCFX 1RZGB 3HI6H 1YN6B 4L3CA 3IDMB 1DE4A 3C5ZB 3NFSL 3S37H 4L8CB 4Z7QF 1UC6A 3HRPA 4OKDA 4UV4L 3X13A 4MJ6B 1X5YA 4XWOC 4KTDL 4W4NA 5GRXG 4R8WL 4YPJA 5CLTA 4XRCB 3KYNB 4X5WA 3W0WA 3S36L 4FZEL 3EO0A 4QT5A 1D6VH 2X7LB 4PTUA 2PYFA 3BVNA 3VFOB 2FLRT 4D0CB 4JM4H 5EZLA 5TFSL 4Z7OF 3NCJH 1V3JA 4OFYD 1RK0B 4HXBL 1BIIB 2F58L 3DVNB 2Y1VA 2DWEB 5CEYB 4L8BB 1MCKA 2R69H 4DVRH 4LLQB 3AMLA 1FG2A 3T0DA 2EDTA 3DGGA 1R6VA 4YBQC 1YEKL 1ZT1A 3MJ7B 2MPAL 3PNWA 1EEZB 4G6FB 2VLJE 3ZE0F 4WI6A 1IEBA 5T1KD 1EV2E 3MRFB 1S8DA 2PYED 1ULVA 1X5KA 3LS4L 5F70A 2CKNA 4GAJH 4C55A 1Y18B 3C2AH 4JZNB 5EPMB 1XGUA 5I76B 2CRYA 4XXCA 4GBXD 1CD1B 4KI5D 3S9DB 3UX9B 1K2DB 2NX5E 2EYRB 3OXRB 3TVMA 4WY7H 3SDAD 3TA3C 4JAMB 1ZS8A 2V2WB 2XKUA 5SV3A 4D3CH 4F57H 1KLUA 1G7LA 4K94L 4Y2OA 5B8CC 4N1EA 4P2QA 4TPRL 3O4LE 4PGEA 1Q9OB 5JA8B 1ND0B 1MFBL 4TRPL 3JTTA 4LEXH 3CFKA 4YHOL 1JHLL 3MRGA 1GVIA 1LEKA 2VZTA 4JGJA 2XN9B 4HEME 3CFBB 2XV6B 3LY6A 1RMFL 3OXSA 1NLBL 4LFHG 4JO2H 3BDYL 3KWWA 4J7RA 5BS0A 5KZCB 1K85A 1OP5K 1M05A 4WRLA 4PJBF 1OAYH 1K5NB 3ZE0E 1KN4H 2Z35B 4IHOA 5CGTA 3T8XA 3ALXA 4JRWA 5FM8A 5IMKB 1C16A 4ZMAT 5GS0D 5JORB 1DFBH 3MUGA 4JGUA 4JB9L 1OW0A 1AD0B 5C0CB 2AEWA 1YN6A 5EOQL 3ZDYF 3G6DH 1CZ8H 4DOHB 3OSKA 4GMTH 1MLCB 5C7XH 4KROC 1B6DA 5HYJD 2DQFA 3HNSH 4KXZH 1IGIH 3N50A 5F89B 4QTIH 5KS9B 3TYGH 3B9AA 3FO0L 2EE6A 4Y2DA 2DLTA 3QUZA 2W1NA 1DQQA 3UTSB 1PY9A 1ZKAA 1KGCE 2QADB 4LSRH 4OLYH 1FRGL 3LEYH 3LZFL 4ZAKA 2Y4SA 2JB6A 3PWVA 1A4KB 4QHNB 1FNEB 2X70B 3AMKA 4DGVL 1A14H 5CEZL 4P2OA 1EGJH 4BZYA 5HDLA 5HYQA 4RWYH 4ERSH 1KXTB 3DWTA 1HYRC 4MD5B 4R7DA 2E9JA 3P4NA 5HDQH 4LL9A 2ARJB 1QFWH 5DMKA 3G6AA 3DROA 2X1XR 4OZGA 4G6AD 3UTQA 4MZ2A 3RTQB 1JGDB 3RWGA 2M26A 2FSEB 3IAQA 3QYCA 3V0VA 4KRLB 2ZCKH 1K4CA 1U8IB 4NZRL 4NJ9L 1QLRB 4M6AA 3BKJH 1FNSL 4JREB 5L2JA 3I84A 1MI5A 5EG6C 2VDOL 4DZ8A 4GXVL 4EDWL 5C0AE 1U6AL 4JM2B 2CJUL 5IOPB 4Q9RH 1NAKH 1Z0MA 4YDJB 4Q97A 2AK1L 1EUTA 3V6ZB 3QB7C 2AXFB 5I8KH 4MQ7B 3MLSL 4HEPG 3BOVA 2EDJA 4PY8J 3AXLA 4F58H 4FQIH 3WFCL 4LLQA 1MQ8A 1RIUH 3EAKA 4YR6A 2AJVL 4MMZC 5DFVC 3V4UH 2VXUL 4LCYA 3THMH 4HKXA 4JJ5B 1JZ4A 4RFEA 4Q0XL 4GG6F 1K5NA 4KVNH 2RQ8A 3G04B 1IAIM 4F8QA 3L3IB 3P73B 3GSNB 4NN5C 3RGVD 1EEYB 1M7DB 4RSVA 5I1AB 5EU5B 1LEKB 5HYIA 4E5XB 4ODHH 3V4PH 3DJ9A 5B8CA 3HC3L 1N8ZB 3KJ4C 3KWWB 1BJ1H 3DSNA 2I9TB 4KPHL 2FECI 1WZ1L 4K8RC 1G9NH 5C9JB 4F7MA 1G1YA 2VZSA 4MSWB 4M3JA 1DDHA 4K23L 4JQIL 3QIWC 1BOGB 5CD5C 4Y5VA 3IFLL 3D2UD 1L0XA 4MNGE 4AK1A 5SWZD 5EU4B 4LEOB 3T0EC 4JFED 4N8VG 1LO3L 4OCRL 4U6HA 1T0NB 2OI9B 1CFVL 2GFBA 4WEMB 2GSIB 5FUCE 5BV7L 1EHLH 5FYLD 3D69A 4AEHH 1SEBA 2FD6H 1MHCA 4XCCH 1PG7X 4KZDH 3LRGA 2C1PA 1FPTH 3MA9L 5F1NB 4GBXC 2G60L 3G9VA 1AKJB 5T1KB 3NN8A 3HKFA 1WFUA 4KV5F 7FABL 1IT9H 1FV1A 4JFEE 4HF5L 5C0NC 3ZE2E 3UTQB 3VWKC 1FVDB 5IHLB 3WFEH 1ZHNB 5GZNC 4PB0L 3QWRD 3CNKA 1IL1B 4W4OA 5DFVD 3MRIA 2VQ1A 4NPYA 1YZZA 3T2PA 5GHWH 2R0LL 1SEQH 1R3IL 1YPZF 3S37L 4M48H 2BXZA 1HHJA 1WIOA 4U1KA 3NA4A 1KPRA 1AXSB 2LAGB 4YIQB 2DM7A 4KKLD 2GSGA 2O93L 5MENE 1A4KA 3S36H 2XZQH 4TULH 3RPIA 1ES0A 3BJ91 3QEGL 2Y72A 1HKLH 2XN9E 3PV7A 5IJKA 5E4IA 4GW4A 2EDXA 3SY0B 3MR9A 4LARH 2QSCH 3U7YL 5ISZD 5GJSH 3UAJD 1KEMH 4TQEH 1PQZA 5ELIA 5KTEL 2DQFB 3PGDA 5I30L 1U36A 4Y4HA 3HI1B 3UCRA 1IGJB 2NX5B 4FP8H 2VNCA 3U30C 1TETL 1ZHLA 1QSFB 1QHOA 2Z31B 4JHAH 4WJ5B 4Y8AA 2R0ZL 4QXUH 5IBTH 3ZDXE 5HSFA 3DUSB 2WQRA 5JNYB 3H9YA 1D6VL 5EC1B 3OKDB 2VDLH 4WEBH 3GSOB 4LPVA 4UZGA 1QR1A 3OG6B 4L1DA 1F3RB 2DLFL 2YPLD 5CZXC 3JVGC 5I8EB 3HAEB 3HR6A 3IGAA 4Z7VF 4D3CL 3VXRD 1Y0LA 3JUZA 1PKQE 2Y36H 4YHLL 3SKJL 2JIXA 4UUJA 3BP4B 4ONGH 1Q38A 1KF9B 1HNFA 4E5XA 3BW9B 1D5IH 4X7SH 5HPMA 4G6AC 5DLML 1M7DA 1D5ZA 2FZ3B 4XMPL 1T2XA 4G9FE 3O6LL 2WUCH 3BDYH 1FH5L 2PCPA 1KB9J 3MRRA 4S1RL 2AXJA 2DS4A 5H35B 5JIKA 5DSCB 3H7BA 4PJDE 5A16A 4MDJA 1KTDB 4W4OC 2BOCB 4FFWC 1TJIH 5IQ7L 2NY1C 1GIGH 1QOKA 4YXHH 4RISL 1R3LB 1U3HD 4YK4C 3GNMH 1N5AB 3Q5OA 5F1IA 3MRQB 4LSQL 1FORH 1U3ZA 3ARFA 5D2LE 3H8NA 4YHOH 4U4BA 4Y4FD 3ARBA 5CILH 3G5ZA 3DVNA 2V7NA 3TF7C 1V7MH 2HMIC 3WFBH 3MOBL 2GJ6A 1G7QA 4K9EL 1L9MA 3TYGL 2Q87A 5FEBA 1TVHB 1ZVYA 5EU7C 3KLHD 5BRZE 4I3GA 3S98A 2K1MA 2HKHH 3GHEH 1QUNA 3EJYC 4I4WA 5CCKH 4OLYL 1EHAA 4FFYL 3VMOA 1BF2A 4WO4D 4YBHA 4HUVB 1AHWA 5ANMA 2XY1A 1C5CH 4MWFA 4ONFH 5J7CC 4MAYA 4NQSB 4BFEA 4NO0A 2VSCA 1QRND 1WAAE 3BIAX 4LHJB 1M4KA 5ALCH 3G6DL 4OQTL 3NABH 5DVOA 3NN8B 5C0EB 4RFOL 1LVEA 5SWSD 5F7KC 3QDHA 2E6JA 4Y4KA 3IXTA 3U1SL 4J3XA 3ZKND 1I7TB 3UO1L 1QSVA 3HE6C 2ADJB 1I3VA 1YN7A 4U6VH 5EUOF 2BNQD 4M93B 1QRNE 5DQDL 5B4MC 1BBDH 4OCLC 3G6JE 4G6JL 1BFVH 1KIPB 3SBWC 4MA3A 4C83A 2YEZB 1IAOA 4DGIL 1KN2L 1A5FH 5L9DH 3T77B 1KPUA 3D69B 3GB7B 5H94A 4PJIF 3I75B 3OKNB 2I9TA 5HI5D 5IG7A 1RZ7H 4PRNB 5JORA 5EU4A 3QEQE 5B8CB 4G9FD 3KXFA 4P5TC 1BVZA 1F8TH 3GBML 4YPGA 3LQMA 3V7AE 1CR9H 1YJDC 3OPZH 1MCCA 4U49A 5ITBL 3C60C 1A2YB 4LLDB 4UT9L 5LG1A 4NO5A 3WO3B 4OFDA 5E9DD 1DBML 2AXGB 4HAFA 1T7XA 3BKJL 2WBJA 4EI6B 4M6NL 5CEZE 1FVCB 1IGTB 1Z9LA 5E8OA 2IBZX 1CCZA 1NQBA 2C4XA 4MVBC 1J88A 3N1FC 1JYVA 5DHVH 4KK5D 3RAJH 2EDFA 6FABH 3TT1L 4HS8L 4C56B 3QISA 1U93A 5T5FH 2O5XH 2VUOA 1XCTA 1P7QA 4ZXBB 2BERA 2Z4QA 5IOPA 3GSQB 2SEBB 5GGSA 3TT3H 3WN5A 3V6ZA 3MREA 3R1GH 1JYWA 4M7JL 5IHZB 1ORQA 1S7VB 2J7LA 3WV0A 4NQCB 3JWOC 3LQZA 4IIQA 5DHXB 5BVPL 4XP4H 3HPJA 1NCCH 5HVWA 3BEVA 4D9LL 2NQCA 2A9NH 3IF1A 1S9VA 3GHBH 4UB0L 3E6FB 3I6LE 2BVQB 1A6AA 1X4ZA 5E8NB 5CP7B 3GIZL 4ENEC 1KTRL 1DBJH 3VMNA 2GTWB 2WLZA 3QG7L 2I26N 3FRUA 4OD3H 2YA0A 1PW3A 4L9LC 1RUAL 4IRSB 1S7XB 1OAUL 1F00I 1T5XA 5I19L 2BVOB 3SDCD 4EOWL 1SMOA 3WL9A 4XBGA 3QUZB 4RGOH 3FQNA 1CXLA 4YZFF 4NM8H 3CXDH 5D6CB 1J86A 2W0KA 2YHGA 2BOBB 3UTOA 4P0DA 4JVUA 1NSNH 1FNEA 3TZVA 5C07D 1ONQA 1WIPA 3L5IA 1P7QD 4JDTH 3Q5TA 3WIFB 1ADQA 2V2TB 3NGBB 1OTUC 2VDNH 5TPWL 4P59L 1IKNC 3F5WB 2VIRB 5IV2B 3L7EA 1A3LL 1WAAA 4WW1B 4XNYL 3VD3A 1XIWA 3C60B 5EU3A 3ZYJA 3E6HB 1H3WM 1NEZG 4TQEL 1C7SA 3BGAA 4FXGA 3FQNB 4NOBA 3FO2A 4P46B 3X3GH 1N7ML 4OIAA 1E4XH 4JFFA 2WBJB 4GW1A 3RL1A 4ZSOE 2AERT 5I1KL 1U8OB 5CZXD 4MQSB 3G6JB 4JANA 2VXQH 4PJGB 5ID0B 1AY1H 4E42A 1SJVA 5I1CL 4OB5L 1KENL 2QKIA 4YX2L 1YECL 4HKBB 2P5ED 1R0AL 3EOBB 1FZOB 3BGFC 4QY8B 3CVHL 3BT2H 3HUJB 3LKQB 1JWSB 4LCUA 4X98B 3B9KD 5GRVK 3UTSD 1LP9B 1JZ8A 1ZLWK 5CEZH 2R2BB 4JQVA 1XGRA 3W39B 3FQTA 3K2MC 3GSUB 3UPRA 3UJIH 1MFCH 2QJDA 1Z5LB 4PB9H 4JQXA 3EYQC 5T1KA 3MGOA 3NBNA 1MSPA 3TN0B 2EIBA 5TE4H 4CU7A 4ORZC 2R2EB 4JPKL 3IDJB 3LH2H 5JDSB 4XPFL 5EZOH 5IVZB 3HC0B 1FQ9C 1WGOA 3ULVL 5HI4D 4LLYA 2Y6SC 1NGPL 1ZT1B 3GMRB 5DUBB 1XF4B 5C0JB 3CLFL 4JZNA 3DVIA 3BIKA 3BP7B 4NN7B 3D9AH 4GG6A 3T3PF 2VWEC 4WFEE 4AIXA 3BZDA 3BDXA 1FZJB 3K3QA 1A6ZB 4YDLC 3OQ3B 4I48B 5TE7H 4LPCA 4NHCL 3T2NH 1B0RB 4N9OB 3RVWC 4RISH 4XCNB 5L6YL 1BVLB 4HUWA 3D1MC 4LOUC 5GRJL 5I1IH 4KFZC 2DWDB 1EJOL 1LMKA 5FCSH 1ZSDB 4MNQB 1A2YA 4JY6B 3VFOA 1KT2B 5DZLA 3KYNA 3CZJA 5D1QC 3MLUL 1MCIA 2XNAA 1OAXL 5EIIA 5I1AA 4QT5B 5JUEL 5ENWB 3ARFD 1FH5H 2KH2B 1A1NB 3FRPG 1OP3H 2MTPA 5ECJE 3PWVB 5GRZA 3MCG1 3L7FB 4FFYH 3LRSA 1U8LA 4FXKA 1FP5A 5D6DA 3QJFA 3PP3H 5E95B 3O6MH 3QDJB 5DXWA 4YXHL 1X44A 1G6RA 3VA6A 1XFPA 2YEZA 4JKPL 2XXMB 2H3NA 4ODWB 5MI0B 2FBJH 2CK0L 3O3AA 4GS7B 2G75A 3TZVB 4JY5H 4V1DA 4XMKL 4AH2A 2D7MA 5IWLA 5HYJE 5KSVA 4K9EH 1CXFA 2R0WL 5HHMB 1F4AA 3UJTH 4PG2A 4KZEH 3J8F7 4UTBL 4GKNA 4KAQL 5JHDE 1QO3A 4S0TD 4GMSL 1BECA 1DN2A 5DRNA 1R3KA 2D2OA 3EDEA 3WFDL 3VFPB 5D2NA 3MRKA 3GO1L 2W0LA 3WHE0 3GSRB 1WTLA 4MD5A 4R7DB 3F7PC 3F65A 1F4YH 2X1PA 2F5BH 1LHZA 4LCWA 4OI8A 3O3EA 1AHWB 5ANMB 5C09E 2GTWA 3I85A 4K7PH 4NNPH 4XPGH 1H3PH 5C08D 1LQSR 2Y06L 2DQJH 2EDKA 4IMLA 4M3KB 1XGTA 1WFTA 1IRAY 1UFUA 1J1XL 1Q1JL 1KIQA 4ZSOA 1TZGH 3EGSA 3OJDA 4MAYD 5J9PA 1JRHL 5E00B 2UWEA 1DL7L 3ZDZF 2A83A 5ICYB 3QNYA 1NGQL 3FN3A 1JIBA 1A5FL 2X4NB 1IC7H 5EWIL 3UPAA 1JWMA 1J7VR 1IEBB 4GRWH 4P4KC 4XPTL 2V7HB 1T21B 4P2RA 4PREB 5EO0B 3TT1H 4XHJC 3UYRL 4NT6B 2DQEH 3DV6A 2OM5A 2GEEA 1MEXH 1FBIL 1IC1A 4IS6A 3EGSB 3OJDB 5IB2B 4UOW0 4YHIB 2GSGB 5ERWB 3CXHJ 3VXMB 3MBXL 2VE6B 1QQDB 3QXAB 3EO1A 4PRPA 3VFMB 3ZO0A 3S7GA 3RHWF 3U0PB 3L3DA 3VCLB 2DL2A 4AEEA 2ENSA 4TOYL 4LLDA 4R2GD 3KPNA 3QHFL 1VGEL 1YPZA 1J0IA 3I50H 1NFIB 1AQKL 3RAJL 4HS6A 3PGCB 3RI5F 2VLKA 3GGWA 3IAPA 3H42L 3BESR 1JF1A 3WDHA 2XTJD 5H94B 3QQ3A 5F1NA 1F42A 2Z31A 5AYUL 2F53E 1S5IL 5CIPH 4F7EA 3IS0X 2QTEA 3I6KB 5E2JA 3FT2A 1HSAA 4WWKD 4R90H 4YFEA 1MPAL 2VMFA 4R9HA 5D96B 1T0NA 4PG9B 3GFUA 4F80A 4GAFB 3EHBD 2CLZA 2E7CA 3IDXL 2EICA 1JPSL 4QXGL 2R0KH 2FJGA 3E8UL 3P3YA 1FCCA 1BIIA 4P59H 2XT1B 5D9SA 1A3LH 1NANI 1U8KA 2LTQB 4WTZA 1MAKA 3Q5YA 2N1KA 1WWAX 2DKUA 4I5BA 2IAMB 3WLWD 1RJYA 1U8NA 4I9WD 1CQKA 4ZUUA 4WV1C 2Z93B 4WW2C 4HC1A 2DWDA 3JWDL 3SDAC 3SGDH 3W0WB 4N0RA 3T4YB 3WEXA 1XF5B 1LILA 3MC0A 1T2QL 5FCUL 4MHHG 5JHDA 4GG6E 3EYQD 1A6ZA 2EEDA 1BFOB 4POYA 3CIQA 4P5MB 3K7UA 4QRUB 1R0AH 5LAXB 1T80A 3UP1A 1TMCB 3BIKB 3BP7A 3HZKB 3SKMB 4XNUH 4JM2D 3HS0A 4JM4L 2V5YA 5J4MA 4XX1E 2IAMC 3BPNC 5CZVH 5DVMA 1RSFA 5ALCL 1P1ZA 2UWEB 4RFNC 1UM5L 1YC8A 1GZQA 2F15A 4XT1C 3TEUA 5H35A 1XGQB 2FEDD 4P5KB 5CMAB 4YAQA 3QUYC 2H8PA 4J23A 4X4XB 1A7BA 2DKSA 1C08A 5FUCC 4BH7B 5J3HC 2GJZA 3FQWB 3BFOA 3FO9A 4R8WH 1TZHB 5FYJE 1G0DA 2ITDB 5MP6H 3RPKA 3UYPA 3LEXB 4XP9L 5GRWA 3PL6B 5DFWH 3BP6B 4KJPC 5JW4R 3NZ8A 3KLHC 5C0BD 4G5ZH 2FGWL 4NO3A 5IFJA 5D8JL 2VXSL 4X6FB 1NMBH 2VQUA 4JN1L 3LRHA 4NBXB 4L8SC 5IK3A 4U6XA 3W5NA 4HPYL 3NCCB 2OZ4H 3PJSA 5DC4B 3HNVH 4HMCA 3UYOD 4CUCA 3PIQA 2VDPH 3KPSB 1XIWD 5H8DA 2EIZA 1BZ7B 5FO8B 4KI5E 4ONHA 2MPAH 4P2QD 2G75B 4HIJA 1SBSH 1CLOL 5AZEH 1MI5E 5T3XH 1ZHLB 3TIDA 3RVUC 5C09B 1DLHA 5JW3L 2PYEE 3ARDC 2IJ0C 1J05A 3HI1A 1HNGA 4V1DB 1DQJB 3DXAD 3ECBB 1T21A 5EO0A 2Z8RA 5DJ0B 1AXTL 1GGBL 2V5RA 3MNVA 1GOGA 1PG7L 3BJLA 4Y5VC 1FIGH 1VESA 5T5FL 1ZLUH 2ERJC 2GTZB 3VXRB 4KQ4H 1BLNB 1CVSC 4HIXH 3WDIA 1H5BC 4XH2B 2FEEL 4XBGB 2G5RA 1QACA 4TRPH 1ACYL 3UBXG 2DIAA 4QRTB 4XB7A 2M8XA 4X0KB 4PJ9B 4M1CC 4BZ1H 3O6FA 4HWUA 2CK2A 2F54A 3BX7C 3QUYD 1ZSDA 1P9MA 3P0YL 4JO2L 4KY1L 4HFUL 1UA6L 4LSUH 5DRWA 2N56A 5TH2B 5JW4M 5CBEA 5L2KA 5LGKA 1L7TL 3VXNA 4MLSA 3WS6A 2WIIA 1NFKA 4HJ0C 2A6KB 3V5KA 3S35X 3GIZH 2KDGA 3V52L 4PGZA 1PYWA 1XT5A 2DKMA 3T08A 4HCRA 1OTTC 4O2CA 3S88H 2ARJQ 1HSBB 1FZMB 3QXVA 5KG9B 1H3TA 5I19H 1FAKT 3BN9D 2BFVL 3K1DA 3WFHA 1F97A 3Q1SH 4NKOA 1FL6B 4ODVH 1C7TA 3IKCB 5F96H 1RUKH 4K2UH 4HZLB 5DJ0A 5HHPA 1W2KT 4OCYH 1S7RB 3GKZA 3GZKA 4CN6A 2LABA 5E4EB 4XNMA 1UM6L 2VABB 1MLCA 2HWZL 5DDHB 5HTSA 1QSED 3V4VH 2BSTA 1Z5LA 3TZVC 2D0GA 4QHKJ 4K55A 3BD5A 4XC1L 5ETUA 4H0HB 1MHPL 3VFGH 3LSOB 5C8JB 4F58L 1B4JL 1CF8L 1MAML 2FECL 3S5LA 4HUKB 5IB3A 4PJHA 5CAYB 2NY6D 3GJFB 4XNQB 2XZCL 1XGPB 5BV7B 3OF6D 2QKIB 4CMHB 1VDGA 3BZ4A 5BZDB 5ACMA 1I7RA 3C2SA 1T1YB 3QBTB 5J6GB 2XN9A 5D2NC 4MHHI 1IM9B 3L7EB 1BQSA 3QHTC 1T66C 2EYRA 4K3JH 5EBLA 4QCIA 2EDWA 1PVHA 2P43B 4H26B 1INEH 3HG1B 5HDBE 4N5UA 4L1HA 4Z7UA 3BH8B 5I9QC 1Y18A 2P7TB 5C92A 1KPUB 4YHZH 3DMMB 4NKMB 2YPVH 2DM2A 3QRFM 1K2DA 3PV6A 1MFCL 4JM2A 2W92A 1FBIH 1IGYB 3K8LA 5BW7C 1MI5B 1YEKH 3V0VB 2FH8A 4WFGD 4OGAC 2WV3A 5B39G 2BVOA 3OKMB 15C8H 3FONA 1DEEB 5K9KA 2D7QA 4Q9CA 4M61B 2X1QA 3DGGB 1WAAF 4AEHL 4X8XA 4GOSA 1I9IL 5DJAB 4QHUA 2XA8L 2MCG1 3L3JA 1DN0B 4ODSH 2H6PA 4N0YH 4RGNB 4XBEL 3WNMA 2C4FT 1T7WA 4HT1H 1OP9A 1S9VB 2HH0H 2JCCE 1MRCL 1LK2A 4BM7A 4ZUUB 5L2KB 3FFDB 4PLJC 3RWHB 4EXPX 1ZHKB 4M7LT 1AP2A 1T0MB 2ZUXA 4X9BA 2VISA 4LU5L 5GS0H 2XWTA 2EDBA 3MLUH 2HJFA 2D7TL 3R4DA 2R0LH 4BFIA 5FV2A 3S4SG 1DANT 1T0PB 1MRFH 4JFFD 3SDDC 3F7RA 4L3CB 3SN6N 2V9RA 1KCVL 1YEFL 3KHOA 4HH8A 4NKMA 4KROB 5L2KE 3A6OA 4DZBA 3F5WA 1LP9E 3EYSL 5T1MB 1JPSH 3GM0A 1JNLH 3U4AA 4LHQB 1V05A 5E5UB 3OKOB 4LBEB 1CICB 3V7AG 2MSPA 2YD9A 3NPSB 7FABH 5LGHH 1QLEH 3O41A 4XCFL 4XPAL 4LLUA 4U0RB 4JB9H 2VAJA 2BRRH 3BDBA 4XXDA 2VLKD 3VWJB 1HCVA 4HIJB 4WEUD 5IK3B 3VGHA 3WUZA 3C8HA 4MGXA 2ZCLH 3ROLB 1CFBA 4WHTA 1R5VA 4XTRD 5JPMB 5MEND 2F8XC 1QNZH 3ZE1F 2FWOB 3M8OL 4ONOA 3BMVA 3TJHC 1HYSC 1HDMA 4M48L 2W9EL 2C5DC 5D1ZC 4CVZA 4GRLA 1RUQL 4BJLA 4X6FA 1RK1A 2IEPA 2XZQL 3GSRA 4KUZL 2P5EE 4XP9H 2HP4A 4EDXA 4OZFH 3IAGC 4DGVH 4MCYA 4MZ3A 3B4NA 2HT3D 5D7IE 1F3DH 1NGWB 3DETD 3GUTB 2MQ0A 5GJTL 4RX4A 5ESVB 2NTSP 4CMHC 1MJ7L 5DJYB 2FX7H 4K8RD 4Y5XB 4OUUB 4IIQC 3BN3B 3TVMB 4WWKC 1F02I 3P4MB 5HDQL 1IAIL 1QRNA 3C08H 2GI7A 2F54E 4HIIB 3NCYS 1JNHB 5D71L 3CVIH 1VKXB 1AIFB 5KVGH 4JRYE 3EUUA 3ILPA 4FFVD 5JOFA 4HGKC 3ULSB 5B3NA 5MP6L 3WEXB 3GKWH 4MWFB 2BNRA 2QHRH 5TF1L 2RIKA 4GW4B 3TBVA 1OSZB 4MA7H 1YJDH 3QHZL 5EO9B 1EDQA 3RUGE 1N26A 4YQXH 1Q9WB 2IMMA 2XKNB 2WP3O 4X6CE 3MLSH 3GJFK 4D9QD 2ICEA 2LE9A 1PX3A 4LVHC 1RURL 2GJ6B 2VXUH 3EO9L 4I2XA 3VWKD 3AS1A 5IB4A 1S7WA 5I17A 5DRZA 2WNGA 3ZKXC 1LD9B 1KCKA 3PP4H 1NLDL 1U92B 3MRNB 4DGYH 4XH2A 2V5SA 4MXQD 4XBPB 5EFIB 3QI9A 4RGMB 4O9HL 3RA7L 3QQ9C 5IUSA 5F7DB 5D7LA 4PV8A 1KTLB 1C1EL 4X4YA 4LQ1A 3TPUB 1TJIL 3MRQA 1JV5B 1AGEA 4PJ8B 2FIRT 4TVPD 3FN9A 4NO2A 5JR1H 4F7TB 1DQJA 4NZUL 2YBRB 2BVEA 1SEBB 2X4TB 1JK8B 2NXZC 2VKXA 5D7JA 4CU6A 4DQOH 1RJCA 2CR3A 4S1SL 4WI7A 3MJ8B 2NY7L 5I66B 1GGUA 5HHVL 4P46D 2W9DH 2A6DB 1JJUA 4FRWA 4Z78B 4NQDA 2ADFH 5H2BB 3TN0A 4Y5VB 5IM7B 5E7FA 4HFWB 3H9SD 4JFZL 5IBUG 5J6HA 3W5MA 2GYSA 1BFVL 1NMCC 3VFWB 2UWEF 2FD6L 4M93C 3RWJA 3EO1B 4D9RE 1ERNA 1F3JB 1X5LA 4FOMA 4KRPC 4OT1H 2AABL 5GGVY 3V52H 5AAMA 1MREL 4I2XB 4TNVF 2O26U 1MHHA 3ROLA 3U9UB 2PKDA 4HK0B 3KDMA 1QFPA 4OCSH 4BH7A 4YBQD 3SKOB 4H0IA 2H26A 5INDA 2VE6A 3QXAA 1CT8A 3IFOB 3KPLB 4U6YA 2VJXA 1XCQA 4Y16A 4IS6B 1T1ZA 4H0GA 5T1DH 5A2JH 3G5XB 2F8VA 5EUKB 1X5IA 1UM6H 4U7KA 4WV1A 3MBED 2Y5EA 2YPKA 4K3EL 2VLRA 4D0DB 3GRWH 3QIUC 3GSWA 3ZSSA 2BCKB 4HIIA 2NY3D 1I3UA 1RQ5A 3MLPA 4LARL 3U4BL 1JUFB 4X7EC 5IEKA 1WT5A 5I18H 4EXKA 3RVTC 5KSAA 3P4OA 2DLIA 3RVXC 1D5ZB 5J9PB 2YRLA 5FFLA 2WP3T 4E41B 3NCFB 4M7ZB 4MJIE 1FL3B 3RFZC 4OBSA 1GZPB 4WUUA 2VISB 3ZKSD 2ZSWA 5GS0C 2E7BA 2GT9B 4IMLB 3TPKA 5DRNB 4GLRI 2IAMA 3VI4F 1R3HB 4WGVB 4FQLL 2R4RL 2IQ9H 3LDBB 4N8VB 5KSAD 1QBLH 4RGNE 4UTAH 4LLVB 2ICWA 2V2XA 5EUOA 5CUSH 3VH8B 5F7WC 3IJSA 4CVZB 4YDIL 3FL7A 5SWZA 4HT1L 4Y88A 2DQCL 4R7NA 1DBJL 5JNYA 4NZJA 5F97E 3HLAB 4LKCA 4H20H 1VHPA 5DK0B 3SGEI 2EE3A 5I6XB 4DUWA 1ITCA 5I8OL 1MCRA 1MHEA 3VFUB 1JP5A 1G6RB 3EBAA 5C6PB 4I2XE 3VXPA 3R06A 2ZKHH 2X4RB 2MFNA 3TZVD 3L6FB 1BM3H 3GEWB 1G9EA 1ROWA 5F3HB 3TESA 4NKIL 2OMBA 1PBYA 3CDGA 5DMGC 1NANH 2W65A 3S96A 4ZTOH 4E0RB 5DVKA 2ZG1A 2WBJC 2NY6C 4GH7B 5D5MF 5J6GA 2NR6C 1RHHA 5DEFB 3KPMB 4XTRC 1AXTH 2X4UA 4JDTL 1QPPA 4PJXB 1PG7H 1YPZB 5EBLB 5DHYB 3PIQB 4CRPA 1UGNA 4G8GE 1A9BA 5EORH 3QA3B 3G5YA 3ARDA 3BXNA 3JTSA 3O6KH 4RGMC 3RKDC 4PY7B 5IHUL 2ESVB 1IQWH 4GSDH 5JZ7D 2Q3ZA 4YXKL 3D3VE 3I2CH 3IRZA 2B1HH 4YFLI 1E27B 3TBSB 3IF1B 1W72H 5E9DB 3BZFB 4MQ7A 1X4YA 4P23D 1LDPH 4X6EB 1AKJA 3OZ9L 3X12B 1X5GA 4HUXA 1JNHA 1UH4A 3EDJA 1MF2L 3ZT5A 5JLZA 3RBGA 3RNQB 3V5DA 5TPWH 2EDHA 4R4ND 1A7OH 1MHEB 1LO2L 1FFNA 4F9LC 2DQGL 3FOMB 1KIPA 3KS0J 5DD1L 3TP4A 4LCCB 4QRRA 3HFMH 4KMTL 4ZUTB 4LLWB 2FSEA 3IDYC 2FJFA 3CLEL 5IF0B 1GCFA 4X7CC 5F1KC 3WJJC 1A0QH 2Q76A 1KB5A 1A6UH 3QPQC 4X6CB 3B5HA 2Y25A 4XP1H 5D1XC 3NFNA 3PDOB 4JCMA 1UADC 1HH9B 2IADA 4LFHD 3AVEA 3IJHA 2HVKA 2B4CH 2MKWA 3T4AB 4M1CD 4YX2H 3QEQD 1M6OA 4ELMA 3INUH 1MCWM 3GSUA 2YN5A 1U8OA 3O2VH 1LNUB 4R2GB 1AJ7H 4X5WB 4UNTA 4RAVB 5AD0A 5ISZB 2AS5M 1WV7T 3V9FA 1JF6A 1TDQA 3N06B 4XMLL 3SPVA 3P73A 3UBXA 2FJGB 2ERJB 2W91A 3I75A 3BE1L 3H9ZA 2C3VA 4WUUE 1KCUL 1OARL 3UTSA 5FKPA 4R0LB 3ULVF 5EUKA 4Z0XB 2Z0BA 1EMTL 3ECBA 1L0YA 1TTGA 4Y16B 2JF1A 4GJTB 3AY4A 1SY6A 4S11A 4BKLA 1KULA 3HE6A 4MA7L 1TJGL 5C0FA 1P6FA 4U6TA 3QCVH 5TE7L 3RIFF 1GGYA 2NY0B 3VDAA 1DUYA 4O00A 3BD3A 3RJDA 2GITB 3STLB 1JGUL 2AEPH 4LRIC 2CK0H 1EJOH 5IMKA 4MJID 5ENWA 2BX5A 3RTQA 4H88H 3TJHD 2A38A 1NC2B 3KPSA 4X4MA 5D7SL 1G9MH 5C86A 1RMFH 2V2XB 4M5YL 4Y5YC 1YPZE 1UZ8B 3VXNB 3FTGB 5HD8D 3NPSC 4QTHA 1D6EA 1H8OA 4F9LA 2VUYA 3SDCA 1PY4A 4F9PA 1C1EH 3GHBL 1JUFA 4M00A 3IU4L 3RWFB 1AR1D 3O6ML 4MNHA 2XTJE 1IKNA 2J6EH 4MB4A 2R4SL 4DCQA 3DRTA 3DUUA 2YD4A 3RNKB 5F9JB 1HIMH 3FRPA 5ACLA 1CD1A 4KK6D 3A6CL 2BSED 5E94B 1WQVT 4OFYA 1FFNB 2A77H 4POUB 2APBA 3SE4C 5IVNA 2O5YH 3O6FD 2OR9H 4EN3C 1GZQB 4U2ZA 2YZ8A 1JPGB 3FO1A 4FQHB 4YDLB 3BZEB 4H1LG 3VE0B 4NJAL 2F19H 1FYHB 2HYMA 3BP5A 1CGSL 4PJGE 2ZCKL 3SO5A 2VAAB 3ULVD 2HJKB 1L7IH 2IQAB 3MLXL 2WBWB 3WFDH 5BMFH 1NAMA 2IALA 5ITFA 3QFJA 1QR4A 1IZJA 5I9QB 4Y8DC 4EI6A 4RGNC 4QRUA 3RDTC 2VDNL 1RFDL 3MFGB 4Z0BL 1F4YL 3S5LB 1FCGA 2DQEL 4QRPA 1G0XA 4XCFH 4XPAH 1KJVB 4UDUA 2A2QT 3AREA 1RZJH 2YUVA 4MXVE 2Y06H 3A67L 3DSFL 1IAKA 3VRIB 2AP2A 1U3HA 5A2LH 1N0XH 4TVPL 4Y16C 3REWB 1R3KB 2G5BB 1P7KA 1DTUA 3DHJA 2ZUTA 2AKRB 3HI5L 1CGWA 2IPTH 1DL7H 4ZS7H 3IKKA 4XGZB 3LKPB 4N8CH 4OLUL 3VFTB 3FB5A 1ED3B 2EC8A 1T3FA 32C2B 4OZFA 5D2LB 1ZXQA 1FNSH 4HAGA 2W65B 3S96B 3WIHL 4BUGA 5HVHB 1U95B 4HWZA 5MEQB 5DQ9B 3MXVH 3MMEB 3R8BB 2IGFH 1HK6A 1QA9A 2P8MB 1MJ8H 4J3SA 1EO8H 4N0CD 5KANI 1IAIH 1Q9LA 3SCMD 1ZLVK 3WNPA 4PRID 4KVNL 1TVBA 1BP3B 4PJEF 1DDHB 5FUOL 5F7DA 2J12B 4LP5A 2HTLC 5LAXA 3CFJA 1NBZA 2GY5A 2UZYB 3ME0A 3V4PL 4XCCL 3BQUD 4M5ZH 2NY3C 1Y6NR 5HDOA 2L7UA 1TXKA 1K6QH 1R5VB 1AR2A 4HQQH 5EU5A 1RVFH 1G9NL 4ZXBD 1IILE 2DI9A 2IAMD 1N6VA 2PETA 3QZWG 4Y4HD 3QAZC 1G7QB 2F58H 2V9TA 1JPGA 3FO1B 3REVA 4I48A 5ERWA 2IBBA 4Q58C 4E41D 5D93C 4NQCD 3TYFB 4ZO8A 4NCC2 1RZIA 2X1WL 5EIVA 5E94A 3AS3A 4OF5A 5C07E 3BQUA 2NY3B 3DUUB 3RNKA 43C9B 3RA7H 1NDGB 2V7HA 4GUPA 3QFDA 2GSIA 1YEGH 3QDAA 2VYRE 4OZFG 5EBMB 1MY5A 4CMMA 3GBLA 4DCQB 4OZ4B 5I8CA 3DO7A 3FT2B 4PJEE 2RCSH 4PRIA 3SE3C 3FQUB 2BMKA 5I0ZA 2YD8A 1CXHA 4OZIA 1NGWA 4DQOL 3CLEH 5LCVH 4G7YL 1A6WL 1JF1B 4R97C 4L3ED 5I73C 2NY6B 1EERB 4P3CH 2FX8H 5GHWL 3CCHB 1IGIL 5AG8A 3MNZB 5HVHC 2EXYD 2B4CL 4JPVL 5ESAB 3CDFA 3NCBB 1NEZB 1A47A 2EE2A 1QKZL 4OQ1A 4Y89A 1D5MA 4JO4L 5KVFL 1MFEL 2JJVA 5DF0A 1QSFA 3P9WB 5DC0A 1ZANH 5E8EA 4DW2H 5FOJA 3O2DL 2D9CA 3QUXA 3GSNH 5DT1H 1CBVL 1B3JA 4HMDA 1QO3B 2HRPL 5TDOB 4JN1H 3V6OC 1FE8L 4LCYB 1UXWB 3D2UA 1KEML 3LKOB 1M7IB 3QIWA 1MNUL 3MJGX 1A02N 3MR9B 4OCSL 1YN7B 4Y1AD 1CICA 4X4ME 3CJJA 3T65A 2HLAA 2FGZA 2OYPA 3MACH 4EJ1C 5F1OB 3MCLL 1BFOA 1JRHH 4QXTB 2H2SD 3C5SB 4LSTH 5D7LB 2WUCL 4DUVA 2HVJB 1GHFH 1I7RB 1T7ZA 4MAYB 2NXYB 3A6BH 5HPOA 1YEEH 3MUY1 2VDOH 1S3KH 5I6XC 4U1SB 3T1WA 4RGND 3L7FA 3SJVB 5C0AA 1U3YA 4N0UE 1OGAE 3VWKA 2ZOLB 2A9MH 2FNBA 4FQQB 2VDPL 4PTTB 2R8SL 4KGLA 3T0EA 4LCWD 1ND0A 2OTWB 3GMQA 3MBXH 5C0DB 4P23C 2BNRB 3VD7A 3SGJA 3WHXB 3AU1A 4P3DA 4MAYC 1N3NB 1YDPB 1KELH 2Q86B 3BN9C 3BPNB 2PW1B 5F7FA 3JUYA 3N1QC 5FIEA 1U8HB