2DQDL

Crystal structure of hyhel-10 fv mutant (hy50f) complexed with hen egg lysozyme
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
107
structure length
107
Chain Sequence
b'DIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title Structural consequences of mutations in interfacial Tyr residues of a protein antigen-antibody complex. The case of HyHEL-10-HEL
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
total genus 23
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dqdL00
1W0VA 4LAJH 3TBTA 4LU5L 2VDKH 3QDJB 5I73B 1BFTA 3S96A 1P7QB 3GJFH 4NOFA 1DFBH 3LY6A 1NBQA 1T7ZA 2FRGP 5JA9A 3H42L 5DJXB 4H25B 1SVZA 4LCUA 2NXYB 1E6OH 4UOW0 4L4TD 2HYMA 2BHZA 7FABH 3PWJA 3BH8B 1FNSH 4Y88A 3KXFB 2QBWA 4MJIA 4CRPA 5TDNA 3FQNA 5DRZB 4K3JH 1HN1A 3RX5A 4YFLF 3W0WB 3SGDI 1EEYB 1MF2H 1X7QA 3SKMB 1GIGL 4Q9QL 1NDGA 4JREB 4PGBA 2A83B 1QRNA 4KXZH 5DRWB 12E8L 4A2LA 1BF2A 4JGUA 3ORJA 3OKLA 1AY1H 4L1DA 3ULUL 3IF1B 4EQ3A 3EJJX 1K6QH 1Z9MA 1CCZA 5K9KB 1TVBA 3UEZA 4I3RL 2GKIA 1G7JB 2EECA 3K74B 4PJFE 1JNNL 3C08H 1FL6A 1NMBL 4PY7A 2YUZA 2YMXH 1KBGL 3HRZB 3RPKA 2DYPD 4WGWB 1V05A 4G9DA 4FMKA 4FZ8L 4XPHL 5KVEL 5EIVA 5A2JH 4N0RA 1I8MB 4X6DB 4U3HA 3U30B 3A67L 1DVFD 4Q0XH 5J12C 2Y36L 4M7KL 3FN0L 4PYHA 1WZ1L 5F7WC 3HE6A 1RZJC 2HVKB 2NLJB 1A02N 5EH1A 3C8HA 4RMQA 1JGUL 4JEGB 5F96H 1JGVH 4JFOA 3THML 2B2XH 3HZVB 4GXVL 1OSZB 1QG3A 4FP8L 1DQDL 1U8MA 1HIMH 2AABH 3L5JA 2GJZB 3CXDL 5ID1A 1QYGH 4XHQA 3MMEA 3NACL 4XTRC 1GPOL 1DBKL 3KYAA 4JFFA 3KDMA 4Y8DC 1RZKL 1FFNA 3QNYB 3F58H 1KJ2L 1T83A 5C0GB 1NMCB 3VXRB 3OHXA 1QKZH 4HFWB 3X12A 5E03A 3TA3C 1U3HB 5EORL 4XMKH 2EC8A 2R2EA 1J87A 3IFPA 3LQAL 5KTEH 6CGTA 5D2NA 1F2QA 1FGVH 4EXKA 2DKSA 2FJHA 4OB5H 4PJIE 4ZUWA 3D85A 3QXDB 3ARRA 2ENYA 2NY2C 4S0TD 4XGZB 4OZIA 1RU9L 1RULH 4N0UE 4PJXA 5FA4B 1NAKH 3T65B 3FQWA 4HKBB 4ELKA 1QBAA 4LVOB 4GO6B 5GRUH 2XG5A 2DMBA 5DFVC 5DUPL 4UTBH 5T3XE 3O9WA 4L9DA 4U1JA 3HFML 3DIFB 3T08A 4F9PA 4PD4J 3GHBL 4WTWA 3I3BA 5ERWA 1NKOA 5I1DB 3EBAA 5CP3A 4PRBA 4MX7B 1RZ7L 3QI9C 4HJ0C 3RUGB 5E9DA 5T1KB 2UWEA 3RNKA 4HQQH 3GHEL 3LPFA 1REIA 3ZKQD 3NFSH 3HC0B 4AQ1B 3AM8A 1AJ7H 1Q0YH 1YJDL 3UO1L 2BSTA 2ZSVA 5LWYL 5H94A 4WUKL 4NPYA 3LPGA 5I8CB 4CVXA 3G5ZB 4UQ2A 3MX0A 4YHPA 4I0PD 4D8PB 4OD2B 1A9BB 1S7QA 2GFBB 1IFHL 1QSFB 2CLZA 3U4AA 5I1EL 1FFRA 2BVYA 4NDMB 3MXVH 5CSGA 1VACB 2V7NA 1NL0L 4JPWH 4NKOB 5C07A 2VDLL 2NMSA 1VPOH 3GRWL 4PJXF 4K2UH 2HFTA 5J1TC 5FXCH 3RX7A 2W9EL 2V9QA 2QQKL 4PRAB 4BSJA 1SYSB 3LB6C 3ULSB 5BS0D 5J1SC 1TLKA 4BM7A 2UV3A 4EDXB 2F5BH 1N5YL 1HDMB 3IDXL 2C7UA 4PRHD 5CUSL 2BERA 3VGEA 1NAML 1W72B 5GGTL 3GMQA 1FZKB 1FJ1B 1J8HA 4X4MA 3RIAK 1WAAA 1Q9LB 4DZBB 2VZOA 1QR1B 4NRYA 4QO1A 2HFGH 3O3EB 1H3WM 2AEQH 2SEBB 1LQSR 4FQLL 3UTQA 3UYOD 2DLFL 3TYFB 3SKNB 4KHTH 2OTPA 5LCVH 2Q3ZA 1JHLL 2GJ6E 2RCSL 4H26A 3C5SB 4I77L 1NDMB 3MV7D 3CZFA 4P4KA 2F19H 2EZ0D 5D1XB 5E2WL 4DK3A 4DW2H 4K7PL 2OTUB 4MA7L 3T0AA 1S7UA 2YRZA 5H37H 5K9JH 5HD8D 1OAUH 3WKNA 5MEPA 2VAJA 4HX1B 3MA9H 1A7OL 1JPSL 1S7SA 4KPHL 4QTIH 2COQA 1P4LB 3PGFL 5HVGB 1ERNA 4OSUL 1FZOB 2Q7YB 4FS0A 4JM2D 3BKJH 1ZLWK 1BOGA 1HHGA 1KENH 3PWUB 5ISZB 2Z35A 1YC7A 5TQ2H 5MI0C 1CFQB 1U8IA 4NT6A 1BQSA 1OCWL 5ITFA 5ICZA 4GRLA 2FEEL 2J5LC 1HXYB 4QNPF 3IT8D 4PRPA 3RGVC 1AQKL 1YECH 2PYEA 1WAAF 1MIML 2BVTA 4P2QB 4X4XB 4X7CC 3ZE1E 3X3FL 5A1AA 4HMDA 2DLTA 5DD0H 5B38A 5FECA 3VWKD 3DMMD 2FGWH 1DJSA 4P2OD 3S98A 5CINL 5DO2D 1MLCB 4X9HA 1QP1A 5HHOD 3QIUC 3RI5K 5DJYB 4YLQT 4D9LL 4IMKA 5E70A 4ELMA 3DX8B 3S3SA 4OGAD 5I76A 1TXKA 1I8LA 2Y5EA 1JCKA 3NAAH 1F4YH 1U93A 2YS4A 1FIEA 1YEHH 1IEBA 1BVLB 1R3HB 3IRPX 1UWXK 3OGCB 4R26L 5FGSA 5FUCE 2F8OA 5DA4A 4YHYB 3VDBA 4S1SH 3KYNA 4KRPC 1MHCB 2AW2A 3QR2A 4IOFC 3MREA 2CDGB 4UUJB 4HC1H 1PSKL 2IBZX 1N59B 2DM7A 2OL3B 4APQD 4I48B 1JI1A 2FB4L 4LASL 1T03H 2H8PA 5T5NF 1WTLA 1IAMA 4P9HC 3RVXC 4NQXA 4M6MH 2EH7H 4NKMA 5HGHB 4XHJC 5EBLB 3WYRA 3QO0B 4NO3B 1KCRL 3ZTJG 2Q86B 5CMAA 5EG6C 3ISWA 3DI2B 2X1PA 1KJVB 4EQ2A 4WRLA 5HYQB 5MERA 2VQ1B 1R5IA 2OCFD 5H35A 2DM3A 4JCMA 4OCYL 2ATPA 1XH3B 3CGTA 2X4TB 1ACZA 4NQUA 3MODL 5EU6D 3WFBL 1HOCA 3G5YA 5ESQA 1DCLA 3NFPA 5I1CH 2N56A 4HHAA 3H3BC 5KS9E 3AREC 4ELMF 2X1XR 3C5ZC 4BQ6A 3F7RA 4HH9B 3WFHA 5FYJE 3VA6A 2VO5A 2E6PA 2ITDA 4HKZB 3F7VA 3W5NA 5DZLA 1VEMA 4MAYC 4IMLB 3TWCL 5F3BA 5EOQH 4NBXB 4LSSL 2QSVA 1RI8A 2XQBL 3OG4B 1YEFL 4CADB 5I71C 3M1BB 5GGUA 3MRMA 4D9QE 4X4YA 1F3RB 4NN7B 1JPST 5JPMB 1G7QB 3O2VH 5IMLA 4FXLA 2VN7A 3CH1A 5E7BA 2MSPA 1GC1L 1M71A 2P49B 3QFDA 1VGEL 3ZT6A 2HJFB 4TPRL 3SCMC 1UXWA 3N06B 1NCAH 3OAZK 1FL5A 3SBWA 1FNAA 2FIKB 3KNBA 5DWUL 5BQ7B 4LVHC 1IGFL 3GK8L 3BGMB 1QLRB 3EYFA 3HPLA 5HJ3A 3I2CL 3ARFC 4X8JA 4ODTL 1G9NL 3DETC 2EIZB 5F1IB 1P7KB 4ZXBA 4JY5H 3WO4C 1X44A 2KQNA 3QEUB 4TVSa 2NX5E 5DEGB 1TVDA 1OWWA 4JN2A 2Q8BL 2OYPA 3U4EB 4LMQE 3PV6B 3E6HA 5TDOB 3QA3A 1JI2A 3P77B 5D4QA 4DAGH 4NWTL 1AQDB 3SKUD 1CIUA 4TNWF 5DRNA 4L9LA 4P2YA 1NLBL 1PFCA 4YIQA 1IAIH 2FATL 4LLWB 4HZAA 2A9NL 4OTXL 2XXMB 3TC9A 2HJKA 4NZTL 5DVMA 2F53D 1KCKA 1FNHA 1TZHB 3SOBL 2DQGH 1N2RB 2X1OA 3FOLA 2CIKB 1DN0A 3KPRD 1XGUB 2VDMH 1QSEB 3DSNA 3MNZB 3RL1A 5I6XB 2DM4A 4RIRA 5DZNA 4RAUB 4HDIB 5TGBB 1DLFH 4PJGB 3SE9H 4PTUA 3T0WA 1KTDA 4LQFH 5GRWA 4LLUA 3ES6B 4MXVF 3EW3B 4XRCA 4OFPA 5C6TL 4POZC 2RIKA 1JL8A 3GBNH 3BP5B 4XCYA 3GJEB 3B9KA 3MBEA 5E00B 5D7SH 5JTWA 3K4DA 2NXZD 3RWEB 1T1YA 5D7JA 4MDJB 3SPVA 2R2BB 5I1GL 4K94C 1CF8L 3VXME 4YDKL 2GK0A 3NMEA 3V95A 4B53A 1CFTA 2AJZB 1M05B 3IAPA 1MHEB 4WO4A 2EE6A 2ZUQC 5AZEL 2FJGA 5JHLH 3NABL 3L3JA 1UCBH 4Q6IC 3BQUD 1RZJH 1L7IL 5L2KA 2VDNL 2G5BA 1PQZA 2IAMA 4TNVK 3U46A 3TJHC 5KSBB 1EPFA 2MFNA 4WTZA 3VFNA 1ES0A 3PDGA 3MRQB 4GS7C 3QEHA 4QY8A 1BQHA 5KVDL 1RZFH 2D4FA 4PG9B 2E9WA 1MCWM 1A1NB 2X4PA 1ZLWH 3P4MA 4QXGL 1X9QA 4KZDL 1FFOB 4LLAA 2MMXA 3ARVA 2HG5B 3JV6B 5IT2L 1SM3L 1FH5L 4KH2A 1Z0MA 4AMKH 2BNQA 2EIBA 4FTVB 2NY0B 1NCCH 4HIHB 3VDAA 1URLA 4IJ3C 2E5EA 1F4WL 3CFBA 1NGPL 3EYSH 4IOIB 1I85A 3OXSB 3MO1B 5IW1A 1NPUA 5AAWA 4YHML 1ZXQA 4BFGA 1GOHA 3BISA 1G7IB 4EDWL 4Z7VB 2VWEE 4JCLA 4F7PA 4ZTOH 3QNXB 3SDDB 1OPGH 2OQJB 3Q48A 2ZUYA 2ERJC 4MJID 5TDPA 3D2UB 2VQTA 3DURA 4JO2H 3QWRA 2VXTH 2BZDA 1CICA 5C6PB 4YHKL 1U91B 5IB3B 3RDTC 3L3IB 1KFAH 3KWWB 2BRQA 3SE3C 5J06A 4LSUL 2K3TA 1DBAL 3IFLL 3WXWL 4JDTH 3FQXA 1UM6L 1QRND 1IC5H 1UWXH 1B6DA 1S7RA 1XGTB 2JJVA 3C8DA 1OSPH 1QNZL 3RWJA 2FHBA 1A0QL 2DL2A 4E41A 1OD7A 5F9OL 1IBGH 1KEGH 2EDKA 5CILH 1LD9A 5LBSL 3Q6GL 5F7EL 4ZUSA 3SQOL 4WWKB 3TH2T 3WFEL 3CMGA 3QDMA 5DA0B 3G08A 3I84A 4JPVL 2CIIB 1JTPA 4DKFL 5ITBL 3CU1A 3D0LB 4PRNB 2ZUQB 4RBPK 1JMZA 3MLWH 3NA4A 1Z9LA 3MRNA 4K3GA 4QOKA 3VXSB 5EZJA 5IVXE 3ZKXC 2NCMA 4NQCB 4Q2ZA 2ZUVA 3RHWF 3NH7L 3ZZ1A 1PZ5A 1EK3A 3HNSL 1OW0C 4Z7WA 1ZGLA 4I2XA 3GIVA 3JWDL 2PO6C 2UY7A 1JNHA 1I9EA 3D69A 1WFNA 3BGFC 4KHXH 4PRDB 2CUIA 3O6LL 4I0KA 1RVFH 4GS7B 5CIPH 1DQMH 2ED7A 4OI8A 3D0VB 2R4SH 5DRXA 3WHE0 3WNLA 4JFFD 5BJTB 3SJVA 1MAJA 2HRPL 2WAHA 1U8QB 3T4AA 2Y4SA 4UU9B 4JZNB 1YQ2A 4A2MA 3DX7B 3RAJL 3WV0A 3FTGA 1T3FB 3KPQB 1OF2A 4F9LA 2YC1A 3L7FA 3CFDB 3TO2A 4L8BA 5C0RH 4QRUB 4IJ3B 2RFXA 3NCFB 1C5DA 1A4KB 5IB2B 4EI5B 2CKBA 2IALA 3V8OA 3DTXA 1QFPA 3DV6B 4KI1A 3UC0H 3VFOA 4QXTA 3D85D 3F7YB 4OZHF 4UILH 2ICEB 4PRHE 1NCBH 1IGTB 3S35H 2C3WA 3ZYOA 1FVDA 2ERJB 3I6LE 4JQXA 4P3WA 4RWYH 3TFKC 5IM7A 4H20H 2YEZA 1OARL 3RKDC 3H0TA 3O9WD 3RDTB 4H5SA 4LCWB 2GUOB 1S7VB 3WNMA 3BYTA 3D25A 1DLHB 1KIQB 4DQOH 4Y2DC 3IDUA 1HHKA 3HZMB 3I50H 4MD5A 3Q1SL 3QG6B 4Z7WF 5GGSA 2DLHA 5E9DD 4GKZA 4IBLT 1C08B 5E6IB 5C0AB 43C9A 3MNWA 5EBWA 5MEOA 5CZVL 2BRRL 2EDHA 4EOWL 5A3ID 5C09B 1MCKA 4P57B 1ZHKB 4NC1C 3SGJA 3AU1B 4I13B 2DI7A 3EIFA 3GI9L 1X5IA 4LPWA 2WQ8A 4B7LA 3OKOB 1UB5B 5BXFA 5ACZB 2ADGA 4PJAE 2JTDA 1Q9OA 4NQEE 2HTKD 1T0MA 3C6LC 4V1DE 3PUCA 1I9JL 1KB5L 1E6JH 2F9BT 1BBDH 5EC2A 3ZKXB 2OK0H 3GJFA 1MH5A 3QUKB 3PDDA 5IBUB 5D9SA 1TFHA 1GXEA 5E5MA 5DQJA 5LGHH 4PP1D 4UDTB 4JFPB 5C07D 3BGFB 1A6WH 2X42A 2HA1A 5CAYB 3OJVC 1J0IA 4OFVA 4X7TA 2B5IC 2VDKL 1LHZA 3QSKB 1DFBL 1BQLH 3OKEA 1G7MB 2OSLB 3KPLA 4PPTA 4G8GE 4FQHA 1PBYA 4Q74A 1E6OL 4WJ5B 4WHDA 7FABL 1FNSL 1RK0A 2KQMA 3SE4A 4ZSOA 4FFWC 2BVQB 1R3IH 3B5HA 4DWHA 4RGMB 3RKPA 4K3JL 2A6KB 3BUYB 3PL6A 3VCLA 1MF2L 1JF5A 2XWTB 5C8JA 1P4BH 5KSUA 4OM1H 4Z0BH 3U2SA 2F54B 5EUKB 4XZUA 2EDWA 5GGRA 3BZEB 4MA1C 3HB3C 4P9HH 1FGNH 2CGRH 3GSUA 2R1WA 4NFBA 1QA9B 1NEZB 1K6QL 4LBEA 1FL3B 1OT2A 4R2GC 3DVGB 3LKNB 6FABH 2CR6A 4P5KA 3HI6H 5FKAA 3QQ4A 2YMXL 1XF2B 1KEMH 1LO5A 2QSTA 1LEIB 3T3PF 3ZT7A 1OGTB 3RVWD 3WBDA 2GTZB 4L8CB 4Q0XL 2VLRA 3UTTA 2ZZUT 3T0EB 1JPFB 3VDCA 4QRSB 3SDXA 2NTSP 5DSCA 4ODUB 1G6RB 2EKSB 4CMHC 1JZ3A 3SGEH 3HAEB 4JZJA 1WZLA 3TJEH 1OD9A 4HPOH 2IBBA 4XP6L 5F96L 1JGVL 2VH5H 2IWGA 3ETBF 4GRLD 2B2XL 1DP0A 1ZHBB 1T04B 1HXMB 4KDWA 4PRPD 3HZYA 1ZA6A 3C6LB 5ENWA 5T3ZD 1HIML 2HFEB 2AABL 3VRIA 2J6EA 2PYED 1EHAA 4H0IA 1QYGL 1GHFH 5KVMC 3OQ3B 1TTGA 1UVQB 4QRQB 3VI3F 4M6OH 4XNMA 2QADD 2VISB 4FNLH 1FCGA 1HSBA 2Z31B 2QJDA 3SDAA 2PXYB 2E9BA 1CFSB 2YHGA 1MWAH 1QKZL 3NGBC 3T3ME 4XMKL 1G6VK 3RL2A 4HIJA 2JJTC 3LN5B 1T22B 1YN6A 2MPAH 3B3IA 3NN8B 5KTEL 1Q9WA 4WV1B 2H41A 5T1LA 1FGVL 4OZFH 3ARBA 4OB5L 4MS8C 4GG8B 3QJHB 4HS3A 4RBPH 5IHLB 1RULL 1NAKL 1FO0A 1I1YA 1JTOA 1JK8A 2NY4D 4R3SA 4XMPL 5KSAA 5GRUL 1ZEAH 8FABA 3L95A 4UTBL 3SGDH 3S5LB 2KUTA 3SDXF 4NJ9H 1ITBB 2NY3D 5F7FA 4F7TB 5MEQA 4YFEA 3QNZB 5C0JB 4X4ZA 4PP2B 3EJZD 3NIDF 4M93B 1XEDA 3MGOA 3Q6FA 4Z78B 4AH2B 3V4UH 5KZCB 2MQCA 1UQSB 4HQQL 2A0LD 1KPVB 4R2GB 4ORZC 3NFSL 3ZE0E 2KL6A 1AJ7L 1Q0YL 3ULVE 1WCBB 1RV6X 1YPZE 1SEBB 3BEWA 3RY6C 2YD5A 1OTSD 1TNMA 3MBXH 1Y6MR 3U6RA 5MENA 3G6JB 3U0TB 3DXAB 3V9FA 4LIQE 3MJ7A 5ESVA 3MLXH 1BMGA 1EAPB 3EOBA 4I1NB 3HG1E 4GQPH 1I1AA 4X7FC 4CMHB 3MXVL 1FYTD 2AXFA 4HJGA 3ZDZE 2GSIB 5IF0B 2VABA 1J10A 2QHLA 2NW2A 4JPWL 1UXSA 1VPOL 1F3JA 3RZCB 1MCLA 4K2UL 3MV8E 1C16A 3EFFB 1WT5C 1ZTXH 2EE2A 4MJ4A 5CD5D 3P4NB 3SGKC 4PTTA 1R5WB 5DJ8A 3CX5K 1JPGA 3F6IA 1AKJB 5CLWA 5JDSB 4NCC1 3V0VA 2F5BL 3FB7A 3IDYC 1QLFA 5HSFA 5JHDE 4QRRE 1B0GA 3BPLC 2AV1B 1IAOA 5EC1A 3TIDB 1A4JB 1OLZA 2IJ0C 5F6IC 4MXWH 5GSVA 5TQ0H 2L4OA 1DVFC 3BPCA 1WBZA 1LO2H 5SV4A 2HFGL 4HUUB 1OP3K 2AEQL 4ZXBD 5FYLE 5HTSA 4UINH 3KPMA 1UZ8A 3O11A 1CLZH 1A6VH 4KHTL 5DD1H 2L7UA 3CC5B 5LCVL 4NQVB 3MA7A 4TOYH 3QEQB 3OAYH 5T5NG 5KANG 1G0XA 5KOVC 2F19L 4DW2L 2FWOB 5K9JL 1A6TA 4NQDD 3O3UN 1OAUL 3V8CA 3PE9A 1QSVA 2VOTA 3MA9L 4HIEA 1LK2B 4TSAH 2CK2A 4QTIL 1KG0B 2ZOLA 5B38G 3BKMH 2XN9B 3BKJL 3PV7A 3MLRH 5IW6A 1KENL 3HUJE 3OKDA 5TQ2L 3ULUE 1M7DA 4QHKI 4MXQC 4NNYB 1NLDH 3JTSB 3EOAA 5ID0B 3MBED 1YEEH 3IGAA 4QRTA 1QBMH 2AEIT 3OZ9H 4PJ5B 5D7JD 4LOUC 1YECL 4G6MH 1BZ7B 4EN3B 2B1AH 3BIAX 2Q76A 1UADC 4XNQB 4J8RA 1CQYA 2APXA 5DD0L 1T2QH 3A6BH 3O4LE 4A6YH 4F33B 1X5ZA 3I85A 4WO4D 2FGWL 2YD2A 4NSKA 1QBLH 3O6MH 1ROWA 2PR4H 5I2IB 3RJDA 3B6SA 5L2KD 2AP2A 4KMTH 3RTQB 2IAMD 1T5XB 2X09A 2P8LB 5DJXA 4BUHA 4LL9A 4HC1A 4H25A 4N9GA 5IJVB 3KPOB 3NAAL 1F4YL 3JXAA 3TN0B 1G7HB 1YEHL 5ABDE 5DGQA 3IDYB 3BH8A 4L29A 2C4XA 1TJHH 3KXFA 3BPLB 4C83A 2A2QT 5DRZA 1DN2A 2H9GB 4S1SL 3W0WA 3BP4A 4XBPB 3QQ9D 5F6IB 5D7KD 4HC1L 3UROR 3RWIA 3SN6N 3EO1A 2BNQD 5FYKH 1T1XA 1JMXA 5A2LH 1H8SA 3O41B 1T03L 1U8NA 3HPJB 3W39A 2NY6C 4M6ML 3QDGB 2EH7L 2H2PD 4X6FB 4QHKJ 1B9ZA 1NC4A 2VLKA 3ZHLA 3T04D 3QZWA 1CD0A 4N8PA 1G0YR 3BEVB 2B1HH 1EFXB 5I15H 1M7XA 3EDFA 5SWSE 3QWRD 4W4NA 5GRXG 1I8MA 4X6DA 2P24B 4QXWA 2W92A 1F45A 1UYWH 4G6FB 1YZZA 5I1CL 2W9DH 4X0KB 1WVZA 3VXRE 4OZIE 3HCVB 3MPCA 4WTXA 2NLJA 3R8BB 4M02A 1FORH 5CGYD 4M7ZC 2IPKA 4E41D 1KN4H 3G04B 3GNMH 4CMMB 3HZVA 5IEHB 3IJSB 3UZVB 3O2WH 4NZDA 5DC0A 5FKPA 2LAAA 3VWJC 3RIFK 2D03H 4JKKA 4ZPVB 3MR9B 5EUOB 3CFJB 4R7NB 5EOQL 5FCUH 5I75C 2HMIC 1ZOXA 1V7MH 3QDMD 1AIFB 3ARXA 3QNYA 2UWEE 4U1IA 3O2VL 3FB6B 3W82A 1RJYB 1DZBA 1U3HA 2PN5A 2N1KA 3HR5B 4QOKD 1NCAL 4JANB 3VD7A 4XNZC 3ZMRA 3P4OA 4NYLA 2ARJQ 5JA8B 3V7MA 4CU6A 5BZDA 3O6FB 3NIGE 3QHFH 5DUBA 3BP6B 3DO3A 3QXDA 5AYUH 4TTDD 1MAKA 3MC0A 4XGZA 2MHAB 3RGHA 4JY5L 4H1LB 4I9WD 1AGCB 4LPTA 4X6DF 5C86A 4HKBA 1GCFA 1MFAH 3V4VH 3SJVD 5F9JA 2R9HD 4URTB 3DIFA 3GFUA 3VE0B 4DAGL 3MV9E 5HI4D 4Y5YB 2XTJE 3V5HB 2OP4H 2R56H 1IAIL 4MX7A 2Z9TA 5JQHC 3RUGA 2DI9A 5T1KA 4PJDA 4L3EB 3VWKC 3WLBB 4NWUH 4JPIB 3WDJA 2ENSA 4AYFA 3HC0A 4GAFB 2DQGL 2VTFA 3BN9C 1XGQB 2VDML 4RAVA 2IADB 1HWHB 1N3NA 2Y7QB 1F90H 1N5AB 4Z9KB 3SE9L 4BZYA 4LQFL 1KPRB 4OI7A 4DKEH 4W81A 5JXAL 3G5ZA 1J8HE 4N0YH 4X4ME 4D8PA 2RAMA 2FIRT 3GBNL 1ZVHA 2R39A 4YPGB 4XXCC 3ZO0A 1L9MA 5D7SL 4WTZG 2GFBA 4HS6A 3D39B 3HLAA 1OP3H 4ODBD 1CS6A 3HA0A 3DUSB 4V2BA 1BQHG 5DEFB 4NDMA 4WHCA 1LP9A 4DGYH 4YH6A 4ETQA 2R69H 1JYXA 1WWBX 4XC3H 1LK3H 5F70A 4APQC 3H7BA 5CP7B 2E9IA 1TZIA 1QFHA 1S7TB 1E28B 5IB1A 4H8WC 4KV5F 5JHLL 5TE4H 3VWJB 1UCBL 5IHBA 1RZJL 4ZFZA 1FHGA 1U2HA 3MLSH 1T0NB 1SYSA 1WWWX 3ULSA 4GW1A 4O00A 4MNGB 1IQWH 1HDMA 3D3VE 1CTNA 5HYJB 4DGIH 3RUGF 1A6AB 3TA3A 3CSPA 4PJDF 1RZFL 4QWWD 5D71H 2R1XA 1UKSA 3MUJA 1Q9LA 4O02H 4RRPA 4DZBA 1QR1A 4DTGH 3TBWA 2R23B 2SEBA 4KZEH 1N8ZB 4AMKL 2E8ZA 4HV8B 1HSAB 5ILTH 4RMUA 3TYFA 1XCQB 4KK6D 3SKNA 1S9KC 1NCCL 5L88H 5EO0A 3EYSL 3DI3B 5H2BB 2FGZA 2W9LA 1NDMA 4Z7QF 2PF6A 1JWMB 4JG1H 3VG9B 2IFFH 4YBLC 3NCJH 5F97E 4ZS6C 4I8DA 2OTUA 1LP9F 4WENB 4ZTOL 1OPGL 1EFQA 4JE4B 1T20A 3QI9A 4FQXC 5KANI 4MB4A 4JVPA 3WUWA 4JO2L 4NO2A 2VXTL 3PJSB 2V2TB 2GW5A 3PL6D 1FZOA 3HS0B 2Q7YA 1KFAL 4HT1H 3HZKB 4OKDA 2ESVA 3BRDA 3PWUA 5ISZA 4JDTL 4KWUA 3WFZA 1F97A 2XKSA 2EDTA 3MRBB 4XT1C 1UB6B 3VGFA 1IC5L 1CFQA 2EE3A 3KPSE 4UV4H 4YXKH 1OSPL 1XR9A 5CBEB 3ZKMD 1BFOB 3FCTB 1AFVH 3WJLC 1ZHNB 1IBGL 3ZSTA 2YPKA 5F89B 4JY6B 1KEGL 5CILL 1FPTH 5FUZH 5CBAB 4ZO9A 5DJ0B 4BJLA 2XWBA 1ZE3C 1D5ZA 4PJHB 4P2QA 4M1CD 3BDXA 3CIQA 2L0DA 3UTSE 3UTPE 4XNXH 2VLRD 2YSSB 1MLCA 2DWDB 3UTTD 1FDLH 1V3MA 1TCRB 3MLWL 3DO7B 5LQBH 1RUQH 1SBSH 3DX8A 4ZS7H 2DJUA 4X99B 5KG9B 3SY0A 3H9SB 4RGNE 35C8H 1ED3A 1YNTB 4FG6C 4UV7H 4RMWA 2H32B 4KHXL 3OGCA 3VXPB 1RVFL 1DEEB 1H3TA 3AXLB 1DQML 3H9HB 4ZNEE 1WFTA 4O2FA 4M6NH 2R4SL 4JGMA 2X4RB 2FYYB 2H3NB 5BOPA 4WFEE 3MRRB 4UUJA 3QUMB 1N59A 2OL3A 1NANI 2ZSWA 4I48A 3SDAD 1NCDH 3WHXB 4R0LC 1SMAA 2VR5A 3T2QA 1GOFA 2DS4A 4DGVH 4UI2A 5C0RL 3FFCE 5DI8A 3MRKB 3VGHA 5IR1A 3QO0A 2Y6SC 4NO3A 3DHMA 4HF5H 2B4CC 5TE6H 5T1LD 3ARBD 3CJJA 1KJVA 3UC0L 1YEIH 5CZXD 1KELH 2VQ1A 3UCRA 4UILL 1NCBL 3S35L 5FCSH 5IFHH 2P5WB 4C56E 1LWRA 2WK2A 1XH3A 5DJCB 4U4BA 1Q94B 4FQXB 4RWYL 5KSAD 2HT3D 4H20L 2BNRE 4OCLC 4CN4A 1U8PB 5HHXH 3C9NB 5DYOB 5IOPA 4AEEA 4OUUB 5DJAB 3PGDB 4LHUA 3EJYC 3IFOB 3GUTA 1U95A 4Y1AB 4HH9A 4DQOL 2YUWA 3FT3B 3I50L 5EN2B 4C55A 1VFOA 2R0ZH 1QHOA 1S78D 1JGDA 2WINB 2ZPKH 4HKZA 3VXUB 1IEAA 3V6BR 1RY7B 3P11H 2ICCA 4M8QA 2IPUG 4P99A 4IMLA 5IB4A 1U8OB 1D5IH 2CMRL 3TNMA 3ZYZA 4CADA 4ONFH 3NCCB 4F7CB 1AO7A 4XAKD 4GRWE 2EYTA 1KN2H 1S9VA 1LE5B 3FFDB 4LP5A 5HPMA 4HBQA 5B21A 3SQBA 2HRLA 5CGMA 2HJFA 3QIUA 3G9AB 1VGKB 2DBLH 4AENA 5I1JH 5IMOB 2FIKA 1E6JL 3MRIB 3O81A 5BQ7A 5GISH 1BBDL 2OK0L 1PY9A 3BGMA 4U1NA 5LJYH 1QLRA 2H1PH 3D9AH 4YDJB 5F1NB 5J4MA 5LGHL 4UDUA 2W65B 3T77A 1U36A 1Z2KA 3VFUB 2EIZA 5F1IA 1A6WL 1P7KA 5HYSB 5GS0D 1NFKA 3NFNB 3LKSA 1YMMB 4QRPB 1BQLL 1IKFH 1DR9A 3PV6A 4Y5VB 5JPNB 4R0LB 1J11A 2NY1D 5HDQH 5F7MC 4KMQA 4I18B 4ONHB 3HMWH 4W6XB 2E6QA 4CW1B 4WU5A 1N2RA 1XGUA 5B22A 1QSEA 3MNZA 2G75B 1NCUA 1P4BL 1PX3A 1DUYB 2D31B 4OM1L 4Z0BL 5BRZB 2AJYH 1V3KA 1ZLUH 4P9HL 1FGNL 2CGRL 3VFWB 1G7LB 4RMSA 1TVHB 3BP5A 1U92B 3DWTA 5JORA 5E00A 6FABL 2YUXA 5EOCJ 3HI6L 3RWEA 4P3CH 2CRIA 2R2BA 3AREA 1T1WB 2E9JA 3MLUH 3C5ZA 4Y16B 1KEML 1CDIA 4MD0B 1PY4A 1LE9A 2PYFB 4M5YH 1TZGH 2AJZA 1M05A 3E3QE 4LSPH 4PRIB 2BSRA 1C5BH 4PJ8D 3QB7C 4MAYA 4WFFD 5F6HI 4KKAD 4Z7UA 5D2NC 1UGNA 1FG2A 4WW2C 5C08B 3TJEL 4HPOL 4JRXE 5D5MB 3TIEB 5KSBA 4RDQG 2VH5L 5SV3A 2VKWA 1I3VA 1J1OH 3EYQD 5J56B 1NFDE 2HLAB 3DGCR 5AZ2H 1MWAA 5F7NC 4OBRA 4GT7A 4PG9A 3HE7B 4ZDHB 3SCMA 4HK0B 1GHFL 1FFOA 1I75A 4CBPA 5K9OB 4Y19A 4M6OL 5CFHA 3VRLE 4WI4A 3G5XB 2HG5A 4OZFA 1MCSA 2GI7A 1QR4A 3QQ3A 1E4JA 4XMLH 5F1SA 1MWAL 3OJMB 4ODVH 3W9EB 3O8XC 3MO1A 2MPAL 1CFVH 2V5TA 3R06A 1NC2B 4HFUH 3AM8C 1FN4A 3UXFA 3O2DH 2FJFA 5A3IC 2DQJH 1G7IA 3R1GH 2NXYD 4KFZC 2V5RA 4N0FB 2R29H 2QKIB 5DFTA 3BP7B 3SDDA 4YDVA 2OQJA 2X7LB 2X9WA 3KXFD 4HPYH 4GBXB 3D2UA 4WFHE 4L3AA 4MA8H 4Y8AA 4FHBD 3W0WD 1F6AB 4OLYH 4J12A 5IB3A 1ZEAL 4AIZA 3L3IA 1LEKB 4I2XE 3TCLA 3JVGA 4NJ9L 2ARWA 3EDJA 4Z7UF 5BZWB 5GGQH 4I9WE 3BPOC 1XGTA 5KSBF 3KPPB 1OT1A 3B9VA 5LXGH 3VD3A 5F6HJ 4PJFB 4QHNB 4PP1C 5L8JB 1PLGH 3L3HB 3V4UL 3KYOB 1JVKA 1NC4D 2VLKD 3R0NA 1L6XA 1UZ6E 5HBBA 2PCPB 4JLRA 3HMXH 3WN5B 1IMHC 4QF1A 3ZKSD 3MBXL 1KPUB 3HR6A 2AV7B 2WSKA 3WL9A 4HWUA 2X4NB 5DURB 2IMNA 3D0LA 2XFXB 1F4AA 3C2AH 3CSYB 4KUZL 4PRNA 4PJ7A 3LKRA 3OF6A 1O5DT 3VGDA 1MJUH 2IH1B 3MLXL 4Q6IA 4QXUH 3ZSSA 2IPTH 3VXSA 5DR5H 3QUYC 1WITA 3FB8B 4NQCA 4CVWA 3IJYB 1WZKA 2OI9B 5T1DH 4PRDA 2DLGA 5GJTH 4H8WH 3TH3T 2BOCB 2Z8SA 5HGBB 1S5HB 4GKNB 3D0VA 1Y0LA 1IGIH 1ZTXL 3LS4H 5H37G 3MCLH 3X13B 1EJOH 1U8QA 1ZKAA 2P4AB 3MACH 4NIKB 4JZNA 5FGCE 1JYWA 3RFZC 2MKWA 2D9QB 3KPQA 3ARYA 4KMLB 4MJ6B 2YD8A 1U3HD 3CFDA 4ZD3H 1YY8B 4U2ZA 2QQLH 5K33A 4RNRB 3VJ6A 4LRNH 3O8XB 1A4KA 5TQ0L 4MXWL 2DQTL 4N0UB 3DV6A 2EKJA 4JO1H 1LO2L 3GEWB 3NZHH 1RUAH 2ICEA 4N8VA 4KJQC 5DJ2B 4UINL 2VZ1A 1MSPA 5B3JE 5C0BE 1CLZL 1A6VL 1L6ZA 4N0CC 4RA0C 1BIIB 2AXGB 4PJ7F 5DD1L 3GMMA 4FQJH 4Y5XB 4TOYL 3RDTA 1KLGB 3SE3A 1KJMB 4LCWA 4Z7OE 1NJ9B 4JFEE 4P46C 3WEXB 1DLHA 1KIQA 1EH9A 3SE8H 4ZG1A 2DQFB 3HZMA 3KHQA 3DV4A 3QBTB 2QADC 1S9XB 5T1KD 5L9DH 3FQRB 5E6IA 4F2MA 1UJ3B 1MUJA 3DLQR 4HZLA 5C0AA 4NKDA 2BNUA 3QH3B 4S0SD 3DBXB 4NO5B 5C09A 4C58B 2APFA 3BKML 4P57A 1ZHKA 1A6UH 2EDNA 1MOEA 3MLRL 3DYOA 1F11B 1CU4H 1I3RA 4ZSOE 3BZ4B 3OKOA 1UB5A 1JRHI 3AB0B 4FXGB 4YK4B 3IRZA 5ACZA 4G6AC 1NLDL 1PEZA 5I8OH 5I1KH 4A6YA 1EGJL 5B8CB 2IEPA 1YEEL 1B90A 2NQCA 1LILA 3GMLB 1QBML 3OZ9L 4L3CB 2OZ4A 2NY4C 4G6ML 1IL1B 2F74B 4QTHB 4WY7H 2B1AL 3E2HB 1T21B 1H3PH 2DQEH 3QUKA 4XBEH 43CAB 4JKLA 2J8UE 1N7MH 4KJWC 5ESAB 5T5FH 1OW0A 1T2QL 2NY3C 4RISH 4A6YL 5ANMA 2PO6A 3UBXI 1YEKH 1SEQH 3B4NA 4LSRH 2NNAB 4RX4A 3EJZC 1QBLL 4XH2B 3BIBX 3O6ML 2PR4L 4PJBE 3ZDXF 5EBMA 5B39A 2F54E 3NCMA 4UBDD 2XACC 4PG2C 2A0LC 4LEOB 1G7MA 4K9EC 4KMTL 4NUJB 5FUCC 5IMMB 1VFMA 4O58L 4HWZB 5TFSH 2OSLA 3ALWA 1ORQB 3ILQD 1OTSC 3V6FB 4TUJA 4XB8A 1UACL 4WJ5A 1GZQB 3QFJE 3FB5B 4P2RA 2BMKA 1TJHL 3QZWG 4P23C 3REVA 2ADJB 1MI5E 2A6KA 4J6RH 2XWTA 2DKMA 5J6HA 3VFSA 1ZT4B 5EUKA 2NY2D 5JR1H 1JV5B 4LDEB 5FYKL 3BZEA 4MLSA 1HQ4A 3EDEA 4R90H 3M45A 3EO0B 2D7QA 1DL7H 5IV2B 1FL3A 4K7PY 4W6YB 2B4CH 4KRLB 1ZMYA 3DVGA 3QIBC 3LKNA 2HVJB 3MYJB 5M95B 5D1XD 1UM4H 4P46B 3OL2A 5CD5C 2FSEB 4ZOEA 5C2BL 4Y2DA 5FB8B 1EV2E 1FC2D 2B1HL 1JTTA 4K7FA 3QI9D 4NO0B 5I15L 5CKAA 1OGTA 4IRSC 1XGPA 3IDMB 5KJRH 4Z77B 1UYWL 3QHZH 5D1QB 5IVZB 1VESA 3FOMB 2ESVD 1JPFA 5ISZD 2W9DL 4QRSA 1I7UB 2EDLA 2E7CA 3HAEA 1FORL 3QDHA 1JWSA 4OBSA 4GRMB 1KN4L 3BGAA 1ZHLB 3O2WL 3KYMB 1H0DB 4LAQH 4Z76B 3FO2B 1H3GA 5K9QI 3C6LA 3BRFA 2HFEA 2D03L 5D7IE 2XTLA 4J3XA 5FCUL 4PYGA 1TNNA 4P2QD 1UVQA 4QRQA 4BSVB 1V7ML 1RUKH 5IQ9B 4ZUUB 3VXNB 2VISA 1T1ZA 2Z31A 4HEPG 3P0YH 1LO4H 3DUHA 2WBJC 4JJHA 3QDAA 3VXQA 3QXUA 4UNUA 3EAKA 2YA1A 3MTRA 4G6JH 3MSPA 1WF5A 2VUOA 4UT9H 1FLTX 5MENE 1T22A 1RPQA 1PG7X 3U9UA 5ACLA 3RY4A 3IXTB 5GS2H 3QHFL 2EC9T 4GG8A 4XPTH 5AYUL 3RBGA 2CDFA 3A6CH 1KT2A 1FZMB 32C2B 3L6FB 4X5XA 1N6UA 2AEPH 4AEFA 1MIEH 3P9MB 4JRYE 1KACB 3H9ZA 2YK1H 3ROOB 2H6PB 1MFAL 3OV6A 3V4VL 5HI5D 5C3LD 3S5LA 4UT6H 1KCVH 3UPCA 4Y7MA 5D7JC 2AK4A 2YRLA 5C0JA 1MFDH 2YZ1A 2OP4L 4JHZA 3RY5A 2R56L 2BHUA 4OF3A 4OGZA 5IB5B 3BESR 3QUXB 3UDWC 5HDOA 3ALPA 1U8KA 5BV7C 5CEXA 4NWUL 3PQYA 3QIBB 4U3XA 5DFWH 1GGUA 1WCBA 2FEDD 4HJJH 3BHBA 1A7PH 4U33A 4XVJH 2P1YA 1F90L 3G6JA 5CSZB 1WWCA 4F7MB 4HG4K 2DB8A 3R0MA 4DKEL 4CDGC 3GMPB 3RWFA 4N0YL 3M07A 1WBYB 2OM5A 5D96C 1PD6A 3T8XB 1DQTA 3L3OA 4LHUD 1P69B 1GGIH 1MPAH 1BWMA 3MFFA 1IC7H 3QQ9C 2GSIA 4DGYL 5J89A 1MCFA 2FHFA 3K3QA 2R69L 2AGJH 4JFDE 4XC3L 1LK3L 4MNQE 5DJ6B 3TVMB 2LAGB 3PWNB 3T2NH 2UY6A 1X3DA 4RRPG 3RZCA 3ZE2F 1KIRB 1MCDA 3ESVF 3PABB 4PGJA 3EFFA 5TE4L 4YNYA 3P4NA 1AO7D 3GSNB 3DVNB 3MLSL 4UTAH 2AJ3B 2YA0A 4X5WB 2OJEB 1CI5A 5DHVB 1AKJA 1ETZB 3L3KB 2VNCA 1IQWL 2P5EA 2WBJB 3KS0H 4TNWK 4X6EB 2C26A 1AR2A 2EDDA 1D3CA 3T2OA 4DGIL 5I1AB 4O9HH 2P8MB 2XKNB 4WHTB 5D71L 4U1GC 5JW5A 2JJTA 5LVEA 3TIDA 1A4JA 3T2PA 4XVSH 4O02L 3WUWG 1QLEH 2NX5B 5T1MB 5J13C 2W59A 4YAQB 4DTGL 4KZEL 5CP3H 1IC4H 3G6JF 2VDOH 1K4CB 5CGYC 3FZUC 3TPUB 1D9KC 5ILTL 2BY1A 2XN9E 4JM4H 2FZ3A 2RJMA 2DJSA 4NQVA 5L88L 3QEQA 1OGAA 2AS5M 4YHIA 5FK9A 4JG1L 4YZFE 4DOHE 4HSQA 3NCJL 2IG2H 3JV5A 2I5YH 2APWA 2A74B 2ZOKB 3GM0A 4FQIH 1P5UA 3IYLW 4XHJD 1LK2A 5CJXC 3LHPL 1KG0A 3OKMB 2EH8H 3DRQB 3VGAC 4HT1L 2X4QA 1QSED 4YEFA 4KQ4H 1Z6JT 5CJOH 2V9TA 5DJZB 1YQVH 4JFHD 1OWRM 1IGMH 4YXKL 4CVZB 4UV4L 1RK1A 4KTEH 4NNYA 5ID0A 1AFVL 5EZOH 3X14B 2CLVB 4TTDC 3VXMB 1MJ8H 1FPTL 1HH9A 4X6CE 4PJ5A 5FUZL 3ARED 4UQ3A 3MCKB 3Q5OA 5EBGA 1PZUB 4XPFH 1G1CA 3MROB 4H0GA 1SYVA 4XNQA 3TLRA 4F8TA 3DVFA 3C6SB 3S37H 2VLKE 4F33A 1JN6B 1WISA 2WNGA 5HI4C 3C60C 5ETUB 3L9RA 5IIEB 4XNXL 4LLYA 4GLRI 4FMFA 1WT5A 2DAVA 5IROC 5I2IA 1FDLL 5K59F 1PEWA 3EYVB 5LQBL 3FQTA 4NFCA 3SGKA 1RUQL 1SBSL 4YGVB 1IARB 4ZS7L 4HUVB 2P8LA 1I8KB 5IJVA 2W0PA 35C8L 4P5MA 4UV7L 3TN0A 1RZGB 1G7HA 3OJDB 4N9OB 3STLB 1KNOB 2GSGB 2X44D 2DQIH 2DYPA 4HKXB 2VDQH 4HCRH 3KG5A 3T4YA 1INDH 4M6NL 2H9GA 4U1GB 3BT2H 4IIQC 4XI5C 4XBPA 1CGSH 2VLJA 3UPRA 5TH2A 4Y19D 1DVFA 4GXUN 5E4EC 5HVHB 4X98B 2C3GA 4U0RC 4QCIB 3DETD 3WCYA 1J12A 4FTVD 3O41A 5I30H 4DGVL 2NY0D 4I4WB 5JW4N 1D9KB 3HPJA 4DCQA 1IEHA 3GSVB 4LHUG 3QDGA 3V6OE 4LSQH 4HF5L 5FO9A 5TE6L 4ETYA 1KTKE 1NBZA 3LH2H 3SDDD 1YEIL 3QXVA 1KELL 5JOFB 3BEVA 1KGCD 3JWOC 3D2UD 5IFHL 3EYUH 2X9XA 2ICES 1F2XK 4OIBA 4GAYB 3AGVA 2P24A 5HHXL 2Z8WC 3GMNB 3PP3K 1OM3H 1OAZH 3MNVB 4QWWC 4NGHH 3HRPA 5HVFB 2PTVA 3H7LA 1S7WB 3RZWA 2BCKB 4OAWA 3MUZ1 4KKBC 2VSDA 5I1LA 3RHWK 2V7HA 4CMMA 2R0ZL 3IJSA 2IQAB 2NY7H 2WIIB 3R4DA 4POZD 4D9RD 2ZPKL 2YWZA 1AHWC 3K46A 3P11L 5SWQA 4XB7A 4DKAA 4U7KA 5EUOA 4CJ0A 3CFJA 4R7NA 1D5IL 3FRPA 3Q3GB 5AG9A 3BZFB 1AIFA 4ONFL 2H26B 1EO7A 1T4KB 4PJCE 4ONGH 1KN2L 5IVXB 1RJYA 2D9CA 3C60B 5FA3A 4Z7NF 1CXEA 2AJSH 3OF6D 3E6FB 4HIIA 3HR5A 4I0PB 4XCNB 3VXSD 2DBLL 5I1JL 4NQCD 4JANA 5GISL 3PL6C 4U1LA 1FP5A 3TJHD 2H1PL 3D9AL 3OWEA 4R4BB 4L3EE 4W70A 2JCCA 3WFCH 3MUGA 5FGBC 1OL0A 4WI3A 3ZKMC 3CSGA 1PX4A 4K9EH 4PV9B 3TGXA 4E0RB 2K7PA 5IHUH 1NANH 1IKFL 3CK0H 4U0RB 4G8FB 4C57C 1K3ZA 1I4FB 4YHOH 3V5HA 5HHME 3TO4B 2W1NA 4M1CC 2C3HA 5HDQL 2HN7B 1QO3A 4FFZH 4RWHA 3ZLQC 4PUBH 1X4ZA 3HMWL 4IRJC 1TITA 3PHOB 4PRHB 1JZ6A 4JPIA 3DX9A 5BVPL 5C6WH 5EUOF 4OF8A 2BXYA 1NUNB 2WW8A 1XGQA 1MY5A 1ZWIA 4LCCB 2Y7QA 2AJYL 1N5AA 5C0EA 1FV1A 2LTQB 4J23A 2BVPB 5IHZB 3NIFE 1XCTA 1RHFA 4LPCA 3WDHA 3RDTD 3VFMB 4OCMC 2VXUH 4YPGA 3QXWA 3TBVB 4LCWD 1X5HA 5E6ZA 1T7XA 2XZQH 3D39A 5E08H 2ZG2A 4P3CL 4MCZB 3DUSA 4UIMB 3MLUL 2WUBH 4UB0H 2QHRH 4ODHH 5E6ID 4M5YL 1TZGL 5C0AD 4U1MB 5CP7A 2EDEA 1XGRB 1E28A 1AHWB 4IHOB 5I9QB 4LSPL 5C09D 3VWJA 1C5BL 1J0HA 4OZFG 2X05A 3V5DA 1BFVH 4PJAB 2NZIA 3UPAA 4NQEB 1T0NA 4V1DB 3TBYA 3MV7A 3RVUD 2V5YA 1A3LH 1BZQK 4JAMB 5EOCH 4G42B 1J1OL 4L8SC 5HYJA 1PVHA 1A6AA 3DSFH 5AZ2L 1VADB 2Z92B 1RHHB 4XP5H 1DANT 2N4IA 4LFHD 2P45B 3P2TA 1BQUA 3O2DA 1EEZB 4WI9A 4ALAH 4D0DB 2ARJB 2FR4B 2R23A 4U3CA 5FF6B 4WUUE 5GSRB 4HGKC 1N8ZA 4HV8A 4XMLL 4RX4D 4PV8B 1OP9A 4U1KA 2ORBH 4ODVL 4F3FB 5EU5B 4P2OB 1S78C 4G8GB 4CVUA 2R2HB 3NTCH 4KQ3H 4OQTH 5E8OB 3CVHB 1CFVL 1TETH 2W07A 1F02I 4HFUL 5HHPB 1JWMA 3T09A 3O2DL 1K3IA 2DQJL 2BK8A 5DVNA 5GIRB 3CLEH 3IJHB 3R1GL 3L5XH 2R29L 3GJFK 3MJ9H 1HCFX 1JWUB 5EULV 5FYKD 4FOMA 4K55A 4P2RD 4YWGH 2IPUK 4HPYL 3L1OH 3QAZC 1QTYT 2KPNA 4OZ4B 3CPLB 4YUEH 4D0CB 1TJGH 4IRJB 4MA8L 3VWKA 2V2TA 4OLYL 1BP3B 2ED8A 2Q3AA 4HBCH 1KTLB 4E5XB 4HUMB 3B8YA 3BAEH 3HMXA 1DTUA 5GGQL 3KLHD 3MRBA 4TN9A 1OTTC 2IANA 1WBXB 3ULVC 3TFKD 2GITA 5LXGL 4FXKB 1GZPB 2XNAB 5MHSE 1PLGL 5BV7H 4TVPD 4CU7A 3LQZB 3GSQA 2EIEA 5J8OA 4P59H 5F89A 4JY6A 4S1RH 1GYAA 4I5BA 4XXCA 4LF3B 1P4IH 3DUUA 3F5WB 4U6HA 1EXUB 5CBAA 5GS0C 5F9WB 1N64H 3HMXL 3T1WA 1JHKH 4G9FA 1HHJB 5IG7B 3D48R 2CKNA 4EVNB 4PJHA 4Y2DD 1KXQE 2CRMA 4CNIA 4APQA 5J11C 1GGYA 5ICYB 5FV1L 3VFVA 5SWZE 3C2AL 2YSSA 3IAQA 3T0ED 2XWJB 1HKFA 5GRVK 1ZAGA 1MJUL 3V6ZB 4QXUL 2FLBT 2IPTL 3L3GA 5DR5L 3DO7A 4XP4H 4PR5A 4OV5B 1ORSB 1OP5K 4K3EH 5KG9A 5D7LE 3H9SA 1EZVX 1D5XB 3MJGX 1JHTB 4M4PA 1PG7H 1H5BC 5T1DL 5GJTL 4H8WL 3C6LD 3VXPA 2GY7B 1DEEA 1ZGLP 4HULB 3AXLA 1CR9H 3PP3H 5IK3B 3H9HA 2LU3A 4N8VG 1IGIL 1N4XH 2X4RA 2H3NA 2MOVA 1W0WA 3LS4L 3MCLL 3ZDYE 1MFBH 5CEZE 3MACL 3VG0H 2Z31D 2MCPH 5INCB 1BD2E 1YN7A 4MQSB 2PXYD 5E8PB 3U0PB 4F80A 1FFPB 3EYOA 4WNQA 3IDIA 4ONOA 1A2YB 5TPWH 5IFAH 2VL4A 4ZD3L 4R96A 3MRKA 2QQLL 1AO7E 4LRNL 4Y1AE 1QVOB 2VRAA 4PJ8C 1SY6H 1BJ8A 3UP1A 4JO1L 4P4RB 4PJHF 2VLLB 3NZHL 1RUAL 2V5MA 4KKAC 3ILPB 3O6KH 4X7DC 1INQA 1AD9A 4ZUVB 3ECBA 3G6AB 1Q94A 4FQXA 4XX1E 3QAZB 5ADOH 1U8PA 4FQJL 3C9NA 5DMIL 5DYOA 4GKSB 1S8DA 1WIOA 2AK4D 4CAGA 5DJAA 3AROA 3GMOB 3MLZH 3IFOA 4LEXH 5DC9B 3HB3D 3SE8L 2P8PB 3FT3A 1IKNC 3K2UH 3J7HA 5EN2A 5EIIA 3SO3B 2A6JB 5L2JA 5L9DL 5D6CA 5J9PB 4OLXH 5KZCD 3Q5YA 3VXUA 4LFHG 3WJLA 4M61B 1S9YB 4R2GD 3ULUC 2AJXH 5C0CE 3E1F1 2ZCHL 5JMOC 4M6AA 4NRXA 2A77H 5I73C 1A6UL 5J7CC 3FO0H 3OKNB 2NR6D 1CU4L 3KPRB 5E1AA 4GMTH 2R0KH 5HDBE 2PTTB 2QQNH 3DXAD 3HG1B 5B39G 3BKYH 3BUTA 4O4YH 1HEZB 3FFDA 1LE5A 4FQQB 5I8OL 5I1KL 1YMME 3S3PA 25C8H 3BWUC 4LHQB 1RURH 1VGKA 5HHQB 2O5ZH 4MAUL 4X9IA 5IMOA 3MRIA 3VGGA 2F53A 3ELAT 4WY7L 3PXJA 3OB8A 2QV2A 1DQQA 3MV8B 1H3PL 2DQEL 4XBEL 5I71B 4J3WA 4YDJA 5F1NA 1N7ML 3EZJB 4CGTA 2W65A 4RISL 5F7KC 3RZCD 1XF3A 3VFUA 1YEKL 1SEQL 5HYSA 4FQPA 3MRGA 4LSRL 2N7BA 3QULA 3INUH 3VRJB 1XGYH 1I1FB 1BX2B 2CKBH 3ESUF 4QRPA 5F3HB 5JHDB 3BQUB 3AAZA 4QRRB 2BVOB 1AKJD 5TFSL 3JBG7 5JPNA 2VN4A 2WBWB 2P47B 1RZKC 4R0LA 2CDEA 2P5ED 3B2UC 3PP4H 4M1GH 5JOPE 5DQDH 1HYRC 5C0ND 1IZJA 1M1SA 4I18A 4ZPTB 4ONHA 1WWAX 4CW1A 2DWEB 2HT4C 3ROLB 4WI7A 4J6RL 3ZT5A 3M17B 4U6TA 3I02B 3AS0A 15C8H 1MCRA 4GUPA 4X6BB 1RQ5A 1JP5A 4MS8D 5KSVB 5JR1L 1U8JB 1LVEA 3L7EB 5C9JB 1YMHA 4OZGE 4R90L 1G7LA 1PJ9A 1W8NA 3KYKH 1TVHA 1DL7L 1FNGA 4LCYB 3TBTB 3QEQD 3HAEG 1U92A 2B4CL 3S96B 3S7GA 3PHQB 1R24A 1UM4L 3MLYH 1T1WA 1YNKH 3JWOH 4MD0A 2BHYA 2PYFA 2FX8H 4JO3H 5IVNA 1NMCC 3PWJB 1T89C 3QJFA 3HUJB 4PRIA 5KJRL 1WCQA 5HHNB 4OIIH 1FRGH 5TDNB 2W0KA 3OKYA 3QHZL 2M8XA 4JFXB 1AC0A 3SDYH 2NZ9D 5IBLC 1X7QB 1NDGB 1JRHH 3H3KA 5D5MA 4PGBB 1QRNB 4R9HA 3OKLB 1CXHA 3PGCB 4LAQL 1SHMA 2OJZH 4OCXH 3QCVH 2HLAA 1HNFA 4PJ5D 5F8RC 1TJIH 3FN9A 5JW4Q 3HE7A 1HWGB 4LVOC 3O4LB 4LVEA 1TVBB 4X9FA 4HK0A 4K8RD 4Z0XA 5K9OA 4J3OC 1RUKL 4PY7B 3PXHA 2VIRB 4WW1A 3OKKB 2WLYA 5FDWA 1FNFA 3P0YL 1LO4L 5DZOA 3S5LG 1QFUH 3TCXA 5DLML 4G6JL 3ZYIA 4N1EA 4UT9L 3MGTB 1Q72H 3BXNA 3RTQD 1A7QH 1LO0H 4N68A 3HE6B 3GBLA 2LABA 3CFEB 4HWBH 2LVEA 3OXRB 3TN0D 2QKIA 4RQQB 3BP7A 4JFOB 1WZMA 4JHAH 4XPTL 4Q97A 1KJ2B 3A6CL 4GBXA 2AEPL 1U8MB 1MIEL 1QUNA 1F6AA 2IMMA 2VLJD 2GEEA 2YK1L 4HXAH 1OP5H 4LLVA 3VI4F 4JJ5B 4OF5A 5LG1A 5ID1B 3F12B 3ARZA 4UT6L 4GJTB 1KCVL 3MMEB 2Y5TA 5DMJB 1CD1B 5BZWA 5HY9B 1FFNB 3TPKA 3WD5H 5C0FB 3JV4A 3CZJA 4XP9H 1MFDL 5D5MF 3KPPA 2FO4A 4PJFA 1HQRA 3QDGD 4QHNA 5CZKA 3L3HA 3X12B 1KF9B 1UWGH 3O3BB 2R2EB 1B4RA 1MQ8A 1U8LB 2D2OA 2PCPA 5SWSB 3O0RH 1QPPA 4DVBB 1I1RA 4HJJL 2NY5H 1EEUA 4UBDC 4FZEH 4E9LA 1A7PL 1YUHA 2FJHB 1EFXD 2AV7A 2G2RA 4XVJL 4ZUWB 5DD6B 4PGZA 1IGYB 2XFXA 4LSTH 4OZIB 1JBJA 3ILQC 1DSFH 4G6FD 4KY1H 3CSYA 3FQWB 2WMPA 3AMKA 2J6EH 1MCEA 2MCG1 3O9WB 1A5FH 1CQKA 1GGIL 1MPAL 2DRUA 4U1JB 3WN5C 5JNYB 2Z8RA 4RFEA 5HXMA 1IC7L 4WW2A 3TM6A 1K5NB 4PIRF 4XXDB 4MXQD 3I6GA 5ERWB 3P9WB 3ZDXE 2AGJL 2O5XH 3IJYA 3WNKA 5FOJA 4PRBB 3T2NL 2BOCA 2UWEB 3RNKB 4GKNA 1BLNB 3H3PH 2EDQA 1JGEA 4U49A 5HYFA 4LOUD 1ZS8B 1RJZA 2DDQH 4UTAL 2ZSVB 3VXTB 1YDPB 4KJYB 5D1XC 5KN5A 2EYRB 4MJ6A 4EJ1C 1F13A 3PF2A 4PJFF 4UQ2B 1FO0H 1OAQH 4YHPB 1YY8A 4O9HL 1K4DA 1NGQH 2D7PA 4PJIA 3ALXA 3PNWB 3O8XA 4QHUA 1S7QB 3D6GA 4JN1H 3S35X 4XVSL 3IXAA 2IBGA 3TT1H 2GCYB 1QLEL 4DN4H 2V7NB 5I8EA 1YEDA 1A9EB 4HLJA 1IC4L 1ADQH 2VDOL 4BFBD 2W60A 4JM4L 2UZIH 1J05B 1BIIA 4M5ZH 1QFOA 3MV9B 4OLUH 2XTJB 4KJPC 5I16B 1KLGA 1NAMB 1Z9OA 5D1ZC 1NJ9A 5ANME 5EU3A 3WEXA 2IG2L 4ZQKB 2I5YL 2XPGA 4WW2F 2DQFA 2NY6D 4FQIL 3FQRA 5B4MD 2HWZH 4EI6B 3KPNA 4OFYA 3DBXA 5D2LE 3U82B 2EH8L 4NO5A 5J3HC 2VL5B 4KQ4L 1J8HB 3OR6A 4PY8I 5CJOL 5FYKE 4P2RE 1YQVL 3A6OA 2FX7H 3V4PH 1IGML 4FXGA 1J0JA 4YE4H 2YPLE 5I8KH 4KTEL 3N0PB 4G8EB 4BZ2H 1KLFA 3AS1A 5EZOL 2A1WH 5LKNA 4PJIF 5GS0H 3GMLA 1MJ8L 4H26B 4LIQH 5IEKA 3D39D 2Z0BA 5B3NA 4YHYC 5AWNH 2C4FU 3LIZH 3QUYA 1IL1A 2F74A 4RGOH 4D0BB 4P4KB 4YHZH 4XPFL 5HI5C 43CAA 1IAIM 1ZSDA 1J1PH 4AK1A 4KK9D 5EPMB 1S7UB 4UT7H 3S37L 2IH3A 5MEPB 1CG9B 5L7XH 3MOQA 3BE1H 4U1SB 1IGJB 1HHHB 3VWJD 4XH2A 2KH2B 1GGBH 4QLRA 1RIVH 4HCRA 2HMID 1I3GH 2V2WA 1I9IH 3U9PH 3D3VB 1YC8A 4LEOA 3IDNA 1BOGB 3C5JA 4GXUM 5IMMA 1ZVSB 4MWFB 4U7SA 1E4XI 1FVEA 2FEDC 3V6FA 1YYLH 1Y6KR 1CTOA 5DDHB 5HYJD 1UFUA 5ICZB 2DQIL 5JW4M 1TQBB 3FB5A 2I07B 2VDQL 3MRLB 4HCRL 4KC3B 1INDL 2ADJA 1IAKA 5EOTA 5JXED 3BT2L 1CGSL 1YNLH 5EDXA 1ZV5A 2GJ6A 4FQCH 1ZT4A 5FECB 5I0DA 4EUPH 5I30L 4PY8J 3EO0A 4BKLB 5IWLC 5IV2A 3FO1A 5FYLH 2XZCH 4HIXH 4LSQL 3K8KA 4OJFH 2X10A 3MYJA 1SJVA 5EO9A 5D1ZB 4P46A 3LH2L 4ELMB 4MNHB 2FSEA 1TCMA 1JF1B 2W38A 5FM4A 4NN7C 4BQBA 3FRPG 1TTUA 1LEGB 4LPUA 4ODXB 1U8HB 2O26U 3JTTA 4Z77A 1DDHA 4JB9H 3KPSB 5IVZA 4RFNC 3FOMA 3BN9D 5T3ZL 4HKJB 2DQCL 1OAZL 1OM3L 3MREB 1I7UA 4NGHL 3REWA 1H15B 2J88H 3V79C 5A16B 1S3KH 3RBSA 2IAND 5LGJA 4GRMA 4IRZH 3W5MA 1U3ZA 4XC1H 1ZHLA 2H8PB 2NY7L 1H0DA 1FNEB 2BOBA 2XY1A 1S7XA 3KR3H 3UTSB 4N1HB 4G9FD 2YN3A 5CMAB 3HHRB 1WSST 5F9DC 2WLZA 4ISVA 2I9TA 4ZUUA 3VXNA 5H35B 2ZCKH 2QR0A 3PQYE 3HI1A 3UJTH 2ATPB 4ONGL 1WC7B 3CFKB 2AJSL 4L4VE 4GLRH 5INDB 4RGNB 3P9LB 1A1MA 3NFPB 1JNJA 4PG2A 4J4PA 5GHWH 3H9SD 2VZTA 1AXIB 3IXTA 3SDCC 5I6XC 5DUMH 3WNPA 3ARUA 5CCKH 1FZMA 32C2A 3WFCL 3L6FA 2X70B 2J12B 4P23A 5IGXH 1UC6A 4DUWA 4K9EL 1X4XA 3BD4A 3DGGB 2M2DA 3FFCB 5IHUL 2WV3A 4JDVB 4JQIH 3CK0L 3MRMB 4BYHA 4YBQD 1JFQH 4YHOL 5IMLB 1FYTA 1M71B 4FFZL 4OCNC 5IB5A 4PUBL 3LN4B 3QFDB 5DK2B 4J3SA 3ZE1F 4M9PA 3B43A 1CGVA 3RWGA 5HI3D 1MLBB 3QIBA 4C56B 4NHCH 4ORGB 4JKWA 4ZS6D 4HUNB 1UA6H 1VB9A 2BNRB 2Y9RT 5HJ3B 2YXMA 3VD5A 3FONB 2P5WD 1B2WH 2K9UA 4N90D 4LSDA 3RA7H 2IFGA 5CSZA 4FQXD 4XCCH 4F7MA 5KS9A 4IRSA 1KXVC 2F5AH 2Z93A 3U36A 4PBXA 2VXUL 4RFNB 3WXVH 2DLEA 5GRJH 3T8XA 4PJ9C 2XZQL 3ARSA 5E08L 5I18H 3E3QC 4O2CB 3ARPA 3QA3B 1V7NH 2WUBL 4NFDA 4R4FH 4MA3A 4UB0L 3W2DH 5DRNB 2QHRL 4L9LB 4LKCA 4ODHL 1FNLA 3EDKA 1VFBA 1OGAE 3TVMA 4YIQB 2EYSA 3VXUD 4JR9L 1FIGH 3PWNA 3OSKA 4ZAKB 1B3JA 4YXLH 2NY0C 4GRWB 1RSFA 4ZOCA 1BFVL 3EDDA 3GSRB 3H6JA 3CH8A 3FOLB 1OB1B 4MSWB 3RL1B 4RIRB 4U1HA 3UTZB 4X5WA 1MCBA 1P84J 3KJ6H 4MJ2A 1A1OA 1A3LL 1KTDB 3SDDC 3L3KA 4MMZC 5FO7B 5EOCL 2WBJA 1CVRA 4LLUB 4X6EA 3WO3B 4ZFFA 5I1AA 4NQDA 3VFGH 2P8MA 2J7LA 3DSFL 4WHTA 4XCYB 3B9KB 4XP5L 1NKRA 1T1YB 4OQTA 5F7YC 4YR6A 4WFGD 3JVGC 4E42B 2NX5A 5T1MA 4GSDH 4L4TE 4FG6D 3SDCB 4ALAL 4YAQA 3O45A 2EDYA 1CFTB 3MJ9A 1K4CA 5KS9F 3JWDC 2ORBL 5E2VH 3MRCA 1D5BB 1A3RH 4NBZB 4QRPD 3L3JB 3NTCL 4KQ3L 4OQTL 1TETL 1J0YA 3MLTB 4PS4H 1RIHH 1U6AH 3CLEL 3L5XL 3OR7A 4AT6A 4WWKC 2IAMB 3MJ9L 4U7MA 4CUCA 3WIFB 4DFIA 2A74A 2ZOKA 1ES0B 4YWGL 3L1OL 4YDLC 1BQHB 3UDWA 4YUEL 3MFGB 1TJGL 2Y6SD 3VH8B 1FSKC 4HMEA 1T80A 3OKMA 3ARGC 4HBCL 2OR9H 3BAEL 2D3VA 5BRZD 4ZFOA 2BSED 5DJZA 5DMYA 4HAFA 2APBA 3IDGB 4CVZA 4XNYH 2VLMD 3ET9F 3QWQB 5BV7L 2CLVA 3VXMA 1JHLH 3CFBB 4P59L 4S1RL 1JZ2A 1P4IL 4ZFOL 2D7MA 4PJ9B 5DTFB 1N64L 5AD0A 1JHKL 1HILB 3EJYD 4LPVA 4Y16D 3MROA 2YD3A 4C59B 4F7PB 3C6SA 2HLFC 1JN6A 4PRID 4FRWA 2HJLA 4P5TB 5ETUA 5IIEA 1Z0NA 5H8DA 1CICB 1W72H 4JRXB 1G1YA 3EYVA 5C08D 2XYCA 4XP4L 2C1OB 2VAAB 4EI5C 1NFDB 3BPNC 3QWOA 4YGVA 3FQXB 4K3EL 4QHMA 1I8KA 4AEIH 2P42B 3RWJB 4TRPH 1RZGA 1Q8MA 3BH9A 3STLA 1PG7L 4Q58C 1D6EB 2BX5A 4HKXA 1TQCC 3HE7D 1CR9L 5C9KA 1E4KC 1LD9B 1VSCA 2QSCH 4FQ1H 4LLQA 1N4XL 4MJ5A 4ZUSB 2VXSH 3KAAA 3QUZC 3UZEA 1PYWA 2IBZY 1MFBL 2VZ3A 3VG0L 1SY6A 2MCPL 4QCIA 3G08B 5GS2D 1DE4A 2VDPH 4N5UA 4I4WA 5TPWL 1D9KA 1I3UA 3GSVA 5E6IC 4UZGA 2VC2H 3MRNB 1BZ9B 4D3CH 2F15A 3GKWH 5EZJB 1SY6L 2FHCA 3CFIC 4Q2ZB 3BIKB 3IDJB 5JOFA 4OZHA 1PZ5B 3PWPA 3O6KL 4GBXD 4I2XB 4G5ZH 5EO1A 1JNHB 3D69B 3RVUC 4GAYA 4YDLB 5TF1H 5KW9H 4N5ED 4EBQH 5ADOL 5CJXA 1FSKB 2G9HA 4LNRB 3ARGB 1XMWA 2BP3A 1PKOA 2JCCE 2GHWB 1P1ZB 3MLZL 5F7DB 1AD0A 4LEXL 5ALCH 4ACPA 4LLDA 3FTGB 4KROB 3K2UL 2WIIA 2YC1B 3L7FB 2PW2B 3RWHB 2QQQA 3LKOA 4OLXL 1JGLH 3P0GB 3TH4T 2CR3A 2AJXL 2RFXB 1RMFH 4HUXA 2RHEA 3WS6C 4Y0GA 5T33H 2ICWB 4DEPB 2A77L 2IALB 2IGFH 3FO0L 3Q3GA 5HYSG 5DQ9A 3VFOB 3MUY1 2H26A 4GMTL 2R0KL 1AP2B 2QQNL 5DURD 5CJ5A 5HGAA 2VITB 3BKYL 4O4YL 3C60A 4BH8A 1UCTA 5IM7B 25C8L 3H0TB 3LEXB 4XCNA 3VXOA 5IROA 1CD8A 1RURL 2O5ZL 2WM0A 4H5SB 4RGMC 2OL3H 4PD4K 3BPNB 5BS0E 3D25B 1PKQE 3Q5TA 1CFNA 1HHKB 4Y4KB 1JE6A 5F72S 5FHAH 5GGSB 4Y4FB 4OT1H 4DVRH 3KLHC 4GKZB 5F7LB 43C9B 5FGCB 1TQCB 5EFIB 1WGOA 3INUL 4HUWA 3NZ8B 1AGEA 1XGYL 3F6LA 4IIQA 4W4OC 2CKBL 4GW4B 2Q7NA 4GW5A 1KB5B 3QUZB 4E0RA 4OIAA 4LK4A 5CD3A 2ZUTA 5FYJU 5BXFB 5E0QA 2FCBA 2ID5A 3PP4L 4M1GL 1I8IA 2ADGB 3CXHJ 1CLCA 5DQDL 1KIPB 2HN7A 1KUMA 1X5AA 1Q9OB 1PG7W 1T0MB 4NJAH 3PHOA 3O8XD 3MV7E 3BW9A 2JIXA 4QT5A 3T0EC 2LFGA 1CXLA 2ATKB 2WP3T 3GJFB 5C0BB 1MH5B 1JJUA 15C8L 1VKXB 5T3XD 1ZT1B 5E5MB 5DQJB 1BJMA 3BWAA 5EWIH 4R6UA 5IHZA 5JUEH 5IVXF 4JFEB 3WIIH 3LQMA 3KYKL 1IT9H 2K7QA 1GH7A 3TBVA 4ZUTA 3IU3A 3OKEB 2ZG1A 2UYLA 1NGWA 3MLYL 3MQIA 1YNKL 1F58H 3JWOL 3OAYK 5ACMA 4FQHB 1I7TB 2FX8L 4JO3L 2KDGA 2Z31C 4P3DB 1SQ2N 4U1MA 4WCYH 1GAFH 5E56A 2PXYC 1AHWA 4OFYD 4ZSOB 4OIIL 1FRGL 1AGBA 4PJAA 4C54A 3SDYL 4WEBH 4WV1C 1F3DJ 4NQEA 3VFPB 5C8JB 5KSUB 5CS7A 4BA8A 2ITCB 1JRHL 4PJEE 4OM0H 5EU4A 3U7WH 4JAMA 4PBWD 4G42A 3GZKA 2R1WB 5HHOE 2ED9A 3QCTH 3UBXA 3QPXH 2OJZL 4OCXL 3QCVL 1B88A 1VADA 2Z92A 2J8UB 1TJIL 3QUYD 1EJ6A 2IANE 1IZKA 4H0HB 4I3GA 4S2SB 2ARJA 4PJBB 2ZJSH 4HWBA 1P6AB 3CDGB 3QP3A 5GSRA 4OUOA 5I74B 1QFUL 1CBVH 4M93C 3RWDB 4G9FE 1VFAB 3FQUA 1AGDA 1AY1L 5FGBA 1MHHB 4KVCH 4F3FA 4JGJA 4G8GA 2R2HA 1WTGT 1R0AH 1Q72L 5E8OA 1A7QL 3CVHA 3QFJB 1X5JA 3SDXB 5HHPA 2JJSC 1LO0L 5DSCB 5GRZA 3GSWB 5GIRA 3C08L 4HWBL 4JZJB 4OKVA 3DYMA 1MI5B 4X7EC 1JWUA 4JHAL 2NR6C 4LKXB 4S1DD 5JLZB 1CDCA 5GRVL 1QD0A 2PTUA 2AAVA 1FQ9C 4GG6A 3HZYB 4YQXH 4L8DB 4OZ4A 4AL8H 3CPLA 4IRJA 3J8F7 2MKLC 5ENWB 1ONQA 4HXAL 3VRIB 5LAXB 1TPXC 4PJAF 2DMCA 2GJ6D 1NGZB 4XNMB 4KJQD 1FLRH 3WD5L 2EIDA 4XP9L 1HSBB 1WBXA 3QEGH 3SDAB 5EU6E 1GZPA 2XNAA 4N0CD 4JKMA 4MB5A 4DZ8B 3LQZA 1UWGL 3RZCC 3FT4B 4HIJB 4LF3A 1CD9B 3F5WA 4P46D 3O0RL 1KB9J 1Q9WB 3WSQH 2NY5L 5DHYB 3ARBB 3FJTA 4FZEL 4NO0D 5DK0B 5KAQF 3F58L 4PB0H 4HS3B 4YDIH 3I6KB 4LSTL 2W0LA 1DSFL 4NM4H 4KY1L 3RJQB 2GY5A 1JK8B 2RBLA 1D5MA 2XWJA 4R3SB 3VW3H 5C0NC 2J6EL 3MOBH 2D4DA 3CFCH 8FABB 3V6ZA 2HFFB 3QYCA 1A5FL 2C1PB 2B39A 1MJJB 3OGOE 5I17A 1RJLB 1LNUA 4YHNB 5D7IB 2EDBA 2VQUA 3QT2A 2R1YA 4G6AD 2O5XL 1JHTA 1UH4A 2A73B 5FO8B 2YWYA 4L8SA 4R97B 1P9MC 4GG6F 4NHUB 4MQTB 5GGVH 3H3PL 2AKRB 4RZCB 4U6XB 3TNNB 1UM5H 5F71A 2DDQL 3BEWB 1AI1H 1BOYA 3BYYA 4KJWD 3NOIA 5INCA 3U6RB 4YX2H 1CXKA 5E8PA 5MENB 1NBYB 1A2YA 1FO0L 1LDSA 4NKQB 1OAQL 1ADQA 3MJ7B 1NGQL 1K8IB 1IM3B 3L5WA 3EOBB 2MTPA 4J4PD 4XAWH 4JN1L 1FAKT 1QVOA 3CDFA 1I1AB 2XA8H 2VSCA 3TT1L 1QFWM 4JRYB 4DN4L 3RNQA 2AXFB 3TZVC 2CXGA 2NZ9C 2NW2B 2F53E 4P23D 2Z91B 2UZIL 4IOSD 1C16B 1MCCA 3MJ8B 4M5ZL 3ARDC 4OLUL 1RZIA 3KPRE 3MLPA 3N85H 1IE5A 1TPXB 4GKSA 3MRHB 4PTTB 3GMOA 4EN3C 4K94H 5DJ8B 3MRDB 3H8NA 4K8RC 3GB7A 1BBJA 3V0VB 1YPZA 2A6JA 3QUXD 1QLFB 3MRJB 5AG8A 5J9PA 1L7TH 2GT9A 1HH6B 2HWZL 4MVBC 2XKUA 1B0GB 3QIBD 1CE1H 1WJ3A 4P49A 4M8VA 4WDIB 5BCAA 3C09B 5GSVB 3OJ2C 2VMFA 5IQ7H 3OKNA 3RTQC 3O3AA 3T3MF 2FX7L 1R3LB 3V4PL 4KRMB 4YO0A 4IRSD 4HGWB 4YE4L 5IESH 5I8KL 3TN0C 5F1OB 1ZVYA 5FYJD 2A1WL 2Q6WB 1HINH 3QXAB 5JO5A 4ZOAA 5GS0L 3RU8H 3MA7B 1VEOA 4JFDB 4LIQL 4MNQB 4PGEA 5AWNL 4D2NA 3LIZL 4K23H 3EZ8A 3W9DA 5HYIA 4RGOL 1ZA3A 4YHZL 2OMBA 2HP4A 1IM9B 1EBPA 1BECA 4HD9A 1J1PL 3VFTA 3TVMD 4G8IA 4UT7L 1A14H 2O5YH 4D9QD 1H5BA 1NMAH 1JYNA 5L7XL 2D0HA 3BE1L 3VRJA 1NUDA 3IVKA 4MZ2A 1I1FA 1BX2A 1GGBL 1RIVL 1I3GL 1I9IL 3U9PL 5F3HA 5JHDA 1QEWA 1VENA 4QRRA 1XR8A 3RRQA 3TBSA 4PGCA 2OR8A 2WBJD 3ZE0F 1YYLL 3STZB 3ULVF 1YPZF 5IP4A 1U3YA 4EUPA 4ZPTA 3WLWC 4CN6A 2DWEA 4QRTB 4IDLA 2WWMC 4LVNC 2BSSB 3KJ4B 4XCEB 5L8KB 4JDZB 3GSOA 5BO1H 2NX5D 1YNLL 4PJ8A 3I02A 4F8QA 1SJXA 3V6OC 2CLRB 5KSVA 4J8RB 5DMKA 4FQCL 4PFEA 4MJIE 1MREH 1U8JA 5E94A 3TZVB 3FT2A 3L7EA 3QPQC 4R7DB 2J8HA 1VHPA 4DOHB 3ME0A 4C4KO 1LGVA 4KI5C 4NSKB 5FYLL 1OQOA 2XZCL 4RMVA 2DOCA 3ARDB 3QISA 4HIXL 3ZDZF 2WUCH 3B6SB 4OJFL 3I75A 2B8OT 3PHQA 4R4ND 2D7OA 1QRNE 1RJCA 4JFQA 2C3XA 1CDYA 4N9GB 4TYUA 1ZK9A 1ND0B 1IKNA 1R3KB 3WDIA 1U0QA 1X5FA 5IW3A 4TULH 2A6IB 4L29B 3HUJA 3W81A 5HHNA 5A16A 4JB9L 4C83B 1SJEB 3QDJA 2OZ4H 3BP4B 4JFXA 1NGXB 1P7QA 1F6LL 4Z5RB 3FHQA 2J88L 4LCIH 4XPBH 1S3KL 3RWIB 3EO1B 4X6CB 2RGSA 3O6FC 1T1XB 3U4BH 1FFQA 4IRZL 1MCPH 1U8NB 4XC1L 3VXMD 3PGCA 3W39B 4YBHA 1Q38A 1V8HA 3WFDH 2APTA 3QQNA 3KR3L 1NC4B 2VLKB 3O4LA 4QGYA 5GRYA 3P0VH 1EEYA 3QZWB 2VIRA 5E6YA 3B5GA 3OKKA 3SKMA 3UJJH 3U7YH 2ZCKL 1GOGA 4Y5YC 2A83A 3UJTL 5DRWA 4U05A 3IF1A 2GTWB 5B4MC 4JFFE 5DVKA 4ZO7A 3MGTA 2I60H 5K9KA 3W11C 2EXYC 1AH1A 4JFZH 5GHWL 3WUZA 3BVNB 3T0VA 1G7JA 1E4XH 3CFEA 5MP6H 3OXRA 3HRZA 4RQQA 4XP6H 5DUML 2IPKB 1JNLH 5DT1H 1KJ2A 5GZND 5D6DC 5CCKL 5C92A 1X5LA 1T5WB 2Z4QB 2UUDK 5D2NE 3HUJF 5FKPB 3WKMH 3G6DH 3ULUF 4TVPH 4LVNB 5IGXL 4JJ5A 1EUTA 3F12A 4C4KT 1CL7I 1T2XA 1CD1A 3CNKA 4JQIL 5HY9A 4PJXE 1VCAA 2HVKA 4U1IB 4AIOA 5C0FA 1JFQL 3D87B 3FZUD 4U6YB 1D9KD 1Q9KB 4KK9C 4ZNCD 2OMNA 1OSZA 3O3BA 5FOBB 1U8LA 5SWSA 3UAJC 3BN3B 3LEYH 4NHCL 2GJZA 1G6RH 3P4OB 4NYLB 4DVBA 1UA6L 3LS5H 3HAEH 5BZDB 3PWPD 5E9DE 1B2WL 5DUBB 5DD6A 5DF0A 5FM5M 3DARA 3RA7L 4XCCL 5C0GA 1IGYA 3VXRA 5J6GB 3IAGC 1T89A 2F5AL 4HFWA 4XMPH 1UWEH 2YOCA 5DK3A 1XIWC 3WXVL 5GRJL 3CMOH 5I18L 5F9JB 3VD4A 2AEWA 4KAQH 5JNYA 5JXEC 1K5NA 4NRZB 4F7EB 4R4FL 1V7NL 4MCYB 4XXDA 3W2DL 4K71C 1FIGL 3C8KB 5FA4A 4PJDB 5TE7H 3CUPB 1BLNA 4YXLL 3T65A 4PJCB 3QRFM 5DXWA 1ZS8A 4WWID 1MEXH 1CWVA 1NGYB 1JZ7A 4RAVB 5C07E 3VG9C 3VXTA 1YDPA 4MDIB 4KJYA 4WHYH 1U42A 1N3NB 1WQVT 3KJ6L 4LARH 2EYRA 3C60D 3FO9B 2R0LH 1ZLSH 5I1DA 3V2AR 4XPGH 4KK5C 5DHXB 3VFGL 3GRWA 4EIZC 1T7YA 5EIQA 5J12B 3ZYJA 3PNWA 3DOSA 4HS6B 1JZ8A 4GMSH 4V2CB 3HLAB 4G3YH 2GCYA 2P48B 3CXHK 1EDQA 1LP9B 4GSDL 1INEH 4ETQB 4QNPE 3HI5H 1A9EA 2CQVA 4IDJH 2F58H 4KTDH 1DLFL 1N6VA 4HW6A 3H7BB 2ZNXA 3BJ91 1TZIB 3DECA 4OZIF 4IS6B 5I8CA 1J05A 2ZWLT 2ZP0T 5IB1B 5E2VL 2NYYC 3MV9A 1WAAE 4XI5D 4OD2A 1CXIA 1A3RL 1A9BA 3GIZH 5HHMB 5I16A 1NAMA 5GGTA 4ZFZB 4XNUH 4PS4L 1RIHL 1U6AL 2AERT 3MRFB 4ZQKA 1QSFA 4MQ7B 3TO4D 1VACA 4GW1B 3BJLA 4FFVC 4HLZG 2I25N 4NKOA 4EZMA 4JZOB 1II4E 3TA3B 4EI6A 2UWEF 2JIXD 4CU8A 3I6LD 2R1XB 3LD8C 3NPSC 2VL5A 2JB5H 1H3VA 2OR9L 4PRAA 2D7TH 2EDFA 1HZHH 4OD1H 1BJ1J 5FGRA 2R8SH 2YA2A 3TBWB 2NY2B 4XNYL 4G8EA 2R15A 2Q8AH 5CKGA 4EDXA 1V3LA 3NIGF 1ZLUK 1XIWB 3BX7C 2VZUA 3K80A 5EO0B 5L8LB 2A6DB 3GI8H 4NZRH 5CJ8A 1W72A 5I19H 4Y4HC 1FZKA 4D0BA 1FJ1A 4KKBD 4Q7DA 5BW7C 3EGSB 3V52H 5EPMA 1C7SA 3O3EA 4PRPE 4MD4B 4K71B 4YBQC 1CG9A 1T20B 3QI9B 4N8CH 5T3ZE 3WUWB 5CWSB 4NO2B 2EEAA 4U1SA 1IGJA 1HHHA 2PYEE 4LDOB 4HGMA 5EU7E 1W72L 4LRIA 1MQKH 3IKCB 3C5SA 3D3VA 4RSVA 4NQED 4B0MM 4V1DD 2ESVB 3C2SA 5HI3C 1ZVSA 4MWFA 5A40E 4LPYA 2LQRA 1CGUA 1TMCB 2XA3A 5D1XA 4AEIL 4TRPL 1QFWI 1XR9B 5DDHA 2R4RH 1E0OB 4ENED 2FECL 3EOYG 4XCFH 4HX1A 2I07A 3MRLA 5C7XH 2IQ9H 4ELME 2YPKB 3QG7H 5IJKC 1P4LA 4WUUB 2QSCL 4FQ1L 2O93L 1KULA 3O4OC 3JV0A 2VXSL 4OF0A 4Q9CA 2XWBB 2P43B 1D5ZB 2HTLD 2I24N 4XWOD 2D0FA 2CH8A 2VDPL 3U0WH 5JDJA 4BKLA 4G8GD 5AYQA 1HXYA 2FL5B 1X5XA 5CIPB 2VC2L 1JYVA 4D3CL 3IKKA 5D1ZA 3GKWL 4MNHA 3SY0B 1JF1A 3AC0A 4X4XA 3SHSA 1ED3B 2X6MA 4G5ZL 1XT5A 4IRJD 2PKDA 4RA3A 1LEGA 1NUGA 3C87A 5TF1L 5KW9L 4ODXA 3ZL4H 1AC6A 1KC5H 1K85A 5FUOH 1U8HA 4EBQL 1KB9K 2XI9A 3KPSA 4O2FB 3LD8B 5DJYA 3NPSB 4HKJA 1NCWH 1H15A 4K8RH 1A7RH 1Q1JH 4U2YA 2ZSWB 4OFKA 5ALCL 3UJIH 5I1IH 2UUDH 5F8QC 3T0DA 1B0WA 1MNUH 1BVLA 1FNEA 1JGLL 1R3HA 5DI8B 2APVA 5IR1B 1RMFL 3UTSA 5T33L 1BAFH 5EZIH 3GBMH 5SWZB 5CEYB 1FYTE 4Y4HB 1MHCA 2IGFL 2CDGA 4Y5VC 1WC7A 3CFKA 4I18C 4P9MH 5INDA 5D7LB 3P9LA 5HGHA 3U79A 3S36H 5EBLA 5IOPB 1I7ZB 2BJMH 1A7NH 2OL3L 2Q86A 1W0YT 4LHUB 4MQXC 4MXVE 4F58H 4QHLB 4ZNEA 3GUTB 1U95B 1WFOA 3WNOA 5MI0B 5HYQA 5FHAL 2YD7A 1JGDB 4OT1L 4BQ8A 4DVRL 4ZODA 9CGTA 3LAFA 2X70A 4WU7B 2J5LB 2X4TA 1IEAB 3DJ9A 4PLOB 1JZ5A 1BD2B 2E7LC 4M8QB 3RGVB 4ZFGH 5IB4B 3O4OB 1ACYH 3TNMB 2BY0A 3DGGA 3FFCA 4JDVA 4QYOB 1AO7B 1KJ3H 4Y16