4ALAL

Structure of dengue virus diii in complex with fab 2h12
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
DIVMTQSQKFMSTSVGDRVSITCKASQNVRTSVAWYQQKPGQSPKALIYLASNRHTGVPDRFTGSGSGTDFTLTISNVQSEDLADYFCLQHWTYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE PROTEIN
publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
source organism Dengue virus 3
molecule tags Immune system
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2012-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4alaL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4alaL01
3QB7C 5D2NB 4M62L 3G5XA 4M6AA 4R7DA 2YKLH 1HHIA 4I0CC 1HHKB 4ELME 4HGWB 4O9HL 2NXYC 4LARL 4HBQA 5J3HD 1XCQA 3U1SL 4PG9B 5I6XB 2I60L 1TCMA 2AEQL 4U2YA 2IEPA 3O4LA 4O2EA 4HCRH 3WFHB 1YMHA 4JVPA 2XZQH 3EGSA 3OAZH 1ONQA 5ANMB 4YBQD 1MFBL 4KPHH 3MZGB 3PGCB 1OWWA 4KDWA 4U6VH 2CLZA 1KT2B 3MRFB 2MCG1 4G8GE 4H25A 5CILH 5E8DH 1T0MB 2F19L 4DFIA 5K9OB 4LAJH 5D8JH 5JPMA 2ICWB 3UTPD 5FM4A 1SEQL 4Y8DC 4AENB 3FONA 1S7TA 1RUQH 4M7ZB 3QFJB 2XWJB 2BDNL 4LKCA 4S11A 4OZHF 3MQIA 4PJFF 4NO0A 4WJ5B 2DIJA 4M6ML 3RFZC 3GM8A 4LU5L 4NHCL 1NFDB 2XQBL 3MV8A 4XXDB 1I85A 4JRWA 3EYSL 4PV8B 3T8XA 5FDYA 5I75B 1WWCA 5L9DL 5GGVL 1FFOB 4OD2B 5DFVD 4XCYA 1WZLA 3RKPA 1S9XA 1MCKA 5T3ZE 3K0WA 5EU4B 2QSQA 3BE1H 4PFEA 4R4NC 4PJ9A 1UG9A 3MSPA 3BVNB 9CGTA 3JVGA 1XR9A 5JOEA 1JF1B 2WBJB 4HS6B 3G6JE 5FYLE 1J7VR 1VESA 4XP4H 3WXVH 4CW1A 1DBJL 3ROLB 1BFOA 5KW9L 3B3IB 4QRUB 4LEOB 3X11B 4FQJL 3VXPA 1MCCA 4PBVC 1ZXQA 3OX8A 1AO7B 4K3EH 1L9MA 4MNQA 1CXKA 1GGBL 4RWHA 4I4WA 5EBMA 3V4UL 3KPSB 1MF2H 5CWSB 5T1MB 3QIUC 1E4JA 3SGEI 3ZKND 4WV1B 2NY1B 3QHFL 1AFVL 3I9GH 4XMKH 1T1WA 1KIPA 3TBWB 3DSNA 5E2UL 1I3GH 3W5NA 4OZIE 3G9VA 5GGSA 5C7XH 4XCNA 1MJ8L 3E6FB 1CCZA 2WMPA 5DI8B 1A64A 5HJ3A 5I1LA 2P47B 2VXVL 4Y4FA 5CMAB 3RU8H 3B2UC 4R8WH 4L3EA 4OQTH 3QXAA 1CGXA 4XB8A 4RMQA 3S96A 5B39B 3DX7A 2E5EA 4QOKB 5I1EL 2E8ZA 3BAEL 3HC3L 5BS0A 1QRNE 4G6FD 5DMGC 5D7KD 4MD5A 1ORSB 4LVOC 4WHTB 1JTTA 2FJHB 5E8NA 5KSBE 3GMRB 2KUTA 2XWTA 2K3TA 2OL3A 1ZOXA 2ARJA 5EDXA 3ZE2F 1N5YH 1ADQA 4J3XA 2JCCA 3FB8B 4PGBA 3GHEH 3HI1B 2R56L 2HTLC 5JA9A 3EYUH 5FO8B 4QRRD 4K8RC 2ED7A 1RIVL 1EBPA 4LQFH 8FABA 2R29H 4NKDB 4L4VB 4GKOA 4GXVL 4MA7H 1TNNA 4JEGB 5I1HL 3F12B 3QH3B 1INQA 5I0ZA 2Q20A 3Q5YA 1MCBA 1G9EA 3HE7D 4DVRH 2EKSB 1HXMB 5CHNB 4W6WB 4RX4D 3NPSB 4MAYA 4HUXB 4FQXC 4ZD3H 4OT1H 4I48B 2QHLA 5FB8B 3IAQA 5I76B 3RIFF 3OXRB 3TV3H 2DKUA 4EN3D 1DUYA 2EKJA 5DXWA 5GGTH 4WHCA 4ISVA 3QISA 1S7WB 3DXAD 4HGKC 1RIHH 3RTQB 4UB0L 1T03L 4GKSA 4JO3H 1KCKA 1OTSD 1FVCA 1G9NC 3NGBC 4V1DD 4D0CB 5IHUH 1P7KA 3ILQC 4X7TB 1U3HA 5CJXA 3S37X 3WKMH 4XPAH 4RWYL 2VLRA 4QRPD 3V79C 2NY5H 2P7TB 5SWSA 2DYPA 5GZOC 3PP4L 4X8JA 4MB3A 1FP5A 5FO7B 3VFUA 1FNEB 5KSUA 1BAFL 3VRJB 1UQSA 1YY9D 3RGVD 5MENA 1A7OL 2C3GA 4KMTL 2DD8L 5KAQF 1FFNB 1JRHH 1PYWA 5C07A 1MCHA 2LVEA 1BEYL 3ARDD 3GRWL 3UXFA 5CJBA 2UV3A 2BNQA 3P0VH 3P9MA 3QCTH 4NUGH 4EVNB 4ZFFA 3LKPA 1MQKL 5IW6A 3QEUB 3BXNA 2CKBA 2Z4QA 4ODBD 5E6IA 2XXCB 4HC1L 4KZEL 5KS9B 1QQDA 3IB4A 3QO1B 1H5BA 4NNYB 4UINL 1ZKAA 4ZAKB 5HHPA 4QNPE 3TIDB 4XRCA 1XF4B 2R1YB 1AR2A 1INDH 3VG0L 4R2GC 2HFFA 1Q0XH 2WWKO 5HGBA 3PDOA 5I1KL 2VAAB 3HPJB 5ICXB 3WFBH 1FFQA 1C5CH 3GSOB 2OCFD 1CFVH 1UH2A 2A77H 2KZWA 3O2VL 4RMRA 4V2CB 4JZJC 4ZUWA 4H88H 1S9YA 5LGHH 5IEKB 5ISZE 3NH7L 2G2RB 3OHXA 3NCMA 2AJSH 1T2JA 4X98B 2XA3A 5GS0L 4X6DF 5E9DA 3E0GA 5JW5B 4LIQH 3E6HA 5CJOH 4S1RH 4QY8B 4XNMA 3WHE1 3O3AA 5C86A 1Q8MA 1EH9A 3C09B 3C5ZD 4GRMA 3P4MA 1OAQL 2BFVL 4OGAC 4W70A 3QXVA 3KLHC 3NZHH 4RFEA 5JHDE 1N64H 2X4UA 3OZ9H 1LHZA 2H45A 3T77A 4LLYA 5IR1A 2JE8A 4U0QB 1OP3K 1F42A 4Z76A 3PHSA 5C8JA 2EDDA 4FNLH 4F57L 4MNGA 5LBSH 1S7QA 1MWAB 1Z3GL 3LSOA 3EOBA 1FL6B 1LEGA 1RHHA 1TXKA 3ET9F 3KXFD 4PRHD 1N4XH 1F58H 4KJYB 5E5RB 5E2WL 3RY6C 1M71A 1QO3A 2E9IA 2CDEA 3QRGH 4KK5C 3VCLA 1J1PH 2OZ4H 4NQDB 2X9XA 1SJEB 3IVKA 2J4WH 2VYRE 3THML 4XVUC 4FMKA 1I8LA 3TCXA 4L29B 3QZWB 1BJ1J 3FN3A 4MXQD 4OCRH 5FV1L 4XVSL 1A7RL 2YA0A 3QUYD 3DMMC 4TSAL 4LOUD 4DOHE 5C1MB 2EDRA 4U7KA 5I30L 5F89A 4B50A 5HYSB 3EDFA 3PJSB 1EO7A 5C09E 4NO2A 4RSVA 2VLJA 4GW5B 5EBWA 3QIUA 4BA8A 3FZUC 1G1YA 5C0AB 2WV3A 4IMLB 4DTGH 4J3UA 4JY5L 4HBCH 2A83B 2DBLL 1K2DA 3C6LD 4YDVA 2DB8A 3HHRB 2J12B 5DJ2B 4ORZC 3IDJB 2EZ0D 5C2BL 4TUJB 4PJAB 3QEGH 3TO4D 4XGZA 2MKLC 2BZDA 3HNTL 2PETA 1OAXH 1A5FH 5IK3B 1I8KA 3EOYG 4JFEB 3GK8H 1ZLSH 2Q3AA 4OIIH 5E2VL 4E9LA 3VW3L 3MRMA 3EOTH 5BV7C 1IAOB 3PGDB 1I8IB 1KXTB 4RGNC 2LAAA 3SE8H 4XMLH 1HH6A 3LIZH 4PJCA 4ZUUB 4C4KT 3MJ8A 2D7QA 2E3VA 5IFAH 2ZKHL 1MNUH 4L5FH 3CCHA 1S7RA 4OZFB 3SDAB 1OARL 2ICWI 4OFKA 1W2KT 4OCYH 5M94B 3BQUD 1P7QB 4NM4H 2HAZA 4LSUH 4P3WA 4ETQB 4JZOB 2XN9E 1QFWL 4RNRA 3UC0L 3D85D 5J12B 3RY4A 3IAGC 1MFAH 3NCYS 3QNXB 5T3XL 1ZTXH 2NXZC 5DO2D 3RL1B 1R24B 3EJZD 5HGAB 4QT5B 5DD1L 3T2QA 4ZPVA 2QSTA 1YEJH 3G6AA 1NAMH 4BZ2H 1J8HD 4HPYH 3HG1D 3S3PA 2AK4D 4NJ9H 4M7JL 1S5HA 2YSSA 1IM9D 2W60A 5T3ZD 2OTPA 3MUHL 1CFSA 5F3HB 1K4CB 4FQXA 3VA6A 2XNAA 1P5VA 5E8PB 4NDMB 3FFCD 2BVEA 1QLFA 3LD8C 4AIZA 1YUHB 3UBXA 4P9HC 1II4E 1RMFL 3SO3C 5FYLD 5C0DB 5FCUL 3NA9H 1DVFC 1P4LA 4JN2B 4MHHG 3HZYB 1T3FB 1EDQA 1QBAA 5C6TL 1I9JL 4XNZC 3S35L 4Y16B 2WZPD 3RX7A 2X4QB 3VMOA 1AKJA 4ONGH 3U0TA 1A4KA 2W38A 1LE9A 3GDBA 1YPZA 2X1OA 4LSRL 2VXUL 4G8EB 3SQBA 3D3VB 4PRPD 1VFBA 2G9HA 5C0RH 1UB5A 1EX0A 5D7IA 1P1ZB 3TIEA 1WICA 1XGQB 3QJFA 3J7HA 3C6SB 3ARBD 4GLRH 3QQ9D 4PTUB 5L0QB 4JKPH 5T3ZH 2A74A 1H15B 1IAMA 3L3OB 3TP4A 2MCPL 1G7IA 4FMFA 4XVTH 3ORJA 3QFDB 1JN6B 2GY7B 4U6XA 2ZG1A 3V6FA 4L8BA 4RFNB 2Y72A 1RSFA 1CGTA 5IHZA 3AS2A 4GRLC 5FYLH 4Y88A 4DGVH 3HRZA 4JKMA 5LQBL 1KN4H 2RCSL 1D6EA 1F3RB 1TJHH 4MD4A 4APQD 1JYNA 2FX9H 4JM2F 3VXRE 3SDDB 2GT9A 4WHYH 1JHLL 2NY4B 4QWWD 3DV6A 4PRBA 2QQLL 2PYEE 3CAFA 4JZJA 1U2HA 4NJAL 3L5WB 1TENA 4JFHE 5IB3B 5HHMB 4RMWA 4PYHA 3GO1L 5D9SB 1CR9H 3BPLB 3O9WC 3HAEB 1GH7A 4WUKH 5EA0H 1G6RA 2XQYG 3B9KC 2WP3O 2NY2D 2ARJQ 3V6OE 1PG7L 1EHLH 4DWHA 2P8MB 1EPFA 5DVMA 1U8HB 4MA1B 1J18A 1AGDA 3BEVA 4R6UA 3LVEA 2AGJH 4U1JB 4K2UH 1U36A 5KSAC 5I1CL 2P5ED 2P8PA 2E8YA 3TPUA 4EJ1C 2GCYB 1N0XH 2H2SD 2ZCHL 5E5MB 3W39B 4PJ8C 1CU4H 3RDTB 2YPVH 1EEYB 2EDBA 1T0NB 5EC1A 3F7YA 5HVGB 3UP1A 2IALA 2C7UA 1TDQA 1GGCL 5IB2B 2Y6SC 1LGVA 5L6YL 5FGCB 3I50H 5J57B 3QUMH 3RY6A 2GFBB 3RWDB 1D3CA 3TYFB 2VISB 3SN6N 5GGVY 3BKCH 3SKNB 1NEZB 3TYGL 5JO5A 1UKTA 3N0PB 3PWLB 1LK2B 3MV9B 1DN0A 1KJ2A 3WHXA 3DMMA 1NH6A 2PR4L 2R2BA 1IGTB 1F6LL 4JO4L 2NTFB 3SDXF 2X9WA 43C9B 4GG6F 1FORL 1ZVYA 1VPOL 4H8WL 2WWMC 5D7JB 1VGEH 4KKCC 3WO4C 1FRGH 2ZSWB 4PGCB 4KQ4L 3T09A 1U95B 2EIBA 4LPXA 3ABZA 4OLZL 3T0EB 1KTDA 4WNQB 1I7ZB 2D3VA 1Y0LA 4G8FA 4MHHI 1NL0L 2EXWD 2X1WL 1P9MC 3UBXG 3I6KB 3LEYH 3STBA 5LGKA 3GMOA 3WUZA 3K7UA 3UTSA 4D9LH 4D0BB 1I3UA 4PLKD 2ATKB 2NNAA 3O3DA 4YDKH 3BW9B 2VUYA 4Q97A 4YO0B 4L8CA 1OGTA 5CCKH 1JE6A 4C83A 5CJQH 1T6WA 1T66D 4DEPB 1MRCH 4IHOB 4X6CF 4M61B 4GRWB 1ROWA 5DFWH 1YECH 1LO4L 4DUVA 1NCNA 1E4KC 5EZOH 2PF6A 4KDVA 2DQEH 3HB3D 3O6KH 4NN6C 5MEPA 2YD4A 1I7UA 2A9NH 5HYJA 5ISZD 2A2QT 4U1IB 1EAPB 4G3YL 1X4YA 5EOTB 2YXFA 1VSCA 5IM7B 3KHOA 1F3DH 3DETD 1W0YT 1YEKH 4R4BB 1X5GA 2W9LA 1P6FA 5T1LD 1BLNB 4Z78B 4DKEL 5I9QB 1QUNA 2FIKB 5JHDD 1GCFA 5IJVB 5TQ2H 1C7TA 2FWOA 3GJFA 4NRXB 2ESVE 3AREC 2DDQL 1NBVH 4F33B 2FR4B 5KOMC 4P57A 5ID1B 3HE6B 5CD5C 3RWGA 4Q6IB 2NW3B 3RNQB 1TIUA 1IT9L 2G60L 4LSSL 5SWZA 3CVIL 3WNOA 1VEMA 3RAJL 2DQTL 2EIDA 2FHBA 4KROC 5AWNL 1IILE 3BT2H 4NBYB 1I1FB 1CL7L 1HQRB 5J13B 3G5VA 4NN5B 4IRJD 1IM3A 4MJID 5LWYL 4HUKB 5TDOA 4XTRD 5EO0A 4Z7VA 4DGIH 4KKLD 3T4AA 1IKNC 3QEHB 4KJPC 2IQAB 4WI9A 4Z0BH 4YXKH 4CRPA 2JIXB 4UBDC 1MCOH 3IS1X 4FG6D 5SWQA 2UWEA 4KKBC 1MVFA 1DVFA 5KG9B 2IAMB 1M05B 1BF8A 5MEOA 3DX8B 4XXCC 2XZAL 2N56A 1SYSA 4XI5D 1T2QL 3BGAA 3MR9B 4NHUB 1IGJB 3BKYL 4MCZB 1BQUA 2CR6A 4JPKL 2P1YA 4ESKA 3L3JA 4RDQG 3DVIA 2WUCH 3T3MF 5T1KB 3CFDA 1KIQA 5IIEA 4U1NA 2UVFA 1J86A 4K94C 4A6YB 3G5ZA 3GBNL 5K93A 3T1WA 2YBRB 4AZ8A 2VZUA 4ODXA 3X13A 5L2KE 1YEDB 3FO1B 4XCCL 1ZANH 1S78C 4ZNEE 1E4WL 3HAEG 5CJ8A 3ULVL 3IKCB 2O5YH 1RVFL 3STLB 4YGAB 2H26B 3EYOA 3IXAB 5JORA 1KB5A 3D25B 3DTXA 4N90E 3NOIA 4JJ5B 5FV2A 4J2XA 1OVZA 3RA7H 1NAKH 2R0KH 4OGXL 1HKFA 2O5ZH 4F7CA 4GRLA 3QR2A 4TUOA 1OY3B 3ZDYF 3IDGB 3L7EA 4G8IA 3MCKA 1RZKH 1WF5A 4KZDH 4EXPX 1UJ3B 5IESH 4UU9A 3UBXI 3VDCA 1R3LA 3VXOB 4ZO7A 1IZJA 3Q3GB 1INEL 4JE4B 4J12A 1CS6A 1T22B 4R97B 4EUPA 4XC1L 5BVPH 15C8L 2HN7A 3MGTA 3QXWA 2OSLA 5KVEL 3O9WA 2XN9D 3I3BA 3V6ZB 1F13A 4U05A 1NQBA 4WO4D 3B9KA 2X2YA 4XZUB 1L0XA 4QHKI 1HNFA 5CLWA 3CU7A 4OZGF 4PJEA 2AJXL 1Q0YH 2XZCL 3MMEA 1ZGLP 3FOLB 5D1ZD 4Z95H 3VXME 4BZ1H 1C1EH 2CJUH 4NYLB 3QEQE 4OF0A 1IQWH 1BQHA 3RL2A 1VENA 5HXMA 5KSAA 4LKXA 1A6UH 4MZ2A 1MCFA 5C08B 4HK0A 3RIAK 4HUUB 2BVPA 2WNGA 3OAUL 1R5WB 4PJ8A 1ZLWK 1CIDA 5EU5B 1AIFB 1JGLL 1MWAL 4R90H 3TNNB 3HR5A 4G9FE 1ZHLA 3CVHA 1FYTA 5IQ9A 4ODTH 4Q0XH 1AXTH 3ARZA 3F6LA 4NQCA 5JHLL 1R0AL 3MYZA 2MWCA 3ZKQD 2FEDD 2FJGA 3ZE1F 2DTSA 4CNIB 2HT4D 5F9OL 4M7KH 4NZDA 4I77L 3ZDZF 1BX2B 1OGAB 2V17L 1B0RB 2CLRB 5DJYA 3BD3A 4GAJL 3GZKA 2R15A 4WFEE 5EORL 3HI5L 3D2UD 4LPWA 5GZND 1C16B 3K8MA 2W0FB 3GBML 4NKQB 5DEZA 1A3LH 1GZPB 1SY6H 4LLUA 2NY3B 1UM6L 4AL8L 1IQDB 5LKNA 4MA8L 2YS4A 1IGYA 3W0WE 4F7EB 2Q8AH 5EFIA 1BVLB 2BVUA 1MI5E 4H1LH 2P24A 1JPFB 2YRPA 3T4YA 4POZD 2YR3A 2VN4A 4JGUA 4YAQB 4G42A 4TVPL 1A4JB 3NABH 1P9MA 1R3HB 3IFLL 3W5MA 2OTWB 4HKZA 4C56B 1OAUL 2VDPL 1WITA 3KLAA 4WIQA 2A73B 1S9VA 4XNYL 1IGMH 5E03A 3QG7H 4PJHE 2EYRB 1MIMH 4FQHA 2GIYA 1CLYL 4N8CH 1JWUA 1TTFA 2NX5E 4NNPL 5ICYB 3BP4B 2Y06L 3CXHJ 3SJVD 1UT9A 4HX1B 3TA3D 3FFDB 1UWGL 4GMSH 3I02A 1H3VA 3I6GA 1T5XB 1CTOA 4X80L 5I1GL 5CIPH 1LK3L 4YHPB 3I75B 2PYED 2NLJB 32C2B 4N8PA 2EEAA 1HOCA 4ZOEA 5EU6D 3IGAB 4PJXE 4JFHD 4QGYA 2F53B 4GUPB 1F8TH 1RURH 1NDGB 5D7LA 4O02H 2CD0A 4OZ4B 5TQ0L 3HUJE 1B2WL 5CZXC 1FL3B 1OL0A 2NY6D 1WBZA 3FT4B 5TE6H 3SY0B 4Z7WE 1NBZB 2F5AL 3MLVL 3ZKNC 3BHBA 4QRSA 4Z9KB 1F11B 5EOCJ 1HZHH 4AEHL 2YD6A 2EICA 3CPLB 3AREA 4IRZL 4YHMH 3H9SB 5C71A 4Z7UB 4AH2B 5DRXA 5F21B 3MOAL 4PRDB 5D1QB 5DC0A 1J05B 1AC6A 4HH8A 4S1DC 1OAZH 3MTRA 1FDLL 5FDWA 4ZSOB 1IAKB 5EPMB 1CGSH 4QHKJ 5IBTL 5C0GB 2AJ3B 1RZ8A 2VIRB 5BRZA 1A1MB 1IGCL 4P4KB 2J5LB 4EUPG 2J8UE 2VDKH 1LQSR 3U46A 3FKUS 25C8H 1QYGL 1JWSA 5DUMH 5GXBB 3V0WL 2GTWA 4NQEA 3FRUB 1SJXA 2YUVA 1P4IL 3WLWD 1IGIL 1IKNA 1CLCA 1L6ZA 4K23L 3QDHA 3BD4A 1A1OA 3MJ7B 1KCUL 1MVUB 1NGWB 3HZMB 4Z0XB 4KUCD 1SVZA 4M6OL 3O41A 5D1XD 1QVOB 4OZHB 3O8XB 1M6OA 4XP1L 1CG9A 3MXWL 5FA3B 4JPIA 3LHPH 3HNSL 1K8IB 3WEXB 2X1QA 4XXCA 1BQHG 1RD6A 2R8SL 2IPTH 3V4VL 1MPAH 1BZ7A 2LQRA 5JW3L 3P4OA 2NY5C 2XIDA 4OBRA 4N5ED 1TTGA 5FK9B 3LKNB 3HCVB 4YEEA 2HFTA 4U1GC 1AE6L 2BP3A 3EYVB 4KQ3H 3RPIB 4WY7H 4LSVL 4JFDE 1TVBB 4YFLI 3CFKB 1AXSA 1NMCC 3SDCB 1Z5LB 4CMHB 4YXHH 3B4NA 4P3CH 4YWGL 2X7LB 3HE7C 1EEZA 5FO9B 3GJFK 1NGZB 2DQJH 3H3PH 1GIGL 2P5WB 3X12A 5IFHL 2BHUA 3U7AA 4U3HA 4NRZA 2P44B 1GYAA 4LSTH 4IIQC 3VJ6A 1NJ9A 1UVQA 2DI9A 2B0SL 4HLZG 4XHQA 2J6EA 4X7SL 2OR9H 4M5YL 3L1OL 3HC4L 4MA3B 1KN2H 1U3YA 3QUZB 4Y19D 4GKNA 2RR3A 4NOBA 4PTTB 1RZJH 1PX3A 5L8KB 3GKZA 2XV6B 4PGEB 4HUMB 4ZUVB 3OAYH 4LARH 5IB1B 3BEWB 5FOJA 4Y5XB 3U1SH 3WYRA 4HJJL 4ZXBC 3HA0A 2AEQH 4PJGA 3H7BB 4HCRA 1IVLA 3ZE0E 2C9AA 5A2IH 3QDME 1I1AB 5EZLA 2HG5A 3MX0A 1YEIL 1WAAA 1T1XB 3CFIC 2RFXA 1AHWC 3QRFM 1YY9C 2DM7A 5HHOE 1LO3H 4K3HA 3ZLQC 5JW4R 1K6QL 3ARDC 3WIIL 4I18B 4Q9RL 4XAWL 2F19H 3JWDH 4P2OB 1EBAA 2GK2A 5F8QC 3LEXB 3W9DA 2FBJH 1E6JL 4HF5L 1JYXA 1SEQH 1WISA 3OKDA 1OB1B 2DICA 1A9BA 4NCC1 1I4FB 2BNRA 5F1KC 3V4PL 4DCQA 3AU1A 1GHFH 5KVFL 2ZG3A 4CVXB 2EYTA 1XFPA 3UJJH 3IFNL 3O4LE 4TTGA 4MX7A 5ADPL 2QJDA 4KUCF 4XPTH 3HPLA 3ALXA 3X3GL 3OKEB 4PJDE 3QXAB 1G7QB 5I17A 3VWJB 5JDSA 1EZVY 4E41B 1VEPA 3PQYE 1M7DA 5GGVH 4QHLA 3ZYZA 1MAML 2E9WA 1DQDH 2NR6D 5J4MA 1GZQB 3MOQA 3O11B 1P2CB 2QQNL 3SKUD 4NQSA 4P2QD 4OI9A 1VGKA 4C59B 2VDRL 1FO0A 2VDOL 2JCCB 2VL5A 3AY4C 3MRKA 5DD5L 1ZGLM 1DBJH 3R06B 2YPLB 4PLJD 4WU5B 8FABB 4FQJH 4XCEB 3C5ZC 1FL5B 3WFCL 3MV8E 5F9WC 4OD3H 4OSUH 3OKOB 1BECA 2H3NA 1GGBH 1L4IA 5D2LF 3V4UH 5L2KD 5CINL 5FKAA 2VR5A 3CMGA 3GMNB 1MLCB 4Y1AB 3IDXH 3REWA 1AFVH 1YEFH 3VFWA 4ZTPL 4KRLB 2QR0B 2X44D 3LKRA 5F6IB 5E2UH 1V7ML 2OP4H 4WW1A 1IEBA 2XKNB 3ZYOA 1UWXH 1TETL 1QKZL 1D5BB 3VXNA 4OKVA 4QTHB 1NCUA 4MNQE 4WFFD 2AVGA 4FFZH 1ES0B 3BDYH 4PJ7A 3MFFB 2FB4L 1S7SB 1HH9A 3E2HC 3DVGA 2A6KB 4J3TA 4IOIA 4AM0A 3OJVC 3C8KA 4HUVB 3WDHA 1ZVHA 3UJIH 2BSRA 1B0GB 1UH4A 3VD4A 3QUYC 5DHVH 3AVEA 3QA3A 2ZOLB 4LFHD 4LRNL 2DQFA 2SEBA 4LOUC 5I1EH 4IEFB 1DBBL 3IU4H 4MYWB 4F8TA 3BAEH 2JJWA 3QCVH 1FZOB 2NCMA 5ETUA 4LHUA 1DQLL 3Q5OA 4PP2A 2BNQB 5TPWL 1UKSA 2O5XH 1U8KA 1CFTB 4KRPB 4QTIL 3LDBC 2O93L 2MKWA 1N5AA 4NNXB 3VXMD 5F7EH 4LCCB 4LMQI 2R56H 1TQCB 4JG0H 3BD5A 4L3EE 5JIIA 1RIVH 5C0CB 2DMCA 1IBGH 3TO4C 1N2RB 1WCBA 1XR8A 4GW1B 4HKJA 5DEGA 1K8DA 4Z18A 4JRYE 4QCIB 2E7MA 1DQJB 2PTTA 43CAB 5BS0E 4G9FD 1EFXD 5DT1L 1S3KH 2CIIA 1EEQA 1V3JA 2WINB 1WBXA 3VI4E 3KPOA 5KN5A 1A6PA 3KPRB 2AXFB 4JRXB 1M7XA 3MO1B 1NSNL 4CMMB 1QEWA 2P48B 3H9HA 3GMLB 4CVUA 1JK8B 1MJJB 1IC4H 4LHJB 1KTLA 4WFED 5GGTA 4YHKL 3FT2B 3ARWA 2OQJA 2YEZA 2VLKD 4QRTB 4HUWA 2GAZA 2W59A 2AKRB 4JM2C 4KUZL 3SHSA 1T03H 3OXSB 4XPFH 2VDQL 3MRJB 4N0UA 2FHFA 3MBXL 4I1NB 4RWYH 3C5SB 5TF0A 5FYJL 4O51A 1MI5D 3PP4H 2B39A 3N1PC 4J3VA 5SV4A 5ERWA 4QOKE 1AQKL 4A6YL 4X8XA 3QP3A 5GSVB 1JPGB 3ARTA 4OFPA 4JCLA 3RVUD 3TT3H 5E70A 1PX4A 4X6DA 4HIXH 1KCRH 3ESUF 3MLZH 4WI3A 4F7PA 3KYMB 5KZCB 1CFNA 4P23B 4O58L 1RU9H 3HE7A 4BYHA 3GRWH 3WL9A 1KCLA 3LS5L 3WNKA 4LLVB 4RX4A 3OKMB 3SOBL 3MGOB 1JHKL 1KJVA 1CIUA 4IIQA 4Y2DD 1A9EB 5A16B 3G5YB 3TLRA 5JR1L 5J6GB 4HC1H 4KZEH 1GOFA 4ZODA 1CYGA 2C1PA 1A2YB 1PSKH 3U9UB 2VLRE 4P2RB 5SWSE 4L4VE 3DXAA 3W9EA 3SKMA 4JR9H 3V0VA 1WEJH 1JNHB 3QDJB 4G7VH 3DGGB 4HAGA 4OFVA 5MENE 1HYSD 4V1DA 5F9JB 4UQ2A 2XTJE 2PW1B 2BRQA 5C07E 4QRPA 4XNXH 4ZXBA 1Y18A 3L9RB 3OJDB 3EO1B 1B6UA 4AG4L 1WLHA 3HZKA 2ZUUA 1SQ2N 3CMOL 1AHWA 2CLVA 3NH7H 2IGFL 5DMYA 1A47A 4YHLL 1B90A 5DDHB 1FG2B 2WK2A 1K2DB 3NCBB 3RZCB 3ARDA 1AY1H 4BSVB 4G9DB 3QQ9C 5D4QA 5HHNB 3CFJB 1YYML 1WFUA 3VFSB 4GBXB 4LLWA 2J7LA 1EJ6A 3T0DA 1N7ML 4D94A 3ULUL 3L3IB 3IF1B 1UB6A 1QFHA 4IJ3B 1MFCL 3EAKA 5DEFB 4YFEA 4MDJB 3DV4A 4DK3A 3IJSB 3QG6B 1F4HA 1U8LB 1HDMA 1A6TA 1FG9C 5JXED 1MCJA 1ETZA 5I8EB 4F57H 3MV11 1IFHH 4GQ9L 4LHUG 3ZTNL 2DWEB 5E9DE 3KPQA 3FO9B 4QWWC 2JTDA 2AI0L 1YY8B 4UT7L 1PD6A 4JM4H 2D0HA 5I8OL 5JMRA 3QWQB 1NEUA 1LP9F 1YQ2A 3EFFB 4PJ5B 4YQXH 2YPKA 3AY4A 1FAIH 2VXSL 3RKDC 1JMZA 4YC2B 5KAQG 1ZSDB 2F58H 2OJZL 2VABB 4YHZH 5E0QA 1RJLB 5GPRA 1JZ3A 1X6NA 4M3JA 4P4RA 1A7RH 4XVSH 3C5ZA 4RCAA 1I9IL 4OTXL 3TZVD 4TSAH 2HLAA 3VFPB 4MNGE 5I30H 4WI4A 5FA4A 3OAZK 4JFYA 2ATPB 5B3JF 4H0HB 1P53A 1CZ8L 4B5EA 2IANA 3L3HB 3C08L 2ZCKL 1D5ZA 4KHXL 4ONFH 5DYOA 3LN5B 4JY5H 3BPOB 3MJ9L 2H2SC 3OKKA 3QDGB 1SHMA 2GI7A 2DBLH 1N3NB 3GB7A 4Q7DA 1S7UA 2JF1A 5J06A 4GS7B 1KB9K 4F37K 3P4NA 4WUUB 4DUXA 1B3JA 5T3XD 1YNLL 3D0VA 4JDVB 5E7BA 4P3DA 3MRLB 3VXUA 2FO1A 1WZ1L 3HNTH 4PRHA 1OCWL 3BIKB 4LBEB 3K4AA 1YNKL 4X9GA 4MDIA 1S7VB 4WDIA 5FGRA 4TSBL 2V2WB 4PJIF 2Z31B 3NCYP 5AZ2H 5H94A 3UZQA 1JHTA 2Q6WB 2VLJE 4PJBB 3DUUA 1A8JH 4YK4C 3MACH 4F9PC 3SGKC 3O6FD 3QDMD 3QUYA 3MUGB 2H8PB 4EDXB 2L0DA 1Q1JL 1PKQE 3BMVA 1FBIH 1KJMB 1MCRA 4LP5A 2PXYD 2ZKHH 1XGUB 3VA2C 3MGAA 5F7YC 3ZT6A 2OJEB 1U0QA 4LCUB 4R4FH 4B7LA 1ACZA 1G7JB 2V5SA 4GKZB 5L88H 1YN7B 2B5IC 1BFTA 2F8VA 3T65B 2OM5A 1FSKB 1MAJA 3OPZL 1V3LA 5EUOB 3QT2A 4BSJA 3Q48A 5T3XH 3O4LD 3V6BR 2RB8A 1KLGB 4FTVD 3TO4A 4PLKC 4PJCE 5I0DA 2X4PA 3I85A 4X4MA 5CGYD 3FOMB 3PWPD 4K71B 5DD1H 3MRQA 4EI5C 3VFVB 2YZ1A 3D1MC 1NAMA 3BGMB 1MHCA 3ZKXB 1I8MA 5AYQA 5IMOA 2LVCA 5EUKA 5BZDB 3PQYD 4NGHH 3BPNC 4OF8A 5HVHC 3H9YA 3FQNA 4M7JH 1G7MB 1HSAA 4OD1L 2FX7L 4PRBB 4YDIH 1FC1A 5GRWA 1EXUB 3HB3C 2RHEA 5D5MF 1QFOA 1GXEA 1VFAB 3P9LA 3JBG7 1NCBL 5KJRH 1RUPH 1CE6A 4PJAE 1U58A 3N9GH 3H8NA 1F90L 3MNZB 4AEEA 4ELMF 3ME0A 1C12A 1GC1L 4NO0D 1Q9KB 4JANB 4JM2A 3EO0B 5C6TH 1I9JH 4JFQB 3MA7B 1A6ZB 5EO1A 1J1XL 3MV8D 4U7MA 5DVLA 1IRAY 3D39E 3NACH 2GSGA 2HRPL 1FPTH 3PDDA 4B7IA 4EI6A 3QUKB 4LSRH 1JJUA 2VXUH 3NTCL 4U1LB 5DRNB 3REVB 3PWVB 3VFRA 4F7MA 1HN1A 4LF3A 1B4JL 12E8H 3SKJL 4H0GA 5B38A 3U6RB 4N9GB 4PJ9D 4QHNA 1TLKA 3ZSTA 3WNPA 1SBSL 2QTEA 1J8HA 5DMIL 5E1HB 4NO3A 3HG1A 1EMTL 2DOCA 2AK4A 4ODWA 3UYRH 4IRJC 2XACC 1ZLVH 1IM9A 4DZ8A 2MFNA 4HEPG 1NUFA 3RHWF 2MCPH 4XBPA 4X99A 3QFJD 1E6OH 3FFCA 3SDXB 2GJJA 3A6CH 1YPZE 4OGYL 4TPRH 4WWKB 1ZHKB 4ZPTB 5IP4A 2EIZA 3CFEA 4HWZA 3TO2A 5LQBH 1L7TH 5D7IE 1RZKC 3IJYB 3RWCA 5GHWH 3SCMB 1ORQB 1R5VA 2QADC 3QAZB 4XI5C 1KLUA 3MA9H 4QRQA 4X6FA 3IXTB 1JHLH 1XF2A 1T5WA 5I16B 1H3GA 2QQLH 4BKLB 3D18B 4PRPA 4TNWF 3C5JA 4HHAA 3G6JF 2HMID 4ORGA 4XPBL 4JFPB 1T1YA 1DN2A 2ICCA 1JVKA 3MOBH 4X83A 4UDUA 1I3RA 4OZIA 4Y4FD 4PV9A 2ZSVB 3NZ8B 1RK0A 4X5XB 2EXYD 1GAFL 1OAKH 4L3ED 3L95A 3NCJH 4JPWL 5IMLB 5EU3A 1CBVL 2M1KA 4GG6A 2ZPKH 1AO7D 4AEFA 4J3OC 4YDJB 4ERSL 5CEYA 2H32A 4JRYD 1DQQA 1JRHI 3GSWA 3BN9C 1MJ7L 3KPSD 5EZJA 3QUXB 2GJ6B 3D3VE 2RBLA 5BS0D 2O61B 4BFBD 4HV8A 4OFYD 3C60B 2MTPA 1I7TB 4AMKL 4M43L 3QWOB 2VITB 3VFMB 4YBHA 3RNKA 4JFZL 2GEEA 3HMWH 5B8CC 2VR4A 5CEZL 3NPZB 3KYAA 2IPKB 2PO6B 1R5IA 3NIFF 1XGYL 1QFUH 3P2TA 1BD2E 3QUMA 1GSMA 3HLAA 3MRHB 2D9CA 4X6CA 4UILL 1ZS8B 2A38A 2ADIB 2APWA 2HJFB 2IFFL 4RMVA 1RK1A 4MJ6B 4LVHB 6CGTA 5H35A 4G6ML 4QOKD 4MAYD 4XBEH 3EO9L 1BZQK 3GSNB 4HG4K 4R3SA 5JQ6H 3C2AH 5KSBF 4LDLB 5D1ZC 4F80A 1BBJA 4FQPA 4HJ0D 4UQ3A 3FL7A 4FQ2L 1ZHBA 1B9ZA 4F9LC 3MROB 5D93B 5DJZA 2P5EA 3U0PB 3DLQR 5TDOB 3FO0L 3BP5B 4Z7VB 1ADQH 1M1SA 1IARB 1D5MA 1E0OB 1NFDF 1BGXL 1U3HD 3MRPB 3JWOH 3KYNB 4DW2L 2FO4A 4ODVL 2VLRD 1MUJB 4L4VD 2GK0A 1RI8A 5E1AA 5JLZA 4YNYA 2FEDC 1T20B 2HRLA 5IFJA 1QA9B 2HT4C 4FFVD 1BOGA 1JGUL 5BQ7B 1J87A 2HJKB 5MEND 1YNTB 1MOEA 1KNOA 2X70B 1LO4H 3QQ4A 5C07D 3TH3T 5IW3A 2CDGB 3DUSB 5CBEA 5B38G 5GZNC 3RUGB 4ZUSA 2B1HL 2NY0B 4F9PA 3SGKA 3OWEA 1XIWD 1G7LB 4Y4HC 5F1NB 4WTWA 3SBWC 4U1NB 1DBML 5E6ID 4U2ZA 3PXJA 1OHQA 4G3YH 5I74C 2CRIA 2IPUG 4OKDA 2XWBA 4NKOA 3RTQD 3UTSE 1OTTC 3CH1A 1P4BL 1DE4B 1OQOA 2XG5A 1AD0A 2CGRH 5ACZB 1C08B 4POZC 4ODHH 3I3EA 3E1F1 1AGBB 6FABH 5K9QG 1OSPL 5A2FA 1X5FA 4HKBA 4L1DA 4DKEH 5F3BA 5BXFB 3DVNB 3OKLA 3W82A 2R2EA 5JORB 1D7FA 2DKSA 2VWEC 1FV1B 2JK5A 3AB0B 3B9EA 4RGNE 4PY7A 4L4TA 3SGJC 2Y36L 3FHAA 1IT9H 4LSSH 3V5DB 1DEDA 4TUOB 3CVIH 2X6MA 4EI5A 5HYJE 3IDMB 1UZ6E 5L8JB 3RAJH 4PRNB 1JF5A 2VDNL 3L7EB 3TA3C 2Z8VC 4PS4H 5EO9B 2X10A 3SQOL 1BFVH 3KYKL 4HIHB 5E9DD 4KRMB 5GJSL 4O5LH 5LWYH 4OF6A 4NSKA 3OL2A 4ZQKA 3S36X 3S8WA 3CSYB 2D31A 4ZAKD 3BGFC 3TCLA 2CKBH 3MGTB 3U36A 2V2XB 1RZFL 3DO7B 3P30L 5ALBL 3FO2A 4Z7OF 2CDFA 3RWHA 3FB6B 2NY6C 2PKDA 5ADOL 1C5BL 3RWEB 2G5BB 1CXLA 2CMRH 2HA1A 4M5ZH 5SWZE 5K9JL 4GRWE 2VE6A 3VFNA 4X9BA 3U48A 1T2QH 3KVQA 4JG1H 5DUPH 4RA0C 3BKYH 2EH7H 2PCPA 3CFCH 4JPKH 1JYWA 4LLDB 2HWZL 2AK1L 1C7SA 4HG4J 3VE0A 4R4ND 3OBAA 2MSPA 1BMGA 5IBUG 5HDOA 4NWTL 4DN4H 4OZGA 3AC0A 2FSEA 4XCCH 3MXVL 3GSRA 4TYUA 3P11L 4IRJA 2UWEE 1F6AA 4MJIA 3EOAA 4X4XA 5HGHB 1Z9SA 3TWCH 2APFA 3SKOB 2QKIA 2CXGA 5C9JA 1FNGA 3BSZL 3WLWC 4U0RB 3QI9B 1MCWW 4JCMA 2VQTA 1S5IL 3UEZA 3B5GA 3KPLB 1Q94B 3KLDA 3D9AL 4OGXH 5D1XC 2VLJD 1S8DA 2NZ9D 2GHWB 1W0VB 1RZJC 4RMSA 1TQBB 4P9ML 2AERT 2CPCA 4XCFH 4Y4KB 1U91B 2EDQA 1DBKL 4KKNA 4P2YA 4HWBL 3P77B 1HQ4A 4N5EC 5IW1A 1WIOA 2AXHA 3AAZB 1NGYA 3GKWL 4XT1C 1HILB 4NQDD 3WFEL 2VZVA 3QNZB 5KVEH 2ERJB 4Y5YC 4ZYKA 2F54A 4P5TB 2YD7A 2VNCA 2R23A 5DLML 5CGTA 2AJXH 3WXWL 3QCUL 5I19L 4FQHB 3IRPX 2CO6B 3ULVF 4J8RA 1Q72L 1E4XL 2WLZA 1J12A 5JOFB 2N1KA 5C0AD 4E0RA 4JFXB 2VXQH 1ITCA 4WRLA 1P84K 3BYYA 3O45A 2ZCLL 2ZZUT 3FT3A 5D7SH 4P99A 4RQQA 1G1CA 4MXVE 5K9QI 2YWYA 3IU3A 5B8CA 1KLFA 5GS1B 5FYKE 2R4RL 3VRLF 3U7WH 5E94B 2HTLD 2DLTA 5C9KA 5JHLH 1R0AH 1CFQB 4PJEE 5I1JH 3MLPA 1DUZB 5C0BB 4LQ1A 3M1BB 4ZO9A 2IH3A 2H6PA 4OBSA 2BVOB 1JMXA 1OQXA 3SPVA 1YDPB 1WFNA 2AJUL 2AJZB 5IROC 4IMKC 2V17H 3BIAX 4QLRA 2XN9A 4GAJH 1ZE3C 3D39D 3BUYB 3HI5H 3O81A 4K7PY 5J11C 2A6IB 3G04B 3QWRA 1YN6B 1QG3A 3A67L 4G43A 4YX2L 3KPNB 4AL8H 3L5HA 4MA8H 4KKAD 5D1ZA 5IHLB 2DQIH 2CR3A 1FYTE 3F5WB 4H1LA 4UT9L 4NQCE 4F9LA 3SE9H 3WUWB 4DKFH 3F7QA 1CE1L 2X4RA 1CD9B 2L7UA 4CAGA 3WNLA 5FFLA 3IJHB 3ILQD 1K5NA 5I1DA 2DIAA 4MZ3A 4XPGL 3LS4L 5C0EA 3HRPA 1U8MA 3QULA 2FL5B 5K59E 1CLYH 1UCTA 3UTTA 3TBSA 5EOCL 2Z92A 3HZVB 2VDLL 1M7IA 1DDHB 4MMXC 4X4YA 4LMQE 4JFFB 1F97A 1GRWA 3TC9A 2Y23A 5CIPA 4PGDA 3D2UA 4KVNL 2ADFH 3DX6A 4RISL 4XPHL 2CKNA 5DJ8B 4Y4HA 5JOPE 1JV5A 3SBWA 4YJZL 5IV2A 3TBVA 2VN7A 5F9DC 4FQ1L 2NPLX 3MRGA 3OR6B 5MEQA 2M2DA 1FYHB 4RMTA 4X5WB 4K55A 3V5HB 1KXVC 4OB5H 4UTBH 5DTFB 1QSFB 4Y16D 1UZ8B 3MLVH 3TT1H 3V5KB 1P69B 5DSCA 3ILPB 3MREA 4I5BA 4AEHH 4PRIB 4K3JL 1G9NH 3R0NA 1U8NB 2J2ZA 1H8NA 2Y5TA 4OJFH 3D3VD 3MOAH 3PNWB 4JFOA 3G9AB 1UKQA 3LPWA 1HHGA 1U3JA 3ULSA 3SGJA 4CN6A 1FDLH 3QHTC 2DQUL 4L8SC 5ITFA 4XVJL 1H3TA 3T2OA 3IETA 3SJVA 4LLMA 4UV4L 3TA3A 5D7LE 2COQA 4O2CA 1U8IA 4HH9A 1Q9LA 3LEVL 1IGCH 2E7HA 2ICES 3CLFH 1P84J 5J1TC 1RZGB 2JELH 1QYGH 4ZNCD 3O6LL 3STZA 1BD2D 3V0WH 5EU6A 5LG1A 1P4IH 1IGIH 3KLHD 1H3PL 4K23H 4CU7A 2WAHA 4XBGB 1DSFL 1KCUH 1FLRL 4P5KA 2HVJB 4YHIB 5EIQA 4U6HA 4JQIH 4LCWB 4M6OH 1BVKA 5GJTH 3MXWH 1CT8A 3VWKB 1D6VL 4MWFA 4O2FB 1KEGL 3CLEL 3WFDL 1ZGLA 3SDDD 3RY5A 2OS7A 1DBAL 5GGQH 1XEDA 3L3KA 4MD0A 2R8SH 5BRZE 4LLAA 5JW3H 3OGOE 3QPXH 4P46C 2EC9U 1SBBA 3LH2L 3NIGE 5HSFA 5ACLA 5HHMD 4NM8H 1A0QH 1LNUB 4LNRB 1OF2B 3D69A 4NQEE 4NT6A 2VMFA 4WW2B 5AUMA 4LSVH 4OLVH 3SEPA 2F9BT 3L3DB 3RWIB 3FHQA 5JXAH 1A6AB 2V7NA 1TCRB 4YWGH 4OLYH 4XVUD 4LCIL 4LGSB 1M7DB 1AJ7H 3PE9A 4S2SA 2KBGA 3DBXB 4FQQB 4HXBL 5HY9B 4NQSB 2C1OA 1B0WA 2ITDA 3BZFA 2IADB 1RFDH 1OT2A 2B0SH 3UPCA 4ALAH 3ZDXE 1PQZB 3CC5A 3HC4H 5D1XA 5F8RC 2IH1A 4WEBH 3CXDH 2A1WL 3RDTD 1BQLL 1XGTA 4OV5A 1TNMA 2YUWA 3GMQA 4H1LG 1RUKL 2OR8A 1RZ7L 4J1UA 5KVDL 1FFPA 1NCCL 3UTSD 3NN8B 5LAXB 3K4DA 4NKIH 1YEIH 1HKLH 2I07A 3REWB 1SYVB 3HAEH 3RVUC 1Q9WA 3LKOB 4Y5YA 4NKMB 4PJFE 4BSWB 4P59H 1GGUA 4ZUTB 3WIIH 3EYQD 3MV9D 4FFYL 5A43C 5HI3D 1KCVH 4FFWD 1U8JA 1FNFA 5D2LA 1ZAGA 1E6JH 4Y2DC 1K85A 3C9NB 1T89C 3HS0A 4OKVB 1MY7A 1VADB 2N7AA 2PYFB 3S3JA 3V4PH 3CSGA 1HCFX 5F93C 3MRCA 4ZFOB 3BKML 4G80A 3BI9X 4Y19A 5ADPH 3MV7B 1UA6L 1GGYA 4HT1H 4L9LC 3BZEB 3BFOA 3T04D 2OI9B 1HYSC 1G9ML 3KWWA 3QA3B 1JTPA 3LN4B 4KTDL 3TVMB 1TZIB 5I1IH 1MAMH 2JB6B 4L1HA 2DQDL 3FCTA 2NXZD 4WCYL 4RGOH 3T2NL 1A3RL 3DO3A 5IROA 4ELKB 3WIFB 1JFQH 5HTSA 2BNRE 2GSIB 2VDOH 3BP7B 2BOBA 4BH8B 4RAHA 3NA4A 4FZEL 4NIKB 2IQ9L 4M03A 3QHZL 4EDWL 1YEHL 1MSPA 3GSNL 1YMMB 2F74B 3WFCH 1XR8B 2UZYB 4RMUA 2FYYA 2QQKH 4HIJA 3VG9B 5DURD 4RAUB 5EN2A 1EJOH 4WEUD 3FTGA 5CINH 2R0WL 1DVFD 1F3DJ 2EE9A 4WGVB 4G7YL 4M1DH 3DJ9A 3GNMH 5JXEC 1IKFL 3FQTA 1PZ5B 1UM5H 2JJVA 3HE6D 2BC4A 3N1FC 2C3VB 5IMKB 1MHHB 2WP3T 3KJ4C 2WW8A 4U6YA 4BFIB 3OGCA 4I2XB 3P73A 5IB5B 4P2QA 4XP5H 1ZT1A 3RZWA 1FZMB 4HFWB 5DMKA 4GRWH 2EE6A 5IVXB 4C57C 2EDWA 2FB4H 2KKQA 3ES6B 3ZE2E 3ALWA 3NCEB 1RJZB 4O51B 2CUMA 4QRRB 1ZVSB 5A1AA 4PRAA 5DHVA 3NIDE 4Q9CA 5DHYA 3V9FA 2DKMA 4LRNH 1X3DA 2BMKA 2X5PA 2LU4A 2JIXD 3O4OC 3TZVC 4R7NB 4YR6B 4DZBB 4YE4H 4G5ZL 4JDZB 1FVEA 4P9HH 4X6EA 1H8SA 3PP3H 3GSUB 3RWJA 2XRAH 3LPGA 2D4FA 3OR7A 4L3CB 2ZUXA 4FXKA 5TPWH 1KPUB 1NLBL 2KZ1B 4QTIH 2BSTA 1KB5L 1RHFA 4PJ7E 4UAOC 5ICZA 2ITCB 4HIIB 1JWMA 5FYJD 5IG7A 2VOTA 3VFTA 2ENYA 1S7XA 4HZLA 4EN3B 3M17B 1KTRL 1LO5B 3MNWB 4L8SA 3VFOB 2YK1L 1HI6A 3RP1A 2DI8A 2HVKA 1YA5A 3SDYH 1CDYA 5HDBF 4Y1AE 5I8CA 1FH5H 3GIVB 4HJGB 4HPOL 2WIIB 1TPXC 1R3IL 5IF0A 1W0WB 4EOWH 1IE5A 1IC5H 1F00I 2R0ZL 1QBML 3O6FC 3KDMB 3GMPA 3WKNA 3RGVB 4YHKH 3VD9A 4UTAH 3UZEA 4YBLB 5KSAD 4CJ0A 4Q2ZA 1DEEA 3T1FB 4URTB 1Z9MA 5D96C 2BJML 1QLRB 3BUTA 2V9RA 4NUJB 2ENSA 5INDB 4LLWB 3LRSB 5E4EC 2OX5A 3MBXH 3U0WL 2X41A 4QF1A 1VACA 1U93B 5FYJH 4P46A 1ACYL 4WGWB 1KUMA 2AV7B 4WEMB 1RULH 2Y6SD 5EBGA 1AQKH 4A6YH 5JW4M 1IL1B 5MI0B 1PZUB 3WN5C 5TFSL 4QHMB 5CGYC 5IBLC 1LP9B 5TH2A 2FX8H 1MCWM 4I3SL 4O58H 1LVEA 4AK1A 1XGPA 1T1ZB 1EFXA 3GRWA 5D7KE 5IT2L 1NBYA 3LS5H 2VAJA 5F44A 2H1PL 2BSSB 3SOBH 3UDWC 3TM6A 4QYOB 2C5DC 3FQWA 4HC1A 4N0UE 3ULUD 3T3PE 1WV7T 5ELIA 1ZWIA 2WWMD 5C08D 5F88B 5I73B 5L7XL 2VLKA 5HHXH 4HEME 4KK8D 5F1IA 3WV0A 3F62A 5D2NC 5L2JA 4LSQL 4LPUA 1IAIL 3DSFL 3BZDA 3PHQB 5JOPD 4X6DE 1W8NA 4XP6L 3K4ZA 2B8OT 5I6XC 3PXHA 3DIFA 4L4JA 1J0ZA 1A14H 2GITA 2X4TB 5E5UB 1NBQA 4KRNA 3CVHH 3ZL4L 5HGDA 3D0LB 1OGAD 1LMKA 1YJDL 3Q1SL 1FZJB 4CADA 3PL6B 3I6LE 5AG8A 1QR1A 2HT3C 4PJIB 1WVZA 5INCB 3V7AG 5DQDH 2VH5L 5DR5L 1RJYB 1Z9LA 3P4NB 4Y5VB 1U3ZA 3DXAE 4Y2OA 3U2SA 1WC7A 1ZT7A 2CK2A 4HLZH 2VC2L 5AAWA 3MZTA 3GSQB 5EIVA 5IUSA 3GIZH 1CD1A 5B21A 4Y2DA 1X44A 3KXFB 2Z0BA 1T89A 1N7MH 4M7ZC 4V1DE 4FA8A 3ULUH 3QIBB 2BSED 3UJTH 2QV2A 4G6JH 2OTUA 4QRPE 1MFCH 1NFIB 2E7LC 4YIQB 2C4XA 1JGDB 5IKCB 1HSBB 5FM5M 1GPOL 1FIGH 3E3QC 4JZNA 2ORBL 4J23A 4IS6B 4L9LA 2QHRH 4C56D 1SEBB 3PHOA 4ODUB 4D9RD 3TPKA 5I75C 4JLRA 1CI5A 3MLWL 4FQLL 3UZVB 3ZTNH 4LIQE 4K7PH 4Z77B 3U79A 1QSEB 5I66B 4XX1G 2VXTL 4ZFGL 3X14A 5CD5D 5IQ7L 3IAPA 1CLOL 5HI4D 1DJSA 4E5XA 4UV7H 2AXGB 5I8OH 4P48A 4P2RE 3N85H 5H37G 4KROD 1OSZB 4LLQB 2WBJC 1T7YA 2HFEB 5BRZD 4PY8I 3C6LB 3OAYK 1E28B 4H26B 1T2XA 1FVDB 2E27H 2EXYC 4KI5D 4D0DA 2F53D 3VD5A 5D5MB 4NQED 4YXLH 4OTXH 2I9TA 4NN7B 4XH2A 4YGVA 4KJPD 1L9NA 3IDUA 4OM0L 5EIIB 2ED9A 4H8WC 5I1AB 1NAMB 2VDMH 2X40A 1HE7A 5DMJB 3VD3A 4ELMB 3ULUF 4DUWA 4WV1C 1CDUA 2NY1C 4KKBD 4JY6B 3KJ6L 2YMXL 4PB0L 2UY6A 1TJGL 1NCWL 4OCSH 2ZCKH 4KHXH 1YEGH 5JXEA 5TDNB 1KEML 3C87A 3MJ9H 3OTTA 2W91A 3H9SD 2BY1A 3P9LB 4KVCH 4BQCA 4F7TA 2ZP0T 3CDGB 3JTSB 5C0IB 2BVQA 2AEWA 3DRTB 2D03L 5L8LB 1OCWH 4G8GB 4D8PB 1YNKH 4NZTL 2JJTC 3BQUB 4TSBH 3B9DA 3TBTA 4OCLC 1J5OL 1S78D 4Y7MA 3D85B 3LKSB 5DD6B 2YD1A 4EI6B 5DGQA 2IANE 4YHOL 3FB7B 1VKXA 3TZVA 5CBAB 1XF5B 1EA9C 1GVIA 3BH9B 1TFHA 3DHMA 4HJ0C 4L8DA 4YPGB 4ZFZB 4CU6A 3VXUE 4U1SB 5FKPA 5B3NA 4PRHE 1IM9B 4QXTA 5E08L 5BO1H 3OKNB 3GI8L 5FYJU 1BP3B 2R69H 4MQ7B 4BH7A 5EZIH 1KXQE 1FCCA 5T5FL 3UO1H 2OK0L 1JNLL 4NP4L 5HPMB 1HCVA 3OPZH 3KPMA 2ZOKA 2FRGP 5JW4N 1IGFL 1RIUL 3FN0H 2F5BH 4E42B 2MOVA 5E00A 5BMFL 3CK0L 3V8OA 3G6JB 3RWFB 5DD3H 1MH5B 3SDCD 1F4WL 1KGCE 3V8CA 3VRIB 4U1MA 4QHUA 1X7QA 4ONHA 1DLFH 4K7FA 1FJ1A 4YHYB 4U1HB 2P5WD 4HS3A 3NPSC 1H3XA 2GTZB 4HCRL 5F7FA 3FB5B 1ED3B 3KNBB 3RJDA 3JTTB 3O6FA 3QDMA 1XIWC 1UWXK 4KI5F 3C5JB 1I1YB 5IOPA 1HEZB 4MSWB 1T1YB 3QUZD 4U6VL 1LWRA 1F90H 2J6EH 3S9DB 3R8BB 5CILL 4OZIB 3RTQC 1J9CT 4M1GL 3ARBB 1GC1H 4R96B 2VQ1A 5D8JL 3WDJA 4HSQA 3BJLA 1U9KA 2OXHA 4R26H 5K9KB 5EU7C 2EC8A 3VXTA 5KVGH 1RUQL 3MRBA 3P0GB 4M7LL 4WTZG 5DJCA 3MLXH 4Z7UF 1I1AD 1UXWB 3IFPB 3DX9A 3NTCH 4GG8B 1F3JA 2DM3A 3PWJA 4PY8J 1BZ9B 4FTVA 3BWAB 3SKJH 1WTLA 2X4OA 4CVZB 5DJ6B 3WN5A 1U92B 3PWPA 4PJDA 1JF6A 4Y89A 3PV6B 4APQB 1EGJL 1SBSH 5IEHB 3GMMA 3PQYA 4P2OD 4OAWA 1K3IA 3TBYB 4RAVB 3ULVC 1QRNB 1MFEL 3DROB 4P2CG 5EC2A 3CUPB 3BE1L 3B5HA 1F2XK 3UDWA 4YZFF 3O2WH 5FEBA 5KSBB 3PGFH 4ZAKC 3L7FA 3TNMA 1I9EA 4A2LA 4GH7B 5FOBB 5FECA 2BOCB 4OGYH 3TH4T 3WXVL 3NFNA 5D2NA 2K9UA 2NY2B 4HFUH 1HHKA 1BM3H 4HGWA 4E41D 3S88L 4GSDH 4K3EL 4PG9A 5I2IB 5CEZD 2X4NB 1J8HE 3HG1E 3U9PL 1OD7A 2AK4E 5DJAB 3WFHA 3OMZA 2AQ1A 3IDIB 3ZHLA 4PD4J 5ANMA 4XPBH 3PGCA 3FFCE 1I3GL 1KT2A 3MRFA 3VMNA 1A1NB 1FO0H 1T0MA 3ZYJA 4NO5B 5F9AC 5K9OA 1V05A 4GAGL 1GAFH 2KQNA 2ICWA 5IVZB 2HT2C 2Q76B 4AENA 2L7JA 4MJ5B 3QXUA 3IDNB 3QFJA 2XWJA 2FLRT 3OKYA 2FZ3B 2MPAL 4JQVC 1MJ7H 2Y7QB 4Z6AT 3BRGC 3PV7A 4ZFOL 4WJ5A 1DFBH 4R8WL 2KQMA 2E7LA 5CZXD 4Y1AD 4LHUD 5EWIH 4AMKH 2FEEL 4M43H 4OQTL 3RRQA 1RJCA 2XG4A 2NZ9C 4PRPE 1NFDA 2Z91B 4XXDA 7FABH 5C0JB 4PV8A 2DJUA 4WFHD 4JO1H 2V7HB 3JSSA 1FFOA 2VR9A 4JFZH 4OD2A 5D71L 5CEZH 2EDFA 1N59B 2J8OA 2E6JA 5EU4A 1MJUH 2AJVL 4PR5B 1HINL 4S1DD 4NRYB 5KANG 3SDXE 2C26A 3UTZB 1R3KB 4GG6E 3BVNA 2DN7A 4YHNB 1CN4A 1JZ7A 3KYOB 4X0KB 1JF1A 2Q86A 2WBJA 4HS6A 5T5NF 2VB5A 3B83A 1A6VL 3GHEL 3U7YH 2IFFH 3EYUL 3ROLA 3B3IA 4QRUA 4LQFL 4LEOA 3X11A 3J8F7 2R29L 1NC2B 2CH8A 4G6MH 3N1MC 3MRIB 1AO7A 4ZS7L 4JRYA 3O3UN 2MHAA 3UAJC 5C0FB 3KPSA 2PW2B 5CWSA 5T1MA 1AD9B 2R39A 4HMEA 4DVRL 1FHGA 4FQ2H 4OFYA 4WV1A 1V3KA 4KRPD 3LQZB 2Z8WC 4X6CE 3TBWA 4PP1D 5GRZA 2Z35B 4XC3H 5TDPB 2I9LB 2UYLB 1BGXH 5ISZB 2XT1B 3FRPA 3S36H 5BCAA 1JGEB 3E6FA 4HQQH 3BKJL 3QYCA 2WIMA 2BXZA 1D9KB 5DI8A 1NANI 5AG9A 1WQVT 1JGUH 2JJTA 3AMLA 5CMAA 5IHUL 3ZO0A 5T1LB 4XPAL 4N0CD 2W65B 3ARGB 5JHDB 2JCCF 1H3UA 3HC0B 1A21A 5AD0B 4PIRF 5B39A 2B1HH 4JY4B 2P5EE 3PG2A 4QOKA 1UH3A 3V52H 1S9WB 2UVEA 1I7RB 3I6LD 3S98A 3K74B 4KKAC 1ORSA 3SDAC 2FBOJ 3K2MC 4WHTA 4U49A 2VZSA 2FJHA 3GMRA 4XAKD 1P4BH 4NUGL 3QCTL 1AGFB 1WBYB 3TN0B 5FHAH 3FB8A 1NMAL 3HI1A 5J12C 1CK0H 5I8KL 1FNGB 5FO8A 4MNHB 3U4EB 3ARFB 5JDJA 4ZXBD 5J1AB 3MBEB 4S10A 4NKDA 1L0QA 1INDL 4L4VA 1KIRB 2Y36H 3F12A 3QH3A 2MQCA 5KZCD 1R6VA 4P23D 4AJ0A 5DQ9B 2VDNH 2EKSA 1HXMA 3WFBL 5CHNA 1SM3L 1C5CL 1WK0A 3SQOH 4DOHB 5F7HA 3CFBB 4HUXA 1OWRM 5GJSH 5C09B 4I48A 4F3FB 5JTWA 5I76A 4H88L 3OXRA 5IW1B 1XIWA 2IFGA 5LGHL 4BQ9A 5F7KC 5ESQB 4P2RD 5BJTB 4MCYB 1RZFH 5CD3B 3T3ME 4HD9A 1S7WA 5ALBH 4UDTB 3RTQA 1CXHA 4L4TE 1C5BH 4D0CA 4Y16C 1KACB 4X7TA 5K9JH 3RBGA 3QXDB 5GRJH 3NZHL 1ZA6B 4IRSB 2P7TA 4JREB 4UOW0 3R4DA 5JZ7D 3KR3H 5FF6B 3AGVA 2YA2A 4X6BB 2EIEA 5FO7A 4FP8H 2CRMA 3VRJA 1VA9A 4KY1H 3ZTJH 1FFNA 1MCDA 5KANI 1QFWI 4FNLL 2C3XA 5LBSL 3SE4C 5CEXB 4NQVB 1JPSL 3ZDYE 5L0QC 4KTEL 3P11H 4GBXD 3QEUA 2YZ8A 1T21A 2PTUA 3O2DH 2G75B 3M07A 3P4LA 1JNNH 5KS9A 3QO1A 4NNYA 4ZAKA 3BSZH 4F58L 1J1PL 2OZ4L 1HXYB 4RFNC 3TIDA 1S5IH 1XF4A 2R1YA 4TSCH 4FOMA 4I0PB 4MB5A 3S4SB 3HMXL 4WO4B 4ZS6D 1GGIH 2IAND 4GAYB 3IT8D 2VAAA 3FQUB 1KOAA 4P9MH 3K8LA 3HPJA 4CDHA 5ICXA 3SDDC 4POUB 3GSOA 4WFGE 2KDGA 4R0LB 2NY4C 4OZGE 1YEEH 4WENB 2YRLA 1DANU 4HWBH 4MJIE 4WU7B 1MREH 3VXUD 5IEKA 1KULA 4DTGL 2G2RA 3GKWH 3BPLC 3LRGA 1DL7L 4PJ5D 3FRPG 4X98A 3P9WB 3T0AA 3MRRB 3NFPB 5IGXH 5JW5A 3A6BL 4LCYB 4QY8A 1R3JB 4OV6F 3QEGL 4JHWL 3Q5TA 2P8LB 3WLBB 3F7VB 3WXWH 3QCUH 4MA1C 1LEIB 2DBJA 1U8MB 2XPGB 1OAXL 4X7EC 4JO2H 3GK8L 1ZLSL 2JLLA 3MRNB 1KGCD 2XI9A 5DK0B 4JQVA 3L5JA 3ECBA 3EYFA 3KPPA 4WI7A 1KFAL 5B39G 3ZE1E 3MNVB 3EOTL 4FRWA 4LAQL 3ZDZE 3HNVL 3QDGD 3SE8L 4XMLL 3LIZL 2Z93B 1ZLVK 3RDTC 1RY7B 2UUDH 3IFOB 4B0MM 1MWAA 4DN3L 1PKQA 1ZHNB 4L5FL 2EEBA 5LGJB 2J88H 1FL6A 2F54E 4ZDHB 1DR9A 5TJWK 5DQJB 2QSCH 4OCYL 1BPVA 3MRGB 4KJYA 3FJTA 4S1SL 4MVBD 1LO0H 5ITBL 3UMTA 3ROOB 2V9TA 2Z31D 3K1DA 4NQDA 4TTDD 1SJEA 4NQTA 1KCSL 2W0PA 1AGCA 3O0RH 4L29A 1WJ3A 2BRRH 3QZWA 2D9QB 1MFAL 3EYQC 5HYEA 2V6HA 5HI3C 4FFWC 5IWLC 5HYSA 3PJSA 1YEJL 3PF2A 5AZEL 1NAML 5D7JC 5HHQB 1FNSL 4GW5A 1RZIB 4OCXH 3QIWB 4LGRB 1WTGT 4HPYL 4BZ2L 4UT9H 2EYSB 1IEAB 4NJ9L 4OLXL 4IMLA 5C0AA 3VXRB 4KFZC 1X5HA 3T0EC 1TVHB 4UT6L 1BREA 2A83A 2R4SL 4Q9QH 1CE1H 4JM2D 2CUHA 3DRQB 4X7CC 2PYEB 3F58L 2XKUA 3HFML 5DJ2A 3IDJA 2K7PA 4TUJA 4PJAA 5KTEL 2VZ1A 2VJXA 2BY3A 1QPPA 5DRZB 1FN4B 3NA9L 1WFOA 3B2VL 2HKHL 5IK3A 4LEXL 1VDGA 3UYPA 4DEPC 1KPVB 2GUOB 4HS8L 4ONGL 1EVUA 3K2UL 1IAOA 3CDCA 3DVFA 3D39A 3PGDA 1I8IA 4M4PA 3JXAA 4KVNH 4ZUUA 5IB4B 1LD9B 3VH8B 4AT6B 1NGXB 2E9BA 2OMBA 2W1NA 5FHBL 1T04B 3DPBA 4OZFA 1TJIL 5EOQH 3SDAA 2HJLB 4FQ1H 1PW3A 1P7QA 3BO8B 3UTTE 5DK3A 5T3ZL 1NGPH 4ETQA 5J6HB 4JZOA 2EDTA 5I9QC 3PWUB 4JGJA 1WZMA 5TE7H 3TJEL 2W0LA 4K3JH 3HE6C 3QNXA 4RZCB 3A6OA 5FCSH 5FUCC 4W4OC 2YA1A 2ED8A 3RL1A 1MRDH 3U4AA 4Q6IC 1UEMA 3CIQA 1R24A 3CZFB 5FYLL 5HGAA 4QT5A 3GJEA 4J6RH 1KSRA 4RRPA 1KN4L 1TJHL 3OQ3B 2RIKA 3GGWB 5GISL 1OPGH 4UV4H 3PIQB 5J13C 2RQ8A 4NN5C 1J0IA 1F4XL 5CSZB 4HKXB 5F3HA 1K4CA 1ND0B 4PJBF 4XNQB 5I71B 5E8PA 5FGSA 4L9DA 5CS7A 5F7DB 4NDMA 3LV3B 3DI2B 3O6LH 3NFSL 1OAYH 5DK2B 1H3PH 2R2HB 1YUHA 1DSFH 3N1GC 3GSVB 4WWKD 1H0DB 4LDOB 4WUKL 2VWEE 2PTVA 4JN2A 2IAMC 2NQCA 3HZYA 1T3FA 2R1XB 4WTXA 1AC0A 3T0WA 1EHLL 1RUAH 3PWNB 4Y16A 3RIAF 2X4QA 3WFDH 3GSXB 4JFFE 3SJVE 4LNVA 3VGFA 1PVHA 4UUJB 2DRUA 4LSDA 4G8EA 2AGJL 5ABDE 3D3VA 4K2UL 5EUOF 3MRCB 1BVZA 2FD6L 3H9ZA 4PREA 1P1ZA 4G80B 5EU6E 1IC1A 1JL8A 5ESVB 2EH8H 1XGQA 1CU4L 2YPVL 3ARPA 2BNUB 4OM1L 2B4CH 3MLTB 4PTUA 5TGBA 3GI9L 3VXQB 3RKDD 4D9QD 3KWWB 3S35X 4IOFC 3L3OA 1QRKA 1U8QB 3I50L 2ICWJ 1JN6A 4TUKH 1BD2A 2JB5L 4XNUL 3QZWG 1CL7I 2H32H 1MCQA 3GEWB 5GGRB 2A6DB 2IBGA 1VFMA 1ZT4B 2ESVB 1UACL 2XFXB 5HYSG 4J7RA 3QO0B 1BQLH 1UJ3C 3INUH 1QZ1A 4XWOC 2YN3A 1U42A 3SDDA 5JPNB 2VLLB 4OI8A 1WWAX 4HZAA 1RUKH 1RZ7H 5KVDH 5H2BB 2PO6D 5SV3A 4M8QB 2DWDB 3L5WA 1U8PB 4OCMC 4R97C 3BZ4B 1NCCH 4DAGH 5IB3A 4JGMA 5DJDB 5HYQB 1G0YR 5LCVH 1MRFL 3HAEA 4WWID 5DRWB 3LEYL 4N1EA 5MERB 4QXGL 2P8MA 3S7GA 4D9LL 2BCKB 4FFYH 1W72B 4LGPB 1DZBA 1JUFB 1U8HA 5F7NC 5BZWB 4NWUL 3ULUC 3AS0A 1EUUA 1GL4B 2R0LH 3G6DH 2NW2B 4U1JA 4HWEH 1TZHB 4G6AD 3BKMH 5EZOL 2GCYA 2ADGB 5DHXB 1KELL 2DQEL 2LTQB 5E5MA 3W39A 4KK8C 3RDTA 4OZFG 2IBBA 3NCFB 1UA6H 1EEYA 3FQRB 1T0NA 5KSVB 4PRAB 5DHVB 1PG7X 4N8VB 1HHHA 4MXWH 2QLVB 4KTDH 2F8XC 5IB2A 1MQ8A 1N6QH 5L2KB 2DQDH 2GFBA 1EZVX 3RWDA 4WCYH 4L4TD 3QQ3B 5D2LE 4DKAA 2VISA 4EI5D 1T0PB 4PBXA 5ILTH 5DD0H 1QNZL 1NEZA 3JV4B 3L5IA 4TRPL 5D6DC 3PWLA 1LK2A 2Q7YB 4RRPG 3MV9A 4Y19E 2NY3C 4EDWH 1YEHH 1JZ2A 5IWLA 3GSNH 1IGTA 1NMBL 2NTFA 43C9A 4PG2C 5D7JA 5EBLB 2ARWA 2ZSWA 4PGCA 1U95A 3VI3F 2DL2A 2LV4A 1FGNH 3T0EA 4WNQA 4LK4A 1T4KB 5I8CB 4JB9L 4DGIL 3I6KA 3QNYB 1IKFH 5C6PB 2NY7H 4YXKL 4Z0BL 3EHBC 4NBXB 4D0BA 1UZ6F 2ATKA 2Q8BL 4G6KH 3BW9A 5J9PB 4YO0A 4YDLB 2AV1B 1KC5L 5HI4C 1QP1A 3ELAT 4PUBL 4BJLA 4IHOA 4M61A 1BIIB 3MRDB 4JAMB 5I18H 4WFGD 3VGAC 4GO6B 2DTML 2ZUQB 3VXMB 5FUOL 1OW0C 4JKWA 1MCEA 3QEQB 4KI5C 4U1IA 1EAPA 1TZGH 2XQYK 2FECL 1UYWH 1MCPH 3WE6B 5EOTA 1XF3B 1N8ZB 2CRYA 4UI2A 5A3IC 5IM7A 4BK5A 1ZANL 3BPCB 4Q58C 4R4BA 3V7AE 1T6VN 1AI1H 2XY1A 4G9FB 1BLNA 4Z78A 1NBYB 4P2QE 4B41A 3QJHB 1XAUA 2XA8L 4OCWH 5IJVA 1NLBH 4KGJA 4M6NL 2APXA 4F33A 2FR4A 2QADD 5D72L 3HE6A 4Z7VF 5ID1A 5D1QC 3RA7L 1NAKL 4J3WA 1CICB 4W4OA 4Q6IA 2NW3A 3RNQA 2E7CA 3IDYB 3LAFA 3WS3B 2Q87A 2ZJSH 2ADJB 1LEKB 4GW4B 2B20A 1I1FA 1OLLA 5IESL 1HQRA 5E2JA 1MHEA 2J5LC 4P4KC 1CWVA 2A6JB 2F54D 1XCTB 3OF6A 2D4DA 4NCDA 1JPTH 3UPRB 3W0WB 1DLHB 4HPOH 4N0YH 1R3IH 1MI5B 3RUGF 1MLBB 3O3EB 2R0ZH 3F7PC 4XX1E 1QBMH 3QEHA 3QI9D 2IQAA 3UTQB 1T7XA 4Z5RB 2JIXA 4CADB 4TQEL 2H2PD 3AM8C 2Y9RT 3CXHK 1FZKB 3BN9D 4HULB 3O8XC 4ETYA 4PGZA 5KG9A 4KJQD 2IAMA 5D6CA 4CDGC 3ZSSA 1GC1C 1VFOA 5DVKA 3DX8A 4Y4KD 3E8UH 1MHPH 2CIKB 1A7QH 3S5LB 5J0BA 3L6FB 4PJHB 4NHUA 3MR9A 2NX5B 4Z95L 4NQXB 4KDTC 1C1EL 4OFIA 1SJHB 4MCZA 4WFFE 2CJUL 1IQWL 3JWNC 5T1KA 3MYJB 5ENWB 1MFDL 2OTUB 4A6YA 3RVXD 2YBRA 2KL6A 1NCDL 4K9EL 3X3FH 4S1QH 3SDCC 2ZUTA 4CMHC 4UIMB 1A7BA 1YEDA 2B1AH 4R9HA 4R90L 1XH3B 3DYOA 2IBZY 4PJXB 4I3SH 4ODTL 2YC1B 3IKCA 4I3RH 4X5LA 4Q0XL 4H5SB 1WSST 5IT2H 3RI5K 3STLA 3QWRD 2H1PH 1NC4B 3G08B 2H26A 3U30B 3HUJB 1AXIB 4LPTA 3D25A 3B8SA 4JJ5A 1NEZG 5ESAB 4Z7WB 4OUUB 1J10A 3C2SA 3JVGC 1B6DA 3QUZC 4M48L 1T7ZA 4MXVF 2XXMB 3IDGA 5L7XH 3AS1A 1A3LL 1SY6L 1UJ3A 3TF7C 4D0DB 4JHZA 5F96H 4ENED 4MLIA 4XP6H 3VXOA 4Y5XC 1P5UA 4HLJA 3Q3GA 2ID5A 2Q8AL 4XH2B 1FE8L 1PEWA 4JPVH 1T22A 5C0BD 4XMPH 5DJXB 1I1AC 2IG2L 4N8VG 3ZL4H 2EDXA 1YJDH 3UTTD 4UIKL 1HK6A 2J8UB 5LXGL 3H0TB 4HUNB 3V6ZA 1QLEL 3CX5J 2EE2A 4U1KB 3AXLB 2FGWH 1JP5A 5JNYB 1C5DB 4RBPH 4XZUA 4I18C 4C55A 2VH5H 1NCTA 5E8EB 4LSPH 4P2OC 2Y25A 1IGML 2J8HA 1MIML 2VLKE 1JCKA 1E27B 2VC2H 3FOLA 4JVWA 5K33A 2FH8A 3VFGL 4Y4HD 4FXGB 1ZA3B 4JJHA 4NYLA 1K4DA 2EC9T 3BH8B 3DURB 1XZ0A 5C08A 1Q9OB 1OTTD 4HUUA 4XP9H 2JKXA 1GPOH 3VWJC 5DS8B 5EU5A 1AIFA 4F2MB 3Q6FB 3TNNA 1F8TL 1RURL 2W9DL 2AEIT 1PY9A 4O02L 4U3XA 4FQLH 4LPYA 3PDGA 3EW3B 4JFDB 5CGMA 5DJ0B 5E6ZA 4HMCA 4JN1L 3H42L 2VXTH 3QPQC 4L8DB 5IQ7H 4KMQA 1BX2A 1OGAA 5E8OB 3MJ6A 1B0RA 2CLRA 3TH2T 5CP7B 5HDQH 1KENH 4JFFD 5B3JE 3EBAA 1C16A 4KV5F 5D6DA 4YHML 4RIRB 2W0FA 4P5MB 2A0LD 3MC0A 1GZPA 3VGEA 1E4KA 1IQDA 5ID0B 2W9EL 1CGSL 4PB9L 3ARSA 4PG2A 2VRAA 1BVLA 4FQCL 4OM0H 2O26U 5GIRB 1PEZA 1JPFA 4MGXA 3MCLH 4ZMAT 2W07A 2VDKL 2RJMA 4PB0H 4YAQA 1A4JA 1NCWH 5DUML 1R3HA 4DVBB 3MJ9A 2OTWA 1KEMH 5F6IC 4C56A 3QDMB 2A73A 3DUHA 3VXSE 2EYRA 4TOYH 3TJHD 2PXYB 5HHOB 2HKFH 4X9HA 2FJFB 3BP4A 5CFHA 2D03H 2GJZB 5CP3H 4HX1A 1UXSB 5FUZH 2I5YH 3FFDA 4FZ8H 4NZTH 3R1GH 1T5XA 2OR7A 1NLDL 2IPTL 1NCAL 2WQRA 3G5XB 4R7DB 1HHIB 5TE4L 3B6SA 4YHPA 1J5OH 3I75A 2NLJA 32C2A 3ZT7A 1OW0A 5DC9B 1XCQB 3IGAA 2EO1A 2F53A 4GUPA 3DX9B 1NDGA 1J8KA 1CF8L 3O4LB 4O2EB 3LZFL 2X4OB 3W11C 1PAMA 4LCWD 3ZKMD 1YMHB 1ZEAL 4OIBA 2X9YA 1FL3A 3FT4A 4P3CL 3EGSB 2RGSA 3UTOA 3SY0A 1ONQB 1NBZA 3CSBA 3PQYB 4XHJD 1F11A 2CLZB 3H3PL 1OP9A 4H25B 4KRPC 3CPLA 3GI8H 2I26N 4LCCC 3H9SA 4PP1C 4Z7UA 4AH2A 3EDKA 5JPMB 4PRDA 5T5FH 2VZTA 1TQCC 5D1QA 5IMMA 2OR9L 3L7FB 1J05A 2V9QA 5A40E 4TULH 1KN2L 3FONB 1RIUH 1S7TB 1IAKA 3OV6A 5EPMA 4ZSOA 8CGTA 1K3ZA 3S3SA 4LKCB 3MLUL 5C0GA 1NUDA 3CK0H 1RZJL 4NZUH 1HIMH 4Z8FH 1F45A 4NO0B 2VIRA 1MCIA 1F4WH 3T0VA 1A1MA 4P4KA 2PN5A 2CRZA 3MV8B 4N0CC 3T8XB 1LE5A 4AEIL 3FRUA 4NC1C 4N0RA 4XCYB 1YQVL 3ZDXF 1ZV5A 3TFKC 1S9XB 3MJ7A 1AR1D 1MVUA 1NGWA 3HZMA 4Z0XA 3EKCA 4BQ8A 2OMNA 3AM8A 4NFBA 1LO3L 2Y07L 1QVOA 3BOVA 4OZHA 3O8XA 4PJ9B 4PJFA 1BHGA 5JUEL 5FA3A 5T3XE 1K8IA 1N26A 1LDSA 1UM4H 4I0KA 5CUSL 3WEXA 1XR9B 4M1GH 3JWDL 3IYLW 5J7CC 2FBJL 4CW1B 4MMZC 2DQHL 4M62H 1BFOB 4KDTA 5CZKA 3VXPB 4O9HH 5FK9A 4M7LH 1GHFL 3LKNA 5HVFB 3HCVA 1J1OL 3U4BL 3UJJL 3OX8B 1MCNA 4MNQB 2VQUA 2I60H 1AH1A 1A22B 4I4WB 3EYVA 4XPTL 5EBMB 3RPIA 1TVBA 5JW4Q 3PP3K 2QL1A 3CFKA 4YFDB 3SDCA 1OD9A 1Z5LA 4P23C 3RVVD 2X7LA 4LL9A 5FO9A 1EGJH 1MFBH 4ZO6A 2IF7A 1T1WB 1KIPB 1NGZA 1DQDL 1ZMYA 4W68A 2P5WA 4LVNB 4H20L 5GGSB 1MFEH 4XCNB 35C8L 4PJGF 4NFCA 4MLSA 4MA3A 5HJ3B 1WAAF 3QUZA 5I1LB 2BDNH 2Q86B 1I8LC 3MV7D 4PTTA 4Y4FB 1UFUA 4FTVE 2BY2A 1BBDL 2BK8A 4PGEA 4L3EB 4M6MH 3H7LA 2EE3A 4ZUVA 3S88H 3PWPE 5IB1A 4LU5H 4NPYA 3BEWA 4OD3L 4NHCH 4OSUL 3TVMD 2XQBH 4Y5XA 2DLFL 3EYSH 3S96B 5JZ7C 4F37F 3DX7B 4JRYB 3H7BA 1KYOJ 5L9DH 2MHAB 1PFCA 3U9PH 4ZTOL 1I1AA 5BS0B 1T1XA 3IDXL 4MD5B 1YEFL 1EV2E 1X5YA 5E8NB 2XWTB 2OL3B 3MCG1 2ARJB 4WW2F 1K9TA 3RZCC 2OP4L 4KI1A 4I18A 1I9RL 1UEYA 4M00A 4P2OA 3VGBA 1W72L 3LEXA 2E6PA 4GAGH 4N9OB 4PGBB 4GBXC 1YMMD 5D2NE 5KW9H 4EEEA 1OB1A 4BQBA 1I4FA 1PJ9A 4CVXA 2MPAH 4IJ3C 4FFZL 3BDYL 3NIFE 1INQB 3T08A 3OKEA 1G7QA 4ZS6C 3VWJA 4RGMB 3UJIL 3S37L 3QHFH 5ANME 1BWMA 1FGVL 4E41A 4KAQL 4CUCA 2EECA 4MAYB 3IU4L 3CD4A 4BK4A 4DFHA 5D71H 3QCVL 1CDBA 4F8QA 4O4YL 1GZQA 3O11A 1P2CA 2AJVH 4WI5A 1MJ8H 1DUYB 1HINH 2CK0L 1O0VA 4M93B 1LO2L 4ISVB 3WIHL 5CKGA 4KJWC 2O5XL 5C0ND 3QFJE 4F15B 5A2LH 3BRDA 3CSPA 4GKSB 2CQVA 5F7EL 3NIDF 4YC2C 1FVCB 1A6VH 3MPCA 2VXVH 1P7KB 4JG0L 1U3HB 1V5JA 3R06A 1CLZL 2GW5A 2YPLA 4WU5A 1IBGL 3KPTA 4XCEA 3E3QE 2VLRB 1FL5A 1NFDE 5SWSB 2DYPB 1OM3L 5M7QA 3NMEA 4X8JB 3OKOA 1P6AB 4ZS7H 4WI2A 3VFUB 5KSUB 1UQSB 3GMNA 3HC3H 5MENB 1S3KL 5HI5D 5BOZG 1MLCA 1X5AA 2XTJB 4Y1AA 4PJ7F 5FXCH 1PYWB 5GRXG 5C07B 3BPOC 2QR0A 3EIFA 1U41A 3WBDA 2X4SA 4GS7C 3AMKA 4ZOBA 3P9MB 4ZFFB 5TF1L 3LKPB 1XIWB 3V0AC 5IW6B 1IC4L 3BXNB 1SVCP 4DQOL 2WUBL 2CKBB 2Z4QB 5E6IB 2XKNA 1FNHA 3BKJH 4P46D 4PPTA 1QQDB 5H37H 1H5BB 2BY0A 1D5BA 5HHPB 2E9JA 2WM0A 4QTHA 4MVBC 4XRCB 5AAMA 1AO7E 1JI2A 2N7BA 4GXVH 4XPFL 2Z31C 1ES0A 3U83A 1A7PL 3MFFA 4TTDC 5I1HH 5T33L 1S7SA 2HFFB 1PG7W 3KPSE 5HGBB 3PDOB 2A6KA 1UCBL 2NXYB 4W6XB 4B53A 4HUVA 1B0GA 3MODL 1XGRA 2XOTA 2ZOLA 2HTKC 3JV0A 4NCC2 2LFGA 3TT3L 4HIXL 1KCRL 3MLZL 4ZUWB 4JHAL 4AQOA 1FZOA 1S9YB 5CKAA 1RU9L 4NZRL 1KBGL 3OHXB 1EHAA 1O5DT 5E6YA 3NAAL 4V2BA 1CFTA 5E9DB 3E6HB 1T21B 4NNXA 4UB0H 2IMMA 3R0MA 4XNMB 1NMAH 4LCCA 3O3AB 1ODAA 2D0GA 1FSKC 5DF0A 4GRMB 3P4MB 5I8KH 1PSKL 5C0CA 4RFEB 4YUEL 4NZJA 1N2RA 2X4UB 4GW1A 2NMSA 3T77B 4LLYB 1OTUD 4BZYA 2Z9TA 4QCIA 4JR9L 4K71C 3M8OL 5IR1B 2H41A 1WEJL 1DQJA 4EBQL 4G7VL 3K46A 1BAFH 4Z76B 3ZKXC 43CAA 4Z7OE 5C8JB 1A7OH 4KMTH 2DD8H 2AEPL 1SM3H 5GS0D 3B8YA 2D7TL 2WINA 4XNXL 5IVXF 2E6QA 3KPRA 4MNGB 4BQ6A 2AXFA 4JRXA 1BEYH 3T3PF 5T5NG 1S7QB 4UOW1 3LSOB 3MO1A 3EOBB 4CMMA 5HGGS 1LEGB 3GMLA 1MQKH 1JK8A 1MJJA 1RHHB 5BW7C 3W81A 4TNVF 3FT2A 1M71B 1QO3B 4UINH 3QDAA 4QRTA 2CDEB 1U2CA 1AY1L 1HHJA 3VCLB 2AKRA 3IVKB 2AJYL 3OXSA 4XWGL 4HW6A 3MRJA 3VG0H 1WIUA 2YUZA 3IRZA 5GRYA 4IBLT 3C5SA 3O3BA 5I1KH 4M3KB 4TVSa 3N06B 5F89B 3ECBB 3EYFB 3KPPB 5GSVA 4NO2B 1JPGA 3PL6D 3O2VH 2ZNWA 2VLJB 5EBWB 3QIUB 3KYMA 4P23A 1IFHL 1GOGA 2B4CC 2BXYA 1JPSH 1PKQB 3VXSD 5GS0H 4LLVA 5JIHA 4YDVB 4KTEH 3OKMA 3MGOA 3O2DA 4JM4L 1A9EA 5A16A 3G5YA 5J6GA 3QIBD 1KG0A 4J3SA 5EU7E 1OAQH 1A2YA 2BFVH 4XGZB 3U9UA 4P2RA 4F58H 3LKQA 4N0FA 5FAAA 4YQXL 4WWKC 1I8KB 2Y4SA 1FAIL 3PABA 1AGCB 2F58L 4YHZL 1JNHA 3HMXH 3QDJA 5MHSE 3DGGA 2P4AB 3MRMB 3WDIA 4AYFA 3SCMC 5F9JA 2WANA 2PW1A 1NANH 3ISWA 3QAZC 1HH6B 4PJCB 4N68A 1A02N 1QSED 3MJ8B 3L9RA 3OJDA 4HWBA 3EO1A 1Z3GH 3L3GA 2EDNA 3CCHB 3ULVE 1S7RB 4Z7NE 3JV6A 4LVOB 4ONFL 5DDHA 1FG2A 2QSVA 5KS9E 1DL7H 5E2WH 2OLDA 3RZCA 5AEAA 4BSVA 2FATL 4G9DA 5HHNA 3A6BH 3THMH 3CFJA