3QUHA

Structure of heme transport protein isdh-neat3 from s. aureus in complex with manganese(iii)-porphyrin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
112
structure length
112
Chain Sequence
LTDLQEAHFVVFESEENSESVMDGFVEHPFYTATLNGQKYVVMKTKDDSYWKDLIVEGKRVTTVSKDPKNNSRTLIFPYIPDKAVYNAIVKVVVANIGYEGQYHVRIINQDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Heme-binding protein
molecule keywords Iron-regulated surface determinant protein H
publication title Molecular basis of recognition of antibacterial porphyrins by heme-transporter IsdH-NEAT3 of Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 24
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3quhA00
3RTLA 4MYPA 2ITFA 3QUHA 5D1ZI 2H3KA 5D1XE 3VTMA 3QZOA 3SZKC 2Z6FA 4NLAA 3VUAA 3RURA 2O1AA 5D1QE 3S48A 3OVUB 3QZMA 4H8PA 3QZPA 3QZLA 2Q7AA 2ITEA 4H8QA 3SZ6A 4YMPA 3QZNA 2E7DA 2O6PA 2MOQA 3QUGA 4WJG3 2K78A 4FC3E 3SIKA
chains in the Genus database with same CATH superfamily
1I3RA 1DBKL 4L4TB 4PJ5B 4N9GA 1B9KA 3OKDA 1QLFB 3LZRA 3O3EB 1DUZA 3QUMA 1O9WA 3WFEH 1C16B 2C9AA 4P5TB 1NAKH 2ALAA 2P52A 35C8H 4ILDA 4PWKA 4ZTOH 5C08A 3W0WB 5LKNA 3HZMB 1A9BB 1CK0H 4HS6B 1YNTF 3A3YB 5I1LB 5AUMA 1VPOL 4ZUVA 3ZDXE 4GW4B 3NOIA 5CR8A 2J2ZA 3MKGA 5T1KA 1QI5A 5D8JL 2WBJA 3MFFA 4XVUC 3L45A 4P9ML 3L16A 1ZY9A 3UO1L 1Y6KR 3X1BA 3LZFH 1MHCB 2GIMA 3S8WA 5KSVB 3K4DA 2UY6A 4NNXA 5D6DA 1E5UI 3B7UX 2JI3A 4H1LG 1RZPA 4IOFC 3H4HA 4C54A 2XQBH 1LO0L 4XH2A 3SBWC 5CP7B 1JE6A 2YEQA 4PMFA 3VQMA 5LB1A 4BQ9A 1YQ2A 1S9YB 1SQ2N 5HGHA 2X1PA 2IPUG 4HJGB 3SY0B 4MJ2A 4ONHA 1OTTD 4G11A 4NYLA 2H2PD 4HALA 1WAPA 3EH3B 2APWA 1HAUA 3EYSH 5F3BB 5HVHB 2GBTA 3CX2A 1NGYB 1FN4A 4JFPA 2PWHA 4PJXF 2GBAA 3VI3E 4BFGA 5AD0B 1ETZB 1KB9K 3AFLA 2XJKA 3QPKA 1PAMA 3IDGB 1KJMA 1Q8MA 2WMPB 3FUHA 3WLBB 3CUPB 3FYIB 3JWNE 4OF5A 2ZWKA 4OM0L 1GGBH 4ZQTA 2VR7A 2A73B 4U33A 2JCCA 4EI6B 5I6MA 5DVKA 4P9HL 4QI3A 5DUPH 1IAKA 4PGEA 2VR6A 1HXMB 1K5WA 5FEBA 1VIWA 4GBXA 4YLQT 3TBCA 1DO6A 5IWLC 4L29A 5E08H 1I1FB 1AXIB 1UCBL 2XBDA 1LWJA 3ZKNC 3T2NH 4XVJH 1LDPL 1UT9A 3RKDC 2NRDA 1JP5A 4BZYA 4CDHA 3EYVA 5DO2D 2C34A 4HJIA 3QYCA 4G7VH 1F1AA 5HPMA 3T1FA 5JQHC 2V3EA 3NSCA 3TZVA 1ZLSL 4NM4H 4AH2A 3RWEA 1X4YA 3TN0C 3MGTB 5D7EA 2BW5A 2F8OA 4RESB 1JGDA 2FX8H 3IDYC 3HC3H 4R7LA 3L17A 5HY9B 2A99A 1MJUL 4JFFB 2VDMB 2JKTM 2BDNL 2QSQA 1X5XA 2CAKA 1JTPA 4EIBA 1CL7I 2EXYC 1P4LB 3OSKA 4E0RA 2GJJA 3BO8A 1G9EA 3FFCE 1DVFA 4CBZA 3P1VA 3MUY1 1HNYA 3MRFA 3GMMA 1Z9MA 4GXFA 3RE0A 2NTSP 4WNSA 1ZV5A 5I0DA 3ARRA 1D5XB 3QXDA 2PO6A 4PAZA 3LKOA 5BVJA 3L3GA 1MQ8A 2YXFA 5I1DB 4ODBD 3UTSA 4IBTA 3H55A 2EDLA 4GSXA 4ODVH 3BZ4A 1WWWX 3FQ4A 4M61A 1AS6A 3OJDA 3U7WH 3S3SA 3IMSA 3L4YA 4PGBA 2N59A 4X5XB 3LHAA 1EXUB 3ILQC 1MFAH 3IGKA 3MVSA 1GCFA 2F1BA 4TQPA 4HDIA 2EP6A 5C0CA 3EZ8A 2XYBA 2FT6A 5D5MF 2YMXH 1LJMA 4HC1L 3CFUA 4AQAB 3UYRL 3K0WA 1KXVC 2BS9A 1J48A 4HHAA 4OFQA 5AVTB 1KLGA 2DTSA 3G04A 4X9IA 3QDGB 1E40A 2R23A 4K7FB 3GSUB 2GUOA 3SKJH 4GS7C 5HGGS 3LH2H 1T80A 4XPGH 2WKOF 1KTBA 2Y24A 5I76B 1KTRL 2HFFA 1NBCA 3CN1A 4HT1L 4YSRA 5ANME 2K4WA 4FEIA 3ULVL 5HJGA 4E41D 1CZ8H 2A1WH 1HDMA 2Q86B 3V7AE 1JIBA 4A2EA 3ULAB 3ROLB 3UERA 2DQIL 1QFWI 4GG6A 1T0MA 2ICES 3JV0A 1QRNB 4IRJA 5DJAB 5AW1B 4ETYA 5IFHH 3FTYA 1BZ9B 3FO2B 5AW3B 2BERA 1XCWA 3EJCA 1M1XB 4LLVA 4KI5E 5KTEH 3QSKB 4WDIA 4JQIL 4NLHA 4QRFA 3QORB 5DLMH 1MNUH 2ENJA 3HBGA 2ADFL 2AK4D 4XGZB 2YPKA 5I66B 5D1ZC 1DANU 3GS4A 3MV9B 2XWXA 1TJMA 5I8CB 1K72A 2HKFH 3ECWA 3U36A 4BKLB 4LNRA 4LARH 1NBZB 2VN6A 4R5XA 3OQRA 3WJMA 2BHYA 1YNKL 1E5ZA 2XTJD 3KHQA 5IMMB 2OI9B 4OZHE 1EJOL 4MDJB 1A1NA 3N1QC 4LPCA 2NZIA 4EIGB 4APQA 2VXQH 4TVUA 1BVOA 3N44F 4P2OC 5CP3A 2CKNA 4X2UA 4E9WA 2RCSH 1FYTA 1UH2A 2VZ1A 5BRZA 1SNRA 1UJ3B 3WKMH 4P5MB 1KOAA 4WI5A 5D2NC 5DZAA 5FC9A 1WGOA 5AVRB 2WXHA 3H7LA 4GT0A 2X7LA 4C4KO 5I1GL 4DN3L 1GW6A 2OXHA 3B2UD 4LPYA 5FGRA 3TN0D 1WDAA 1WVZA 3ZL2A 1E9OB 4M3HA 5FHAH 3QH3A 5K1NA 4H8HA 4KAQH 1SXBA 4XBGA 5BO0D 1SBSH 3QUKA 2DICA 2AXJA 1HHGB 3AXLB 3U2SA 5KVFL 4AV4A 5KSUB 2WXQA 4ZSOB 5LNGA 4CU6A 4NN7B 4FJ6A 4ODWB 4ZMNA 1CG9A 1HHIB 3DIVA 1AZNA 5L2JA 5HYJD 3HB3D 4K4KA 1FGVH 3N0PB 4UM8A 4HS3A 2L04A 2R8SL 3AM8A 4KC3B 3U82B 3BMVA 2F19H 4ABUA 1R3KA 1KPRB 3OGCB 3ISRA 5C92A 3ARBC 3MO1B 1ZOXA 2ICCA 4ZJ9A 1FL3B 3O6MH 1T1WA 3WMSA 3VGFA 4HWBL 4FI6A 3ILQD 3QI9C 5JHLL 1BM7A 3VI4B 1G7LA 2G5RA 4YX2H 4IEFA 1V27A 3IFLH 1HL9A 2XWJB 4LOVA 2XOTA 4XPFH 3C2AH 2QVTA 3FSOA 1JXJA 4Z7WF 1ZTXE 2P5EE 4LVOC 1T4KA 8FABB 4JM4H 3FRPB 2EE9A 2O5NA 4KRNA 4HD5A 3GQFA 5I8KL 3T1WA 3P11H 1T7YA 1S7WB 3I2CH 3KPSE 1T21B 4O2CA 3VWKC 1OW0C 2BVQA 2DMCA 1H3VA 4XC3H 3UTQA 2EDNA 3ARDB 4MJ6B 4MLIA 4RDQF 5HGDB 2MOVA 3GJFB 4ALAH 2IGLA 5DSCB 4F7EA 1SLUA 3FPYA 1N0LA 4IKIA 5KOMC 5T3XD 4YSEA 3TYFA 1FFNA 3VNZA 1N10A 5IEHA 1ADQL 1L9SA 2BFVH 3GIVA 1T4WA 5C9KA 4I3SH 2GHWB 5D7JB 2KH2B 4AYFA 4H8WL 2ZOOA 3QPXL 1P4IL 3MRRA 4JDVB 1AE6H 1LQSR 1KWGA 5GRXG 4FQQA 2W07B 4ELMA 1CVSC 4K94H 3RJQB 4HMCA 4NO3B 1INQB 4PJ8B 4JQVA 2OMYB 5FA3B 3THML 2X53A 1E5AA 3BGMB 1I75A 2GSIB 3GF8A 4K0OA 5CINH 1OSZA 3WFCL 2B7DT 4MS6A 4AYSA 3SDXF 2R2BB 4GKSB 1G7QB 1AGEA 3NH7H 3SGEI 2AV1B 4DP5X 2GIXA 4AT6B 1CCZA 1J1PL 1RVFL 4RZCB 1K4CA 4YL9A 3ROOB 1MAML 1AO7A 1D5IH 1N0XH 1CO1A 1AHWB 1T1YA 2Q7YB 3BKYH 4P2OD 2FX7H 4HIIA 3K4AA 1U93B 5GGRY 3DJRA 4PJIB 1ZLWH 1CL7H 4WJKB 5L7XH 4U1NA 1FSKB 1RZ8B 3F7KA 3WHE1 3ZPDA 1OV8A 3ABLB 3WGUB 2K0RA 1YPZF 4FQ2L 4GJTB 4FQJH 1F4WH 1OARL 1VKXB 3L3OB 3TO4C 2BWQA 4RWYL 3WL9B 4KK9C 2DWDA 3MJ9A 4UQEA 4AX3A 1S5IH 5B8CB 3WXWH 5FGCE 3MAWA 4PJXE 4Q9CA 1H9DA 3VFWB 1A9EB 5IF0A 5J9PA 1UVQB 3IGFA 3TNMA 3M8OH 3BRDA 2YFOA 2VLRB 1HXKA 1E9QA 4FG2A 3QGVA 5FDYA 3QNYA 1MJ7H 4LSPL 1MJ8L 3MV01 2VL5B 4YQXH 5E8OB 5GJTH 1S78C 1QSFA 5JPNC 1OAZH 3G08B 4O02H 4Z3IA 3VD5A 1U8LB 1TVBA 3B34A 4YHIA 1BZEA 4G1EA 3CHQA 3M46A 3VMNA 1KULA 1YMHB 2ED8A 5DI8A 3MDJA 3RJOA 1WD9A 3SDCC 5EU5B 1Z9SB 4L23A 3CFMA 2JKLA 1NCCL 4JZNA 4YHZH 1JPGB 5E99L 4RX4A 1AR1D 5LBVA 4CAGA 3OMIB 5IGXH 1EZVY 2D7TH 2I32A 3CN0A 4H20H 3TCTA 1WE5A 4DCQB 3QI9D 3MBEB 1AP2A 4QT5A 3FF8A 3H7BB 4PJFB 3B4NA 3OLGA 4ZO7A 1QVOA 3E2HB 3MRIA 2X70A 4PHXA 3L4CA 1QEXA 3U4EB 3AAZA 4WI0A 1E0OB 3OKNA 2WQAA 4YAQA 4GQPH 2O93L 1DBJH 2CIKA 5SWZE 4P2QB 1U2YA 3TYGH 1QZ1A 1LK2A 3LD8C 2I85A 1GC1H 2CDGB 3IU3A 3H3KA 4GUOA 5E9NA 1OGTB 5F7EL 1QFWH 3QJVB 1UADC 3NDYE 4LASL 1SN2A 3G5XB 3QQ4A 4H2CA 1OAKH 4N6RB 2F0CA 4AZUA 1XB3A 3S5YA 4OI9A 4GI8A 3BC9A 1I7ZA 3MU3A 4WFED 4U6XA 1UA7A 2F53D 5CIPA 4Z7UA 1JG9A 1WCBA 5IROC 1MCPL 2ZX7A 1NKRA 4AE1A 1I7TB 1XD1A 2GITA 5DJ6B 3FN9A 3DVNB 2OSLB 3FFCA 1EA9C 2ZUWA 4UCFA 5F9WB 4EN3C 2P8PA 1GGIH 4G6AC 4RWHA 1DN0B 4FHKA 1NSNL 4ZXBB 3FO0L 3FQYA 5ICXA 4JPVH 4GW5A 4NP4H 4MBOA 4A6YB 3JWDC 3MFGB 5GIRA 5FF6A 5D5ME 5DEZA 1I8MA 4UAOB 5DC2A 1YEWA 2GFBB 4C57C 4XPHH 1JPST 4ONOA 4LRIA 2MKWA 5MEQA 3MNWA 1OOWA 3K71A 3G6JF 4UTAH 2H8PA 2EDOA 2P8MA 3ARVA 4MNQB 4IGBA 2VIRB 5G4NA 1HINL 5KBKA 2KYIA 1ZS8B 4OT1L 4ZMLA 1J5IA 2WXOA 3BIKA 4WWKA 4XN9A 5HHNA 1CICB 3N0AA 4NC1C 5EUKB 1JCVA 1T89A 3RJDA 2MCPL 3Q01A 4K8RC 1F3DJ 1NMAL 3ZLQC 3AUVA 2P43B 2BOBB 3D3VE 2CLRB 3O0RL 5AL0A 2VITA 2OTUA 1E4WL 1T66C 2F8XC 5FOBB 1FG2A 5B1CA 5T1LD 5T5NF 5IMOB 2DD8H 3TO4D 4PV9B 2PCFA 5E9DD 5ISZB 3OMAB 1I8AA 3GSNL 3ZMRA 3BKMH 2TRYA 2Y5QA 1PG7H 3BP5A 4H26A 4YNYB 5DT1H 4LB8A 5F6IB 4ZW6A 2C26A 1DFBL 3LOWA 3OG6B 5HDQL 1JHLH 5INDB 1HSAA 2Q0ZX 4PV1C 5FO8A 3KPQA 3WE6A 3SDDB 3PU7A 5HHOB 3WEBA 1QA9A 3H0TA 3OF6D 1JGUH 4CRPA 1KCSL 1OL0A 2XXMB 3ARTA 5DHVA 3S7GA 2GVYA 4ELDA 5AW2B 5LNDA 3K2UL 3EOBA 1ETJA 4F8TA 2YPLB 1PS3A 2Q1EA 2X40A 3ULUF 2G3XA 3OJ2C 5EA0H 3RHWF 3SPVB 4PRPE 4N9OB 1RUML 4YDVA 1LP9F 1VENA 3VFGL 3SQBB 3ZZSA 4GAYB 4POZC 4DPRA 3BN9C 3C5JB 4YHLL 3OKKA 4KDTA 1XR9B 1J0HA 3O2DL 4M48L 3NSJA 3VVWA 5HYSA 4AQ8A 1UWGL 4GUPA 4Y19E 3HE7D 4YPGB 1NC4A 4LMQE 2FUQA 4N5EC 2JELH 4Z3EA 2DM4A 2KS0A 3N6YA 5GSVB 5K9JH 1MPAL 4LIQL 3ESOA 2Z91B 4Z7NF 2W0KA 3KYOA 4PW3A 4ODHH 4B0MM 3JV5A 3MLRH 5E8EB 2JB5H 3Q13A 2OL3A 1AGDA 2YRLA 4LSRH 3UPCA 1AYOA 3HG4A 5I9QC 5C1MB 4J3VA 5FUZH 1T5WB 4QOKE 3SYCA 5C0GA 3P4NB 3MRDA 4HOZA 2VM3A 5JW5A 3V9EA 3K91A 4FNQA 1OCZB 1WICA 2VLJB 4JDEA 2CJUL 4UDTB 3B9VA 1H5BB 5EIVA 3I6KA 3BD5A 4WGKA 3Q6FB 2C8NA 4I0KA 4WWID 3WIFB 3CFBB 4PJHA 4LVEA 4U1IB 4X8JA 4E9RA 4NDMA 1BFVH 2R39A 3V55A 5JIQA 3AY2A 1PF3A 2HT2D 3QEQE 1GZHC 3RIAK 1RPUA 1DJGA 1FV1A 5KSAD 1PEWA 3LKPB 2EH8H 4LE8A 2I07B 4NQSB 4X7DC 3OR7B 3WFZA 1Z5LA 3ZR5A 5H35B 1IL1A 4N4YB 4CADB 4Y16C 4X4XA 1GOFA 1AY1H 2FD6H 4QD2E 1KCLA 2MRYA 4Z7WE 3T0EC 4MMXC 1JD9A 2ZONA 5DHEA 2CDEB 4XOAA 4LLQA 4BINA 4NKIL 4CKVX 1YN7B 4JFDB 3BVUA 1AANA 4UDUA 4EZKA 1UATA 1UWEL 3NACL 3EDJA 1JZDC 3ZRFC 1WBXA 5MENB 1A5FH 4E68A 2JWYA 3MACH 3WE1A 3B3IA 4G6FD 1O7DC 3SDAB 2AI0H 4TUKH 4QF1B 4JKPL 3OR6A 2AMUA 3SCMA 4HCFA 5C0BE 1QFWM 4FLOA 1U8MA 2AEPH 2GSGA 4YH6A 5DS8A 1KGIA 3IRPX 5T3ZD 3DO7A 4M8QB 3N9GH 4PJCF 4ZPVA 3C5XA 2ATKB 1TENA 3ERXA 2F7QA 4Z95L 3BLBA 2Y9RT 4I1RA 1OAQL 1GZQA 1XTLA 3KHOA 2Z31A 4HFUH 4UILH 4PJEA 4ACPA 3OLIA 1TOXA 2DI8A 2XKNB 3CDFA 4CSPA 3C9NB 3ZSSA 1IBFA 2FLRT 1YEJH 4JHAL 2IDFA 5LQBH 4F9LA 2BSTB 4M62L 3MI6A 4R84A 4IBUA 4KRPB 1LLAA 1G9NH 3KGTA 1OAXH 3BCFA 4KXAA 3DPDA 3SDXE 2BCKA 1Q1JH 4DN4L 3KYKL 4OZGB 4MB3A 1FL6A 2BIMA 4RMTA 3D4YA 1X5JA 2ITEA 1WH0A 2AQTA 4HLEA 3I50L 1M7IB 4RFEA 2HN7A 3RNQA 4H25A 2AF2A 4YO0A 3DV6A 1P7QD 5CU9A 3TBYA 3UAAA 1G7HB 4LK4A 3JBG7 1E8WA 4X7TB 1YPZE 5H37G 4EQ2A 4ZMTA 3VJ6B 4JB9L 4WO4C 4F7CA 3DJZA 1HCFX 1UZ8A 3BI9X 3CFEB 3UCRA 3FRPG 4WI9A 4Y4KC 1N3NA 1W16A 4X4MA 3T0XA 4UQ3A 1G0DA 1OF0A 3KCWA 4P2RA 5IT2H 2FJGA 1NCAH 1ZPLA 2J55A 3NIFF 2IF7A 3DSNA 4NP9A 4JCWA 4Q9RH 3FQ1A 1VZGA 1C5DA 2X3CA 2VNCA 4O2FB 4OF0A 4JFHD 1HHHA 2UX6A 5GGTH 4WJG3 1T83C 4WTWA 2Y6SD 1J0ZA 1MHHB 3TA4D 3CC5B 4XMLH 4YSPA 3FHEA 4XTRC 3CC1A 1PZDA 3LIZL 5KJRL 3ML9A 2IG2H 2CHXA 2Q3ZA 1U21A 3AWGA 4Y2DD 3T9WA 2EVGA 3ZL4H 1A21A 3IJYA 1RZKL 5HD8C 1ZANH 4MAUL 4OV5A 3FT1A 1R5WA 5C0RL 3EJZC 1XGPA 2WHVA 3NDZE 3WD5H 4X8CA 2Q76A 4OVUA 3MUGA 2YZ8A 4R97B 4OD3L 3DGCR 5MHSE 4I48B 1JZ3A 5LBSL 3H9HA 1FIGL 3WN6A 2CH8A 3FSAA 3R8QA 3IK2A 1CBVH 1R19A 2A83B 5FYLE 1VFBA 1IEAB 3PUCA 4JY5L 4Y16D 1RP9A 4OZ4B 3EOYG 5J13C 1IM9B 2P80A 1AQDA 3DO4A 1UKTA 2MFNA 4Q9QL 4DF9A 2X10A 4ZTPL 3G6AA 2H5UA 2G2NA 1QBBA 1TDQA 2AABL 3CFQA 4IBQA 1E9PB 3IFPB 4JRFA 4XBEL 3IAPA 4FTVB 2X6VA 1I9IL 3HE6B 3O6FA 4R2GD 2ADJA 3HN8A 2J6EL 4BQ6A 3MLWH 3NA4A 1SY6H 3WIAA 5SWZA 3MRJA 1ZT7A 4R7NA 4DO5A 1P4UA 4HJ0D 4L3AA 4LL4A 5JLZB 5KYUB 1A6PA 4ZBJA 5AAWA 3BPLC 3UYPA 2G30A 3ASOB 4W9ZA 3NJXA 4JG1L 1FL5A 4WV1A 3CSFA 1IC5H 3CXDH 1MVUB 2BNQE 4OJDH 1V7NH 4HXBL 4J2QA 3RX5A 1KJ3H 2AXGB 1INEH 1NGZB 2BXZA 2O30A 4CU7A 3BW9B 1EDHA 1NAMH 3I9AA 3CN2A 3D9AH 4OI7A 2NQCA 3AREB 2C7UA 2NNAB 4LT7A 2J4WH 2JJTC 3TFKC 4WW1B 2F7IA 3ASWA 2BSRA 5DQ9A 5FA4B 1JK9B 1MFCL 1MRDL 4E9YA 5IHZA 4CN4A 1W72H 1MRFL 3G6JE 1A3LL 3Q2LA 4JFQB 1JPSL 4NQEE 4HOMA 3ZO9A 3V4VA 4JVPA 3BVNA 2E75C 4NBZB 4X99A 1UD4A 3UTOA 1JVOA 2OZNA 1SFDA 2GJ6B 3RU8H 3UZVA 3MLPA 4YFLI 4AC4A 5BRQA 2WBXA 1KIQA 3LZQA 5C6WH 2CK2A 2EC9U 5I5MA 4KZDH 1GS6X 3HBZA 1EO8L 1NIBA 2ED7A 3LEXB 3R4RA 1DDHB 5CZVL 3HAEA 2IANE 3GGWB 4D7BA 1OCWH 4MJIE 3O2WL 5IVZB 1H0DA 5EZOH 4EI5D 1N7ML 4HCRA 2WBWB 2NX5A 4XT1C 4NPYB 2R69L 1H6TA 3SPJA 3QE5A 4HGMA 3DVGB 5AW6B 2OTWA 4M7JH 1JK8A 4JJHA 3UAEA 1QTSA 1Q90A 1SXSA 2WO4A 3KYNA 4XMPH 4A2DA 3TV3H 2CQVA 4DEWA 3OZ9L 1YA5A 4K9EH 3PNWB 3IMTA 3G5ZB 2X09A 3HPLB 4H1LH 1I8IA 2XFXA 1RK0A 1SDDB 3T65B 2BRRL 4GXUN 1B2WL 4ODXB 4TQ8A 5GGQH 2C4XA 4JDTL 4MDRA 2F74B 2XU9A 2NYZA 1N5YH 3RWJB 2P9RA 2OR9H 3ULUE 1E4JA 2MCAA 5KN5B 1J5HA 3MZTA 4X80H 1PGRB 1LP9E 2N3JA 1OAUH 3FYEB 1DDTA 4EUPA 2A0LC 5SWSB 5I74C 5CBEA 4BFIB 1Z9NA 4OJEH 3BQUB 3VG0L 4AM0B 3HR5A 1FO0B 5CEZL 3V10A 4JO4H 1NCJA 1DEEB 3UTTA 2VZSA 3GFUA 1AZZC 2ZOLB 3MCYA 5AZUA 3NCJL 3OM3B 4AC2A 5E2WL 1MVYA 1AGCB 4N1EA 4ZS7H 4ALAC 4Z7NE 1A3QA 1E5YA 1S8DB 4MNGA 1FJ1A 2YPVA 3IJ7A 4LRNH 5FK9B 3NTCH 4IMKC 2BK8A 1IIIA 2WN2A 3B9KC 5AKSA 5L4FA 1UD3A 3RL2A 1ZK9A 4WGVB 2AXWA 1NA8A 4JEGB 2ZKWA 4KDWA 5J12B 4HZ1A 4QXGH 3VXNA 1FPTL 3O9WC 2H32B 2RGSA 3UBGA 1OGAA 2HVJB 4C55A 3KPNA 4MD4B 4F2MA 1IE5A 4ZAKC 1EJ8A 1I4FB 4K94C 1U8NB 3B9EA 5KVGL 1K6QH 3BJ91 3C5ZC 4QEGA 4ZFQA 3SIKA 3ZDZF 2CO7B 1C08B 1HQ4A 3IE4A 3GMNB 1FDLL 4UT6H 5FKAB 4A67A 4AQ1B 5KVMC 2QADB 5GZND 3FTSA 1CD0A 1RIVH 3P77A 2UWEB 2GTZA 4U1KB 3VRJA 5L2KA 4MA1B 4N0CC 1IKFH 4GXVH 1RK1A 3QIBC 2JIXD 3AWFA 5JXAL 5L8LB 3BWAB 5I71B 1XAUA 2ZXDA 3KXFB 2R1XB 2QTVA 1P9MC 3LRSB 5T5FA 1BEXA 2BY2A 4MQXC 3SBWA 1M57B 1RZJL 4PWFA 5EWIL 5DEJA 3VDAA 4DGWC 4Y2NA 4E41A 2O26U 3OAZK 3VCLA 3Q9PA 3GBLA 5DVPA 5IQOA 3ESVF 2K7PA 3DHUA 3HRZA 2VDOH 4NO2A 4C4UA 9CGTA 5CJ8A 5ERWA 4LBEA 3LPFA 1EAOA 3NA9H 4PRDA 5FIEA 5FB8A 4B41A 1EAJA 2JTDA 4JFEE 3VQ1C 3DSFH 1U30A 1LK3H 3QG7L 4JW3A 4NQXA 1XB6A 1M7UA 5AL8A 3B43A 3FK3A 1HZKA 3V4PH 2PTVA 4XHJC 2XN9A 3PAZA 5LLIC 1NUFA 3WIHH 2DKUA 4PJCE 4DK6A 1QSEE 1R3JB 3KNBB 3HR6A 4Z78A 5IQ7L 4KQ0A 3NZHL 5B38A 4Y8DC 4FTDA 2Z92B 3I9GH 2AK4A 3ARZA 1RZGB 1HZLA 2DQCL 4X98B 4WO0A 4KI5D 3WKYA 4BDVB 1KEMH 3VQ2C 2E6JA 1XT5A 5C7XL 4KNUA 1LL1A 1XAKA 1HH9B 3AT0A 5H4ZA 1GOHA 4KZEL 1ZGLP 1JL8A 2Y4SA 4XXDB 4D0BB 1FZKB 1ZA6B 4AIEA 1RPQA 2V9UA 1KCVH 5D7HA 2OMWA 4Y4FC 4M5YL 4DFHA 4QRPE 5IWLA 4Q7DA 4R0LA 5HYQB 3EGSB 3ELQA 1E8ZA 3EDEA 1IBHA 2ZKHH 2FB4L 2H9GA 4LCUB 4HV8A 4ANVA 2DIAA 1QLRA 2Y06H 3QUGA 3H54A 2MTAA 3KJ4B 4B9JA 1AQKL 4TULH 3MRMB 2NXZD 1TMCB 3AUWB 3MHZA 1ZRUA 3NQKA 1YNLH 3GDCA 1C12B 5ESVB 3TN0A 5J11C 2J12B 1R0AL 4LHUB 4AIZB 1E8XA 2A0LD 1GC1C 1HS6A 1KIUB 4B9IA 2H45A 3QO0B 5HGBB 4B5ZA 4F15B 4YL4A 3OAWA 5ITFA 5ELIA 4KKRA 3FQXA 4BH8A 3BAEH 3X1FA 4K5OA 4F1SA 2GIYA 4UT7H 2XWCA 3FUKA 3DHJA 1H6FA 5JW4M 4HKXB 3NJFA 1FNSH 1ROCA 1A6WL 3EH5B 3BUYA 2V2TA 4GY4A 4ZPTB 1YPZA 1T0NA 3BFOA 2DH3A 3PP3H 2EECA 1ZJAA 1TYJA 3MV7B 1JZ7A 2NY0B 6TAAA 4MB1A 5C0AA 3ZIMA 2D73A 1LGVA 3AJ7A 3RVVD 2NW3A 3BH9A 4HWZA 4AIOA 2XPGB 2QKIC 3LTVA 5E7FA 1HQRB 5CJBA 5DTFA 4U0QB 4XC1L 2Z93B 3O9WD 5BZDB 2CXGA 2AVGA 4TM9A 3UJJH 4JBSA 1RUPL 5BS0B 4OH2A 4FFYA 1G6RB 4KMTH 1A7BA 3STZB 3DBXA 3T2QA 1NANI 3C5ZD 4NSKB 3RBGA 4UI2A 3A23A 5IBLC 2X1WL 1JZ8A 5LUMA 1RUAL 5I1AB 5BW7C 1NIEA 3ATFA 2ZPKL 4PJ9B 3LS5H 2H7WA 7FABH 3BZ5A 2O5ZH 2CLZA 3MLVL 1TPXC 3CCHB 3QIBD 3MLTA 4YDLC 1BPVA 1BJMA 1YMME 5DJDB 2P5ED 3RWGB 1V3JA 3VFOA 4YGVA 3QUML 2AQSA 2OW6A 2LFGA 3PQYB 3RVWC 2IH9A 3KPSD 4XX1E 1JXDA 4KTYA 1G7MA 5IHWA 1DLFL 3CZJA 4BFOA 4LSVH 5DJYA 4A2GA 3MXWH 3UMNA 1HHJA 3QEUB 1XGTB 3WMQA 2YGQA 4L5FL 3ATBA 5CO1A 1UOVA 2X87A 3OKEB 1UH4A 3VXQA 4CSSA 1AGFA 3WUZA 1SEBB 3US0A 1R75A 4JFWA 5DJ8A 1ZWIB 5CJXC 2ZQKA 1IT9H 3BPNB 1P2CA 1TNNA 5BCAA 2MNUA 3BGFB 4HF5H 3QDME 5JIIA 1YEHL 2VE6B 4NQDB 5EN2B 3LN5B 5D1ZA 2R4RH 3PWUA 3BCDA 5E1IA 4FF9A 4MFHA 5CMAA 5A3IC 2XG4B 5EZIH 3KGRA 5AVSB 2BNQA 3HG1A 4IRZH 2CBMA 2XRAH 4F1ZA 3S88L 2XTJB 4BD4A 3QFJE 4Y88A 1EMTL 4PY7B 2W9DL 3D8MA 3U9UB 2ESVE 5ETUB 1YJDL 4XO5A 4BYHA 3MRGB 4XBPB 1WYJA 3BPOC 2W0FB 3RQ3A 3F8UB 1KGCE 1PFOA 1UYWH 1W9XA 3ASNB 3P3YA 4LGPB 3S34H 5IB2B 4PRIA 3ZHNA 2DN7A 2VC2L 5GS3A 5D2NA 5CGBA 3DDFA 3QVAA 2IAMB 2FIKA 3QJFB 3BH8B 4QHLA 1J8HE 5AZ2L 3NRFA 2DWYA 4JLRB 5F89B 4OF7A 5GGRB 4JHZA 5MI0B 1VESA 1HSBA 5DEGA 1MI5D 4F9PC 5KAQG 3B1UA 1MCOH 4MMYB 4PWGA 5G5DA 4PB9H 2ZWZA 3VH8B 1QHOA 2EIBA 3QRLA 2DQFA 3TV8A 3ENEA 4BFRA 3D2UA 1BEYH 4M3JA 4XP6L 1HXYB 2KERA 2Q8BL 5I6OA 3BWUC 4GI9A 5JIHA 3ESNA 4YIQB 2WC7A 2BS8A 1W2KT 4PJ5E 2ZWNA 4K7PH 4BGLA 4WGWB 2CO6A 4AWJC 3MJ7B 4R4FL 4GSDH 1A3ZA 3BUIA 1BLNB 3QRGH 3OHMB 2XVLA 3B8YA 5DEFA 3ARBA 1XXDC 1X44A 4BKTC 1FRGH 4YHKL 3SPGA 5C3TA 1LYQA 2D4FA 4TL4A 5CSZB 5LNEA 4IU3A 5CD5C 3DHPA 3W39B 5I1KH 4PREA 3SO3B 4AG4L 1ZHKB 3EYFA 2CD0A 3IJHA 1AXTH 2GAZA 2WYZA 1QPXA 1XGZA 3CMGA 3MRQB 4G5ZH 4YUEH 5AYUL 5IB5B 3A4AA 1U8CB 2NUPB 2CJTA 2IALA 4MBRA 1XF3B 1G9HA 3ARSA 3RUGA 1BZ8A 1U3HC 2BZDA 3TO2B 3DUUB 4W9GC 3MJWA 1KYUA 4OQTH 2PP7A 3RAJL 2Z1KA 1CU4H 1MLCA 2NNFA 2B5IC 5D71H 1P69B 4GAFB 3VWKA 2EE3A 1OW0A 3CZLA 1SMDA 3AG3B 3BPCA 2B1AL 3VRLF 1YYCA 1HH6A 4OFDA 5FW8A 2L7UA 1F41A 3Q0HA 4HIXL 4QO1B 3RVWD 4LVNC 5CR1A 5E24E 4OD2B 3QJHA 2F53A 5LCVA 4LCYB 5FFLA 1OD9A 4Y5XB 3QUXD 4TVPL 3RYMA 4AJWA 3U9PL 2Q3AA 3MMEB 1QNZH 1B6UA 4O51B 2FHCA 1L0XA 5I16B 1FNGB 2H6OA 3V0WH 3FQTB 2P47B 1IGYB 2PCPA 3NIDB 4IJ3B 5CD3B 4IBSA 4PI0A 2BSDA 4YK4B 5F9OH 2I69A 4WSKA 2D3JA 2NTFB 5C0IB 4NQCE 3AGWA 1MDAA 2D4DA 1AXSB 4OIBA 3DXAA 1AZVA 1IJNA 2ITDB 2SEBA 2X4RB 3QR2A 4S10A 2VWEE 3P0YL 5D6CB 4FABH 2Z7ZA 1G9NC 3WDHA 4ZMZA 1AQHA 2AQ3A 3ELAT 1A1MB 1A25A 1GAFL 2G3ZA 5KG9B 1AS7A 1RJZA 4PWJA 1PY4A 4MAYC 2E7HA 5I6XB 1OP5K 2Y7NA 5L88L 4W6XB 1F11A 1KT2B 2Q8AH 3SYOA 1ILUA 1GSMA 2X42A 4Z8FL 1IM3D 5F3HB 2OSYA 2DQEL 1T1XA 3NPSC 3D18A 4KUZL 4P46C 4PJFF 2F54A 4XN2A 4LDCA 1A7PL 5TDPB 3U30C 3CDCA 3RVUC 3Q6GH 4HUUB 4O2EB 4OLWL 1WTLA 4OIAA 2IQAA 2G9HA 2R1YB 5DMKA 5J6GB 3Q05A 1ORQB 1YO4A 3CVHA 3QIWC 5TDOB 4XZUB 1TVHA 4YDJB 2APSA 2G5UA 2J8UB 2NNXA 5EU7E 3K1KC 3VXRB 1KB3A 3NABH 3TO4A 4D9RD 1FHNA 1AG0A 1NCBH 3D3VD 4HAKA 2Z65C 1KXQA 2YXWA 3VA6A 5E8PB 3M7FB 3DX6B 5DYFA 1NPJA 2CBTA 2Y69B 3IYLW 4AQEA 5FKPA 1JMZA 2FQGA 3VTMA 1BVNP 1KN4H 1XSIA 1TEFA 3HMWH 3D6GA 4XCNB 4X8XA 2EDMA 4AYBA 2R2HA 3QUZD 3OF6A 2VMCA 1WFOA 2D8KA 5KVDH 1HI6B 2AQPA 3UXFA 3EYQC 4N0UB 5EORL 2R29H 3KWTA 2ADGB 5I30L 4LSTH 5JPNA 1LQBC 5C0EA 4PI2A 2DQGL 4ZRGA 2L7QA 2GEEA 4KU1A 4W81A 3EXJA 2GT9B 4FYQA 4HBCL 2JKNA 2ICEC 3LQMA 3L6FB 3SDCA 2BMKB 5IREA 3UROR 2YRPA 3PWPE 4PCSA 3FOMA 1XF4B 5ACZB 2HMIC 5EZLA 4G7RB 5FXCH 2EIDA 4PRPD 3IKCB 4RA3A 5CXPA 1ICTA 2O72A 2MIZA 3HNSL 3GRWA 4NO0D 4W9HC 1XIWB 3LQAL 4JVWA 3K2KA 3WSQL 2Y07L 4TF4A 3DMMD 3VE0B 5JORB 4GMSH 4WI6A 4A2MA 2VDMH 4JGJA 1IE4A 4TSAH 3FFDA 2FVNA 5DRXA 4BKSC 4C83A 1THCA 4PBXA 4Y19D 1J12A 1CLYL 2WIIB 2EUVA 1SEQH 2HA1A 3SYAA 1BGXL 1CLOL 4U1GB 1NCIA 1AGBA 2IPKA 1Y7VA 3MZGB 2KT6A 3CMOH 4PLNC 4DTGH 4G9FE 2ZJSL 2I9LB 4HIEA 4LQFH 3H9SD 1XB8A 3PIQB 4GRLC 4IBWA 4QOKD 5EU6A 1N26A 2IWKA 4OU3A 5IROA 1MAJA 3PDGA 5M94B 1FH2A 3FS9A 1XMEB 4PJGF 1A22B 2HT3C 1X5LA 4ZW7A 3C6SB 2Y2YA 1KCUL 5IKCB 4EN3A 3T3PB 3FCTB 3SB3A 5TDNA 5DWUL 1XO8A 1KELL 4CN1A 3QEQD 3A6CH 4HZAA 4HUKB 1LO5A 3HZKA 1VADA 2MHAB 3OKLB 2C3GA 3KPOA 1JF1A 4LLMA 5F1KC 1N6QH 1SYVA 4PJDB 4N2BA 3HB3B 3TVMD 1RJYA 2V2XB 2WLLA 3GS7A 3Q2CA 4K3DH 3QXTA 2BY0A 5JOFB 1MCQA 1XH3A 5F9JB 3UJIL 1GYCA 1OSPL 3T8MA 4KVCH 1WS8A 1CDJA 3WY3A 3S3DB 3D39B 2HT4C 4FL4C 5DUML 3CDGB 3BAIA 3QUYC 1MWAB 2NW2B 1P5VB 1DVXA 4B9PA 4XNXL 1P6FA 4B50A 4RCAA 2H1PH 1FNEB 2LU4A 1NM4A 2AQ1A 3Q1SL 4P3WA 4TSBL 3C60B 4GUCA 4UM9A 3QIWD 3X3GL 1RU9L 4KJYA 4LHUG 4OJFL 4Z6AT 1ND0B 5C0BD 3UPRB 2XN2A 1WWAX 2W9LA 3EGDB 3FT4A 4NZDA 4WENB 3L95A 4S1DC 4L1LA 3AU0A 2G60L 5DUJA 5H4YA 5G2NA 3LPGA 4LAQL 3TP4A 4BK4A 4UIMB 5HI4D 4R96B 2QSVA 5CSBA 1FZMB 3QWOB 4JKNA 3MV8A 3RIFK 5J1AA 3T08A 2AJSH 4K9EC 4ZUWB 3D4ZA 3KYMB 3FO1B 2EIKB 4UTBA 3ECBB 2AJXL 2JJWA 4PVLA 3O4LA 4JM2F 1VFAB 3NAAH 2Q10A 2B59A 4A7VA 1QSVA 4BSWB 4WFHE 1KXHA 2K4AA 2NDFA 3EYQD 3PPEA 4JX0A 2ICWI 4M43H 2N4IA 3INUH 4R7XA 1M2VB 3MJ9L 5J89A 1XZWA 3E0GA 5B3JF 1LO2H 1Y18B 3V0HA 1RULL 1P5UC 4G8GD 4X6DB 2NY6C 5ICUA 4HEPG 4JRYE 5GS0H 1WUNT 4L4VB 4KKAD 4KKNA 5FUOH 4Q74A 5DK2B 4UYQA 2WKLA 2HMID 2ED9A 3DTXB 1R5IB 1CLZL 1V5JA 2A74C 2ZG2A 1FZOB 2FT8A 3IS1X 4X7CC 3ES6B 4FQCH 1IGJB 1IGTB 1XSKA 3DOSB 4GAJH 4NI3A 5DJ2A 2PW1A 3VSTA 2EAEA 2C3WA 4P57A 1DVUA 1AIZA 3DROA 3QQ3B 3RZCA 5D7IB 1JCKA 2OX5B 1TO5A 4XNUH 3DUHA 2WLHA 5DJXA 1BAFH 3IS0X 1QNIA 1TJGH 4JFUA 4WU5A 3TJEH 4ECNA 2HTKC 1M7DA 3V5KA 1XBDA 2DQ6A 3ZUNC 2R83A 3PWJB 2EVFA 4H4NA 3O2VL 3SE9H 5CLZA 4JFSA 5AOJA 5CJ5A 5HGAA 1JZIA 4FP8H 4I3RH 3GB7B 4L8DA 4QHUA 3TBWA 5ABZA 1E6JH 2CSPA 1I82A 4NUPA 2EEBA 3SKMB 2JK5A 1GZHA 4KV5F 5E00A 2HT3D 3QCVL 5BUAA 1Y07A 3E9TA 3NZSA 5CN1A 1LO4H 2XY2A 3QULB 3OTTA 3D06A 4JN2A 4OJAA 3ULVF 1V55B 3QZLA 3AROA 3WNOA 5MHSD 4UUJB 1H8LA 4BSVB 4DIXA 4FNPA 2MSPA 3I74A 3BIBX 1KYOK 1EZSA 2HLEB 1YAZA 3P2DA 4LDLB 4ISVA 4Q4IA 3T0EA 4FXGC 4MMXA 5TE7H 1NDMA 3FTGA 4E9QA 4OUUA 1U8PA 2YFNA 2ZSWA 3FTUA 2N7SA 2QLYA 4MZIA 1OE1A 1RFDL 3WEXB 4OGZA 4ZT1A 3D1MC 2BP0A 5FYJL 3VRLE 3O4OB 5PCYA 5F1NB 5DD6A 5DMGD 1NCDH 3MROA 3MOBH 3GJFH 3T3MB 2GPZA 2VZTA 4PRBB 1X7SA 5F1OB 4IHOB 5FX3A 3FH5A 1DQIA 1KACB 1DO5A 2XQ0A 1AI1L 3HJ0A 4I0PC 4PIRF 5I1EL 1BF8A 4E9TA 2E7CA 1TTCA 4KKBC 5I2IA 5KSBF 3DBSA 4FZEL 5TH2A 4NENB 1T3FB 3VW3L 1QKZH 2AFNA 4ANKA 5A16A 1UB5B 3LY6A 5FFOA 3VH8G 1I1CA 1AACA 4S1DD 3V52H 4OUOA 2NLJB 2VDPB 1LM8V 1CI3M 1VGKA 4F93B 4RISH 4NQQA 3FN0H 3MBXH 1J10A 1E30A 1K2DA 1VACB 4EI0A 5EIIB 3NEEA 4FHJA 2JFCA 1E65A 3EGXA 3IDNB 3V9CA 1MAKA 5JXED 4PJ7B 2HFEB 3BDBA 5BOPA 3EYUL 4QTHB 4CMHC 2FNWA 4MD0B 2GK2A 1AJ7H 2EDDA 4O58H 4BXVA 5CCKH 2XETA 4X6CA 3NZ8A 1U6AL 1QHQA 4PJFE 1UXSA 4PJBA 1NUDA 1MFUA 3MFFB 4ZZFA 3V7MA 5IIEB 5E4EC 3UTPE 2MPAH 3AVEA 1TFPA 1UENA 5DJ0B 5SWQA 1WZLA 3QEHA 1UZ6E 4G8FA 3L3DA 3C8KA 4NNXB 1NTDA 3V6OC 5KUKA 4CVZA 5JQ6H 4WO4A 2R4SL 4RGNE 1SLXA 2VR9A 3S35H 5GS2H 2QSCH 4TLKA 3Q5YA 2N01B 3I02A 1FYHB 4Y4KA 3VFUB 2PR4H 2V0AA 4K3EL 3LXCA 1OGPA 4AGQA 1HX0A 5T33L 4TQIA 1FVEB 4UQBA 4YDIH 2DZEA 5D7SH 3LRHA 2IAND 2NY1D 5IM7B 4QGTA 4MJID 43CAB 4NYLB 4U7MA 2NY4C 2CMRL 4Z0XA 3VXUE 4DP0X 1T83A 1SMOA 4EOWL 4ORZC 2Y5TA 2EE2A 3WJJC 4I77L 4ONGH 4FKKA 4B9FA 2R0ZH 1RJLA 2E46A 3LQZA 3EFFA 3PHAA 4F8PA 1RUQH 2HRPH 4X5PA 4BELD 1KJMB 2ERJB 2VC2B 2ZWYA 2VLKA 3I3DA 5T1LB 3RVXD 2HAZA 4R8WH 2Z4QA 2J8OA 1WIUA 4WTZG 2OL3L 2WCSA 4S1RL 4TNFA 4UIKH 3ULUD 3ZE0F 5J6HB 4ETQA 2R0WH 1IAKB 4A2FA 1R3LA 3RIAF 1B0GA 4V1DB 2BSSA 4MNQE 1JS4A 3AS2A 1DQJA 3KJ6H 5HPOA 3EYOA 1TQSA 4L29B 1IFGA 3CXHJ 3CVBA 3P0GB 3BUBA 3NMEA 3ZUCA 1KC5L 2JJVA 4DO6A 3MLYH 2XZAL 5IOKA 5F7BA 4JANA 2CGRH 4K3JH 3PGCB 4AH2B 4JL1A 2G3NA 2YMTA 1NDGB 2QHRH 2UUDH 1YY9C 3H3PH 3JTTA 5LGJA 4S1QH 4N2KA 3P4MB 1EEYB 4LSSH 2QPSA 3SZKC 1UM6H 2TRHA 3QHFH 4Y1SA 2NT0A 3D25A 3HHMA 2DQHH 4LPVA 1SGKA 4NEHB 5KS9B 5I8OH 4OCXL 3UMTA 2ATAA 4XN1A 4I0PD 4QTIL 5TJWK 3V6ZA 4E0RB 3LRMA 1IBDA 4L3EA 3HG5A 2C9PA 1ZMYA 2WD0A 4PJGE 1OK0A 3HE7B 4IKJA 4QRSA 15C8L 5C7ZA 4G6ML 3GMMB 4OTXL 2ZKMX 2OV0A 2WXRA 4OM1L 4UV7H 5CEYB 3E8UL 2A5UA 2BNRE 1IFRA 1B0RB 4A6YH 5D4HA 3LPPA 3AY4C 5J3HD 4OAWB 3T0WA 3I85A 4YXKH 2R0KH 5ECJE 5EOCL 3ZMEA 1LDSA 2JJTA 2YPLE 1QO3B 4JHUA 4WJ5B 2V2WB 1FLRL 4QYAA 2JXMB 3QWRD 3FB5B 3MUHL 2VXQA 5E9AA 3ZHLA 4IMLA 5D1QE 4DGVL 4URTB 4LOUC 2Z34A 1TU2A 4Q56A 4HPOL 1MEXH 3KLLA 1SXAA 2JKRM 3K0YA 4OLYL 1SF5A 2MJWA 4G80A 2SODB 3LJ3A 2VXTH 5LJYH 4FI8A 3EFOA 1DANT 3MNZB 4QCIA 1CFQA 1R3HB 2ITFA 5KSAB 3WJLC 5BV7L 3F7PC 4N3TA 5D1XE 3PYCA 3NFSL 3FN3A 4FXKB 2UXTA 1S3KH 3RZWA 2AXFA 4PS4H 1I8KA 4M7ZB 2YOCA 4JFED 3BSZH 2YZ1A 4GMTH 2HFFB 1F2XK 4GRWH 5IUCA 4WU7A 1IGCH 2Q7AA 3HI5H 3X11B 3GSQA 1QSED 2YXMA 5CCKL 2QTEA 4JZOA 4KHTL 4PRHE 5FYKL 2PTTB 1ODAA 4WW2F 1TQBC 1PD1A 4GG6B 2BVOB 1T0MB 5CGMA 3WTWA 4G6FB 5FO7A 4LCWE 1ZVHA 2VZ3A 3QHTC 4NFDA 3P0VH 1I1AB 3CZFB 4WDIB 2V5YA 1PDKB 3WU1A 5GS1C 3U7YH 2E5EA 6PCYA 1T5XA 4CVWA 2CDFB 4QRPD 1F2QA 2OYLA 3V6FA 1Q9LB 3ZO0A 5HJ3A 1JWUA 3VXTA 4KJPC 4KQ4H 1OCRB 2YA0A 1L9MA 4LNRB 4L8CA 2OMUB 4HX1A 1BVZA 2W1NA 3QDHA 3V0VB 1P0SE 2C1OA 1J9RA 4MJ5A 5EPMA 4Y8AA 2VLME 4Y5YC 1Y0LA 5CJQH 3O3BA 5E5LA 4DVRH 3BEWB 1OTSD 3GI9L 1KBGL 3ZYJA 3PFQA 4JY4A 1NFIA 3FQNA 3LKNA 5JO5A 5BRZB 1ACCA 2IFFH 5MEPB 2E76C 3FW6A 4JPKL 1MFMA 4ATTA 1VERA 3VXSE 3MYZA 5E5UB 4IMKA 4ZUSA 4N28A 1J5OH 3B9KA 4NB7A 1IC7H 1QUPA 3WKPA 1I9RL 4RRPA 4WKZA 3S8GB 3QUKB 3OHXB 4P5TC 5F7FA 3EOTH 1P7QB 4DKFL 3U2SB 3O9WA 4NFBA 1XXFC 1DSFH 4YJZL 4U1MA 3WCYA 3E3QE 2QQQA 5F7DB 2ODIA 4ZAKA 2H0EA 5JUEH 4HEMA 2ID5A 2DQTH 1KZQA 4AENA 3C5ZA 1E6OL 2DWSA 2JMRA 4KV5E 5B7EA 4IKKA 4UM8B 4HG4K 1MQKH 4HS3B 1MJUH 4M4RA 3FCGA 4NAJA 4KRMB 2APXA 4K71B 4L9DA 4PBDA 5E51A 1KCKA 3ULVE 2WZPA 3QIBA 4IDJL 1KENH 3FOLB 4BZ2H 3S2AA 2DKMA 2WLZA 2ZUUA 3JTSA 5CWSB 1GMEA 2IWGA 1P9MA 1L5GA 2C7FA 2GKIA 1GTNA 32C2B 1KGUA 3O3AB 4WVRA 2UZIH 4OGYH 2V5TA 4WUUA 4QRRA 3IAQA 4G6JL 2CBQA 2FYYB 5GSRA 3SPCA 1YMMD 4JMNA 3DX3A 4Y1AE 1XZ0B 4MQ7B 4PD4K 1BOGA 5AZEL 3VXME 3O41A 4AL8H 1FVDA 1LNUA 5IJKC 3BWSA 1ZVSA 3AMKA 3D0LB 3R1GH 4RAUA 1VLXA 2WQRA 4QXUL 1NPUA 3QJUB 5HVHC 3SO5A 5JHDA 2DMBA 1AIFA 1MY7A 3BT2H 5KANI 3A6OA 3C2SA 2OQJB 5E6UB 3HNTL 2R7EA 3KL5A 2P44B 2WUCH 4Z1PA 2YSSA 1KJ2B 3NN8A 4F7EB 3V4VL 2RQEA 5F3FA 3B5TA 2D9CA 5F1SA 2V7HA 1RSYA 2D0HA 2HJFA 1N0LB 5DFWH 3OXRA 1CYWA 4MVBC 3QYMA 4OFYD 2DRUA 4O02A 1KLUA 4G7YH 3QDMD 2UZPA 5DYOA 4R2GB 3EO0B 3BYYA 3K1DA 2Q6WA 3MCKA 4YFLF 1N8OE 1PZAA 1JGIA 3SODB 4Y4FA 1U8JA 4MB4A 4LSUL 3BQVA 1P6AB 1UEYA 3QEGL 4DEUA 3VD4A 1ZT4B 2OM5A 4MXQD 1G87A 3GEFA 3QFJD 4XP1L 2ZWLT 5TQ0L 3QHZL 4HCRL 2ESVD 4ZUUB 2GG1A 5IVXA 1XCQB 3EF4A 3WDJA 3ARPA 5DD3H 5KVFE 5E5MB 4KO5A 2GYSA 1KGCD 3IRZA 1BZOA 2FGZA 4F7PA 5EEYA 1F13A 3O45B 3FO9A 4EBQH 1MI5A 2HVBA 3UZQB 1PVHA 3VFTB 5EU7C 5DQJB 3SGJC 1J8HD 3FMGH 1K4CB 1RHHB 1R24B 4Z76A 2E74C 3ZDXB 2PCYA 3LIUA 4CILA 3QIUC 2Y7QA 5C0DA 2BIIA 4KK8C 2ZYHA 1UXWA 3PY9A 4FLQA 4GSQA 3RY6C 4MASA 4DO4A 4KITB 1L9PA 2LQRA 4KXCA 3P4OA 1M2OA 4M7KL 1TZHA 1NL0L 5TD4A 3QB7C 3DX9B 2OJ1A 2A38A 4PB0L 5HYIA 3L5IA 4ELKA 1X4XA 1EJOH 4PJ5D 5K39B 4GXUM 1GY2A 1YDPA 4NZTL 3RGVD 3FRUB 2OAAA 2LU5A 2IO5A 2QKIA 4YSTA 4ZNEE 4NM8L 3TNMB 1PLAA 2UZYB 4U3HA 4XNAA 4DKTA 3QYNA 2GJPA 1TTGA 4BQCA 5SX4H 2EKSA 5EO9B 1UQSB 1NINA 2YJLA 4OGQC 1V3MA 1AKJA 4EI5B 4UNUA 5A2FA 3T77B 2V3FA 3ECQA 3WNIA 1TZGH 2YPVL 3AWEA 3HI1B 3HLAA 1GYVA 3ZE0E 2FWOA 5BW7A 4DZ8B 5DF0A 4URKA 1DJZA 1JDAA 4UTAA 2BNUA 1U2CA 5E8PA 1DZ0A 5EIIG 1RLBA 1EHXA 2E9IA 3TTYA 3ZSTA 3B7RL 3QWNA 2F1AA 4A7TA 5B7MA 1CGYA 2FYVA 3M1CA 2NY5H 4JL2A 3WBDA 1SHSA 3HIZA 5IESH 1P4BH 1PX4A 4NKDA 5LN8A 2DL9A 1OM3H 1SM3H 4HKBA 2XG5B 2VZUA 5FCUH 3LEVL 2OYKA 2X70B 4NWTL 5IFAL 4GT7A 4TQEH 3I6GA 2L4OA 2X88A 5D9SA 4UT6A 2CIKB 1J88A 3US1A 1LK2B 4CA4A 1T20A 1X9UA 4ZMPA 2FR4B 5KZCD 2WQVA 1S5HB 5T5FL 3ZY7A 3QORC 3B2PA 4TUOA 5D55A 3OMZA 5CJXA 3VFNA 1FVCA 1R33A 5TPWH 5ILTH 5C86A 4N2AA 4A38A 1XWVA 2FH8A 5L6YL 1QLEH 5AG8A 4X9GA 4Z7UB 1OPOA 3CSPA 4I2XE 3MXVL 2PW2B 1A2YA 3EOAA 1NOFA 3GPEA 4AIXA 1J1OL 2GITB 5DD0H 2FO4A 5SX5K 3FFCB 1J05B 5GZOC 2OI9C 3EH2A 3GK8L 2CA4A 2NR6D 1CBJA 1F3JB 4DW2H 1BYOA 1IC1A 4IOIA 4XAKE 4JN1L 3CH1A 3HS0B 4GW5B 5CIPH 2AK1H 5GS0C 2CJ3A 2H26A 1UJ3C 4OCLC 5GIRB 3QXAA 5FF6B 3SJVE 5J7CC 5CILH 2BIQA 5EU3A 1KY6A 2HFTA 3ZYOA 3C08L 2BY1A 4YSOA 2B2XL 2H3KA 4JRXE 4MCZB 2H1XA 3GHBH 2DQJL 2B9BA 4OSUL 4AEHH 3H2WA 2R9HC 4JFFD 5TF1H 3K71B 2WV3A 3P30H 5I1CL 2EXWC 1CGVA 1V7MH 4HQQL 4G42A 4F9PA 1F4XL 2JIXB 3RWDA 5T1JA 2X4TA 2DI7A 3RWIA 1CE1L 4WWKB 5ENWA 2VDKL 3SY6A 4KGJA 4NN7C 3NPZB 1KPUA 2QV4A 3EXLA 2Y7OA 1F97A 2VN4A 3KWXA 3PUUA 4XVTL 3S35X 4E5XA 4F27A 5KW9H 4MKTA 3HUJF 4ATWA 1BQHB 1ZSDA 4K15A 3APFA 2ZAGA 3CK0H 1QG3A 1HEZA 4ORGB 3WELA 4PH8A 5ANMB 5T1MA 3PXJA 3GBNL 3QNZA 4JFZL 1KF9B 1I3GL 3L9EA 1ZLUK 1IKOP 4JO3L 3N42B 2WAHA 1S7XA 5CNHA 5K9KA 3S36L 5LXGL 1CMOA 3CLFH 1G9ML 4OLUL 1G7PB 1HSAB 2XLLA 2YOAA 1DHKA 4QXWA 4S1SL 3F6JA 3B7SA 3HBPA 3QAZB 3KXFE 5C70A 5FCSH 4H8VA 5BOZG 4RMQA 3ME0B 5B1BB 2E7LC 1WIOA 1IGML 1U3HA 4J8QA 4NHUB 3GD1C 3QDGD 4FMVA 4OKDA 5C09E 3ZE2F 1FO0H 3ZQXA 1KEGH 4ZK8A 3ARDC 2F5AH 4W9JC 3TBSA 2Q3XA 1M56B 1F8TH 2XSKA 5EOTB 4KVPA 4FLSA 4H8QA 2DQMA 5GISH 2ZZUT 1PU0A 4LCIH 5DHVH 5EEUA 1BD2A 3S37H 2I7SA 4FFYL 4J3OF 2XDHA 4F58L 4AVKA 4FFWC 3H9SA 4HWEL 1KN2H 5CBAA 4OZHB 4GUPB 3VFVB 3VMOA 4EQ3A 1NC4B 4AEFA 3WUWB 2NXZB 2OYMA 2WB1A 1GKOA 2C9XA 2WO2B 3CFJB 3W5NA 5D7JC 2B20A 4G9FD 4ABQA 3DO3A 1QRND 3P3SA 4PJ6A 3U48A 4X4YB 5EEXA 4L8SB 1YEFL 1KUMA 5ESAA 4Q9BA 4D9QD 2G3MA 2JE8A 2Y1YA 3TJHD 2A6JB 2OL3B 3UYOD 1OPGH 4ZX3A 1FG9C 2YN5A 3TTSA 3SGDH 5HJDA 1RK7A 3MA9L 3MRDB 5I23A 2PYEA 4UB0H 5E6ID 3MV9D 4JDEB 4OCYH 2VDQL 4GLRI 5FYLL 1IGIH 1ACYL 2X2YA 1WT5C 3M1BB 3A22A 4BUGA 4MAYA 2H6PB 2Z8SA 4AKQA 5HI3C 2PPAA 3E9UA 1ACXA 6FABH 4A7GA 4KBPA 1H3PL 3EO9L 1AHWC 1FV1B 4JREB 4MX7B 4ZMOA 1A7RL 1JPFA 4P46A 4YSDA 1O0VA 3TH4T 4EEEA 5JW4Q 1GL4B 1FSKC 3HC0A 4H0HB 1IL1B 3L4TA 4EDWH 1OD7A 3Q3GB 3JT2A 2OSXA 2Y1AA 3L3OC 3W11D 2N1TE 1TIUA 3QIWA 2VN5A 1UOLA 4RGOL 4CW1A 5B8CC 1FBIH 5AVVB 2DLTA 1F4YL 1WO2A 1VHPA 3PWLA 4CSTA 2R9HD 4KMQA 3QDJE 2J7LA 4BH7A 4K07A 5L9DL 1K3IA 4NZUH 2GBUA 4DQOH 3G3LA 3B3IB 4WK0B 1ITCA 5GGTA 1PIGA 1MFDH 4MZ2A 2ROXA 5GJSL 2P5WA 1WC7A 3GJEA 5JW3H 3T6XA 3DV4B 1ID5I 1MREL 4L8BB 5IB3B 1AS8A 3EADA 1U8MB 5FDWB 3KPSB 4LSQL 5KYXA 2AW2A 3MC0A 4Q6YA 2B8OT 3IN0A 4P59H 1TZAA 4LKXA 2DTMH 5KSBA 3T4AB 4JM0A 1LD9A 4P3DA 4UOW0 4Z23A 4XP4H 2EYSA 4NAMA 5DDHB 2XV0A 4FLRA 2NYYD 1MCEA 3K72A 4WFHD 2ICEA 4G8GA 5CUSH 5T1DH 2FH6A 2MCPH 3DIFB 5ADOL 5BV7B 4TSCL 1BZ7A 1CDCA 2AMGA 4PGCA 5E2UH 2IEPA 4LIQE 5HSFA 1CC3A 2EKJA 2IH3B 3E2HC 1KJVA 1LILA 2Z35A 4KROB 3RB5A 5BOJA 1CT8B 5DJCA 1Y1DA 3KS0J 5IZ7A 3FSWA 4LLYB 2EJ1A 4JRYD 2D7NA 3D4GA 2NXYB 2X41A 2XNAA 3RTLA 4JPIA 5KVEH 2VXUH 1JGVL 4M6NL 3AT9A 4M6ML 1YNTB 5HHME 3FNKA 1MIMH 1WZKA 3UTZA 4I9WE 3V9FA 3BHBA 1D5BB 4HZLA 4U1SA 2GEQA 4G9DB 1HE7A 2XN1A 5AW0B 1GSKA 2AEQL 4WI4A 3T2LA 1JNJA 4DGUA 1SY6A 1X5GA 1TF4A 4X8GA 3WNLA 3AQXA 3WNNA 1UB6A 3II2A 4YHPA 4G70B 4FQIL 4FFWD 3K6DA 2DJSA 4GRLA 4JFYA 1M6OB 1Q9WA 4EKXA 2JNZA 3RNKB 5F9WC 2OSWA 1F3DH 3E8VA 3VFGH 5EZJA 2FJGB 4ZXBC 4AVHA 4U6VH 4BSJA 5JZ7C 4OLXL 4R90H 1U4EA 4N90D 1YZZA 5BJTA 4HIHA 3RY4A 1FCCA 4CVXB 3WTXA 1HHHB 3BDXA 1G6RH 1NAMA 3CDZA 1ZHNB 4JVUA 4UAOC 1OOAA 1DQTA 4OBSA 1LE9B 4PJ8D 5GHWL 1F90H 1N64H 1BVLA 1RIHH 3CNKA 3W2DL 4YWGH 5FGCB 4GO9A 3QFDA 3MRLB 4PJXB 5LCVL 4F57H 5C0ND 4WEBL 2O61A 4XMZA 1LEGA 3D85D 1JWSA 5FLVA 1CGSH 2CLVB 3IJYB 1W72A 5G4MA 1I1RA 1E7UA 2YAMA 4ABWA 4ADGA 4AMKL 4OV5B 2I27N 1SJXA 2XKSA 2HP4A 4X6DF 2Z64C 4Q0XH 4KMLB 4FA7B 3A5VA 2YXVA 1T04A 2YD6A 3WFBL 1CICC 1XHHA 1O75A 5DMIH 5DZNA 4U3SA 1NC2D 4H88H 1T2QL 1UA6H 3QUYA 4OLVH 3U4BH 3UJTH 5I18L 3VWJB 2HJLB 3V0FA 2NUTB 2WYIA 4HUXB 4Y2OB 2MQCA 4GINA 5I1IH 3N55A 3ZTJG 3VFSA 2K8QA 1QWHA 4YVNA 5DD5L 1XGRB 2OMBA 4U2ZA 3G6AB 4XMUA 3VX0A 4LLDB 3LVTA 3RDTC 2VKXA 4NQVA 5KYWA 3TA3B 2ADJB 1M42A 3DRQA 2VLRD 3IU4H 5G55A 5I6KA 3SDDC 3BP6A 5SWZB 4H1LA 5F88B 1ZT7B 5F96L 1AR2A 4G8IA 1DQDL 3RL1A 5F72S 4JFOA 1ZSHA 3CVHL 1QFUL 1U8IA 2EC9T 5EUOF 3ZKXB 1JZFA 4ZD3H 4LKCB 2A6IB 5I15H 1E42A 1ZT1A 4PP1C 2J88H 4YZWA 3HVNA 2OMVA 3FU9A 4HFWB 4PU2A 3REVA 5C0JB 5FUCC 3TCXA 1XF1A 1G94A 1P5UA 2JJUA 4J23A 5INCA 4UU9B 4JE0A 4XNZB 4IK6A 1R17A 3MBED 5CZRA 1NLDH 1JI1A 4D0DB 5FO9B 3VSUA 4LDOB 3X13B 5ICZB 2A74A 2BSRB 1ZGLA 3UTPD 3LXUX 1BF2A 4OCWL 1LO3H 1S9VA 4P2QD 3CN3A 3V4VB 4PVBA 5D5MB 1UWYA 3MRKA 3JWNG 3QQDA 3CSGA 1CIUA 1JVLA 1BFOB 5ITBH 4WFFE 2BHFA 1BW8A 1OF2B 5BZWA 5DMJB 4MYPA 4PVMA 1UWXK 3EJTA 1KIQB 5F6HJ 2CM5A 4C58B 5DVMA 1A6AA 3HUJE 1H5BC 2C9RA 3I6LD 4ENZA 2GJZB 3MOAL 3GRWL 1NFDA 4FQLH 4R4ND 1I9JL 2WVTA 2ZWSA 3APNA 3OV6A 4PWIA 5LDSA 2HG5A 1X7QA 3HAEB 3VXUD 3U2IA 3TBVB 1X5MA 3HFFA 4DP2X 4GLRH 1DJWA 2XT1B 1SXZA 1X6NA 2NX5B 3Q8CA 3AS0A 3I50H 3OKOA 4JPWL 3JV4A 4NN5B 3PAUA 5EOQL 3L9RA 3P3RA 4ZXBD 3D3VB 1TCMA 2OTWB 2ZCHH 3KYNB 5F7LB 3BISA 2XIIA 2WWKT 4NAQA 1JYWA 5D70H 1NEZB 1XDTT 1I8IB 3KLSA 1JZ4A 3K5SA 1BSIA 1XD0A 4MAZA 4NLAA 4AGMA 3LDBB 4QKXB 1E28A 5EEWA 1GIGH 3QUZB 5E8DH 3DTUB 2QPUA 3GEWB 4FXGA 4XNBA 3STBA 4MNQD 1JHTA 3ZE2E 5D93B 1H9VA 1GHFH 4OFVA 4PM1A 3PP4L 5CJOH 1N59A 1QBLL 5DS1A 4HLZG 4AL8C 4F8QA 3SDAC 1JNHA 3VGAB 3L1OH 4EUPB 4ZFZA 1N8ZB 3SBPA 1CICD 1BIHA 3EBAA 4DFIA 5CBEB 5C3LD 5AB2A 5IQ9B 3VA2C 3HR5B 3KCPB 1JYNA 4HS8L 2VZVA 3T6ZA 1DLHA 4P5KA 3WI9A 4I0PA 4PRPB 2E27L 3IF1A 3WIHA 3X14B 1MW1A 1VFMA 2HFGH 4M4PA 4NO0B 3N44B 3NESA 1B3JA 3PHQA 1HILA 3DMMB 3WIIH 1C5CL 2CWRA 1JPTL 4UV4L 3CVIH 5K9OB 1SMAA 5IMKB 4CNIA 2B3IA 3UH8A 1BMWA 1EO7A 2RQ8A 3EJSA 1S7TB 1GGUA 2Z3FA 1MG3C 2CRMA 4KRPC 3MA7A 4FQXA 1OIOA 3N85H 1E4XL 3VXNB 1BQHG 3UG5A 2FGWH 4K8RL 3RIFF 1OGAB 3GO1L 4Q9QH 1ZPUA 1NDTA 3ZKQD 3O3DA 4WLCA 1WQVT 3EHBB 3LZLA 2JCCF 4WY7L 2YPLD 4QOKB 4HUNB 2WVVA 2XX0A 1OT4A 4OB5H 4GW1A 2IXQA 3OSVA 3TT1L 4JGNA 2PN5A 3V7AG 4MJHA 1FWXA 3P77B 1MFEH 4N2NA 4NOFA 2GTZB 3VRJB 1BBDL 3FUMA 2JLPA 4IBYA 2OZ4H 5IJVA 1T0OA 2VQ1B 12E8L 3QEQB 3PNRB 2OMXB 4DT2A 4UTBL 4UQ2A 1EDYA 4YOKA 3V6OA 1Q0YH 3LB6D 4NPJA 2B0SH 1BXUA 3MX0A 4F80A 4QGYA 4XPBH 5D1XD 5CHNB 5MERA 1NBVL 3BP4A 1TLKA 2PXYA 5EBMB 4C56E 1YYMH 5LDUA 3QA3B 3HRZB 4NO2B 1EAPA 3HC4L 5ERWB 4A63A 4PRDB 1AZCA 3JV6B 4KK5D 3MYJB 3U0TA 3WY2A 4XPTL 2K78A 2NOYA 5GPRA 5E2TL 3MTRA 5BZXA 5CCJA 1J18A 3G9AB 4PRHD 3WJJA 1T5KA 3JUZA 5I6PA 4R9HA 5F8QC 3UC0L 4HOXA 1PYWB 3HPJA 2EXTA 3WUWG 4Q58C 3ZTNL 3GSVB 1PZUB 4WTXA 4F8LA 3MLXL 4LCWD 1HHKB 3FU7A 4JM2D 5TQ2L 4HK3J 4QHKJ 1TETH 4R97C 4WK2B 3BZEA 4P4KB 3UBFA 1SJMA 2XX1A 5C0BB 2XYCA 5CEZE 1RZ7H 1U8QA 3L4UA 1FFRA 4JG5A 3C5SA 4YHYC 1JNNH 4JAMA 1JGLH 5E1AB 2CCLA 2EEDA 5D2LA 5FV1L 3PHOA 3VD2A 2OCJA 3SYPA 3B6SA 2OMWB 1NBYA 1KIRA 2VDKB 4NJ9H 4G3YH 1TJHH 1JWMA 4R0LB 3WFEL 1OLZA 3D39E 1NAKL 35C8L 4ZTOL 2H9GB 5DGRA 2VLMD 3ZKSD 5BMFH 4JFDD 4HV8B 4OF8A 4DEPC 1CK0L 3U6XS 3BE1H 2P3YA 2E3VA 1QSZA 3HE6C 4XP9H 1XGYH 5GRUH 3CPUA 5EF3A 1SYSA 1CFTA 3SDXB 3IMRA 5C07E 3LZFL 4RVBA 2BRRH 5KVGE 3CE1A 2IQ9H 4HAGA 2HX8A 5C8JB 3VXSD 4P48A 1NCHA 1XSOA 2PWGA 3K74B 2XQBL 3QNXA 4FCHA 1DQLH 3WS6A 1L7IH 5GGSA 2HPTA 3V5HB 2V5RA 2R2CA 1NGQH 1OCCB 1AHKA 2AEWA 2WBKA 4M6AA 1OP4A 1G0YR 3LNFA 1NCUA 2NNCA 4ODSL 3GSWA 3LXBA 5DUBA 3S3BB 2V2TB 4ZNCD 1YPZB 2YD5A 2VL4A 2QR0B 3CQPA 3TH2T 3TFBA 2J57A 1WD8A 4ZMVA 4MNHA 3AY4A 4DP8X 1DJHA 1KPVA 2P42B 1AD0B 3L3HA 3LPOA 2HWZH 3EYSL 1KLFB 1ZV9A 1MCIA 2EIMB 2NZ9C 1PJWA 1UWXH 4PS7A 1DJYA 3K81A 3ULVD 4MXVF 5DC9B 4YSUA 2J20A 1AD9B 4ZZKA 1KTJA 2ZCKH 1L6XA 4GB9A 4X6DE 3H6JA 2BSED 3CHPA 4NKQB 4HW6A 2L8AA 5HHPB 2I9TA 4PRNB 4L4VE 3DBXB 2A2QT 2LLGA 4MCYB 5DFVC 1GGBL 1MWAH 4UOQA 2D3VA 4I88A 4GEJA 2FEDC 4Y1AD 3WJLA 5DUPL 1P7BA 2VDNH 4I18C 4OGAC 3WNMA 2DJ4A 4MA3A 5KBPA 2WNWA 5E08L 1MDTA 2FJHB 1D9KB 3PDDA 4RIRB 3T2NL 1FDLH 4OCSL 4XVJL 3CWGA 3ZIYA 4BQBA 1ADWA 1D5ZA 2R2EB 4G7VL 2W81C 3CHOA 2CJSA 3K6NA 4GH7B 3PXHA 4TVSa 4NM4L 4XPAH 5JXAH 2ZXCA 3ZRCC 3ESPA 4RGMC 4F8OA 2QMKA 4KDVA 2FX8L 3HC3L 1MFBH 4U2YA 2V9TA 3QZNA 1PLGH 4KPHH 3MREB 1PZBA 1OO2A 4ZS6D 2ZNWA 4TL5A 1G7JB 5B21A 5T3XH 4DGYH 2AANA 1P2CB 1S7UB 4J12A 4HGWB 5GS1A 4JO1L 4UOZA 4AZ8B 1L9QA 4R4BA 2X0VA 1EFXB 3NK4A 1OSYA 5D1ZB 3QG7H 3FB6A 4D0CB 2YUWA 1MIEH 2ZP0T 3LZOA 1B90A 3MJ8A 5CMAB 3BQUC 1WA1X 2A6KA 2R1WA 3DVFA 1P84K 1Q94A 2XN0A 1G4RA 4OQTA 2BNQB 3HG1B 4N1HB 4Y5YA 5AAPA 3FQRA 4ODVL 1NIFA 1KNOA 3RB7A 3U7WL 3ZKMD 2A6DB 4XNQA 2FZ3B 1MFAL 4HUMB 2F5BH 4MWFA 2P8LB 3HEIB 2WW8A 1JD7A 4GOSA 4PRIB 3K6FA 3NJHA 1Z9OA 5D2NB 2YMXL 4G72B 2COVD 4P2AA 3HE6D 2JJSC 3T8XB 4QXVA 4L4TA 5J12C 3G6JB 3OD3A 1N70A 1R5VB 4NQEB 3W9DA 3O3EA 3CLWA 1C16A 2HCZX 4PTUA 2CKBB 4P5TA 4HJUA 2FB4H 3SKJL 5IB1B 4I1PA 3W0WA 3FUFA 3LH2L 1G7IA 4XPGL 1INDH 2DQFB 4G71B 1YEEH 3D2UB 4AQ1C 4HS6A 3JXAA 1ZLVK 4POYA 3QPQD 4XMKL 4GFXA 2QADC 5I1LA 2LAGB 3CFKB 1CZ8L 4GW4A 3LXAA 3E1ZA 4OD1H 5ALCH 3K2IA 2CPCA 4KK6C 4MA1C 4JGMA 1ASQA 4N20A 5DZLA 2IANB 2NY1B 2ZOTA 3DX1A 5C08E 2NYKA 5I71C 4ELMF 5JPMA 3ARED 4MJIB 3LRLA 5CN3A 3BAYA 2VISA 5DEFB 1URZA 3UBHA 3IDUA 3ARBB 3VYNA 4EDXB 5IFHL 4A2LA 2P28B 1XGQB 3WNKA 3QJRB 1S9YA 1A6WH 5GGVY 5KTEL 4L5FE 4U1LB 1KBKA 4HJGA 2AJYH 1TNMA 1FQ9C 3NVQA 5DLML 4PREB 1MNUL 2X89D 3BKCH 5HTSA 3UAJC 3N1FC 3EYFB 1KV3A 1IEBB 1W0YT 3RA7H 4ENEC 2DEXX 5IJKA 4J1UB 3K8LA 1I7UA 2HKFL 5F3BA 3UIYA 3RG1C 5E56A 1NGYA 4LARL 3VUAA 3MNDA 2YARA 5B39A 1Q1PA 4WNQB 3BT0A 4RMWA 1LP9B 4W9CC 5AD0A 5IMLB 1IAII 4QWWC 3IDGA 2VXQL 2WYTA 1HH6B 2B15A 3L08A 2H3XC 3CUPA 4FG6D 1IGFH 4FZ8H 2RCSL 3OB0H 3WKML 1Z5YD 2A73A 2VDPH 1WJ3A 3BP7A 3NCMA 1YEKH 4EI6A 2R29A 4WHTB 3T04D 3H6AA 1B88A 1CD8A 3QCTH 4YN3A 5BQ7B 1TYRA 2DWEB 2PCPB 2QBWA 4NKMB 4Q8BA 3D52A 3IJ9A 4KAQL 5FHAL 4Z7NB 1CXHA 5BUGA 2WWMC 3FQUB 1EXGA 1SBSL 3B8SA 4B5EA 1KB9J 3CZGA 3HAEG 3TURA 3S5LB 1DQQB 1GKEA 4XCFH 2JCCE 3LZPA 2SEBB 4XAKD 3MGTA 3OB8A 1IMHC 1FGVL 1L9OA 4AKPA 2VN3A 1FFPB 1CTOA 5K33A 3SJVD 4JFFA 5DHYB 4YHOH 2X1OA 3BQUD 4F15C 4AYID 1F11B 2F19L 1NEZG 1F18A 4JRXD 3SGJA 2WXKA 1BLIA 1P4LA 2D2OA 5JIKA 5EF2A 5I24A 4EIZC 5GRWA 3QIUA 3O6ML 1P1ZB 3F7YA 2ADYA 5IQLA 4YX2L 3MRHA 3IFLL 1CE6B 1D5XA 4L9LB 1TVHB 2NY0C 3C2AL 4XPFL 2RIKA 4EUPG 5I1DA 4NHCH 3N1GC 4JM4L 2ODHA 3KVPA 3VXPB 4X5XA 2Z6FA 3P11L 2WKGA 3I2CL 1M9WA 1EXUA 2KLSA 4IBLT 4XC3L 1DBBH 5FKPB 3STLB 3BH4A 1KB5B 1VJSA 3NJKA 1S7SB 4AQAA 1UUNA 1VA9A 5BO1L 1QATA 1D2PA 2K8MA 3GDBA 4S2SA 4UQDA 3SE4C 3UTSE 4ALAL 4W6YB 4C4KT 4PJCB 4B7LA 2Y36H 3NCYS 3QW9A 5C71A 4KK6D 1Z3RA 5LHDA 3QDGA 1JZJA 2B3RA 4K7FA 3GSUA 2XCMC 4P8QA 3TONA 3SE8H 2BFVL 5C0CE 3KXFD 1GYWA 5FS5A 4P3CH 4I3SL 5FGBC 2FQDA 3F01A 4TVPE 3RPBA 2UVFA 4XP6H 1AE6L 4UNIA 5C09D 4FHBD 3MCLH 1REIA 3ZDYF 1XF2B 4YPJA 2Z7WA 3VGDA 2JQAA 1A6ZB 4KY1H 3ROLA 5E23A 3UAJD 4QRPB 3ILEA 5CINL 4JMXA 4RMBA 1K8DB 4Q6IB 2BVUA 3HG0A 1QRNA 5DJAA 3NH7L 2D7OA 3FH7A 4L1TA 3FO2A 4C83B 2LHAA 5DWPA 1H15A 3GZOA 4F2FA 4HJTA 2WZ6A 1V8HA 4NUGH 4DQAA 1XGUB 2IADB 3BPNC 5A7BA 3QORA 1D5IL 1N0XL 3GKZA 1JGEB 3LS4H 1AGBB 4MZ3A 2FAUA 4XVSH 5I66A 3ETSA 2FX7L 5L7XL 5HDWA 1CL7L 3E80A 1A6VH 2VDLH 3QXUA 4HIEB 5I8CA 2O6PA 1UD8A 5I8EB 3VD1A 3L2MA 3L5XH 1NBZA 3N42F 1F4WL 4FQJL 2FO8A 2FUTA 1Z32X 1SF3A 2XTJC 5DRZB 4X6BB 4UAHA 3SOBL 5GZOA 5IMMA 3VU2A 2I25N 3WXWL 3NIFB 1BJ8A 2IBZY 1G1KA 4MXVE 2AS5M 3QARA 5HDLA 1DSYA 2WLJA 3CVCA 1KDIA 3GXNA 3M8OL 4RDQG 3UPAA 4NC0B 3VGHA 2IAMC 3KR3H 1JF1B 1MJ7L 1WBZB 3Q2VA 1TFHA 3FB7A 4MMZB 4YHNB 3QG6B 3PWVB 2NCMA 4YQXL 5AKTA 5GJTL 3G6DH 1RJYB 1E9OA 4M1CD 1GR7A 3E6FA 5MI0C 1A7OH 1OAZL 4MYWB 3F05A 4O02L 3S96B 1FYTE 4NNPH 5BRZE 2DDQH 3JWDH 2WY3B 1IAOB 3AXLA 1B9ZA 1C7SA 4M3KB 5KSUA 2QQKH 1ZEAH 2EE0A 1N12A 2DLHA 4ZSOA 5F70A 4ODWA 3GSXB 5DRWB 1HHIA 3FJTA 5IW6B 4X5RA 4YHZL 4M29A 5IGXL 1MCBA 2D7TL 4H20L 1FORH 3SBRA 1A4JB 2AAAA 1YMMB 4WEUD 5IJDC 4YC2C 3WYRA 5EO1B 4S0HA 4KJYB 2OR7A 3GBMH 2H2PC 4DSYA 1DBJL 3FT4B 3MO1A 3SEPA 3KPRA 3L95B 4KUZH 3TYGL 1GC1L 1FL3A 4FFVD 5T3ZH 4FMFA 1QFWL 4XO3A 4CMMB 1YUKB 2EEAA 3MV8B 1IZKA 3VI4A 3ULSB 3FHQA 3SO3C 4IU2B 5BVPH 4PJHF 4KRLB 1OAKL 5C6PB 2XWJA 5ID0B 4F8NA 1N5AB 4XCEB 3FSZA 3UG3A 4ZG1A 5TFSH 8FABA 5EUOA 3FRPA 3ZOAA 1RPKA 5SV3A 4PJ9D 1XQ4A 2PYFA 4NZRH 1JXKA 2WLIB 3IBOA 2R56H 2E7LA 2H2SD 1S6NA 3QDMB 3ARDA 2R0LH 2VGLM 2H6UA 1GGIL 4PW4A 2BHUA 4FE9A 1EHLL 4MJ6A 3PQYD 4JPVL 1ITBB 5EBLB 4PLKC 4UQIM 5HHMD 4NP4L 3GJFA 1UM5H 1L6ZA 5DZVA 3ALPA 1IAIH 4Y5XC 2DYPD 3CVDA 1RZKC 2F7RA 4I9WD 4TLUA 2W8CA 2KI6A 4NOBA 4XPHL 1BVKB 4FG0A 1T03H 1C1EH 6PAZA 1OM9A 3FBQA 3LZNA 4IJ3C 4WQOA 4YK4C 1MFNA 5FM5M 2X6UA 5D7JA 3F12A 3DROB 3RZCB 4UTAL 1A4CA 4JDVA 1M53A 4NIKB 5D7LA 4QRTB 3MODH 4KNSA 2W07A 3X12B 4F24A 2QJDA 3VRIB 4WU5B 1J8HB 1DVTA 1PAZA 4NO3A 1INQA 6CGTA 4IJTA 3FT2B 2OMYA 3P2BA 4U05A 3LN9A 3QJQB 3U1SH 4PJEF 5I6XC 2R2BA 1EVTC 3OWEA 2X4SB 3A4DA 1WT5A 1MHPH 3MRPB 1J8SA 2AV1A 4ELME 5DR5H 4AT6A 1RUKH 1OTUD 2DD8L 1CUOA 5I1JH 2BSCA 2JK5B 1A14H 4XBMA 4HXAH 3ROOA 4D2NA 2O5YH 2YGVA 1AHWA 5IW1B 2Q7YA 4ZUTB 1OQOA 2G5BB 3BKML 5DT1L 1YCSA 1PG7L 5DA0B 2Y7SA 3RGVB 3P9WB 4PJIA 3U7AA 1WEJH 3HW7A 1RZ8A 2DLFH 1JHLL 4IBVA 3TGXA 2IAMD 2OJEB 3L3OA 3ZR6A 3WL9A 1R1CA 4OUUB 1QYGH 1AO7E 2ZOKB 2ZSWB 2VDRH 1HC1A 5B8CA 4L1BA 4N2FA 2J72A 3VFWA 1A9EA 5EA0L 4L0PB 1UVQA 3D09A 3FCSB 4FC3E 2CGZA 3ARFB 5DD6B 3BXNB 3MROB 3LHPH 4KUCF 5HI5D 1KJ2H 4D3CH 1Z9LA 1VB9A 2VL5A 5E8OA 2B39A 3MLUH 3B2DC 1BMZA 3PL6B 3MBWB 3WTSA 3G08A 5TE4H 3AADB 1U8LA 1TG8A 2W0LA 2JELL 3IEAA 4FX5A 4WAFA 3PGDA 1KYFA 1YMHA 2QDWA 4KX7A 5AFAA 5K9JL 4HU8A 3CZSA 4R5VA 4LFHG 2G0LA 5EU5A 5DUMH 4ODHL 5FGSA 3MLRL 2JB5L 3P4LA 5HHVH 3TBTB 1QSFE 1O9VA 2EO9A 1NM9A 4GKZA 5KZCB 2IWEA 4DCQA 5FUZL 1XIWC 3NCFB 3VM5A 5EBWB 4YXLH 1GGYA 4KH9A 3ZTJH 3RWFB 1I7RB 1DVSA 1RU9H 1SXNA 3EGXB 3MLZH 4ZX6A 3KW8A 1T6VN 2EVIA 1F1DA 4TRPH 5GRZA 4NQCB 2K3HA 2K70A 4JR9H 5T5NG 3MRNB 2DM3A 4JY6B 2CDGA 4P05A 1BFVL 3L4XA 5CAYB 3ZDZB 3IKKA 1OGTA 1FLTX 3VGBA 2P26A 1YUHB 1TQCB 3OZLA 4MRBA 1UXSB 4B27A 1X7TA 3HNVH 4U1GC 4N6RA 2YKLH 2CUHA 1ZKAA 2IDUA 3B2XA 5JDJA 4PLKD 3QEHB 4G8FB 3U25A 3C8KB 2KZBA 2OLDA 4L1SA 1QMUA 2W5PA 2UY7B 1AY1L 1I7TA 2FD6L 3E38A 3OKMA 5DJ6A 3B2UC 3DVNA 2YN3A 4BEIA 4AYEC 2FBOJ 3PAYA 4ZO8A 2ZX5A 2DY2A 4UYPA 1NGXB 3N40P 2BJMH 2ICWA 1A5FL 4Z7UE 1UXLA 2ZKYA 3KDMA 4LESA 4A6YA 2YQ2A 1VF5C 3DOIA 3LKQB 2YD0A 3MACL 3BVTA 2AI0L 4TUKL 1TLMA 2GFBA 5F2FA 1J11A 4TOYH 2WUBH 3HB3C 1OLLA 1RY7B 1VGEH 2J56A 4AGLA 2HLFC 3CXHK 2AEPL 3LQZB 3E1F1 5FYJE 5GRJL 5CU5A 3N9GL 5KYYA 4TXVB 2X4PB 4N2OA 4N2MA 2VIRA 4AYMC 4OZFB 1PZ5B 3JWNH 1ZS8A 2UYLB 4Z0BH 1D5MB 4HFUL 4UILL 4AXWB 1OAYH 4LZKA 1ZLWK 4M02A 1CICA 3KWVA 3S5LG 1CXFA 4PG2C 4O4YL 5EUKA 1YEJL 3ZDYE 3M88A 1DQVA 2A9MH 4M1DH 4R3SB 1A7NH 3IFNH 2C9UA 5LQBL 2BOBA 1D7CA 1JF6A 2BSSB 2CLRA 2QDVA 3C60C 3CFCH 3GTNA 4PTTA 3A67H 3U0WL 4GQ9H 5ID1B 1G9NL 4BFEA 4KTEH 3BSZA 2Z8WC 3KD4A 5FOBA 3KZ8A 2X4QA 3V4UH 4JFTA 1A4KB 3VXRD 2XICA 3PWPB 4PV9A 1OAXL 4FRWA 2E0PA 4J3OD 5E70A 3W81A 5CSGA 1IAIM 4OJYA 5LWYH 1Q1JL 5ISZA 3HC2A 1QFHA 2CHWA 4J4PA 3L1GA 3RDTA 1Z1WA 1DBMH 3NT0A 5J8OA 1IFHL 5INDA 4V11A 3M7OA 1QQDA 2X4OA 3DX8B 3WN5C 3B7YA 5HHOA 3SDDA 1NPNA 1PL3A 2XQYA 3ZYIA 4Y1TA 5DU7A 4L3EB 3DRTB 3IXTB 4D9LH 3AU1B 1NIDA 4YDNA 2ATPB 1SQMA 4XI5D 2V5SA 5IT2L 4OIIH 3O6LH 1NCAL 4G9FB 1U41A 4GAYA 4NQUA 2DOCA 1X9QA 4UINH 4X9F