3QUHA

Structure of heme transport protein isdh-neat3 from s. aureus in complex with manganese(iii)-porphyrin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
112
structure length
112
Chain Sequence
LTDLQEAHFVVFESEENSESVMDGFVEHPFYTATLNGQKYVVMKTKDDSYWKDLIVEGKRVTTVSKDPKNNSRTLIFPYIPDKAVYNAIVKVVVANIGYEGQYHVRIINQDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Iron-regulated surface determinant protein H
publication title Molecular basis of recognition of antibacterial porphyrins by heme-transporter IsdH-NEAT3 of Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Heme-binding protein
total genus 24
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3quhA00
4YMPA 3VUAA 3QZNA 4FC3E 2H3KA 2MOQA 3RURA 4NLAA 4H8QA 3SZKC 3QUGA 2O1AA 3RTLA 2K78A 3QUHA 2ITFA 4WJG3 5D1XE 3QZLA 4MYPA 3OVUB 2Z6FA 3S48A 2E7DA 3VTMA 4H8PA 5D1ZI 5D1QE 3SZ6A 3QZMA 3QZPA 3SIKA 2Q7AA 2ITEA 2O6PA 3QZOA
chains in the Genus database with same CATH superfamily
1GYVA 4TLUA 2DD8L 2O5XH 4JO1L 4RH4A 4P99A 5DJZA 4X5XB 1IL1A 3CMGA 3N06B 5MEOA 3IKKA 4AUJA 4K2UH 2GK2A 3S4SB 1GOHA 1O7VA 1UENA 1J86A 1TCRA 2OMUB 3OXSA 4RMUA 5D9SA 3TWYA 3WELA 4HC1H 3US0A 1P9MA 4HZAA 5E2WH 4XN1A 4MZ3A 5EU4B 3WOVA 2Z31D 3BUYA 5BRPA 4YN3A 2VLKE 4PRBA 4GW1A 4ZAKA 3T2OA 1HDMA 3S2AA 1PCXA 4WWKC 4K5MA 3V6ZB 4NPYB 3KS0H 1QVOA 5CN1A 3HPJB 4UOZA 1QSFD 2DQHH 2ESVB 3C2AL 4MA1B 4WFFD 4O02L 1T0OA 3QRBA 3SDDD 2J2ZA 2BP0B 3QUMH 4Q9QL 2E47A 4PJXF 5I71B 4CADA 5CGBA 4KY1H 1TZGL 4PJDA 4Z7UA 5EZIH 1FYTD 3TBTA 4E9XA 3WY4A 3RFZC 1PQZA 2FT7A 4P2CG 1IZKA 4U05A 2GJZA 1U30A 3MNVB 4G43B 1T1WB 3CZFB 5EU6E 3DIFB 4WEBL 1HC1A 5F7MC 1EBAA 3FU3A 5ESQA 1EFXB 3A47A 3B7RL 3AMKA 5EMYA 3ZT5A 1IAOA 5EDSA 2EDWA 4UIMA 5B4MC 3MRLA 4FFWC 4XR8C 1FFQA 1E4JA 2UZXB 3CCHA 4FA6A 4MXQC 2CJ3A 3DGDA 4HUCA 3VI3F 4IRSD 1WIPA 1ZEAL 1SUJA 1DTUA 15C8L 4GSUA 5TQ0H 3L1GA 4QO1A 3DBXA 3SDCD 2C9AA 1T1XB 2AXJA 4QRRB 2BY0A 4YWGH 4PG2A 3GS7A 4DW2H 3CFCH 3P54A 4KBPA 5GGTH 4F9PA 1KB9K 3PP4L 4JB9H 4PJXE 4L8DB 1KFAH 1A7NL 2DMCA 3C5ZB 5KN5B 4MSWB 3W0WB 3NRPA 1MZYA 5I74B 5DMYA 3STBA 2ZWYA 1A9BA 3LHPH 4OZGB 1GOFA 1EJOL 1JPST 1S9YA 2QQKL 2VLLA 4FNUA 3L3GB 5F7WC 3C6SB 5AD0B 1MQKL 2WQ8A 3Q9PA 4K94H 5EEZA 2QL1A 3C5JB 5TE6H 3QORB 4LKCB 2X4QA 5IT2L 1MNUH 2AJYL 4NN6B 1RZFH 2E4FA 3DSNB 1SJMA 3C6LD 3LXBA 3QIUA 5KEZA 1MWAA 2JKSA 5IHUL 1FL5B 4GXFA 2ROYA 3T4AB 2A99A 3VI3E 3D18B 5KSAC 2UWEF 2BHFA 3MRKB 3X12A 4OV5A 1SEQL 2HMID 2I5YL 3CSTA 2J44A 1PSKL 4BCXA 3CHXA 3IXAB 3CZGA 3VSVA 1UZ6F 5KSBA 1LWHA 3VFTB 3MRPB 5I16A 3RWCA 1A3RL 2H6OA 2APWA 2YGOA 1JMZA 4XAKD 5T3ZL 2VJ0A 3IB4A 3R0MA 5KBKA 1FGNL 1JPFB 4LLQA 4NRZB 1N67A 3PHAA 1W72A 3O8XC 2V9QA 1CBJA 2VQ1A 3ARRA 3KYMB 4M5TA 5ADOH 1G4RA 1TZIB 1ASQA 3V4VA 2Y1AA 2D03L 3EO1A 3NIDF 2F9BT 3D6GA 5EDXA 4QHUB 3S8GB 1OGTA 5EIIB 2GG1A 2F58H 4O51B 4JN2B 3DROA 1FL3A 1Y1DA 1RZ8A 2JXMB 5D6DA 2UWEE 5DLMH 2F7OA 3PYCA 2O6DA 1UD4A 1LEGB 3QDMD 1RIVL 1UZ6E 4AOFA 4R7LA 3D39D 5FB8B 4PJEB 2JKLA 2P43B 1U8QA 1ZVSB 5DUMH 2EXYD 5IF0A 3UXFA 3LV3A 4G6FB 3BHBA 5ISZD 4P5RA 4EPSA 3P2TA 3NEXA 2DM7A 4C83B 3W5NA 2QVIA 2JKXA 3PIQA 4FX5A 3JWNE 1MLBA 4GAAA 1CYWA 5F88A 5GZNC 2DMGA 1RJLB 2Q10A 2EH7L 4ONHA 2PYEA 1OP9A 3U4KA 3RUGA 4IOSD 4GRLC 3NIDE 4J2XA 4HKXB 1TMQA 2A0LC 1Q8MA 5CCHE 4ZO8A 2AEWA 4X5PA 3VWKA 3Q6FA 2A9MH 3CQQA 3GRBA 2H2SD 1E4WH 2RGSA 1HU8A 2IBGA 5G5DA 1TUPA 1NWPA 2FNWA 5C71A 1IC7H 2J1WA 3OJDB 3KPLA 3EKCA 3FU5A 4DTGH 1LO4H 5GISL 2FRGP 4UIKH 2RD0A 3VDCA 2CLVB 4BGLA 1P4IL 4P2RD 1SUHA 1BBDL 2Q76A 3MRIA 1OP4A 5D7IA 2YD1A 5AUMB 1K4DA 4Y4FA 5HJGA 4HS8L 2CBQA 3JWOH 3WTXA 2ZWSA 1MFCH 5LQBH 1REIA 4FJZA 3NQKA 4OZ4B 3VG0H 1F4YL 1QFWL 2WVVA 5T1MA 3CXDH 4NHUB 4YAQA 3O3EB 5CCJA 2NXYB 1W72L 1X9QA 1YEWA 1B6DA 5IW3A 1A2YB 3UAJC 4X8JB 1CG9A 3VWJC 3ET9F 3RIKA 4NFDA 3BWUF 1E9PA 4KITB 4U3XA 3V4VL 2CLRB 3ESNA 1WGOA 3JV4A 2R0WL 3MBXL 3MRJA 3QJZA 3W11D 3VD3A 4E9RA 1OQXA 1GJIA 4ODVL 1U8NA 5I0DA 1ZIAA 2MKLC 3GRWA 3RDTB 3ZHNA 1RUKL 3KE0A 4PGBA 1E5BA 5AB0A 2DQJH 3TCLB 4PJAA 1W2KT 2M1KA 1L5GA 5EBGA 4FRWA 3MJ8A 4R5TA 1H9VA 2ITFA 3MLUH 5MEQB 1AO7E 4HFUH 1L0XA 1CUOA 3APDA 3R4DA 4JN1L 1JGLL 4WKZA 2OYPA 3AG2B 4Y4KC 4DO5A 4OZGF 1PIFA 3S34H 5A7EA 1IAKB 5CJQH 1EHXA 3RRQA 1VFOA 1X9LA 4HJ1A 1N70A 3ETBF 4MJHA 4QRQB 2NY5C 1HNFA 1MXDA 5BV7L 4KZEH 1OSZA 2B1HL 2OMXA 4HS6A 1BZDA 1HIMH 4AZ8A 4FQIL 3CLFL 1U58B 3NCYS 5D4IA 2W95A 3MFFA 1RK0A 4K9JA 2R0ZH 3SDAA 3E6FB 4L37A 5HDRA 3CDZB 4M4RA 4A7TA 4RRPA 3LKOB 4KI5D 1HNGA 1S7SA 3NA9L 1E8ZA 3M7FB 2ED8A 4JFYB 2PTTA 3V6OA 3KLHD 3BDXA 3U36A 3VXUE 1MFAL 3L4TA 2OX5A 4B97A 4CC4A 5EEVA 3D50A 3MUHL 4XX5A 5LO7A 2L3BA 3HUJB 5C09A 1X5XA 4GIPD 4NP4H 5DK2A 1F11A 3W0WE 2AV1A 4WFED 4F7KA 8FABB 4DGYL 4OZGE 4Q4EA 3QIBB 3UYRH 5C0FA 3VGHA 1QUNA 5IFHL 2EVJA 4RAHA 1ZVHA 5BS0B 4PGJA 4RGND 1L3NA 4S10A 3V5DA 2B5IC 3IAGC 4HT1H 1NLBH 3RPBA 2JJVA 4AENB 4MXWH 4L48A 1T0NA 1X7QA 3Q1SL 5G4NA 4OIBA 3VCLB 1A6TB 4LLYA 3MA7B 5DJ6B 1RFDL 2NY6D 2E27H 4LQFL 2HLEB 4NOBA 4G8AC 3TWCH 5L6YH 4PJEF 3WXVH 4F5CE 4TPRH 3GXIA 4HJEA 4EEEA 4Y4HA 3MUJA 3L48A 1LMIA 2X1OA 3TO4A 3RZCA 4HCGA 4HIEA 3HZYB 2ZSVB 4P9HH 3R06B 3NCJH 4NC0B 2ZKWA 3JZYA 1J0HA 4Z95L 5T3XH 3MODL 5KVEH 5I6MA 3GRWL 3FTYA 1RUAL 3OC8A 2Z9TA 4YEFA 4P0DA 3VXRA 1JZ8A 2HVBA 1IBGH 1CICB 3RL2A 3KXFE 5JOPE 5JQ6L 5B21A 5FWRA 3BPNB 3GXTA 4DUXA 2OQJB 3PV6A 3DMMB 4KO7A 4UM9D 2ICEC 3FTZA 3MBED 4D0BA 2DH3A 2VDNH 4O00A 4OZFG 4JRLA 3ZDZB 5A2JH 1O75A 1YJDH 4Q97A 4YPGB 1XMWA 1NGPL 2XN9E 5ICZA 4NBZB 5KVEE 2VXSH 4PJEE 2GSIA 5K9OA 1NCNA 4WFHE 5GRVK 3VDBA 3ZE0F 3RU8L 2F5AH 3GSVB 1U3YA 3F58L 4X0NA 1T6WA 2VJ8A 4PJIF 3KPSB 4I85A 5FO8B 1A3LL 2CZNA 4UAHA 4NNXB 2WVTA 4F2MB 2VZ1A 5JMOC 3AT8A 1KT2A 5JQHC 4IS6B 5T1DL 2VKWA 1EV2E 3GSWA 1MCPL 4B3EA 1KTRL 3H9HA 2X7LA 4JM2C 9PCYA 1G9EA 1TTFA 3BUPA 3FXIC 1VFMA 3QI9C 2X05A 6TAAA 3QQ3A 1SRDA 4PRID 3RTQC 1OARH 1A1MB 3T0XA 5IESL 4JQIH 1ZT7A 3EO0B 3T4YA 2W8CA 1YUHA 1K8DA 2A1WL 1PTZA 4MNGE 2X41A 3G04B 4NQUA 5TFSL 1SLUA 3VGAC 1JXFA 3SZ6A 5C97A 1TJIL 3BQVA 2PO6A 1W0WA 3ZE0E 4X4YB 2V2XB 5HVFB 2AJZB 4XX1E 5DRWA 3DETC 2P80D 1SYSB 4PJIE 3C75A 4KXAA 1KTCA 1G7QA 2YARA 2Q8AL 4HZLB 1Y18B 3WL9A 2E7LC 2CLZB 1CFNA 4Z3HA 3CDGA 4MB5A 2DM3A 2QGBA 5AVTB 5FKPB 2XZQH 1MHEB 1UM6H 4BUQA 5HYJE 5TDOB 1ITCA 3ROLB 2ZIDA 1XGRA 3TJEH 4I4WB 1BBJB 1TT6A 3SDYH 1I1FB 2XY2A 4JQVA 5D1QA 1RZPA 2DQEH 4WHTB 5CR8A 2F7IA 5EOQH 3HR6A 1MELA 5LDSA 1G7PA 1SDYA 1B9ZA 2XA8L 1S5HB 3MRBA 2IDUA 5C92A 2D8KA 4AEFA 2XZCH 4OZIB 2BIIA 2X9YA 1A7PL 4GXVL 2HLFD 1U95A 5DQJA 4I5BB 1OWRM 1X7TA 1KIUB 3GSOA 4LU5H 4BHUI 2FWSA 3HRZA 2A83A 4JY5H 3CZNA 4MAZA 1UZGA 3HBPA 2FLMA 5ENWA 4NGHH 2YAMA 3BZFB 1YMHA 3EHBB 4LLVB 2E8YA 2Z64C 4FEIA 2ZSWA 2V5YA 5L8JB 1QG3A 2PW2A 4QXWA 4XP6H 4JFFA 2ZKXA 4NZTH 4J3WA 2WQSA 3D05A 1WFMA 3OKMB 4APQA 3ML9A 4GQ9L 3BDYH 4OCXL 2Y6TE 3VXSB 3ECVA 4X5WB 5AYTA 3FO1B 4EI5D 3SE8H 2ADGB 4WK0B 1LEIB 2CDGB 3HW7A 4YHPB 4AJYV 2P5WA 3Q5OA 4OTXL 3NIFB 4HAGA 3BH9A 2CBMA 4YHOL 2H9GB 2X9XA 3IGAB 4A04A 2YEQA 4BH7B 1A02N 1IEHA 1D3CA 3DARA 4JM0A 3S8FB 2G3ZA 4JFEE 5IJBC 4IU3B 3FQ4A 4M03A 2FYVA 3BLPX 4GMSH 1A6PA 4F7MB 4JJ5B 5CINH 3OQ3B 1D7FA 1SVCP 4D94A 2LHAA 2OP4L 4MLSA 4O58H 1RZJL 1EGJH 4TNFA 5EBWB 2WINB 4ZFGH 1HQRA 4AK1A 1H15B 1NCHA 3G6AB 3ZYZA 1PFCA 4JO3L 4XB8A 3V5HA 4N26A 4J4PA 5GJSH 2BIOA 2VYRE 1MIEH 3ULVL 1E9OB 2YA2A 4ISVA 2R7EA 5K93A 4P9ML 5BS0E 4P5TB 3A6CH 1CMOA 3IDIA 3OZKA 4HWBA 1A1NA 2BS71 1ANUA 4HXAL 1IKFL 4LL1A 4N8CL 4CVXB 3GMPB 2FJSA 2BSTA 3GLEA 3QJFA 3TA4D 5I6NA 4X5RA 1XCQB 5DJ2A 3RNQB 3HLAB 3TVMA 5J13B 3BPCA 3FQNA 1U0QA 2OR9H 3E2HC 4FHBD 4ZXBD 5C9KA 4WW2A 1ED3B 2DYPD 1SJXA 4WTWA 5DJDB 1KBWA 5IVXF 2NX5E 2PWFA 4FQ1H 3ULUL 1V3LA 1PLCA 1YY8A 3CH1A 4R3SB 4K7PH 3OVUB 3P9LB 2WXNA 1L7IL 3HS9A 4LLMA 4ZPVB 2VC2H 3MXVL 5CEYA 5C7XH 4KX9A 4JHUA 4JZJA 3TBCA 3UX9B 4YDIH 4D0CB 5JA8B 1QRKA 1ECZA 3V5KB 3ARDC 2HVKA 3QPXH 4DNLA 4PIRF 1ZLDA 1O6SA 4G80B 4E5XB 4M43L 2DEYX 3O45B 1TVBB 4EI0A 3P4OB 3QFJD 2JCCA 1RVFH 1SLVA 5HGBA 2G0LA 4XO9A 4H1LB 3QUYB 3BT0A 1ILUA 3KPPA 4CNIA 2YBRB 3CWGA 5IVXE 5ICXA 3RWGA 3OKNA 2AK1L 1G0DA 2VGLM 4X9BA 1DQVA 4Y19B 4J27A 3WN5C 4ZUUB 5L9DH 1N5AB 3QA3B 3ZQ9A 5CKAA 2CHNA 3KPSE 4JFHE 4C55A 3IGLA 5DZVA 2OZNA 4G6MH 1UEMA 4F7TA 2NQ3A 2JKNA 2ITDA 1E27B 4ZFZA 1ZDQA 2XETA 3LS4L 1FFRA 1NAKL 3KW7A 3NJKA 4NQEB 4F2EA 3HA0A 1I1AD 2X4RB 2PETA 2BCMA 4CN6A 4CA4A 2ZXAA 4Y2LA 2APFA 1E8XA 2BINA 5I1LB 1ZXQA 1DVZA 1TIUA 4N3UA 2EILB 2V17H 4QYOA 3IJ9A 5INDB 3IRPX 5DFTA 3LH2H 3H9SB 3Q2LA 1JZIA 3C87A 2NY2C 4W9JC 1S6NA 4D0DA 4G7RB 3FFOA 4HDIA 3WHE0 4ES9A 5I8CB 4J6RL 2KKQA 1MREL 4JDVA 1QMUA 2CGRH 4DKDC 3GTTA 1DQLH 4OZIF 3ZIYA 2MCG1 5K69A 4OY9A 3O0RL 2NTSP 4M61A 5HHOA 5K9QG 1OAKL 2IXQA 2OTWA 3RX5A 4LSPL 2JB5H 3VYPA 1HOEA 2Y1VA 4CBZA 1PNCA 1QRNE 4A2FA 4U1LB 1HZHL 1Q72H 1KYAA 3ZKND 5E94A 2G30A 4FG2A 4L8SB 4UOW1 1L0PA 1TR7A 2NQDA 4R8WL 2HT3C 2HA1A 2Z7YA 1FI8C 5EO9B 3ZDXF 3MGOA 3TA3B 1EXHA 1U3ZA 1A64A 3IFLH 3PWUA 3NIFF 2NNXA 4YDLB 3F04A 3SBWA 1MFDH 1J5DA 4NENA 1LLAA 4PP2A 4OZIE 1IVTA 5AOMA 4G1EA 3P69A 4IOIA 3DIDA 3S6CA 2A9NL 3U2IA 1MXGA 1DQDL 1LP9B 1VEOA 2PTVA 5HY9A 5A2AA 3RVUC 1WD9A 1R4XA 4HMCA 3ESPA 3RI5K 4EI6A 4HISA 2X40A 4UM8A 1U8LA 2KQNA 1CIDA 3F62A 1AMYA 1ET7A 3GIVB 4Z77A 1MRDH 5SWZB 3B9KD 4BBWA 1NICA 2FSDA 4IRSC 4YGAB 3A6BH 4L9DA 1EO7A 4FOMA 1UJ3A 3K6DA 4ANUA 1BD2E 3SDCC 4ODUB 2WAHA 3ZDXE 4XPFH 5IMMB 1K72A 3NACH 1BVLA 2PNDA 5FO7B 2QQLL 3GXMA 1ACCA 4BRJA 4UI2A 3GNML 3MV8B 2HVJA 4YDZA 1J0IA 4I2XB 3NIFE 2VN6A 1CL7I 2Y4SA 5F3HA 3RWEA 4AM0B 5CGYC 1IT9L 1NBZB 4GLRI 1FN4A 5E9DD 4NCC1 1AGBB 1D7CA 1W8NA 4OD2A 1MW3A 1MAKA 1G9NC 4P49A 4GUOA 5E5MB 4F7CA 2H1PH 2BOBA 4ODSH 1S7WB 1X7SA 5F9AC 3EOAB 2AQ2A 3ZZLA 2WTRA 5DLLA 2R1XA 1EO8H 4PY7B 1J1OH 2VERN 2HMIC 3BISA 3JWNG 4J3UA 4HG4J 4RFEA 2BNQE 2H0PA 4TKWA 2YAPA 5EZJB 4GMTL 4ABVA 1DQKA 4QRPE 2WLZA 3M8OL 2HWZL 1PKQA 3UTSA 3S5YA 4Q9RL 1N64L 1TNMA 2H2PD 3CHPA 4PLNC 1NCBL 4M1CC 3FTGA 3EJZD 1UA6L 4X4KA 5EUKA 3DJ9A 3WNIA 4Y0GA 5IQ9B 2KQMA 2ZUTA 3G6JF 1IGCL 3ISWA 4C8XA 4OCWH 4XN2A 5HHVH 4KZDL 2Z65C 2ILLA 4G42B 4YL9A 4I9WE 2HAZA 2EZ0D 5D5MB 5JHDB 4N0UA 2JJWA 1NIAA 2ZYIA 4BH8B 3NFPB 5I0YA 2K4AA 4OSUL 1UA3A 4QHNB 3GS0A 1TOXA 4Y2DA 2VLME 2F53A 4N24A 5KG9B 3GSUB 4M6NH 1LDPH 4XMZA 3K6SB 2EXYC 3DVFA 5C0BA 3DJTA 2K78A 4DJMA 5C0RL 2PF6A 4GS7C 1KGWA 2WXJA 3BT2H 3BIBX 4X6EA 2E8ZA 3OAUH 2E7BA 4TN9A 3NK4A 5GS1C 5T3ZD 5IG7A 4JPKL 4DP1X 3II2A 5AAMC 1YEIL 3TOPA 1WZ1L 2DQGH 4JL2A 5DZ9A 3G6JE 3BVDB 4AYID 3VFWA 3LNEA 1HQ4B 4ZAKD 2Z91A 1F3JA 1TYEB 4PJ5E 4OUUA 4R0LB 2EVHA 1RCYA 3FRPB 3PWNA 4MD5A 2H2SC 4Y19E 5D1XB 4OJDH 1KJ2A 2OCCB 1NEZB 2ZOLB 3NA4A 3OKLB 3IRZA 1HVXA 5D70H 3T77A 4IRZA 3E8UH 2VN3A 1CDGA 3HHSB 1JPGB 4PY8J 1YQVL 1Q1JL 5C0EA 4PRPA 5B7MA 1HXYB 3AWGA 5JORB 3ME0B 3QARA 1ES0B 5E0QA 5KJ4A 4PGEA 3LS5H 2JK5B 3MOBH 3B5HA 4LB8A 4NQQA 3ZSTA 3H9SE 3CZEA 2VE6A 3MU3A 3B56A 1KBKA 1RK1A 3O2WH 4H44C 3MCKB 5CSZA 1NFIA 1XH0A 3EYOB 3MCLL 3NG5A 2PYFA 4BQ6A 5FFGA 3OB8A 1U92B 5D93B 3GMMB 5FO9B 3F84A 4OLYL 1S8DB 1MEXH 5A7BA 4OCLC 1R17A 4N1HB 4P57A 3MZGB 2Z8WC 1LP9F 1FAIL 3RE0A 3MRRA 1AJ7H 5K59F 4NS0A 4DZ8B 1D2OA 1D5IL 4PGDB 4JL1A 1UCBH 3HI5H 3L7EB 4Y7OC 4EQ3A 1FVCB 4L8CA 3N1PC 3GPEA 4BKLB 1CE1H 4YH6A 5SX5K 3W11C 3KGRA 4FFYH 4GBXC 3MLZL 4A6YB 5J1AB 2QVKA 3HB3C 2YKKA 3OHXA 4GAFB 3RAJH 3C60B 3FULA 5I1GH 4K5NA 1OW0A 5HTSA 4MJIB 1U8KA 4FNRA 3QIUD 3RY6C 2MQGA 4JFOA 1T89A 5EULV 3SYCA 2VLKA 4ZTPL 1AHWA 1KN2H 1GIGL 4PV1C 5F1IB 4AYMC 4XMVA 2BSDA 1WBYB 2X1QA 3DVNA 3FUFA 1OOWA 4R4FL 1JZDC 4DKEH 2WBKA 4UQBA 5J0BA 2FATH 3SIKA 3ARTA 3LD8B 2BOCB 3ARGC 3K91A 1DQJA 1LP9E 4KXBA 1J1PH 1TMCB 5GGQH 5K59E 3G5YB 1SQMA 3GB7B 1E3XA 2ALAA 3LIUA 4HC1A 4I0PB 4PFEA 4N9GA 1ZT4B 1KFGA 2YD4A 4YBLB 2FB4H 5EU6A 4KKLC 3VXQA 1R5WB 3LRLA 5DJ0B 1BZ8A 3FB8B 2AXFA 4F93B 3L3OB 4WI0B 2CRYA 4LIQH 3CU7A 4K4KA 2FEEI 4XNQA 1RPUA 2YQBA 4KI5C 2VRAA 1NCIA 3NUKA 4TSBL 3RI5F 4Q58C 5FDWB 2ZONA 1AY1L 1KJ2L 3OR7B 3DYPA 4PTUA 2OK0H 2FJFA 4MMXA 3WIFA 4GUPB 2FUQA 2ZUWA 3X11A 3IK2A 4UTBH 5EIIG 2QSQA 3CVHA 3HFML 4NO3A 3GZKA 4GSXA 2R51A 5K1JA 5JW4M 2IH3B 5DD6B 1AHMA 4XPTL 4AW4A 4A7GA 2BVOB 3F6JA 5DK3A 4X7EC 2WLIA 2E6QA 2GIXA 3DOIA 4BSVB 1NUGA 2XFXA 2JB6B 2H0FA 1HSBB 1XGQA 1XIWB 4PJXA 4WJ5A 4ZUTB 3TIEA 4PJCB 1I8KB 3IDYB 4L1HA 1U4EA 1E9QA 2E6JA 2BMKA 5L8KB 3NCBB 2X4UB 5HDBB 3EO9L 4G9DA 5IB5B 4J39A 1CQKA 4G8IA 3OMAB 1XGZA 1DBAL 1T6BX 1GGTA 4P59H 3O4OC 4PJFF 2C8NA 2PYED 1E2VA 2IBBA 3IF1A 4AKQA 1GTNA 1HILB 5I18H 4C4KT 3VWKD 4AG4L 1HSAA 1MLCB 4JY4A 3DTXB 3LEVL 2BWDA 1JV5B 5DD3H 3VW3L 3MJ9A 1B2YA 4KK5D 2HPOA 3CZLA 2GEQA 1AFVH 3BWAB 4G5ZL 4W68A 1GMEA 5GIRB 4NX0A 1SXZA 4KKAD 5A2BA 3TO2A 3T8XB 5JR1H 1K2DB 3BEVB 5E5LA 1PCSA 1EHLL 1NGYB 1ZIBA 1YECL 1GZPB 3T0EB 2N1TE 1AQDA 1QA9A 3UTOA 1PG7L 3LVEA 3HIZA 2GBVA 4URKA 4PREB 2L8AA 4XX1G 1DJZA 3LPWA 3MBEC 4ZUSB 2PKDA 2A77H 2IC2A 2O5XL 1BW8A 1AIFB 2D3NA 2ZCHL 3IDNB 4PJFE 5E8EB 2QTVA 4PCTA 3VRIB 3NJFA 3U1QA 5DC2A 1FCGA 2VM3A 3NZSA 4HC1L 5E2WL 1ZY9A 2UWEA 2XWBB 5LKNA 1YEEL 1OSPH 2PXYA 1F3RB 3ARBA 4P4KA 3CSBA 4HALA 3VA6A 5TF1H 2CDFB 2QKIA 4IJ3C 4U31A 2IOMA 4J3OF 1LTXA 4RWYL 2F54B 5IBLD 5B22A 4P3DA 1GAFH 3WS3B 1P7QA 2PPAA 2A9DA 1H5BA 4OFPA 2BERA 4NKMB 4DESA 1S5IH 3W38A 5D7JC 2HJFA 2WWOA 4ODWA 1JZ4A 3CVHL 4QTHB 5FUZH 2OMZB 1L6XA 2Q6WA 2QPSA 4JFDE 5FX3A 2EEFA 3NPSB 4LVOC 4EIUA 5ADPH 5LWYH 1J5OL 4U6VH 1A7OH 1QEXA 3T6QC 3TYGH 4GIAA 2X2HA 1DLFL 1XCXA 2QGCA 1XB8A 4BQ9A 3T2PA 3KPOA 3DO7A 3BAEH 4FGMA 3RWIB 1XR9A 2N4IA 4PJ6A 2PWGA 1Q0XH 2J88H 5KUKA 4Q2ZA 1OP3H 3ZMRA 2J1XA 3MRCB 4TNEA 5GGUA 2H41A 1RUQH 3LEXA 4JKWA 4ODXB 5DJAA 3V0FA 4F57H 4B5EA 3Q8FA 4DW2L 4AGPA 1CLCA 4CGUB 1JERA 3QWRA 5TH2B 3R1GL 4JGMA 4QGYA 3SDAD 4NKDB 3N9GH 2L0DA 2XYCA 3INUL 5EO1B 3P2BA 1ZCRA 4DO4A 1OL0A 3LHPL 3MJ9L 1T5XA 2NLJB 4XNAA 2RFXB 2OJZH 2AXHA 4LSTH 4GOSA 1JRHI 4NM8L 1PF3A 5C09D 3U4BL 3RVXC 3U0PB 1MNUL 1HHIB 3FQTB 4AWJC 5EZOL 4XVSH 3U7WH 2NZIA 4ZD3H 2HLFC 1WS7A 3HCVA 1XSIA 3F6LA 3QUMB 4PV8A 1U42A 4FQCH 2OMUA 3TONA 3AVEA 1HINH 1YEHL 4PS7A 3WIIH 1NL0H 3GBNH 2BVEA 3CHOA 2OA9A 1M2VB 3N1GC 2E9WA 2K8MA 3HPJA 5HDQL 2ESVA 1SLXA 3QW9A 3BUIA 1KCRL 2F19H 3DO4A 3MYZA 4M62H 4S1QL 5ILTL 2BP0A 2P8PA 2C9SA 4PJCF 3QULB 2GI7A 5ADOL 2H47C 2QVTA 4FAAB 5AKRA 1C08B 3S3JA 5HHXH 4Y4HD 1MCSA 1OLZA 3PV7A 3TO4D 4PP1D 3RZCD 2VQUA 3DIFA 5I82A 1CD1A 1EFXA 2VKXA 4TSAH 3X3FH 2DWXA 2MIZA 3V0WH 3U2SA 2UZXA 4K8RH 4M29A 2WQXA 3VXRD 6FABH 3IDJA 4GKSB 2DWTA 3RIFK 2X87A 1Z3GH 5FW6A 5DUML 3CX5J 3GK8H 1T1XA 1EHNA 4M7JL 5FYKH 1HZLA 1F1AA 3VFPB 4ZFQA 4V1DB 5BVPL 1ZPUA 3QDJB 3RWDA 1J48A 3KEDA 2CO2A 2YD8A 5DVNA 4IBLT 1BQUA 3ZTNL 6PAZA 2B4CC 5L4JA 1WGVA 3PFQA 4L8DA 4PJCE 2CJUL 4IMLB 3JUYA 1MHHA 3MQIA 5I1EH 3C5ZA 5KN5A 4MSWA 3W0WA 4PB0H 2R8SL 4N2OA 4OZGA 3H2WA 3L1EA 2E0PA 4CC1A 3L3GA 3D9AH 1TETH 1P6FA 2BSRA 2G4EA 2HH0L 4HMEA 3UAEA 2MPVA 1D9KB 4DO6A 1TTBA 2A9ML 3ECBB 3QJXA 2XG4A 5FYKE 4ZXBC 1UB6B 3V52H 3DSNA 2LOEA 4HK0A 1OAQH 2UY7B 4NXSA 2MCPL 3GPSA 1DSFH 1DJYA 1NAMH 4J23A 4B27A 3UZQA 1NGZB 4TUJA 2RTTA 2YHGA 1QLFA 4RX4A 3D18A 2Y3NA 3NCYP 1ZS2A 1A0QH 3AQXA 1DR9A 4GKLA 3A67L 3IXAA 3MRPA 5B8CB 1BMGA 3BOVA 3VXTB 3OMIB 3TBWB 4KJPD 3FL7A 1AMXA 3QUZB 5DF0A 4F5CA 3QFDB 2HFGH 2KS0A 2X1PA 3KPRB 4B95C 1D5BB 2XVBA 4PBDA 3JYBA 4HSCX 1DVTA 4NRZA 4YQXL 1E4HA 1ZLVH 3T0EE 4XP5H 2PO6D 3TH4T 4X9YA 4K7FA 4UUJB 1MFCL 3ULVD 4DT2A 4KKPA 2KERA 3MV11 1CFVL 1OGSA 2E7DA 1XVSA 4QHUA 4XP4H 4Z8FH 1MCJA 3UP1A 3EYQD 5EIIA 4AQ1B 3KLLA 1YZZA 3KXFA 4O51A 4JN2A 4OI9A 1T7YA 4TSCH 1PY9A 2W0FB 3LQMA 3T6XA 1JZJA 2H7WA 2JXMA 2DLHA 5LJYH 1NINA 5E08L 4WK4B 1HN1A 2VZ3A 2CHDA 4Z18A 2H3KA 4W93A 3II3A 1ZHBB 1JGVH 5AOZA 1Q9LB 3SGJC 2AQRA 1Q9OB 2XN9A 3UG4A 5C9JB 2F54E 4BFIB 3ULUD 4QKTA 5FB8A 4PJEA 2FGWL 3JTTB 5CIPH 3SE4C 1I1AC 2JKRM 1H6FA 3RBSA 4ANKA 4AZUA 4XC3L 2X3CA 2X4SB 2PWDA 4BFKA 3OAYH 4MWFB 5FV1L 1IC5L 1OCZB 5FLUA 3S34L 1NIDA 1JDDA 3RP1A 3BRFA 3KPMA 3T2LA 2F1AA 3SPVB 3DNKA 4HKXA 1OE1A 3KAAA 1HEHC 1KJMB 4JFFD 3L1FA 1YYML 4FNLL 3L9YA 4APQD 4KZEL 3LXCA 3ZUCA 2ZYRA 2VIRB 5SX4I 2BW5A 4L3FA 4Y1TA 4WLCA 4GEIA 5EWIL 1HJCA 3I9GL 4HJ0C 3CVIL 4KJYA 3VMPA 3CPLA 1B0GB 4HHAB 4A37A 4FI6A 4MNGA 3OJDA 2P5WD 2FK9A 3K2IA 3T3MB 3DVGA 4JQXC 1DJWA 5L2KE 2WO4A 4F24A 3VU1A 5FOJA 2CLVA 2PCPB 4HPOL 1TKWB 1SXNA 2CAKA 3FO9B 5F7KC 1XXDC 4HPYL 3RB5A 4PJIA 2OS7A 3JTSB 3H7BB 1IM3A 1BZOA 1LEKB 4NO0A 1FZKA 1MFVA 3EYVB 1S4IA 5IKCB 2EH8L 2YKLL 4WUKL 5ECGA 1XGPA 3MRGA 4HWZB 4N25A 3MREA 4N0YL 4TOYH 1FHNA 3Q3GA 3AABA 4OB5L 3RGVA 4LCCC 3CHSA 4I87A 4J4PD 3P4LA 3LQAC 1A7RH 3BSZA 3QEUA 1N6QH 1SM3H 5LDUA 5FWQA 4U4BA 4JKMA 2CQVA 2XIBA 1CFMA 3ZE2B 1CPUA 5ID0B 4JHAL 4GEJA 4XOEA 3B9KC 2OSYA 1BEYH 2CHXA 3CG8A 2W38A 4OJFH 2MNJB 5L6YL 1YLBB 3OAZK 4MQTB 3SGDI 2G5RA 4ZQKB 1DDHB 4K3DL 4WCYH 3TVMD 3PFUA 1KXHA 4HKBB 1DANU 4XMPH 4QTIH 4XO8A 5E8OA 1BG9A 5JO5B 1E28A 3DX9B 1U8CB 3UGUA 5IB1B 4NN6C 4TQPA 5DVPA 4FN0A 3DX1A 4ALAL 4GJTB 2UUDK 1OAJA 2X3AA 4FNPA 1FNSH 4BWUA 2BVQB 2CCVA 1JZ3A 2V8MA 1DVXA 4UZSA 1BQHG 2H8PA 4QRQA 5BRZB 1UWEL 3QNFA 4HKJA 1XL6A 3CC1A 4Q6IA 4EN3B 5KTEH 3U25A 4GAYA 4KROD 4XPBH 4EOWL 1TZHB 2XSKA 3J2PA 2EE3A 5C7ZA 5HGHB 3POHA 4E5XG 2NY3B 3LKOA 4H8WL 3S3BB 1JNLL 3P30L 5EF3A 1W6WA 2DW5A 1BMZA 1EEYB 1IUZA 1J0YA 1J8HB 3HNSL 4YSAA 5CSGA 5CD3B 1HXMB 1GZHC 4XOBA 3RIFF 2CM5A 4MBOA 2UV3A 1TJMA 3GSNH 3O41B 4S1RL 1IAIL 4G71B 4LNRA 4KHTH 4QRUB 2IANE 3EJZC 3BPOB 5GJTH 5DD5H 3MXWL 1UKQA 5BS0A 3HOGA 2FJUB 3IDMB 3QXTA 2WXGA 3T1FB 1BGXL 4AENA 2OMTB 2PW1A 2ZOTA 2D4FA 3VCLA 3P0YH 4A1RA 1SEBA 5LBGA 1GHFH 1PPIA 3BXNB 3ISYA 4MVBD 4HUUB 1WLHA 3L81A 3NABL 4MA8L 3UPRA 3JV0A 4NAQA 2PPDA 3ILPB 2OL3H 5AVZB 2NX5A 4GRMB 2X4OA 4HU2A 2XTJB 4IRJC 3BSZL 1TTAA 2DV6A 4IBZA 4HOZA 4UQ2B 1F41A 4OGXH 5C0GB 5DMIL 2Y24A 2VZTA 2XZQL 3R06A 5HHOD 3UDWA 4GW5B 3R7RA 2ZWNA 4N68A 3WIHH 4UWQB 1P9MC 3LEYH 1WAEA 1N6VA 4JFQA 4GQRA 1MVFA 3VFMB 5D96B 1G9HA 1FZJA 4LAJH 4OGZA 1F90H 3BFWA 1BQ5A 4U2YA 5FW7A 4N2MA 2XXGA 3DX8A 4M93C 2XZCL 2EDEA 3B2VL 5HI3D 1S3KL 3QQDB 4GY4A 3T3MF 3L4WA 2X53A 4LU5L 5IVXA 3NDZE 4ADGA 3QXUA 3FBQA 4OR1A 1F0LA 2OKMA 3GSVA 1YY9C 2HN7A 1KEGH 4XP6L 4LKXB 3FQ2A 3KPSA 3KWVA 4FG4A 1IGIL 1X4YA 2AQ3A 4AC2A 2OMNA 5FO8A 1YMME 1AGCB 3D69B 1NCAH 3MLRH 4ANWA 3RX9A 5T8IA 5A16A 4XGZB 4NNXA 2J43A 1MFEH 4U0RB 1RZKH 1ZSHA 5DJYA 3L13A 5CR1A 2VXVL 3SE8L 3MLVH 4IS6A 3IE9A 4GAGL 4U6YB 1WWWX 1CD0A 1JI2A 4KXCA 5DMKB 5ETUB 3RG1C 3ASOB 5F1SA 4JANB 4Z3FA 3GTNA 3SCMC 1RIUL 2W0KA 1YEJH 4H88L 1A1MA 3EO0A 1NMAH 3BQUC 3CXHK 5F3BB 2OSXA 4XNXH 3MRDA 3P9MB 3T3ME 3G04A 3NN8B 1X4XA 2E59A 4RQQB 4V11A 5TTRA 3W2DH 1CIUA 1JPSL 4J1UA 5EN3A 4UU9B 1A8ZA 4X4YA 4MX7B 2V2XA 5CINL 5LBSA 5ICYA 1JZ2A 3GGWA 2AXGA 4KC3B 2R69A 4O58L 1SN5A 2BX5A 5KYUB 4WV1B 1NOFA 2AGJH 3CLWA 4RGOL 5AB1A 1RULL 1BAWA 2QELA 3CIAA 3MRFB 1OK0A 5KUMA 1QRNA 3QIUC 1GW0A 3TNMB 4KVCL 1BSIA 3H0TB 4MCYB 3ROLA 2YZ8A 4Y5XB 3IJ7A 1CF1A 2PMZA 4XVTH 1BBJA 5GGSY 2IAMB 3QWQB 4PIBA 3RNKA 1YA5A 2WQUA 1I1FA 4XCFL 1WZLA 3MLYL 4WHTA 3BN3B 1AACA 2WO2B 3M1CA 4H5SB 5I1DB 3FAXA 1S5HA 4XZUB 1X5FA 3KYAA 4OGAD 4LE8A 3UTSD 4NQCB 4AQEB 3R8BB 4OZIA 2E9JA 3I74A 4N1CA 7FABL 1JHLH 3GXFA 3TYFB 5JXAL 1ZVNA 3T0DA 2ZQKA 1XAUA 1KIUA 1F4WH 2F8VA 4HUMB 4BCYA 4DVRL 2AEPH 3HNTL 3VQ2C 5HDOA 1XGTB 5GS2D 2EYRA 1L0YA 3ZZSA 4NQVB 4Z0XA 5ICUA 3TIDB 3Q44A 2JF1A 4YSDA 4OT1H 4DQAA 1IBZA 4XVJH 1BD2A 1XCTA 1I8AA 3F83A 4YDIL 4NQDE 1CXLA 4NKIL 4HBQA 2VW4A 3VXSA 4X5WA 2ZP9A 5LAPA 2FBJH 2H32A 2IALB 3R4RA 4ZMTA 5I8OH 4ERSH 1DJGA 1KGCE 4Y2DD 1PKOA 2CDGA 4YHPA 2F53D 2KZKA 3LKNA 4KH9A 3VA2C 1KGXA 4J2QA 1KULA 1RVFL 4LCWB 3S2CA 4YS4A 5C0BD 3M6DA 1DQQA 3CZKA 4QAMB 2P26A 3ORJA 4Y5VA 3IGAA 3QPKA 3QR0A 5ABZA 4EQ2A 4N86A 4UQ9A 5KW9H 3H54A 1AD9B 2CKBA 5FUOL 4YNYB 1S9KC 4F7EA 3NH7H 1C9SA 4M3JA 3I9AA 1NPUA 1USZA 4X50A 5DEGB 3UTQB 4F7MA 2VXQH 4KK6D 1R3JB 5L9DL 4U7MA 2X42A 3KBEA 3BVUA 1DCEA 2J4WH 2ZX7A 4K71C 3KLAB 3G6AA 1FRGH 2LABA 4JM4H 1G9NH 3NQIA 1CGSL 3FO2B 4CGTA 1W9XA 2BNQA 3MNMA 2WJ5A 5LBSL 3DMMC 5BZZA 4NCC2 3VAEA 4QRPA 2R69L 3O0LA 4P5TA 4KKAC 1BZ9A 3LH2L 4NN5C 3UABA 1BQKA 1JZEA 2ZOWA 3VXOB 4PRPD 3CN4A 3TN0C 4CVXA 3GMPA 3WKNA 5KVDH 1N0LB 4DF9A 5PCYA 3ABZA 4NWUH 3EJQA 1IBBA 5GRVL 3KWTA 3TASA 3HLAA 1S9XB 2A74B 3SQOH 1H3TA 2VC2B 4QRTB 2X6AA 1R3KB 5EBMB 1ED3A 1NKGA 4J3OG 2Z92B 3KDPB 4S1DD 3AREC 4LVHB 5I73B 1QKZH 4N20A 1RZGB 4R3SA 5GRJH 4KOBA 5AYUH 2G75B 3C8KB 2Q1EA 2BIPA 1BQHA 3IFOB 5KVDE 1QUPA 2BFVH 3MNZB 5IBLC 4LOUC 2XFGB 2F18A 2GY7B 4L3EE 3S36L 5AYQA 4WHYG 1VGKA 3EGDB 2C1PB 1ETZB 4LRIA 1XBRA 3CDYA 1RKRA 1PD1A 5D6CB 5EC1B 4G6KL 3N2JA 4G80A 4E5XA 1ZHNA 1FFPA 4HKZB 2OSWA 1FBIH 2H3XC 3HBQA 3LMJL 4FXGC 1Z32X 3M45A 1NFAA 3HNVL 3P0VL 3G6JA 4JFXB 4MD0A 5IHZB 1KTLA 4PJ8B 3LZOA 2BIMA 1JWUA 2VLKD 4KAQH 1F58H 2YBRA 3FQXB 3OKDB 4F8QA 4PJ5A 3SKJL 5B7EA 3UYPA 5BOZG 5I6PA 5CEXB 1BIHA 5EORL 4Y19A 3KPNB 3J27A 2NT1A 4YHYB 1UC6A 5ACZB 5EEXA 1WFUA 5IUSA 2WUCH 1WITA 4KV5F 1EXUB 1ULVA 5D7SH 2CKBL 1HAUA 2WXHA 4KUZH 5H37H 5HHQB 3WY3A 5EU6D 1OCRB 5C07B 3VFRB 4NJ9H 1AZNA 1HH6B 2FX7L 3H9SA 5AZ2L 1MW1A 3V6OC 1NSNH 3CFDB 1MJJB 1WFOA 1I4FB 3OSVA 4QF1A 4BK5C 1EBPA 4HW6A 5EU7C 1KG0A 1NCTA 3HAEH 2EC9U 4A38A 3EHBC 5I8CA 1I7TB 3A4FA 4P48A 4ECNA 4BK8A 1QPXA 2GUOB 3RWHB 3BH8A 3P77A 2J8HA 2D9QB 3X13B 4FULA 3P3YA 4HHWA 2Y2TA 4KV5E 5IQLA 2FJHB 1QSVA 3CGTA 2E6PA 5TK2A 4U1LA 5KOMC 4NNPH 1Z9LA 3AQDA 1DANT 5E2UL 3RZWA 5G4MA 4U2ZA 1BWWA 3BGFC 3ZO9A 5JZ7D 1XHHA 3J07A 4NJAH 3QG6A 1NA8A 3VM5A 3KZ8A 4KJQD 1UM5H 4PWIA 2EP6A 1JVKA 5GHWH 1J1XL 1PZBA 3KH4A 3ZOAA 1RXLA 4P2OB 4WI2A 4Y4HC 5BJTB 3ZL2A 2R1YA 3DK0A 5HHVL 2Y5EA 3WE6B 1HYRC 1KGYE 5IFJB 2L7UA 4OKVB 4D8PB 1LP9A 4DPCX 1BM3H 4KGLA 1CYXA 1GYAA 4N5UA 2MTPA 3C8DA 1CTOA 2F1BA 1DO5A 3Q43A 4ZODA 5TE7L 2J56A 3LIZH 4PJGB 5CSBA 1AXTL 1QSEB 3ECUA 3TFKC 3D34A 3NAAL 4ODUA 4XE0A 2UZIL 2XC8A 2OJEB 4LP8A 2D2OA 1UASA 1CLYH 1RAMA 2DMBA 3ZK0A 1MI5B 4GG8A 5FO7A 1D5ZB 2H4EA 4OD1H 4QXTB 3OAUL 5FKAB 5FOBA 2X38A 4NAMA 2QADD 4FYRA 2RALA 3WJLA 4HUNB 4AM0A 2OZ4A 2TRYA 2ROXA 4AJVA 1T1YA 3PU7A 1JHTB 3BPLC 3ARBD 4P4KD 3HG0A 2IWGA 5F9OH 3TEYA 4U1HB 2JCWA 2QQNL 3I6KA 3JTBA 1PX3A 3UTZA 1P4BH 5E5MA 4OI8A 1P7QD 3FOLB 3HC0B 1S7WA 2YD6A 2YA1A 4JJOA 3EOAA 3PCYA 4XHQA 1NGWB 1OAUL 4HF5H 1QBLH 1CLOH 4PY7A 1KGJA 1N7MH 3OLEA 2MMXA 4HLJA 4V2BA 5A6IA 2FT6A 43C9B 5IB3B 5FO2A 1NBYB 5E56A 2JLLA 1P5VB 5DC4B 1YNLH 1RI8A 5L8LB 5KBMA 3SGEI 4DCQB 3BAYA 4WHDA 3BKJH 4WFEE 1S9VB 3ARFC 3X1BA 3GMQA 2NNAB 1BFTA 4ATWA 4HQQL 3ULVC 2V7HB 4GFTB 2AXWA 5BVJB 3ZMEA 2J12B 1G7JA 5IQ9A 5J9PA 2DEWX 3HG1E 4L9LB 1GKEA 4GW4B 1KCUH 3ZW3A 3EYQC 1F4AA 5D7LB 1QWUA 5HYIA 2DQCH 3FCGA 3QWRD 2ARWA 5DHEA 3FOMA 1NCCL 1UCBL 4HLZH 1E5CA 2FJGB 1ZXKA 2ZPKL 4DOHE 2BSSA 2P5EE 4MNQE 4ETQB 1FO0B 4BH8A 4X7TB 3E8VA 3KG5A 5F6HJ 4PJFA 4M8QB 4CW1B 3ULUC 4W9IC 3V7AG 3RAJL 1AYRA 4XHJC 3SJVE 2VDKH 1XT5A 1A5FL 1WWAX 2FGZA 3MO1B 3V0HA 3K6SA 1UWGH 1JVLA 3JWDC 1H3VA 3H2QA 4HJJH 4M48H 3ULSB 1J5HA 4UDTB 3HRZC 4P46B 4X4XA 1LMKA 1D6EB 3HR5A 3SE3C 5BUGA 5JW3H 2Q86A 3HJ0A 4ZX4A 4Y16A 5C6PB 1U3HB 1UADC 1R3HA 2XG5A 1P6AB 2VZVA 3GXPA 2IEPA 3QGVA 5GGSB 2WOBA 3VXMB 1KCBA 4ELKB 5IB2B 3DRTB 3MMEB 2CBPA 5FGCE 2OZ4L 3F6IA 3LDBC 1AS6A 1R24A 1AD0A 4JFDA 5J1SC 2VDPH 1JD7A 1AO7D 2WBJC 1HCZA 2X6CA 3OF6A 1JPGA 3T0AA 4GAJH 2G9KA 4RFOH 1ZE3C 1Z9SB 4FDWA 5C0ND 2NPLX 5I0VA 3K1KC 5GGRB 1SMDA 1YC8A 3L7FB 1EFXD 4XWGH 3IXTB 1YNTB 1NIBA 1RZIB 3D2TA 1AZRA 1GW6A 4IIQB 1HH9A 3LZFH 2D7TL 2EIZB 1T21B 5KVGE 3MCKA 3P9WB 1TCMA 2FWLB 2FIKB 4B9IA 1X5GA 1IB5A 4QCIA 4MXVF 3CMOH 4YHKH 4YX2L 2AKRB 5FO9A 4NZUL 1S8DA 4MAUL 3HZ3A 4QY8B 5KWYC 1HHGB 2J55A 4G7YL 3IU3B 1KJ3H 4YFDB 3X14A 3CNKA 4KO5A 4GH7B 1FPTH 3LKRB 3MGTA 2LAAA 1IGFL 1SHSA 4H0LC 4DZ8A 4OIFA 2NXZC 2X0WA 4NI3A 4PGDA 5AB2A 1RMFH 4WJKB 4P59L 4WWPA 3FDWA 1U8MB 2XNAB 2ZUXA 4MA7H 5DZJA 2DQIH 3LZNA 3W0WD 3BKYL 4XNBA 5I6KA 1R9FA 5IIEB 3O6FA 4A6YA 2CR3A 3MJ7B 5GGVH 2OSLA 4PB9L 1CGXA 2XKSA 5DJ8B 3D3VE 3TVMC 3PNWB 2VZSA 4FD0A 1YG9A 5KJRL 4WW2C 4FQJL 5D2LF 4WWKB 5E1HB 4QLRA 1H8NA 5FM4A 4U1NA 5CO1A 1C12B 4JW3A 3DIVA 3EZ8A 5CAYB 4MXVE 2DQMA 4RX4D 5DYOB 3NT0A 2WCPA 1H6TA 1JOIA 5EN2A 4OAWA 5B7FA 3RX7A 1MCKA 1WBYA 5BQDA 5JR1L 1GL4B 1K9TA 3LPGA 4I88A 5FHAL 3RFZB 1AKJA 3BVWA 2QSTA 3CK0H 3I6LE 4WO0A 3H9ZA 5K5YA 4L4VB 2AQSA 3U6XS 2OYMA 2C9UA 1TZOA 5DJ0A 4ZG1A 3FB8A 4F92B 1SMAA 4KFZC 3LYRA 5I15H 3I9PA 2BC4B 1N2RA 3LKSB 2X6VA 5FDWA 2Y1YA 1LO3H 5D2LE 4AIZB 3GC3A 1AQHA 4GUPA 2Y07H 1CU4H 4JO2H 3KXFD 5JOPD 3HC4H 1MSPA 4Q8BA 4MASA 2HRPL 1GAFL 2EEXA 2I25N 2K9UA 3NZUA 4QHMB 2IH3A 2R9HD 5I1KL 2IGFH 5AVSB 3ARPA 5AVYB 3D09A 2WIIA 1F86A 2BW4A 2XN9D 4J3TA 1GCYA 1R5IB 2AEQH 4BSVA 1S5IL 2QSCL 1T22B 5DD1H 1HSBA 4ZUTA 2QLVB 3FCTA 5DEJA 3KL5A 3WUWG 4PJCA 2P7TB 4M6OH 3UAFA 4WFHD 3ZKXB 1I8KA 2IDQA 4NYLB 4B3VA 1D6VH 3QO1B 5I76B 2X4UA 5IB5A 2YMOA 2WLLB 1MCEA 5AZEL 2B4CH 4UNTA 3EOBB 4YJZL 2RA1A 1M7XA 1P7KB 1M9SA 1HILA 3GI8H 5LGJB 1JXDA 3DXAB 5C0IB 2XDHA 2QZQA 5AL8A 2O93L 3P3RA 3V7MA 2N0KA 1JV5A 4S2SB 3NESA 4N90E 4G8GB 1ZJAA 4YUEL 2DMHA 2XPYA 5I1HH 1E6JL 4A6YL 1QYGH 3QEQB 3DX6B 3QEGL 3PDDA 4BZYA 5GIRA 3HI1B 3ZQXA 2VMFA 4JKKA 3O8XB 3RVVC 3T8XA 1K2DA 3BEVA 1NGYA 3T0EA 1GZPA 1NAMA 1WBZB 2OJZL 3CC5A 1R1CA 5IJCC 5BUAA 1XB3A 1AR2A 2H0JA 3N55A 1XR8A 4PREA 3KR3L 4R4NC 1IM3D 1FC2D 4ATTA 4XVSL 5E51A 1AIFA 4NO0D 5TJWK 2Y7QA 5F7YC 3OGCB 4FTVE 1E7VA 3IDNA 5J4MA 1GSKA 2X89A 4FQCL 3GBDA 5HYJD 3B2MA 4HH8A 3VRIA 2ATAA 1JGIA 2QDWA 3QHFH 1IJNA 5ITFB 2VDRH 4NCDA 1NL0L 3RGVD 1YNTF 1VAHA 5CWSB 2NXYD 4YHZH 5F0MB 2V37A 1TDQA 1RJYB 4TVSa 2CIIA 2F54A 7CGTA 4OI7A 1LQBC 1MAMH 1R3LA 2WXQA 2TRHA 5TGBA 3RPIB 4DQOL 4FQ2L 5BW7C 2VL5A 1XF1A 2ZCLL 2FWUA 3EYUH 4UT6A 5LBVA 4LSUH 1UJ3C 1WC7A 2HT2C 3OV6A 1E5AA 4H8PA 1TZ8A 2EUVA 5I28A 4WWOA 4QTHA 3WTVA 1F6FB 2BP8B 2QHRL 4GRLB 4HIXL 5EPMA 5LCVH 3B8YA 2DWDA 2OMZA 1E4XL 4LSRL 5DQ9A 4DP2X 2EC9T 5IVZB 2Z1KA 2FWOA 3C60C 2GQHA 5HDWA 3TNNB 2HJLB 3SD5A 2XPGB 3GMOA 1HTYA 5L0QC 4APXB 1T2QL 4ELMF 3WLWD 3TURA 3IJYA 3RWIA 4JHWH 2VMJA 5FM8A 1TVHA 4DEWA 4LK4A 2K3HA 1RHHB 1UACH 1Z3GL 43CAB 2AQTA 4LDLB 5FYKL 3WKML 5L2KA 4OW6A 1BYNA 4JPSA 2F7QA 3UPAA 4DFIA 4I0PC 5D8JL 2QR0A 4NKDA 4JFED 3IYLW 5I1EL 4XAWH 4XOAA 5EO1A 3RWFB 3F01A 3L3OC 1JYWA 3UJTH 2NLJA 4X8XA 1TETL 2YIHA 1OTUC 5DUJA 2B8OT 1D5MB 4NO5A 3V52L 3U0PA 3MLXH 1HHIA 1FORL 3HC3H 4OGAC 4U3HA 4ELME 1K4CA 3VWJB 1OAQL 3QIWC 2AJSH 1HT6A 2Z4QB 5F72S 1NAML 3IDXH 3UTPE 3UC0L 1N5YL 2W9DL 1INEL 2CHWA 4I3GA 5BS0D 1QQDB 4I3RH 3QCTH 4RMTA 3WFEL 1ZT1B 1AE6L 3AG1B 2CH8A 1N68A 1KBGH 1BF5A 4S0TD 2MOGA 3PQYB 1G6RA 1M2VA 2NCEA 2JMRA 3B5TA 4G9FB 1SOXA 1M7IB 4XP5L 2DD8H 2DJ4A 4JO1H 1M57B 2UY6B 4Y4KB 4JFSA 3I6GA 1HYSD 2NX5D 4Y2DC 5GS0C 1ROWA 3LJ3A 2L7EA 1C08A 1A1OA 5I19L 4EUPH 2B16A 2ZXEB 4KOCA 1QX1A 4DK3A 4XMTA 3G5WA 3ZYIA 1PX8A 2X2YA 3PRZA 4LPUA 3CUPB 3ILQD 4UT6L 2EDLA 3SE9L 3F7YB 1TG8A 5HI4C 5JHBA 1XSJA 1TJXA 4PYHA 4XI5D 3VFSB 4H7VA 2DL2A 4KUCF 5HI5D 1UXLA 3HZMA 3C2AH 4R5XA 1JTTA 2YJQA 3QH3B 4ILDA 4KK6C 4O02H 4GKSA 1E6OL 1U91B 1WEJH 4IMKC 4Q9QH 2W07B 3MTXA 1TZGH 2VISB 2VAAB 3VFPA 1PZSA 1UHVA 2DRUA 4RBPH 2CPUA 1OGAE 3FTUA 3ZY7A 4WEBH 1H8OA 4LGPB 3UMNA 2XWTB 1BOGB 4TULL 2VERA 3X1GA 5F7DB 1T1ZB 1AS8A 1G5AA 3NEOA 4YO0B 2IANA 3KPSD 4JFHD 1GY1A 3VGDA 2B5IB 1V7NL 4PCSA 15C8H 3ECBA 3QO0B 2W65A 5EOTB 2Y5TA 3CFBA 2FHCA 2UY7A 1J05B 4YOKA 4JPWL 3O2DH 5AZUA 1P6WA 1A4KB 4HS3B 5IOPA 3IS1X 2BDNL 2C3VA 3MV9E 2WZ5A 3DUUB 3VXTA 5F70A 1QHOA 1JNNL 3AXHA 3QUZA 4Z7WF 1EJOH 2QQKH 3QUXC 3I85A 4XNDA 1MQKH 4LOFA 3L17A 1D5BA 5IT2H 4KKCD 4NFCA 4YBQD 2NZ9C 2AJYH 4OCMC 3U46A 1GOGA 3B6SA 3GI9L 4EDWL 5HHME 5IHUH 4JG5A 1G6RL 4OM1H 3AM8C 3FTVA 1YQ2A 4ZX3A 1QRND 2I5YH 3QS3A 4XBPA 2O6CA 5J57B 1T5WA 4JZOA 4BEIA 3S3SA 1AHWC 1ZHLB 3RVWC 2ICEB 1IFRA 1A3RH 5AALA 3P2DA 4FL4C 3APNA 3HAEG 3L5WA 3TV3L 3S5LB 3C5SA 1FGNH 3PWLA 3P4MA 1Q9LA 3WUWA 4ZO6A 4NZRL 4GT0A 3AT9A 4Z7WE 3ZE1B 1AP2A 1JFHA 3LRGA 2X4SA 2D03H 4H20H 1KYDA 5FPIA 4MWFA 3NPZB 1NCDL 3WV0A 4AL8L 4EXPX 5E99L 1ZHKA 1DE4A 1SMOA 1YMMA 2ENJA 4N2IA 4TUKL 1N19A 1YEDA 2C4FT 4P23A 1ZGLM 3O3BB 5JNYA 3GJFK 2YC1A 3J7HA 3H55A 3SPVA 2VB5A 4JM2B 1DJIA 4ZDHB 3D2UB 1HL4A 1PAMA 3EYFA 1KJMA 1RIVH 2M83A 3GF8A 2BVUA 4GIOA 4FQXC 3QI9B 1VLXA 2EYSB 4HH9B 3RTQB 1BD2D 1JWSB 1DFBL 1KV7A 2MWCA 2YXFA 4OZHB 2Y69B 4XNMB 3A24A 2AAAA 1RIHL 4YLQT 5LAXB 1IFGA 4HD9A 4HP5A 3SD2A 3OPZL 3DX7B 3VGAB 1B0GA 2YAQA 4HHAA 2OCJA 1VKXA 3EH3B 2Q0ZX 1LNUB 4NZFA 1P0SE 2EH7H 2ZG3A 3FO9A 1AZVA 5CILL 3MJWA 3JTSA 3H7BA 4K3EL 1ZWIB 3N44F 3FF8A 4RSVA 1XF2B 1E42A 1LEKA 4JGJA 3EYVA 4AQZA 5IKCA 2ADIA 4X99B 1VHPA 3CFKA 9CGTA 1PZ5B 5I6XC 3DJRA 4WO4C 5FCSH 2XQ0A 5AWNH 3K2KA 1JBJA 4HPHA 4M8RA 4Q52A 3HG4A 4PWFA 2BNQD 5HPOA 4E0RB 5GISH 4B9KC 5EHFA 4I9XA 4K94C 1MWAH 1I9IL 4LNVA 4G3YL 4QRPD 5F3FA 2K1MA 3MCYA 4P5TD 1FDLH 1NPJA 1BBDH 3ZGIA 1QLEB 3N85H 2VRQA 5ID0A 5TDNA 3QZLA 2V6HA 3ULAB 3PQYE 4HS8H 1JZGA 3QJOA 3BJ91 5FHBL 4YXHL 1P4LB 3K72B 1DDHA 5B38B 4AYSA 1WIOA 3BVTA 4Y89A 2WXIA 1JZ7A 3O9WA 1F4YH 2V33A 4RMVA 4POZD 5HD8C 4OGXL 1JAEA 3HEIB 2XWCA 3KYNB 1YCSA 1AZUA 3L95A 1W72H 5JO5A 3OLGA 5IB1A 2VDMB 4I9WD 3QQ4A 1YN7A 1Z9MA 2QADC 3F7VB 4KQ4H 4DKAA 1T04B 3L3DA 1A14L 1KB5B 2F7PA 2ED9A 4NQDA 1K6QH 3MV7E 3V4VH 4P4KC 5H8DA 3MBXH 3BX7C 3OMZA 4U6HB 3CX5K 2IOIA 1RH8A 3QRFM 1WFNA 3U9PL 5DFAA 2VLMD 1F90L 1FE8L 3R0NA 5B8CC 1A6ZA 1DUYB 1MPAL 4ZMXA 5DMGD 4JKLA 4X6CF 1RUKH 4EN3A 3WFBL 4DHLA 4HGKC 1DN0A 3L4UA 4C4UA 1TZHA 1KIPB 1N9PA 2DBJA 3AU0A 3LRSA 4LL9A 3KJ6L 5HGHA 5FEBA 4HLZG 3H7LA 4Y9CA 2EUWA 4JN1H 1JGLH 4NQXB 3QK0A 1KUMA 2R4RL 2E9BA 4PRHB 1EEYA 3P4NB 2X1XR 4LEOB 4R83A 5I8EB 3VDAA 2K7QA 1S7VB 3FU7B 4JO4L 1HXMA 2IV9A 3ZKMD 5SWSE 4PJ5D 1NC4B 3WTUA 1P5UA 5FF6A 3SQBB 3SHSA 1MFEL 2XZAL 5BV7H 4Y19D 1EUUA 1N4XL 5JXEA 2B1HH 4UMSA 2XWJA 4PQXA 5I5MA 4FQIH 3CLFH 3MYJB 1PEZA 1GGIL 2OL3B 1TQCC 5E8PB 5A2LH 2GHWB 3EAKA 4WSKA 2XWZA 4N2DA 2JJTC 2GBUA 3PABB 3U4AA 1CXFA 4X6CE 2DI7A 4P05A 4XB3A 1NMAL 1RPKA 1CDHA 2R2EB 3E2HB 4FADA 1KGIA 3O6LL 1MFAH 1VACB 2X6UA 5HHNA 4M56A 3W2DL 4TLKA 3ARWA 3RJQB 3H9SD 5IR1A 4WNJA 2BY3A 4HUUA 3T8VA 1QSZA 2A3TA 4M6ML 4Z7OB 2CJSA 5D1ZI 3WD5H 4O2CB 2NR6A 1EA9C 2YXWA 2FZ3A 4UQ2A 3BAXA 3D33A 3FT4A 1BX2B 1KBPA 5C0GA 5CMAB 4IKIA 4KTDL 4V2CB 2HTKD 3N42B 1NC2B 1KYOJ 2J8UB 1Z9NA 2DN7A 2IQ9L 4JRWA 3ARDB 4X8CA 2K4WA 3Q1SH 4L3EA 4X6DF 3WNJA 1V05A 4IBQA 3T5WA 3JWOC 1FL6A 1RFDH 4LQFH 4LSQL 2FLRT 3HS0A 4X0KB 3RHWK 3STZA 1KELL 4H25B 4L29B 5KYYB 3RL1B 3RBGA 2V2WA 1ZGLB 4NKOB 1VSCA 4JLRB 3CZJA 4HA1A 3KWWA 4PRDB 3QQDA 1CS6A 2HUEA 4R96A 3Q05A 1F4WL 5AG9A 1TO5A 1SHMA 4ZMZA 3WN5B 3HI6L 1T0PB 3GHEH 3U9UB 3NTCL 1VENA 3MODH 4Z95H 5HGAB 3WJMA 4NUGL 3VJ6A 2JQAA 3GRWH 1RUAH 5CU5A 2QLYA 4LKXA 1A22B 2H3NB 3D69A 5TDPA 3CJJA 3MOQA 3BWUC 4F58L 1NPNA 1RY7B 4IKKA 2EDBA 4X6DE 4X7SL 4XN9A 3ZQWA 4AXWB 4QTFA 3HBZA 4BFEA 3KH3A 1EVUA 4U6YA 1NGPH 1ND0A 5CP7B 2COQA 2DJSA 1CURA 2NY2B 4GO6B 1BZ7B 1HHHB 5DEFB 3LZLA 1CFQB 1U8PB 2FH8A 2DQFA 2GBTA 3TS8A 1H3UA 2PWEA 2E75C 1KZQA 3F58H 5IK3A 4KX8A 3A4AA 4F3FB 4X5QA 4JO8A 5A40E 1A3LH 3SDXB 3GXUB 3QNXB 1PZ2A 4UU9A 3UBXB 4MX7A 3WGUB 4LRNL 2LLNA 4LGRB 2ADJA 3BCFA 5T1DH 1U8HB 5KYUA 3GJFH 3CSYB 3WI9A 4JM4L 4MAYA 3QNZA 3N5AA 1BHGA 3B34A 1KYFA 3R7QA 4Q9CA 3DOHA 3M17B 4LDCA 4YE4L 3HAEA 3Q06A 1FG2A 1DQIA 3F7RA 3H0TA 1MCNA 4MCYA 3Q9QA 4OBRA 5IESH 1E2ZA 4Y5XA 2A1WH 4Y9BA 3A5VA 1OIOA 5TFSH 3SO5A 1FYTB 4QXUL 1TJIH 5KVDL 4R7VA 1CF8L 4JHBA 1TSHA 1BAFL 5I1DA 4DH2A 4XZUA 2Q8AH 4QXVA 3DUSB 2GK0B 2QBWA 2WYIA 4AQEA 4U6XB 5JHLA 3KM1A 3MBWB 3TYFA 3WEOA 1GC1L 4ZS6C 4JRFA 3EJYD 2IJ0C 4LAQL 5GRJL 4IRSB 2I9LA 1UXSB 5D1ZC 1W80A 1JP5A 3RKPA 4CKQA 1QI3A 2Z8VC 4NQVA 4UANA 2IADA 3D0VB 3SDCB 4LCIL 2BHZA 5T33L 2BFVL 3I75B 3OX8B 1G4MA 2OXGA 1XGUB 2NTFB 4HWEL 3WLBB 3LN5B 2IF7A 3FC8A 3C9NB 3TPKA 5E4EC 1A7PH 1NDGB 3OHMB 4ZX6A 1FBIL 1BF8A 4PJ7B 2DJUA 4JJHA 3VVVA 1TJHL 1I7ZB 2VWEE 5T1LB 2XVLA 1S9WB 5HPMB 1AAJA 3SKNB 3UROR 3ZVVA 1P1ZB 4YNYA 4GQ9H 3ZZ1A 2QDVA 3IT8D 4Y16D 2FX8L 1PY4A 4OCXH 4PRHE 3WTYA 2DM2A 5MERB 2XT1B 1LILA 2C9VA 3LB6C 3FPYA 3FB6B 3WO4C 3VTTA 1PS3A 1WV7T 3FTWA 4YGVB 4IBYA 2VDQH 5I1AB 1SOSA 4UQ3B 2QT6A 3PGCA 4OTXH 2F8OA 4OVVA 2HSIA 2J8UF 3F8UB 4RESB 1FFNB 4JFDD 4MHHG 2AK4B 4GO8A 4PS4L 1MCOL 3GJEB 1XH1A 4NJ9L 2EXSA 1IIIA 3W1ZA 1VZIA 1ROCA 3NSFA 1F97A 1N0LA 5CGMA 1ZANL 1S9XA 5HGDB 2A74A 3QISA 1B4JL 2QTEA 2OP4H 4QRTA 4UQIM 3WSQL 1RZJH 1TPXB 4J3OD 1JNJA 5EBMA 3IFNL 4WNSA 1Q94B 1RP8A 3I02B 4A7QA 3FB5B 5DTFA 3ULVH 3DRQB 4X80L 1RZGA 2HPTA 1XZ0B 4P9MH 2P5EA 3F05A 4MNQA 2G75A 2W9LA 3C8KA 1OEZW 5E2TL 2DLIA 2ZUYA 3IFOA 2W91A 3DPBB 1SVZA 2VR8A 5JHAA 4HXAH 3N3EA 1IKFH 4B6ZA 5JHLL 1X6LA 2P44B 2J8UE 4DGIL 1PFOA 4QNPF 3CFUA 2X88A 4L1SA 3SJVA 4GS7B 4KVNL 1G94A 3EGDA 4CMHC 2C1PA 1ETZA 3WMPA 3DHMA 1NGQL 4GSRA 5DZAA 5GS1B 2WTPA 3O6FD 5D6CA 1ZLWK 5EC1A 1EAQA 5KANI 3TH2T 2R56L 1I8MB 2JIXA 5CN2A 4HYTB 3VD5A 4HJGA 3WKPA 3X1NA 3CFJB 7PCYA 2KZ1B 4JFXA 2IPTL 4GP4B 3WS6A 1HWWA 4WV1C 1XXFC 1L7IH 3OKDA 5E2VL 5DVOA 3MXVH 3RHWF 4XCYB 4XNUH 2CMRL 4NC1C 3WLWC 5CEXA 5DO2C 1LXMA 4XCNA 5JDJA 5E6RB 1AKJD 5D1QE 1HK6A 2LVCA 1EXUA 2P24B 2WC7A 3OJVC 3GWJA 1NJ9A 3GXNA 4M43H 5CN3A 3CVDA 4QNPE 4P2RB 4OF7A 3VFUB 4NZDA 2AP2A 2G2RB 4W9KC 1TQBC 2AQPA 4OD1L 5IW6A 2Y5QA 3VFRA 3BVNA 1HH6A 2NCMA 2EKSA 3QE5A 4Z78A 2ICWI 1MJJA 3N40P 2AK1H 1FVEA 5HYFA 1I4FA 2R4SL 3K71A 2ICCA 3MPCA 4LT7A 3B9AA 4KK9D 3VFGL 1R34A 3TX4A 1OB0A 4JFFE 1I7TA 3VE0A 1HCYA 1IE4A 1VFAB 1WIUA 2ZUQC 2UYLB 3GMRA 3LS4H 3PGDB 5AW4B 4ZFFB 2GUOA 4IGBA 1T6VN 3RWHA 5IJKA 3EFDL 4UBDD 4NQTA 1GS7A 1N7ML 1AQKL 4BKTC 2A2QT 2K8QA 4W6WB 4GBXB 4U3SB 3F7LA 5HDLA 1FA4A 2FJHA 1UQSB 2CDEB 3OQRA 2VH5L 1D5XA 3HB3B 8PAZA 3H9YA 2P42B 3ZLQC 2YD5A 3IEAA 3GM8A 3RWJA 4M7KH 1U36A 3D3VA 1BFSA 1BJ8A 2NW2B 4J6RH 1MREH 5FYKD 4JMXA 3N41F 4WSJA 4AYFB 5T5NG 2HRLA 4HWBH 3DSFL 3DX4A 1LHZA 2JVUA 3CVBA 4AVJA 2NOYA 1HYSC 1HL5A 1OAKH 4MRCA 1LE5B 1EZUA 4LSPH 4YR6B 1KACB 5BJTA 1EANA 2ZKMX 3LH9A 1FNEA 1Y6MR 3ARGB 2N3JA 2EDKA 2XBTA 2XV0A 3GLZA 3DURB 8CGTA 3GMNA 1DVQA 4OKVA 4D8PA 2DIEA 4R8WH 4XI5C 3VGBA 1OB1A 5HI5C 3AQZA 5CEZH 4UNIA 2NY0D 3QP3A 2EACA 4Y5YA 4JCLA 4BFNA 5DRZB 3T0ED 1Q9KA 1PLGL 4GO9A 2JCCF 2VUOA 1LK3L 2CA4A 1VPOH 4KRNA 3EF7A 4W6YB 1MI5A 1FLTX 3FSWA 2AF2A 1G0YR 3P0GB 5D2LA 4QXTA 1QR1A 2X89D 2AI0L 2FL5B 3REWA 2A9NH 3QUGA 1DQDH 5CEZE 2GITA 5IUCA 3C08L 2X4NB 1R47A 3T6WA 1MDTA 4TNVK 1JHTA 1MRCL 4A2DA 3T0BA 4AMKL 1CXHA 4RGNB 1CE6A 2Q87A 1JPTL 1NCOA 2FTAA 4U1HA 3DX3A 4WEMB 2F54D 3FUHA 2GYSA 2Y7NA 2A6DB 2R1WB 1YSOA 3BESR 1U8OA 3CHRA 3FOLA 3HC0A 4KK8C 5KVGL 3D25A 4AJWA 5IY5B 2H6PB 1RERA 1IRAY 2EABA 1LE9A 1U8JA 4PGZA 4O2EB 2QQLH 3O4OB 2CUMA 3GNMH 1G7IB 4LCYA 1PG7X 2JCCE 3AUVA 4ZZFA 2X9WA 1OALA 43C9A 5IB3A 1A4JB 2Y2YA 1IT9H 5JDSA 1NBYA 4XWGL 2AK4E 3BJLA 1P5VA 5DQDL 25C8H 1KLFB 4DCQA 4LPCA 1YHPA 2EDXA 1ADWA 2I7OA 3LZFL 4KKCC 5F6IC 5DS2A 1X44A 1QASA 1K5NA 4YBQC 3AXLB 3Q1EA 2NNAA 3NBNA 5AW7B 3W37A 2VW6A 2H1XA 4BQCA 4IYKA 3QR2A 4UMGA 3KS0J 4B7IA 1KJ3L 5DFVD 1U2YA 4HIJB 5L2KD 3L3IB 1KTJA 4XH2B 1TQTA 4UM9B 3EJTA 3MBEB 3HG3A 2FYYA 3TZVC 5IP4A 1W8EA 2FJGA 4YIQA 4GMTH 3VH8B 3DGGB 3M8OH 2HWZH 1FO0A 5EUOB 1CDCA 5BO1L 3ECQA 5DRNB 4HSQA 1N64H 2E56A 4FTVA 4E2OA 5J6GA 4M8QA 4CW1A 2R0LL 4RAVB 1FVDB 5DRXA 1UA6H 3EIFA 3I3DA 5FAAA 1O0VA 4IJ3B 4NRYB 3AROA 1IGCH 2WZ6A 2Y1ZA 1UXWB 1NFDF 2ENPA 2KYIA 3AACA 4FQQA 4UDTA 4P46A 4WI5A 3UG3A 4KZDH 1D6EA 2EIKB 3S37L 4LQ1A 2J5LC 3TT1L 3UMTA 1BP3B 1YYLL 5D7JB 1CDJA 5D2NE 5I8KL 2BIQA 4IOFC 4OSUH 3TF7C 5DXWA 1T83A 1UA7A 2X70A 3JVFC 2WWKO 4PRIB 3GUFA 5GGSA 3CK0L 1KOAA 3BP5A 3SN6N 1I53A 3DRTA 4ELKA 4LVOB 1YPZB 1JWMA 3RKDC 4NBXB 4OQTA 1HEJC 2H26B 2OMVB 2PP9A 1J8SA 3GUTB 4JPKH 1VRSA 1Z9SA 1WZ1H 1ZLWH 1IEBB 5JPMA 1S7RB 3ZRSA 5DR5L 4F9LA 2I60L 3U4EA 4ICXA 1YNTA 3RJDA 4LGSB 2V5TA 1NFDE 5ANHA 2OR8A 4L18A 4LBEB 2FEDD 1TF4A 2FIKA 2R29A 4LP5A 1KZYA 1WHOA 2AEQL 3LXUX 4JK0D 2AKRA 1E3FA 4E68A 1KC5L 4XVOA 3KM2A 4QY8A 1KWGA 2KBGA 4JCMA 1N10A 1HHGA 3VYNA 4XNYH 2EDMA 1SPDA 3BO8B 2Y7LA 1JN6B 1YQVH 3QEHB 4Y1AE 1I8IB 3LKRA 2GHZA 1F4HA 3US9A 3W82A 4KKBC 3X17A 5I6OA 3RGHA 4JKPL 1U8MA 5ERWA 5JLZB 3WFHB 3B7YA 4BDVB 4DKTA 1UATA 3Q8EA 4O2FB 5ANMB 4ELMA 4XVUD 2EDQA 3MJ7A 2IAND 3SOBL 5DJ8A 2O6PA 3PNWA 1M6UA 3DX0A 4YSPA 2KUTA 4LHJB 5KSUB 1DBMH 4OLYH 2DKMA 5A3ID 4POZC 1FO0L 1MJ8L 4WWKA 3KLSA 4PLJD 4MA3B 4DPAX 3G9VA 3KLQA 1FAIH 2EXWD 4D9RE 2E9IA 3F5WB 4B9PA 3B4NA 1B9KA 2DQDL 5EIQA 5GXBB 2Y22A 3VFNB 1AKPA 1INDL 4I18C 3DBSA 1EMTL 2YUXA 1N12A 1BPVA 3ZTDC 2QMKA 3RFZA 1MOEA 2XTLA 1IAMA 3MLZH 4B9JA 1IBYA 3KJ4C 3V9FA 5JPNC 2XI9A 2YUWA 4HUWB 1MHCA 1PKQE 2WLJA 1F6LL 4PR5B 3IETA 1HHJB 1LD9B 3UBHA 3ZHFA 4LASL 2AZAA 4JR9H 4G6AC 1E8YA 3UJJL 1GIGH 4KVPA 2F74A 3LKSA 3AT0A 3PJSB 2VDRL 4BZ1A 3IAQA 5J6SA 4R4FH 5B1KA 1QW9A 4AIZA 2FECL 1KMGA 2UZYA 4OQTL 4P2YA 3ZKMC 2JI1A 2ORBL 2YXVA 2ZP0T 4QHMA 1CFTA 4WUUE 5INCB 1UT2A 3FUIA 2EJ1A 4ODHL 4N6QA 1PG7W 1OGAA 4ZMWA 4Z7VB 2A6JB 1T22A 2B59A 2GCYB 3OZLA 1FH2A 5B1JC 1NIFA 4DPBX 2P7TA 4NLAA 1R75A 5LCVL 2F1EA 1WISA 4NYLA 3A4DA 3QO1A 4X7DC 5I76A 2GKIA 4TSBH 4N8UA 4C56E 2DBLL 1DVFA 4TNVF 2G5UA 1AY1H 1KJ2H 5AOKA 4AEHH 4ZXBB 3CPUA 4YFEA 4RAUB 3X3GL 1YMMD 2HG5B 4IRZH 3GO1L 4P23D 4KMLB 3HFMH 5C8JA 3VVWA 1UJTA 3EOBA 3ZMNA 1UVQA 1BVKB 5KSAA 3ZO0A 2K70A 4XPTH 1P7KA 4QRFA 3QRGL 1F4XL 2BNUB 1MCWW 3O11A 4E9YA 5K9JH 4S2SA 2ZCKH 5AG8A 1JGDB 3LQZA 2GT9A 2HTKC 3QEQA 2ETWA 4ZO7A 3EO9H 1DSYA 3BIKA 3HI1A 4NT6A 3VRJB 1URIA 2I9TB 3CDFA 2YEZA 2Y25A 4MZRA 4JVPA 2BJML 1HAWA 4ONFL 1J88A 2FQGA 5F9JA 4DVBB 3QFJB 1WCBB 1ZLUH 3DOSA 2NYYD 4JDEB 3VQLA 3BKCH 5F2FA 5C0CB 1YPZF 4AG4H 3O3UN 3FN0L 3MLXL 2ITCB 2XU9A 2A9AA 1O7DC 3IVKB 4G7SB 2YGQA 1G9MH 3COOA 3MX0A 3OGCA 3IDXL 4W70A 4WY7L 4IK6A 4G5ZH 4KKNA 1M9WA 4I3RL 3QCTL 4E9VA 5KS9F 2HFFB 2RQEA 2QQQA 3FB7B 5ITFA 3LZPA 3EFOB 2EKJA 4JPVH 2D31A 5KVMC 2R2BB 3VSTA 5M94B 1FLRL 3BRDA 4JRXE 1EHLH 1YECH 1I1AB 2X6BA 2KT6A 3E80A 4GQQA 4D2NA 1FHGA 4ZS7L 5IQNA 1PG7H 1G1KA 3RPIA 3TBYB 4AGLA 1OTSC 4HOMA 4BZ1L 1G7MA 3ETBJ 3QPQD 5JW4R 5FGSA 4XRCB 4RZCB 5GZNA 3CN1A 3L6FB 3PAVA 3H3KA 1TEGA 2ZCHH 1I7UB 1PDKA 5IMKB 2BP8A 3FT2A 2ZF8A 3O9WD 3WMSA 2AABL 1YPZE 1JMXA 1EZSA 3H2PA 5IVZA 3S97C 1YEEH 2X4TB 4F1SA 2UZPA 5ESVB 3TNNA 1TQWA 1UT1A 1A9EA 1JV2B 3HC2A 4RWYH 4I1RA 3WJLC 4APXA 4A7GF 4NQDD 4GKNB 3TP4A 3SB3A 4PLKD 5A43C 5KS9E 1H9DA 1AGEA 1FP5A 3G08A 1WEJL 4W9GC 1RHHA 1UWFA 2X4PB 5JYLA 2KLRA 3EGXA 4W9CC 1KGCD 5HXMA 3ZGHA 3CVHH 4OJEH 1DUZB 1O5DT 4KY2A 1I3RB 3OB0K 4EN3D 1UTDA 2JNZA 4JRYE 4Z1PA 1K85A 5DDHB 4B60A 3IJ8A 2X10A 3QR1A 1J5OH 2BM3A 4OKDA 1YEFL 2NY3D 2OJ1A 3CTTA 5H2BB 2E4TA 3RWFA 1DLFH 4LCVA 1KXQE 1WRFA 1S3RA 3U0TA 4M1GH 5IBTH 4OBSA 1ORSB 3CFEA 3ZHDA 2D2CC 4LCCB 1D5MA 4Y2OA 3SBQA 4MJ5A 3QDAA 3MJ6A 3UAJA 2K0RA 3ESVF 5JXED 4FMVA 3AC0A 4U3CA 3O2DL 1UB5B 1BOYA 1BLNB 4LBAA 5G4OA 1ZK5A 3B9KB 1QQDA 4YDMA 3R1GH 3HE7A 2FBRA 3INUH 1E3ZA 3L3KB 1ZA3B 3MSPA 4IDLA 2WLYA 3MJ9H 3P73A 3L3JB 3PQYA 4CJ1A 2ZX9A 5ECJE 3W57A 3B3BA 4G9FA 4GSDL 2HZHA 4YK4C 4BFBD 5BOPA 4NUJB 4R4BA 5SWQB 3CN3A 4NM8H 3U4BH 1ZGLP 2WMPA 1M7IA 2BVYA 1QFWM 4Z7VF 4ZSOB 5EZOH 4PY8I 1MUJB 2UY6A 3AMLA 4O02B 5E6IA 4H26B 1EAJA 2XTJD 4OM1L 4GQZA 2DYSB 2NR6D 3O4LB 1NCWL 35C8H 1L4IA 2Z0UA 1GGCL 4XE5B 3MV7A 1YEHH 4LPTA 4CC0A 2WXLA 3CUPA 1Z5LB 2O5ZL 3F7YA 4DZBB 3NSYA 4U1IB 5T1KB 3VFSA 4L3ED 5HDQH 4Y16C 1M3IA 3GSQB 5E6SB 1PGRB 4S1QH 1KCRH 3NJGA 5ILTH 4OFYA 2ED6A 4NBYB 4K23L 4F8OA 5ALCH 1JF1B 2VISA 3GMLB 4OCRL 1NEUA 4H20L 1W91A 3FSVA 2VABB 3KEHA 4Z7VE 4XOCA 5D7HA 4XN8A 5JOFB 4IBVA 3JV6A 3SPIA 5SWSA 2EC8A 1NZRA 1ONQB 1ZAGA 3JWNH 3VXNB 2AANA 3GSXB 3PGFL 4WI3A 3ZL1A 4BZ2H 1MHPL 4WF7A 1T1ZA 1TFPA 4ZRGA 4YO0A 7PAZA 1OF2B 3WEAA 2YPKB 3ZTCC 4I48A 1QBAA 1OT1A 1XF4A 3QJUB 4X83A 4J3OC 4ZFOB 4OCYL 4FC3E 3WGVB 2A73B 2X2IA 3QC5X 4L4TE 4HCIA 4M7JH 4AGNA 4YE0A 4NQSB 4X6CA 5BVPH 5CZXC 3CLEL 4BV1A 2QSVA 3NP3A 2CJTA 4AKPA 4NIYE 1KIQA 3QC6X 4WNQA 3LOWA 4JFVA 1JRHH 3ZTNH 4HS3A 1A4KA 4G2AA 3SO3C 4WWID 2CJUH 3DGCR 3E6HB 4IRJB 2RQ8A 4L5FE 1M1XB 1MCBA 2K3TA 4UAOC 2R8SH 5KYXB 5KSVB 3Q48A 3Q7JA 2GJ6B 2HH0H 3H1ZA 4DP5X 5DJZB 1IL1B 2BS9A 1NFKA 4DAGL 3O6FC 3VI4B 5IWLA 1TCRB 3MUGB 2BY2A 3PHOA 1A66A 2MCPH 2HX9A 3QYNA 4N22A 2JI3A 5C0CE 5AWNL 5KBDA 4N5EC 5D71L 4ZAKB 5EF2A 4XBEL 1E4KA 1HDMB 4MAYD 3A67H 32C2A 1QVOB 4WI7A 1F02I 1ZHLA 3NRFA 3SYOA 1MWAL 3QB7C 4M93B 4UB0L 3V55A 4ADJA 1VERA 1FDLL 3N85L 1OANA 5CXPA 3BH4A 4CADB 3ESOA 5TPWL 2MEJB 4Z7UB 3VG9C 2WXPA 3H53A 2NY5L 3PF2A 4UV7H 4HZ1A 4YQXH 1PQZB 4WI9A 3BGMB 4IQHA 2GJZB 3CBKB 5F9DC 3FO0L 1IGJB 1U33A 5ESQB 2AV7B 5LXGH 3GINA 4UIMB 4MQXD 1JXKA 1CFVH 1T0MB 1MH5A 3MRLB 4J3XA 3CCHB 4OIAA 4KQ4L 1QFPA 3CSPA 4FI7A 1KY6A 4HJSA 2DLFL 1K6QL 5E08H 3FYIB 4X6DA 2EIDA 3FUDA 4ZDHA 3D2UA 1X5LA 3DBXB 2RACA 4XNZC 5F1OB 4NI6A 2XIDA 3C8HA 5J6HB 1IQWL 3QI9A 1A6VL 3SCMB 3RTQA 1JWSA 4XNMA 2ESVE 2FGWH 2GJPA 3FU9A 4MD4A 5IJVA 3BQUB 4PMFA 3T9WA 4XC3H 5AW9B 5LAXA 3APFA 1S78D 3OR6A 4B9CA 5E24E 3MJGX 2O1AA 3WY2A 4MJ6B 4LDOB 3II1A 2Q7YA 2XRAL 1IC5H 4K8RC 1QEWA 1LNUA 1UYWL 4OM0L 4L3CA 1XL4A 2RHEA 2ODIA 3TBSA 1G84A 4P2QB 1TFHA 2X4QB 4RRPM 2I07B 1ETA1 1UEYA 2LAGB 2ZP8A 2E46A 2W5PA 3QIUB 4HFWA 3ABKB 4AE0A 2AC0A 1ZWIA 1NOAA 1YYMH 1KENL 3C6EA 4FNLH 1KCVL 1T7WA 4TMPA 5CHNB 3V4PA 4OCNC 1XF2A 5A2IH 3BWSA 4K7PX 3NJJA 5DHDA 5EWIH 1AANA 1JZ5A 4X99A 5E9NA 3I9GH 2DWSA 3CVIH 1PZ5A 2EDDA 4WEEA 4Z7NB 1TJGL 3IBOA 4JUSA 4BXSV 4Q0XL 5I16B 1VADA 3RWCB