3QUHA

Structure of heme transport protein isdh-neat3 from s. aureus in complex with manganese(iii)-porphyrin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
112
structure length
112
Chain Sequence
LTDLQEAHFVVFESEENSESVMDGFVEHPFYTATLNGQKYVVMKTKDDSYWKDLIVEGKRVTTVSKDPKNNSRTLIFPYIPDKAVYNAIVKVVVANIGYEGQYHVRIINQDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Iron-regulated surface determinant protein H
publication title Molecular basis of recognition of antibacterial porphyrins by heme-transporter IsdH-NEAT3 of Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Heme-binding protein
total genus 24
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3quhA00
2ITFA 2Q7AA 3QUHA 4NLAA 2O6PA 3SZ6A 2E7DA 5D1ZI 4YMPA 3S48A 3QUGA 4H8PA 3SIKA 4MYPA 3VTMA 2O1AA 5D1XE 3SZKC 2MOQA 2Z6FA 4FC3E 5D1QE 3VUAA 4WJG3 4H8QA 2K78A 3OVUB 2ITEA 3QZNA 2H3KA 3QZLA 3RTLA 3QZPA 3QZMA 3RURA 3QZOA
chains in the Genus database with same CATH superfamily
1FFNA 1X9RA 1IVTA 5EU6A 3PXJA 3UX9B 4FQHB 3WXWH 3EGXB 4MSWA 2X05A 4PRBB 3TBVA 1U92A 1JZ7A 2X41A 5KYUA 1NCTA 3PDOA 2WMPB 2O93L 3IMVA 1T3FB 4HG4K 4PWIA 3BT0A 2OI9C 3ULUE 3PWVA 4JRXE 4KRPB 1OLZA 5M95B 5J3HD 2P45B 3U2JA 4DKFH 5AUMA 2O30A 2BMKA 2X6CA 1FDLL 3NIGF 4YEEA 2EVGA 4MJ4A 1S9KC 2FH6A 5EBLB 4N86A 3JV0A 3VXMB 2BHZA 4XPAL 4GRLA 3SBWC 3MX0B 3MOBH 1AQKL 4KRPD 2Y4SA 3RUGB 4QRFA 3UYOD 1MLBB 4RAVB 4G43B 5JIIA 4NQVB 1HQRA 4PTTA 4EVNA 1DQJB 1QW8A 1P7QA 3WL9A 1DE4A 1DQLH 1IEBB 2VR6A 5AB2A 1UWGH 1D6EB 2O5YL 4L1HA 1TFHA 1OL0A 4GAGL 4XP1L 1U8PB 2CPUA 3PNRB 2X4SB 4Z7WE 5B3JF 3SKMB 1F11B 5DJ0B 4AE0A 5E2WL 2DTSA 5E5MB 4POZC 2Y2WA 4TXVB 1O6SB 4PJ9B 3EDEA 5F7LB 2E6JA 3C09C 3DVNB 4PTUB 1MFAL 2OYLA 5SX4H 5GRXG 3O2DA 3V6FA 3WFDH 3BT2L 1VJSA 2VB5A 2FHCA 5HHMB 3EH5B 5H4ZA 1S7XA 2EINB 3SO5A 3P40A 4C4KT 5EZJA 5HDWA 3TJEL 5JA9A 5MEOA 4AT6A 1OY3B 3MRJB 4JR9L 3S98A 4ELMF 1AGEB 1ETZA 1MCQA 3MTRA 3CU7A 2EQDA 1NBZB 1FNGA 4I5BB 5DRWB 4Q89A 4JG9A 3B9AA 2CO3A 4FX5A 4YHOH 3ABGA 4WSJA 4AW4A 2F74B 1S7UB 4HT1L 2IALB 4NNYA 4P4KB 3JBG7 5GS0C 1K8IA 1XGPB 4M6MH 3NZHL 5GRZA 3TNNA 3Q5TA 3PG2A 5FYJD 4GINA 2YRBA 3CFBB 1Q1JL 5DQ9B 4JAMA 3VW3L 3VD3A 4PRDA 5M7QA 3FQWA 4U31A 1CBJA 4F33B 1XR9A 4KKLD 4PJFA 4J4PD 5HDBB 4Z7VE 4YDJA 4HJJH 1TYRA 3FO0H 4BQ9A 1MY7A 1QSZA 3H9SA 5LB1A 3OR6A 4NQSA 2KDGA 3QZWG 3RX9A 3K5SA 1V27A 1TQUA 1J05A 2UWEB 4DZBB 3EHBD 3OAWA 3GMLB 4G1MA 4PWEA 5CFHA 3DDFA 3MMEB 4XZ4A 5J9PA 3WN5C 3CSYA 3A23A 2Y0SA 1T22B 3E9UA 5IJVB 2XQYK 3TBWB 4CSZA 1BQSA 1I82A 2V2WA 1TTAA 2VN4A 3OTTA 3C87A 2TRYA 3KH4A 4DGYH 3CZNA 4FN0A 4OQTL 5GSVA 3VXNA 1TO5A 2FLMA 3T6XA 3I9AA 3ROOB 2D7TL 2CDGA 2VUKA 3FBQA 1OHQA 1EEUA 4C54A 2Z31A 4HK0B 1E9OB 1AHWC 5DVNA 1SY6L 2IPTH 4QPEA 6PCYA 2PWDA 3JSSA 3QDJA 1AIFA 2DQTH 4NZUL 2GT9B 4ZJ9A 3U1QA 4X99B 4NGHH 4XCEB 3MJ6A 1K5NA 4P2CG 3KLHC 4MVBC 3O0LA 1XCQB 3AQZA 4GH7B 2EYSA 3AREC 1QR1B 1WCQA 1JGVL 2HJKB 4XO4A 1HC1A 3IB4A 3AVEA 2YJQA 4QXTB 2ZX5A 1XH3A 1IC5L 4HDIB 4NM8H 1S9XA 3UP6A 3LRMA 4FA7B 2CD0A 5J8OA 2A6JB 1KSRA 2YZ1A 2R29H 1N5AB 4AJ0A 2WVTA 1H6UA 2LT9A 1YN6A 4ZMYA 2ODIA 4M6OL 5FPIA 1HIML 5C08A 2JKSA 3C2AH 2OMYB 3QNYA 4FMFA 4YXKH 3SKOB 3UGUA 5J6GB 1RHHB 5TF1H 3GSVA 1FNSH 4BXSV 1DVZA 2DB8A 2X2IA 3N04A 4X5QA 2CRYA 4QRTB 4UNVA 2VAAA 1KN2L 5B8CC 4DKEH 1P84K 1WAPA 4XP9H 4AEFA 2APSA 4H88L 2FQDA 4EEEA 1JNHA 4OLXL 4QRAA 1UXMA 2YPVH 4YZFF 5DHYA 1PD1A 3GMNB 2R2CA 4HBCL 3ARDD 3BN9D 5ADPH 3F8UB 4KTEL 1ZLSH 3GO1L 4G8GA 4LIQH 4PG9B 4Q4EA 1GYVA 1CFTB 4Z3GA 3DRTB 3HNSH 5DHVH 5E9AA 2G4EA 4NJAH 5IQ9B 1V55B 4RGNE 5HHQB 2V8MA 3B7UX 1PJWA 3L9YA 4GAYB 2CGRL 2V9QA 4O02B 4A68A 5HVFB 1YEHH 1SOKA 1UZ6F 4HWUA 3HLKA 4G9DA 5GS0H 3V10A 2WINA 2C26A 1R0AL 1UB5B 1NAMA 1HXKA 3HZMB 1FVEB 2EDBA 1NGYA 1NWOA 1RZ7H 4KMTL 2P5WE 3VMPA 2OR9L 1OTUD 2E27L 2AQ3A 4NN7C 3LKRA 4G11A 5E70A 4U6HA 2Z0UA 4Y1AA 2CBQA 3DBXB 4IOFD 5JW5A 5E4AA 3IGKA 3MUHL 3ZTDC 3GSNA 1H5BA 2A9NH 3AJ7A 1N6VA 3MV8A 4NNXA 1C16B 1LL1A 4OLWL 1SHWA 3ZDWA 3LAFA 4GI6A 5GGTL 2PW2B 1ORQB 2ICEC 1GJIA 4PJBB 1I9JH 32C2B 3K6DA 4MMYB 4MRBA 4UDUA 1OAYH 2Y69B 3PWPA 1IBYA 1LP9B 2XTJB 3MLSL 2UZYA 2ENQA 4AQ1B 4IRJD 2HMID 4WJ5B 1OGAB 2YEQA 1X3DA 3T6ZA 1T5XB 1TVBB 2V37A 4XAWH 3X12A 2DQGH 3H8NA 5IHLB 2GIXA 4C83B 4KTGA 2NY7H 4LRNL 4QAMB 1B0GA 1UH2A 1QZ1A 2ADFL 1RULH 4W6WB 3WI9A 3F6IA 1WPCA 1RZ8B 3IJYB 3T8XB 1AZNA 1CT8B 5FYJL 5IG7A 1RUMH 5I1CL 1USZA 1KTJA 1J9CT 3MROB 5GZOC 4KK9C 1QBBA 4NZTH 3T2LA 1GGCL 3DX6A 1CI5A 2FSEB 1N0LA 1T1XB 3IJEB 5FHBL 1JGUH 1OWRM 4ZFZB 1UZ8A 1TUPA 2XZZA 3H1ZA 1H15B 3HS0B 4LPXA 4XC1H 4IJ3C 4D8PA 2CHWA 3B9EA 3SOTA 2L8AA 3NESA 5CN1A 4XXCC 4CJ0A 4F7CA 2BH0A 5EDSA 5EUOB 1SJEB 1ICTA 4X5XB 4YK4B 4CU8A 4TPRH 4WK4B 2FWOA 1X44A 4G6JH 2VR5A 3WUWG 5E8DH 3VG9B 2FEEI 1QTSA 3O3AA 4HUWA 5T1KA 4F7EB 2JIXA 5IJKA 1AKJD 5E6ZA 4OB5H 2ZXQA 4RNRA 3RBSA 3L3DA 2FSDA 4PU2A 4EI5B 4OM1L 4U1NA 3AG4B 2F5BH 3ZO0A 4G7QB 2W80C 1JF1B 4WNQA 4IHOA 2NSXA 5FFOA 1GZQB 4UV4H 2AGJH 4P23D 3RVVD 2CKBL 4GLRI 4MNHA 2C1PB 4FYSA 1GZHA 3QZWA 2OMWA 4I0PD 2ZYRA 4LEOB 4Z3IA 2ZSWA 3CFUA 4LT7A 2P8MB 1K4DA 4L2YA 2CBMA 4BUHA 5AWNL 2AHIA 1YEDA 4YFLI 3D09A 4JRYA 5EEWA 1W91A 1KYDA 4XODA 1E28A 5BQ7A 3KPNB 5IFJA 4TULH 1FWXA 4LVHC 2P7TB 4D94A 2HWZH 4P5MB 1THAA 1KGIA 5EO9B 2CR0A 4FG6D 2GW5A 5AAMC 2P8PB 2PO6A 3GSQA 2J4WH 3D18A 3EYVB 1JCVA 1BZ8A 4OLZH 4AMKH 4ZX4A 5I18L 3GRWA 5KS9B 5A2AA 3A6CL 3LIUA 5DD6A 3T3MB 4XVSH 4DW2L 1R6VA 1MAKA 1J1PL 1ZHBA 1OE2A 2BY0A 1AC0A 1FPTL 1RZFH 2BHUA 3QCUH 4P8QA 5CGMA 2XN9E 1PF3A 3KHOA 3FW6A 4H0LC 1J5HA 3QP3A 4H40A 1MWAA 4ISVB 2HA1A 4ZDHA 5E24E 3KJ4B 5L4JA 1E2ZA 1WSST 2BNQE 3IDIB 3QGVA 1TXKA 5GRVL 3G5VA 1TT6A 3U25A 4WSGA 4FQCL 4PJHF 1RJCA 2VC2L 1TZIB 1HJCA 4UT9L 4W9DC 1URLA 1NMCC 1A6UH 4N2DA 1OT2A 3X3GL 1DUZB 4YO0A 3BSGA 4MQXD 1Q90A 4QHKJ 1A7QL 3QO0B 1YMMA 2B3RA 3CFEA 2DWYA 1KGYE 3FCGA 4RBPH 1M3JA 4JL1A 4IBUA 3P4MA 2DLHA 4KFMA 2VW6A 4LGPB 1F02I 5KVGL 5T3ZE 4LFHD 5ES4B 3NT0A 4KKQA 4D9RD 1MCEA 1OF0A 2HKFL 1N18A 3HZYB 1S5IH 4EAEA 3UAJC 1JZ8A 3TWCH 1ZGLP 3WXVL 1HKFA 4GEIA 1QHPA 4HALA 3SJVE 3UIYA 4FFYA 3PP4L 2EIMB 4XBGA 2FIKA 3OKEB 2C4XA 5BRPA 1DEEA 2AK1H 4J39A 2CRZA 5ACZA 3IM1A 4FXKA 1E67A 2R69A 2WPGA 3HLAA 3PWLA 1A7BA 1RZKL 1BF5A 1FG2A 4O2CB 1CLVA 1IX2A 1NZRA 4D0DA 4WZ9A 1QG3A 3CVHL 4OVUA 2OL3B 1CB4A 3MA9H 4YXHH 3EG9A 1MFCL 2VXSH 2DPKA 4HCRH 1H3PL 5IMOA 3ZKXC 3X11A 1J5CA 3KPQA 3LKSA 4BK4A 3SGDH 2J6EH 2FVNA 2EIKB 1G6RL 2BSRB 5HXMA 3ZYZA 2X1XR 3ARRA 1GYWA 1KIRA 1XVSA 2XOTA 3Q2LA 2KYIA 4ZW3A 4LAQH 5FKPA 4OJDH 5C09A 3D50A 1BEYH 4GP5B 1KJ2L 5IB2A 5FK9A 3GI8L 5CHNB 3MLTB 4XN5A 1N0XH 4ZUTA 3NP4A 4JM2D 4Y1SA 1R3KB 1F56A 1JRHH 1KLFB 3MACL 4LPYA 5GGRA 1KCRL 2G5UA 2MOVA 1FFOA 3GMOA 3DARA 3WO4C 4CILA 3PQYA 1ET7A 2OQJA 4PCYA 5F1IA 1Q9WA 1RMFL 3RGHA 2EH7L 2WQRA 1FFRA 3RVTC 3GXTA 3CC1A 4ADGA 3H7LA 2JB5L 3F12B 3VI3B 5EU3B 2ZUUA 4P46D 5TDPA 2I24N 3WD5L 5F21B 2OSYA 3UGXA 5HYQA 2VZOA 3VXSA 4ETYA 1AR1D 3FB8A 1NEZB 1L9MA 3B9KB 3P3RA 3SGEH 1W15A 1UXWB 4CMMB 3LNHA 3CSPA 5LGJB 3RFZC 4EO5A 1T03L 3ZIMA 3HC4H 4P2OB 5TTRA 5EU4B 5FO8A 1AC6A 1S7WB 4PJGB 1KCVH 4PJ7E 4GAJH 2BNUA 2VJ0A 1IL1A 3SE8L 1U3HA 3P4OB 4LHQB 2BSSB 4L4TE 4JFDD 4GRWB 4YHZL 1ZY9A 1J8KA 4KVPA 4Y5VC 3LNIA 5T1JA 4JFYB 2BRRH 5FEBA 5FLUA 1Y7VA 5CEXA 2K7QA 3ARFC 1XF3B 2EC8A 1Z5LB 5FXCH 3WUWA 4BQ6A 2EDTA 3SD5A 2GEQA 3ZE2E 3UG3A 1BEXA 1OSYA 2EEDA 5JW4M 2VJXA 1WHPA 4X8CA 1JVLA 2GJZA 3FF7A 2ZCZA 5IQ7H 2AQ1A 2ZG1A 3Q7JA 4IBVA 2HVJA 4QHLA 3IE9A 2QSQA 5MI0C 2NY4C 3QQ9D 2AJUL 2FGWL 4FQLH 1JYWA 2CRIA 2A9CA 3TM6A 5I73B 4FYQA 2I69A 3HC2A 3T1FB 3HRZC 3IETB 3D12B 2H2SC 3MLZL 3MRPA 3QDGB 2Q1EA 4JGMA 2ZP0T 5CN3A 1T21B 3OB0K 2APFA 1NIFA 1N6QL 2R1YB 2I32A 5DJYA 3A22A 3LB6C 3RFRA 3TEZA 4W1TA 3Q2NA 2NW2B 3SDDB 2OMBA 2R15A 4PRIB 1ID5I 4YN3A 1I7ZA 2F53B 5LGYA 8CGTA 1C08A 3IAGC 3FRPA 4O51B 3CD4A 2PTTB 5DD3H 4MJ6B 1LNUA 5DRNB 3W39B 1HCZA 4MCYB 3SDDD 2YUVA 3QDME 2EYTB 5GGSA 4OZGE 1JZ4A 2Y5TB 3M1OA 4JG0H 4QWWD 2F53D 1M1XA 1AAJA 3HMXH 3WYRA 1NGPH 1NSNH 2DWDB 2YARA 4AVKA 4KFZC 3CFNA 2WLJA 4KK6C 4WFFE 5L2JB 4CNIA 4W9ZA 3GPEA 3KPOB 4WI8A 1HHJB 4BEIA 1CDYA 1ND0B 3E6FA 1ZV9A 2MNWA 5DJAA 5B1JA 4NJ9L 2YO3A 3LQAL 4IBQA 4PJDE 2A73A 3ZMNA 5JUEL 3QEHA 4EIBA 1ADWA 3ULVF 2IOIA 1SEQH 2IOOA 3W2DL 2AW2A 5GXBB 2CCLA 1JFQL 4OZHF 4RAUA 5C0BB 1YY8A 3O6KL 4Y19E 4ANKA 3WLWD 3EYFB 4ZNEA 3DTUB 1VHPA 3DWTA 2VUYA 3L1OH 3RY6A 5TFSL 3U0TA 4GUQA 5DURB 3CC5B 1HVXA 5BW7C 2XVBA 3X1NA 3Q01A 1HYSC 1NUNB 4HCGA 1U9KA 5C0BD 4WRLA 2VR3A 3HAEH 5D2LB 3T0XA 3VXUA 1IC7H 4IRZA 1E9QB 1DBAH 2WNGA 1JPSL 4I18C 5DURD 2AMUA 3TEUA 2GTWA 1DQTA 3NSFA 1E8YA 2WLLA 3CTTA 2AI0H 4B7IA 4I2XA 1WLHA 2AQ2A 1FO0H 3PL6C 5F7WC 4AGQA 3OSKA 3CXDH 5FM8A 4HC1A 2NPLX 2DI8A 3RY5A 4OR1A 3MV7B 1EFXB 1JI2A 1Q9KB 2MQ3A 2VXQL 3FB6A 3QXDB 2X4OB 4LNRB 3RJDA 5IV2B 3Q8CA 2GITA 1QBLH 2YFOA 3H4FA 2CLRB 2O1AA 5AKSA 3UMTA 1XAUA 2OX5A 3QJHB 2WN2A 3S34L 4OZIF 1QO3B 3L5JA 4ODSH 2HJFA 2EDXA 3O9WC 3B6SA 1EFXD 3HN3A 3QDJE 4PJXB 2MHAB 4KROC 3GWJA 1EDHA 2Z92A 2G0LA 3ZDYE 1CDBA 4U7MA 2P47B 4BKLB 1IGMH 3S7GA 3U0PA 5ICYA 3QJXA 4XMKH 5DTFA 1QSFE 4FQXB 3FTYA 4R6UA 5HPMB 2R9HD 2F8IA 1EGJH 2X9XA 2DICA 4FULA 4N2IA 1KG0A 3NAAH 3PNWA 1B4LA 1UUSA 4MA3A 5FS5A 5J6SA 2IG2H 3C9NA 5FUOH 3ETSA 5FA3A 1MG3C 2DLIA 4GO9A 5ICZB 1NH6A 1AP2B 3EFFA 4Y16A 4NUJB 1RUQL 4UANA 2BP8A 3SDCB 3QR2A 2V8LA 1K5WA 4HOWA 2PW1B 4I3RH 2QV2A 1IGYA 1WFMA 3KYNB 1TCMA 4RX4A 3D51A 3DX4A 1OQXA 1A4KB 2WV3A 2V7HB 5E00A 1R34A 2X4UA 4HPOH 1CUOA 1FO0B 1GS8A 2NY1C 1MI5A 5DUPH 3CH1A 4XX5A 3SGKA 5DYOA 4XH2A 3IBOA 2OM5A 1UM6H 4HKBA 3GJFB 3BUYB 1SLVA 1W72H 2AEQH 3NOIA 3FU0A 4KDWA 2ZOOA 4OD1L 4UU9A 3DKHA 2JK5B 2B0SL 4P3DB 4V2CB 4G8GE 1HL5A 3BQUC 3G04B 4KKAD 3VWJC 3OLEA 4WKXA 5TQ2H 5DRZB 4JANB 1SVBA 1OEZW 3G5YB 1HH6A 4GIPD 4GYBA 5KVDH 3L8QA 1F3JB 2NZ9C 4LSDA 2ZNXA 2NR6C 1PIGA 1EDQA 2DTML 2NY0D 1JWSA 3QXAB 4HXAL 1WFTA 4IIQC 2AV7A 3C5SB 3MQIA 3V79C 4YUEH 2IV8A 4U1IA 1J18A 2J88H 3JT2A 4IOSD 1KGUA 1KDJA 1E8ZA 3F05A 3AS0A 3W38A 4OKDA 3I9PA 5AYUL 3D0VB 4Y1AE 5AVSB 1WISA 5DO8A 2G75B 3W5NA 1M7DA 2OYMA 3K46A 5IFHL 3ESNA 4MXQD 2ORBL 3Q13A 3BSZA 3NACL 5L9DL 2X4QA 2GJ6B 1JD9A 5IIEB 3ULVC 4AC4A 3B5GA 3MFGB 4DQAA 5F9JA 1AO7E 3F7KA 3OAUH 5KJRL 3ARPA 4KXDA 4ZMWA 4ZMQA 1XGZA 1T89C 3P73A 3B5HA 3M17A 5BVPH 2Z4TA 4ODWB 4BK5A 3LRSA 4L8SA 4Y4FC 4E9LA 2GJ6D 3DOSA 3L5WA 4N2BA 2VDRH 3IDMB 4PUBH 1KY6A 3N42F 1UKTA 2MRYA 3QZNA 5T1LD 5C0DA 4BA0A 1KC5L 2E74C 5E1GA 1T7WA 1HDMA 4H44C 1Z0MA 4HEME 5DT1L 5HGBA 1OSPL 3VFOB 4XPHL 5F7EL 1LJMA 4HP5A 4X80L 4XNXL 4A2HA 4GKZA 2A6IA 2VUOA 4M7KL 3ZL2A 4B95C 1X5FA 5D7LB 4Z8FH 4GMTL 2CJSA 3KLAB 3KBPA 5D2NB 4JJ5A 4Q6YA 4MMZC 3VVVA 5C1MB 4JFFD 5D1XE 4NPJA 1U8QB 4K7PX 1A3LL 4H8WL 4YDVB 1B0IA 1WWAX 3Q8AA 3NJIA 4QKTA 1N8ZB 1CDIA 5D7LD 2GUOA 1NANH 4LHUA 5EUKA 6FABL 1NCBL 4JRLA 4AL8L 1SFDA 1SQ2N 2WLMA 5DLML 1N2RA 4CVZA 2HKHH 3SGJC 4HIJA 2XXFA 4J3SA 1RU9L 3LX9A 5L4FA 1T0NB 4HZAA 3UPAA 3LH9A 4UM9D 3ZTNL 4JPIA 1RURL 2XJKA 1S9YA 1BD2B 1OAKH 5DZVA 4CDHA 3RWIA 2CA4A 3O3BB 5B38G 2ATAA 4TNGA 1P2CA 2FBJL 4IGBC 3MRQB 3A4DA 5T1DL 1BGXL 4LARH 4J2XA 5LBSH 4HUVA 5ABZA 3SDXB 2EC9T 5DMKA 2P4AB 2DWTA 4KQ3H 2OTWA 5D1QB 1SM3H 1U21A 3FB7A 5KEZA 5KBKA 1BD2D 4I48A 1K6QL 2C7FA 5ACMA 1F13A 5T3ZL 5E1AB 4W6XB 3ZGIA 3TWYA 3RDTB 1BOGA 2ADIB 4L37A 1PDKB 3CXFA 3RUGF 4OCXH 3V7AG 4Y5YA 5D1QD 5IEKB 1JPGB 1LO5A 3VFNA 5EIVA 5KSBB 5LN4A 3L4WA 1CF8L 1VACA 2ICWI 4KUZH 2W38A 2UXFA 2XA8L 1OD7A 4Z7UA 3E6HB 4MJJA 1IAIM 3N91A 3MNZA 5I1HL 4Z7QB 4K15A 3RAJH 3BUPA 4WW2F 3TJPA 4MD0A 1QRND 2N7BA 5AB9A 1S9VB 3JTSA 1YQVL 3HB3B 1BPVA 2KUTA 3MJ9H 4GAFB 5HHNA 4BZ1A 1XGQB 3H54A 1JPFA 4QXGH 1GKOA 1RPUA 2DQHH 1LO0H 2ZG3A 4MJIB 1PU0A 2JJWA 4R5VA 3T4YA 3Q6GL 3IFPA 1N19A 1R3HB 3VH8A 2OMZA 3KPMA 4Z77B 3NDZE 1WZKA 4M03A 1OARL 4EMZA 1F4YH 3L3JA 4I9XA 2HTKD 4U6VL 3T4AC 3RE0A 4XB7A 4XWOC 1N3NB 5DSCB 1TETH 2TRHA 4H5SA 2KPNA 4PLJC 2BY1A 5C0AB 3WMQA 1B0RB 1AMXA 2FECL 2DBJA 4W9JC 2XWJB 4MYWB 5BRQA 2W92A 2VDPH 5TDOA 1TZHB 4OJEH 5KVEE 4G71B 4P2RD 1KXQE 5DD5L 2FTAA 5A7EA 4LGRB 1VFBB 1ZWIB 2JCCA 3JWOL 4NAQA 5EU7C 1JBJA 1S5HB 4RLDA 2X2YA 3QCTL 1X9LA 2UYLA 2FATH 3D4ZA 2ATPB 2ZAGA 1J5OL 4EE2A 1OGSA 5HDBF 4MFHA 4Y4KC 3B5TA 4YQXH 3DUSB 3MJGX 2HRPL 3LD8C 3RGVD 4RQQB 2YD7A 4E9YA 5EBWB 1TLMA 1LWJA 3TBSA 3DROB 2OLDA 4C56A 2UWEF 1JV2A 1T20B 3K6NA 5IBLC 5CJBA 4HHAA 3RVUD 4BGLA 5HD8C 3LH2L 3CZFA 4KKCD 4ICXA 2B5IC 3AFLA 2VABA 3RTQD 3UL4A 3T77B 4B9IA 2J3SA 4JMXA 5TK4A 1JF5A 1FRGL 1QSFD 1SJHA 4JDTH 1S46A 2H7WA 4NLHA 1CGSL 2HX9A 4XPAH 1OT1A 3TCTA 1T4KB 5JXEA 4N2FA 3R7RA 2DQUL 2F54E 4YFDB 2JH2A 4X6DB 3VXQB 1WWWX 4LCWD 2VN3A 4OAWA 3QNZB 3HW7A 5FIEA 1M05A 3R4DA 3QIWC 3SDAD 1YYCA 2OP4H 4L9LA 3DO7B 5AOJA 4ECNA 4G6FB 1GOGA 1VENA 2X4NB 5D7EA 4JY4B 3TVMD 1RUAL 5C09E 4OTXL 2ITDB 2O5YH 2VZ1A 4GEJA 4H26B 3HE6D 2D03H 4FMKA 2JJSC 1R17A 4GAGH 5EO1B 5E6IB 4GKNB 1AANA 2X3CA 1QFWM 5AQ0A 3ZT7A 2BSCA 5E2WH 3O41B 3OGCB 1G1CA 4G6FD 4BH7A 2DYPB 1U8KA 2LFEA 3BAWA 2BIIA 5JQ6H 1MFAH 4AMWA 3MNWB 4TVPE 3EO1A 3IDNB 4N0UB 2W07A 5MEPB 3RL1B 1A9EB 3QDAA 4U6XA 3LZLA 4YGVB 4N8CL 3KS0H 3TO4B 5DD1H 3TJEH 3P3TA 2BVPB 3QUXA 1H0DA 4HWEH 3FONA 4DK6A 4JR9H 4QTIL 1OTSD 1RUPL 5C0JB 2GFBA 4IDJL 2G0KA 3C6LB 2APXA 4Y8DC 3VXSE 3TJHC 2R23A 1YPZB 4N8VG 1NPJA 3QNXB 2YPLA 2Q0ZX 3BZ5A 4HT1H 4YHMH 1NBYA 1SYSB 2ZSVB 4Q9QL 4JG5A 3V4PL 2LOEA 4MS8D 1L9OA 1QI4A 5C6WH 4ODXB 2VXVL 3QIUB 2HB0A 3ARBA 5E99L 1Q1JH 4M48L 3VW3H 2HX7A 3ARUA 2FJHA 3UP1A 2VR9A 4YNYB 2C4FU 3H9HB 5CILL 1XH0A 1SOSA 3UTTD 4L29A 4L3EA 1KGCE 4OGZA 1L5GA 3K80A 3OJVC 3QIUD 1SZNA 4AG4H 2C3GA 1E27A 1XGTA 2ITCA 1G0XA 2V7NA 3T08A 4LKXA 3NIFF 4DP0X 4HU2A 2X2UA 4M93B 4WAFA 4B9PA 4WWKD 3UJTL 4WW2C 3BW9B 2Y7QB 3EJUA 1VKXB 3CHXA 3MV11 3VG0H 4LLDA 4KOBA 3DUUB 3ZMRA 2BCKB 2R56L 3CZSA 5BV7L 1JOIA 3C6SB 5DJDB 3BWAB 3CFKA 4KUCF 4OKVA 4ZTPL 4X6BB 5B38A 5C3TA 1U8JB 3REWB 3HJ0A 5KVFE 4TRPL 3CPUA 1WTLA 4OQTH 3V2AR 5LCVA 4PRAA 5GGUB 1ZS8A 1OCOB 2L0DA 3H3KA 3IJ8A 3MRGB 1F4HA 1UHVA 4G6MH 2D7TH 1WFNA 1RJYB 4G8EB 3VYNA 4PJBF 4FABL 5HYIA 1HCYA 1SY6H 2EUWA 5BZDA 2Z64C 4KKLC 4NZUH 1WK0A 1LP9F 2DWEB 4J4PC 3WIHA 3MX0A 3D48R 3VGEA 2G5BA 2BIMA 2I27N 1U91B 5CS7A 1BMZA 1UCTA 5CR8A 4ZPTB 1FSKB 5D4QA 4CVWA 1JGVH 4HH9B 2XKUA 2IGFL 1A0QH 5D1XD 2ZXCA 5AOIA 2VSCA 2X1WL 3EHBC 4S2SA 2YXWA 3SOBL 4RFOL 4FYTA 4X7TB 5KTEL 4JO3H 1A4JB 1KJVB 4ZOBA 3RWGA 4X4XB 1ZA3B 4IRSB 4J8RB 3V6OC 1D7CA 4M6OH 5E5MA 1QNZH 1FI8C 2BLFA 3BAJA 3LHAA 4DP9X 2EVJA 4MX7B 3QUKB 4E41A 2WD0A 4GOSA 1TJIL 3DNKA 2VLME 4MWFA 5CAYB 5HJ3B 3U6RB 4PG2A 1G7PA 3EXJA 3ZIYA 4IRSD 1D2OA 4MB1A 4YPGB 4WHDA 1XTLA 3RX5A 3U7YL 3AAZB 3D25B 3IGAB 3S96A 1T2QH 2ZUQB 4MNQA 3MUY1 4OLXH 2AVFA 5DJ6B 5DRWA 1M1SA 3KPRA 4JDEA 1FYHB 5AW9B 4D0BA 5EUOF 4JN2B 2ZX8A 4G8IA 4KTEH 3V0VB 4ZNEE 1XZ0B 4HW6A 2MNUA 4AYFA 4OT1L 5F9OH 1Z3RA 2YBRB 2FEDD 3QHFL 4AV4A 5AVWB 4K23L 4Q2ZB 5C9KA 3QULA 5KUKA 5C0CE 4HIXL 3MRMA 2JI1A 1DCEA 1SLUA 4WUUD 4F15C 3GB7A 2XNAB 1FQ9C 2OSLA 1H3GA 2QPEB 4DVBA 1R0AH 2HVKB 2NW3A 5ANHA 2YKLL 3ZRSA 3KL0A 4KMTH 5I8EA 2VR7A 2OR9H 2E27H 5T3XD 3GIZL 3ABKB 2X10A 4AYDC 1OW0A 3K1DA 2PUQT 3BP4A 1RZJL 3KEHA 1P5UC 2PP7A 1EBAA 3FFDA 4OLWH 2R2EB 3L54A 4X8JB 4ZS7H 4L0ZA 3LDBC 1G4RA 3BRFA 5E9DA 3BH9A 1ZIAA 1CE6A 4POYA 3ARDC 3BN9C 1X9QA 3BZFB 4UAHA 4Q52A 1KB5B 1P0SE 2RQEA 2ZWLT 2Y1VA 3L3HA 3T3PE 1QLRA 2FL5B 3MLSH 3PWJB 3SY6A 5DO2C 2Y1ZA 2VT0A 4UDTA 5L0QB 1B9KA 1R9FA 2N7AA 5KS9F 4BK8A 3T3MF 1EPFA 1MHHB 1EEQA 2EXYD 4NKMA 4OY9A 4R3SB 4ZD3L 4MJHA 3EGSA 1C5DA 1T83C 4N2OA 3MLWL 4XXWC 3G6JB 1M71A 1IFGA 5DWUH 2QLVB 3U6XS 1SBSL 3PE9A 2YD5A 3KW7A 4MDJB 4YSEA 1SQMA 2OYKA 1J1OL 1FL5B 1MNUH 4HKXB 2DMHA 4N0FA 3FT2A 3Q6FB 2PXYC 4JPQA 2Z7UA 5I1CH 1OTUC 5MEND 3CMOL 4G9FB 1NMBH 4LLUA 4ZFOB 4GBXB 4FHBD 1BDYA 3CQQA 4X7SH 1GGCH 1B90A 3U48A 3ZY7A 1SNRA 3RFZA 1N12A 1X7QA 4XCYA 1ZGLA 5E2TL 1PZUB 1CGYA 1HWWA 2ETWA 3WHXB 5KSAB 3VM7A 2FLBT 4G9FD 3WJLC 3QPQC 3VU2A 5EULV 1WHOA 1PD6A 1V05A 3U1SH 5KBDA 4NSKA 4FFZH 4N8VA 2XVGA 3IJHA 4P2QB 4IRJC 3VSVA 2HMIC 2G3MA 5DQJB 4PJAA 2XWTA 2K1MA 4A37A 4NHUB 4AQAA 3RY4A 4WO4A 1PCSA 5C0RL 5J57B 3ZW3A 1R5WB 3QAZC 1SVCP 1F8TL 4X5WA 2JSFA 3V0IA 2X0WA 3VXTA 5AAWA 3WG7B 3QI9A 3NK3A 2F54D 4OM1H 2WBJB 3G5ZA 4OFYD 5I15L 3DUHA 4YC2B 3VD0A 3P30H 1I85C 3CFMA 3FU7B 5B3NA 4LF3B 3BUDA 2CKBH 2R2BA 3QFDA 5IW1A 1FORL 1ORSB 2I85A 1CD0A 4PRHE 2Z8SA 3VSQA 3X1GA 1NDGB 3UZQA 1X5MA 2VL5B 5AWNH 5EOCL 3CWGA 3ETBF 5FF6B 4KH2A 3U7WL 1GHFL 4EZLA 4AYBA 4LO9A 1ES0A 2CDEA 4X0KB 3SBPA 4GO6B 3KMDA 2PF6A 2FZ3A 1XGUA 1YZZA 2R29A 3SBWA 3S3JA 5I18H 2NTFA 2Q20A 4PGEB 3V4VH 4NQEE 4DW2H 4L4VE 1J1PH 5JOPD 3VFUA 4OLYL 2N1KA 2NY2D 3VX1A 4RSVA 1BFOB 1FPTH 3UAEA 4R97C 2R27A 5INCA 2SEBB 4N6RA 4F5CA 2FH8A 3H7BA 5IMKA 3RHWF 4QLWA 5BS0E 4P23C 3UTZB 1A14H 4CC1A 5KBLA 3LIZL 4NQQA 4WY7H 5GSRB 4I0PC 3ZDXE 4UT9H 3DSNB 4B9YA 4TVSa 2EKJA 4A6YL 2YPVA 3VI3F 3X3GH 8FABA 5ISZD 5HI3C 2VLJE 4PVBA 5JXAL 4P3WA 4OV5A 1A7QH 4APQB 4LLQB 2IQAA 2XACC 3BPLC 3HI5L 1OM3L 1KLGA 1NEZG 4FQJL 4FG6C 4YL9A 3BAXA 4GLRH 4C4UA 5A43C 1ASPA 5DHVA 1XD0A 2AC0A 1E5AA 3LRHA 1R3JB 2RMNA 3M7FB 1GOHA 4LOEA 2FSEA 4LQFH 3FTSA 2KS0A 3ILDA 4PJGF 5C2UB 1U0QA 2HKFH 4PS7A 4FQ1L 2H9GB 4HUXA 4OLUH 1DLFL 3GKWL 4GRWF 1RD6A 4KVCL 5T3XL 4Q0XH 4UQ2B 1GGTA 3UAFA 1R24B 3W9DB 4PY8I 2AEPH 3QUYB 3SBQA 3L95B 1WBXA 4AGPA 1SJEA 3QJTB 5FA4B 2JNZA 1O7DC 1L0XA 3V4VB 3CHSA 1S3RA 2IAMB 5E4IA 5CCKH 5EBMA 5FO9B 2VDML 2WO4A 3UZVB 4MQXC 4BFGA 2WUBL 3Q9QA 4UOW0 3CVHH 3M45A 1HSBB 3QQ4A 1UB6B 1H3PH 3UO1L 3WN5A 5KWYC 4X7FC 3W0WB 1WZMA 1GW0A 4IKIA 4HKZA 1KTKE 2MPVA 3L3KA 2W9EL 3I02B 5KVEL 4NIKB 2NX5A 4OF5A 1NL0L 4NS0A 1KBVA 5SX5K 1J8RA 4YSTA 1S78D 3DIFA 3GI8H 3NGBC 3MA7B 2DQEL 3MZGB 2VLMD 1QFHA 3D69B 5F9WB 3PWNA 1AHWA 2BC4A 3LQAC 3MACH 4J3TA 4OCRL 3D06A 1E90A 5EO9A 5I1LA 1KCRH 2P8PA 2WJ7A 2WKOF 2XV3A 4PWJA 1ET5A 3JTTA 3I6GB 1NCGA 4JPKH 5BOZG 3HG1B 4NUPA 1BZEA 2E6QA 1RMFH 5D7HA 4KXZI 4XP4L 3MRHB 5D5MB 3DJRA 4PP2B 2OMUA 1JVOA 2IXQA 3AREA 1W0WB 2BFGA 5FOJA 2EZ0D 4KZDL 1DUYA 4TNVK 3ULUH 2JB5H 2R59A 3CN3A 4AEHL 3RWCA 1TCRA 3EBAA 2K4AA 5E7BA 1II4E 5HYFA 5L2KE 3WD5H 2P46B 3FQTB 3QEQE 3F84A 3AC0A 2WAHA 2AF2A 4JFHD 3SSGA 3T0EE 4BZYA 1EEYB 4JY6B 2G60H 3IWUA 4MMXC 5KBMA 4LKCA 5C0CD 1Z3GL 4PJCA 1EZVX 1T03H 4G7VL 1BFSA 2BWDA 4UBDD 1OB1A 3NDYE 4LCUB 2P5EE 4Z76A 1A1MB 4JCLA 1UZGA 3BAKA 5B21A 1AGFA 4QTHB 4HVBA 2H32H 4WEUD 2FO4B 3P9WB 4JM2C 1BWWA 4PB9L 4YHZH 3SPGA 3VFSB 4C58B 3O4LE 3IPFA 2DIJA 3FU6A 2DBLL 5IHBA 5JPNC 2O6EA 1J0JA 1TQTA 3MODL 3OAZK 5CU5A 5BZWB 3LSOB 4NT6B 3FQ4A 5KVMC 2RGSA 4PJEB 4YLQT 5KJ7E 2HCZX 1SJMA 5DZ9A 5I30L 1CD9B 5D2LF 5DQDL 1J8HA 1MHEB 3FTUA 1E5CA 4OVVA 4YBQD 1CGVA 4P46C 1HH9A 2K9FB 3KPLA 1AQ8A 1U4FA 4U1GB 1AR1C 4XVUD 2IVFC 1G7IA 1IMHC 4QIRA 4CSPA 2NUTB 4RGNC 1UEMA 4P57A 1DZBA 3CDFA 3IS0X 4FG0A 3HBGA 3TH4T 2AJUH 2FGWH 4CW1A 1LK3L 4LCCB 2FQEA 4Y89A 3ZPDA 5GS3A 4JRXB 4B6ZA 4TL4A 3LKQA 1HI6B 4BSWB 3MLZH 4LOFA 4X9FA 1FCGA 4RSYA 5DJXB 2NUPB 1VA9A 2WOYA 3OV6A 3P11L 5EFIA 4Z9KB 5SWSA 3PWUB 1CGWA 1RKRA 1ZXKA 5HYSB 1E4XL 1KOAA 2ICEA 5IR1A 4NQUA 2J8UA 3VB9A 5DUBB 4JFEB 4CMHC 2WZ0A 2YSSB 3ALXA 4PJXF 1ACCA 5AVRB 1G7QB 3RWFA 4OCYH 2WB7A 4FOMA 3HC0A 4F8OA 4PV8A 3LHPH 1TYEB 2H32B 3NCYS 4QRPA 3QCVL 2NXYB 2AJXL 1ZSHA 3AMKA 1BQHB 1GMIA 1R3KA 2M1KA 4JFED 2IOMA 4Z7WB 1XH1A 1BVNP 4JVPA 3ESMA 1QTPA 2DOCA 3QQ9C 1EK3A 5AW2B 5J11B 4DESA 1NFDA 3VDCA 4BH8A 1BMGA 1ZCRA 5KVFL 3SE9L 4IBWA 2NY6C 5HY9B 4GG8A 1PZ2A 4X5LA 3ZDZB 5GZOA 1JTPA 3Q1SL 3HAEG 4BUGA 4G8FA 4NJ9H 3LQAH 4JKLA 5JUEH 1PZDA 1MLCA 3DSFL 4XPGH 2OXHB 3L3IA 2G9HA 1E4HA 4AIOA 3W2DH 2YR3A 5CEYB 1JFQH 3GIVB 5K9KB 1FCCA 4ZUWA 3O6KH 1YECH 3GK8H 4P4RB 3K2IA 1TVHA 4PRHD 2J57A 5LAXA 4D7PA 3E8VA 3BHBA 3T0BA 5TFSH 1S7WA 3L7EB 4XXCA 2J1YA 4LXFA 1OAUL 3WCYA 4ERSH 1Z9NA 3QORD 4QR7A 1XT5A 3VQ1C 4JFOA 4L3EE 1B0WA 1WWCA 4LRIC 4PGDB 3VGBA 5JQIB 3OLGA 2J6EA 3SKJH 4M43L 1JPSH 3MBWB 5CWSB 5E8PB 4Z7VB 3ENEA 3VGAB 4NFDA 4L4VD 1U2CA 4G1EB 3GQFA 4ZXBD 1V5JA 4YSUA 2A9AA 2DKSA 4R26L 4WTZG 4XP6L 3DTXB 1NFAA 4JZOA 1E2VA 3IDGB 4FRWA 1AOZA 3EOAB 4M4PA 4L8DB 4M8UA 2XU9A 4EUPB 5C2BL 5JHAA 1ZVSB 2EICA 4YR6B 5SWZB 3ZZSA 5BS0D 3OGOE 1NTDA 1I1AB 2QKIC 4HISA 2J25A 3NSCA 4LEBA 2VXQH 4FFWD 1HHHB 3WLWC 3EO0A 1R3IH 1TEYA 1NC2A 4HAFA 3ZKMD 2LAAA 2KBGA 4DVRL 1IBHA 1DBJL 1LVEA 4PW4A 1VFAA 4UTBH 1GTFA 4E5XB 2WUCL 5AAMA 1ITCA 1A6VH 4QO1A 4ZMVA 3PIQA 3EH4B 4RMTA 4UQ3A 5ADOL 3TTYA 5KAQF 5F7YC 4H8WC 2ILLA 2VXUL 5KAQG 1SYVA 2F5AH 3IAQA 2R7EB 1QOKA 4GQZA 4FI6A 3L4VA 3WKPA 1Q0XL 2EVFA 5F6IB 3E1F1 4C8XA 5CP7A 3HIZA 1IBZA 2HX8A 2OBGA 3T0VA 2GKIA 5DMIL 4AL8C 5I1DB 4POUB 2WOBA 3O6ML 1NCHA 4TUJA 5BNXD 1S7RB 4M1CC 3EADA 1ZGLM 1RUQH 1HCFX 5C0IB 3WFCL 4UQEA 5A2IH 1IIKA 3RPIA 1MHCB 5EN2B 4E41E 2WZPA 2GG1A 4V1DA 4TNWK 3KPSA 3RYMA 2WXRA 1EZLA 2A4EA 3X13A 3NPSC 1KFGA 4CVXA 4AH2B 2X7LA 2UUDH 1HU8A 3ECBA 3B56A 2H3NA 5I71C 2Q6WB 4DUXA 4DO5A 3HKFA 4OCSL 3RU8L 3TASA 5FOBB 1P6AB 1LD9A 2DDQL 5GRWA 2VLKD 1CQYA 1UT1A 2YN3A 3II1A 3T6VA 3BAIA 4UILL 4WKZA 4F27A 2VMCA 3OF6A 2KHAA 3HE7B 4OD1H 2EE0A 3V0JA 3MYJA 3CHPA 3D30A 2HUHA 3TBCA 2B0SH 3DX8A 3UAJA 3TBTA 1X5XA 2YD6A 2WO2B 2OK0L 4UT7H 3D3VE 1JMZA 4KX7A 1BG9A 4G42A 3KWVA 1CS6A 1R5IB 4IBTA 4LVOB 2CUAA 1MREL 2DTMH 2V9RA 2FGZA 4KKNA 1AKPA 3EKCA 5ESAA 4IBZA 4NP4L 2W65B 5E8OA 5TH2B 2VITB 4ZO6A 3VI4B 2JI3A 2CM5A 3SDXF 3S9DB 4M3HA 1D5XA 1I53A 1X5ZA 3S3SA 3GSUB 4R83A 3SDYH 4BWWA 4F8QA 4G83A 2O5XL 1S9WB 4P05A 5AL0A 5AYUH 3Q3GA 2DM4A 2OXGB 1AQDB 4P0DA 5HVHC 1E8XA 1S7VB 4ZZKA 2L04A 4JQIL 3UTPD 5IFHH 2NZIA 1GY2A 2ORBH 4H25A 4A2MA 1JPTL 2K78A 1ZV5A 1DYZA 1F18A 5E9DE 4DGIH 5I1JL 5KSVB 4F2MA 4G80B 1I3VA 1XF4A 1JK8B 3U2IA 2EIBA 2W59A 1A8ZA 3TT3L 2XN1A 4WI2A 4HGWA 2WTRA 1N26A 3BH8A 3GC3A 3P9MB 4WFGE 3T0ED 5KSBF 1TLKA 4PYGA 5KJRH 1E9PB 2Z8VC 4RDQF 4ZQKA 1CLOL 3HMXA 5HBBA 1UD3A 4KKAC 1XSOA 4ANXA 4YSCA 4RDQG 5CJQL 2QFRA 3DLQR 2GSGB 2VH5L 4JGJA 4YHLL 4TTGA 4Z7QF 4EKXA 3STZA 4GUPB 2P5ED 1FE8L 2NY0C 3DHPA 1O0VA 2Z6FA 4MCNA 1BQLL 4TSAL 5KYWB 3JWOC 2VDNH 2COVD 1FYTD 4BKLA 3RVWD 3O4LD 1OSPH 5GRUH 4JPWH 2F08A 4J1UA 5F89A 1GS6X 3BFQG 4W9KC 4X4ZA 3BPOC 2Y06L 3ATDA 4QRQA 4XNXH 1S7SB 4J6RL 1VCBC 3LKPB 2JKIS 3OKKA 4M7KH 2ADGB 3SO3C 4NWUH 5EZIH 4U49A 5E94B 2VZ3A 3R4RA 4MXQC 1MW1A 2IDFA 5F9AC 1ECYA 1XIWD 5JYLA 4K07A 1A3LH 3HAEA 3TYFA 1T7XA 1FC1A 1IKOP 1G7LA 5DA4A 1P69B 2PP8A 2W0FA 3CHRA 3KXFA 4NYLB 3AU1A 3IMRA 2ZD0A 1NCBH 4Y2OB 4AL8H 3EYUL 1V3KA 3B4NA 4PJAE 3VGGA 5DLMH 5CCGE 3K81A 1FO0A 2W9DL 5LDUA 1T66C 2UZXA 1UWYA 4LSUL 1D7BA 5H35A 3BX7C 4Y5VA 1S7QA 1YVLA 3DMMD 3HG2A 2DLEA 1K4CB 3ARFA 4LSSL 5G5DA 3RJOA 1PG7L 1F00I 1QSEA 2Z35B 5CEZE 5K59E 4AM0B 1BQKA 1YAIA 1FZJB 2E8ZA 1CICD 3G04A 3GLZA 4Y4HC 2ZWKA 1N59A 2CJ3A 3CBKB 4OI8A 3IK2A 2KMWA 5FB8B 4WTZA 1BBDL 1YDPB 5IF0B 3SQBB 2VDNB 5T3ZH 1YUHB 4ZFFB 2ZYSA 3NCJL 3GBML 2JMRA 1V54B 3H2QA 3NJGA 3MLPA 3ZTEA 1JGEA 2G9KA 2JE8A 3QUZD 4ZMZA 1A6TB 4X6DF 1B9ZA 5J5EA 3HRZA 1EGJA 2WYHA 5B39G 5I30H 2Q86B 2QR0B 3EJYC 2E9WA 5FFGA 2D7OA 4X6CA 1FVDA 2E86A 3OD3A 4GKSB 1CF8H 4OLEA 4H8QA 1BZ9A 1DJSA 1A9BB 2XA8H 2OSXA 1BW8A 4LSTL 4I1RA 2PYFB 5KANI 1FH5H 1E2WA 3VMOA 5IIEA 5I23A 1A9VA 3IXTA 4KXCA 2XHNA 5I6NA 5EZLA 1D9KB 3AMLA 3HG0A 4OZFB 1FZKB 2Q5BA 3VWKB 1C9SA 4NX0A 3Q6GH 4NO0A 3LKOA 2BNQB 4NPYB 4DNLA 5IW3A 4JO5A 1VDGA 2WKLA 2VISA 1RFDH 4U6VH 1W72A 4JLRB 3VWKD 1IEAB 1HHGA 3GI9L 4MKMA 1YPZF 5EMYA 5E6RB 5CR1A 4OCNC 2WP3T 3UJIL 4DETA 1HHIA 3PGFH 5BV7C 2IPUK 2BOBA 2GI0A 2AK4A 3AQXA 5DD5H 3JWOH 2ED9A 4D8OA 3AB0C 1G7HA 3QCTH 3DJ9A 3F7PC 2GC4C 1MNNA 4M7ZC 4OD3L 1AQMA 1AZVA 2YZ8A 3BP6B 3DHUA 3FFCE 3FDWA 5IEHA 1J5OH 1CYGA 3DTDA 4KI5D 3NJKA 3CZUB 1JXDA 4RMBA 1NBVL 2HRPH 3RURA 3OPZH 3BZ4A 2QT6A 4F1ZA 2KDYA 4FJ6A 5KN5A 3SJVB 1HHKB 3QS2A 1QR4A 3HI1B 5A6MA 3LN9A 1XSJA 4Z23A 1ZHLA 4EN3B 3P0YL 5J6HA 4I18A 1TPXC 1H8LA 3IU3B 2D2CC 2RIKA 4U3SB 3GJEB 5HHOA 2CALA 1F6AA 4P59L 2FD6H 2H41A 5EF3A 2WN3A 4NBYB 3TNMB 3WFHA 2Y7MA 2QPSA 4A2DA 1CGSH 4FHKA 5FCSH 3F7YA 5CMAB 1Y6KR 5T33L 3ARGD 4JZJB 3PL6A 4RVBA 5D7JB 4EN3D 1JF6A 4R4BA 2DQUH 5DEFB 4YMPA 4QRRE 3F6LA 1F41A 1SJVA 3E3QC 3ZKND 3P9LA 1BVLA 4BSVA 3BD3A 3CX5K 3CNKA 5BRZD 5IROD 1JPST 3DX7A 4S11A 2VERA 1RUAH 3ZE0B 4NUQA 2QVFB 2VQ1B 3D33A 3Q43A 2IQ9H 4NRYB 2ALWA 4TQHA 5F7BA 2GTZA 4AUYA 2J20A 3DV4B 4E9XA 1I1CA 1L4IA 3RGVC 2RB8A 2XLLA 3O9WA 2B2XL 3ASOB 1FL6A 3UERA 2R4SL 4F3FA 1Q94B 1INDH 3UTSA 3RVUC 2XQYG 5JYMA 4ACTA 2VDQB 2FJUB 1A3RL 2CCVA 4KKCC 2FX7L 1VF5C 3RTQC 1P1ZB 4N8CH 1CIUA 4OW6A 1DJHA 1RZIA 4XPFL 5DI8B 3VAEA 2WSDA 1U2HA 4QTIH 1RUPH 4LBEB 3OKNB 4LSRL 2FHFA 1L6ZA 2ICCA 4IDJH 3WKNA 4Y1TA 1MKFA 2ICWB 2ZAIA 4F58L 1OQOA 3HZKA 1OO2A 4ETQA 3SDAC 3CDZA 1WC7B 4U1MB 2KC0A 1U3YA 1IJ9A 1JDCA 4Q9QH 4PJCE 3U36B 1DSFL 3V4PH 2ZUWA 1KGWA 4FXGC 3TVMC 4HLJA 4E42B 3AGVA 2VXVH 4JFZL 5E99H 5JHMA 3HE6C 3ZQWA 4M48H 4UI2A 2K4WA 1RZJC 3BZEA 3V8CA 3NIGE 2VMJA 4G59C 2X09A 5CILH 5LBSA 4AIZA 5I0WA 1H8NA 1SHXA 5LO7A 1DQKA 2OMVA 4BRVA 1ANUA 3O8XD 4AEEA 4L4TB 5ESQB 4R9HA 3MLVL 3N6YA 1KEMH 1LO2H 4R96B 2BWQA 1GZPB 3UG4A 1FZMA 4ZMXA 5I28A 3UJTH 1YCSA 4OD2A 1TNMA 1OM9A 3BQUA 3VWJA 1J8HE 4YHNA 4ZMTA 2AXFA 1FFNB 1OTSC 2UX7A 2R56H 4KJWC 4WFGD 1FGVL 4FL4B 5EU6B 2J73A 3DUSA 1HEZA 1N70A 1XB8A 2QQKH 4NQDA 4XNAA 4ZTPH 5B3JE 1CDHA 2ARJQ 4MSWB 4X2UA 4BZ2L 2KLSA 4LVNB 4ZFQA 1BAGA 3TBVB 5DMGC 1U92B 1N6UA 3VNYA 4TRPH 5T8IA 4IIQA 1PFCA 3U4BH 5KYUB 3AQDA 6PAZA 3QQXA 4OFVA 4HH8A 3BIKA 4WWNA 4Q9RL 2YN5A 3PWVB 4JX0A 4WFEE 3APFA 1ZHKA 5CGYD 4FABH 4PY7B 5AUMB 4MTMA 3MJ9A 3QJFA 2BMKB 4M62L 1PTZA 4WWID 4X9GA 4ELME 3JWNG 3QZPA 1JZDC 4QOKD 2YD4A 4NRXA 1NEPA 5B39A 1JWMA 4GRLB 2EABA 1DVXA 2P1YA 1RCYA 3B2VL 2Z4QA 3LRGA 1MIEH 2I26N 3G6JF 1HQRB 4PTTB 4WWKC 3SCMD 4EVNB 1INEL 2Y25A 1VIWA 3THMH 1P7QB 3WL9B 4HV8A 5IBTL 1KJ3L 1D6VL 3FU9A 4RFOH 3S6CA 1XR8A 2ODHA 3V4UL 5KTEH 4GRLD 1P7KA 1EV2E 4Y4FA 3C5JA 5AOLA 5GGQL 2WK2A 3GSRA 1HNFA 1QZNA 3KL3A 1NM9A 3GUFA 1BJ8A 1HOCA 4ODBD 4N22A 25C8H 4WK2B 3PJNA 5KUMA 4UQDA 4RGOL 3I2CH 3ZTJG 1A02N 1MFUA 3QDMB 5EZOL 5MEPA 2BNRA 3RL1A 1Z66A 3V6FB 2NXZD 2R0KL 2AEWA 3LJ3A 1S7XB 2F2HA 1L6XA 3VGHA 2PCFA 3U7YH 3SYOA 3AG2B 5EZJB 1TZGL 4NQCE 4XTRD 2DEYX 2XFXA 5I6KA 4AT6B 5MEOB 4FAAB 3VXPA 2XI9A 5TE7H 1ETZB 3LXBA 2XFGB 4G6KL 4F57H 2GBUA 4MMZA 1FNGB 5C07E 12E8H 3HN5A 4JGUA 3RKPA 4YS4A 5E8EA 4TLUA 2D3LA 5D1XC 4NNYB 4FQQA 4I7ZC 4OT1H 1K8IB 4ODXA 4I8DA 3T2OA 2EXWD 2RR3A 1UXSB 4DP7X 4OFQA 3TNNB 4K23H 4BWTA 3NYKA 4IOIA 4HIXH 1O7SA 3SGJA 5IVXA 4CN4A 4JAMB 4PRDB 2KZWA 4Y5XC 2EIZA 3FQWB 2EDFA 4AY0A 1XR9B 1XBDA 4FKEA 4HIHA 5FUZL 4YDJB 2YKLH 4WV1C 4DGWC 1ZLVH 1GJWA 1CE1H 3GIZH 3BXNB 3BP5A 3H9SB 1LWRA 1F1GA 3M7OA 3WFEH 4IGBA 1Q4NX 3N85L 5KYXA 3OR6B 3BPNC 3PFQA 4NQSB 5SX4I 5EWIL 3OZLA 1J05B 2XRAL 4G1MB 5D6CA 5J9PB 2HT3D 3CSYB 5SV3A 3T2NH 3NIDE 4MKTA 5K1NA 2VWEE 1GXEA 3H9SD 4CC0A 2P24A 4PRPE 2V2WB 5DK2B 3K0YA 1BAWA 4JHAL 4KAQL 1QFPA 2PPEA 2UZIL 3OG4B 5GSVB 2Y7SA 3VXNB 3LRKA 1RJYA 2FEDC 1HQ4A 2Q7NA 4ZS6D 4M02A 2CDGB 4X6FA 3MLWH 2YQ2A 4P5RA 5E51A 3D2UA 3NRPA 2Z31B 2E3VA 1GPOL 2NNXA 3D2TA 3QH3A 4GW1A 4JO2L 3B3IA 4NNPH 3QDJB 1AIFB 4UNUA 3IBEA 3RI5K 1ZD6A 2F58L 4R7DA 1OP5H 3P2DA 3VCLA 1K5NB 3WGVB 2EYSB 3NSYA 4ZAKD 2DV6A 5F7AA 1FJ1A 3UO8B 2Z31D 1E7VA 3B2XA 2EE3A 5IB4A 3QC5X 1XH3B 3EYSL 1S9XB 3UPCA 2GSMB 1DDHA 4P5TD 2V17L 1LQSR 3DXAA 2M2DA 1YN6B 1UZ6E 4Y8AA 3FO1B 5DF0A 2OMXA 4ELDA 3T4AA 3OC8A 1E65A 2PNDA 5C08B 3QNYB 3EJSA 2FX9L 1T1YA 1I1YA 3GSVB 2EXYC 3N41B 3VXRE 2X89A 4F7MA 3D39E 3I75A 4L9DA 4M6AA 2VAAB 5C0RH 3UBXA 1I1RA 3L1GA 5C08D 3DYPA 2A6KA 4I9WD 2PYEE 2IANA 3QQ3A 1JNHB 5DJ6A 3OZ9L 5TPWL 1JNLL 5DHYB 1EMTH 4QRRD 4HJGA 5I15H 2OJ1A 4OQTA 4DT2A 2G2RA 2KPWA 2IFGA 4Y4KA 4G8GB 5F0MB 3K91A 3VGFA 4ADJA 4DP2X 4WUKL 1FORH 1SY6A 1F4XL 4N1EA 4NB7A 1EO5A 3IGUA 1ACYL 1QUNB 2OZ4L 1TTFA 5IM7A 3P0VL 5ALBL 5E6SB 1E40A 3GKZA 4G9DB 2HG5A 2WC7A 1H6EA 2WINB 4LDLB 4NXKA 3GMRA 1NAMB 3U7WH 2LLGA 4LE8A 5DFWH 2XPZA 3WTSA 1NGYB 2P42B 4L3AA 3SE4A 3LKRB 1UQSA 4U6HB 1RIUL 2YGVA 4Y1AB 1KYOK 4KTDL 3HNVH 5JW5B 2EDDA 3O45A 4YDLB 2LR4A 3GSNB 2TAAA 2FWUA 1RPQA 4NNXB 3MV8B 2A6DA 4OLYH 3QIWA 4KZEH 5T5FL 3C2SA 2CO2A 5BO1H 4JGNA 2VL4A 2NMSA 4FI8A 4J3UA 5CEZL 2YD3A 2XXMB 4UDUB 2DMGA 3PWPB 1KYFA 2JJSA 3VFTA 5D5MF 3DECA 4YFLF 1BV8A 4CC4C 1UD5A 4PBVC 3MV8D 2WVUA 4Z3TA 5I1IH 3LIZH 1B4TA 1RZGB 2BY2A 2WYZA 2F7PA 1TTGA 2CU9A 3O2DL 5AW0B 4A6YH 3X12B 3LN5A 3CSGA 2AEOA 5F8RC 3PWPD 4H8PA 4RDBA 2E7LC 2BW5A 1UD2A 4JM0A 1B0GB 5JXAH 2P8LA 4JHWL 1AYOA 4B60A 5JIDA 1SOXA 3N1QC 4UOJA 4CAGA 4F9PC 3GM0A 4FQJH 2MTPA 1OM3H 2WZAA 5IG7B 3TPKA 3FJTA 5IMLA 4OJAA 4FKHA 4YLBA 4UAOC 5JTWA 1MJ8H 2UY7A 5IK3A 3DX6B 4BFKA 5MHSE 1N0LB 3PAZA 5F8QC 2NY2C 4FQ1H 5I75B 3EJTA 2YKKA 4KVCH 3TIEA 1UZ8B 3T09A 3KXFE 3U2SA 4QLRA 2J2ZA 1YUKB 1RERA 1TQCB 4D8PB 3NP3A 1WFOA 2E5EA 4F7CB 4PJEF 3BYTA 4BGDA 4OUUA 2PKDA 3DPBB 4QF1A 2VLRE 2FWOB 1U3JA 2JJVA 3L16A 4R4FL 4FG2A 5IVZA 4J2QA 2F19L 5T1KB 3O3AB 4HUWB 2ZCLL 3FS9A 4HPYH 4LNVA 2JIXB 4ONGL 3QEGL 3GXUB 1SVZA 3QB7C 4RNRB 5FV2A 4UT6H 3QFGA 3L3DB 3QFJE 2J5LC 1C7SA 4GS7B 4U1NB 4XGZA 1ZA6A 1KPUA 4LF3A 4WNQB 4IHOB 3GBNH 4QXVA 1N5YH 2PWFA 5PAZA 1SOQA 4MNHB 2W9EH 4PJHE 2GTQA 3QZWB 3K0WA 5KVEH 3HG5A 2OMWB 3AABA 1NL0H 2ZSWB 1K4DB 4GUOA 4HOMA 1YEDB 2OCFD 4JRYB 1P6FA 2AZAA 3QZOA 3CJJA 1W8NA 1E28B 5BQ7B 5IFJB 1RI8A 4YHYC 4WTWA 3S0PA 4IYKA 1JV5A 4OCRH 5HYSG 2FEJA 3A21A 3QZBA 1JZ5A 4J4PA 3FO2A 4OF0A 4QJ4B 2PO6B 3GSQB 4YX2L 1GJUA 1YYLL 2APWA 3D18B 4NQCD 1U3NA 4JRYD 4XP4H 5D71H 4PHXA 5IMMA 3D85A 1QRKA 3C8DA 4KJYA 1G94A 2KL6A 3TP4A 3LZPA 5FDYA 5DD6B 3ZRFC 3ZOAA 4WCYL 1ZHBB 2N7SA 4KZDH 5EIIA 3KWXA 3DI3B 4Z7WF 1AS6A 1TMCB 5ETUA 4FFZA 4WQOA 1BQHG 5AEAA 4F20A 2C1OA 4G8AC 3K6FA 1MWAB 2HUEA 1MCKA 4ZDHB 2OW7A 3P77B 3OL2A 3V6OA 3G5VB 3ZDZF 3Q1EA 2NY3D 3DSNA 1Z3GH 2GIMA 4XAKD 5FYLE 4G7RB 1J87A 4JREC 5AL8A 1H3TA 4JKWA 1S78C 1WS7A 1CLYL 4YO0B 2R0ZH 3LMJL 3I74A 2XUWA 1NMAL 4PGZA 2O72A 2BVYA 4AV5A 4EIUA 4U3CA 3CFEB 2AK4E 4PB9H 3MXWL 4A7QA 3UIZA 2B1AH 2CKBA 3EJJX 3P4MB 3NFNA 4G5AA 5DRXA 3OKLA 4AM0Q 1EUUA 3IVKA 4YDKL 2F9BT 4TVPH 1CD1A 2EZ0C 1DN2A 5F3HA 1YMMD 5DQDH 1FFTB 1GKEA 5C7XH 3ZSSA 2W5PA 3VJ6B 4NCC2 1QSVA 4GB9A 4MAYD 4PRPD 1UWXK 1XXDC 5BCAA 3UABA 1YJDL 4Z7VF 5DC9B 2AJVL 4GJTB 5D96B 4F8PA 2CLZA 4GSDL 3V0WH 4X0NA 4YE4L 4XBGB 2FIKB 2HPTA 4JFPA 1DEEB 5JHDE 1MVFA 3TO2A 4HKJA 3V4VA 3DOIA 5ACZB 4X4ME 1LO3H 1S2EA 4FXKB 1MRCL 4L0YA 5HGDA 1NGQH 5HHOE 5FKAA 3SBRA 3HLAB 3O4OC 2DMBA 3IJ7A 3PWLB 4XNQA 1S3KH 5IVNA 1MCIA 4XI5D 4RMUA 4EUPG 4JW3A 1FG2B 3M1BA 4EPSA 4D0DB 1P5UA 1R19A 3P11H 3WJJC 3HVNA 3OJDA 3EG9B 3GMPB 4KY2A 5IMOB 4U6TA 3X11B 1E4XH 2G3XA 3KPQB 3LKSB 4UT9A 1J9RA 2ARJA 3ARDA 4ZI8A 1CXEA 2DYRB 4XWGL 5C0ND 1P4LB 1KIRB 5I66A 3S88L 4E5XG 2X0UA 1HKLH 5FKPB 1PY4A 3QUML 5C09B 4XNDA 4A7UA 5IB2B 5C3IA 1QFUH 3I9GL 1IAKA 2WLIA 3QCVH 5FK9B 1T83A 2YQBA 3QK0A 3JV6B 4NUMA 1IIIA 4XXWA 3M07A 3AG3B 4ZUTB 2OW6A 1JGDA 1JG9A 1PSKH 3PJLA 1ZTXE 2GY5A 4GPVA 3I6GA 4R2GB 3GMOB 5GGRB 1FFOB 3ELAT 1IBFA 1CMOA 3PQYB 5I8CA 2OQJB 5F1IB 1TU2A 2WCSA 4QHMA 5KVFH 5J1TC 4WF7A 1W0VB 2PXYA 2WLZA 3SE9H 2QPUA 5A2FA 1DVTA 5K93A 1LYQA 3VDBA 5EO0A 3Q1SH 2O6FA 2BK8A 3BKJL 4M7JL 3I9IA 4R2GD 5DK0A 4A2GA 2FWLB 2X6AA 3DSFH 4OJCA 4BQ8A 3BGFB 5TDPB 3CFDA 2YUXA 2AQSA 4KHTL 2L7QA 5HYQB 3VXSB 2CJTA 1KPRA 2ZCKL 3HS8A 3WJLA 5D93B 2XZCH 1EEZA 3DDGA 1AZZC 3SGDI 2AXWA 4F7PA 2Q7YA 2CR3A 3CVHA 1JXKA 4WEMB 5FO8B 1OAUH 2XPGA 3U7AA 3SKNA 2A77L 2BNUB 2VRAA 4K2UH 4PQXA 4QTHA 1IL1B 1U3HB 4MNGA 4TTDD 1IC4L 3T0AA 1G6RA 1WV7T 4M43H 1NCOA 2VW7A 4JY5L 2EACA 3VFPA 1KZYA 1JRHI 5CEXB 4OSUH 1IM9D 1U3HD 3FCSA 3WUWB 4B9KC 1I85A 4HS8H 5HYJD 4XP6H 4NN5C 2EC9U 4PJ5A 3MKKA 2Z34A 3VI4F 2ESVE 5GISL 1FH2A 2P26A 3WDIA 3A5VA 3IMWA 5C2BH 2VDOB 2GJZB 3R0NA 5EDXA 3TZVC 5B7MA 3O3EA 5I5RA 4HMCA 4WENB 4YSQA 4HUCA 2VRQA 5AD0A 5I19L 2HVJB 2ROYA 4X4YA 3CZEA 4QHLB 2R83A 5HDLA 4TYUA 3MNVA 4DVRH 4KNQA 4YL4A 1KBPA 1DBJH 3RB7A 3WELA 4RBPK 3K72A 4FQPA 2B14A 5F0LB 4DN3L 5AW8B 1HI6A 3TOPA 4U1SA 3LNFA 3QORC 1PKQE 4N4YB 2ISDA 1UJ3B 2D3JA 5ADOH 2BXYA 4FFTA 5K9QG 1MOEA 3BP7A 4FD0A 1ZANL 4DOHE 3MRPB 1AKJA 3TA3D 2IH3A 4K55A 2VXUH 2BS8A 3ULVE 2BJML 1CG9A 3E2HC 4OZHE 4IRZH 4O2EA 1M57B 1X6LA 5JHLL 1Q0XH 5DUBA 5AVYB 1RV6X 4ZXBC 1RUKL 5DK3A 5DJYB 3WFZA 1BQUA 2F18A 4U3XA 3WV0A 5DMIH 1H3WM 4P23A 3O6MH 1I7ZB 4Y2DC 5HDQL 3CZJA 4ODUA 4XB3A 1AGDA 1D5MA 2R1XB 3CBRA 4I0PA 1C08B 2WWKO 3FRPB 3WFCH 1YA5A 4NHCL 3WJMB 1LNUB 1PX4A 4DEUA 1RSFA 4ZPVA 2Y24A 2E76C 5GGSB 2BNRE 3ZKMC 3I50L 2RAMA 1M1XB 4W6YB 2CUHA 3QJUB 3BWZA 1E4WL 4OCSH 3OWEA 3RU8H 4CNIB 2DDQH 3E6FB 4N2KA 5FO2A 1XEUA 5D7IF 1HXYA 4Z78A 2VDKH 4UILH 4G70B 3QDHA 3ZO9A 3OHXC 2A73B 1EFQA 4F2EA 5IB1A 3QEHB 2CQVA 1QVOA 1I3RA 2CR6A 2WWOA 4WFHE 3MCLL 1C1EL 3RZCC 1UA6H 3OHMB 4JO8A 4IM8A 4NOBA 4XZUA 4AQ8C 3RILA 4RAUB 3RPBA 2OK0H 4PS3A 4RETB 3CDGA 1YY8B 1LTXA 3VUAA 1FUNA 3WY4A 1E6JH 2AKRA 4URTB 2K6WA 4WJG3 5F0JB 1MREH 3U0TB 5IVXE 4OZIE 1W16A 2CIKA 3NABL 4NP4H 5BZZA 4EBQH 5CXPA 2D3NA 3DGDA 1NKGA 3MBWA 2ZX9A 4HQQL 2H1XA 3RWEA 2O5XH 3QPXL 2QSCL 3HFML 5EA0L 2C3VA 3TFBA 4PCKA 3TBYA 2GTWB 1CJYA 3OKOA 2WLLB 1IGFL 2AVGA 4XMPL 3ARYA 4RISH 3VXUD 3WOVA 4I2XB 1JPTH 2BZDA 2GHZA 3C12A 1PYWA 2WNXA 4CBPA 4LAJH 1VPOL 4WLCA 1DLHA 4CSTA 2UXTA 3TT3H 1I1AA 5ICXA 1URIA 1UASA 1HHHA 3VB8A 4HJ0D 2JV6A 3ESOA 3FB6B 3B2DC 5D1ZD 1QBML 5FYLD 2VH5H 3MU3A 4YHLH 4H0IA 5D4HA 5F7DA 2XKNA 5JMOC 1EAQA 4FI7A 4PYHA 2OX5B 1FE8H 1IAIL 5DFVC 1BQLH 2VDKB 3FN0L 1ASOA 2QADB 3C8KA 2HJFB 3B6SB 1TJHL 4KJQD 2ZKHH 1G0YR 3T8MA 1X9UA 2Z92B 5HI5D 3UBFA 4KKZA 3APCA 2YRPA 3FAWA 4TSCL 1HINL 1A7OL 1I1FA 1OXYA 4J6RH 5DTFB 5IESL 5IB5A 1HAWA 3MYZA 1KG0B 4ZUUA 3PNWB 4MA3B 4AV0A 4FTVD 2FWSA 2M8XA 2CBTA 3C9NB 1NINA 4LPWA 4MMXA 5FA3B 1QLEB 3EIFA 3CN2A 4OZ4A 5C0IA 3EFFB 4Y16B 3T0EC 3BSZH 3ISRA 2BP8B 4KI5F 4I85A 3RKDC 2CRMA 1IGYB 1PAMA 2D73A 2Y6SD 2ZYIA 4YHIA 5E00B 1QW9A 1DVFD 1F4WL 2F8XC 1MPAH 2W0LA 2X4UB 4D3CL 4JM2A 4NWTL 2YD2A 4PWHA 4B97A 4Y16D 1YEIL 2MQCA 1TJXA 1OSZA 3FT4A 5E4EB 3JUZA 1DL7L 1MI5B 5JPNA 5EU7E 3T65A 2QKSA 1Z0NA 3CH1B 4QDGA 5A2KH 2CSPA 1A64A 3F7VA 4LSSH 4RMRA 3QJRB 4XH2B 5DYOB 1PG7H 5EORL 3RVWC 4HKBB 3LS5H 3HN8A 1TR7A 4UU9B 2VXQA 4RMWA 2NDGA 3B34A 3CZLA 4YE0A 5CLXA 4X6EA 1AYRA 4P46A 1R5IA 4XPTL 1HH6B 1GIGL 2BINA 5I5IA 1UFUA 2EE2A 3LEXA 3GLDA 3RWJA 1XIWC 3QHZH 2IFFL 3OR7A 4DCQA 2Q76A 3KLQA 2IF7A 5B3SB 1JWSB 1M53A 3GBMH 4XN1A 5K1VA 4OQ1A 4B3EA 3AU0A 1LO4L 5J4MA 4H7VA 2AV7B 5A7BA 4Q9BA 5HSFA 1Q9OA 4HHGA 3B2UD 4V33A 4U1IB 1HXMA 1YMHA 4HD5A 3BKYL 4HWZA 2W88A 1F3DH 1AD9A 3TPUA 1RVFH 2P5WA 2FUQA 3ZE0F 4JFDA 1MCSA 3IPEA 1DSYA 1WAAA 2LVCA 1TJGH 3B7YA 1M7DB 2YAEA 4LSTH 3DMMC 1IU1A 3UMNA 1OP4A 4LEXL 1YNTF 4NQEB 3UADA 3KYOA 5FGBA 2X4QB 5ABDE 3P9MA 1D2PA 1QFWL 5EEYA 1CICC 1E9PA 1PLCA 2E4TA 5F9JB 4M4RA 1ESOA 1ZE3C 2ZX6A 1U2YA 3QUGA 3HZVA 1XCXA 4O58L 3P73B 3M17B 4LMQE 2WQXA 5E1QA 3HJEA 3FYIB 3LRSB 4L8SB 2H47C 1C5CL 3DOSB 4XNZC 3ZHNA 3L5WB 3POCA 4U3HA 3BE1L 3ZDXB 4RA0C 4W70A 3JXAA 4DGVL 5ABAA 3QUZC 1ZK5A 4YHPA 5LG6A 5C0DB 4YBLC 2XWZA 2QBWA 3GI9H 1HDMB 5HGBB 2AQRA 4MXVF 4R8WL 2M83A 4YWGH 4D2NA 4GT0A 2E46A 3KYKL 3UJIH 2AXJA 1U8CA 4NUGL 1N9PA 4GKZB 2A6IB 1TNNA 4RZCA 1AE6L 1HT6A 1MW0A 1BXUA 1WZ1H 4MS6A 2E7MA 2ESVD 2K9UA 5JPMC 4JJ5B 3UCQA 5ENWA 4OD3H 3MKGA 5EF2A 3AM8C 2JKWA 3ZZQA 5B4MC 4XMZA 3V52H 2DQDH 1RL1A 4B0MB 4WU7A 1H3XA 1NBVH 3IDXL 3RUGE 2GUOB 3ZN6A 4LHUB 5EUKB 3FUFA 1OIOA 4O2FA 4LRIA 1N2RB 3LN4A 5CGTA 3CH8A 3S3BB 4K5OA 4CVZB 5JR1L 1JWUA 1U3ZA 4HIJB 1N67A 2F7RA 2YMTA 2D4DA 3P0YH 5AOKA 4JM4L 3DOHA 3W3BA 3FXIC 2ZIDA 4P59H 3EGDA 4NZDA 4JPIB 1PIFA 2R1WA 2XT1B 3M46A 1G7JA 4JDZA 3RB5A 5FYLL 2B20A 3RWIB 1ZRUA 1M6UA 4QHPA 5T33H 1KBWA 2E4FA 2H2PD 3GS4A 1P2CB 3KEDA 4X9YA 3DV6A 5D70L 4IBYA 4HUVB 5HHME 5DMKB 1SN2A 2OTWB 1IC0A 1UT9A 2LW3A 2QKIA 3FB7B 3FT1A 2DRUA 3CHQA 4I48B 1ASQA 5KZCB 1IEHA 1SRDA 5IFAL 3K74B 5FYJE 1DQML 1AG6A 3M8OL 3GLAA 4NXSA 2O5ZL 1BOGB 3NCWA 1YN7A 3FHEA 1N7ML 1PNDA 5EOQL 4Y5YB 4ABUA 1PLAA 1QNIA 2B2XH 1LO5B 4OIIL 1NANI 2HN7A 3PUUA 2R4SH 2XVLA 1ZJAA 3U4EA 1VACB 5DA0B 4P3CL 5FM5O 2FX7H 4HZLA 4M1GL 4Z7UB 1OD9A 1KCSH 4GQ9L 2WVVA 2DQFA 3MNZB 4NN6C 3VDAA 4XPFH 3WEAA 4UIMA 3PFUA 1E5ZA 4MD0B 5HDBE 3JTSB 4MAUH 2XN9A 3ARGC 3LQMA 4XXDA 3P4NA 2BVQA 3BWUF 1MFNA 2W91A 5HHNB 4JG1L 3ULAB 5I1KH 1KPVA 1JPFB 1OTTD 1DO5A 3VD2A 3BVDB 3QYMA 1MJ7H 3KLKA 3MUZ1 2UWEE 1O9VA 4K8RD 2WQ8A 3T4YB 5IROC 3IFPB 4PAZA 4TV3A 1KYAA 2OMZB 3KPMB 3VH8B 1DVUA 3ERXA 4JZJC 4JFZH 1E42A 4XMWA 3L3JB 5SWQA 1ZE3H 4LDEB 3AXLA 3ZYJA 2DS4A 1DQQA 5ILTL 4KKPA 4PGBA 1NGXA 2WLKA 1PS3A 3ULSA 4Z95L 3GZPA 2VMDA 4P06A 4W68A 1SXCA 4R84A 2RQ8A 1X5LA 2X6BA 1YLBB 5AFAA 4WTXA 5TDOB 4JCWA 3MLVH 2FO1A 2JCCB 1IE4A 2DIAA 1LDPH 1CYWA 2UYLB 3U6XA 4ORZC 3F01A 4PS4L 4PJFF 2MSPA 3QXTA 2A1WL 3QIBD 2DMCA 1EAOA 2YXVA 2Y5EA 2E8YA 3QAQA 1HHKA 3ZT5A 3TBSB 3P2TA 3QRLA 4OH2A 4NI6A 4C56B 2WXQA 1JV2B 4HHAB 4N8PA 1L7TL 3C5ZC 4HETA 4LLMB 4HHWA 3CZFB 3IU3A 4IHBA 2B7DT 3TL5A 4X7DC 1BHGA 2VABB 3BFWA 3WE6A 4OBSA 4BFBD 4M62H 1OK8A 2ITEA 1QKZH 3W5MA 1SJHB 5EU5A 3US1A 1U8MA 1U8NA 2CG9X 3OC5A 1KN4L 5J12C 3O8XC 5LDSA 3S8WA 1BOYA 3CLFL 2ZXGA 3KZ8A 2BVOA 2HKAA 4K5MA 1MFDL 4OAWB 1NCUA 1UGKA 5J7CC 3IDYB 4NC1C 4L9LB 2C9XA 1INEH 1O7VA 1L7IH 1KJ3H 1D6VH 3DRQB 5TJWK 3V4UH 1X5JA 2EDQA 1UENA 3GXNA 1L3NA 2FQGA 3ZU8A 2O6DA 4B9JA 4Z0XA 4XN8A 5TE4L 8PAZA 4R7LA 5KVGE 3ARTA 4PJ6A 4ABWA 3QVAA 1A1NA 1DBBL 4HIPA 4BH7B 1U8KB 3KM2A 2NCMA 5LXGL 1IM3D 1VLXA 4IOSA 5EZOH 3EO1B 1HCVA 3NIFE 4LLVA 2W07B 4FLRA 3GM8A 5E2UH 2R0KH 4FNSA 4MB3A 1RH8A 3KR3L 4U6XB 4QHKI 1A21A 4XX1G 5CGYC 3DX3A 3WKML 2ERJC 4NCDA 1TZGH 4TNEA 3QUXB 1H0DB 4TM9A 3FONB 4K3EL 4Y9CA 4G6KH 2ADYA 1OE1A 3FB5A 2GFBB 4HXBH 3N41F 3FSVA 2ZE0A 1NCIA 2R23B 2ZPKL 1OCRB 2YPLB 2V5RA 5ID0A 2GY7B 1NBYB 2VTFA 3B43A 3FSOA 3QUXD 4MA8H 3SCMC 5EV7A 4L8CA 3H53A 3AS2A 1NIAA 2ZICA 4KO7A 3SD2A 4BFOA 3ARBB 4GY4A 3TGXA 3QHTC 5HTSA 2FJHB 5IQMA 3N40F 4PJ7A 1INQA 3ESVF 3KPPA 3PXHA 1CFQA 4XN9A 3TESA 2XTJE 4LLYA 5T1LA 3WIAA 1ZXQA 4FS0A 2FIRT 4L29B 4L3EB 4OI9A 5HHXL 1E43A 1L5GB 4B5EA 1E27B 1XGTB 2ITCB 2V7NB 3NH7L 2QELA 3L4UA 4LKXB 1GZPA 5E08L 3KL5A 2HPOA 2NXZC 3N85H 1MZYA 5EZPA 3IJSB 2P43B 3ILQD 5EWIH 1P1VA 4Y4HA 2XRAH 3MRDA 4XTRC 2FYVA 4CSSA 1VAHA 4LLDB 2XYBA 2SODB 1PLGH 3HPJA 4R0LC 3MR9A 3CFKB 4JFFA 3SE6A 2WB1A 4OKVB 1JS4A 1OOWA 2ZKYA 5B38B 3MV9D 4XC3L 1KELL 1A5FL 2LLNA 2XQBL 1FNEA 4JHAH 1KUMA 3WNKA 1N10A 2HXAA 3R18A 3K1KC 4PRAB 3HC3L 1ZS8B 3B7TA 3POHA 2EDKA 5F1OB 1MDAA 1ZPUA 4DP4X 2XCMC 2FX8L 5I16A 3NTCL 2R0WL 4PY7A 3BFOA 1I3GH 3FT3A 4E9QA 4ZFGH 1GPOH 2XBTA 1BMWA 5BZDB 4UM9A 3LOWA 3S5LA 3O2VL 4GSXA 4IU3B 2G5BB 5EUOE 1BYNA 1QQDB 5D7KD 2XBZA 3V4PA 1CFSA 4W4OC 2IDUA 1MEXL 1I7UA 4PFEA 1EJFA 1LQBC 3TV3L 4S2SB 3VXMD 3Q05A 1JMXA 2R2HA 1PAZA 4YDMA 4Q74A 5L8JB 2X9ZA 5DEJA 3ES6A 3RWGB 2EECA 2IH1B 3UBXI 2A83A 4XVTL 4LP8A 1O9ZA 4MA1C 3OM3B 4R90H 5LGHL 1QI3A 2CGYA 3CGTA 4GSUA 2IWEA 5E6YA 4E41B 3QDMA 4OZGA 4UIKL 2E9IA 4MWFB 4PGJA 2V2TA 1G7PB 4JO4L 3ZYIA 3FMGL 1YYML 2IADA 3D5OF 3CX2A 4TQEL 2KZ1B 4PJ9D 4BFEA 3S96B 3S35L 3FH7A 3FUIA 4MNQB 4PJDA 5TPWH 4RFNB 1JNLH 4AGMA 3MLXL 5GGVH 1AXTL 4JB9L 2FQFA 2G2NA 3KPRB 3L5XH 3MGOA 4JDEB 4NDMA 4PV1C 5HHMD 2MCMA 2APVA 3PCYA 1QRNA 3MRBA 2VGLM 4UB0L 4ZAKC 3U9PH 3W56A 3MJ7A 4G8IB 4WHYH 3UPRA 2Z31C 4AYMC 1HJBC 1L6PA 1WEJL 5KS9E 3T3ME 2XG4A 1TSHA 2OV0A 1R5VA 1UXSA 3OAYH 4XCCH 1VSCA 4Y19A 4AYFB 2AERT 4WUKH 3KBHE 3QPKA 4P5TC 3KPRD 1F4XH 2DI7A 1O7DE 3QULB 1U8HA 1ACYH 2CO7A 2OZ4H 4Z7NF 1HZHL 3MRMB 4P4KD 5AW4B 5ALBH 4TLTA 3B8YA 1NCDL 2DJMA 2QGDA 2I07A 2OSLB 3DX1A 1JHLL 3GB7B 4DVBB 5IHUL 1ZPLA 2NW3B 3AS3A 3GDBA 2EEXA 3BXNA 4DQOL 2ZAHA 5I8EB 1BP3B 1GL4B 2H26B 4N2CA 4U4BA 2H0FA 1RIUH 2FBRA 4KTDH 3BP4B 4IBLT 3CZKA 3DVGA 4P2RA 1BIIA 5CBAA 3PAUA 3FFDB 4TUKL 3VRLE 3VVWA 4D9RE 5T5FH 2X5PA 5E9DB 3BH9B 4HOZA 5GQBA 1CE6B 3JZ7A 3EH3B 5E1IA 3CU1A 5DK2A 2YGNA 5E56A 2CHDA 4IKLA 1WITA 5CEZH 3L3HB 1QLRB 4JFXA 3N1GC 2DD8H 4UDTB 1U58A 3RLSA 5K9JL 2X40A 3RGVA 4NKMB 3DX2A 4ORGA 3EGSB 2LFGA 4J12A 1IBGH 1C5DB 3HEIB 2VO8A 2WCPA 1M71B 4DPRA 4QRUA 2X4TA 1G6VK 1GVIA 5E03A 1TTRA 3NCMA 4JHWH 1RXLA 3RTQA 5AVTB 2A74C 4N0FB 2HFTA 1ZLWH 1PW3A 1ROWA 3FT2B 2H45A 2NQ3A 4EZKA 1QSFA 2COQA 2BS9A 4G3YL 1YJDC 1JGLH 4LLUB 3RX8A 3C60C 4O5LL 2DQJH 2Z65C 4EN2A 2AV1A 4Y7OC 4S1QL 4LCWA 1MCLA 3SDAA 1REIA 2O4EA 3RFZB 1X7QB 4XCYB 1ZGLB 4S1DD 1NCCL 4YSDA 2CKNA 4LEEA 3PAYA 1DVQA 4FXGA 5FYJU 1B3JA 5DS8A 3TVMA 5DDHA 3FO1A 3N43B 3D0LA 2E75C 4TNVF 1CVRA 4ZOEA 3HE6A 4YDLC 2KLRA 1H5BC 4NSKB 4N8VB 4L0PB 1TYJA 3IJHB 3IN0A 3NJXA 2NDFA 4PJAB 1Z9MA 2I5YL 2XWTB 4AQAB 4MCMA 2QVTA 4WO4B 5F1NA 4F93B 4R4FH 3T6QC 2F19H 4HJIA 1G9ML 2ZCLH 5CZRA 3LPFA 4X5WB 2EH8H 2FNBA 3KH3A 1I8AA 1KTRL 3QEGH 3VXTB 1BX2A 1IC1A 3QI9B 1KENL 3G5ZB 4W9CC 4K4KA 1EA9C 3TYGL 1DBKH 5HI4D 4IIZA 4YDIL 2R2BB 1VRSA 1X4XA 5DVMA 3QFDB 5IW1B 1CR9L 3CFCL 3WNPA 1QUNA 2CXGA 3VI3E 1CFVH 3UZQB 1IRAY 3OKYA 3BUIA 1U42A 2OI9B 1Z5HA 4XBEH 5JOEA 2X38A 1CWVA 3CVCA 1QWUA 3WIHL 2VN5A 1NQBA 2EJ1A 3ECWA 3RNQA 5I1EL 4JFDE 1ES0B 2CDEB 3UTTA 2H1PL 1WAAE 3E7JA 2VDLH 4JPVL 2CLVA 1WA1X 3KWTA 4YX2H 5IZ7A 1YYLH 3IMBA 2FZ3B 1XGUB 4PJGE 4HPHA 2ZOTA 4QT5A 4A2FA 2NTFB 3UTQA 3LPOA 4KUCD 2JFCA 3FUDA 1P5VA 3FZUC 1QPPA 1WIUA 3VFUB 3JQOB 1IVLA 4GRWE 1WBYA 3CFIC 1YEFL 5INCB 2AQTA 4OCWH 4N6RB 3U0WL 3MGTB 5JIKA 3H7BB 3ZL4L 1AO7A 5IMKB 3EJZC 1A4AA 1MHPH 1RAMA 1RZGA 2D31A 4LU5H 1UWXH 1G7MA