2DQDL

Crystal structure of hyhel-10 fv mutant (hy50f) complexed with hen egg lysozyme
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
107
structure length
107
Chain Sequence
DIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/hydrolase
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title Structural consequences of mutations in interfacial Tyr residues of a protein antigen-antibody complex. The case of HyHEL-10-HEL
pubmed doi rcsb
source organism Mus musculus
total genus 23
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dqdL00
1ZT1B 1M1SA 1K9TA 1KJ2H 3BD5A 3SEPA 3TBWA 4HWUA 5KSAC 2P45B 3LSOB 5J1TC 3KPNB 3HG1D 1FGVH 2YUVA 2R56H 4M6NL 1NDMA 5E6IB 2EXWD 4D9RE 1ZHLA 4Q0XL 5F7DB 4FXLA 4U7MA 3B3IB 3MUHL 3LB6C 2ZJSH 1Q9WA 3FAXA 3T0EB 3WLBA 1J8HB 2W0PA 4XBGB 5CZVH 4DAGL 5C71A 3DRTB 3F62A 4ZQKA 4QXWA 5J3HD 4Z7UF 3QIBB 4S1SH 4IRJA 5DYOB 1MH5B 3G5ZA 3X13A 5GJTH 4G9DB 2ILLA 2BVQA 1FNGA 5KTEH 4D0BA 3OZ9L 2J8HA 4HUWB 2A1WL 1OQOA 4XNXH 3OJDA 5GRXG 3VFOA 3LS5H 1OARH 5J11C 1UXWA 1VFUA 3FB7B 1QA9B 2AQ3A 2WINA 1BLNA 3NH7L 2HN7A 1UENA 4P49A 4PLOB 2YD1A 1GH7A 5EUOB 1UWEL 4RAHA 1GIGH 4UINL 4G6KH 3EZ8A 4ONFL 5IMLB 3QUMH 1LK2A 4HK3N 2Y23A 3HC3L 5DHVB 3I2CL 4N1HB 2Q3AA 1L9NA 4YC2B 5F9JA 3NIDF 2YA0A 5FUCC 1AGBA 3MMEA 4QHUA 4GRWH 2WWMC 5DQJA 3MROB 5T5FL 4FS0A 2VXUL 4JY4A 3BRDA 3NFNB 1WIPA 3H7BB 3CU1A 1WT5C 4F7MA 4FQ1L 3MR9B 4EQ2A 2BMKB 4H26B 1OAXL 2D7TH 3PWJB 4LSPL 5KAQF 2NR6D 3WLWC 2GJ6E 3S3SA 4FFVC 3WSQH 3PXHA 3O11A 3U9PL 4AT6A 3Q6GH 5IWLA 1MLBB 1Q9OA 5JORA 3FQUB 4RMSA 4JR9L 4H20L 4LVOC 1D5BB 1BVZA 2VABB 5SWQA 5K9QG 3QEQA 1KN4L 2HH0H 1W0VA 1MCSA 2NY0D 4LCIL 1FZMA 1MIML 1ORSA 1N6QL 3M8OL 5I9QB 4FQQB 4LSTL 2NY7H 3OJMB 3OPZL 4D94A 3CXDH 3JSSA 1KTDB 1VFBB 4GMSH 4NQSB 2BY3A 4X4XA 1RJYB 2XQBH 2L4OA 4NCDA 5KSAA 4XPBH 3RKDD 3GB7B 1YC7A 1SJXA 5CEYB 5DWUH 1EFQA 4XP1H 2CUIA 1R3KB 2AXFA 4OZIF 1EFXD 1E28B 2PCPA 4X98B 4GUPB 2ZPKL 4WFED 4F7PB 1WGOA 3PIQA 4K23L 5E9DD 3BIKA 3GO1L 5IHUL 4P2YA 4PP1C 5IBTH 1WUNT 2PR4H 1G9MC 3KPSB 3O9WD 2X42A 2ZUWA 3WUWG 4X5WB 4LK4A 1OCWH 3VXUB 1MWAB 2YRLA 4EDWH 4OFPA 3WIHH 3HLAA 4HV8B 4OLUH 3EHBC 4MZ3A 4E41D 1QRKA 1MHPL 1G9ML 4X9BA 4IHOA 3AUVA 2XKNB 4D8PA 5HDQH 5F44A 2VTFA 1U42A 1MCEA 5A1AA 4AG4L 1DQML 2XWTA 4G8GD 1NGWA 1PW3A 3GRWL 1QLEH 5BV7B 2V17L 3D87B 1JK8A 2P7TA 3EJZC 4J6RH 3HE7C 5INDB 2A9NL 3WUZA 4M6ML 4X7FC 4AJ0A 3MLUH 5F1IB 4HH8A 3HAEH 1OAZL 2P5WA 5EU4A 3RY6C 4RRPG 4AH2A 1E4XL 5CP7B 5BVJA 3GSOB 1NSNH 2J8UB 5F8RC 5EWIL 3AXLB 4IJ3C 2Y6SD 1ZEAL 2HKHL 5CKAA 1OD7A 1Q38A 2UZYB 3TA3B 2DQHL 3TJEH 1YYML 4GSDH 2BXYA 4GKZB 1WT5A 4XXDA 2IWGA 3GBNL 3BGMA 3QCTH 4MCYA 3T77B 4CRPA 5SWSA 3G9AB 3Q48A 4DVRL 3QUKA 4JVWA 4P5TD 1KCLA 1I1AC 2ICES 4XC3L 1FNSL 1AGEA 1I7ZB 3Q6FA 2VLMD 4NGHL 1JE6A 3E6FA 1CG9A 3MV7B 5IW1B 3OXRB 2B4CL 4Z0BL 5EBLB 3CU7A 4MXVF 4FXGA 4GW4B 3P4MB 2XQYK 3JTSB 3BPOC 3O4OB 1XR9A 5LGJA 2NNAB 4NC0B 5ETUB 1AR1C 3PV7A 4QRPB 2OMNA 2P24B 4JRWA 4DGYL 3FFCB 3LKQA 2Y36L 1CDIA 1MFCL 3DX8A 4K3EH 5C09E 1QBLH 1TZGL 4V1DB 3RWCA 4F2MB 1NH6A 4XI5C 5EU6B 1UCBH 3ZKNC 1FAIL 1P53A 3OKOB 3ARFB 5E2UL 2R8SH 4CU8A 4NQEA 1S7WB 1QBAA 1K3IA 1U8IB 1KCRH 4FFZH 2C7UA 5I1JH 3S9DB 4D3CL 2WBJD 1LK3H 4J23A 5GHWL 5I30L 1J05A 3VW3H 4YHNA 4JJ5B 3GRWA 2E8ZA 1BGXH 2XFXA 2ERJC 2BHYA 2BNQD 4GKOA 2N1KA 4HXAH 4GBXD 3HNSH 5CBEA 1FZOA 3T3MF 4PJGA 3HNTH 4R4FL 1JF6A 5HYSG 3MLZH 1MEXL 1RI8A 1Z3GH 3ARYA 3DVNB 1KB9J 5D7SH 1FL3B 4QY8B 4PB9H 3ULUD 3MODH 4OLYL 4G7YH 3T2NH 3MRHA 4HUMB 5IB5A 3HE7A 4GRMB 3ZE1F 1KELL 3LH2H 1QRND 4HJ0D 4EI6A 3DUSB 4RFNC 2BHZA 4I13B 3RY6A 4U6TA 4O9HH 2Y7QB 1J8KA 4X83A 2AABH 3ARBB 4YXKH 3WDJA 5I8OL 2EDOA 4ZUTB 4NPYB 1CE6B 1KCVL 3TPKA 1HKFA 3OAYK 3VI4F 2OK0L 2HFFA 5EZIL 2NY3D 5DZOA 2X89D 3VG0L 4MMZC 1NFIB 1OP5H 4UOW1 4UNUA 3BKYH 1JRHI 2ICWI 4P9ML 3RU8L 4ACPA 4RA3A 5C07B 2QEJA 4F7EA 3MRLB 3O3DB 1MUJA 4WUUD 1G0YR 1I1AA 3GMQA 4NOFA 3STLB 2FIKB 1UCTA 3V7AE 1RUPL 3D5OF 5ITBL 4WFFD 1L7TL 2QKIA 2EDQA 4DOHB 5LKNA 4GG8B 1N4XH 3T3PE 1MFDH 2BOCB 5EDXA 1EEUA 5JXED 5GGVL 1PLGL 5DZNA 5C6TH 4ESKA 4C54A 3N0PB 4D0DA 5GS0H 4P2OC 4N0UA 2OTWA 4NDMA 3NN8B 3W2DH 5IVZB 3IFNL 4OIIL 5TPWL 1ZV5A 3IXAA 4I1NB 4JRXD 1FJ1A 1XGQB 2MPAL 1CICB 1KT2B 5JXAL 1HHKA 3MXVH 5C92A 4WTWA 5TFSL 3THML 3EYSH 2G75A 4N5ED 2Z91B 5IT2H 2WWKO 4LPCA 4WIQA 3M1BB 1MI5D 3MRMB 2VDMH 4QHMA 5DS8B 1MNUL 3QZWG 5D6CA 1YEDA 1TQBC 4OD2B 1MLCB 4XPTL 3VFMB 3FT2A 1PY4A 3TT3H 3NABH 3K74B 1I1CA 1YEIL 1ZHBB 4XPGH 1YPZA 3UPCA 1NKOA 3H9HB 4HS8L 4JFDB 5D7IA 2J5LB 5C6WH 4OF3A 3RVUC 4JZNB 5IB2B 4MHHI 4Y16B 1NAKH 5E8OB 1Q1JL 5J1AA 2A38A 4NNPH 3K4AA 2XZCL 2BCKA 3D85D 5C0GA 3INUL 2YRPA 1K6QL 4RGNC 1OAKL 3D25A 3Q5YA 5ADOL 2H2SC 4B50A 5DI8B 1FN4A 4DUVA 2JJWA 5FUOH 1TJIH 1ZLVH 1JUFA 3I6GA 5ANME 4P57B 4U1HA 4JVPA 4Y19D 4YZFE 1P4BH 5EO9B 2F54D 3LRGA 2I5YH 2LVEA 4XMLH 2AI0H 2ITCB 3HFMH 4NZRH 2CH8A 3IVKB 4X5XB 1VFAA 1W8NA 4J3SA 3WKNA 5EA0H 3MZGB 3GMOB 4D9LH 3RPIB 4KQ4H 1R5WB 5IJVB 5BJTA 2IAMD 3VWKD 3REWB 4Y2DD 1SQ2N 3W11D 2G60L 2VH5L 3VA6A 1D6VH 1CFSB 4ZUVA 5K9JH 4XHJD 1YDPB 4HIIA 4JM2F 5D7JC 3G6AA 2FGWH 5GSVA 1TQCC 1RHHB 5DJCB 4OLZH 3BPNB 4MJ6A 4TUJA 5ESAA 4OT1L 5AZ2L 4HK3J 4P3DB 3MZTA 4XP5L 2IH1B 2ZG2A 4PJBB 4EN3C 3C09B 5J89A 3O6FC 2CDFA 2DYPA 4KKBC 4AQ1B 5ADPL 3U30C 3MLVL 4NQCE 4I0KA 2VQ1A 2GITA 3RVVD 3TN0D 3WUWA 1MHHA 1NCCL 1T22B 4X9GA 1A7QL 1XZ0B 5F3HB 4MQXD 1FVDA 2OR9L 4P2OA 1L6XA 5F72S 5BQ7A 1ZMYA 4X7TA 3UTPD 1FZJA 2R0WL 3OKNA 1IAMA 3ABZA 3DO7B 3M17A 5E94A 4X0KA 3Q1SL 3O6LL 4ODVL 2AW2A 4KQ3L 2X4OA 2VSCA 4MA7L 3TFKD 5BMFL 5DLMH 4LARH 2AKRB 3CH1B 4HD9A 1BEYH 3IDXH 4Y5VC 4LLUA 3O3EA 3WIFB 5ICYB 5E6YA 2R0KL 2D31B 5KS9F 3VXMA 1FNFA 4PRAB 1PAMA 5D93B 2DKSA 5B39G 4HUVA 4KZEH 2NX5E 4OFKA 5I76A 2IFGA 1LP9B 4P9HL 5F88A 4G8IB 3U4AA 2WUBL 4RFOH 1P7QD 2R0LL 2PYED 1IJ9A 4U0QB 2DJ4A 2YPKB 5FYJH 3S7GA 3U6RA 2PETA 2LABA 2PO6C 4E41E 4ZNCD 5IBUG 1CXHA 3PHOA 1QFUH 5D1ZB 2ADGB 1KTRL 1LO3H 1C08A 4U33A 3TP4A 4YXLL 2HTKC 5IBLC 5C0CB 4PTUA 2V2TB 4NHCH 4PGZA 1CDYA 2DQIL 4PJEA 3WHXA 2BC4B 2FECI 2BRRH 2C9AA 3B2VH 3V4UL 4KHTH 2BSTA 4NFCA 2YRZA 2GKIA 5FM8A 3W0WD 4LU5H 4TVPD 2QJDA 4MQSB 3CVHH 1PZ5A 4U1IA 1D5IL 3E8UL 4LCYB 2A77H 3V7AG 1MSPA 3VFRB 5CWSA 3CX5J 1NUGA 4HWBH 1U9KA 3OB8A 1TVHB 1MJUH 1JTOA 1XH3B 4IMLB 1MHCB 5AEAA 2ZCHH 4YX2H 4AMKL 2P8LB 5DT1L 4EN3A 1U8PB 4C58B 1ZS8A 2ZNXA 3PNWB 1P5UA 5JDSA 1ZKAA 1YEJH 4Q9CA 5MHSE 1DSFH 4WUKL 1IQDA 4C57C 4R0LB 5FEBA 1AFVH 4UQ2A 5LJYH 1HSBB 3O6FA 1MCRA 1P5VA 4CGTA 5D5MF 2DQUL 2I9LA 4TSCH 3KPRB 1JL8A 4KRPB 4OGAC 2BNRD 4M93B 1U8KB 5F3BB 1KC5H 3TIDA 1ZAGA 3Q5OA 1K4CA 2PYFB 4HLZH 4XP4L 1ZVSB 4ELMB 3LMJL 5BS0B 3S4SA 1P6FA 3MBXH 5EOCH 3GKWL 1S78C 1JV5B 5I16B 3EYOA 4F15C 1XCQA 4JPVH 4RDQF 3VDAA 1CLYL 1IARB 3GMPB 4Y5VA 4XNZC 2NY5H 4BM7A 4EBQL 4JE4B 3QDMD 5DMGD 1JMXA 3QEUA 2NLJA 4PJAF 5I17A 4OI9A 1DLHA 3PWUA 3RI5F 4WNQB 1EO7A 4DW2H 1LE5B 1JWMA 5K9QI 5CZXC 3VD7A 5DJ2A 2GJ6A 1KPRB 1OGTB 3RNQB 1VGKB 2VZUA 2MHAB 5L2KA 4A6YL 3BW9B 2BNQE 1II4E 3W82A 1T1YB 2GAZA 4M7JH 4JFOA 4HQQH 2PO6A 1N2RA 5CGTA 2ZOLA 4HPYL 4XB7A 4PY7A 2PTUA 3IYLW 1XIWB 3KPMB 4R2GD 4BSWA 4LRIC 1DBAH 2Z4QA 4U49A 1QVOA 3DURA 1G6RA 3N06B 3D6GA 1I3GH 3V5DA 1HINL 4OFYD 3P0VL 3KPOB 4S1RH 1SEBB 3QULB 4L4VD 1DZBA 2JLLA 4MX7B 3I84A 2I60L 4Y8DC 4XVSH 3VFPB 1ES0A 4MGXA 1A6AB 2ZUVA 4I5BA 4F7TB 4QHNA 5IVXE 3VXNB 1A3RH 5L0QC 5SX4I 2Z31B 3QCVH 3G5XB 4U2ZA 5GGSA 4U1GC 2VDNL 2WBKA 1MFBH 2H1PL 3DXAA 2ATPA 4FFYH 4LF3A 3VWJB 4YWGH 1UVQB 2CD0A 3RX8A 4PD4K 1I7TA 2OQJA 1BQHA 1YQVL 1ORQA 4TVSa 4YE4L 5I6XC 2C1OA 5IHBA 3W39A 3V6OE 4ZDHA 2Q8BH 3MOAL 3DVIA 3UCRA 1UWGL 5KJRH 5F9AC 4ODUA 2XQYG 2W9EH 3TNNA 4F33B 3QHZH 4OZIE 2NY2B 4FQ2L 4WW1B 4KC3B 2LV4A 3LKNB 3H0TA 3BWAA 5HD8D 5GRVL 1RULL 5EFIB 5EPMB 1OAYL 1UJ3B 3S35H 4WI8A 4HKBA 1N64L 2P42B 1CU4H 1ZXQA 2EYSB 3FB5B 1YEGH 1X7QA 1BAFL 1WIUA 4HPOL 4WU7A 4LHJB 4Z18A 3V8OA 5JHLH 4FP8H 3WL9B 1UACL 3ULSB 2N7AA 4JDTH 3P9LA 5C2BL 5I2IA 1ZVYA 1OQXA 4QHLA 1K4DB 3C2AL 3Q3GA 3BUYB 3SKMB 3HC4L 3MO1A 2B39A 2X2YA 2X10A 2DD8L 2R1WB 5DTFA 5KVMC 1JPSL 1AH1A 1CXKA 5TF0A 3BIBX 5IEKA 1RJCA 1J1OL 3G04A 1JGLL 2DKUA 4RBPK 4DN4L 4JO4H 2ADFL 3U36B 3WIIL 5IOPA 4JPIB 1DUZA 5DVMA 4ELKA 4JLRB 5DRNA 1KULA 5HHQB 4XH2B 3WNKA 4JQVC 2BSSB 4LQFH 4YHYC 2YMXH 2CDGA 1TJGH 1UZ8B 1R24A 4LRIA 1WQVT 4GW1A 1T5WA 1KXTB 3S36L 1RJLA 5KVFH 1CN4A 2BVTA 4TQEH 4ZOEA 4DKFL 2EH7L 3EYFB 4PGDA 4KJQD 2MCPL 1NBVL 3CDCA 4NC2B 2WQRA 1NCBL 1YUHA 1VEMA 4UDTB 4M6NH 1MY5A 5EUKA 4PJ8D 1QSED 2M2DA 5C09A 4XB8A 3BZ4B 3NCMA 4Q0XH 3TBSA 3MLSL 4F3FB 2ZOKA 4ZO7A 3FN0L 5EUOF 3QISA 4DAGH 1S3KL 4MXVE 3RAJL 2AVGA 1I8MB 5IGXL 5J3HC 4XC1L 3QI9B 2WMPA 3MNVA 3TYGL 3GSUB 5AYQA 3CLFL 3OZ9H 4M7LL 3L7FB 4K94C 1BM3L 1N59A 2A1WH 3HN3A 3ZLQC 3JV6B 3QDGE 4HHAB 3NH7H 2IMNA 3OF6D 4HIEA 4L4TD 1KCSL 1TTFA 1N7ML 1UWEH 4UINH 1NFKA 3CSYA 3DUHA 4ONFH 3C6SA 3HC3H 3CSGA 3I2CH 1I75A 3SDAB 5DD5L 5TE6L 4P99A 5F7LB 5HGDB 2EKSB 1MRFL 4I2XB 2KKQA 3LEYL 4YK4B 5C0IB 5DJ0A 4IRJB 2YEZB 1D9KD 5T5FH 5I8EA 2VXUH 1KXQE 3T3ME 3CK0L 2CLZA 3G6DL 4GAGL 2E7BA 3HZKA 5HHOB 2DQJL 1QACA 4FQ1H 3LEVL 4OF5A 2WLYA 4LPTA 1OAXH 2R2EB 3D3VE 4LSPH 3FQWA 1NEZG 1XR8B 5F7YC 3U9PH 3ZE1E 1MFNA 1NGYB 2DTML 4QNPF 3JWOC 4Y8AA 5CEZD 4JR9H 4JZJB 4H20H 4L29B 1RSFA 2XY2A 5ESVA 4R4ND 5GISL 4JQVA 4H0IA 1KN4H 3BUTA 3SCMD 4Z76B 3KYAA 2YPLD 4K71B 1AGCB 2NTFA 4LCIH 1MIMH 2NY0C 3RTQB 1N6QH 3M8OH 3VI4E 4AL8L 4LSTH 1AI1L 3OPZH 3ZKXB 4I48A 4EI5D 1NANH 1K2DA 4GQ9L 4LSQL 4N68A 4BFEA 4KKNA 2JIXB 3HG1A 1OP9A 2RQ8A 4QT5B 5C3LD 2DWEA 5GRUL 3O8XB 1BFVL 2XIDA 3OGCA 2GEEA 1IM3B 4R26L 3EKCA 1A64A 1I8LC 5JORB 2ZPKH 4WFHD 1JPTL 5MERB 4K23H 3ELAT 4ORZC 1R3LA 3GO1H 3RY4A 5IHUH 3MV8B 5EC1A 4BQ9A 4NYLA 5FO8B 2VB5A 2HT4C 1KTLA 5ICXA 1PDKA 3ARVA 1B88A 1UWXH 3MYZA 3BISA 2C5DC 3MV01 2BX5A 2XG4A 4ZO8A 2P8PB 4PRIE 3L6FA 3PXJA 5JMRA 4U31A 4QRTB 3TH4T 5FYLD 1FIEA 3HI6L 4G80B 2ED8A 3UTZA 2J8UF 2ADJB 3IRZA 1KXVC 3HR5A 2ICWB 3RVWC 1MHPH 1G9MH 1Y18B 2UWEB 3P73B 1FCCA 4KJYA 3RI5K 5TH2B 2FO4A 4AG4H 1DQMH 3GRWH 3GJEB 3JV4B 2V17H 5ANMA 3V79C 3DGCR 3P9MA 4HFWB 4NNYB 3V8CA 3TO2A 4X6FB 4H0GA 1K5NA 2A9NH 4M6MH 2AK4E 1NMCB 4MA1C 4BFBD 5E6ID 4ZFZB 1BMGA 1H3XA 1OAZH 1B0GB 4Z7VA 1E4XH 3QIWC 2CXGA 1T7XA 1JGDA 1E4JA 1FL5B 5EWIH 3PWNB 1ZEAH 2HKHH 2Y6SC 3IDJA 2P47B 3P4OB 4I0PC 3TBTA 1J8HD 2DQHH 4LPWA 1YYMH 3HLAB 3MNWA 2O26U 4P4RB 2DI9A 2GSGA 2W65A 3L3GB 4I3RL 1HSAB 3UTSB 3VFVB 1EJOL 3GBNH 1WJ3A 3TV3L 4XNYL 1AQKL 4DVRH 3HRZA 4MNQB 3DOSA 2CDEA 4P5TC 4XC3H 2ZSWB 1FNSH 3C60B 4MLIA 2X9YA 3WN5C 3ET9F 4NGHH 4PJ5B 3GMLA 1BVLB 3KAAA 3BMVA 4PJ7B 3EZJB 5GGRA 2VITB 2B4CH 5KANG 4Z0BH 4IM8A 2J1KA 3CFKA 5MP6L 2C1PA 5JQHC 1RVFL 4RMQA 1TCMA 3F7YB 5J12B 1J0HA 4NN7C 5GGVY 1E6JL 2F53E 3FRUA 4NUGL 5GSRB 4DGYH 2Y36H 3L3IA 3D18A 1J11A 1MFCH 1PKOA 5IQ9A 5C0BE 4E42A 4NRYA 5HDBF 1A2YB 2IC2A 1TZGH 4JRYB 1I8LA 5C08E 4L8CB 2XWJA 4JAMA 4IRSD 1FAIH 3QUKB 4MAYB 3EYVB 4YDLB 2DAVA 1EEQA 5E9DA 2A6JA 5E2UH 3BKML 1CGSL 3BHBB 4LKXA 5GRZA 4D3CH 1CG9B 1EV2E 2NX5A 2WBJC 3TBYA 5IB1B 5GHWH 5I30H 3UYOD 1KLUB 3WYRA 4RGMC 4M03A 3LQAC 1EPFA 1MVUB 4MJIE 3PL6D 1KJMA 4R4FH 3LKQB 4E41A 1MEXH 5I8CA 2IPKB 4KI5F 2V7HA 4OLYH 1BOGB 5T3XD 4KV5F 4G8GA 1G9EA 5H2BB 2CR3A 1KELH 4KDTC 5IB3B 1R5VA 4MS8C 4NC1E 4Y0GA 4HKXB 1RU9L 4NFBA 4L3EB 4PRNB 5HYJD 3OQ3B 3ULUL 3QIWA 4HKJA 5I8OH 3HZMB 2NYYD 4I0PA 2NXYC 1KCVH 2VQUA 3QWOB 5CMAB 2OK0H 5EZIH 3MJGX 5D2NE 3VG0H 2NY3C 1IGYA 1Y0LA 4P9MH 3RU8H 2GJZB 3MA7A 3VXUD 2Z93B 2OS7A 2ZSVB 4P5TA 3V6OC 4NQDE 2O5YL 3WN5A 4L1DA 1HWHB 5F9WB 1RUPH 5ITBH 4HF5L 3UTTB 1L7TH 1P9MC 4NRZB 4Z5RA 1FSKC 3BEWB 3GSRA 4MJ5B 2JTDA 3U4EA 4LRNL 4PLNC 3KLDA 4K7FB 1OB1B 1A47A 5GGVH 1PLGH 4JANB 4S1QL 2AJUL 2BOBB 4Z7UA 5D2LE 4JFXA 2EDRA 1X5KA 3MTRA 3IFNH 4OIIH 4PP2A 4HWNA 5TPWH 5I1LA 4P23B 2MPAH 5JXAH 5ID0A 2VXQL 5TFSH 3THMH 1GVIA 4N5EC 1I1AB 3H3PL 1MNUH 3RL1A 4RNRB 4WEMB 1XGPA 4YDVA 3T4AB 3K2UL 4XPTH 1XGRA 2WBJA 3GBLA 1X5JA 5DJZA 2QKIB 1IC7L 1YEIH 4L3AA 5C86A 1MQKL 5D7LE 5E2VL 4HS8H 4BYHA 3OMZA 1QBML 5DD6B 4DZBA 3EGSA 1Q1JH 2BNQA 1HXYB 4E5XB 5HHNB 2XZCH 1P7KB 2XWBA 3INUH 1K6QH 2G5BB 1CXLA 1OAKH 2HVKB 4MWFB 1W72B 4IDLA 3MV7D 3UBXG 5ADOH 3SJVB 2NW2B 1L4IA 1HNFA 3CFEA 4XWGL 3ALWA 4YBLB 3EO9L 2OYPA 4PJIE 2F15A 1QR4A 1KJ2B 4BFIA 3FRPG 4OZHB 4HS3A 4LVNB 4QHMB 3FFCD 1QRNA 4NP4L 3SGJC 4U6VL 1INQA 4YBHA 3ZYIA 1ZGLB 4C83B 3X3GL 5KN5B 4LSUL 4V1DD 1A1MA 1FFNB 1GGIL 4P2QB 5E2TL 4K9EH 3CFJA 3LRSB 3ARFD 1L0YA 3L3HA 3QJHA 1T4KA 3QIUD 5D1XD 1NAML 3NIGF 3JUYA 4HS6B 2IAMC 2G60H 2VH5H 3W11C 5DC4B 1WBYA 2ICCA 5E7BA 3C6LC 3NGBC 8CGTA 1BD2E 1BZ7A 1NC4A 2CKBA 2GCYA 4OT1H 5AZ2H 3V6OA 4QLRA 3AREB 3PE9A 4GS7B 2YOCA 4XP5H 1ACYL 3NFPB 2UZIL 4JO1L 1SY6A 4PV9B 1IM9A 3NCJL 3QQ9D 4OZIA 1P9MA 3TYFA 3ARGB 1F4YL 5ADPH 5JZ7C 1ZHKB 3QUMB 5TDPB 4KAQL 3MLVH 1NCNA 2VZ3A 1F11B 4LOUD 4PJ9B 1EMTL 5DA4A 1NCCH 3RVVC 3TN0C 1VFMA 1A7QH 4LNRB 4JHBA 2OR9H 4PJCE 3DO3A 4G9FD 3MLRL 2EIDA 3IU3A 4NO3A 2R0WH 1UB5B 3MRDA 1RZKC 4JRXA 1F4XL 1UKQA 1WAAF 5DRXB 1KGCD 4Q9RL 3EUUA 3Q1SH 4Y2OA 1N8ZA 3O6LH 4ODVH 5I73B 2J7LA 4KQ3H 5CP3H 4TUJB 5FCUL 4HUKB 4MA7H 5BMFH 3TFKC 2R9HC 1MI5A 4ZUUB 5D7KE 4BH7A 3WFDL 2EECA 2VR4A 3MUGA 1OAQL 3G08B 4HDIA 2R0KH 5AUMA 5LGHL 2WLZA 1KLFA 2W60A 1C1EL 5FYKE 4P9HH 4OLWL 1YY9D 3O6ML 2WUBH 3WUWB 3O2DL 4JKWA 5LG1A 3UAJD 2R1XA 3OHXA 1JF1B 1A8JH 2R0LH 5IROC 3D85A 4FQIL 5JW3L 4LKCA 1BQUA 2FH8A 5HI5D 5ABDE 43CAA 3KPLA 1QLRA 5IMKA 1LE9A 5ESQB 1MCOL 3UZQA 4X6CB 3W9DA 1G9NL 1S7VB 4YXLH 3NPSC 4Y19A 3O45A 1FL6B 2DQIH 3KWWB 3SGJA 3H9ZA 2LTQB 2BK8A 3ZE0F 3V4UH 5A16B 5IB4B 5DEGB 4BFGA 3DHMA 1CICD 1PX4A 1WWBX 4HFUL 1R5IB 4AM0B 5KSUA 3LD8C 3MRKA 3RVXC 4ZFOB 2CUMA 5DQ9A 5ICZB 5DHYB 1S9KC 5DK0B 3T0EE 1D5IH 1T83C 3E8UH 3IGAA 1GGBL 1QFWL 2GK0A 3L3OB 2IAMA 4XAWL 2MKWA 3K46A 2W0FB 3C6LA 3IDMB 4N8VG 5MENB 4N5UA 4ELMF 3K1KC 4JFDD 3HZVA 1YN6A 4AMKH 3IJHB 4TVPL 5SWZE 4Y16D 5E7FA 1C08B 5DT1H 3U0WL 1OHQA 3D39E 1T2QL 1YQ2A 4WUKH 4S10A 3QDGA 2DQUH 1N5AB 5EUOE 3F7PC 1QSFE 3TN0A 1ZVHA 4NKQB 2DRUA 3AB0C 2BVUA 4QF1A 3DVGB 4B53A 4XP4H 2Y4SA 5IF0A 3MRPA 3HRPA 4ZNEE 3WO3B 1V5JA 2OL3L 3LMJH 1OD9A 4J3XA 1U8LB 2EIZB 4YFDB 4WWID 4ZUWA 3GKWH 5FIEA 1RZ7L 3CPLB 1HEZA 2H9GA 4PB0L 3DRQB 1CLYH 2CQVA 2EDYA 4HBQA 1M7IB 3VXSD 1LHZA 2X4TB 4EBQH 1WC7A 5EIQA 5K59F 4QCIA 4IOIA 4RDQG 3MV9B 2FLRT 3MBEB 4HGKC 2D0GA 3QO0A 4WFGE 1T7YA 5INCB 2IFFL 1HDMB 1P7QA 1R3HA 2H26B 4PIRF 4U6XA 4A6YH 2KZWA 2VLRB 1K4CB 1YN7B 5IROA 1JZ4A 3AROA 2A73B 4X4ZA 4L9DA 4K3GA 1X5LA 2Q3ZA 4ZXBD 3VCLA 4HPYH 4BKLA 5HYSB 3EFDL 5BZWA 4R2GC 5DFVD 2EEAA 1IMHC 1HE7A 1KJVB 4EXKA 1HINH 1FZKA 1CXEA 3P0VH 3QBTB 1MRCL 4JM2C 4BSVB 1UFUA 4KJPC 3SE3A 5I1AA 4HWEL 2I60H 4QNPE 3GSXA 4R9HA 3RA7L 4GXVL 5TDOB 5C0JB 4LBEA 5DJ2B 3W0WA 2VO5A 1UZ6F 3VXTA 4J7RA 5FOBA 1T83A 5E56A 1YMHB 1OTSD 2VDNH 5F9OL 4ZMAT 2H1PH 3ZKMD 3FQTA 3KPSE 4ODBD 1PG7W 4MD0A 4PY7B 1IC4L 2XY1A 2YPVL 4MSWA 1MCHA 1YQVH 4YE4H 4PRIA 3FFDA 3CXHJ 5J7CC 3FQXB 2Z4QB 1NANI 4NZTL 5B21A 3MOAH 1SJEA 1UWGH 4DUXA 1O0VA 1GZQB 1EZVX 4U1LB 3V0VB 2R2HA 1G7HA 3NA9L 2OL3A 4FQ2H 3FTGA 4R4BA 5EBGA 2FJFA 3GDBA 1RULH 1DVFC 5HD8C 1B3JA 1OAYH 1DEDA 2BNRA 4Z95L 1N64H 1UM5L 1E4WL 2XPGB 4JB9L 4XAKD 3VGAC 1BAFH 4IIQC 4HX1B 4HPOH 4WO4B 1CYGA 1CFTB 3QG6A 4OBSA 1BIHA 3U2SB 1UACH 2VLJB 3EO1A 5GJSL 5JLZA 2AK4A 5CHNA 1YMMD 5C2BH 3BVNA 4PV8B 3C2AH 3HC4H 2C1OB 2J8UE 2DD8H 3B9KC 5DDHB 4ZDHB 1OGAB 4P0DA 4WI3A 2JJVA 3PDOA 1JPSH 4I18B 4HZLA 5I74C 2B1HL 3MGOA 3QZWB 4GW5A 1PFCA 4PGBB 4FTVE 1J1OH 1LO0L 1JGLH 4LASL 4DN4H 2FL5A 1I9RL 2XT1B 2ADFH 1DQJA 3WIIH 3FCTB 4RGOL 4JVUA 2AXGA 5KANI 5E8EA 4LP4A 1H3UA 3KR3L 2Z8WC 3T0BA 2ADIA 2OSLA 1OAUL 1C5CL 1Z2KA 2JK5B 4NZDA 3KPRD 3QPXL 3QDJD 15C8L 1ETZA 1E4XI 4X9HA 5D1QD 3S36H 4DKFH 2PTTB 1NC2B 2EH7H 5IMMA 3BDXA 4QRPE 1S9VA 1GOFA 4JM2A 3FFCE 2MCPH 3VJ6B 1NBVH 4X8XA 1JHTA 4KJQC 4DGIL 2HRLA 4O00A 1NCBH 2ID5A 4RZCB 5BS0D 1WEJL 4ODTL 3RKPA 5C0BA 1G7PA 4WGVB 5EU6E 1FG2A 4J12A 3MLSH 4KH2A 5GGRY 4YHIA 4U05A 3SE9L 3FN0H 4NFDA 5JO5A 3ROLA 1QPXA 2EDXA 4O2FB 5BOZG 2NW3B 3FO1B 4X9FA 1S3KH 3RAJH 5MEQA 1YEFL 1KIPA 5IGXH 4CDGC 4H1LA 4XC1H 5ENWA 3K4ZA 5J0BA 1FGNL 2J4WL 1DE4A 4ZOBA 2X41A 3GNML 4RIRB 5I71B 3TYGH 5DUBA 43C9A 3CLFH 4M7LH 3B9EA 4BUGA 1BM3H 5KSVA 4KK8C 4I9WD 3DWTA 2EZ0C 4Z78A 4P4KC 1DVFA 3IDIB 3RWDA 1XIWD 4CDHA 4XP6L 1KCSH 4FG6D 4DCQA 1N7MH 3S97C 2PKDA 3TBSB 3O4LE 5KS9A 4IIQA 1IL1B 5DD5H 5TE6H 4FXKA 1MRFH 2F5AL 5LVEA 4M61B 3LEYH 4QXTB 5CSZB 5E5MB 1D9KC 1T1ZA 1EO8H 3B9KA 2V7NA 2Z31D 3CK0H 4P3CL 3G6DH 1AP2A 4GAGH 2C3VA 4KI5E 1NGZB 5A2IH 5C1MB 3VWJD 2DQJH 1DANT 1P2CB 3LEVH 1HQ4A 3DX9B 4BA8A 1KB5B 5B39B 5C07E 5HGHB 2BSED 4NRXB 5LQBL 2AEQL 4FMKA 4NT6B 5HPOA 2DTMH 1JNLH 3ARRA 2MJWA 1PQZA 2P5EE 3IDUA 2D9CA 4XNMB 1N6UA 3MCKA 1V7ML 5GISH 3IDYB 3IS0X 5J13B 4MB5A 2HVJB 3EDDA 5B38G 5IBUB 3IDGA 3MLXL 1OWRM 4AL8H 1AI1H 2EIBA 1LD9B 4GQ9H 4I0CC 4HGWA 1EO5A 4LSQH 2EDHA 3UZEA 5C7XL 3DUUB 3L9RB 1GC1C 3GMRB 4NCC1 3TESA 3W5NA 3RGVD 5A2LH 5H35B 2J88L 2VXVL 3PABA 3RBGA 5GRUH 1BFVH 4N0FB 3LKSA 4R26H 3LS4L 2AV7B 1TZIA 2UWEF 3CMGA 1JPTH 5IMOA 4JG0L 5D5MA 1J1PL 5ESVB 3GI8L 1ZSDA 4ETQA 4MA3A 5HHME 3QEHB 3WNOA 3DIFA 2NY1B 3ZT7A 4ISVB 3S8WA 3K0WA 5D7LA 3UBXI 4U0RB 4QYOB 5EZOL 5CD5D 4X7EC 1IGFL 3RUGB 3HI6H 4MCZA 1QHPA 3N1PC 4P4KA 1F2QA 1IGTA 4KXZH 5LXGL 1S9YB 3QRGL 3WNLA 1NPUA 3A6BL 3OF6A 4L4TA 2CJUL 4LCUA 2R1YA 5FECA 4JFEB 3I6LD 2H32H 4X80L 5F1OB 1O7SA 4UMGA 4FQHA 4PJAA 3T2PA 2K7QA 5FYLL 2YKLL 3V5HA 4J1UB 4RQQA 1MJJA 1RZ8B 5E6IC 1BZ9B 5DF0A 1CCZA 1B6UA 1D9KA 3CFBB 4CVZA 1RZFL 4GRLB 4JDZA 5D96B 2BVOA 4PJ7F 3IFPA 1AKJA 2DQDL 1RUKL 2GFBA 2Q6WA 1SYSA 3T0EC 3GK8L 2VUOA 3C9NB 4WDIA 2X4PA 2Y72A 1OM3L 3U7WL 2ZCKL 3QI9D 4I3RH 3QIBC 1UB6A 1CD1B 1EJOH 3P4LA 3TV3H 3QRFM 4XNYH 4ZTOL 2CK0L 5IP4A 1G7LB 4I4WB 1AQKH 2IMMA 1C5DB 4QRRE 1XF4A 4TOYL 1J88A 3KPQB 4XCEB 3VE0A 5DUPL 1V7NL 4JQIL 1FLTX 3DNKA 4EUPH 2A0LC 4HUUA 3HTLX 1QKZL 2YPLA 1KEML 1KIQB 1EBPA 5MP6H 3WE6A 1RVFH 3RWHA 3T0VA 3T2OA 4OI8A 1FBIL 3U79A 3MFGB 1NMBL 3SDAD 1E6JH 1EUUA 4NUGH 3HR6A 3ZHLA 1AGFA 4YC2C 5F1NB 2GSGB 4IRJD 4C4KO 1ZHNB 2AV1A 3QUXB 1HOCA 3MRGB 5CUSL 3K1DA 3V6ZA 1OSZA 3KHOA 2DN7A 3MJ7B 3HCVA 3RWEA 1CT8A 2X4UB 3BKMH 5HHOD 1CGSH 5ACZB 1MCWM 3HUJE 4WI9A 1KNOB 2CO7B 2CRZA 4X4YB 4I3SL 2BSRB 1I3RB 1CFBA 4WHCA 1XGUB 4EUPG 4NQCB 3LN4B 1UXSA 1BP3B 2CSPA 2ATKA 5E5RB 3DROB 4JEGB 2OJZL 1XT5A 3D18B 1F8TL 4O2EA 4NRYB 2Z35A 1DCLA 5BXFB 1IAOA 5I9QC 5C70A 3SBWA 2XWJB 3MRFB 4U6YA 3N85L 5C0CE 4S11A 4OF0A 5FDWB 5IK3B 1ZLUH 1TMCB 4ORGB 3KPNA 3KYOB 2DIJA 1RU9H 3NVQA 4KKCD 2ZUXA 2QSVA 5E6IA 2NX5B 3ULUH 5F7DA 1D5XB 5EORL 5T3XL 5J4MA 3T0EA 3QEGL 2NYYC 3WS6C 3UYRL 1J8HA 3MV8D 4XBGA 3DRTA 4W6YB 3REVB 3ULVD 3QIBA 3EOAB 5DYOA 1MH5A 5I8CB 4G9DA 2DKMA 3ZE0E 2O5YH 4LAJH 3UEZA 3FB7A 1QA9A 1RZJC 1HZHL 2X1PA 2E6QA 1KUMA 4U2YA 4HF5H 1FPTL 5EUOA 3AGVA 2Z0BA 4LRNH 3QUYB 1QSFA 2GT9B 1WTGT 5IMLA 5F7EL 5DHVA 3RX5A 5BV7C 4F37F 1MWAL 2AJUH 4S1QH 4WHYG 3WBDA 3MRIB 1SM3L 1L0QA 1B90A 4EEEA 5EO1A 3MROA 1N5YL 1X5IA 5DJYB 2IBZX 2Q8AL 2VXQH 1P84K 1NLDL 2LU7A 4D2NA 3NFNA 1A6ZB 4WV1B 5F70A 2H45A 2UV3A 3H3PH 3UTOA 3TA3C 3H7BA 4M02A 4OZHF 3K2UH 3SDXE 3MR9A 3B2UD 1IBGH 2BMKA 4LEXL 4H26A 5FHAL 3UTSD 5EZLB 1IC7H 3PWJA 4Z5RB 1U92B 3X3FL 1MQKH 5E2VH 5C0ND 1HH6B 1JVKA 1MLBA 1QBMH 4MNQD 3FQUA 1D5BA 1JGVL 2VABA 3C60D 5EBWB 4PJ5D 1BBDL 4XWGH 4S2SB 2L7UA 4FQQA 3EO9H 1CI5A 2N56A 3C08L 5K59E 3CIQA 1KTDA 3QXUA 4NQSA 1YEEL 1QOKA 1RJYA 4TSBL 4YGVA 2V9QA 5DVKA 3RWJB 3GB7A 4NP4H 3W9EB 2IEPA 5MI0B 4U6VH 2VE6B 5CEYA 1QFHA 2ESVE 3WLWD 1GZPB 5E95B 3X3GH 1R3KA 4Z7OF 4LSUH 5B38A 2WP3O 4LHUG 1GGIH 1JCKA 5E2TH 4X98A 4GUPA 3CFDB 4YPJA 4F7PA 5GZND 4MAYD 2NZIA 3WS6A 3ARFC 5HVHB 1NAMH 1M05B 5CIPH 3GFUA 4LFHG 3KPSA 3FOMB 4MD5B 4X5WA 3VXUA 1NEZB 3RWFB 1MWAA 5K9KB 5A2JH 5DR5L 5FA3B 2NY4B 1ACYH 4HV8A 2UZIH 4JO1H 4Y4HB 3NCJH 1LGVA 1IRAY 1F4YH 5ID1B 1OTUD 2VRAA 2XKNA 3NCYP 3K8MA 4KAQH 2EDEA 2XXMB 5L8KB 1EMTH 3QP3A 4WTZA 5IVXB 4LOUC 4XPAL 1AE6L 4XBPA 2RHEA 3B8YA 2DM7A 4HG4K 3DMMC 4PP1D 3RIAK 4KGJA 3MLRH 5INDA 2X44D 1FNAA 5F1IA 5J6GB 1F4XH 1WBYB 4Q9RH 2VZ1A 5CP7A 3GSOA 2J8UA 2ZNWA 5FCUH 3ARBC 3AXLA 1YEHL 4CW1B 3BSZL 4J3WA 3TA3A 1EEYB 3EHBD 3WFDH 4X6CF 1OAQH 4GKZA 2B0SL 1WFTA 4PJHE 4KI5C 4ALAL 5T3ZD 5LGHH 1C1EH 2HKFL 2H6PB 3BMWA 4PJXE 3T77A 4OLWH 3ARWA 3JV0A 3O6MH 5F7KC 1TNMA 4NO0B 3O2DH 2W0KA 3EJJX 1QHOA 3UAJC 3ZMRA 2JJUA 4LDOB 1I7ZA 3HE7D 4RCAA 3ZHDA 4FQIH 5JW3H 1CDUA 3HMWL 5DD1L 3MV7A 5IW1A 4LLMB 3OXRA 4OZFG 5HI5C 5EBLA 4HC1L 2R4RL 3N1QC 2WWKT 1IT9L 3GM8A 1H8OA 4GW4A 3P4MA 5F6HJ 3SGDH 3JTSA 1MCOH 1G9NH 2NNAA 5ETUA 3SQBA 5F6IB 2X1WL 1RQ5A 4JPWL 2FH6A 4QRPA 2P24A 3FFCA 4X6DF 1JZ5A 5C0EB 4P23D 3UC0L 4HFUH 1EH9A 4V1DA 1CICC 1WBXA 4F2MA 4CN1A 5EU6A 4GJTB 2Q76B 5EU7E 3OKOA 4LVEA 1I1AD 3ARFA 1LO5B 4JQXA 4TTDD 1GGBH 1QFWH 4CMHB 3IXTB 2EDDA 2OX5A 5E00B 3PP3H 2PW2B 1S7WA 4XAWH 2N4IA 1U8IA 5JR1L 2XRAL 2X05A 2HJFB 4JJ5A 4ERSL 3IFLL 1TETL 2J5LC 4G6FB 4TVPH 3ZO0A 1AR1D 3C2SA 4QOKE 3U0WH 4Y16C 4PREB 2YN5A 2X4QB 1JN6B 1T2QH 2AJYL 5ILTL 4XVTL 1U2HA 3DVNA 2CLRB 1FL3A 4QY8A 5DJ6B 4Q6IB 4XI5D 1JBJA 1N6VA 1VPOL 4RSVA 3DMMA 4GRMA 4I2XE 2D03L 2EIEA 3QH3B 4HMDA 3OJVC 2OL3H 5HGBB 3DUSA 3B9DA 1RZ7H 1CQKA 1CFVL 2Y7QA 4P2QD 4ONHB 2B20A 3ARBA 3I6KB 4QO1A 4PB0H 1YN6B 1A9EB 5JOPD 1AO7B 4ZUTA 4NPYA 5JPNB 1CE6A 3FJTA 4CMMB 1NBZA 2E5EA 3GJFK 4LLWB 4YUEL 4Y88A 3H8NA 1P7HL 3U0TB 2G9HB 2IBBA 1NFIA 2NMSA 2GSIB 1XGTB 1WFNA 3FONB 2HRPL 5L88L 1HNGA 5C07A 3MRLA 3O3DA 3BPNC 2IFFH 1PEZA 3J8F7 4V2BA 4FFWC 4RAUB 1S7TB 3STLA 1HH9B 2FIKA 4XCNB 4Z0XB 3C09C 3VFGL 4GG8A 3EFDH 3T09A 1AXTL 5B8CB 1M71B 4PJ9D 5GGUB 4R90L 5DFVC 1G7IB 1K8DB 4KTEL 5BRZB 1MRCH 3NN8A 1BJ8A 4KRLB 1Q9KB 5DHXB 1VESA 4JFYB 4DJMA 2KQNA 2ZCLL 3OKMB 5GRYA 4HWEH 1XGQA 3RA7H 1CICA 1KT2A 4GXVH 2RFXB 3D3VB 5F7MC 1I3VA 4Z9KB 4U1KB 2Z91A 4LIQL 2W1NA 3MRMA 3M1BA 1FFOB 5DS8A 3S96B 2HJKB 4YDJB 3UP1A 5F9OH 1OTSC 4OD2A 4ZUSB 1CXFA 1MLCA 3VFMA 3QPQD 3SE4C 1MREL 2BNUB 1ZHBA 5D93C 4F7CB 3H9YA 1IC4H 2YPVH 3AVEA 3A6CL 3GMNB 3H9HA 5EIVA 1A6WL 4JFDA 4MLSA 4NNXB 3NCFB 4JZNA 2JCCB 4Y16A 4NZTH 4P2OD 3NOIA 5E8OA 3CLEL 3QUZC 1ZTXL 2PXYB 3NA9H 4P5KB 4XPFL 2HAZA 5DI8A 3HB3C 4NQXB 1IAII 2UWEE 4H1LH 5DMKB 2IBZY 4E0RB 1VADB 2E3VA 5D1ZC 5KOMC 4Z95H 1UM5H 5EO0B 5F8QC 1E4WH 5FO7A 4JB9H 3QJFB 4ODWB 5D9SB 5EO9A 4GKNB 3O6KL 2DBJA 3T0AA 2YHGA 3OKDB 3VXMD 1G84A 5GJSH 1D5ZB 2PTVA 3P4NB 2ITCA 4JFFE 3IVKA 3DYOA 3VXPB 5LGKA 3GMOA 3RPIA 3BRGC 1WZ1L 1R5WA 5IJVA 4DWHA 4KXZI 3REWA 4RGND 2N7BA 25C8L 4EIGB 3VFTB 1AD9A 2B1HH 3ZYJA 1CFSA 3QO1B 1YDPA 1LO0H 4LASH 1TXKA 2JE8A 2D2OA 3BOVA 1I9RH 1RHHA 2ED9A 5DJCA 5I0DA 1V3LA 3L5WB 4RGOH 4P3DA 3DECA 2IH1A 3U83A 3KR3H 1U58B 3JTTB 4YIQB 2I26N 4R0LC 1OAUH 4HBCL 1B9ZA 1C5CH 1HQRA 3MRBB 4ZS7L 5JLZB 3MOQA 3UBXB 3QPXH 15C8H 4D9RD 3N50A 5T1KB 1T22A 4KRPC 4PGCB 5IG7B 1XZ0A 5F3HA 3SDDB 4M93C 5FUZL 3U7AA 4M3JA 4ZYKB 3BH8B 3ZKSD 4NJ9L 5E08L 4DGIH 3E3QE 3P0GB 3DO7A 5F97E 1FNLA 5J6HB 1WEJH 4ODTH 2CXKA 4JRYE 3Q5TA 3VGHA 5SV3A 2X4RB 3SE9H 2FGZA 2YSSB 3CH1A 1KPVB 2B2XL 3WIFA 1RUML 5ICYA 4JFPB 1IGJB 2D31A 3HA0A 2XTLA 1YEFH 4PRAA 4KKBD 1A6PA 4JO3L 1FGNH 2J4WH 3OGOE 4FQPA 4N9OB 3GNMH 4G8IA 4XGZB 3IFOB 3C8HA 3CD4A 4R97B 3QUZA 1ZLWH 1WAAA 5DFWH 2F53B 4Y1AB 3DX6B 2YPKA 2BJML 1A3QA 4K8RD 5AAMA 2FHCA 4HAFA 5CJQL 3B8SA 1W0WB 2LAAA 4KUCF 5TE7L 4XP6H 3KNBB 1XIWC 1A6UL 5D1ZA 2ADGA 4YAQA 3SKOB 5C08B 2D3VA 1G1CA 4YHML 4ZO6A 3CDGB 5C0CA 2V2TA 1H0DB 2G2RB 2BC4A 2F5AH 2A6KB 4QXUL 1GRWA 2XKUA 4L3EE 5GGTL 3P40A 1K85A 4M7KL 3VFNB 5HVGB 4HAGA 2GJ6D 2YK1L 5HYIA 4P3CH 1BIIB 2Z31C 4LCYA 3ETBF 3VFRA 3VXQB 4MJIB 2PO6D 3DV6B 3KLAB 2KQMA 3VWJC 3WFHB 2CR6A 4NQUA 4EZMA 4ODXB 4OGZA 1TVHA 1XH3A 4IMLA 4ZFFB 5LQBH 2AEQH 4EDXB 5HXMA 1MHCA 5M95B 2P8LA 4PS4L 5HGAB 2X1XR 1U8PA 3PNWA 1KG0B 1EVTC 4NO2B 1HHIB 1V7MH 4R0LA 1KLGB 5IIEB 5A43C 1HSBA 2UY7A 3UTTE 2NY2C 5L7XL 2QQLL 2FCBA 5HHPB 3KPRA 3NA4A 3QNZB 1B4RA 1C16B 2SEBB 1UJ3C 3MYJB 3MLXH 1U8KA 5F3BA 5E70A 3T3PF 2PYFA 3MUJA 4WO4D 1AP2B 5B4MC 3GGWB 1ZVSA 4LLQB 1F42A 4CKVX 4X9IA 3IRPX 3TZVB 3VH8G 4ELMA 5C7XH 2QHRL 5D2NB 2EDKA 3RUGF 2J88H 1HQ4B 2VXVH 4JZOB 3PV6B 1JV5A 4M8QB 3VDBA 2VZSA 5I16A 3LS4H 2YD7A 1G0XA 4FQXB 1WBZA 4Y5YB 3GMPA 4JG0H 4NQDB 1MELA 1J1PH 4OUUB 3GI8H 3P30L 4PGJA 2OXGA 2B5IB 4WNQA 4OM0L 1LE5A 1KPRA 4N8VB 1OGTA 4O58L 1NUDA 3RNQA 1VGKA 2MHAA 2A6DB 5EZOH 1IGFH 3BW9A 5CD5C 1T1YA 4OZGE 3IB4A 4NIKB 2XA3A 3BZEB 5LXGH 5D2LB 3T04D 3QRGH 5GGTA 2I25N 3SJVE 2BFVL 2XICA 1MJ8L 2X6MA 1XIWA 2A74B 3A6BH 3BP4B 3KPMA 4KHXL 2CJUH 1CL7L 5EOQL 4X80H 4OZHE 1A7RL 2I07B 5ACMA 4KVCL 3KPOA 1SEBA 3QULA 2YKLH 5FYLH 5A2FA 4F57L 1BFOB 4MX7A 2BY2A 1FRGL 3NMEA 5FF6B 3VFPA 1J10A 5CZXD 5K33A 4YZFF 1A6AA 2VWEE 2CPCA 1G0DA 4F7TA 1IKNC 3VXNA 3DETD 2VIRB 1RZFH 3A0OA 5J8OA 2Z31A 3G5XA 5EU7C 2DQDH 1RUKH 3VXOB 3GK8H 3C5JB 4LSVL 3VWJA 8FABB 1UVQA 1OM3H 3U7WH 2ZCKH 5D4QA 5JNYB 1RIUL 1IC1A 4WU5B 4S1DC 3QI9C 2X4NB 4LCWE 1G7QB 4DVBB 1CGWA 1FNHA 4ZTOH 5I1KL 5C0DB 1FYTE 2CK0H 1T89C 2BVPB 4WW2B 4PJIB 4TOYH 1XF3B 5DUPH 1V7NH 4JQIH 2EDJA 4WHTB 4F33A 4WW1A 1S7UB 1QKZH 3LKNA 2VAJA 4QWWC 5EFIA 3EDEA 5EPMA 1KEMH 4YO0B 1UJ3A 1YA5A 4JFZL 4FOMA 5C09D 1ZT4B 2OCFD 4ODSL 5KVEL 1EXUB 1W8OA 4JDZB 2EYSA 1FBIH 2CIIB 1NMBH 1OLZA 1AKJB 5C0AE 3SDAC 4GRWE 2YC1B 4HMCA 1RD6A 1JHKL 4JKMA 3WL9A 1TLKA 2PN5A 3QAZB 4V2CB 4YK4C 5BZDB 1A0QL 1OP5K 1FO0B 4L1HA 3PHQB 5CUSH 1K4DA 3F7RA 3BUYA 3SKMA 4YGAB 3U82B 1BD2B 2R1WA 5FM5M 2AEWA 5DHVH 4E9LA 2AEIT 2HMID 3H3KA 2E9IA 1IGCL 4PRPB 4F58L 1J5OL 4NJAL 2YZ8A 4I3SH 1WWCA 1YNTB 3U36A 4A6YB 5E8PB 5IKCB 1LNUB 2HT3C 4JPIA 4CN6A 1MCCA 3LV3B 4JZJC 3LKRA 5HHQA 4XH2A 4PJCB 3VD4A 3BX7C 2BSSA 3CGTA 4Q9QL 2OJZH 3IF1B 4K71C 1F8TH 4TRPL 2DQEL 3RTQC 1UZ8A 5CCKL 5IM7B 2A83B 4Q58C 4JM4L 4X6CE 1KV3A 4PRHB 3DJ9A 3ZKXC 4XVUD 3N85H 3RDTB 3VXRB 3EYFA 1HHJB 3AC0A 3L7EB 3VGGA 3OKEB 4K3DL 1DBML 3KXFE 5EZJB 4UDTA 3CC5B 5CGMA 1IKNA 3O8XC 3QFJE 2VLKE 5SX5H 3BZ4A 4F3FA 4C56E 5EORH 5T3XH 4YR6B 1ZGLM 1N0LA 2J3SA 3QEGH 3PDDA 2IGFL 4ZD3L 3UYRH 2DJUA 3FO2A 1RFDL 3EYQC 3PGCB 1I8MA 5MENE 1MCFA 3QI9A 5IW6B 1JPFB 4UNTA 5TQ0L 2NY1D 1DL7L 1VA9A 1T89A 4M6AA 1IAOB 3GSUA 3SKUD 3L7FA 4X6DE 1ZLVK 3QXDB 5AZEL 1HZHH 3JV6A 3BZDA 4HHAA 4OLVH 3ULVL 1FPTH 1XEDA 1NMAL 1DQLL 1DTUA 3FN9A 4KVNL 2XTJE 1F90L 3BEVB 5F7EH 1MWAH 1QFWI 3SDAA 5FFLA 2MTPA 2ED7A 5HGDA 2EKSA 1UQSA 1SM3H 4I2XA 2IANE 1JRHL 4HZAA 5C0IA 1WFOA 1ZWIB 1NMCC 1N5YH 2YEZA 3C8KB 3MLPA 4JY5L 2Q8AH 4GRLD 3IS1X 1NLDH 2X09A 2JF1A 1A7NL 2YA2A 4HJJL 5SWZB 3WFZA 1B0RB 4LLVB 5HHOA 1VKXB 4KZDL 3D39B 3MV9E 3ARPA 4LEXH 3C5ZB 4KROB 5FHAH 3B2UC 3V4VL 2R2EA 4FQCL 2GUOB 1QUNA 1XR8A 3HZYB 5K9OB 3X3FH 2KBGA 1NGYA 1QSFB 1TCRB 5C0NC 1CFQA 1D7FA 1XF5B 3GSQB 4JZJA 2VLRE 4L29A 1JGVH 1N3NB 3CAFA 4G7VL 5I1DB 3C60C 3CFCL 3H2WA 2OR7A 3AFLA 3T65A 5IFJB 4Z76A 1AGCA 3RTQA 5A3ID 5EO1B 2IPTL 4RISL 3E6HB 1BBDH 2CO6B 3U0PB 3C08H 2ZWLT 4ZS6D 5J12C 1YEEH 3WDIA 4TSBH 1DQQB 3GSVB 5JHDB 1RZGA 2JIXA 4QT5A 3E3QC 2APWA 4POYA 4KMTL 5DC9B 3O8XA 1F13A 1IM3A 1G6VK 3BD3A 4F9LC 4XHQA 1BPVA 3AMKA 5LWYL 5MERA 5GZNC 4MAYC 4YDLC 1U8OB 5J9PB 7FABL 5IVXF 3MV8A 5FO8A 3FT4B 1RIHL 2P8PA 3BIAX 4NQCD 1PSKL 4QRTA 2Q20A 3BJ91 5DR5H 4G80A 4YGVB 4ONGL 2ADJA 3OG4B 2ICWA 1YY8B 1Y18A 4OD3L 4M48L 1WZMA 2UWEA 3P73A 5T1MB 3X17A 3I02B 1OTUC 5D8JL 2R2BB 5TH2A 5B38B 3VRIB 1J1XL 2XYCA 1I3UA 3GJEA 3JV4A 3OKYA 4JFQB 4XPAH 1AE6H 4HFWA 4NNYA 4X6FA 3GEWB 2HT4D 5DURD 3V2AR 3QWRA 2VLJE 4AEEA 3O2VL 2DLTA 4ZFZA 2NX5D 4HIXL 1DBKL 2J2ZA 3MJ9A 1B0GA 3MRJB 4IS6B 1UADC 5HDLA 1T6VN 3D0LB 1AGDB 2VR9A 4ZSOE 3KPPB 2MFNA 1FL5A 1OGAE 1YEHH 3PWNA 2OM5A 5LAXB 5E24E 3BSZH 3P4OA 4L3CB 4XZUB 4ALAH 2B0SH 1FORL 4P4RA 1QR1B 3O3BB 3RVWD 1OP3H 3VRLE 3L3GA 3UTSA 1HSAA 3VFVA 2HKFH 1LEGB 1ERNA 3V6FB 4MNQA 4DK3A 1JMZA 5D71L 5E2WL 2ZSWA 4XBPB 2ZUSA 3C60A 1NQBA 1U6AL 3ECBB 3HMWH 5DD1H 5FHBL 4PJ5A 5DJDB 5F9WC 1BVLA 5T33L 3NCEB 5T3ZL 4PJ7A 3UPAA 2VITA 4HC1H 2R4RH 3O41B 1IT9H 3QUYD 3QIWD 3P77B 5HTSA 4M1CD 3F7YA 1TPXB 1WISA 4JKPL 4I0PD 4JPWH 3DBXB 5GSRA 1MCNA 1T1WB 2R0ZL 1IC5L 3D2UB 3MCLL 1U95B 5H94B 5JA8B 5KVGL 1RK0B 4FTVB 3UC0H 2Q7NA 1A2YA 3I50L 4P23C 2QL1A 4JRYA 5FKPA 4L8CA 2H2PD 4G43B 4K3JL 4F9LA 1JIBA 5EU3B 4MAYA 4KKLC 1MJ7L 3AS3A 3EYVA 1HCVA 3BHBA 4TTDC 5MHSD 4ZOAA 5JR1H 5DO2D 2XRAH 1FLRL 4M3KB 4W6WB 1A1NB 5IB1A 1DP0A 4LSRL 1KLUA 3S5LG 4BQCA 5I1GL 2R29L 1RIVL 3BN9C 4ERSH 3IFLH 1TETH 3OB0H 4IDJL 2FR4A 2DM4A 1S9XB 3HAEG 5K93A 1MVUA 2FECL 1BX2B 3MUY1 1U8NB 2AJYH 4NKOB 5ILTH 1B6DA 1PG7X 5MEOB 4XVTH 3O9WB 4H88L 2JJSC 4TUOB 2IPKA 2H32B 2CRIA 4N9GB 3PWLA 1BOGA 4YBLC 1WBXB 5L9DL 3B9AA 1F45A 5H2BA 1NEUA 1VPOH 4FQJL 4LVNC 5C2UB 5EU5B 5IB3A 2D03H 1WCBB 1F3DJ 1NCWL 4HJGB 5KG9B 4HKXA 3QQNA 2J12B 4L3EA 4PRNA 3SE8L 2VWEC 1CFVH 3HZMA 4PJDB 2E6PA 3QWOA 3ZDZE 1OWWA 5CMAA 4YUEH 1T03L 1X5ZA 2VNCA 4XTRD 2HRPH 2QBWA 4OD1L 5L88H 1J7VR 2GJZA 3K3QA 2Z93A 2ZSVA 3NACL 1R3IL 5IJKC 3AM8C 5DMJB 1ZANL 3AREC 2YUZA 2NY4D 3O4LB 5GIRB 3E1F1 4GS7C 3DMMB 4MS8D 1DJSA 3CNKA 3VFGH 3UTTA 4NRZA 5JDJA 3ARGC 3MRQB 3BEWA 1AXTH 4MJ5A 4MD4B 3PQYE 4K7FA 4QGYA 4R90H 1NFDE 4PJ9C 7CGTA 1OB1A 4LLYB 4JANA 2WUCL 4JKLA 2BOBA 4Y4FB 2NXYD 3BPLB 4KTEH 1JPGB 1HYSC 1NBZB 1S7XB 3EOBB 1TVBB 2JCCF 1P69B 2ZCLH 3X14B 3QNYB 3PJSB 1ZE3C 3OX8A 2XKSA 4P23A 4X6BB 2DQGL 1NC4D 4OQTL 5I73C 4LIQH 2L0DA 2FIRT 3BI9X 5ISZE 2P5EB 1ONQB 2Z8SA 3MLWL 4RNRA 4UOW0 3T4AA 1IM9D 3F6IA 1MREH 3EFFB 3QPQC 2QR0B 4WHDA 2IALB 3A6CH 2OTUB 4R96B 1A6WH 2FX7L 5DD6A 4NO0D 5FYJE 2HJLB 3RUGE 2X1QA 4N8PA 3MFFB 4CN4A 1HXYA 4E5XA 1ADQA 5HHNA 3CLEH 1P7KA 3UPRB 1ZTXH 5GQBA 2G5BA 2HVKA 4MWFA 1W72A 4P2RE 2JJSA 4XPFH 3SJVA 2NW2A 3GMMB 4LMQI 4KMLB 2FYYB 1BREA 1VEOA 2WIIB 4JFEE 2DF3A 3S88L 2Y06L 1EHAA 2HP4A 1KJ2A 4WTXA 4OZHA 5F1SA 5I1HL 3TO4C 2Q86A 1OF2B 1PZUB 2LTQC 4UIKL 5HHMB 2WAHA 2W0LA 1ZGLA 4C83A 5KN5A 4Z7NE 3KYKL 1A5FL 1U8MB 1FFNA 4P2QA 4JGJA 1I8IB 3LRSA 1A02N 3TPUB 1WZ1H 2Y1VA 4HS6A 1J0JA 25C8H 5EN2B 4LQ1A 4Z77B 1JZ3A 3HPJB 2VDRL 4R7NB 5IW3A 5IJKA 3AM8A 4G6FD 3AREA 2W9DL 4JPKL 4PJFE 4ZFOL 4M5YL 5FO7B 3NFPA 4PV9A 4XMPL 4HBCH 3NZ8B 3ARGA 4ZS7H 1F4WL 1ZHKA 1PKQE 3QUMA 2O61B 5TDPA 1X5FA 5FGBC 1JJUA 4OQTA 4WUUB 1F11A 1HXMB 4PJ9A 1X4XA 5FYJU 4LNRA 4YPGB 5FUZH 5E1AB 1WWWX 4NJ9H 5E08H 4OJFL 1UB5A 1PYWB 1AD9B 3C6LD 5DRXA 5DMIL 1S7RB 1I1RA 2EH8L 1P4IL 5D70L 3NCCB 4HKZB 4LHUB 1CTOA 4QRRB 4ZUUA 4CVWA 4MDIB 4APQB 2B2XH 4PBXA 1RUMH 4AEFA 1QO3B 5TDNA 9CGTA 3G08A 1NLBL 4JCMA 1ZA3B 5JIPA 3QDGD 3BQUB 2YBRB 4GAFB 5JZ7D 3VGDA 1HQRB 3QDHA 3MBEC 4JO3H 4GG6E 4MNGB 4LP5A 4FNLL 3IJSB 5IFAL 1T7ZA 2IJ0C 1JF1A 2X9WA 3UYPA 4JGUA 3QWQB 3TCLB 1T80A 2UVFA 4F8QA 2BJMH 1XCTA 2R69L 1MQ8A 4OF8A 4AEIL 1KYOJ 4LCCB 5CJQH 2HFGL 4K8RC 5TE7H 1A6UH 2C4FU 5KZCD 5KSBB 1FVCB 1F3JB 5ESQA 3D0VB 4X6CA 3GKZA 5DK2B 1S7VA 2AQ2A 2R9HD 4YHMH 4OCYL 2ENYA 1FL6A 3K7UA 4Z7WE 5GRJL 3TO4A 3KWWA 1WITA 4QXUH 2JB5L 3H9SE 1X3DA 5A16A 2FEDC 4K8RL 5GGTH 3HUJB 5DEGA 5IB4A 4M7KH 3HS0B 3D3VD 1R5IA 1UWXK 4AM0A 2FSEB 1UM4L 2V5TA 1NAMB 2YK1H 3SDCB 5GS1B 4ZFOA 1Q94B 4RRPA 5ICZA 5DHYA 2ORBL 5DK0A 4AIOA 2KH2B 5CIPB 3QUZB 2F54B 3L3OA 5EG6C 4J8RB 4PGEB 3VFWB 3OG6B 1VGEL 2W0FA 5MENA 3IDMA 3OXSB 1G7MB 3LQZB 4KTYA 4YAQB 4LNVA 3SO3B 2VAAB 4ODHL 3IJHA 1A22B 4PS4H 4X6DA 5L2JB 3TH2T 2AJ3B 3VWKB 3HPLB 4Y2DB 2J6EH 4LEOB 3LRHA 4HH9B 3SY0A 5L7XH 1V05A 2QQLH 1N5AA 1A3LL 5FGBA 3CZJA 12E8L 4OZFB 4L4JA 3RVXD 1RAMA 2EC8A 2DQCL 3QG7L 4LAQL 2UVEA 1S7SB 1G6RL 4EXPX 4W4NA 2IH3B 3DVGA 4WO4C 1UM6L 1U2CA 3AS2A 4JCLA 2QHRH 1T5XA 1U8LA 2EIZA 5JW4N 3KS0H 4TYUA 5D2LF 2C4XA 3CPLA 4JDVB 4PRID 3U9UB 4GO6B 3DRQA 2VMFA 3X12B 1M7IA 2GYSA 2X4TA 4DTGL 4I18C 3P30H 2ZP0T 4XCCL 2UY6A 3MBEA 3MV9A 4XPHL 5CSBA 1CDJA 4OM0H 1INEL 3MACL 2WZPD 1U91B 4O58H 5AG9A 1F97A 2P8MB 2Z9TA 3FHAA 5INCA 4A2MA 4J2XA 1HDMA 1Y6KR 3G6JB 2H26A 4P48A 3JWDC 2VLRA 1YN7A 2UYLB 4L5FL 4M5ZL 3R8QA 1M6OB 2A73A 4OLXL 4UT7L 2EDNA 4UUJB 4EVNB 4KDVA 1R3JB 2EDFA 2BFVH 3FZUC 5KOVC 1MJ8H 2AK4D 5HYSA 4D9QE 3JVGC 4KHXH 1CL7H 5EOQH 2Q7YB 1JZ6A 5GS0C 5DRZB 3SDDD 5A40E 3QEQE 2PYEB 1T0MB 1KJVA 1A7RH 3JWDL 1WBZB 4KVCH 1IVLA 1SEQL 2P4AB 4WW2F 4PJIF 4BSVA 4F57H 1JTTA 1FRGH 1N4XL 1KB9K 4CBPA 2C3GA 1L6ZA 3SDXB 4J3VA 4GMTL 5TDOA 5C0JA 5JW4M 1IEAB 2VJXA 4GXUN 1QD0A 3DETC 5E99L 2YZ1A 5ITFB 4NN6B 1YMHA 4W70A 1RMFL 4LSVH 1KPUB 4P5MB 1HILB 3GSNB 1CGYA 1RIUH 5T1LB 4HLZG 5I1KH 5DUML 5I71C 5C0FB 3FQXA 3PP4L 3OR7B 1F6LL 1DBJL 2QQKL 3L3JB 4BK5A 2F53D 4JM2D 1GZQA 4U1LA 3V0VA 4KJPD 4YDKL 4X5LA 1AY1L 1IGML 4KY1L 1QZ1A 5C0BD 1CVSC 2ESVB 4P2CG 5JW5B 4JFZH 5KVEH 4ODSH 4QGTA 1XAUA 5C08D 3V0WL 2DBLL 3BJLA 4H0HB 2XPGA 1CFNB 4P46B 4HX1A 1H3GA 4WO4A 4M1DL 1CFTA 4H5SB 1JHKH 1TZHA 3MLTB 4WRLA 3U2SA 2VLJA 4G8EB 1O5DT 2AK1L 4KU1A 1A0QH 4PJCF 4PV8A 1MHEB 4GXUM 2FZ3B 5DDHA 2FLBT 1TENA 5FUCE 4OIBA 1OGAA 4Y89A 3BD4A 3AAZB 2O93L 4I18A 3I75B 4MJID 4X6EB 3QZWA 2HMIC 1IE5A 3U48A 2DS4A 1IGCH 1KENL 2P5WE 4PGBA 4F58H 1J5OH 3CUPB 5DRWB 2CIKB 1DVFD 1RK1B 4NJAH 1H5BB 3N1MC 5AAWA 1QBBA 2P49B 5CJBA 1BF8A 3FCTA 3O3AA 4XRCB 1VEPA 4JG1L 1JGEB 3QDMB 3P2TA 1KIRB 1J0ZA 1CGTA 3IDYC 4Q9QH 4JREB 5J13C 1I9JL 2JK5A 4P3WA 4XMKL 1I7RB 1MAJA 3JVGA 3ARQA 4TRPH 2DQEH 5SWSE 3TJHD 2ICEB 3O81A 3KDMB 1KB5L 5CCKH 4UQ3B 4JM4H 3B9KD 2PTTA 2YD4A 1NC2A 4MJ4A 4GQPH 4XVUC 5DSCB 3VJ6A 1WIOA 2L7JA 4KK5D 2DQFB 4ONOA 3RZCB 3TZVD 3LEXB 4K3DH 1DBMH 4PJHB 4RZCA 2A9ML 4IEFB 5HDOA 4HK0B 1OTTD 2MQ3A 3G5YB 4PJXB 2AS5M 4FQXD 3S37L 1B0WA 4L4VB 4NQDD 3LKRB 4ZD3H 1LWRA 2IGFH 4O2FA 2NW3A 3FO1A 1EJ6A 1RFDH 3CDYA 5I1CL 4N90E 1U3JA 1Q8MA 5TQ0H 1DL7H 2NY1C 4RIRA 2HT2C 4YBQD 4U0RC 1BVKB 3WEXB 4NQEE 3TVMB 1DQDL 1EHNA 5DJ8A 5AZEH 3RRQA 3S3JA 3T4YB 2V2WB 3IDIA 3ULVH 1NMAH 3H3BC 1DQLH 2B7DT 4KVNH 1U8QB 4U1MB 1F90H 5FDYA 5B3JF 2UUDK 4PJGE 4BQ8A 1IL1A 3VRJB 1UGNA 5ALCL 3CSBA 1CXIA 3FO2B 4M61A 1JRHH 4DEPB 4OB5L 1Q9LB 1CLCA 4ZG1A 4QXTA 3EDFA 5CSZA 3AS0A 5D7LD 4JY5H 5E5MA 4NM8L 5D96C 4GRLC 1T3FB 1AO7E 1TITA 3BWUC 1A7NH 1A7OL 3KYNB 4HJJH 4KK8D 4QOKB 1NGZA 3NIFF 4KZDH 4LLDB 2EZ0D 3RWGB 4P4KD 1P2CA 3ILPB 3DX9A 3V4VH 1KB5A 4FQCH 5EOTB 5B39A 5HGHA 3O3UN 1FH5L 3B6SB 4NRXA 5E6ZA 3STZB 3ZE2E 2Z92B 4NT6A 4BZ2L 3UO1L 4XNMA 5JIHA 3V5KB 3L3KB 4K94L 1KF9B 3BO8B 1L9MA 4C4KT 2DTSA 3CFCH 4PLJC 1UQSB 4Q2ZB 2V5RA 2HVJA 5HYQB 2IPTH 1S5IL 2IPUK 4RISH 5A3IC 2W92A 4YX2L 3MA9L 3MRCB 2MWCA 1DQTA 1Z0NA 2DDQL 3SGEH 2VISB 1HN1A 2F74B 3S6CA 4ZS6C 1AKJD 2ARJB 1LD9A 3JBG7 5BRZE 4K2UL 3MRNB 2BHUA 2E8YA 3DUUA 3L9RA 2BP3A 3GMRA 3N9GL 4KMTH 4ZAKC 2X4SB 5H35A 1ZLSL 3QUXC 4N0FA 1JPST 2E7MA 2GTWA 3MNZB 1BD2D 2AV7A 3ESVF 1CFQB 4N0UE 3GUTA 3G5VB 2PF6A 5LWYH 5DJAA 5FA4B 2YA1A 5L6YL 3T65B 3OAZH 3FB8B 1A1OB 2DICA 3AU1B 1D6EB 2IQAB 3LKOB 4PJ8B 1QSEB 3QEHA 3ZSTA 1D5MB 1RIHH 4ISVA 4FZ8L 1A6TB 4QYOA 1JYVA 2JCCE 1A7PL 1PSKH 3JWOL 4HIHB 3RUGA 3QA3B 3BKCL 3CX5K 3VD9A 1SYVB 4YHPB 1RZGB 1S9YA 3ROOB 4ETYA 1JWSB 4OD3H 1AHWB 4M48H 5DVLA 1VDGA 5D8JH 3F5WB 4JFEA 3RHWF 1J1XH 3RDTD 4LDEB 1I7UB 5D7KD 1M7DB 4XCFL 2FEEI 4J1UA 1ND0B 3QT2A 3OKLB 2DIBA 1RZ8A 3O2VH 3VH8B 5EBMB 3CVHA 4HIXH 1DBKH 1I8KB 1BZ9A 5FYKD 2APFA 3CFBA 3BP5B 4RFEB 1F3RB 4GRLA 1KJ3L 2A6IB 1C7TA 5FO9B 5C9KA 2YS4A 3OKKB 1EAPB 3C9NA 1FORH 1GYAA 4M7LT 4UV4L 1RHFA 3KGRA 4J4PC 2EDBA 2FWOB 1CD1A 4C55A 1EEZB 3L1OL 2FHBA 3TWCL 4HSQA 1G7LA 1I1FB 4I4WA 4QRSA 3VI3E 1C5DA 4Q6YA 3KPQA 5ERWB 4XCEA 3T1FB 5D71H 5E2WH 3KJ6L 1U6AH 1F6AB 5FHBH 5T33H 5T3ZH 3B4NA 1ZT7B 1FYHB 1PGRB 2QV2A 1NGPL 1KIQA 4RAVB 3EBAA 1P4LB 4JFFB 3ARDB 1NL0L 3QUYC 4O4YL 1FP5A 4M1CC 4JKPH 4X4ME 2DLHA 4NO5B 3T0ED 3T2QA 3SCMB 1UC6A 1PX3A 1H15B 5F1NA 2R0ZH 1IC5H 4YNYB 4ZAKA 3QIBD 3MCLH 2VZOA 1ZHNA 5KVGH 3QUXA 4UI2A 3MRGA 4QTIL 5I8KL 4U6HB 3I50H 3KG5A 5HY9B 4K3JH 4EI5B 4OCNC 3MJ7A 2H2PC 2X7LB 4GLRH 4B5EA 1MJ7H 2X4UA 5SWZD 4WV1C 1HKLL 1ZA6B 2A0LD 1JYNA 3D39D 2RAMA 5ACZA 3C5ZD 1FLRH 1S5HB 1KNOA 1NGXB 4H25B 3FMGL 5DO2C 1ITBB 4X4YA 4HIJB 3PGDB 2BSRA 1I3RA 4LSRH 4TPRL 5JUEL 1XGUA 4DZ8B 4HEPG 4NQCA 1QSFD 5I1GH 1MAKA 3LN4A 2R29H 1RIVH 3LPGA 4U7SA 3K81A 1F3DH 3P11L 4IDJH 3FHQA 4CNIB 4PR5B 4AIXA 3BPCB 3OV6A 4Y1AE 4N1EA 3DROA 1DFBL 5GGQL 4MJ2A 4BH8B 4WGWB 1L7IL 4PJDF 4Y5XB 3OSKA 4H88H 2WP3T 2CLVB 1MCDA 5BXFA 5FKPB 5L9DH 1MIEL 3MRFA 4OV5B 5F96L 1WCQA 1WWAX 4FQJH 4CADB 5FDWA 1REIA 5IK3A 1GGCL 4X99B 4ORGA 1NCWH 4NQVB 3OTTA 2OMBA 3KYOA 2H8PA 1EK3A 5MI0C 1AD0B 3SE8H 2DOCA 4NKDB 1C12B 1D5XA 2DQTL 4WFGD 4PJEE 2FR4B 3DVFA 2PW1B 3VD5A 3D69B 4M62L 5HVHC 1JZ2A 3F7VB 1T03H 4J4PA 3REVA 4NQTA 3WKML 2D9QB 3EOAA 4DKAA 5TGBB 3UZVB 4XTRC 5EIIB 4OD1H 3ZTJH 3PWLB 5D72L 5GRVK 4PYHA 1U8JB 3NACH 1PEWA 1R3IH 1AC6A 1BBJB 1ZANH 1IFHL 2VDOL 4L8DB 3L5IA 5BVPL 3PWVA 3LQAL 2NY4C 4LGSB 3SKJL 3S37X 2KDGA 4NKMB 4Y4HC 1CS6A 3IETB 4OM1L 5AWNL 3BP7A 4B7IA 5GPRA 3QUYA 2GT9A 1IAKB 2WUCH 3DX7B 4UDUB 4LPUA 1HI6B 3L3DA 3MRIA 3WO4B 3BKJL 1MCLA 3KPSD 1S9WB 4UT9L 5DFTA 3FQRB 1J0IA 1T0PB 5DJYA 3GJFB 2DQGH 1G1YA 4OQTH 4U3CA 1UA6L 4WV1A 1A6ZA 5TQ2L 1Z9LA 3MLWH 3ZTJG 5CLTA 1X5YA 5EZLA 1CD9B 3SN6N 1U92A 3TNMB 1J86A 1HH6A 4IRSB 4YEEA 2FRGP 3ULUF 2FX7H 3VGBA 2VL4A 2CKBL 5JPMB 2H41A 4AIZB 2E7LC 5EBWA 5CBAB 3RNKB 2NXZB 1SY6L 4BQ6A 1UYWL 3DV4B 3DYMA 4M8VA 4S2SA 3OX8B 5L2KE 3S88H 2X5PA 2Y06H 5SX4H 3PHSA 3VD3A 3WS3B 4YHKL 3PL6B 5F6IC 5JOFB 4UU9B 3TA3D 5I1HH 1XGYL 2R2CA 5HBBA 1A4KB 3RWJA 3W9EA 2VE6A 3D2UD 2X70B 2I9TB 2HLFD 4UIKH 4FTVD 1GZPA 3KYKH 1A5FH 1WZKA 3PUCA 3CFDA 4YJZL 5JA9A 4OQ1A 4EOWL 3R06B 1M05A 5IHZB 4CMHC 4OZGB 1DEEA 1DLFL 5ECJE 5HYJB 3ZTNL 1RZIB 4M6OL 2EE2A 4PG2C 1CL7I 2MOVA 3FOMA 4MD5A 4R7DB 2VDRH 3KJ4B 4MQTB 1NEZA 5CD3B 3RWFA 5IUSA 5C0RL 5K9KA 2W9DH 4JPKH 3DXAE 3LOWA 2EO9A 4M5YH 5FA3A 3BXNB 4QRPD 4Y4HA 3LPFA 4XMPH 2NZ9C 2Q86B 1LVEA 3U7YL 5ID1A 1F4WH 4WJ5B 1AQDB 4Q6IC 3ISWA 3O2WL 4Y7MA 5EU6D 2YN3A 5IVXA 2EYTB 1HHGB 1X6NA 4PYGA 3U4BL 1TFHA 4OJFH 2VDKL 4QRUB 1GGUA 3MRRA 5J6GA 4IRZL 5DMIH 4G6AD 4NZUL 4AZ8A 2EH8H 4XBEL 1P4IH 2W91A 4LCWB 5D70H 1FYTB 3ARSA 3RHWK 4CW1A 5JTWA 32C2B 5KSBF 1EEYA 1X5GA 3BH9B 4PRPE 1NLBH 4QKXB 1VACB 1JNHB 3HNVL 5GGSY 1ZGLP 2I24N 1I4FB 1T21B 1S8DB 2H6PA 1IKFL 2HFEB 3HUJF 4NO0A 4FNLH 5I66B 3O4LD 5IFAH 2E7LA 3DMMD 1CIUA 5C0AB 3MPCA 4GRWB 2CGRL 3TC9A 2R69H 4AEIH 3HI5L 1QSVA 2B4CC 5CSGA 2HFGH 4LLMA 2R23B 1LEKA 3OBAA 2C3WA 3T0XA 5B8CC 4R3SB 1IGIL 2V2XB 4PRHE 1UEYA 2VC2L 3ARBD 3VXRE 4PY8J 4Y4FD 5DK3A 3MGTB 5AYUL 4OCYH 5IEHB 5GRJH 5E0QA 4KI5D 5CAYB 5TDNB 1NJ9B 2JB5H 1V3JA 2Y9RT 1CD8A 4K8RH 5C0EA 1BWWA 1RZKL 1X4YA 1AIFB 5C07D 1UM4H 3HC0B 2Q76A 1CVRA 2ZUYA 5TF1L 2ORBH 1LO5A 1MY7A 2P5ED 1T0NB 3WJJC 5MEPB 5B3NA 3PG2A 3IXTA 5E00A 2PW2A 1Q72L 4FZEL 3UJIL 1XCTB 3BDYL 1VGEH 4PG2A 1XMWA 4JGMA 2HJFA 4BK4A 3TBVB 4HCRL 3S35X 4PPTA 2LAGB 2AJZB 2IPUG 3FOLB 4ODHH 3QIUB 5D1XB 4DFHA 3FO0L 2XZZA 4PREA 4WI5A 2X4QA 3VGFA 1JN6A 3PF2A 4IBLT 3KLHD 4JN2B 3TO4B 1CD0A 5FM5O 3KVQA 2PXYC 3KXFB 2CLRA 3SE3C 5DJ6A 1A3LH 2P46B 4Q6IA 3UJJL 12E8H 3QFJB 2EO1A 3UTQB 5JQ6L 2VLKB 1JHLL 2DQCH 3QG7H 3PWPE 1DUYB 4LAQH 3MCG1 4RMUA 4KPHL 4C56B 3T8XB 1G6RH 2LQRA 3S4SG 1PY9A 2YR3A 2BERA 1UM6H 3G6JF 4CU7A 1CZ8L 2IG2L 3QH3A 1FQ9C 1QEWB 3QFDB 3SDYL 3I3BA 4OF6A 5HHMD 4LPYA 4PRBB 5HGBA 5FGCB 1URLA 2VL5A 3X11B 1FFRA 3FB6B 4ONHA 3I6KA 4TUKL 1A9EA 1SBSL 2RGSA 3Q0HA 1AO7A 4H8WC 4G9FB 5JPNA 4JFHE 4OZ4B 4X6DB 4XWOD 4CMMA 2YWYA 4LLWA 1NUNB 2ZUUA 4DTGH 5JMOC 3U0TA 2G9HA 3GBML 2APXA 2GSIA 1XGTA 4XCCH 4XPHH 3SY0B 3FONA 5HHXL 5B3JE 5FYKU 1ROWA 5FK9B 3MJ6A 3WXWL 1INEH 4WWKB 3MACH 5I75B 1ODAA 3SDXF 3OR6B 3S5LB 2XTJB 2R39A 1GCFA 2Y5TB 4H8WL 4GKSB 4M5ZH 1S7TA 4L5FH 4RAUA 5DGQA 1HH9A 1YNKL 3O0RL 3RX7A 4OLXH 5T5NG 4XCNA 4UT7H 3HAEB 4KMQA 4Z0XA 4AENB 4U1JB 2IANB 1PJ9A 1T5XB 5IV2B 5B8CA 1P1ZB 1M71A 3ALXA 5GGUA 2ZZUT 3NIFE 1G7IA 1K8DA 3SDDC 3GSWB 4L9LB 3JWDH 2ZUQB 2EYRB 5JHDE 4PLKC 5BRZA 1SEQH 3P3YA 4G8FB 4QTHB 2V9RA 1SHMA 1Q9KA 4JFYA 4AY0A 3OKMA 4PD4J 4MNHB 4XX1E 1F02I 4G6ML 1MOEA 4HCRA 4GMTH 1LEIB 2RFXA 3D3VA 2MMXA 1EX0A 2XN9B 4U1KA 4TNVF 5E99H 1E6OL 2X40A 4FFWD 3WJJA 4LHUD 3S96A 4QRRD 1FFOA 2VLLB 3LPWA 2XXCB 4XT1C 2HJKA 4APQD 4OCSL 4YH6A 2MSPA 2HLAB 4YDJA 3RY5A 3HG1E 4ZUSA 1RMFH 3VFUB 1BQHG 4U3XA 2BNUA 5CJ8A 3BQUD 5CJ5A 2F5BL 4EIZC 4F7CA 4LFHD 3EO0B 3GMNA 3E2HB 5DUMH 3SGEI 4HGMA 4NNXA 3PP4H 3BN3B 1GOGA 2JCCA 5M94B 2AERT 5DGRA 1DBJH 4R97C 2QQKH 4KK6C 2PXYA 3I3EA 4YDKH 4P5KA 1ZLUK 1AY1H 4NQXA 1IGMH 4KY1H 5DMKA 1YYLL 1CWVA 5F7NC 2VDQL 4E0RA 4Z8FL 1KCUL 1VADA 4OAWB 1CDBA 1H3PL 4OFDA 5EO0A 3V0WH 2DBLH 1DN0B 1KOAA 3A67L 4HUXB 3QJFA 4ODWA 2OJEB 4UBDD 1GL4B 2K1MA 5D9SA 5HJ3B 1EHLL 1BOYA 4M1DH 4GKNA 1WSST 1A4JB 2HFTA 5CGYD 3OKDA 1FIGL 5F89B 2Y5EA 1D5ZA 2KUTA 3P4NA 2AK1H 4BZ1L 1YJDC 4K9EC 5J56B 2W38A 4MQ7B 2FJGB 3SDCD 3VXPA 3QUZD 3F12B 5I1IL 3VFTA 1SMOA 1KENH 3ES6B 3HB3D 3QO1A 3QNXB 4PG9B 4Z7VE 4O51B 3VFSB 1YJDL 4K9EL 5D1ZD 1IZJA 5AD0B 3BP6B 3GHBL 4PJHF 1KEGL 2RR3A 4M1GL 3L5WA 2HG5B 1I1YB 3VXSB 2DWDB 5C0CD 4JG1H 4PJXF 4NM4L 1U58A 3JTTA 2DMCA 4YIQA 3IU4L 1TZHB 3LKPB 1I9JH 3LAFA 3MRBA 4XMKH 4NC1C 3UBXA 4A2LA 3TJHC 1A9BB 1KB5H 5T1KA 4PGCA 5IG7A 4PTTB 3SDDA 4ZSOB 4ZYKA 3ILQD 2F19L 3BH8A 4X4MA 3FRPA 5F9DC 4LVHB 4UZGA 4ZXBB 5GS2D 4KK5C 1U93B 35C8L 3FQNB 4L8BB 3CZFB 3TZVC 2X9XA 5J6HA 5D2NC 2A9MH