3QUHA

Structure of heme transport protein isdh-neat3 from s. aureus in complex with manganese(iii)-porphyrin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
112
structure length
112
Chain Sequence
b'LTDLQEAHFVVFESEENSESVMDGFVEHPFYTATLNGQKYVVMKTKDDSYWKDLIVEGKRVTTVSKDPKNNSRTLIFPYIPDKAVYNAIVKVVVANIGYEGQYHVRIINQDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Iron-regulated surface determinant protein H
publication title Molecular basis of recognition of antibacterial porphyrins by heme-transporter IsdH-NEAT3 of Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Heme-binding protein
total genus 24
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3quhA00
3VUAA 2MOQA 5D1XE 3QZLA 4FC3E 3VTMA 3RURA 4H8QA 3QZMA 4NLAA 3QUGA 3OVUB 2ITEA 2O6PA 2K78A 3SZ6A 3QZPA 3QZOA 3SZKC 2ITFA 5D1ZI 3SIKA 5D1QE 4WJG3 3S48A 2Z6FA 2H3KA 4H8PA 4MYPA 2E7DA 4YMPA 2Q7AA 2O1AA 3QUHA 3RTLA 3QZNA
chains in the Genus database with same CATH superfamily
4UM8A 1Q94B 4I5BA 4E9LA 3TX4A 3N91A 3GMPA 1KY6A 1MPAL 1VPOH 1OALA 1R34A 1KTBA 3EKCA 4IRJA 3IEAA 4KNTA 4TUJB 1HZLA 2IBZY 1KJ2H 4PRID 3U4EB 4HEPA 3BE1L 1DLFH 1N64H 2FX9H 4KVNH 5DC2A 2ZSVA 4S10A 4XMKL 2IAMD 1AH1A 3I9IA 3HZMA 4TNGA 2E6PA 4WKXA 3AITA 3N41B 3O6MH 3QIUC 4O2FA 4PREB 2ZYHA 4R2GB 2DQFA 3WL9B 1HYRC 1OM3H 4Q9CA 1LNUB 4IOFD 5HHXL 2IVFC 3GI8H 4JZNA 2AZUA 3CAFA 3VXPB 1RZJC 4HUXB 4DP1X 1DFBH 2CM5A 2BSRB 3L9YA 2VQ4A 2PWGA 4HMEA 1RULL 1VGEH 2RGSA 4APQD 4XPHL 4HKJB 3VNZA 1TVBB 5J6HA 4HWEH 4G6MH 5B38G 6FABL 3FRPG 1WPCA 2MQCA 3Q7JA 1YEGL 1KBGH 1FIGL 2APXA 2W9EL 2YD2A 4EE2A 2F7PA 4JRLA 4M43H 3IF1A 3ZKND 3KPSD 3VFWA 4Y2LA 2Q3XA 5HI5D 2CCLA 3MLVL 5IQNA 2ZOOA 4DPCX 3UBHA 2Y1ZA 4V2CB 2XIBA 4A37A 1AIZA 2R56L 1ZGLA 3MLRL 4FQCH 5IEKB 1HEHC 4X5QA 1IGMH 3GDBA 4NCC2 2G3XA 5AW0B 3BJLA 2WXQA 4ZO9A 1CXHA 3RPIA 5IB3B 2ZNWA 3P9MA 4MMZC 2WIMA 4U6XA 2DYPA 1TJHL 4XXDB 3D69A 3F2LA 2PCXA 3K80A 2EDJA 3H3PH 2MOGA 4PEEA 2R4RH 3V8CA 1WAAE 4YDNA 4O58L 5JYLA 5AW8B 1A5FH 4AH2A 1G7LA 1TQCB 3RRQA 5C0GA 3ISYA 3ZT7A 3V0GA 1I1RA 2WQ8A 3CFJB 3FH8A 2GQHA 3KYNA 3G5XA 1B0GB 3FSOA 4OZGE 2R2HA 1I7RB 1AI1L 1HAWA 3SOBL 1BJMA 1EDQA 3CX2A 4HIHA 3QVAA 4Y1AA 1YQVL 2VRKA 3GSNH 4RVBA 4IHBA 4I18A 2Q2LA 3NZSA 3FB5A 3VXUD 4G9FB 4P3WA 4OGXH 4AV5A 4NO0D 2AQQA 4Y2OB 2WXMA 5HVWA 3FCSB 4E68A 4I87A 5DZOA 2OSLB 4UYPA 1XCQB 4FG2A 3TJHC 1F2XK 1WF5A 4WI9A 4YWGL 1UOVA 2B1OA 5HY9B 3SY6A 3GSQA 2V0AA 5E00A 5E24E 3BKCL 2FL5A 2VLKB 2WO3B 4GSDH 3UAJA 1C5BH 2OMNA 2EUZA 1ZLEA 1LXMA 3SDCB 1F4WL 1CD1B 2D03L 2X4SB 3BT2H 1OE3A 3FL7A 5AVXB 3W9EB 1OCWL 1OV8A 1GZQB 4ZFOL 2WSPA 3H85A 4N8CH 4GLRH 4P5KB 4QRFA 2UWEE 1XH3B 4JHAH 3GRGA 4Z7UF 2AJXL 1X4ZA 3MROA 4IBLT 4NZUH 4JQXC 3W82A 1VGKA 4OLZH 4JANB 2BSCA 2XPYA 3ET9F 4Z3FA 3BRGC 4KRPB 2CO4A 3ZMEA 5JHLH 2AP2A 4P06A 3GRBA 3LQZB 4OUOA 3PFUA 4XHJC 1NOLA 2CD0A 4NQDE 5F8QC 5EZPA 2X2JA 1JGDA 3MRJA 5TDNA 4E9XA 1AOZA 3BCFA 5I0YA 4H13C 4F9PA 1CYXA 4AGPA 1MHCB 1MJJA 2AEWA 1U8JA 2VKWA 4YHPB 1MCOH 2A9NH 2R23B 4R3SA 5F6IC 3MLSL 3ECUA 4N8VG 1TCRB 2A6IB 1H3VA 2O6CA 2BOLA 1M1XA 2CLZB 4MAYD 3T0EC 5GGRA 2A9MH 5J3HD 4N9GA 1RZQA 2RACA 4YDLC 2O4EA 2D3NA 1P7KA 3V7AE 3PGCA 4P07A 4JFZH 4BWTA 5L4JA 4XPTL 3HZYB 2DBLL 1G94A 5CP3H 5GS2D 3NSXA 5T5FH 4OI7A 4NC2B 4Y5VC 1UCTA 3QULB 5E2WL 3OWEA 2Z31B 5GS1B 5L2KD 4M6OH 4WY7H 3SQBB 3LDBB 3NN8A 4FA7B 4LB8A 4G1MA 4UT9L 1OTTC 3LKRB 3T6VA 3HR5B 2QKSA 3O2DA 4M93B 2CJUL 2NR6D 2DF3A 1DQML 3FTZA 4YLQT 5T1DH 3RUGA 2EDNA 3Q2LA 4GG6B 4G8GB 2DIEA 2XG5A 1G5GA 1KIPB 1XIWA 4L4TE 5EBLB 1HKFA 3KPNA 1FGVL 2XX1A 3LNIA 4UTBA 5IQOA 1V3KA 3QQ3A 3U1QA 3P2DA 1EMTH 2VERN 3PDOA 3QUKB 3BJ91 2CDEB 1NMBH 1S46A 1X3DA 4HK3J 3SBWA 5AUMB 2KC0A 3CIQA 2HJFB 3W3BA 4JO1H 1SDAB 2V4LA 5I1HL 1ZGLM 2YA1A 3QO1B 4B9PA 2LLNA 2XNAA 4AENB 4ODHL 2LAGB 4ODWA 5KSAC 3CLEL 1FZOB 4XVJH 4DP6X 4AQ1A 3MYZA 2JKIS 5JPMA 5TQ2H 5DVOA 3QSKB 4AZUA 1WCBA 4GY4A 2YRBA 1H15A 3EOBA 3LKPA 3NSJA 5CILL 3VRLF 1PG7H 1TZHB 2NW3A 5I1IH 1MFCL 4HSAC 5INDB 1LP9E 4LVNC 3WKPA 4WGWB 2O72A 3DXAA 5BMFH 4OZFB 3ULVF 3BN9C 4NQDD 2WVVA 4P9HH 4M8QB 2AQRA 3ALWA 3APMA 3O4OB 2KH2B 1A6UL 2CKNA 5GGTA 3GIVA 2VERA 3IGFA 1BQSA 1E6JH 5D5ME 4NP4L 1IKFL 1NMAL 3FHQA 5H37A 2GSMB 5H94A 3M1BB 3T4AB 5JXED 1KENL 1U41A 1EDHA 5F8RC 4KOCA 5I19H 1RJLB 3WXWL 2EXYD 3GT6A 2I9TA 1HZHH 1T2QH 4RFNC 3L9RB 3SYCA 4N2DA 4NQUA 4U3XA 3N40F 4H0GA 2VXTL 2YBGA 4PRIA 2X0VA 3IDXL 4ZUWB 1R5VA 2GJ6E 4XBPB 1MCQA 5DDHB 3DO7A 3CLFL 3PWVA 1D5XB 1P4BH 4LLYB 1NPJA 4TM9A 1X9LA 2IAMA 4ZPTB 3TO2B 1PLAA 3O6FC 2ARWA 2VW6A 5CBEA 2GYSA 3IFPB 4UQEA 2O61B 2ZXAA 3WS3B 1T3FA 4LKCA 4HS8L 5CZKA 3UDWA 5DXWA 5J6SA 1H8LA 2OLDA 1MW1A 4G83A 3ARDC 3F12A 2WWMC 1HQ4A 3O9WD 3FB7A 1HQRA 1CFVH 5D9SB 3FQNA 3NRFA 2V5MA 1CD0A 1TZGL 3UCQA 4L4TD 4JG1H 4LSSL 4APQA 4S1SH 4CILA 4Z8FH 2ZOUA 3UBXB 1TENA 2XT1B 3KPTA 4TYUA 2J88L 2YGOA 1ZLWK 5C0EA 2APTA 2RFXA 3I6GB 4A39A 1D6EB 1TT6A 3KPSA 5B39A 3SJVB 2GBAA 1RLBA 5JNYB 3FBKA 3H3BC 1MNUL 3AT8A 5IW1A 3NABH 4NM8L 3VA6A 5BJTA 4WI4A 1R5IA 4QRAA 4JAMB 4JRWA 5J8OA 1N2RB 1MCBA 1XZ0A 4F7PA 2OMUB 5ITFB 3GMLA 3UTQB 1AGFA 4H26B 3VO0A 4FQJL 1FHNA 4FI8A 1EJOH 1OANA 2H3XC 5E1IA 3K2MC 4CU6A 7FABH 1EAPA 2DKSA 1DQDH 2DWSA 4M1CD 2GCYB 3O2WH 1UQSB 4H8WH 2A0LD 2EEAA 1JNJA 4YSUA 3W0WB 3B9KD 3OB0K 1IGFH 1P7QA 4NZ8A 4UMSA 3LN4B 4X6EB 3QWRD 4L8SA 4FHJA 2FEDD 2QVKA 2NQCA 4PY7A 5F71A 3MPCA 1ZA3A 2FQEA 3SCMC 2Q0ZX 3X3GL 1IL1B 3FO0L 1PX4A 3TH3T 1D7FA 2BVQB 4KITB 1XTLA 3VQLA 3Q9PA 3IYLW 2PPAA 1QPPA 3U1SL 5JLZB 1EVUA 1T83A 2DMBA 2W80C 5IJKC 5I1JH 2MCPL 4NO0A 3PDDA 1N6VA 4U1HA 2BNRE 4PJBA 3KJ6L 3QNYB 3O6KH 2VUKA 4DK6A 2BHFA 3ALPA 4JREB 4CVZA 1J1PL 1E8YA 4FQXB 1A02N 3FSZA 3MGTB 3EYUH 3DRTB 3I3EA 4HFUL 2GJ6D 5GGSY 3KBFA 1GS7A 1IAII 2YAOA 5AENA 4HKBA 4H44C 4I7ZC 3WEMA 1DBJL 2AK4B 4JRYE 1EUTA 4UF7C 1WZ1H 2Q76B 1RUPH 2IPKA 2XRAL 1Y1DA 3H0TB 1I7UA 3LRMA 4ADIA 1W72L 4AQAA 1P5UC 2P8MA 1U3YA 5AWNH 2BOBB 1EZUA 4FG6C 4M5ZL 5CEYA 3QRGH 3BWAA 3TYGL 3ETBF 1N59B 2UXFA 4HUUB 3BKYL 1QLFB 1XGTB 4EUPG 5F9OL 1SVZA 2VNCA 1AMYA 1EANA 2XTJD 4P5TD 4YFLF 3SPHA 1GJIA 1N4XH 3BP6A 3SPCA 4RGOL 3D08A 2X2UA 1UWEL 4JDZA 2HTKC 1KJVA 4L5FL 3ZZSA 1R9FA 1B2YA 1K4CA 4KO6A 1BPVA 1FL6B 1HEZA 4Z7WB 2ADFL 4AC2A 1KEMH 4U3SB 4PJCF 5FDWA 4NB7A 4EI6B 5CJBA 1HOCA 2WOBA 4G7SB 4AKPA 5AZEL 3VD9A 3O2DH 4NQSA 3FN3A 5AKVA 1UJTA 1KTLB 4QOKE 1WK0A 5KUMA 3TA3A 3TT1H 1TOXA 2BSTA 1P4IH 3ABMB 2WB1A 5ADPH 5DJ0A 4KX9A 4MAYA 2XLLA 2B1AL 3KYKH 4ETQA 5IB2A 4UTBH 2GJJA 1P0SE 4OIIH 1KELL 4UCFA 5EEXA 3D8MA 3JV4A 3DV6B 1AKPA 4ZUVA 1P5VB 3LRGA 4MB5A 2NY0C 2D7PA 1ZJBA 3QUYA 4LCYB 5A2AA 1UXWB 1WAAA 2Z91A 3OKYA 4MSWB 1NEZB 5LBVA 3ZO9A 4R0LC 3MBEB 2YPLE 2WTRB 3TV3H 3LPPA 3L95A 2OCFD 1K3IA 4MZ3A 1ITBB 3AVEA 3KPQB 4YDKH 5ACZA 5L2KA 1MRDH 2A3TA 2Y3NA 4H4NA 1F8TH 4L0ZA 2HFGH 1ZHBA 2V5TA 1X6LA 1OLZA 5IBUB 3Q8AA 1LK2B 2HH0L 4P2OC 4X5WB 2P52A 4AYMC 4DHLA 2NR6A 3EYOA 2VAJA 3HC4H 4PCYA 3FHEA 1N3NB 4ISVB 2BNRD 2VR6A 4PJ8D 1U42A 1LD9B 1DJZA 3EJQA 4BRJA 4YAQA 3KW7A 3N43B 1KGUA 4GH7B 2L0DA 2GUYA 3VCLB 4IK6A 1X5ZA 4WEUD 4A7VA 4DPRA 5B7FA 5EA0L 4NQVB 2HP4A 1DJHA 3VD5A 3CFIC 4M4PA 5GGTH 5F1NB 4GKZA 3WGVB 5L4MA 4RMQA 4TULL 1QFUH 1QG3A 4JRYD 3ZE2F 1XO8A 4NKMA 4JY4B 4UB0H 3EO9L 4QKTA 5E4OA 4DEUA 1DANT 1ETZA 4PGEB 1Q1PA 3HI1A 1Q0YH 5TE4H 1CFNB 3AM8A 3DVGA 2R27A 3BKJH 1HH6A 4X6FA 3GF8A 4MCYA 5IR1A 3SDAB 1KTDB 1S8DB 2UWEA 4P3CL 1JZEA 4N24A 3K2IA 4RIRB 1JZ4A 4AGNA 4PJ9C 3GFUA 3BPLC 4TQEL 2C1OB 1M7DB 3VXMB 4L8BA 3D0VA 3RDTB 2V7HA 2VABB 3WJLA 5A2FA 3K46A 3LYRA 4FLHA 4KDTA 1KB5L 1Z5YD 4GXVL 1OAXL 2VE6B 4NKDA 2FWUA 5DQJA 4EIGB 4ZUSA 1X7QB 5BQ7A 3WN5C 3IMWA 5IHHA 5IW3A 3SDCD 1INDH 4NQDA 3MRLB 3SODB 1UA6L 1BAGA 5I16A 5HVHC 4LSPH 3S2CA 3K5SA 5HHNA 4PP2A 4PJDB 4UNUA 4QT5A 4Z77A 1V10A 2APVA 2J7LA 4QOKD 1E4KA 2BERA 4AM0B 4L9LC 4DN4H 1L7IH 2ADJB 1T4WA 1GAFL 4UWQB 2EDWA 1NAMH 2TSAA 3IB4A 5FGBC 2Y7SA 5JXEA 5T3ZE 2IG2L 1GIGH 2E46A 1A1NB 2J2ZA 5HYFA 1QO3B 2DWDB 2P9RA 5CD3A 3CD4A 4FNLL 4EOWH 1JPGA 3P2TA 3PHOB 4PJHF 3VFVA 3QE5A 4FP8H 2F7RA 4MMYA 4IS6B 4X6BB 2YPLD 2QMKA 1MZZA 3LPFA 12E8L 1RERA 4HLJA 1DJSA 2OX5B 5DUML 2RHEA 2Z7YA 3CQFA 4ZQKB 4ERSH 1GSMA 4LBEB 3RA7H 3RVVD 3EOYG 1L7TL 4OD1H 4XRCB 4GIPD 5CCGE 3FQWB 4HLEA 3CVCA 3CE1A 2X9YA 3WUWB 4Z7NF 3AS3A 1OTUC 4U49A 2P5ED 2W07A 4GSQA 4QR7A 1DEEA 3RJQB 3O9WA 5KBPA 4MA8L 2MOVA 2Z4QB 2ZOWA 3P73B 1MVUB 2P5PA 2EEDA 4L4TA 2KZBA 2VQ1B 4RAVB 4D9LL 4KI5C 4XCYB 2V37A 4AMXA 1KYDA 2A73A 1JE6A 4JY6B 3TFKD 1I8IB 3C2SA 3OKKB 1ZIAA 2BP3A 3SGEI 1JMXA 1MCHA 2ENYA 1ZT1A 5F96L 2ATPA 2APWA 4K5LA 1CXKA 3X17A 4NT6A 3IXAB 3V0WH 4F8QA 3FTWA 3QIUB 1VFOA 2VIRA 1CFQB 4YUEH 1EO7A 1A7PH 2GJPA 2HWZL 3ARBB 4BFIA 3MQIA 4AVKA 3P69A 3KYOB 4DCQB 4L37B 1W72B 2PPDA 1MWOA 3F7LA 3E9UA 1CF1A 1MW2A 5IBTL 1E3ZA 3U0PA 1UD5A 4LVHC 1R5WA 3SJVE 2VLRE 4AL8C 4AJYV 5HHVH 1E65A 5JW3L 3LS5L 2IDSA 5EBGA 5J9PA 3EJSA 1UKSA 3B9KA 1WFNA 2VW7A 4OU3A 3FRUA 4KO9A 3QWRA 5T1KD 2E7MA 5CP7A 1LO0H 1R3HB 4RETB 2OPCA 2Y5TB 5JQIB 4JCLA 2QVIA 1NGZA 5FK9A 2E9JA 3JTBA 4V1DB 3EO1B 3L4CA 3UO8B 3RWEA 5BRQA 3KHOA 3GEFA 1QBMH 1P9MC 3APNA 4WUUB 5FUOL 3MMEA 4K3HA 5D5MA 3W0WE 1A3LH 1AZNA 2CJTA 4PJIF 1N0XH 2YPVL 5JW3H 1U8OB 2YSTA 4UT7H 5F0MB 1P53A 4MMXA 3VVVA 3WO3B 5T3ZD 3CCHB 2YGNA 3VD1A 1BM7A 4PJEF 2JB6A 3L3OA 3TBSA 3E6FB 2G3NA 2W91A 4DAGL 1BQUA 2DQJH 5JOPD 5AW4B 2GJ6A 4OM0L 5HSFA 5IB4A 3VYPA 3QEGL 3IVKB 1TTAA 1YG9A 1FVCA 2VDLH 1H5BA 1AZZC 4AT6A 4EQ3A 1AGCA 4YHYC 1Q94A 3CN0A 3X14B 1MCFA 1QVOA 3AB0C 1Q4NX 1A9EB 3IDGA 1S3RA 3UERA 3E3QC 4IU2A 4FG4A 5AYTA 1B0WA 4IJTA 2J4WL 3ARTA 4MLIA 3LB6D 1ZPUA 1IGIH 3ABKB 3B83A 3JQOB 3HMWH 4P5TA 3UIYA 3UACA 5GS2H 2AK4E 5FR3A 1EGJL 4OJFL 4Y4FD 2YK1L 1VEOA 4PREA 1R0AH 1HHIB 4JFHE 4UV7H 2VQUA 4L8DB 4LVEA 4XPGL 3BAYA 4JFPB 2OXGA 3UABA 2QV2A 4TQIA 3VXPA 4HUXA 3WAKA 2PP9A 4R26H 32C2B 2OMYA 4JUTA 3QG6A 1Z0MA 1K4DB 1LVEA 2K4WA 1TVBA 4KQ3H 4LDCA 1MN4A 3JWNG 4WV1C 3RWFA 4H0HB 5F0LB 1JFQL 3LN5B 4Z7WE 4K7PL 2WNGA 5DA4A 4TNVF 2ZP9A 1JZDC 4OCWH 5CN3A 4KHXL 2VLRD 3SJVD 2YD0A 3DX8B 1EWHA 4XX1E 1A7NL 2IDFA 3G5VB 2XSKA 3ABZA 4CVXB 3EYSL 2DL2A 1B4JL 1KB5B 3CHPA 3TIDA 5ILTL 4JE0A 3VG9B 5M7QA 2FD6L 2Y07H 4KV5E 3WTSA 2FWLB 4J8RB 1DJXA 3RWDA 1B90A 3UPAA 1H3WM 2K4AA 5IB3A 1H9DA 5F6IB 1YECL 4JQIL 5EOCJ 4FTVB 2BHYA 4W9GC 8PAZA 1C8QA 4FLQA 4QRRB 5KVGL 1UXSB 3T0EB 3ZBMA 4GMSL 4WFGE 5IESL 5K1NA 4Z7OF 4YDLB 4ZNEE 2BNRA 4DQOL 5JW4R 3QUMH 4PJ8A 5A2JH 1C1EH 1NCCH 2A5UA 4AIZB 4GEIA 5SWQB 1B0GA 3WNIA 1UJ3A 1EHNA 1J5HA 4GRMA 3QWQB 1LEKB 4NLAA 2A77L 1FZJB 1DJWA 5JHDB 2WKGA 1AHWA 1TEGA 3VXTB 4M8UA 1MFUA 1G0DA 4Q74A 3SGDH 2ALWA 2G3ZA 5CLWA 3VGBA 4JKPH 2CGRH 5KBNC 2XKNB 3ZTNH 2OMWA 3TN0C 4JRYA 3IGLA 3U6XA 1MY7A 3PJLA 4Y2OA 4MXWL 2VRAA 2XA8L 2J1ZA 2AK1H 2HLEB 2F8OA 1AC6A 3FCSA 1MJUH 2BMKA 2J43A 3ALXA 1GY1A 2OSLA 1NLDH 1L3NA 4M8RA 4Z76B 1CT8A 2FT8A 3QXWA 1CVRA 4WFFD 1CFSB 4LSQL 2HLAB 3DHMA 3VFRB 5CEZE 1J11A 1BBDH 4MD5B 1EEUA 3QJVB 4B5ZA 4GW1A 2I26N 3C6LD 1MRCH 5D4IA 3PDGA 2PPFA 4N0CC 5JXAH 2KERA 1CFBA 4PLKC 1IBGL 2B9BA 4HIEA 5F9AC 1CK0L 4N2CA 5J1AA 1GS6X 4DN3L 3SDCA 1Q9WB 2X4SA 4JFHD 1BJ1H 3W9EA 2QHRL 1GZQA 1BQHB 4AYDC 1BZEA 2XXCB 4L1SA 3FQRA 4P5KA 4R5VA 4AYFB 4N2GA 1WWWX 3CFEB 3RHWF 5FYLD 3P0YH 2MSPA 3GI9L 3K7UA 3CWGA 4QOKA 4H7VA 5DJ2A 2ERJC 2A1WL 2H6PB 4BQ8A 4J1UB 4BJLA 4IYKA 1NBQA 2X9ZA 3SZKC 5C0RL 3VG0H 4GS7C 2VM4A 5T1MB 1WBYB 5I8OH 4KK9C 3UZQA 3DIFB 1MHCA 4PJDE 5GGRY 5HD8C 5I6XC 1ZV9A 2KLTA 3QI9D 3UGXA 4DESA 5JZ7C 1E27B 2YPLA 1TCRA 1A7OL 4K9EH 2ZWKA 4H1LG 1CMOA 2CLZA 4WW1B 5F88B 4F33A 1Z6JT 1BFOB 4PS8A 1JVKA 2WC7A 4MTMA 1GTFA 4NZTL 1E50A 5TFSH 3QR2A 1U36A 1QYGH 4UQ3B 2P5EA 5CKGA 4RGND 3HZYA 2G2RB 3TIEB 4RMWA 4WFGD 3HBPA 1WTGT 4C8XA 3KL5A 3MBED 1ZCRA 4QRQB 1JNHB 1G7QB 4XB8A 1FHGA 3QA3B 3LNGA 3QULA 2VUYA 5GS1A 3FT0A 1T04B 5K5YA 3CZJA 3KLKA 3SQBA 5JMOC 2FVNA 3ARPA 5HDWA 3QPKA 3EH2A 1NCHA 3CBKB 2E59A 4I1NB 4WSKA 1F58L 3O6FB 1UCBH 4MB3A 2EVFA 5I23A 2YC1A 4IOIB 3IE9A 3H9ZA 3HG1E 4D8PB 1OTSD 1JV5B 5DWPA 5EBLA 2FB4H 4QTIH 2WBJB 3W9DA 4Z7IA 1U95B 1MFEH 3T71A 4NFCA 4PD4J 2M83A 5IHZB 3QZNA 2N56A 1NCTA 5HDQL 5SV4A 2XN1A 2CDEA 3AUVA 3H2WA 2QQKL 2YHGA 3VGAC 5CEZD 4X7FC 2ZT9C 3CZKA 3U83A 2HJFA 3LNDA 2I27N 2JXMB 3FQXB 3HG0A 2XYCA 2C3XA 5AL0A 3N85H 4RDQF 5IBLC 1WT5C 3QO1A 2DY2A 4YS4A 4AENA 1AAJA 3MLTB 5T1KA 3F01A 4LQFL 4MQ7B 4P99A 4BWUA 2ED7A 4P2CG 3RTQC 3OR6A 4JMXA 4J6IA 2MQGA 1LO2H 5FF6B 2VYRE 1WFJA 4WW2A 4U1IB 1IV8A 1J12A 2AJYL 4MXQD 1MIML 1MAMH 4BH7B 2B0SL 5INDA 4FYRA 2XBTA 1S9XB 3NIFF 4OZFA 4FQ1L 1EO5A 3GMQB 1JNNL 4M8QA 2BVUA 1D7DA 1SDYA 2GABA 4V1DE 3PGFH 2J8OA 3S2AA 4XWGH 1PJ9A 1XAUA 4EVNA 2BZDA 4DP5X 4WUUE 2GT9B 3HJ0A 5DD6A 1WA2X 1EXHA 1NCBL 1Z0NA 3TJEL 1KLGA 1D9KC 5DSCA 3H42L 2YQBA 2VDPH 4Z7VB 1KACB 4ODVH 3O6LH 3QG7L 3A67L 2BX5A 5F6HI 1W8OA 4AEHH 2ESVE 4G43A 4AW7A 4FXTA 5LQBL 1TJGL 4TLTA 1LWJA 4XBPA 1YA5A 1D5XA 1HYSD 4LLYA 1REIA 3RX7A 1MCKA 4ZPTA 2XQ0A 3M88A 2YZ8A 1OCZB 1BEYL 4Y4FA 3PAZA 1RZFL 1NFDB 4B3VA 1YUHB 3DX4A 3ARZA 4U3CA 1ZS8A 3Q5YA 4R4BB 1WFOA 2EJ1A 1I8AA 2WQRA 3STBA 3JWOC 1ZHNA 1V7NL 5H2BB 4JFYB 5I1AB 5DD1L 1T89C 2KZ1B 2SEBB 3W37A 2FX8H 5I73B 3MRBA 1Y0LA 3V0VB 1A25A 5BVJA 4JFVA 1RZIB 3HG1D 4H8QA 2AW2A 1XSOA 1RVFL 2WAHA 4AL8L 5HYEA 3JWDH 5C09B 1H6FA 1KPUB 2BZCA 4PD4K 3AAZB 1JDAA 2R0ZH 3MRIB 4HJ0C 5F9WC 3T3PB 5I18L 4KKLC 2R83A 4HIXH 3I6GA 3FNKA 3CMOH 3V55A 1O9ZA 4FG0A 4A38A 4F15B 2NNRA 5ESQB 1PY4A 4AKOA 3SJVA 2VLRA 4K15A 2EIBA 3S5YA 5JNYA 2EH8L 3IKCB 4OLUL 1DL7H 3TBBA 2PWHA 3B2DC 4NC1C 1EO8H 3QIUD 2F7OA 3VTTA 5DURB 5HDBF 1Y1UA 3MJ7A 1NSNH 1TMQA 2BIHA 3RKPA 1QLEL 1J7VR 3D18B 4M02A 5ITBL 4MRCA 4CN6A 3KLAB 1OEZW 5A2KH 5DT1L 2PCFA 4TV3A 3RJOA 4BH8A 2VL5B 3CDFA 3FS9A 2D7NA 3H6JA 3L16A 1MREL 1YNKH 4JFOB 4KKRA 1BLNB 3UCRA 4UT6L 1JXDA 5B8CA 4MDRA 2NY0B 3KBHE 3VD7A 4O2CB 4AJ0A 4O4YL 4B5EA 4BINA 4YHIA 3QPQC 4F20A 4V1DD 2ZKHL 4N9OB 2QJDA 4R0LB 5F7UA 2BVQA 4OVUA 3CNKA 3LPGA 2R1WA 4LNVA 4NZRH 4ZMYA 5IV2B 3T0EE 3X1GA 1IU1A 4WUUD 4NUJB 1SM3H 1H3PL 1F02I 4WDIB 1QOKA 4DKEL 3QNYA 4G7YL 2HFTA 4YC2C 3QAZB 4FQXA 1YLBB 3ABLB 2ESVD 1K5NB 2XWTB 4K94H 4LHUG 4M62H 5JHDE 1JD7A 3GXMA 2G0LA 3M17A 5E99H 5AOKA 3U7YL 5MEQB 5GRUL 5BVPH 3GO1L 4A6YL 4LLQB 1JF5A 2X3BA 2RD0A 3C6LA 1FBIH 4LDLB 3T6XA 2Q76A 3RIFK 3ZDYF 3KGTA 2IFFH 3KVQA 4XP9H 1BBJA 4NHCL 4ALAL 2BOBA 4JGNA 1IC0A 3DA0A 1WBZB 3K3QA 4HUUA 1OO2A 3EGXA 4XP5H 2D3JA 1XGTA 4G7VH 4IEFB 3FN9A 4MJJA 4OGYH 3MRCA 3S6CA 1BVLB 2VDRL 3QH3B 3L1GA 3CSYA 5SWZB 1IZJA 1DO5A 3F7YB 3QHZL 2HRHA 4ZMLA 2OL3B 3D85D 3MUZ1 1RMFH 4HEPG 3TJHD 4XR8C 5TGBA 1GJUA 1YPZF 1FL6A 2AJSL 3KJ4C 2CPUA 4PJ9B 3BPLB 3EDJA 2R0LL 5C7ZA 5FYKE 3UEZA 3VB9A 4FFWC 1RZ8B 1WVZA 1UD4A 2I07A 3WN5B 3OG6B 3FTXA 5JDSA 2QSCL 3K6NA 2VDNL 3QI9A 1IEAB 2Z3FA 2WIIA 3DX6B 4PU2A 4X7TB 1JZ3A 4P4RA 1RK1B 5AW3B 1VFBB 5HVHB 3WY1A 4OFKA 3WEXA 4N28A 2CBPA 5CBAA 2YMXH 2IADB 1BM3L 1CXLA 2K45A 2NZ9D 5LKNA 1YNTA 2D7QA 2P5WB 3I9GH 4H0LC 4L9LB 4PN6A 3SBPA 1G7PB 1MRFL 4UILH 2VRQA 1D5ZB 1U4FA 4ZW3A 4MSWA 3CIAA 3T0VA 4XHJD 4ZNEA 3MBEA 2G9KA 3VRIB 4Q7DA 2NNAA 4G5AA 5ACLA 3OJDB 1FZKB 3GMMA 4AZ8A 1T1YA 1RZPA 4O02L 1NCWH 2KLSA 2R15A 1B6DA 1M9SA 1B2WH 1MCSA 3IETB 4GB9A 4KZ0A 2NY5C 3FB6B 4KGJA 5EO0A 1LK2A 3T0ED 2H0PA 4PV1C 3IJSA 4B53A 4R4FH 4BFBD 2QQLH 4OSUH 2FO1A 2EC9T 1NCAL 4L05A 3VCLA 3DX1A 5E03A 1ZLUH 5JHDD 2V6HA 3R19A 3WHE1 3EADA 3GRWH 5F1NA 3V95A 1QWNA 3S35L 2IQ9H 2P42B 4UU9B 2ZXCA 4XX5A 5K1VA 4OUUB 3HUJB 4G5ZL 5EN2B 5F9DC 4P48A 1XB6A 4JY4A 4N2HA 3ME0B 3GBML 2JB5L 1GPOH 1RZGA 3IXTB 3T65A 3PFQA 2P45B 1UD8A 1OTTD 3RYMA 1X5KA 2F58H 3GHBL 3T4YA 4H25A 3HS8A 2HKHH 4GRWF 1A4AA 1GZHA 3F83A 5AYUH 3DVIA 1OAKL 4RIRA 3ATDA 5E8PA 3FOMB 5BUGA 3EXLA 1AZUA 5AVUB 4WWPA 2C1OA 1M7DA 3PWPB 2XBDA 2FJSA 5LBSH 1A6PA 3QWOB 1XSKA 2ZUWA 2VE6A 2NTFB 1KV7A 3KPRB 2WGXA 5I74C 3U4BL 1IQWH 4ZO6A 2PWFA 4CMHC 3CVBA 4NIKB 3IGAA 5FYKD 3UO1L 1DQLL 1QSVA 4MQSB 4PR5B 2CDFB 2EDXA 5CJ8A 5LGHL 3DX3A 4PJDA 1SXAA 1UM6H 2K0RA 3ROOB 3EGDB 1MFDL 3RPBA 3QGVA 5EZJB 2CU9A 2FLBT 1BMWA 4AM0A 4DGYL 5KSAD 4R8WL 4PRAB 1T1ZA 3UGEA 3D3VB 3SEPA 2FT7A 3W5NA 3PHQB 3AXIA 4FMKA 4OCNC 3CDYA 1A1NA 4J3OD 1RZ7L 4OF0A 3QUHA 2C1PB 1QLEB 3BN3B 5MEOA 7FABL 1SF3A 1ASQA 4S0TD 2X1PA 3DUUA 4MX7A 3GB7B 4JDVB 4IS6A 5SX5K 4IBYA 4KPHH 4HJIA 4X6BA 4EBQL 4J3XA 3BN9D 4XMPH 1F3DH 1U6AL 4X6DE 1A8ZA 2NY6C 4K8RC 2OX5A 2CIKA 4WIQA 1WYJA 1XR8B 3N3EA 3NA9L 1JWSB 4LBEA 4Z0BL 3FYIB 4AQZA 4XNMA 3QS3A 3DIDA 3REWB 1O9WA 1EFXB 4U1JB 4HKZB 1KV3A 3D2UB 4YHYB 1TKWB 4MNHB 1NDTA 2KI6A 4XT1C 2PTVA 1AGBB 3MA9L 2Z4QA 3P73A 1I85C 3AB0B 1J8KA 2UZIH 3HG1A 4RAVA 3GXIA 4RBPK 4PUBH 4XCYA 3X2QB 5JOFB 3UTSE 4NO2B 1PSKH 1NFDE 4M3JA 3FO9B 2YRLA 3H2QA 1T22B 2V9UA 1BWWA 3LHPL 1JXKA 4RZKA 2DOCA 2Y7NA 4TSCH 4G3YL 3O6FD 3GIZL 4HJTA 4E42A 5AALA 1CD8A 5CN1A 2XPZA 4G2AA 4O51B 3QIUA 4JN1H 2WD0A 3QISA 4A6YB 3L2MA 1UG9A 5F89B 5DZVA 4NWTL 5B38B 3CHSA 2WZAA 2YKKA 4G6KL 5C09E 3T6ZA 4L48A 5DHYB 2QL1A 2V33A 3LXUX 3ARDD 3DSNB 3HE6C 3LZNA 3QQ4B 2WWMD 4L37A 3T3PE 5IIEB 2O5ZH 3L3IA 5JHAA 3OMAB 1T20B 3M1CA 2WNKA 5PAZA 1DO6A 3QORD 4YNYA 4HBCH 2K78A 2APSA 2EYTB 4WTQA 5DVPA 2X6UA 4DK5A 5I2IA 2VDRB 1ZPLA 4L0PB 1KCSL 4YJZL 4PRHB 4QRPD 3ETTA 5KJRL 1IUZA 4OF3A 4ADJA 4G6AC 2DEYX 3KPLB 1MWAH 3LPOA 4QKXB 2E7DA 4HCIA 3OLIA 1J0ZA 4FXGB 4K3JL 3WNLA 3H7LA 4V1DA 2H7WA 2WXOA 5F72S 2ZNXA 5BCAA 1A2YB 4X80H 5FYLH 2B3RA 5HYIA 5JA9A 1WWCA 4WUUA 3WIHL 3T6WA 3FCBA 3ZYIA 1DBKL 1RURL 6PAZA 2ZX8A 3U30C 3D05A 3A4FA 4X5RA 4MMZA 1BD2B 1U8OA 5DO8A 3GHEL 2FIRT 4HH8A 5FWRA 4KVCH 2HLFC 4OLXH 1Z66A 2ESVA 3IWVA 3E6FA 4J23A 4Z3GA 3ULUF 3L5JA 3JYCA 2DJUA 1N6UA 3MV9D 1AXTL 4GBXD 3IVKA 4HQQL 2NOYA 4LOFA 2X41A 4LO9A 4O2EB 1ULVA 3SCMD 2P47B 1RK0B 1WD9A 2X44D 3U6RB 5KSVB 3P3UA 2V7NB 1KN4L 3C9NB 4OKVB 3FCUB 1A9EA 5H37G 4YEFA 3LS4L 5AOIA 4AWJC 4F58L 2WTOA 1SLUA 2KLRA 4O02B 3WSQH 1SBSH 4KXZI 1W9XA 3L4YA 2VZ1A 1N5AB 1A1OB 2YD6A 3QT2A 3WNPA 3IU3B 5D96C 1MZYA 1HE8A 2PW2B 3D85A 1GGCL 4ONGH 3UTSD 4AE0A 4LRNL 1S7VB 3I75A 3I3DA 4N2MA 5IQ7L 2Z8RA 1M7IB 1NWOA 2J5LC 2Y25A 3A3YB 5KZCB 1CU4L 4KUCD 3P4MA 2YMTA 3P0GB 5BOZG 5TDOB 4UIKL 4YLBA 2VDKH 4HIIA 4MWFB 3U6XS 2XFXB 2AITA 5FO9B 1DDHB 4QHUB 4MA3B 5SWZE 1FFTB 4GAJL 1JF1A 3F62A 1K4DA 5H8DA 4DW2L 1M9WA 1ZGLP 5ISZB 1FZMA 3KXFB 3DK2A 1WFMA 2I7OA 4U1NB 4DP9X 3LN5A 3I6KB 1GMIA 2H32B 3ZO0A 3WJMA 1UOWA 4N6QA 5CLZA 1JV2B 1FLRL 2X28A 4N2IA 5CEZH 3G5VA 3TO4B 4N8VB 3VGFA 1OB1B 4KROC 5B39G 4IKIA 4CVXA 1V5JA 2N1TE 1YYCA 3IGUA 5F6HJ 3T6QC 3HMXA 4J8RA 3P02A 2B59B 5E8OA 3MNWB 5C6TL 2V9QA 3IU4H 4HCRH 5I6XB 2DM7A 1GW0A 1S7WA 2XWBB 3ABGA 3NACH 4LSTH 3U0TB 3V6ZA 2P5WE 4XPAH 5JHBA 5HI4C 5EORL 4OZHF 4YZFE 3VWKC 2OSYA 4OV5B 1UXSA 3T0EA 3D07A 4XZUB 2F1BA 5LBGA 2AJUL 3ZDWA 5GGQL 1U8CB 3V4UL 1UH2A 5IZ7A 4JEGB 2X70A 2PABA 4Y7MA 2VC2B 4RMBA 3DJ9A 4S11A 3NSDA 1SN5A 3ZL4H 2YWZA 3OQ3B 3ML9A 3QHTC 3DWTA 3UPRB 5SWQA 2NY0D 3WAJA 4LSVL 5FO7B 5ECGA 2QVMA 1NMCB 5JHDA 2VMEA 3MLYL 5IHUL 4ZXBD 4Y5VA 3RL1B 5JPNC 2CPCA 3IT8D 3UC0H 1E43A 1HILB 4PJGB 3KDMB 1NC4D 2NY3C 1ASPA 3QPXL 4C4BA 2R69L 3ZHLA 4QXWA 4XPFH 5IB1A 4P2OD 3TA4D 1QLRB 2JELH 3L4WA 2VISB 4L29A 5KANI 1CBVH 1HCVA 2J8UF 5LLIC 4YBQC 3OAUL 4Y1TA 5INCB 1CFSA 2HLAA 1PAMA 1AR1D 3C09C 1DHKA 1E28B 2WP3O 1OW0C 3LVTA 4WKZA 3VFRA 3CC5A 4KI5E 3CU7A 1OY3B 4MD5A 1AZCA 2MFNA 3HUJE 3O4LB 4OF7A 1G9NC 2E6QA 4Y16C 3O3UN 15C8L 1I1CA 5EHFA 5DO2C 5BW7A 2AJ3B 4K7PX 5IW6B 2DQEH 3S8GB 3SKMB 3L6FA 5D2NC 1QR1B 4NJAL 1Q72H 2XZZA 4I2XB 2OR7A 4M6AA 4IRZA 3CFEA 3QJZA 2Q8BH 4MB1A 3PWPE 1DSWA 1NCUA 5KSAA 3LH2H 5LCVL 1AIFA 4B9YA 3RTQB 4J1UA 3MRNB 4JN2B 2B15A 1F86A 4PWEA 3RZWA 3UJTL 4MQXD 3O0LA 5KTEL 5J6GB 2NSXA 4JFUA 4PJ9D 5KSBF 5T1MA 3S34H 4JW3A 3EYQC 3QBTB 3DIFA 4UM9D 4DGVL 1LGVA 3B2XA 3CX5J 2E7BA 3Q1EA 5TE6H 1GYVA 3SDYL 1QW9A 1E27A 1JTOA 1IGTB 1ETB1 1MY5A 3GMOB 3KLDA 2DKUA 3D3VE 3ISRA 5DZAA 4AC4A 3RVXC 5FLVA 5KAQG 1DSFL 1RZJH 1LO4H 2JJTC 5L6YL 4ODBD 1ILSA 3ML8A 5HGGS 1AG6A 5I5JA 1YEJH 1S7RB 4MD4B 4NGHH 4DT2A 4EXKA 1ADQL 2P5WD 3AQYA 3DJRA 2VXSH 4ZQTA 2LLGA 4UQ3A 1U8IB 3HC3H 3P4OB 4FHBD 1D9KB 1KIQA 2G2RA 3IMSA 3TPUB 3TIEA 1BVNT 1FYTB 2ZWYA 2J73A 5FUZH 1QA9A 5D1XC 1OM9A 3BOVA 4OZGF 1UZ8B 4QRQA 2AQ1A 1G7QA 1MHPL 3BMVA 4M1DL 4WI0A 4A2GA 4PGJA 2AS5M 4G82A 4MXVE 1T04A 4LL4A 5L8KB 4NHUB 4JG0L 1ZV5A 1BZ8A 3KH3A 1GHFH 3PWNA 1U8NA 4M56A 2JJSA 4LLMA 3O6FA 2W0FA 3D7PA 3RZCC 4IBTA 4WJ5A 2VXUL 3ZDZF 1BOYA 5AB0A 2BHUA 3E3QE 3MV01 1J5DA 3KW8A 1UT2A 4FMFA 1OTUD 4HMCA 4AMKL 2J1XA 4KRMB 1U95A 2Z65C 3ARDA 5DD5L 3TFBA 5IGXL 4PG2C 1GYWA 4J3WA 1IKOP 5IHZA 4GUPB 3K6DA 2ARJQ 2MPVA 5K9OA 1G4MA 2GK0B 3L2NA 4ZUTA 3QORA 5HDOA 4KI5D 2YAHA 5I76A 5DRXB 3MNVB 3B43A 2Z92A 4DTGL 3FQXA 2EZ0C 1PZ2A 5F9WB 2IDUA 1JTTA 4QRPA 2HPTA 3F85A 3L7FA 3MLTA 2WN2A 3MRHB 1J5OL 4IJ3C 4MQ7A 3WGUB 1HKLH 4LLAA 5CD5C 4XXWC 1X5LA 2GSGA 3RWGA 3MFGB 2R4SL 3QEHB 2IQAB 4NZJA 5FF6A 2PR4L 4MKMA 5BV7L 5JIQA 1K72A 3WXVH 3PWPD 1NANH 1NGQL 4RQQB 4U1IA 3ARFB 3MLZL 4HFWB 2KUTA 2I5YL 3MV7B 3CFMA 1VZGA 3K74B 1EFQA 3RNKB 2BOCA 1JPSL 1AQDB 2F0CA 1SEBA 1J10A 4PTTB 1RUMH 2TSBA 4UIMA 3IMUA 4NO3B 2YXVA 3MRGB 4TPRL 3U9PH 3MLUL 1E9PB 1ZVNA 1OPGH 4P46C 4YIQB 1OCCB 3ZR6A 3MV9A 2ZOTA 4GBXA 4QHNB 4XVTH 2GITB 1DBBL 2VOTA 3L8QA 1N12A 3G08A 4X6DA 3SCMA 4LCUB 5TH2B 1BD2E 2ZP0T 5JIKA 3VNYA 4PI0A 1ES0A 3BAEL 1CD9B 3CV5A 5IJKA 2NRDA 4YXKL 4KZDL 1ZLWH 5I0VA 2Y2TA 5EV7A 1ZLSL 1ACZA 4JY5L 4R96B 2BP5M 3TGXA 3V7AG 3WOVA 1L9RA 3CXDH 4PJ5B 3HB3C 4O5LL 5A16B 3APDA 4YC2B 3FUKA 1HFUA 3NCXA 1GZPB 2D2OA 3UTSA 2CAKA 1LK3H 1R3IL 3HMXH 4X99A 4XCFL 3MRMB 1NFDA 5IFHL 1YUHA 1OP5K 2HB0A 3VU2A 4KQ4H 4RZCA 1CE1L 4M7LH 1EFXD 3AY4A 5F44A 4MJIE 4AIXA 4EUPB 4WHCA 2C3VB 4YL4A 2SEBA 2HG5B 4WEEA 4OBRA 1WGVA 1KBBA 1CG9B 3WLBA 2H0JA 4BUQA 3OXRA 1P5UA 1RZIA 3ATEA 1SJHB 4QF1B 5GPRA 1Z1WA 3G5YB 1NCNA 5IF0B 3BSZL 2NX5E 1KPUA 1KDIA 1XGUA 3OB0H 4AXWB 1KCBA 2ICEA 3U36B 2K3HA 3MRIA 2DQCL 2WVTA 4NQTA 3P0VL 4DERA 5HHPB 3HG4A 4CC0A 5AW5B 2FZ3B 5FM5O 3TNMB 3P77A 4JB9H 1JYXA 5CR8A 4OF6A 1XB8A 5E2VH 2EVHA 1ET5A 3I84A 1KGCE 3L1FA 2VXQL 1R4XA 3I74A 1NKGA 2B4CL 5ISZE 1IARB 1A7BA 3BHBA 4OIAA 5E2TL 3STZB 1T7VA 1PZAA 5C0CB 2G2PA 2Y7LA 3OVUB 2VDMH 3CHQA 3HLAA 3VXOA 4DFHA 1CQYA 1PIGA 3KLLA 3IBEA 3Q3GB 4JG9A 1I9JH 1U8PB 2A9CA 3KLAA 5DA0B 5K69A 2J57A 2LU4A 2VL5A 4XE0A 1LP9F 3WIIH 2XX0A 4LARL 2WY3B 3S97C 1JSYA 1WAPA 4ZW8A 1FWXA 4RSYA 1CURA 2CRYA 4J3SA 4HPHA 2X6CA 2PETA 4F2EA 3HPLA 2Q10A 2DD8L 3OKMB 1MFBH 4CBPA 5DHXB 5FYKH 1FGNL 3VU1A 1F90L 5C0JA 4JJ5B 4MBRA 1L6XA 1BW8A 4IRZH 1FFPB 3FQYA 5IV2A 4ZXBA 4PRBB 3FF7A 1AO7B 3ES6B 1H8OA 2WP3T 3VFPA 4OLVH 2RTTA 4D7PA 4WDIA 1NC4A 4LMQI 4LLUA 1BD2D 2G2NA 1SBBA 2VMDA 5J1TC 1S9KC 1H19A 4M5YL 1YMMB 4KUZL 3IKKA 2YXMA 4J3OH 4JFTA 4GT0A 1WA0X 2J6EA 4P2OA 2C4FU 5JO5B 1K5NA 1MF2L 4N0FB 3RB5A 5JR1H 3HS0C 2BSDA 4QRUA 2W9DL 4M3KB 2H1XA 3FHAA 5JUEH 2E76C 4LLWB 3BUYB 1BVNP 5DFAA 1VZHA 5E9DD 4NKQB 1O9VA 4PJGE 3AT0A 2NXYC 2NY1C 4IRJC 3BDYH 1FFRA 1GSKA 4PVMA 5A2LH 4AE1A 4BQ9A 1NJ9B 1ZTXH 2VR3A 5D1ZI 5F7KC 1IIKA 3SE4C 4HHAB 5IOKA 2CO6A 4YBHA 3TN0D 3BRDA 4MJID 1CCZA 4P4KD 3SE6A 5DJ8A 1T0MB 3S8WA 5C08B 1XSJA 3QH3A 3RFZC 1O6SB 4P9HC 3F7YA 2F5BL 2LV4A 1FNFA 4GAYA 2OL3A 4X9YA 5B1BB 4LEXH 4R7DA 2FNWA 2NX5D 2JI3A 4MFHA 1EZVX 4DGIH 4PJ9A 5KZCD 3A23A 5FECB 2IBGA 3L3HB 2ZKYA 2ICWI 3L81A 1RZ8A 4QTHA 2ZCHL 1MW0A 1PNDA 2EE6A 4UM9A 5I74B 1L9QA 3L1EA 1AYRA 4X7TA 1JZ5A 4CMHB 1J9CT 1KGCD 1OAUH 3F05A 1RK1A 3L7EB 3K6SA 5FB8B 4BFOA 2QPEB 1OGPA 5ISZD 4G8FA 3T1FA 3DETC 2IADA 1CDJA 1FJ1B 4B7IA 2HVJA 2HN7B 2P5WA 3PAUA 4L9LA 5I15H 1T6BX 4I8DA 5DD0H 4OFPA 5EC2B 4E9YA 4I3SL 5FGBA 1JFHA 2AV7B 3FTVA 4QXUL 5LVEA 1JK8B 3NJJA 5ICUA 2F19L 1WS7A 3ZHFA 3CQQA 3Q8FA 1JGLL 4XAWH 3I50L 1NBVH 2DI9A 5JIIA 4KK9D 1C7SA 5EUOF 4F7KA 1RUQH 1SLVA 1UFUA 2I85A 4FZ8L 3D50A 4KK5C 4LKXB 2YKLL 5HD8D 4AK1A 5JZ7D 1DSYA 2QT6A 3FB6A 1N5YH 3BP7A 3H9SB 3SDXB 2YR3A 3LEYH 1J1OL 2YN5A 4MA1C 4FN0A 3O0RH 4NBXB 1NC2B 4GINA 2X6AA 3B7UX 2ZWNA 2FJFA 5K1JA 4P3DB 1TVDA 1PPIA 5D71L 4I1RA 5B4MD 1NFAA 1ED3B 4B9JA 3LCYA 2RCSL 1TTBA 1GJWA 3K4ZA 5HYJE 1CL7H 4AUYA 5EH1A 5B7MA 4A67A 3IDJB 3RVTC 5EU6E 5GRXG 2H0FA 1QW8A 1PU0A 1RFDH 4AEIH 3HUJA 5EN2A 3I02B 4XMLH 4FQLL 4HEME 3U1PA 1P1ZA 1PZSA 5HI3C 1FP5A 4TSBH 4PCSA 4PH8A 2AQPA 3EH3B 1QFWL 3PQYB 2XN0A 4H8WC 3U7WL 4ZW6A 5I17B 4RNRB 2EDEA 3QZPA 4P2RB 2UUDH 4F7TB 1JXGA 1B4RA 2FWOB 5CEXA 1TEYA 5HGBA 4L8CB 3UYRH 1HIML 4N2BA 1QRKA 1HTYA 2ZSWB 5KYXB 3PWPA 2YD3A 1X5YA 1F6AB 2V8LA 4GUCA 4CGUB 3PHSA 3DBSA 3DYMA 3HE6B 4PAZA 4AQ8C 4URTB 5HYQA 1ODUA 5AW9B 3SQOH 1EDYA 4K71B 1VPOL 4MDIA 4NKOB 4YFLI 2Q9OA 4NC1E 5IBLD 1RUKH 3OXSB 1KJ2L 3FZUC 1LO3H 1NH6A 5H35B 2NUTB 3QUZC 2R8SL 1DLFL 2IBBA 1N64L 3VQMA 2FX9L 4PRAA 3ZYZA 3GPSA 3KS0J 2ARJB 3MV7E 4FQHB 4FA8A 1IE4A 7TAAA 4F9PC 3BKMH 3D9AH 1LMKA 3MYJB 1O7DC 1JNLL 2C3GA 5DQDL 4YHZH 2C1PA 1P9MA 4GW4B 1OM3L 2CHNA 4ICWA 1KG0A 3GI8L 3WKYA 3FT2B 5KVEE 2BIIA 4JM4H 4AY0A 1MLCA 1MLBA 1DFBL 4D0DA 4X5LA 1F00I 5AG9A 2XETA 5ERWB 3FUFA 5CMAB 4DZ8A 4DFIA 4KKAC 2MIZA 5E08H 1M2OA 3LZOA 1XR8A 1HX0A 1ZHLB 4G6ML 4EI0A 4X50A 4GMTH 1E9OB 1NA8A 2HMIC 4L1BA 3LIUA 1KBGL 1EFXA 4ATTA 4GW5A 3R1GH 2IV8A 1UA7A 1TKWA 4MNHA 5CU9A 4XP6H 4YXLH 1AGBA 1BZQK 2QADC 4JM2F 3PCYA 4X98B 4DO5A 1AFVH 1JIBA 3EYFB 5JOFA 2XN2A 3MLPA 4XNUH 5CLYA 1IGML 4NO2A 3Q44A 4R6UA 5JOEA 4M9OA 1Q9KA 5HYJD 1II4E 1T22A 3EDKA 5EU6D 4X7SH 2XTSA 5C0AD 3BI9X 1A21A 2CBOA 2UY6A 1QSZA 4GG6F 3H3PL 4U0RC 2R4RL 4O51A 4WNQA 4ZBJA 1NLBH 2J5LB 3UC2A 1A5FL 4ZAKD 5F89A 1OHZA 2BLFA 4Z6AT 2JCCE 5LG6A 5DHYA 3QQ4A 5IIEA 3SBWC 2EILB 1ILUA 2C8NA 1W0WA 2DL9A 4QY8A 4ZPVA 1E0OB 1S5IH 4UQ9A 3GSNL 1B3JA 1I9IH 3JV6A 4FQQB 5A7BA 2EYTA 4WV1A 1QAWA 4ZT1A 3IDUA 4OGXL 5BO1H 4AQ1C 2VXVH 4KKLD 2BWDA 5EEVA 3RKDC 5C7XH 4F5CE 5AD0A 2C26A 3GXDA 5IJBC 1E90A 3TBTB 4LCWB 3TU6A 5C0CE 2DI7A 3B5HA 4KROB 3MGOB 5F7AA 3MO1A 3C5XA 4YBLC 4DVRH 4EKJA 1HWHB 2D7OA 1BFVL 1UB6B 1J8SA 1DVXA 3UOAB 4HDIB 4JHWH 4XCCH 3E9TA 4OM1H 2MPAH 2HJLB 3QC6X 4GSDL 4PV8B 4D7BA 1C5BL 4XH2A 1BD2A 2Y7MA 4KOBA 5BZDB 2O93L 4U6YB 4HJJL 3MRPB 5CN2A 2J72A 2E86A 3BT2L 4LLDB 3JUZA 3VWKB 1DE4A 1PX3A 2XU9A 4JFQB 1B4LA 4ECNA 2F6AA 4K07A 1X5AA 3A6BH 4N8CL 4JHAL 1UWFA 2KDGA 3BH9B 1G6VK 1KLFB 2RAMA 1SLWA 4NZUL 5E9DA 2L7EA 1F13A 4OLZL 3IFNL 1F4HA 4O2EA 4KQ0A 1RK0A 4XBGB 2AQNA 3QZLA 3QPQD 5CSZB 2QGEA 5JHLL 5KSVA 2ZIDA 1TZAA 1NOFA 3C9NA 1YMME 4OKVA 5CR1A 5DMYA 1RHHB 5KG9B 2VZOA 1HHKB 5JPNB 2D7MA 3TN0A 4MJIA 1DQIA 4B9FA 4P4KA 2F7QA 1PNCA 1A1OA 1PEWA 2NY3B 1SJXA 1MCOL 2A9NL 3IU3A 3CZUB 1U9KA 2PW2A 3FTUA 5DRWB 3UDWC 5KS9B 4TVPE 2NX5A 2CBTA 2Z7ZA 2JIXB 2A9ML 5F0PB 1S7VA 1AZRA 3ARUA 3LMJH 4XP4H 1OGTB 5D2LB 5GGSB 3C09B 5DUBB 1PL3A 2GJZA 2Y6TE 4Y16B 4PHXA 4JFZL 5EFIB 5TDOA 4J39A 3NZ8B 3ZE1E 3FT3B 5DJDA 4K5PA 4MJ4A 4QHUA 4CN1A 3WMQA 2LR4A 2AC0A 1I1FA 5CLTA 5ISZA 5T5FL 1XXDC 3DTDA 3MRRA 2APBA 5CCJA 4U1NA 4M6OL 4WY7L 2AAVA 3QXDA 3VI3B 2HSIA 1X5JA 1OF0A 3WFHB 2H26B 4WFHE 1JV2A 3INUH 4JFDE 2DM4A 1OB1A 3MKKA 1XF4A 3MUJA 2WLNA 4H1LB 1IGJB 1FSKB 5T1DL 5DQ9B 2A9AA 4A1RA 1XGPB 1QI5A 3KM2A 4MHHI 3T08A 4IRSD 4FFWD 3S88H 3QJFB 5C0CD 3MNWA 1KCUH 4I0PC 2XWBA 4JRXB 2F53B 1PY9A 2C9UA 5HDLA 1EMTL 5F1SA 1RJYB 3UL4A 4UQIM 3V7MA 4OV5A 4L8SC 1PEZA 2DQ6A 2BPBA 1JZFA 1U8CA 1ZSHA 2EEBA 5C0BB 3FQUB 3DURB 2ZUSA 3UPRA 4LU5H 1GRWA 1ET7A 1ZANH 3VXSB 5IP4A 1IAMA 1T83C 1PLCA 4P8QA 1O75A 1X5IA 2CJ3A 5D1XB 5MENB 3L4XA 1SY6A 3ARSA 1PG7L 1SEQL 1MJ7H 3WV0A 1UM4H 4XO5A 2WLIA 3RL1A 1JBJA 2WPGA 4PJGA 4PCTA 3KDMA 1HU8A 3AY2A 2BCKB 1EXGA 3FULA 1ASOA 5BMFL 1YMMD 1FNGB 4QUOA 2XXGA 4P9HL 1QLRA 5CO1A 4BHUI 2VISA 3RZCB 3NJNA 4OZIB 5BUAA 5F7DB 1MG2C 3WTWA 2A6KB 3VJ6B 4RX4D 1E28A 2NCMA 5TK2A 3OKDA 3E1ZA 4A2EA 1E6JL 1R33A 5E9AA 3ROLA 4U7SA 2VZ3A 2PW1A 4TVPD 5FYJE 3QJRB 3PQYE 3BZDA 5I19L 5IW6A 1BF8A 1E5UI 1XZWA 3SKMA 3MXWH 3FN0H 1T2QL 1C12A 4N2OA 3KYAA 5EOCH 5L8JB 4JDEB 2E7CA 4HCFA 3MRDB 5FKPB 3Q0HA 4NS0A 1A3QA 5FHAH 3LQAL 2OBGA 1JS4A 3D06A 4Z7WF 1YEDB 4JN2A 1JGEB 2GC7C 4GG8B 2JNZA 1MKFA 3TF4A 4ETYA 3SYAA 1UZ6E 3ZTCC 3OWRA 2ZCLH 3D1MC 1PMYA 3S0PA 4WFHD 3TBVB 4X5PA 4UOJA 5J3HC 2HX9A 4JFDD 3OGOE 1RIHH 2CK2A 1U92B 4H8VA 4R5XA 1CFVL 1IGTA 4KV5F 5TF1H 4HWZB 4XX1G 3R4DA 1PZUB 1IC4H 4S1SL 4Z8FL 4P46B 4X9IA 1BV8A 4BFKA 4CADB 1A0QH 4PV9B 4YLCA 1OWWA 5E6IB 1IAIM 1KCLA 3FTYA 3OKLB 4MD4A 2AJVL 2MEJB 5IB1B 5IUSA 5SX4I 5CFAA 2A7BA 4ZG1A 3G6DH 1U8IA 2AJZB 1D9KA 3M8OL 3BMWA 1A6VH 2XZCH 3NABL 4GQQA 4NNXB 3MLXH 3GQFA 3WIHA 4UDTB 3KGRA 5DMIL 2EYSB 2XACC 1HHHA 2MKWA 3TNNA 4IMLB 4Q2ZB 5D93C 3VTAA 2BW4A 3R4RA 3EH5B 5ICYA 5HYJA 3IFOB 3HB3B 3MCKA 3NK4A 5EU6A 2RB8A 1DQDL 5C0AA 2I24N 2AI0L 1PGRB 2N7SA 3O2WL 2CR0A 2NY6D 4H8WL 4K8RD 2Y7OA 4TLSA 5BQDA 5FKAA 4HUKB 3T2NH 3IK2A 4WI2A 4GP8B 1JN6B 4MCZA 3C60D 5BRPA 3FONA 3DO4A 1NC2D 4GSUA 3NZHH 4HEMA 4I0KA 4TNWF 5FXCH 3N43F 4ZAKA 4Z18A 5IBUG 5I5IA 4PGDB 1N68A 2BIOA 2ICWJ 5I75C 3GUTA 4ZYKB 4BFGA 3WNMA 3C8DA 2EE9A 4JL2A 4KK6C 1LEIB 4ZOCA 2GK0A 5EO9B 1MQKH 1CTMA 5DEJA 2DH2A 1JUFB 3GS4A 4KTGA 2VH5H 3L13A 5I1JL 5ESAA 3QS2A 4YHNB 5FYJD 1LILA 3O6KL 3T77A 3PQYD 1M56B 1ZJAA 3SO5A 1QQDB 2VSCA 4OLYH 5T1LB 1R3LB 3WJLC 1TCMA 4AG4H 3VD2A 1GA2A 3NVQA 1IAIH 3FU3A 3W1ZA 3BEVB 1SVBA 2VKXA 1YAIA 3BYTA 3EYUL 2IQAA 3QEHA 4LK4A 4R7NB 3SE3C 1IM3B 3GLEA 2PMZA 4TUOB 4JR9H 2NLJB 4KAQH 1MCEA 1VFUA 4RQQA 2PXYC 5EC1B 1F0LA 1SHSA 1VA9A 4HFWA 1OAZH 1A4KA 3P3TA 4JGMA 3SY0B 1FVEB 3RNKA 1I8MA 2ICES 1WZ1L 2P49B 1RUPL 1I3VA 3AG3B 4AEEA 3DOSA 4PTTA 4GSXA 1VHPA 3CHXA 3EJTA 4NO3A 3VFGH 3ZR5A 4AEFA 4M61B 5F2FA 5AWNL 5IT2H 1E9PA 4WTZG 3QRGL 1Z9PA 1DLHB 5HYQB 4U6HA 4AQEB 1JJUA 5BZWB 2NCEA 4Z7QF 1RPKA 4MAUH 5ID1B 1WEJH 4G6AD 4U1KA 2A6DB 3B6SB 4BSVB 1JGIA 1V55B 4KJQD 2CA3A 3CZGA 4D3CH 5CNHA 4LCUA 5TH2A 1O7VA 3M1OA 2VR4A 4OFYD 1JPFA 2H6OA 4IIQC 5KYWB 3TWYA 2OXHA 3T8XB 4HOZA 1XXFC 2Z8WC 1KEML 1TVHB 4H2CA 4R96A 2Z93B 3ZKSD 5J11C 3O2DL 3NGBB 2EYRA 3TT1L 2HLFD 1P4IL 3C8KB 1GZPA 1UGKA 5ADPL 1P4UA 1N19A 4BXSV 5GJSH 4K4KA 3KYKL 4Z3TA 3MRMA 4UM8B 1UUNA 4I5BB 4UTBL 5EUKA 5KOMC 4OIIL 3GMPB 3VI4B 5GRJH 4IRJB 2NXYB 4ODTH 1HSBA 2BVEA 2C3VA 4QLRA 3S9DB 2ZWLT 3FT4A 4PWIA 2PLTA 1BIHA 5G2NA 1UURA 1CG9A 3ETBJ 5FGRA 1KSRA 1SJHA 4OTXL 1TJXA 3FXIC 2VC2H 2G5BA 3TV3L 5KS9E 2JCCA 2VJ8A 4XPHH 4PYHA 3CGTA 4YDKL 5D2LE 3U36A 1OF2A 1MRDL 1U8MA 3LRSA 1F8TL 5F1OB 2HFGL 2QTVA 2YD9A 6FABH 3V9EA 4G6FB 2W9EH 3DHUA 4K9EC 4EDXB 3TEWA 1BQLH 1PKQE 1SY6H 4JO2H 4JZNB 1I75A 5KYUB 5I8KL 1S6NA 1PW3A 3T9WA 1I3GH 2RJMA 4X4MA 2X88A 5D2NE 2HZHA 2RALA 5K59F 1C5DB 4IRSA 3EUDA 3MLRH 1WJ3A 4W70A 3STZA 1CLOH 5J6HB 5C0CA 4OV6F 2A0LC 3Q3GA 2JKLA 2YOCA 2JKRM 3VI3E 2N59A 5GGTL 1XDTT 2P8PB 1S3KH 3DKHA 1QFUL 3B5GA 4PTUA 1WV7T 3B37A 4UB0L 1T7ZA 4N20A 4FJZA 4QYAA 4GIOA 2B3IA 2IFGA 1ZGLB 4NEHB 1Q0YL 5TE4L 3BKJL 3UX9B 3NIGB 4KROD 4F8PA 4JRXE 3RPIB 3RU8H 4U6XB 1FFPA 4UTAA 5IY5B 2H6UA 1NWPA 3D69B 3TL5A 3LKNA 2GIYA 4Z95H 2VR5A 3NEOA 5FA3A 1MCPH 3VSQA 3NIDB 4U05A 4MJ6A 4X4KA 3FK3A 5FYKU 5C0BE 5K9QI 4XC1H 4AH2B 1YMMA 1INDL 1MIEH 1L9OA 3VWKD 5JO5A 1M3JA 3NH7H 1VJSA 4ABWA 3BAKA 3G5XB 2KDYA 2R2HB 1A7QH 1UWXK 3IMTA 2FAUA 4LSPL 3FT1A 3EFOA 4RX4A 5D1XE 3BUYA 4HIHB 4EZJA 2C5DC 3VW3L 3WFBL 3AREC 4DN4L 1O5DT 4I18B 1L7IL 1C7TA 3FB5B 3LZRA 3C5ZC 4JQVA 4POZD 1G9HA 1FNSH 2X6BA 1NJ9A 3PS6A 1DEDA 5EZIH 2BY0A 4YE0A 1GIGL 4GI9A 3DX9B 2ADGB 2XTJC 4I48B 4P5TC 4HHAA 2KPWA 1HJBC 4OZIE 4TF4A 2YD1A 1JF6A 1PLBA 4BXVA 4EOWL 5CJXA 1T0MA 2XV3A 3GZQA 4FP8L 4ANUA 4R7LA 4ZFZA 2AJXH 3CXFA 1IEBB 2XCMC 3AMKA 3P9WB 5E00B 2FT6A 4U0QB 2BC4B 1KYFA 1ZOXA 4RFOH 1Z5LA 2JIXD 4ERSL 3RA7L 3ZE0B 1H6EA 4OD1L 4TUKH 3G5ZA 1F3JA 1K8IA 4OVVA 1NM9A 3ZL2A 3ASWA 5C0ND 4JFDA 1GGYA 2YFOA 2L7JA 3L7EA 3MROB 2X38A 1VGKB 4PJFE 1O5PA 3SGEH 3JWOH 3TH4T 3PWLA 1FJ1A 3LNHA 5CS7A 2K8QA 1AY1L 2HN7A 1U3JA 2VN5A 3QUZB 4KGLA 4A68A 1FYHB 4WU7A 5EC2A 3MRJB 1T1WB 5EF3A 2WB7A 3FU6A 5C0FA 3JYBA 1MJJB 2DBLH 3V0WL 1U8JB 5C70A 2IO5A 4YUEL 4Z78A 1A7PL 3EYQD 3O41A 1WH0A 1M1XB 3ZKMD 5GGRB 4N9GB 1DVSA 5KN5B 4JRXD 2EE3A 5I8EA 1A4BA 4YHKH 1P7KB 3UJJH 3RVXD 5IMLA 3L48A 4UAOB 4QYOB 4LBAA 3ZL1A 3C60A 4K3GA 4MJ5A 1BP3B 1NC2A 4AGLA 1QWUA 4R7XA 1DQMH 1UOKA 5FUCC 5ANMA 5C0BD 1AHWC 4Q9BA 1J5IA 4S2SA 1LO0L 1QTYT 4E2OA 1FQ9C 1ETJA 2IPUG 3CHOA 2FDBP 2GBUA 2QADB 1I85A 3IDJA 5KVEH 4OCRH 4TLKA 3IPEA 1MFNA 4NBZB 1QBML 1EHXA 3I02A 1A3LL 1N0XL 4ZSOB 3II2A 3RUGB 1YZZA 5GSVA 3PQYA 1SFHA 1N26A 2QTEA 3ESOA 4UT7L 2XG5B 4ODHH 1XIWB 3RBSA 4L3CB 3AUWB 2PKDA 1TUPA 4F7TA 3FPYA 5C6WH 3RP1A 1VRSA 1UEYA 5AOMA 3RWIA 1NCJA 3C2AH 2EIEA 3BAIA 3QQ3B 2ZSWA 1DJGA 1PZCA 2OMTA 4M7LT 5FCSH 2MCMA 1F6AA 2WO2B 3KWXA 4ZMVA 5JQ6H 1UT9A 3WTVA 4KZCA 2VDLL 5SX5H 1ZDQA 2YRZA 5CZRA 2KMWA 4FXKC 3MI6A 4M6NH 5CGTA 2XNAB 1YEFH 1JYWA 3MUY1 4F8NA 3N04A 4NKOA 4M1GL 4ODWB 2BS9A 1PTZA 1RLWA 2EZ0D 5I6PA 1F42A 4AQ1B 2WKLA 4E36A 2XJKA 2X4TB 1H15B 3BAJA 3EOBB 3HMWL 3P3RA 4LLVA 1OP4A 3BLPX 2Q1EA 3UMTA 1BZDA 2ZG1A 1HN1A 3NCMA 5EIQA 5M94B 5E1GA 3CSBA 2ZXGA 2WUCH 1ZT7A 2IMNA 3QQDB 4OFYA 1R0AL 2H1LM 4RBPH 3VSUA 3DXAB 4BKTC 1SN2A 4UV7L 4GW4A 2WVVB 4FQIH 1ET8A 5KVFE 1SHWA 4J3OG 1QD0A 2XPGA 3C5SA 2VLLB 5HDRA 5DS1A 1QTSA 1CLCA 3GIVB 5LNGA 4JFWA 4OT1H 4LPUA 3CLFH 4NBYB 1DQKA 1VADB 1ZHLA 2Y06H 5H94B 3F7KA 1VCBC 2GKIA 2E27L 4K7FA 2ROXA 1R6VA 3NJLA 3MJ9A 3U79A 2CQVA 2VT0A 1NIBA 1H3GA 3HBGA 4FJ6A 4PRIB 1R5VB 4XVSH 3HC0B 1TQWA 2WGNB 1NBZB 3DO7B 5AVQB 1OD9A 1I9RH 2UX6A 3PWVB 3EYFA 3ARGC 1V8HA 3CFUA 2Y07L 1KCWA 2OI9C 1G7IB 4UZSA 3VAEA 1BYOA 1SFDA 3J2PA 3NRPA 4ZTEA 5I0ZA 4BK4A 2IALB 4HGMA 3DMMC 1T3FB 2EEXA 3VI4E 3J27A 4YXHH 2YSSA 5BRZE 1DCLA 4UTAH 3BYYA 2XN9E 3Q5OA 3GM0A 3F12B 2J3SA 1K8DA 4KKBC 1HQ4B 3HRZC 4LP4A 5HJDA 3JZYA 5FA4A 1HQRB 3WENA 1GY2A 3FQNB 1C1EL 1NCCL 1BZ9A 4APQB 3COOA 2NY5H 1BJ8A 4KKNA 1NAMB 3VB8A 3S3JA 3ZMRA 2RFXB 2KS0A 4EF3A 1ND0B 4XB7A 2AEQH 3ILDA 3AGWA 3KPSB 4FQQA 1O7SA 5B39B 3NDYE 2CGRL 4HAKA 4JKPL 4RA0C 5DS8B 1PFOA 3ZTNL 5AEAA 4ZFQA 4TVPH 4V33A 2AK1L 1NGXB 4XI5D 1BOGA 1UFGA 1MJUL 1R5IB 2W94A 3PV6A 3FQTA 1ZEAH 1XZ0B 3DROB 5T1LD 4F7PB 3GMLB 1M6UA 1NLDL 1IJ9A 1A7RL 1UB6A 4J2QA 4MYWB 4Y89A 2YZ1A 1PQZB 5A1AA 4P5MA 1L9SA 4HDIA 2KQMA 1BBDL 5FM8A 2ZWSA 3U1SH 1PDKA 3LZFL 5D4JA 4ANVA 4HH9A 5JXAL 1MRCL 4DNLA 1GGBL 1XB3A 4I0PB 4NP9A 1SDDA 4U6YA 1KCVL 1F18A 4HCGA 3SE8H 3VWKA 2FYYA 2G5RA 4L8SB 1B4TA 3DI2B 5CFHA 1J1PH 4WU5A 5G4NA 1ZA3B 4R84A 4UAHA 3CDZA 2CIIA 1MJ8H 3BH9A 1KULA 3AQDA 3F84A 4OFQA 4U1MB 4X9HA 4DK3A 3P0YL 4ENED 1CICC 1AP2A 1UA3A 3NFPA 4Z7VF 2A2QT 3VXUB 3VFUA 1DTUA 2JJVA 4XBGA 2WXLA 3A47A 4FCAA 3NIDE 5DZNA 3KCPA 2EH7L 2WJ5A 5DK2B 2E5EA 1BIIA 1RHHA 5KG9A 3CFTA 3VG0L 2WBKA 1QNIA 4HAFA 4XNZC 4ADGA 4CVZB 2J71A 5JPNA 5L7XL 3S3PA 4OLWH 4ZUUB 2BS8A 3CPLB 5I8OL 3KZ8A 3TYGH 5CUSH 1YAZA 4XOEA 1F3RB 4DGUA 2J8HA 4NNYA 4LCVA 5KBDA 3CZEA 4HKBB 1KJ3H 4LSDA 3FFCE 4TSAH 4K9EL 3RGVC 5KS9A 3CZSA 4F1SA 1NCDH 3APCA 4HLZH 1E4XI 2JIXA 5D2LA 1GGUA 2A74C 4L5FH 2IPKB 3EBGA 3Q6FB 2WAQA 3MOBH 3OGCA 4X8XA 5DUBA 3MOQA 1E5AA 3TYFA 2P8MB 5EFIA 2NXYD 2NY1D 3CFKA 1PKQA 5BRZD 2DW5A 5TFSL 1OP9A 4C58B 3NZ8A 4K8RH 3FT3A 1CDYA 1YN6B 2WLJA 2XN9D 3ZTEA 3RG1C 1E5BA 5DEFA 5D2NA 4FYSA 5F9JA 3LSOB 3K4DA 1AVAA 4OFVA 3UTZA 4IQHA 3LKSB 4JDZB 3W57A 4CW1A 1KJVB 4B95C 2NNFA 1I82A 1K4CB 2HX7A 3VI3A 1HEZB 5C2BH 2IJ0C 2YXWA 3WFHA 2VUOA 2AGJH 2R39A 3OKOB 3FUMA 4FDWA 4HC1H 3IWUA 5FDWB 3FFDB 1UCBL 1WZAA 1QATA 2ZX9A 2DS4A 1RIUH 1XF2A 3SPJA 1WA1X 4ZK8A 2DMGA 2F5AL 2VDLB 2BSTB 4WWID 4F7CB 2FB4L 3UP6A 4QTIL 4X4XA 3NCBB 4FEMA 1MFEL 1GC1C 4IGBC 1HDMB 3EJYD 4JRXA 3NEEA 3X11A 4PPTA 2X9WA 3FUHA 3JV4B 5L88L 2DQDH 2X4PB 2EABA 4PMFA 5B8CC 2VMCA 4R83A 1O7DE 1DZ0A 2HT2D 2DIJA 2JJTA 4LDEB 4NYLB 4YHOL 3DETD 3Q1SH 3X1EA 3N85L 2Z91B 3T04D 1NCOA 2MH4A 2PCYA 5C0BA 2GI0A 3DURA 3FQUA 2UZXA 3CN3A 3NJHA 3L95B 5L8LB 2AEOA 4OLEA 2ZX7A 3U25A 1N6QH 5ACZB 5L2KB 4KWUA 1LO2L 1ZHBB 5F7EH 3GMRA 2JFCA 5DMKB 1LM8V 5D93B 3TCXA 2BVTA 5GGVL 1KCRH 4KK5D 3EYOB 4LSUH 3LIZA 5I6LA 2W0KA 3RVWD 2FTAA 1FNGA 3FO2B 5C07D 3DGGB 4FMVA 1IQDB 1O0VA 1KLUA 1WIUA 1IO4C 3RZCA 3VD3A 4KFZC 4DKFH 5F7DA 3C08H 1YNLH 1BCIA 5EOQH 3VJ6A 4OCXH 3PGFL 1KWGA 4OD3L 4QRTB 4XWGL 1N70A 3C87A 3M45A 3GXNA 4L3AA 5I75B 5JW4M 3FFCD 1AQKH 2VM9A 1JCVA 1U0QA 4PG2A 5E7BA 1OAXH 1LDPL 2D7TH 2NY2C 4FCHA 4NKMB 4ZSOE 2QR0A 3C6SB 2VDPL 3RVTD 3O6LL 1T7YA 1OE2A 1ETZB 3RIKA 2VSKB 2CHXA 4M5TA 3HI1B 3MZGB 2EUWA 3LTVA 3GJFK 3V6OC 1I7TB 2IOMA 3MJ9H 1HH6B 4JGJA 4X6FB 2GEQA 1I1AC 2N7AA 2B14A 4MCYB 4QTFA 2UWEB 2ORBH 1E40A 3MRDA 3QQXA 3II3A 2BVOA 3QCVH 4L8BB 4XXWA 2V7HB 2WSDA 1GAFH 4PJFA 4LASH 3QQ9C 5DQJB 4GT7A 1ZLVK 1IX2A 1FNEB 4I4WB 4OAWB 3QUMB 4Y9FA 5JW5B 3K5RA 4GP5B 3QI9C 2PXYB 4ZTOH 4N1EA 4FQPA 3E38A 3KG5A 1K6QH 4Y5YA 2ZXQA 5DD3H 4W6WB 3IDMA 1ETA1 1A9BB 4KMTH 1U92A 2GSIA 1TLMA 2FX8L 4PP2B 1TTRA 4QT5B 5DK3A 3K8LA 4D94A 3K8KA 3TTSA 4Z7UE 4KNQA 1PZ5B 4XC3H 3JWDL 4CADA 2I9LA 4RGNC 3FZUD 4PV9A 1JOIA 3WJJC 2R0ZL 1TETH 5IVZB 1XH1A 3QUZD 4HIXL 3BDBA 4G8IA 3BZ4A 3CMOL 3FJTA 4NI3A 5DMGC 1JWUB 2MTAA 2WXIA 3D25A 3H2PA 5I26A 3RL2A 1PG7X 3ZSSA 1JZ6A 3ZGHA 2EUVA 2WCSA 4GAAA 1DL7L 4NJ9H 1FL3A 1EO8L 1L9PA 4MMYB 4RRPM 4Z3IA 4GJTB 4MRBA 1ZTMA 1FDLH 5D6CA 2I69A 3F6JA 3RPKA 2D0FA 1NSNL 2X40A 4Q2ZA 1S4IA 3X3FH 3RX5A 1X7TA 5J11B 2D73A 3IFOA 3HHMA 4TS6A 1OXYA 4KKAD 4LNRA 4NQEE 5FGCB 3T0DA 3BO8B 5F96H 3AACA 1YNKL 4XMZA 1JN6A 3T2QA 3S96A 3W81A 2HMID 1DEEB 2OK0H 5EIIA 3TXAA 3F7VA 1XQ4A 4LIQH 1QEWB 1EH9A 4L4TB 4UINH 1M7UA 2CG9X 4ZYKA 1ADWA 1G1YA 2Z34A 2A73B 1TTFA 1FAIH 5CGYD 2FX7H 4X2UA 1TQSA 4NZDA 1VFAA 4HETA 4U1LB 5CCKL 1ONQA 1QACA 2Z35A 1IGCH 1KPRA 1SM3L 1D2OA 3FUJA 1BXXA 3QZOA 3ZRSA 3DUSB 2YPKA 4YHNA 3SN6N 5K9JH 4YSEA 5E4EC 4BK5C 4DP8X 2VIRB 4KY2A 2XICA 1QQDA 5T1LA 5AVZB 1R3LA 3WFZA 4X6CF 3ASNB 3BEVA 3QDJE 4K94L 5EULV 4M62L 2MNUA 2WQWA 4TUOA 4MNQB 5EC1A 3U0PB 5B7EA 1R5WB 4TQ8A 5BVPL 5FUOH 5J9PB 1FVEA 1VF5C 3THMH 1FBIL 5IM7B 3D30A 3B9KB 3GBDA 5JIHA 4MD0B 1IAKA 2IFFL 3FB8B 5T5FA 1RXLA 4XP9L 3H9YA 4JRFA 4M61A 5CP7B 4F8TA 1JZJA 2XXFA 4HP5A 2FJHA 4AQEA 1G9NH 3K0YA 1OP5H 5I6MA 2V9RA 4GYBA 4XP5L 4G7VL 3RKDD 4BZYA 4OGYL 3W39B 5I1LB 4WWKD 5ID1A 3QDGB 4YEEA 4N90E 3QEGH 4BSVA 1Q9LA 5EN3A 2XDHA 3UPCA 3VRLE 2MOQA 2YBRB 2WXJA 2WANA 4W68A 5KYWA 3T8XA 5DFWH 4OY9A 2JB6B 2DQMA 4N2LA 4CVWA 2X1QA 1TVHA 1DBMH 3ULVE 4RAUB 2K70A 4LMQE 4EDWH 3VD4A 3C8KA 3VXUE 4NENB 2LU5A 1FVCB 4PJHB 3HS0A 2QSTA 3CVIH 4N68A 3A4DA 4NUGH 1AGCB 2YK1H 1BXAA 2YMXL 3JV0A 4HPOH 4PLJD 4P5RA 1QVOB 3AREB 3IDGB 3I9GL 3RWHB 3VI4A 1UYWH 1D5IL 1U3ZA 4IU2B 4NQED 5AVRB 4UILL 5DLLA 5BRZA 4U2YA 3TOPA 3OMZA 1T66D 2AANA 4CMMA 4JZOB 2XN9A 5CZXD 1UWGH 4I3RH 4JE4B 1I9EA 1U93B 2XTJB 3DLQR 4P5TB 1AS8A 3SE4A 4WK4B 2VL4A 1JGVH 3AS1A 4CDGC 1FIEA 1XTMA 4HZLB 3UYPB 5A2IH 1AMXA 1NCWL 3RFZA 3PJSB 3HNSH 1JFQH 1B2WL 1E5YA 2D8KA 1OAQH 2ZQKA 4EDXA 5D4QA 1J1XH 2OXGB 4FS0A 4RA3A 5KYUA 2IANB 2CHDA 1A7NH 2VSMB 4NRYB 2OMYB 4RMRA 5D1QC 3B9VA 4R4FL 3LIZH 3EH1A 5B1AB 1GKEA 1C5DA 1PZBA 2QQLL 3QG6B 2ZX6A 4OSUL 1JI2A 1FFQA 5DZ9A 5T3ZL 1RAMA 5BPPA 5DMJB 3WY4A 2VDPB 2YAPA 4KTDH 4M7ZC 3QDJD 3RWFB 3LNFA 5AW2B 1KB3A 3R8BB 4NQXB 2IQ9L 2P8PA 4P0DA 1JZHA 2Q8AH 1E30A 5KVGH 3MSPA 5IROD 3SKOB 2B2XH 4DQOH 3QCTH 3TBWB 1GPOL 2R2EB 4XN4A 3VX0A 1ZVYA 1FFNB 3TIDB 4U6TA 1OSPH 1JDDA 2F58L 2WCGA 3D48R 3O11A 3RWDB 2HKHL 4N2AA 5GZNC 5AYUL 2G30A 2A77H 1LE9A 4HG4J 2W9LA 4HBQA 4HJEA 4PYGA 4ILDA 4XNYH 2PP7A 4AJVA 4N90D 3D4GA 3KCWA 3O3BA 2FLMA 3V0EA 3C5JB 3NCFB 4D0CA 3W2DH 4I0PD 2COQA 1EUUA 4DEPB 5AVTB 1IQWL 2BNRB 3LAFA 4TRPH 2EE0A 1T1XB 3HI6H 4PJ8B 5C07A 1KIUB 4N0RA 5L2KE 5GRZA 1UJ3B 2WCPA 3ELQA 4GRMB 4A7GF 5AKRA 1KFAH 3ULVD 4BSJA 2NQDA 1UM6L 4UNTA 2DQGH 4FYTA 2X6VA 1AHWB 1ACXA 2DMHA 5C2UB 3FFCA 2WLYA 3IN2A 2CA4A 2OMWB 4JRYB 1NM4A 5CCHE 3IN0A 1CK0H 1NBYA 3U82B 1XV8A 2ADGA 3DX9A 2BMKB 1UC6A 4I48A 4CSZA 2DLTA 1RP8A 2E9GA 3LVEA 4QO1A 3VSVA 2C9AA 5C6PB 3BUPA 1UB5A 1CT8B 3U2SB 4KPHL 4L3EB 4XMPL 3VH8B 1IEBA 5F7NC 3Q2WA 1OB0A 2HAZA 2BC4A 4L23A 4GW1B 4U4BA 3OAWA 3QJOA 4MA7H 2L3BA 4FF9A 5IG7B 4HIEB 3OZLA 4C56D 5J1AB 1MCIA 5LB1A 9PCYA 2OYLA 1PKOA 3PHAA 1HT6A 3VWJD 5J1SC 4AQ8A 3FQRB 2JK5A 5IOPB 1IBFA 2DQIH 3B2VL 1TSRA 3EIFA 3FAXA 2O6EA 3ZHKA 3GS0A 1I4FA 1TYRA 2IH8A 2NZ9C 2UZIL 4MJ2A 4OR1A 4QOKB 5DJ2B 3US9A 1D5MB 4PUBL 1FORL 4NN6C 2DWTA 5JYMA 2VSDA 1NFKA 1PSKL 3BFQG 3QUZA 1JL8A 3T0BA 5DRNA 2Y7QA 1B0RB 3HBQA 4X7DC 3IAGC 3V4VA 3BIBX 1T1WA 2YARA 4S0SD 1L6PA 3E80A 3CSPA 3UZQB 5DTFA 1UVQB 4PJCE 3TV8A 2WXPA 4QWWC 2G9HA 1HL5A 1WO2A 2LAAA 3H4FA 1XL4A 2YPLB 4G80A 4YX2H 5J13C 2XWJB 2ED6A 5KN5A 4F33B 5EBWA 2O5ZL 4HG4K 3ZJAA 1J8RA 2E7HA 4JFFE 5FW8A 4NX0A 1S9VB 1ZMYA 4HBCL 2CR6A 2P5EB 4QYOA 4ZI8A 4PJAF 3JT2A 5E6ZA 4MZ2A 4OQTA 1AGDA 1GYAA 2JWYA 4Y4HC 1AGEA 4P2YA 4HV8A 3ECBB 4YN3A 4X42A 2AABL 4QHKI 5ID0A 4PS3A 4RFEA 4ZFGL 3D39B 5KVFH 1FRGH 3BX7C 4PGZA 4HOXA 5FGCE 1OHQA 5FYLL 3ARGB 4Y4KC 4H0IA 4JVUA 2QQKH 4KZEH 1U4EA 2WN3A 2VLJE 4NFBA 5EEZA 2YC1B 5FS5A 4ZSOA 2PO6C 2OS7A 3DMMB 5C0DB 4L3CA 3O81A 1UASA 3WNJA 1U8HA 1KN2H 3TCTA 4OLXL 3W9DB 1BZOA 2ZUYA 1L0PA 4ABQA 5E1AB 4AM0Q 3T2LA 2Z6FA 4H88H 4L1DA 5BW7C 1SGKA 2Y36H 4DWHA 2CXGA 2VZSA 2BJML 4Q52A 4KK6D 3UMNA 5F70A 1UHVA 1HVXA 3DJZA 4KXZH 5T1KB 3ZE2E 2D3LA 5JMRA 2IGLA 1IBBA 3WSQL 1SBSL 1ECYA 3OR6B 2DYRB 2X4TA 1ID2A 3ESUF 4MNQE 1ZWIA 4WCYH 3V9FA 3N1QC 4WWKA 4RMTA 1MFMA 4J3OC 3FUIA 4WW2B 5BZZA 1E2ZA 2FEEL 1U91A 3VXQB 4Z7UA 2EKSB 2VR9A 4BGLA 2LVCA 2R1YB 1NCBH 3HLKA 4ONGL 4S1RL 1SHMA 3QQDA 2C9SA 3TZVC 4MB4A 2PXYD 2ENJA 3TONA 5L0QB