3QUHA

Structure of heme transport protein isdh-neat3 from s. aureus in complex with manganese(iii)-porphyrin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
112
structure length
112
Chain Sequence
LTDLQEAHFVVFESEENSESVMDGFVEHPFYTATLNGQKYVVMKTKDDSYWKDLIVEGKRVTTVSKDPKNNSRTLIFPYIPDKAVYNAIVKVVVANIGYEGQYHVRIINQDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis of recognition of antibacterial porphyrins by heme-transporter IsdH-NEAT3 of Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Heme-binding protein
molecule keywords Iron-regulated surface determinant protein H
total genus 24
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3quhA00
3SZKC 3QZOA 4H8QA 3RTLA 4WJG3 5D1XE 4FC3E 3QUHA 4H8PA 2E7DA 2Q7AA 3SZ6A 3RURA 3QZNA 2H3KA 3S48A 3SIKA 4MYPA 3QZLA 4YMPA 3VTMA 2O6PA 3VUAA 2MOQA 5D1QE 2K78A 2ITEA 4NLAA 3OVUB 3QUGA 2ITFA 2O1AA 3QZMA 5D1ZI 2Z6FA 3QZPA
chains in the Genus database with same CATH superfamily
4ELKA 2B3RA 1N4XH 2BK8A 4FFYH 2BH0A 4Y8DC 1YLBB 4L9LC 4RIRB 2IWEA 2XWRA 4L23A 3GSUB 1MELA 2OL3B 4NO5A 2NY7H 2EE0A 5HJ3B 2XZQL 1SRDA 3S2AA 2IMMA 4P2OC 4TRPL 4HBQA 3HLKA 4NQDB 5FO8A 3GPEA 3RL1A 2HYMA 4U1GC 2BNRB 1JHKH 3QJHA 2ID5A 5ENWA 3VXQA 3UMNA 4PEEA 3QXVA 1TCRB 3DSFL 3IPBA 5L8LB 3GBNH 4Y9EA 4BH8A 2PYFB 3PUCA 3QJXA 5L2JA 3BN9D 4EXKA 2LV4A 3QXDB 1I1YB 4N8PA 1JZIA 1JGDB 1KGYE 3J07A 3H3KA 4J3OH 3FU6A 4H8UA 1UM5H 1EHKB 2FRGP 4NNXA 1T6VN 5D6CA 2AJZB 2V7NA 2AV7B 2IMNA 3BDXA 3O11B 4C4KO 5D1QD 1PG7H 1U8KB 1OP3H 3PLYA 3VD7A 3QIWD 4ZX6A 5AL8A 1MWOA 5DJ8B 1X9UA 5BZDA 1QSEA 2GBUA 2C1OA 3NJKA 3QPXL 4OUUA 2YC1B 3BI9X 5KN5A 2CPCA 1BJ1H 1BFVL 1EJOH 4O4YL 4OFQA 4FNRA 5GS0D 3CNKA 5LAXA 4K5NA 5KS9F 2DYPD 1PZDA 3FBQA 3MLUL 2E27L 5D4IA 3RUGE 1BYNA 4Z9KB 3GMNB 5FGSA 3GD1C 3GRBA 4I18A 2ZKXA 2PETA 3EH1A 4U7SA 3QUZB 3CQPA 4MJ2A 3TU6A 1QW8A 2IBZY 5E08L 2CUAA 4AKQA 4AQ8C 5CD3B 5I5IA 4HKJA 2VDOB 4QO1B 1AY1H 3TNMA 1FGVL 3HMXH 1AJ7L 2CNYA 3QE5A 5IB4B 5BXFB 3IDXL 3NJVA 2DM7A 5CILH 5CLXA 3RJQB 1P1ZA 1ZVHA 4C57C 1B4JL 1R6VA 3ZE1B 1FO0H 3HBGA 3QJQB 2VLLB 3V4UH 4PJFB 1NTDA 1JPSL 2G2RB 1AKJB 4L3AA 1B0IA 4XOCA 1E9QB 1ZLUH 4MJ6A 1OQOA 1FL3B 1Z32X 3MRRA 3CSYA 1CDYA 4E42A 4QHKJ 4H0IA 5FUCE 2AQ3A 2JIXB 3AAZB 1SNRA 3PHOA 4XVUC 4YGVB 3MLXL 5CD5D 2ERJC 2IC2A 2WNGA 2UZYB 3UBXG 5I0ZA 1FE8L 4XN9A 2WC7A 3FAXA 3G6AB 1U0QA 3FH5A 3VRLE 1Q0YH 3HVDA 3MGTA 2GKIA 3BQUD 4JPQA 1MRCH 4YHPA 1AI1H 4OZ4A 5SWQA 4XPAL 1MHPH 2MOQA 3B7RL 3I6GA 1R3KB 2R1XA 4D0DB 2Q3XA 4H1LA 2X2YA 3IXAA 3EIFA 3LVTA 3PXJA 5I6XC 3MV8B 5L9DH 5A2BA 3BLPX 4L48A 4MJ5A 2QQQA 4Y2NA 4BZ1L 4WFGE 1L9MA 4Z7QE 1T0NB 3VD1A 2IFGA 2QL1A 2APTA 4KRLB 4KZDH 2VE6B 2DL2A 2HAZA 2B1AH 2P4AB 2Y7MA 4Q89A 3RURA 2M83A 4IBSA 4HUUB 1ZLVK 4AEEA 1E28B 4LQFL 4BBWA 1CXKA 5CKGA 1WSST 4YHKH 4EVNB 2DLHA 3US1A 3MBEB 4XNXH 5DEGB 2YGOA 5MI0C 2FYVA 4GI6A 1W0WA 2GEEA 2X4PA 3SKJL 3LKNA 4KI1A 2OI9C 2GPZA 4AJYV 4ZG1A 2V5MA 2WHVA 4NPJA 4E41D 3EO0B 3CFJA 2EVFA 3ZDYB 3NAAL 4ONHB 1BXUA 3KW7A 3ZKXB 4QRUA 4L37B 2VLRE 3MTXA 2WWKT 3AS1A 2NXZB 4TVPH 4QTHA 2JKIS 2A0LC 4LPXA 2NX5A 2D7TL 4YHNA 4ZTPL 3OKKA 1MCIA 3QDJA 4FQXD 5D1XD 4XBMA 2XBTA 3STLA 3KS0H 1DLFH 4AEHL 4C83A 2HTKD 3UAFA 2EE6A 3D09A 2HFGH 2BERA 2NLJA 5DEFB 1GGUA 4TL4A 5FGCB 4ACTA 2D7MA 5SWZA 4GBXA 3LSOB 3NJFA 2IAMB 4PJFE 4HEME 4XCCH 2IDUA 2UY6B 4RCAA 2OTWA 4JM4L 3WXVL 4HJUA 4AQAA 1HWGB 3RVWC 4Y1AB 3T71A 3V4UL 6TAAA 1JS4A 1VFAA 2BOCB 2CLRB 5DTFB 1N7ML 1NZRA 2EZ0D 2QQKL 5C2BH 3AACA 2Q8BL 2Q76A 4JE4B 1NBYA 2EXTA 3PV6B 1M2VA 1A3LL 3IJHA 1S7RB 3TFBA 4M7ZC 2CKBA 3CFEB 3BSZH 1KB5H 4FTVB 2B14A 1Z0MA 2WSDA 3PJSA 1YMMB 3QO1B 1U4FA 3QUKA 4O9HH 5E00A 2HA1A 3HUJF 3O0RL 1WA0X 2BIQA 1CBVL 1AXSA 3L4YA 3OX8A 3SD5A 3VYPA 2EECA 1OXYA 2G9HB 3WE1A 5DT1L 5LGJB 1KZQA 1DDTA 3CDYA 4RBPH 4R0LA 2L4OA 1NAMB 3LDBC 3ZJAA 2WP3O 4Y16C 1LP9A 3QHTC 4XPBL 3ULVD 2LW3A 4X6FB 4CVZB 4NUGL 2VWEC 3TEYA 4YOKA 4FA7B 2FBRA 5E9NA 3MUGA 4I1PA 1LP9F 4F3FA 4G9DA 3SCMC 3DSNA 2PTUA 3VI3A 2BNQD 4DTGL 5DGRA 4M03A 4ZUVA 5A40E 1MFBH 4FTDA 2FHCA 5AYUH 2FDBP 2LVEA 2Y7OA 2QTEA 1PD1A 4GY4A 3QVAA 4UAOC 4Y5YB 3DI3B 1ZDQA 3F6JA 2YAPA 4EF3A 5I0YA 2X4SA 5KVGH 4CJ1A 5DD1L 2KI6A 3WIIL 4F15C 3CFTA 4LRIA 3DMMC 1KTCA 3LNEA 3BH9B 3AW5A 3B1UA 1NFDB 1TQBB 3NIDE 4WKZB 3T0EB 2VN4A 3HI5L 3NUKA 5B22A 5TQ2L 4BFFA 5F7DB 4KJPC 3IMUA 4IRJB 2ZOKA 4NQVB 2NQCA 1Z3RA 3HPJB 3NAAH 1DJXA 1T03L 3I2CL 4JY5H 4XB7A 3ARBA 3QJFA 5HVWA 2C34A 3L3HB 4ZTPH 4X7EC 4FULA 4ABQA 2EP6A 2ZUYA 4N0YL 2APSA 2C4XA 4XWGL 1TQUA 6FABL 5FC9A 1T5WB 3EBHA 1JWMA 2ZUVA 4V2BA 3HAEB 1KPUA 3PHQB 2F8OA 1KEGL 5KVGE 1FLRH 4LVOB 5F3HA 5IBTH 2WLMA 1DVFB 3GHBH 2KERA 3TONA 2FATL 4GIPD 3C5ZD 4LCVA 3DJ9A 1NM4A 2BIMA 1MHEB 2OZ4L 3LIZA 4B7LA 4FQLH 5MEOA 5ERWB 5HHPB 3T0EA 3V4PL 3B9KD 2Q8BH 1KGUA 2DWDA 5CBAA 5ALCH 2EYTA 2EXYD 4ZNEE 4DP2X 3T77B 1FYTB 3T65A 1LK3L 2MCG1 4JO2L 1ES0B 4MZ3A 2O6EA 4Y5YA 1YEKH 1DSFH 3G5XA 2APFA 5IF0B 1XB8A 1NGQL 3EG9B 3CN4A 3IVKB 3AG1B 5HJGA 3K6FA 3BPOC 4ZUVB 2LTQB 2Q2LA 3K71B 4E5XA 4PPTA 1OLLA 2VXUH 4NPYB 5F89B 4KK9D 2CCWA 4KVPA 4FXKB 5F6HI 1RZJL 4DVRH 4JFSA 2IAAC 1BMZA 2MQ3A 3MUGB 4E5XG 3L3IA 2XPZA 5ESVB 4NCC1 1KY7A 1SLUA 1KDIA 1UASA 1U91B 1JWSA 2LFEA 2MRYA 4LL9A 4PRHA 3SEPA 2A0LD 3ZYZA 1L6ZA 3NFPB 5JHBA 1NUDA 2FUTA 1BXXA 3KYMA 1TVDA 3ZU8A 1EUTA 4UTBH 2PP7A 1M4KA 2A9NL 4BE6A 5HPMA 2MCMA 1MNNA 2ZSWA 4IW4C 5AYUL 1JSYA 2KZBA 4JN2B 1WF5A 2FSDA 5IEHB 1W91A 1XV8A 2YAHA 4Y19E 4FXGB 5IVXA 3CVDA 4F33B 4ZMWA 4LLVA 2JJWA 2E46A 2YSTA 3P3UA 4FFZL 5IB3B 2D0HA 4P59L 4X6CE 1FV1B 1N6VA 2XWTA 3K80A 5I30L 5DHMC 2ITCA 2BOBA 4PGBB 4BUGA 2WVVB 5E2WL 3RWIA 3WD5L 4Z77A 2WKLA 4NS0A 4L4VD 4LLDA 2VR8A 3VGAB 5IMOB 3VRJB 3F01A 3LNFA 3OC8A 1NDMA 4YDJA 4YSOA 4XPTL 1A6WH 5D7KE 1N0XH 5HI5D 5LWYL 1YMHB 5IFJA 2IBGA 2BC4A 4X8JA 1KYAA 2O1AA 2Z4QA 2FHFA 3G3LA 3PY9A 1L5GB 4B9PA 1LD9A 4N0CC 2NT0A 3KPPB 3QUMA 4DJMA 4OFKA 3SKMB 3RZCD 3O6FA 4M4PA 2R1WA 3VO0A 4OLUH 2YPKA 3SDDA 4XZUB 3WBDA 4H0GA 3L3KA 3VMPA 3L1FA 1DQDL 4R96A 3HMXA 3VRIA 1W0WB 2OZ4H 4F7PB 4GRLB 3MAWA 3VRLF 2EIZA 3EYQC 1RZFH 1BM3H 4OF3A 3P40A 4OIIH 1E4JA 3E1ZA 1BXVA 5DZPA 1WFMA 2VE6A 2VW4A 3CBJB 3LXBA 5I0WA 1MFAL 4M5ZH 5ISZD 2YUVA 1AZRA 1JV5A 3LQZB 3QIWC 4BKLB 1CFQB 4IEFA 4MA1B 5C0IB 4LRNL 1ZXQA 3O41A 5EOCJ 4GNKB 3TYFB 3ULVF 3KXFE 1ZV2A 2XTJC 3EZ8A 3FU7B 3W39B 2DQ6A 1WQVT 4NOFA 2WP3T 1YEIL 4JFHE 4OAWB 2YK1L 2R8SH 4L1TA 1EFXA 3H55A 4KZCA 4XNQB 4PRBB 1I53A 2V2WA 4EBQL 3CXFA 2NW2A 1SBSH 3MGTB 3I75B 3BKYL 1JNLH 2JB5H 3F58H 3MRFA 4GSQA 2ZOOA 3KPNB 3ZZSA 1KIPB 2X53A 1NOFA 1T5KA 3KGSA 3UTQA 4BSVA 4KUZH 1J1PL 4X50A 3NCCB 4W9DC 2DS4A 3V10A 1KTDB 1U92B 5JUEL 1MUJA 3HKZA 5C6TH 4C4BA 2RBLA 3E3QE 2PUQT 3VW3H 3I6KB 1RZKL 2XU9A 1G5GA 4FNLH 5TDNA 4X6DA 5EBLB 1AYRA 5CJBA 1UKSA 4JFED 4OKVB 1K5NB 1OAZH 3NCEB 3SBRA 4R4BA 3ZHKA 4ELME 1M2OA 2FE0A 3BOVA 5GGQH 4QMEA 1KYDA 2PN5A 3LN4B 2UY7B 3LVEA 4LFHD 3ROOA 3RFZB 2A4EA 3IWVA 4M6OH 2GUOB 2ILLA 1EJOL 2WWMD 2PW1A 2KZ1B 5E2WH 4JFVA 2E27H 3LMJH 4JKKA 5DHVB 5FHAL 1JAEA 1OHQA 4Z7UB 4FC3E 5SX5K 4YDLB 3JSSA 1A6TB 1QFHA 3QCUL 1D9KA 4XVJH 3ZZ1A 2VQ4A 4JPIA 4EN3B 1B0WA 1HJBC 4G6KH 3QUZA 3RDJA 5DHVA 3DURB 1Z9PA 1C7SA 1ZT7A 4G8IB 2DM2A 3P2TA 3ZIYA 1BEYL 3VGFA 4Q6KA 2H1LM 5DK2B 5J9PA 3MYJA 4HUCA 4RH4A 4EIGB 5LAXB 5L6YL 4NO2A 4AYSA 1FO0L 1QFWM 2WKGA 2X12A 5KN5B 3ZRFC 3L08A 3DVGB 4Z7VB 4APQA 3E2HB 2Q20A 3S37L 3ZDZE 3ARXA 3RFRA 5TDNB 1SVBA 3HE6C 4GXFA 4JPVH 1JZ5A 1QEXA 3QEQA 5BV7C 4O51B 4KXCA 1I1AD 1MUJB 1QSFE 3HCVB 3VDBA 4JFQA 4H1LG 3FKUS 4GS7C 5DUBA 3GLEA 2E6JA 5GGUA 3CVIH 1NH6A 2ZKHH 4IU2B 3QXAB 4FYRA 2HUHA 4XC3L 5IG7A 2PPDA 5FUOL 2UZPA 2KT6A 1P9MC 3K6OA 1KZYA 1OTUC 1W2KT 2GJ6E 4FQ1H 4JAMB 4GEJA 4M7ZB 4UT9L 3TJEH 4EZMA 3BKMH 4H0LC 2IH8A 4KK5D 4XR8C 3CFIC 4UQ2B 4WV1B 1MCBA 1OOWA 3NSDA 4AG4H 4HAGA 5E6IC 1SYVB 3AU1B 4ZAKC 4X4XA 1U8NB 4Y9BA 5I24A 4HJGA 2X0UA 2IAMC 3KE0A 4KROD 1OGPA 2ZUTA 2XA8H 5D1ZI 2WKOF 3GSXB 3MV01 2B1AL 1BQHA 3UG4A 1I7TA 4AGOA 2VMFA 3P0YL 4F7PA 4LAQH 4WU5A 5KYXA 4JFFB 3S5LG 2VZVA 2A38A 4WI3A 4MNHB 1DBML 2WB7A 1I7ZB 4LHUG 3WNKA 2ZOTA 1U95B 5EU5A 3WNIA 3BAXA 5BOJA 2AQTA 1N5YL 2EUZA 2EKSB 1AD0B 3MCLL 2HX8A 3G5ZB 4NC1C 3C6LA 2F7PA 4RFOL 4X8JB 3VXSB 1P84K 4ELMF 4P57A 1QEWA 3OLDA 4B9GA 1HC1A 3QIBD 3WFEH 1SYVA 3AU1A 5IHUH 1D5MB 1QTPA 1T2QL 2NY5L 4J8RA 1N8ZA 4X6BB 4PR5B 1LO0L 1OPGH 4LP4A 1WFNA 1PLGH 3MV7E 3P0GB 4XH2A 5IBUG 2OLDA 1PZAA 3G6JB 3VGDA 3W38A 1MEXH 4YC2B 5HYFA 1M7DA 2FWSA 4OW6A 4A1RA 4KY1H 4J3TA 1IKOP 2XBZA 3P4OA 1CFSA 4CUCA 5GS0H 1FV1A 3MNDA 2VXSL 5FO7A 1WLHA 2R7EA 3UYPA 3DV4B 5B39B 1G7MB 2HN7A 4Z3FA 2JMRA 1E3XA 4HYTB 2IGFH 1IU1A 4BFGA 1AZUA 4KO6A 4JCLA 2NY6D 2WBWB 3ZMEA 5EIIA 3HNSH 4Y5XC 1A7NH 5C2BL 5KBKA 3KXFD 1LE5A 1M71A 4JFQB 5I1HL 5HHPA 3WMSA 1PX3A 1E9OA 1HDMB 5HPMB 4OJAA 1LO5B 4A7UA 3LS4H 1RZQA 5EPMB 3VXRB 1CD1B 2J1WA 2ERJB 3C08H 4B6ZA 3C8HA 1C12B 5GJTH 4DZBA 1N3NB 2X1WL 1KLGB 3MRNB 3WN5A 4PRHB 5ANMA 1AZBA 1OB1B 4UT9H 3R06B 1KYUA 2DEWX 2CMRH 1SLXA 3M6DA 4UBDC 3Q0HA 1JI2A 4JLRB 4CSPA 5E4EC 5JW4M 4JM2D 2Y4SA 4HOXA 3NCFB 1HEZB 2F7IA 4ZZKA 3AADB 4YL9A 4E9XA 2HKFH 3IU3B 2M1KA 3N9GL 4PJ7B 2EYTB 4HULB 3V6OA 2F7QA 1FGNH 5ITFB 4ZX4A 1QWHA 5MEOB 1WT5C 5B7EA 5T3XE 4D8OA 2CO2A 3GPSA 4Y9FA 5F9JB 1UATA 1OCCB 3FH8A 3D25A 3FT2A 4PU2A 4R8WL 3SQBA 3UGUA 3MJGX 3LZRA 3VE0A 1MFDH 3HAEA 1V7ML 4X6DB 3MBXH 4P3CH 1IKNC 2FUQA 4JG0L 3UZVB 1IC4H 1MCRA 1J1OH 2NDGA 1HOEA 1Q8MA 2FJGA 1XF5A 4ZMZA 1OM3H 2FSEA 4UTAA 1KTDA 3N1MC 5DFAA 2Y07H 5TH2A 3FFCD 2QGBA 2X05A 1HYSD 2QQNH 1XB3A 3LZOA 4OM0L 3FXIC 1WITA 4G1EB 1AO7B 3KPNA 3CN2A 1H9VA 4HGWA 2AQNA 3MRBB 4PJ9A 1KWKA 1AGEB 1ONQA 5J13C 3DVNA 2XBDA 2GFBB 1IAMA 4KY1L 1HK6A 3KPOB 4OAWA 5A2JH 1L7IH 1P7KB 3CHPA 5JMRA 3W39A 3RVVD 1V3MA 1JTPA 2UYLB 4ODVH 3W5NA 1AHWB 5BNXD 2D03H 1UZGA 1SLWA 2K3TA 3PNWA 4KJQC 4UV7H 3OG6B 2HFTA 3VWKD 3C60A 1INQA 2DQJL 5KSAA 2M8XA 2R2HB 3UO1L 5JIKA 3UXFA 5DFWH 1PQZA 4FEMA 1ZHLA 5GGRB 1YEKL 4Y4KB 1TEYA 1DSFL 2W5PA 5IMKA 5LBSA 4YO0B 1KBGH 3OBAA 3AREA 1I9EA 1YNTA 4OZFB 1U8OB 5A2IH 4F3FB 2N1TE 4HFUL 1P7BA 2XACC 4NJ9L 1AS8A 4GS7B 2Z1PA 4N0FB 4PQXA 1DVQA 1CT8B 2BHFA 5D7LE 4X5LA 2HRLA 2A6DB 3JV5A 1E4XH 4GIOA 4PMEA 4PRPA 4YQXH 3FTGB 4ANVA 4PRIE 1FORH 1EO7A 4HH9B 3SJVE 2OMTA 2W0PA 4N25A 2G9HA 1TJXA 1VPOH 5I6MA 2AI0L 1XGRA 5T3ZH 1RZ8A 4UTBL 2L7UA 2Z35A 3NQIA 3F7PC 4ILDA 3L9EA 4XP1H 3FSOA 3QDAA 1OW0C 1HT6A 3S3JA 2A1WL 1MQ8A 2AW2A 2DLIA 3O6KH 5CZXC 5T1MB 4K9EC 4K8RC 3S8WA 4EN3C 3MLRL 3A6BH 2OTWB 3UIYA 5BV7L 2NPLX 2CSPA 4HKBA 4KPHL 4LARL 4YZWA 4P46D 3ZSSA 4BQ6A 5LVEA 4JG0H 2R69H 1IC4L 4ZW3A 1BVLA 3BIAX 3X13B 1L0QA 1KGWA 1UJ3B 1YEJH 1QVOA 1EZVX 2F19L 3GLAA 4GP5B 4HCRA 1TO5A 1N6UA 3VXOA 1FG9C 3QDJB 4AGQA 3WJLC 1SXSA 4CA4A 1TZOA 2J73A 1XX9C 1DBKL 2AC0A 2J1YA 4K94C 1K5WA 2BVQA 2M2DA 3QORC 2E6PA 1DUYB 4L37A 5CJ8A 2CWRA 1KYFA 2X89A 3GXTA 3U9UB 1FDLL 1HCYA 3ZTJG 5E24E 1OSPH 1RIVL 4QJ3B 5AZ2L 3VJ6A 4L4TE 1WIOA 5EF2A 2Q86A 1M9SA 2XI9A 1FFTB 1L9QA 4YL4A 1RJZB 3IRZA 3OKDA 4M6AA 3IB4A 4NN6C 2OYMA 1FUNA 2C9VA 4XTRC 3FTYA 4A2MA 1AZNA 5IROA 1XQ4A 2FT7A 4ZXBA 1GAFH 1MWAB 2XDHA 3OB0H 5IM7B 3UO1H 4POUB 5CD5C 3N1FC 4PJAB 4LOUD 1HHKA 4R5XA 4OIIL 3LPGA 4QYOA 4JDZA 3QXTA 5FW8A 1BWWA 2CUMA 3EGDB 3ORJA 4NNPL 5KYWB 5AAMC 3PAYA 3Q3GA 5D5MA 1RUPH 3WIFB 1T6BX 1MWAA 3IN2A 4LRNH 1G6RH 4KU1A 3H9SD 1EANA 1F1AA 1SEQL 1YYLH 5C0CD 3VM5A 1PS3A 2EZ0C 4RDQF 2IO5A 2BSSA 5AVQB 5LBSH 4BFIB 3G6AA 1FORL 1DVYA 5FECA 3ZRCC 1WBYB 1EAOA 4D3CH 1A6AA 2VXTH 2GUYA 5EULV 4ZFOB 5EOCH 2GABA 2AXFB 1EGJA 2QADB 3IK2A 3MRHA 3WTWA 3QI9C 1HILA 5EN3A 5C07B 2HVKA 4DQOL 3W2DL 3Q2CA 4R84A 4P9MH 2Y2YA 2CH8A 5AW6B 3ARBB 3QJFB 2BVQB 4OF5A 1AXIB 3S5ZA 3N85L 4QRQB 5ESQA 3BWUF 3HMWL 3QDGE 3ZTEA 2GVYA 2Z8SA 3SKUD 1F11B 1K4DB 2A1WH 1YEHL 1QSEE 1J88A 2VYRE 5D2NC 3KWWA 4QTFA 3LH2H 3N42F 1BVLB 2VLRD 3ZVVA 2VLLA 4WGWB 4HAFA 4G83A 3BH9A 1O5DT 1ZK5A 3QUZD 2EDHA 3GHPA 1JMZA 4LARH 1F8TL 1IGCL 1T2XA 4NKQB 3DARA 1YQ2A 4NP9A 1GH7A 4GKNB 2EE3A 4X6EA 3SKNA 1BA9A 1QSVA 2ZUXA 2H47C 1ETZB 2EJ1A 2GJRA 2OMZA 4ZFGL 4LLQA 5FXCH 4I9XA 1FNFA 1YN6A 1N9PA 2P1YA 4K9EL 4KHTH 4OT1L 5IJKC 1NCBH 3TA3C 1WBZB 4KQ4H 4HUKB 5IQ9B 3LN5B 1PZSA 2KL6A 2ADIA 1S7QA 5DHXB 5AB0A 3ULSB 4MNGA 5D1QB 5AZ2H 3NABH 5EEYA 1ZXKA 1JZJA 3TCLB 3L4XA 5JHDB 3LZNA 2O5YL 1XGPB 2CLVB 3IDYC 3QQ4A 1RV6X 4LDLB 4PY7A 3L1OH 2JKNA 4TNVK 4KITB 3GUTB 1THCA 4CDHA 2F54D 3H6JA 3GS7A 4JMNA 4YHYC 1XR9B 3WIHA 1S4IA 1ACYL 3HZVB 3O3AB 3H85A 1F58L 4TSAH 5AG8A 1CVRA 1R3JA 2QPEB 3GKWH 1E5BA 2OSLB 3QIUA 3QHZL 4YDMA 3MUY1 3RWHB 3FB8B 2OPCA 4NN5C 4ATWA 5A6IA 4MA8H 3RE0A 3NIGF 3CPUA 4JFDD 3FUIA 2VRAA 1YCSA 5ENWB 2XOTA 3F5WA 1AHWA 1OKEA 1ZRUA 1OOAA 5LBSL 5KS9A 2DJUA 4G9FE 4LU5L 3P2DA 1SOKA 2V37A 2CK0H 3X12B 1NUNB 4LPWA 4LEXL 1DBAL 3CLEL 9PCYA 1JPGA 2F5AH 2OL3A 3UADA 3WXWL 1E67A 1AGEA 4AMXA 4WK0B 5F7NC 2B5IC 2I60L 4PI0A 3DX0A 4XPFL 5JOFB 1SVZA 3G6DL 4MS6A 5I1EH 4BZ2H 5D7LD 5FHBL 4OCNC 4DETA 3FHEA 1O7DE 1X5LA 3LTVA 5JYMA 2KLSA 4JL1A 3B1TA 1RMFH 1T1WA 5JW3L 4FQXA 3QDJD 3OL2A 3NCYS 5AKTA 3FU5A 3KGTA 2VO8A 3P3RA 3VTAA 3QNXA 3SQBB 5C86A 5KVFL 2IPUK 3ATFA 5GZNC 3D0VB 2FJFB 3AB0C 4XMUA 5IGXL 5JORB 4GW4A 1AD9B 2GK2A 4RRPM 2DWTA 2L7JA 5DDHB 5D1QE 4RRPG 1KC5H 2DAVA 3IXAB 4F8OA 3ARGD 3ULUH 4GSDH 5C0BB 2J21A 1QX1A 1F3JA 4JM2F 1T21A 4MD5A 4OV5A 4JK0D 5DQDH 3V95A 3HE7B 1QASA 5FYJD 1OD7A 5KSBF 1PNCA 3CZFB 2ZWZA 2R4RH 3PL6B 5KSAD 1FL6A 4AJ0A 1RK1A 4IBTA 3MC0A 1NCGA 5L0QB 3QA3B 3RDTB 2O5YH 1A7PH 2HVBA 5EO9B 4JFUA 3REVB 1MCCA 4IHBA 4KTGA 1OB1A 2YPLE 4LASL 2FO8A 2WQAA 4LESA 2A5UA 1B9ZA 4FFWD 1HSBB 1NCNA 3ARFB 3FFCE 5IT2L 1HJCA 1N3NA 1P0SE 3KJ4B 3PGFL 2ICES 1C12A 3ZKMC 2VDLL 2H9GB 4IKNA 3LZQA 3CSYB 3TA3B 2CGZA 3DIFA 4Y16B 4CU7A 1LO5A 5AVRB 4AM0B 1T5XB 3VFPB 2ZXWB 1DQML 3BIKA 1RSFA 1NMAH 3OAWA 1YEWA 4LHJB 1J5IA 1OARH 1X3DA 5E8OA 4GT0A 1U6AL 4NNYA 2R27A 5HHXL 1VRSA 4ERSH 4P23C 3F7KA 2WAHA 1BM7A 1AH1A 4OJFH 1MAMH 3R19A 4IOIA 2EKJA 3K0WA 4HPOH 5JR1H 3M1BB 3PREA 3UTSE 4B0MB 1E30A 3CFCL 2HX7A 1BYPA 2XHNA 3BAWA 4Q6IA 2WWNA 4ONGH 5GIRA 4W4NA 2ZX8A 4ZW7A 4F37F 5KJRH 4LSVH 5D7JC 2G60L 1Y6KR 4PJIF 4OCRL 5DMKA 5TE6H 1J9CT 1FZKB 5I19L 5AD0A 1WS7A 1X5IA 3ECUA 2CE6A 1D2OA 3L9YA 5LCVA 3T4YA 4ZMQA 3G5ZA 4K7FA 4NRYB 3TBTA 1CICA 3NP4A 2Y7NA 5F88B 2JK5A 4PJDF 3Q6GL 3BRFA 1CL7I 2EEBA 4H8HA 4R8WH 1P7QA 2RJMA 5AOJA 1MW2A 1IGMH 2EH8L 4A55A 5D6CB 4YZFE 4F24A 1F00I 4PS7A 2VOTA 3HC0A 2EIKB 4NPKA 5DSCB 4I77H 3C5XA 1CDHA 4XOBA 4HV8A 1HNGA 5C0RH 2PPFA 3X1EA 4N2FA 3QXDA 4K3JH 5IOPA 3TN0D 3HC2A 1QFWI 2VDRL 2CM5A 5GZOA 5CEZE 3KBEA 4HJ0C 4OM0H 2FWUA 4QHPA 3LIUA 4MHHG 1FH5H 4X4XB 5F6IC 3SPGA 1OD9A 3CFMA 4HX1A 4PJ5D 4JG5A 1MNUL 1R47A 3TEZA 4NQEE 1JPFA 2HT3C 2FWOA 3P9WB 1LDPL 3R18A 1XAKA 4XX1E 3RL1B 5C1MB 3GB7A 2WQ8A 4Z7OE 1DSYA 1WD9A 3JV6B 1CLZL 3GT6A 3MV7D 4PMFA 1IC5L 1R5IB 4ABWA 7FABH 2JQAA 3D85D 2B08A 5F7UA 4ZNEA 4Z95L 3I3EA 4F57H 2AQRA 3GSUA 3WLBB 3VQLA 4AWJC 2QADD 2VDLH 1JK9A 2F15A 1JZHA 1MRFL 4JZOB 4W6XB 4U1MB 1FL5A 1TKWB 3O3DB 4LSSL 1XCQB 3V9EA 4IIQA 3ILQC 5FYJU 3VXNA 3T1WA 4LSPL 4JFDB 3L3OB 3MV7B 1KBGL 1BEXA 3VA6A 3WKNA 3ZIMA 3QEQB 2CXGA 2G5BB 4TN9A 2PR4L 3MRQB 4ABVA 3CC5A 4HQQH 5F7HA 4HFUH 1HOCA 4N2AA 1WVZA 2W9EL 4AYEC 2F53E 3LEXA 3BSZA 4X9HA 2CR6A 2QEJA 4Z7UF 3KWVA 3VXSE 1KCRH 4XMZA 3QEGH 5K9KB 2EEAA 4OH2A 1INEH 3RYMA 2Z1KA 3IBEA 4JDVA 5EC1A 3RNQA 2YFNA 3L3GB 3EJPA 1G7PB 2Z93B 1ZTXH 2ENQA 2YA2A 4WFEE 4P4KA 2FYYB 3W9DA 2J8UE 3S8FB 4ODTL 2K8QA 2VABB 4P49A 1T04B 2UWEE 2FECI 3OF6D 5BMFL 3J27A 4JFFE 1DQLL 5TE6L 4OCMC 1RPUA 1QFWL 3CG8A 1XR8B 4BK5C 4PGDB 5GGTH 1K85A 4L3CB 5HHOD 5KW9L 1CUOA 1QFUL 3IS1X 5F7WC 4IQHA 5LXGH 2X2HA 5DD3L 1K72A 3DHUA 2YUWA 1SFHA 5LJYH 2B1OA 3H7BA 4RA3A 1FZMA 2GTWA 2YMXH 4N5EC 3U4KA 3APCA 4LVHB 1MPAH 1H8OA 1ACCA 2B2XH 5D1XA 1ZLWH 5C9KA 1JWUB 1KG0A 4JRXD 5CSGA 5BS0B 5FK9A 1A6VL 5C0CA 2ZJSL 1X7QA 5D70L 5C0RL 1U21A 4Y7OC 5EBLA 3X11B 1MCFA 1U8LB 5EC2B 1MRDL 3A5VA 3HS0C 3IDMA 3MUUA 2ZSVB 5JNYB 2DMCA 4YDVB 2C3XA 5K9OB 4P23D 5E7FA 5K39A 5CGMA 2H8PA 3HG1E 3L5WB 3UAJA 1GRWA 1XF4B 1N2RB 1IAIL 2AK4E 3FRPB 2WLYA 4HXBH 1OAXH 4QRSB 1BCIA 3CJJA 3P4LA 5HHME 4KK8C 1YN7A 2YPVH 2QR0B 3GJFK 1U8HB 1MCLA 4Z7VE 5LO7A 3APDA 2WO3B 1G7JA 3FU7A 3RTLA 2DI7A 2GAZB 3LPOA 4YEFA 4W4OC 1QHPA 1VFBA 3IFNH 1N10A 4LSUL 5K33A 3PWNB 5I74C 1FFNB 1ZOXA 3NIFE 3HA0A 2NY0B 3IPFA 3K2UL 3KXFA 4Z18A 3BQUA 5D1ZA 4OLZL 4PJXF 4YAQB 5KSBE 3OVUB 3EBGA 4JRYE 2W9EH 4HG4K 1UEMA 3S96A 3SBWC 3MN8A 5EEUA 1RY7B 4PIBA 2P42B 2XWBB 5FKAA 1W0VA 2X0WA 4MJJA 4M43L 1TMQA 3QRBA 3QZWG 4HS3A 3WJJA 4A2DA 3T0XA 2RIKA 1GJWA 4MD4A 2X4UA 3SE8L 3K0YA 4AEIH 1E9PA 3ARDB 4YSQA 1JN6B 2B59A 1TPXB 5E03A 3CVHA 4HGKC 4AQ1A 3S88L 3E38A 4DQOH 5KBPA 1UB6A 4F8NA 4U1IA 1EA9C 4P8QA 3U4BL 2F1AA 3C6SB 4ADIA 4HIJB 4OSUH 3KM2A 3VYOA 4D0BA 4HIPA 1WWWX 1ZGLB 1NDMB 3VMNA 1GZHA 2JELH 1NC4D 5E6RB 2D9CA 2GITB 1ID5I 2K8MA 2Q0ZX 3GNMH 2WVVA 4NQUA 2XKSA 3QUHA 5KAQF 2OA9A 4IS6B 4LGSB 4P2OA 3ZGIA 3CSPA 2XXMB 5IB3A 1BMWA 3JVGC 1MPAL 4LLVB 1IGCH 1F8TH 3F12B 4PJAF 2H1PH 4ZQTA 2ICEC 4M5SA 5IVXB 1WFTA 3WHXA 1R33A 2MNJB 4KZ0A 2YO3A 1WFOA 4AXWB 4XPGL 3BE1H 1DBBL 1BQLL 4F7CA 2LGNA 4X5PA 3T9WA 2HCZX 3WLWD 1DVUA 4E68A 1COBA 5CP3A 4YZFF 4CVXA 5CFAA 4B9YA 4LP5A 3RIAF 1P7QD 3EJRA 3A6OA 1M42A 3QDME 2J7LA 4UV4H 4U6XB 4QY8A 2E8ZA 5A43C 4PHXA 3CZGA 3C60D 3QDGD 2EE2A 4PJDE 2RAMA 3GK8H 1RIHL 4AZ8B 2ZCKL 3N50A 5I18L 4YIQB 3L1OL 4AKPA 2FTAA 4MAYA 5LQBL 5IB2A 4HOZA 1JYWA 4XX5A 2BNUB 3G5VA 3U25A 1NCWH 2H32B 3HUJA 4NQCA 1M6OA 2VITA 2WVTA 5C6WH 1AACA 1NBVL 4TSAL 4AV4A 3LRSA 4NRXA 1CC3A 1SEBB 3FCSB 3GRGA 1OO2A 4ONFH 4PWKA 1U42A 4XNUL 5HHQA 3PL6C 3BGFB 3SGEI 2YWYA 4Z8FH 5IB5B 3CAFA 3CPLA 3WMQA 4MA8L 1CFNB 5D4JA 3PWVB 4AQ8A 4GO9A 3K81A 2WBJC 3WFDH 2Z0UA 1KCLA 4JRFA 1S7WA 2XZCL 2A9BA 4H2AA 5JIPA 4WTWA 3FH7A 5K9JH 1U8QA 4JFXA 2JCCF 1LQSR 4V2CB 2A9AA 4TQHA 1GVIA 3KHQA 4LEXH 3BO8B 4XC1H 4Y5VA 3HPLB 5EOTB 3JXAA 2WQSA 3OPZH 1PF3A 1FPTH 1G9NC 4PJHB 4JQIL 4XP6H 4WI4A 4Z0BL 1X6LA 4X83A 4U1HB 2Y2TA 4E9TA 4XPFH 4L4TD 3GM8A 4XE5B 4UINH 2W07B 5DUPL 4GMTL 3RPBA 1KELL 4NI3A 4PP1D 1U8QB 3ARSA 4PLNC 1E4KC 3LKSA 5JHAA 5CEYB 3BVDB 3CMOL 1HH9B 2ED8A 3ISRA 1BZ7B 2E7BA 4AJVA 1RZIA 3KLDA 2BFGA 4IRJA 4NQVA 4U1GB 3QIBB 3KJ6L 1S8DA 5KVFH 4JRXB 2APVA 3ULUE 5IFHL 5JPNA 1BAGA 3DJZA 2OMBA 1ODUA 1A9BB 3B83A 4PB9H 2Y7QB 1BQLH 1BLNA 3RIKA 3SGJA 1SEBA 5SWSD 4U3XA 1NGZB 3WEAA 2VQUA 2P24B 4I2XB 2W38A 1KNOB 1MFNA 5I0XA 3NZ8A 5DHYA 2UZIH 3QIWB 1URIA 1O5PA 4JGUA 3PQYA 4KQ3L 5EZIL 4F8PA 2JE8A 4XRCA 3KDMA 2K0RA 2OYLA 5IB2B 3PXLA 4LF3A 1C9SA 3ZZLA 1GHFH 4D9QE 5EU6E 5CJ5A 2W59A 1MJUH 4QHMA 1S78D 2IQAB 4YHYB 4WHTA 4LEBA 5D7IB 4GRLC 2C9QA 3QJTB 2FT6A 1E42A 4JBSA 4RDBA 5AB2A 4U6YA 5B8CC 4NDMA 4MS8D 3D2UB 4IDJH 4JO3L 1XBDA 4J8QA 4JKWA 3U46A 2DZEA 2P8MA 5IVOA 2Z0BA 3RGVB 2XWXA 2CKBB 4M48H 3GTTA 5IIEB 3SDAB 3HNTH 1BZEA 1CLOH 4UT6H 4X5WB 5GS1C 1QZNA 3T6VA 4FQQB 4P23B 3GMMB 1KJMA 4HKZA 4Y1AA 4PJ8D 1M7IB 3RAJH 2UXVA 3ZGHA 2XZCH 4ALAC 5FLUA 2NUPA 1X5GA 4KVCH 2F8VA 2QSQA 3HB3B 3O8XA 4M7LH 5H37H 4X8XA 3GHEL 4FJ6A 5EN2A 4LSRH 1A6ZB 4HIJA 1R5WB 4EZKA 2LT9A 4JZJB 4R7NA 4NM4L 4JQIH 5DVOA 2GC7C 1S9KC 2F54A 2NX5B 4ZW8A 1NIDA 4X99B 3GBML 3QUYA 4FZEH 3CGTA 1F6AA 5I1CH 3VD9A 1PKQE 1TNNA 4J2QA 3PAZA 3B7SA 1IFHH 3OKLB 3QH3B 1MREL 3M17B 1WICA 4UANA 3BRDA 1W0VB 1KFAH 3QAZC 2V5RA 5B8CB 4X5XA 3Q6GH 2NYKA 2MHAB 2DD8L 4FQHA 1JHLL 1K2DB 4HKXA 2J2ZA 4GKSA 4GP8B 1MXGA 3V0GA 5FB8B 5DD0L 3KD4A 1YNLL 3FFDB 4DPCX 4PB9L 4OD2A 5CGYD 4M7JL 3UJIL 3DGDA 5C3TA 4JQXC 35C8L 3QWNA 2PW2A 4RGND 1JZ7A 1QWUA 3QW9A 1DN0B 3VDAA 2FX7H 3PWNA 2CDFA 2K7QA 3SD2A 3WI9A 4QUOA 3RZCA 3AB0B 1FH5L 2QBWA 2UZIL 4JFOA 3KYOB 1HXYA 4KQ3H 1OT1A 4I9WD 4M1DL 1I1AA 4Y4FA 4O2EB 1RUQH 4MX7A 5JHDE 4GRWF 4ORGB 1M1XA 5E1QA 3VXMA 1THAA 3DBXA 1KIUA 3QAZB 4XGZB 4HD5A 1RUAH 2OXGA 4QRSA 3BUPA 1F2QA 4U3CA 2O5XL 4YSPA 1ML0A 4J3UA 2WNXA 2XPYA 1OEZW 5SWZD 3SQOH 2AEIT 2WXQA 3A0OA 5A2FA 1OE1A 3SE3C 2B5IB 4FZ8H 1J8HA 5JOPE 3PHOB 3NIFF 3M07A 1LEGA 3IFOA 2DQFB 3FPYA 4CU6A 2COQA 4E41E 1TT6A 3QUXD 3QS3A 1JZFA 3DK0A 3BLKA 4X80L 5ALBH 5EUKA 5L2KA 4UM9A 4P46B 2EIEA 4R6UA 2BVPB 1JZ2A 2EYRB 4CVUA 5LN4A 2JB6B 2LVCA 4WW2C 3ZE1F 1JJUA 1EX0A 1N0LA 3DGGA 4QOKA 3B56A 3T8XB 1TETL 1DFXA 4JEGB 1IGYB 2NY3B 1FZMB 2GTWB 3WTUA 3QWOA 1CGWA 1GKEA 4HEMA 3TZVD 1WAAF 1H3PL 1TJIH 5GS1B 3MRKB 4OLWH 4NWTH 5BXFA 5LKNA 1BFVH 3ZO9A 1CTNA 4ZTOL 2DMBA 1T1ZA 2C7UB 3WJMA 2O6PA 5GSRA 2WJ5A 3L2MA 1EJ8A 1MCEA 2K3HA 1WWCA 2MFNA 3WFBH 5BMFH 4HPYL 2AS5M 4OZIA 2Y0SA 1T04A 4GQ9H 2O6FA 5E5LA 4PREA 2OM5A 5DYFA 2X4RB 3BP6A 4X4MA 3W9DB 4Y5YC 5IK3B 4Y2OB 2KYIA 1G7PA 3NCXA 5DF0A 3K1KC 3W56A 4DVBB 2WCPA 2CLZA 1EEUA 1IUZA 1MCPL 1VFMA 3LRKA 4KTEL 5FF6B 3EAKA 1FYHB 5FR3A 2BHYA 5HDOA 4F8LA 5HJBA 1KLFB 2Y1VA 3FT4B 1NGXB 3FQ2A 1HSAB 2E9WA 4AL8L 5HHMB 2LTQC 4Z7WF 2X1XR 2OJ1A 4LT7A 2ZX6A 2AMGA 2DY2A 2H41A 1A7QL 2X5PA 4YWGL 4DVBA 2JWYA 3V0VA 7CGTA 2V7NB 3BKCL 4Z7VF 5KBMA 5DWPA 3E6FB 1X4XA 2XLLA 4Y2OA 4I89A 3FQNB 1I1YA 2ADJA 2J25A 2I9LA 5H37A 1F6FB 3U1SL 4C8XA 3E9UA 1FVCA 3NRPA 1DJYA 3IKCA 4WF7A 4K94L 2L7QA 3ZW3A 1OAYH 1IAIH 2ZOWA 2C3VB 3SY6A 4B9FA 4BZ1A 4EJ1C 4AH2B 5DO2C 1V8HA 4LCWD 4Z76B 3ARBD 1G0YR 3HHSA 4Z5RA 4QNPF 3GXNA 5DFVD 3LV3A 1K3IA 2J4WH 2EYSA 25C8L 1MRCL 4G7RB 15C8H 3ZRSA 4FZ8L 2O72A 1NDGA 5EZJA 1YECH 4C47A 2X1PA 4GRWE 4MJIB 4N3UA 2GC4C 2XXGA 2GSIB 4DK6A 3KPTA 5EUKB 5F71A 4DAGL 2VERA 2Q7NA 4TMPA 4XXDA 4HALA 1TZIA 5J13B 5FUCC 2Z7WA 1F4XH 1NKRA 5I6LA 2OMYB 4WHYG 3I50L 2E86A 5DXWA 2JJSC 2IQ9L 5TPWH 4AW4A 4EN2A 1BVNP 3L16A 5CGYC 4LQFH 5AW1B 2NT1A 2JK5B 3FO1A 1A8ZA 4OLWL 4MA7H 1Y6MR 2DIAA 4YXKH 4F15B 3OD3A 5J6GB 1RURL 2A6IB 1NSNL 4NAMA 1P5UA 4QHLB 4LCYB 2XN2A 3NIDB 3T0EE 3TL5A 3PWPA 2CM6A 5D7JD 1FZKA 3ZTNL 3V4VL 1HXYB 2DBLL 4DP4X 1FO0B 2W81C 1KTKE 4ZFZB 3SE9H 1CURA 4LP8A 1ZTMA 4RWYL 4FTVE 2GIYA 1EEZA 1P53A 4MMXB 3KPLB 3O45B 1G7LA 1OGTB 4UTCA 5D7IE 1X5YA 1I3GL 5FM4A 2FHBA 1U3YA 1ZEAH 1R3LB 2VDOH 4OCSL 3FCTB 1MQKL 3R0MA 4UIMB 3P4MA 1JZEA 5SV4A 3W82A 4OR1A 2JKLA 2J2ZB 2H1XA 4I7ZC 4PSRA 1UUSA 3ZDXB 5FAAA 4JO1H 4V1DE 1F1GA 2WIMA 3QUXC 4MWFB 2VLJE 5E6ID 5DRNB 1KDJA 1T4KB 1JZ4A 3MXVH 4H8WC 5TE7L 1G4MA 4JDTL 4JN1H 4MB5A 2ZNWA 3S5LA 3TCXA 5C0JA 1T5XA 3OHXA 3V6ZB 2CCLA 5EBMA 1NL0H 4LNVA 1Z1WA 2CJUH 2MKWA 1SQ2N 3CXHJ 3EF4A 4OCLC 4YJZL 3GIZH 1TLMA 3WUWG 1YMME 4L05A 4DP9X 2FK9A 3PFQA 1E50A 3NFSL 4FOMA 3U6RB 3NIGE 4BFJA 2Q9OA 3QEHA 4R7NB 4Y19A 3NK3A 3HS0B 4TNVF 3MLZH 1J9QA 4ZUWA 4OFYA 3PF2A 1AQHA 5DT1H 3MOAH 3WHE1 2OSYA 3LKRB 4AL8C 4BA0A 3IJ9A 3GSNA 1OWRM 4X6CA 1R0AL 1A1MB 2GYSA 2NSMA 3BH8A 3QUXB 4Y5XB 1EVTC 5ICUA 3E8UL 1SXAA 2CBMA 3L6FA 3GSOB 4RISL 3FUHA 4PJ5E 2ZICA 1B88A 3AITA 5I8KH 4G43B 4NENA 1TQTA 1Z9NA 1D7CA 4PBWD 1AGBB 5KSVA 5E2UH 4RMVA 2P80D 3P54A 3D4ZA 1AP2A 2DBJA 1JDCA 1N64H 2WKOA 2X1QA 4GW4B 2YGQA 5J1SC 4R3SB 4NKMB 1BIHA 2WLKA 3QNYA 5F9OH 1OP3K 1MJ8H 1ZSHA 2OL3H 1J5DA 1EERB 1PLBA 3FTXA 3QNXB 4O58L 4AGLA 2PP9A 3RB5A 1HIML 3CZEA 2AQSA 2R2BA 1YEFL 4FQXB 1OTSC 3TBYB 1JK8B 3C09C 3KAAA 4UT6A 5LB1A 4HEPG 1MW0A 3NA4A 4HF5L 4Q14A 5KZCD 2GIXA 3JWOH 1UWXK 5BUAA 1T20A 1ADQL 1X5AA 5B38A 1F42A 4NO0B 1FZOA 4LBAA 2O93L 4L3FA 3P11H 1H19A 4M6NH 4J4PC 5GGSY 3PS6A 3P9LB 1M05B 1SUJA 3Q48A 4G72B 5FM8A 5KJ7E 3MOBL 1Y1UA 4Z7QB 1EEYB 2VC2B 1JF1B 4UINL 3V52H 3KLSA 4GMTH 1I3GH 4M1GL 2AJSH 3H42L 3RPIA 3UZQB 3EGXB 4N28A 1FBIH 3RUGF 1ZLDA 4RFNC 4LL1A 5BO0D 2VLJB 3NG5A 1LEKA 5CP7A 1TCMA 1JGUL 3QIBA 4OFIA 4B9IA 5IBTL 5KYYA 1RUML 1XCWA 3VWJD 3OJ2C 3UAEA 2HG5B 4HWNA 1XD0A 2QV4A 5KUKA 3QIUB 1A1NA 4X0KA 2AHIA 4MMZB 5A16B 1ASPA 3C2AH 4PP2B 3TWCL 2ZT9C 4K2UH 2PCFB 4WUUB 4QXWA 3VGBA 1S5IL 5DGQA 5IUCA 2DLTA 4R90H 5BQ7B 3RWJB 3NJHA 3BO8A 5A7BA 3QQ4B 1XGPA 2CLVA 4J6RL 4K3HA 4NQSA 4PY7B 3UIZA 3FFCA 3VFRB 3Q8AA 3RJDA 2AQPA 5ICZB 3G6JE 3OB0K 4P2QA 5ELIA 1BP3B 2AANA 2J88L 4X6CF 3UZEC 3VGEA 4QRBA 3F7YB 3M7FB 3PJNA 3D6GA 4PRDB 3RGBA 4ZZFA 4H40A 2J5LC 4LK4A 1DBJL 2HJLB 3B6SB 3MV9E 1A9EA 1U8MB 4JHWL 1NGWB 3C6LC 1E3FA 3EYVB 4NLHA 3KDPB 5E1IA 4CMMB 4YXHH 1L9NA 2VISB 2W9LA 3FZUD 1JF6A 5J3HC 2VLKA 5F7AA 2IANA 2ESVE 2EVIA 2PWFA 2Q3AA 1KGJA 1MHHB 1UWGL 2Z91B 4FABL 3MRJA 2DYRB 4OIAA 2RACA 1R46A 4K7PH 1KOAA 1KULA 4FFYA 4K71C 3W5MA 2R29H 3DMMD 4UM9D 1WZ1H 3G5YB 4MSWB 1S7SB 1UVQA 1OGAB 1RVFH 4P59H 2MIZA 2AJXL 1WEJH 1JPTL 1SHSA 1IGJA 1WS8A 3QFJB 4M1CC 3S2CA 4C56A 2DM4A 4G6FD 3MLSH 3RFZC 2OS7A 3E6HB 4HJSA 3PNRB 3QISA 3ZDZF 2PWDA 5HHVH 3U36B 4NGHH 2NY1C 4WW2B 4LCIL 4NBXB 3IGAB 4NI6A 4U1NB 3Q5OA 4DESA 3GBMH 4FZEL 4CVXB 4W81A 1I8IA 1T66D 2X4OB 4E0RB 2R0KH 3ASOB 3VD5A 2R4SL 1UC6A 1A4BA 4XMKH 5HYSB 3NOIA 1IMHC 1U93B 4JM2C 3U4AA 1MJ7L 2BSSB 2GJ6A 4PI2A 4EUPH 4MXVF 5DJXB 2PO6A 3F12A 3RGHA 2EVJA 2DLFH 2QTVA 5SWSB 4K4KA 2YLHA 1Q1JH 3FOLB 4P2OB 4E9WA 3X1FA 4TVPE 3RWGB 1IL1A 3THMH 4OTXH 1A14H 1KGCE 3OC5A 4NJAL 4ELDA 4F1SA 2W88A 4XX1G 3BP7B 4FDWA 4XT1C 2XN9E 2EDTA 3U7WL 2ZCHL 1HNYA 2NQ3A 4Z7OF 2XQBH 3X3GL 4ZX3A 1KCSH 1PAZA 3OKMA 4YXLH 1E8YA 2E9GA 4JFFD 4KQ0A 4CJ0A 2ENYA 4M5ZL 1QBLH 3WY4A 3CSTA 1Q72H 1O6VA 2CO3A 2J6EL 2FLMA 4PJGB 4J6RH 3VFVA 4BXSV 4XI5D 4L9DA 2ZX9A 4FNTA 1IEAB 4P06A 2K78A 1XGUA 3EOAA 1PEWA 4WW2F 4NM8H 1RLWA 4WJ5B 1QHQA 2VXQH 3GLDA 2P3YA 3FTVA 2OX5B 2F53D 1BWMA 3O9WC 2IFFL 2ARJA 4G8EB 3WELA 2J8UF 3OM3B 1UH3A 2MQCA 1IKNA 3HC3L 2MQ0A 3DYMA 3ZXAC 1W0YT 2V9UA 2OSWA 4P2RD 2WD0A 1J1PH 2BP0B 5IJCC 5DI8B 3P0VH 5E6IB 2HZHA 4WU7B 4FLSA 2Y9RT 5ALBL 2F53A 3A3YB 4IOFD 4TVUA 3NJIA 2B1HH 4HZAA 2QDWA 5DLML 1VFBB 1KT2B 3EJZC 1UD3A 1FN4B 4FNLL 1RHHB 2G75A 1TVBB 3LS5L 3SCMD 2HT4C 4TULH 3TBVA 4PS4H 4O2CB 4UNIA 1F4WL 4PWGA 4E9SA 4QGTA 4YDKH 1M7XA 2R29L 2DQGL 2NR6A 2XV0A 3A6CL 4KK6C 3SY0A 3MJ7B 1MWAL 1JPTH 2WTPA 4PM1A 3N06B 3AU0A 4MAUH 3D69A 3NACL 4GAYA 4NP4H 2DKMA 3PDOB 4LCUB 4Q0XL 1CF1A 2NZIA 3L5WA 1CDCA 1YRKA 3VFGL 2WUCH 2NSXA 3UX9B 4FQIH 3T4AA 4MCZB 3D3VA 5DJCB 3TIEA 1YZZA 3K8MA 1KXVC 1Y1DA 4XNMB 2C4FU 4P4RB 3K4AA 5EC2A 3TIDA 1P84J 2JFCA 4XOEA 1JTOA 1CVSC 5I76A 5C0CB 1IAOB 2KBGA 4FEIA 1ZLVH 1RLBA 3D48R 5D1XE 5C09D 1I9RL 1OVZA 5ANME 2A6DA 2P8LA 2YGNA 4PRPB 4RQQB 2AJ3B 1ZT1A 2WXKA 3ARPA 4N0FA 4WCYH 2AJYL 1VZHA 2ARWA 1F56A 4FI8A 4KTYA 3FT3B 1X5MA 3WSQH 2CDEA 1GS7A 4YHMH 4Y4HA 4JFZH 3QG6B 4P5TA 5CIPB 2Q6WA 4FQJL 4QNPE 4Y4KA 2VDNH 1OE3A 4PLKC 3TN0B 4GT7A 1QWNA 3FU3A 4KJQD 3T6ZA 1GOHA 1MCOH 4MKTA 5IR1A 2F18A 5I75C 5IMLB 1BFOA 3VFOA 2VIRB 2PWEA 3MLPA 1CDIA 3MR9B 4PGEB 4XVUD 4WGVB 4ODWB 1O0VA 1YEDB 2X4TA 2ZAIA 1F45A 5IJVA 1GGIH 3BWAB 3C9NA 2AGJH 4IBUA 1XIWC 2BNQB 5E23A 1YMMD 4A37A 1T3FA 2DQEH 2H0EA 3OXSB 1ZA3B 4GW5B 4K7PY 4QXUH 4B96A 1ORSA 4AUJA 2NTFB 5DQJB 1W16A 4ISVA 1U58B 1T22B 3FL7A 4OF7A 4Z7WE 4BSWB 4DGVH 3VXTB 2BNRD 5CEXA 1WV7T 2N59A 4FKKA 4DK5A 3MNZB 1LO3L 5KSBA 3MO1B 1ZANL 2CJTA 5EB9A 1RULL 5SX4I 2IDTA 3KH3A 4ODBD 3WJLA 1ED3B 2CUIA 4R97B 1IJNA 3POCA 2W9DL 4ALAL 4UQAA 4DSYA 2QV2A 5TPWL 4XVSL 4P5TD 1P4LA 2EO9A 4WTQA 2NY4B 4FTVD 4F58H 5GJSH 2W80C 4V33A 3G6JF 1D5XA 2YOAA 5DVKA 4F7MA 4XMPH 2WWOA 3V7AE 1XCTB 1CFMA 4R4NC 4CC1A 4M5TA 4JZNA 1B6UA 4EXPX 1LYQA 2EIBA 3O3EA 1XFPA 1HYSC 3ZE0E 2C26A 2YAEA 3MLUH 2COVD 5C0FB 2WUCL 1FG2B 3IU3A 4A7GF 3T0EC 1QFOA 4HX1B 2NY7L 3QSKB 4Y1AD 3C5ZA 1HEZA 3DMMB 5I16B 2WQRA 3OZ9L 4W9JC 1FNGB 5IHUL 4KRPD 1Q94B 3NDZE 4ZUTA 1JHKL 2DOCA 3HZMA 4GYBA 4WDIB 4D0CA 1UB5A 1VGKA 2EADA 3HC0B 1CTMA 1T1YB 4KJWD 4UQ3A 1KV7A 4QI3A 4P04A 1CLYL 2BW5A 4D8PB 5AAWA 4PJCB 1WAPA 1NFIB 4JO1L 1JTTA 4YHML 4YK4B 3MV8D 4ATTA 3QYCA 4QTIH 5BS0D 5IW6A 3BP4A 5HJDA 2NNFA 4XN8A 2BSTA 2XN9B 1PW3A 2QVKA 4U6HB 4YSAA 1SMDA 1F02I 3VGAC 4DZ8B 4LCWE 3WIHH 5HHNB 5C07E 1QMUA 3S3CB 3LIZL 5B3SB 5B7FA 2VXVH 1KGXA 1GL4B 1TVHA 2VDPB 2IAMD 4ZNCD 5EV7A 5FCUL 4ZQKB 2WM0A 3GFUA 1HHGB 2JIXD 2J20A 1LILA 1NINA 3H3PH 4LOEA 5HI4C 1SOXA 2BWDA 2NNCA 3KL3A 3DLQR 3N41B 1S3KL 2VDNB 5CJOL 4H13C 1IBZA 5FO9B 2XJLA 2CMRL 2I25N 4HWBH 5ETUA 1QBBA 5EU3B 1MHPL 4EI5A 5E08H 3S97C 1OGSA 1OSEA 1IQWL 2V5TA 5E2UL 4WRLA 3QI9B 3AUVA 3B3BA 3APFA 3EJCA 2V7HB 4QLRA 5AVTB 3UG3A 2ZZUT 4GKOA 2LLGA 4QKXB 3BX7C 4NEHB 5IP4A 3C6LB 4P2RA 4J5VA 3IDGB 1AD0A 1JCVA 3G9VA 1BLIA 2RA1A 3OMAB 1QUNA 2DRUA 2MQGA 5EU5B 4YPGA 1FNSL 4PJCA 1WGOA 4D8PA 3OJDB 3C5JB 2W0FA 5BRZD 8CGTA 2G3ZA 1SXBA 2XC8A 4M62H 4MXWL 2VLKD 4UM8B 5IW3A 1NBQA 1SHXA 5C0NC 1PLCA 2VUYA 3TVMD 4X5QA 1OANA 4KDTC 2WN3A 1RERA 3IDNB 1DP0A 3MGOA 4FNUA 1RK1B 4NLAA 4W9HC 3BMWA 1E90A 2ICWI 4PJDB 4PRHD 3UJTH 5DJZA 3GMRA 5C0EB 4N8UA 1DTUA 4X9GA 4HUWA 5CMAB 1T21B 3APNA 4MD5B 4OV5B 5JW4R 5EU7E 2CHWA 3HC4L 1A6UL 3EGSA 4X98A 5ISZB 1HAUA 3QIUC 1IRAY 4BCXA 4LAJH 4N90E 2IXQA 4WV1A 1TDQA 1BBDL 4S1SH 4LEOA 1PSKL 4UWQB 4FMKA 4MXVE 1UM6H 4GXVH 4WWKB 2HFGL 2FX9L 3CHRA 5CHNB 3MMEB 1RZJC 4I88A 3ZKQD 4GUPB 4XCCL 3VXRD 4JFWA 1PFOA 3KNBA 5G4OA 3PJLA 5FYKH 4I3RH 1MH5B 4B97A 1CO1A 1SHMA 4GG8B 1A6PA 3DX7A 4MZ2A 4KZDL 3S37X 3BUQA 3GC3A 5D7SL 5JOFA 1UJ3C 5LNDA 3EFDH 3QDGA 5E2VL 1XH1A 2H5UA 1CBJA 3E0GA 4DOHE 3EHBD 3LIZH 2DWEB 5FKPA 3PGCB 5GZND 3PPSA 4O02A 1DEEA 4DW2H 4NO2B 2YZ8A 4M61B 2K70A 1YEGH 1BZDA 1FNEA 5JXEA 4OFVA 3RTQD 1AQ8A 1YQVL 4G6AC 2AMUA 4LVHC 3PWLB 3TYGL 1SJXA 2SEBA 4MBOA 4U1KB 4U4BA 1OT2A 4P99A 1CD0A 3UDWC 1EJFA 4FXLA 5TDPB 4A2GA 1PNDA 1I8LA 3OXRA 2DDQH 3F05A 2ATKA 5CUSH 5K1VA 1VPOL 2EC8A 3B8YA 5IR1B 1XSOA 2J55A 3IMWA 3VI4E 3VD0A 1A4KA 3WE6A 5KSUA 4EUPB 4CSSA 3UJJL 3UP1A 5EU7C 1FF5A 3N44B 3US9A 1KIRA 1SZNA 4RSVA 5CIPA 2PW1B 4NOBA 4MNGE 4QF1B 5CN1A 3G9AB 4QRPB 3DOSA 2GI0A 1A4JB 4HWEL 5I2IA 1ZT1B 1O6SB 2F74A 1ZIBA 3AY2A 4AGNA 3ZQXA 5AEAA 4ANXA 1R5VB 2E7DA 1E27A 4I85A 2UXGA 3QUMH 2JI1A 4HZLB 4UUJB 2D4FA 1PJWA 1O9VA 4P4RA 3HS8A 4G1MA 4IRSA 2EDDA 1U3NA 4OQ1A 3FQWB 4JY5L 5FW6A 2Z8VC 4KXAA 4ZS6D 3QFJD 1OP5H 1IGIH 4N2BA 2AABH 3LNDA 3D85A 5C8JB 2WPGA 1C5DA 3L3OC 3ROLA 1C5BH 1E6OL 3ALWA 3SGKA 2V9RA 4FNQA 1WHOA 2AXGB 2OMZB 1ND0B 4WFFE 4S1SL 4O2FA 3Q13A 2PWGA 5DUML 2C9SA 1A7BA 4KAQL 1PZBA 4OCXH 3FFOA 6FABH 5I1IH 1OLZA 5D93C 3ZKND 4EQ2A 3DDGA 1FVDB 3TT1L 1HINL 1JNNL 1JF5A 1R1CA 4MAZA 3D34A 4I3RL 3VFSA 5IREA 2VZ3A 2GSGA 1KLUB 1SJHA 3W3BA 4R26H 3ZE2F 1CB4A 1KBKA 5JXED 1Q9KA 2XIIA 3JUYA 4MMXC 1VADA 2HLFD 4TUKL 3MA9L 1K4DA 5E6IA 3K8LA 1YNKL 5AYQA 5LGHH 4PCYA 4UOZA 1KCSL 3ELQA 3WUWA 4YXLL 1BFTA 2C9PA 4BRVA 2HT4D 3LH8A 1NGQH 2ARJB 5E7BA 4PGCA 4R96B 3VRIB 2D2OA 2AXFA 5EMYA 1JZ3A 5DD5L 2WVUA 3L3KB 3S9DB 1R34A 2NX5D 2OXHB 3QI9D 3DDFA 3IDJA 1XCXA 4EN3D 1S9WB 3KCPB 2E4FA 2O6DA 4NUJB 1NCJA 4E9QA 2X10A 3ISWA 5I8EB 4JRWA 2HFEA 4GJTB 1DL7H 4N87A 3V0FA 4MDJB 2P8PA 4D3CL 5K69A 5MEQB 1GCYA 2YWZA 3CN3A 3O2DA 3AMLA 4TYUA 3ULUD 5I6XB 4F20A 2O4EA 3WNPA 3QO0A 4PAZA 3BEWB 4BE5A 4XCEA 4WNQB 3VRJA 4HETA 1QSFA 3GINA 4L8CA 4IJ3C 4UT7L 4Z77B 1IC0A 3R4DA 3WN6A 1IL1B 4GI8A 1IM9A 2VC2H 3LS5H 4M3JA 4R7XA 5BZXA 4LGRB 3L4WA 4M9PA 4TULL 3FOLA 4PS4L 3GUFA 4WW1B 3UYRL 5L8KB 4LCCC 3RHWK 4KNUA 1DO5A 3T2QA 1SY6A 3BD4A 1YDPB 3E9TA 3ABLB 5FX3A 2CBOA 1ET8A 2NUTA 3MRMB 4BRJA 1LK3H 3P69A 3EYOB 5DZVA 1P4UA 3DROB 3UP6A 5D7IF 5DURB 4XNDA 1G9NH 4ZD3H 3N42B 3Q1SL 3SYOA 3T08A 1C5BL 1E6OH 5TF0A 3T0VA 2YRZA 2VH5H 4X4KA 1ORQA 2NZ1A 4ZUUB 3QFJA 4AM0Q 2AZUA 4N2GA 2P52A 3CBRA 2AV1B 1QVOB 3OQ3B 5DJYA 1BXAA 1QI5A 4I3SH 2C9RA 5J06A 5ESVA 3L95B 3NCBB 4N86A 4IRZL 1S7TB 2V5SA 3NABL 3TT1H 1LK2B 3FCGA 2D31A 1WISA 3ARGA 4HPHA 2A9NH 3UTSA 4BFEA 1F0LA 3UG5A 1IBDA 1MHHA 4WW1A 3FU0A 3SOBH 3UO8B 2O5NA 1RZFL 4OZFG 5HGDB 4ENED 2VISA 5FYLL 3GJFH 1FYTA 3T77A 2J1XA 5TFSL 2G0LA 1U8MA 1QSFB 3EYUH 3OV6A 5AWNL 4YEEA 1SYSA 1L9RA 2XJKA 3O9WD 1ZS8A 3QO0B 5MP6L 1VCAA 4KKRA 4N8CL 2FBJL 4P9HH 5KVDL 2OBGA 3F00A 2VN7A 2SODB 1DVFA 2IDSA 3P9MA 1TEFA 1C5CL 3BWSA 2G3NA 3FRUA 5GSVB 5D7EA 2IBBA 3KCPA 4KUCD 1NCTA 4ODXB 1CI5A 1H15B 1IQDB 2LLNA 4QD2E 1EXGA 4YFEA 5FOBB 3DJTA 1N0XL 3OLIA 5LWYH 2OXHA 3OWRA 3D39E 4J6IA 5E2JA 1ZIAA 4AYDC 3RVUC 4GUOA 2JSFA 1QRND 3FPXA 5D55A 4JY4A 5A16A 2A74C 3MX0A 4F9PC 5LNGA 3BHBB 5I15L 1E4WL 2VCOA 2JKTM 2XX1A 4NRZB 2RMNA 1PQZB 3TZVA 2ZUQB 3MCYA 4UIKL 3L2NA 4WSGA 5CWSA 3VW3L 3PWUB 4WGKA 2R2HA 4L8SA 2G9KA 5E56A 6CGTA 4RZCA 3PNWB 1OHZA 2AVGA 1RMFL 2HVJB 3O6ML 5JW3H 3GS4A 5GGQL 2BSRB 1RQ5A 2Z92A 3ASNB 4YDZA 4ZPTA 2RD0A 4MQTB 2ADGB 1QLEL 2XIDA 1FZJA 2GTZB 2P5ED 3VM7A 5CWSB 5FHAH 3RI5K 4L1BA 2C4FT 3C60C 1A3QA 3LAFA 3QCUH 4TVSa 3ZDXE 4GSDL 3D85B 5A6MA 5C8JA 5IJDC 4WO4D 5C0AA 1VB9A 1MIEH 4L4JA 1FAKT 1QLRA 3MNWB 1XF5B 5FOBA 4V1DA 5EUOB 1XD1A 3CZNA 4G1MB 4WHYH 1KWGA 1BEYH 2ORBL 3MZGB 1R5VA 3VH8B 1O6SA 4LIQL 2FCBA 2HFFB 3SOBL 3V5KA 3DOSB 1JMXA 1I7RA 2J72A 3F2LA 1YMMA 1JFQL 3QO1A 1NIEA 1GC1C 1G7QA 1RZKH 3L7FA 4PLOB 4NKIL 2WUBL 1CGSH 3WNMA 2MPVA 3GZKA 2KDYA 5HHMD 1MVUA 2JV6A 3W0WB 4NENB 5KSUB 1AR2A 5CKAA 4LLYA 3NEXA 4U1JA 4YMPA 1OW0A 1TJHL 2H3NB 3MJWA 5LXVA 3K6IA 4N85A 5CSZB 1WAEA 1B2YA 1H3GA 3PFUA 1UWFA 5HHXH 3GXPA 1VZGA 4OM1L 3U2JA 4Y4KD 3RGVD 2HTKC 3EBAA 3AWEA 1F97A 4FQ1L 4WFHE 1FQ9C 3D08A 2OMWA 4XP5H 2N7AA 2W94A 3EJTA 1J0JA 4JPSA 4UBDD 3K72A 3TPUA 4HGMA 4QRRA 1P69B 5FGBA 1ZLUK 5E9DE 5FIEA 2ICEA 5BVJA 1G6RA 5E1AA 1B2WL 3IE4A 3JWDL 5C09A 4IHOA 3TESA 3VXRA 1ZY9A 2ZOLB 2XN1A 3O8XD 3ARFC 5HDQL 5I15H 3DRQA 4OZHA 3UTZB 2Q8AL 5C0JB 1VGEH 2IH1B 2K4WA 3ARWA 4ANWA 4GAJL 3QORA 3Q7JA 2R23B 3RDTC 3V0WH 4XAWL 3FONB 3GEWB 3L54A 1J0KA 3ARUA 5IB1A 2LU3A 1TMCB 1UXWB 4JDEA 5DZOA 3HE7C 3P4MB 4MXWH 4BIKA 2FL5A 4G5AA 1OCWL 4DN4H 3FQXB 1OF0A 3SKOA 4ZMPA 3X1GA 1IM9B 1IBFA 4IKLA 3WCYA 1M7DB 4Y4FD 1NCCH 1WO2A 3SJVA 2DLEA 1KCWA 3PAVA 2ZKHL 4ZDHB 2VM4A 4MTMA 4WNQA 4XCEB 5HYJD 4XNBA 4K3JL 3BEWA 3KPSB 2YUXA 3ATDA 3AQDA 4M9OA 1MHCB 2VDRH 1RK0B 3KG5A 4L18A 3L3DB 1AZZC 5CMAA 2P8PB 2O26U 1JHTB 1YYCA 1MY7A 4JANA 4LOFA 4KX9A 3IDNA 2Q7AA 4PGJA 1GOGA 1LDPH 4JRLA 2XYCA 4CNIB 5E8NA 2GQHA 1TFPA 1CLZH 5TK2A 1C8QA 4UM8A 4MNHA 1IAKA 3RKPA 5SV3A 1CGUA 3U9WA 4JM2B 1NBCA 3GIVA 1D5BA 1Z0NA 3KPQA 4LDEB 4LVOC 4S1DD 3N40P 4IDLA 2PYEE 4F57L 5ITBL 4JJOA 3FUJA 4JZJC 5IV2B 1LO4L 1TZIB 3MRDB 1UM5L 5CLZA 4NKIH 4L8BB 3GSXA 3O6LL 5I1HH 3CHOA 4BCZA 4MJ6B 1T1XA 1XIWB 2NY1B 4KTDH 4MMYA 1ADQA 2YIHA 4OI7A 4BCYA 1Q9WA 5AVZB 4L1SA 2LAAA 4HQQL 3MVSA 1ZV9A 3B34A 4G8FB 3T3MB 3BKJH 1DDHA 4OM1H 3QZBA 5HI5C 4FXGC 3U0WH 1XGYL 5IW1B 4RFOH 3WS6A 2ITEA 2NYZA 4A39A 3MV9A 2WINB 2EXSA 1S7XB 3KLHD 2G0KA 5CD3A 1NPNA 2KS0A 2P5WA 3AQXA 3AREC 4RGNB 2OTPA 3LNIA 4RGOL 5BOPA 4HZ1A 5IZ7A 5BO1H 2GK0B 4EZLA 4TLTA 5DO8A 3RB7A 2JI3A 1TVHB 1PLGL 3FQNA 4JG9A 5F8RC 5CZVL 2H2SC 1C5DB 3UPAA 4P3DB 5JYLA 5DUBB 1QFWH 4PTTB 1GGBH 5CINL 5IHBA 1VACB 3QDMA 1HH6B 3NBNA 2VXSH 1KN4L 3JTSB 1YJDC 3V0WL 4PFEA 1TYRA 4B9ZA 5EORL 4HZLA 4YBQD 3TH4T 2P45B 4MJHA 5D1QC 3DVGA 4N9GB 1OAKH 2OW6A 5BZDB 5A2CA 2JJTC 4OCWL 3W37A 3BPOB 3RRQA 3HAEG 2QDVA 1OCWH 3WKYA 2NQDA 2YMXL 1ICTA 5EBWB 1VACA 3QDMB 4CC0A 1VJSA 4QRPA 2AJZA 3NEEA 3ET9F 3LDBB 3HUJE 1AZVA 4NQCE 3T6XA 1T1YA 3CZJA 3EJYC 4UQ3B 4PJEF 4CRPA 2EABA 4PREB 2ED9A 3DUUB 1TSHA 2QHLA 3C75A 3O3BB 4JPIB 3CU1A 3H4FA 1I8KB 3RX5A 3BP5B 4P5MA 3WE6B 2R83A 3IJ8A 1EBPA 2QQNL 4HCGA 4MMZC 5D7KD 5JIMA 2F5BH 3B3IA 1U30A 2ZWYA 5H8DA 3T5WA 2GJJA 2OCFD 4H5SA 3VXUD 1BOYA 2A77H 4KZEH 3OXRB 3BFQG 4MQ7B 1XB6A 2SEBB 1KN2L 5D2NB 3WV0A 3IJ7A 2ZXAA 1ZA6B 2VQ1A 4JZNB 1LE9A 1ZJBA 4OI8A 1PKQB 4HLJA 4GQQA 3GSWA 1Q9WB 2UY7A 3VB8A 1JZGA 3O2DH 4MQSB 5FUZH 4ODUB 4MMYB 2MKLC 2QSVA 2ADYA 2JB6A 2BZCA 2CDGB 1I8MB 5HHOA 5HTSA 4R26L 3N9GH 1M6UA 3BIBX 1Q90A 4OKVA 5FKPB 4KNTA 5CBEB 4MBRA 2DQJH 2YPLD 4PYGA 2K6ZA 4QXGL 3SPCA 1A7OL 2AEQH 3OLEA 4BH7B 2XPGA 4P2OD 1JXKA 4YHKL 1TO4A 1SBBA 4XNXL 3NCJL 3DX3A 2NXZC 5T1DL 1TU2A 1ZVSA 3VG0L 3ARQA 2HMIC 2B4CC 4CNIA 5C08B 2DW5A 3SPVA 2BVOA 2ZF9A 4PJCF 3BD3A 5AKVA 3I75A 4NQXA 4AYFA 3W9EB 4BA8A 1SJMA 1W15A 2BO0A 3IGFA 1KIUB 1EFXB 2DPKA 1E4XL 1G1CA 1BIIA 1NDTA 3AUWB 1GSKA 3FCUB 4WAFA 2D0GA 2DWSA 3F7RA 2IDCA 3KPSA 2OR7A 4WK4B 2H6PA 3AXLB 3DRTA 3FDWA 4FLRA 1YEDA 5CM1A 2TSBA 4K3GA 4WEBH 3EGSB 5E5RB 5EO1B 3CZKA 5FWRA 3S88H 1H3UA 1HWHB 4ZOBA 2DL9A 5CINH 1D5IH 1L7IL 4GG6B 1C08B 2XYBA 3TEXA 4JR9H 3PQYE 2TAAA 1GTNA 3FQYA 5HGBB 1I3RB 5EZLB 2KKQA 3ZDYE 3DIDA 3QQDB 4RVBA 5E4EB 4HKXB 3ZDXF 1I1AC 5CXPA 1OAKL 2IDFA 4Q52A 3A6BL 3T2LA 1KCKA 1BDYA 3SGDH 4OQTL 2VDQH 4QRTB 1A9VA 1DQIA 4LHUA 4G42A 3QORB 3NJNA 2VR9A 1CQYA 4KRPC 4NQDE 5AKSA 1BHGA 4A6YH 4L8DA 5TJWK 3BEVB 3FN0L 2H0FA 3KPPA 5C09B 3JT2A 2AQ2A 2NMSA 2UZXB 3CZSA 4A2LA 2WBXA 4M7LT 1JNHB 2BC4B 5IOKA 4KJWC 3SDCA 3EXJA 1GSMA 1EUUA 2VWEE 4I4WB 3APMA 5DJ0B 5EN2B 3CLFL 4RFEA 4V11A 5C0ND 3GLZA 1EHLL 4Q9RL 2OAAA 1SXNA 1B0GB 1UWYA 4I3SL 3ECBB 4PW3A 4U4IA 4CN1A 4EDXA 3KEDA 3PP4H 4F7TA 2AK4B 3N0AA 4DN3H 3OR6A 3GK8L 4P23A 2QQLL 4TOYL 5EDXA 1PX4A 3K74B 4PJEB 4I87A 3M1OA 4F33A 3VQ1C 3V5HB 4XP1L 3TA3D 2DQUL 2ALWA 3TEWA 3BUYA 4YC2C 2FR4A 2F54E 2EEDA 5KVGL 2OMVA 4KFMA 3X3FL 3HVNA 4GI9A 5TFSH 3K6SA 3V5KB 2EDKA 4ODHL 5AWNH 4U6HA 5IWLA 4NNPH 4N2NA 43C9A 2FD6H 2VZSA 3U0PA 2FBJH 4ZMAT 4Z8FL 4KPHH 1C16B 3ECWA 3MV11 2FEDD 3MBEC 2JXMB 3MRIB 2V0AA 4FCHA 3KLKA 4G71B 4F5CA 1CIUA 3OZKA 1TNMA 3P02A 4JGJA 2YQ3A 2R56L 3S0PA 5EEWA 2VR7A 3J7HA 5TQ0H 5JOEA 2ZYRA 1CG9A 1J9SA 4ACPA 2IH9A 5HGAA 5DR5L 3QYMA 5GRYA 3PQYB 3TURA 3L81A 3DBSA 3ZL4L 1ZLSH 1JUFA 1Q94A 2AXHA 2ZNXA 1NGZA 1TTFA 3PABB 1OSPL 2ZXGA 2PO6D 2I24N 2B4CL 3AXHA 1N70A 4RFNB 3HBZA 4MASA 1WYJA 3G04B 3BSHA 4O5LL 3BP7A 5K5YA 2FGWH 1XGQB 2BX5A 4IIZA 1UOVA 4JNXA 5DHDA 3GMLA 3TEUA 3CMOH 1NGPH 3MLTA 4JQIA 1T2JA 1H0DA 4LLWB 2R1YB 1AR1D 5I8OL 3PWUA 1YO4A 3ILPA 4WZ9A 3TVMC 1V05A 4UU9A 5IEKB 4NRZA 1RAMA 4PBXA 1J8HE 1H6EA 1GMEA 3A21A 4BYHA 2CGRH 3IJSA 1M9WA 3C09B 4I0PA 3FB7A 2KDGA 4K9JA 1QKZH 1V3JA 2EIJB 1B0RB 2UVFA 1TZGH 3JT0A 4PS8A 5B1BB 1HEJC 2XG5B 2Z3FA 4QOKE 4WI0B 4CN6A 2RQEA 1Q9LB 3ABZA 3EYQD 5FCSH 1Y0LB 2QLVB 4FHJA 4C56B 3P3TA 3QXWA 4N2KA 3RWEA 1GHFL 2PXYA 3BPLC 4IBYA 3RNKA 2X6VA 2VLMD 1KCVH 4ODSL 3OGCA 1XF2B 2BSDA 3W2DH 3PWVA 1NC4A 4N1HB 3BWAA 1USQA 2GT9A 2IALB 3DTDA 2DYSB 1YPZB 3QUZC 5IB5A 1J18A 3F6LA 4LCWA 1J11A 5AVVB 1ACYH 3II3A 1TEGA 2N1KA 4KK6D 1S7VA 1BFOB 3VFOB 2WUBH 4B5ZA 1NM9A 2A99A 3TBCA 2CO6A 3GKWL 2VUOA 2R9HD 3QHZH 4ADGA 3UTSB 4BK5A 4JHUA 5C2UB 3O0LA 4TSCL 1NGWA 1HHIA 4PWIA 2BNUA 1U4EA 3ZE0F 1SDDB 4ANKA 2ZF8A 4G9DB 1JIBA 2CDEB 5T5NG 3VUAA 4XP5L 3F7YA 1AQKH 1XT5A 3T8VA 2BDNL 3DUSA 3PDGA 4MNQB 4RSYA 5KYUB 1KJVB 2X9YA 4XPTH 1BQ5A 5LCVH 1KV3A 3B2VL 2BY0A 3GZOA 1JOIA 3KYNB 3HZYA 1ET7A 1QA9B 2LABA 4FA6A 1L6PA 1NCBL 2V2XA 3C8KA 2B0SL 1B2WH 1FFOA 3JWDH 4P5KA 4GQRA 1IEHA 4OU3A 4K8RL 3DX4A 4HCFA 1KGCD 3MCKB 1EFQA 2BW4A 4WUUA 3BZDA 2YSSA 4UILL 4N3TA 3TT3H 3EDEA 1NBYB 3PV6A 1YDPA 3WHXB 5LBVA 1ZSDA 2Y69B 4J27A 4B41A 3RWFB 5DTFA 1XSJA 2R1YA 1IVTA 4HW6A 2PTTB 4L29B 3HG1B 1HFUA 1LQBC 2UY6A 3PP3K 4LMQI 2R9HC 4M8QB 4GBXB 4WVRA 5F7LB 2P46B 1CLCA 1TVBA 1N12A 4G70B 1DQQB 4JO8A 3KYKL 4MB4A 2OJZL 3IGUA 4LPCA 4O02H 2F8IA 1MFAH 4UNUA 4DEWA 5HYEA 1ACXA 4OLVL 1WZMA 1E5AA 2WY3B 2YUZA 4HHAA 4WU7A 3DX8A 3H7LA 1EEYA 1FLTX 3MROB 1T7XA 3R1GL 2UWEA 3QJRB 2B59B 4P3WA 2PYEB 1YEIH 4Y89A 4W9EC 2Y1AA 1K8IB 3QFDB 2BS9A 2YD8A 4PLJD 5BVPL 5FEBA 2C7FA 2D7PA 3ZE1E 4M1DH 1FE8H 1EO8H 1QLFB 1OP5K 3ZN6A 3V9CA 5KTEL 3ZBMA 4WJ5A 3MRCB 1CR9H 4J4PD 3OR7A 3VSUA 3WXWH 2X3AA 4F8TA 2DYPB 4KUZL 3X14B 2K7PA 4PJIA 4M1CD 1OIOA 1IT9L 2AKRA 1K8IA 2CHNA 2QKIC 4IMLA 2E7HA 4PJGA 4XPAH 2ESVD 5D72L 2KPNA 4U3HA 3PWPE 4ZAKB 5ITBH 1S46A 1YJDH 1U8JB 4JM0A 2YKLH 1LO4H 1BQKA 3BQUB 5DQ9B 4CU8A 1X5ZA 3D07A 3DX8B 2WTRA 5BZZA 2X1OA 3RX7A 4H7VA 4AQ1C 5CN3A 3WS3A 4P5SA 4C4KT 2PABA 3RUGB 4J4PA 2GSGB 2HT2C 4YGAB 1LGVA 2ZE0A 3D8MA 1Z3GL 4L9LA 4HJTA 1NMAL 1EZUA 2I26N 3LEYH 2Z64C 4M6OL 1RUKH 5E4IA 1UXSB 2GY7B 4L29A 3EOBA 4ZI8A 4OZ4B 3F84A 1MKFA 3B9AA 1JGEB 2WLNA 3HRZB 2AK4A 1EK3A 1F86A 2W8CA 5LCVL 3AT9A 1ZSDB 1Q0XL 1MAML 1AR1C 2JVUA 3EYFA 4J3OG 1T7WA 5ID0B 3V4VB 3ULUL 4U6VH 3W0WE 4RFEB 3VD4A 2O61B 4GW1B 3BT0A 2LQRA 2GEQA 3FQWA 5CLTA 3CXDH 3EJYD 3JYBA 2Q2EB 3WKPA 1JNHA 3CBKB 3VWJC 4G7QB 5IROD 5J6HA 3HI6L 1CN4A 4Q9QH 4Z0XB 5J8OA 2XZAH 2OMNA 3CHQA 1NCAL 5FYKU 4L8DB 1GGCH 3TP4A 4G9FB 3VFTB 1IGJB 1N59B 2YKKA 3NJJA 4EI0A 3FB6A 1UTDA 4N0UB 1OPOA 1OT4A 1CQKA 3CX5J 4IOSD 3DX2A 3EUUA 2BZ7A 3PGFH 5DJDA 2WXNA 3DETD 3ME0A 4BQBA 5AB9A 4DP5X 3SYQA 4JGNA 3ABKB 1T4WA 4GPVA 1HEHC 3TBSB 2ICWA 3RL2A 3CFKA 3T04D 4PJ5A 2RFXB 1BD2E 4XBGA 3RVWD 3FCTA 1DQMH 1A47A 4PJ8A 5HYQA 4CADA 4HWZA 4I77L 1LLAA 4BWTA 4RX4D 2N7BA 1A3LH 1MFCH 1X9RA 4XC3H 4B0MM 5DS8B 2BCKB 2BVTA 4CW1A 1EEZB 2QSCL 2VABA 4KK5C 4G8GA 4AJWA 1NFKA 2F5BL 3NVQA 1CBVH 2EO1A 3H0TB 5H35B 2F58L 3WLWC 3U4EA 1X5XA 4XAKD 5CEZD 4Y2DC 3PWPB 3QG7H 4HPOL 5KBLA 1UG9A 2J8OA 2NDFA 4ONOA 4NUGH 1ZGLP 2WZ6A 2Z7ZA 3MRQA 3SBPA 1RPKA 3QPQD 2XA8L 4D94A 1U3HD 2VGLM 1ZHKB 2XXFA 4P0DA 5J56B 3FB7B 2BSBA 2AEPL 2HTLD 4LSSH 4W93A 1NWOA 2AEQL 3X2QB 2YBRB 4JFPA 2GBAA 5C92A 5L2JB 3WKML 1F4XL 5E8EA 3WTVA 1J8HD 3GXMA 2XTJE 5AVYB 3VI4F 3OSVA 2DQCH 3H2PA 1OL0A 5EEXA 5FLVA 2QFPA 3JV4B 2XWJA 3QC6X 1QQDA 1KCRL 5F96L 2IXQB 4KOBA 5G55A 3SDXE 1JPFB 1H6FA 5EU6B 2EDJA 1UOWA 2NY5H 1E40A 4I5BB 1WWAX 4U6VL 2WXMA 1RURH 3BVTA 2C1PB 4IMKC 5AUMB 2HP4A 3I6LD 4NO5B 1ZPLA 1I31A 1IBGH 1K8DA 3D30A 1ZHNB 1YEEH 5DU7A 4ZMOA 4XHQA 4CKQA 1F4YL 4EKXA 3D39B 1QO3B 1I85A 2XZAL 4XWGH 1GJIA 5IVXF 5LXGL 3EH2A 4UYPA 4Z95H 3UTTE 3AQZA 4OGQC 1XEDA 3BVUA 5K59F 1A7NL 5T1LB 3GHBL 5BUGA 5HPOA 4IYKA 2YAFA 1XDTT 4JREB 1DZBA 1XTMA 3FT4A 1ZD6A 3VA2C 2FQEA 4PB0H 2VKWA 2XQ0A 3LS4L 1HH6A 3D2UD 2KQNA 2R0WH 1OAUH 4MNQD 5DC0A 2W65A 2OMVB 1TZAA 4JO2H 1CFBA 3GI8H 4GMSL 5IK3A 3BUYB 1AP2B 5GRUL 2VLKE <