4JKNA

Mercury metallated pseudomonas aeruginosa azurin at 1.54 a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mercury metallation of the copper protein azurin and structural insight into possible heavy metal reactivity.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 29
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature ec 1.20.9.1: Arsenate reductase (azurin).
pdb deposition date 2013-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4jknA00
4A68A 1ASQA 1M9WA 3HB3B 4AZUA 2VMJA 1XB3A 3MX0B 5I5IA 4GYBA 1NZRA 1TEGA 1AS7A 2EIJB 1DYZA 2IDSA 4WTQA 3X1BA 1AR1B 2GBAA 2YXVA 3ERXA 1W8EA 3V9CA 3C75A 1HAWA 5I6PA 2AVFA 2TSBA 1NIAA 2CAKA 1I53A 2YQBA 3ZDWA 2GHZA 1L9QA 1AANA 3D12B 4UF7C 3ZX1A 1OCCB 3ZBMA 4F2EA 1HFUA 4TXVB 2GI0A 2I7OA 2IH9A 2IDTA 2B08A 3FU7A 1MG2C 1F56A 1BQRA 2HLEB 3DTUB 1JZEA 3CVCA 3NJNA 3QQXA 3UACA 4BXVA 1GS7A 3ASNB 1KCBA 2OJ1A 2HRHA 4GXFA 4E9WA 2QPEB 4HZ1A 1JZHA 1KBWA 1QLEB 3SBPA 4DP0X 3QJTB 3V9EA 1SFDA 3NJHA 4M3HA 3H4FA 5B7FA 2UX6A 3NSCA 1E5ZA 1L9SA 4F2FA 4DP1X 2NRDA 2DV6A 5D4IA 9PCYA 2OCCB 1QHQA 3EH5B 1BQKA 4X4KA 2FT8A 4E9RA 3IBOA 5A7EA 2I7SA 3X1NA 3OMAB 2FJSA 4YVNA 5PAZA 2VW4A 1X9UA 3PCYA 3UABA 1NPJA 2QT6A 4NB7A 4FA7B 4CSZA 3NT0A 1AACA 1AZUA 1FWXA 2I85A 3FT0A 2PLTA 2EINB 3FU8A 1NDTA 4DP9X 2Q5BA 3FSZA 1HAUA 2GC7C 3BVDB 5AKRA 2YAOA 2PPCA 3FQ2A 1CUOA 1R1CA 3BQVA 1IBZA 2BO0A 1ET7A 1GY2A 3S8FB 4PCYA 1PNDA 3AG1B 4KO7A 2RACA 1BEXA 2MTAA 4PAZA 3H56A 4G7RB 3EHBB 2P80A 2YAEA 3JT2A 2QDVA 1E67A 1PLAA 2VSMB 1AOZA 2Y69B 1ET8A 2AANA 3NJKA 2YAHA 2ZONA 2XU9A 6PCYA 4GP8B 1N70A 4E9QA 2W88A 2BWIA 1ZIAA 1GR7A 1JZIA 1XB8A 2CJ3A 2XWZA 5B1AB 1RZPA 1NTDA 5TK4A 5AFAA 3FS9A 3FYIB 2HX9A 2FQFA 3T71A 3IN2A 3WKQA 1OCZB 8PAZA 1PY0A 1AIZA 2GSMB 4ZK8A 3T6WA 2YAQA 4E9VA 1A65A 4YSQA 2CALA 5I5JA 5I5MA 1GY1A 2HX7A 1VLXA 2R7EA 2PPFA 6PAZA 4P5RA 3T6XA 1PAZA 5PCYA 5IY5B 3G5WA 1FA4A 3ABGA 1BXVA 5E9NA 4KNUA 1ETJA 4Q8BA 1ILUA 1NPNA 2AZAA 1JZGA 1AS6A 3RYMA 3ABKB 2PCYA 4G71B 2QDWA 4HCFA 4YVUA 1J9SA 1ZDQA 1J9RA 4W1TA 1AS8A 2FQGA 1MZZA 1BXUA 2XYBA 2GC4C 2XV2A 4E9XA 2BZCA 2AZUA 1WS7A 2IWKA 3OM3B 2BP8A 1JXDA 1W6WA 1V10A 2FT7A 3IN0A 2IAAC 2WO3B 2HXAA 4E9YA 3WNJA 1L9TA 1A8ZA 4KOBA 4ENZA 3PLYA 4M4RB 2VN3A 1X9RA 1MZYA 1L9PA 2FTAA 2Q9OA 1M56B 1BYPA 3FU9A 1BXAA 1E30A 1XMEB 2GIMA 3CVDA 3UAEA 3ABMB 3GXUB 2W8CA 5TK2A 1PZCA 5ANHA 1OE3A 2R7EB 1OCOB 2X87A 1GS8A 2DYSB 4YSTA 4HHWA 5F7BA 4YSEA 3EH3B 5B1BB 1ZV2A 2IWEA 1E65A 1AG6A 4KO6A 1PF3A 2ZXWB 3GDCA 3HEIB 4KNSA 4AX3A 4BWTA 3SQRA 4YSSA 1NICA 2PPAA 3NP3A 3IEAA 2BZ7A 3NSFA 1TKWA 4G72B 4DP5X 2DWSA 3S3BB 2BHFA 3N2JA 3WG7B 1KGYE 1OCRB 4EF3A 1MG3C 3PAUA 1WS8A 3NJMA 4Q89A 1L9OA 2E86A 2A3TA 2FT6A 3WKPA 1NIEA 5F7AA 3X2QB 2DY2A 1SDDB 3QJVB 3NJFA 3TU6A 3WIAA 3H4HA 2PP7A 2H3XC 2H47C 2XX0A 1JZJA 2UXGA 4DP7X 2TSAA 1FFTB 2UXFA 1PMYA 1SNRA 3OMIB 4GP5B 1TEFA 4UAHA 5B1KA 1WA0X 2BWDA 3WNIA 2CCWA 5B1JA 4FAAB 4YSOA 5D4HA 4AKPA 2FWLB 2YAMA 3S3CB 1AAJA 2B3IA 4KO5A 1SJMA 1NIFA 3QJRB 4KNTA 1WA2X 5LDUA 1PZBA 1AZRA 4BDVA 3FPXA 1CURA 4A2EA 3NSDA 1J5CA 1KV7A 2XUWA 5D4JA 4N4YB 3NJGA 3PAZA 1MDAA 3S8GB 3PPSA 7PAZA 1UATA 4HAKA 2WO2B 3CG8A 1BAWA 3GYRA 1B3IA 2BW5A 2AFNA 2XX1A 1KDJA 1SHWA 3CVBA 1JERA 1OOWA 2J55A 3QPKA 3PAVA 1OE2A 3JTBA 7PCYA 1PLCA 4BWUA 4DPBX 2YAFA 3TBCA 4F7KA 1IBYA 3ABLB 1WA1X 1V55B 3AZUA 1BQ5A 1KDIA 3X1GA 1YLBB 3AY2A 5I6NA 5EHFA 2VW6A 4HCGA 1A4AA 2YXWA 1RZQA 2N0MA 3T6ZA 1RKRA 2UXVA 4NAJA 4CSPA 4HALA 4A2HA 3FU7B 1KBVA 1AQ8A 3KW7A 3DIVA 1GS6X 2H5UA 3AG4B 2XXFA 1URIA 4YSUA 3EF4A 2YAPA 1W6LA 1EZLA 1NWOA 4A66A 4AKQA 1M57B 1PCSA 4QLWA 1ZDSA 3AG3B 5B7EA 2XV3A 2WSDA 3SBQA 2X88A 1NWPA 1SF5A 4AKOA 1PLBA 2JXMA 2XXGA 2UXTA 5B1JC 4E9TA 3QJQB 3OMNB 4W9ZA 3FYEB 1TU2A 3NJIA 4DPAX 3UADA 2XLLA 3KW8A 3S3DB 3T6VA 3NJLA 1DZ0A 1CYWA 2FQEA 2XVBA 1V54B 2IWFA 4BWWA 1JOIA 4A67A 1IKOP 4BXSV 2J57A 4JHUA 3CDZA 2EIMB 2VW7A 4RH4A 1IUZA 1OV8A 2BP0A 1SF3A 1ID2A 4HHGA 3U25A 3AG2B 3IE9A 3FPYA 4P5SA 4DPCX 2BP8B 1WAEA 2XV0A 1SHXA 2PP8A 2J5WA 1PZAA 1QNIA 3FQYA 2JKWA 5B3SB 2PP9A 5AZUA 1AZNA 1ZPUA 2IDFA 3PXLA 1JVOA 3UGEA 2Y1AA 1AZCA 2IH8A 4YL4A 1J9QA 2EIKB 1BYOA 3OQRA 1A4BA 1ASPA 3NYKA 3TA4D 2ZOOA 4GP4B 5I26A 4YSPA 1ET5A 2HZHA 3UAAA 3ZIYA 5I6MA 1NIBA 1ZIBA 4MFHA 4E9SA 2PPDA 1JXGA 3QJSB 4YSDA 3QJUB 2P80D 1A3ZA 4DP4X 1KYAA 4G7QB 4YSRA 4DP6X 3N55A 3DKHA 4JKNA 2FNWA 1SFHA 1OE1A 1CYXA 3T9WA 3X1EA 2DYRB 1JZFA 3FSAA 4NERA 1GSKA 3WI9A 3FSVA 5FC9A 1A4CA 4HIPA 1OF0A 2CBPA 3CDZB 2JFCA 3TBBA 2BP0B 1E5YA 1NINA 1PNCA 2HRGA 4G70B 4QKTA 1NIDA 1XB6A 2MRYA 3FQ1A 3NSYA 4WKXA 5B7MA 4KOCA 2PCFA 2J56A 4A2GA 2FQDA 3FSWA 4GY4A 4JHVA 3SBRA 2HX8A 3AW5A 4DP8X 1J5DA 2QPDB 4BK5C 1N68A 4N8UA 4BDVB 1SDDA 3OD3A 1EHKB 1L9RA 2GB2A 2UX7A 4DP2X 2EILB 2VM4A 1GW0A 3L45A 4A2DA 3X1FA 1KCWA 3NJJA 1J9TA 3EH4B 5I28A 1GYCA 3ASOB 4YSCA 1ILSA 2BW4A 2IDUA 2LLNA 2VM3A 2DWTA 2ZWNA 4YSAA 5I6KA 1IC0A 1JVLA 3NP4A 1AG0A 3CZUB 4UANA 2CUAA 5I6LA 4K9JA 4AI7A 1AZBA 2IDQA 2VSKB 2OV0A 1CC3A 5I6OA 4L0PB 2YARA 3MBWB 1JXFA 3TASA 1ASOA 1RCYA 4A2FA 1ADWA 1T5KA 4HCIA 4G7SB 4KO9A 2PPEA
chains in the Genus database with same CATH superfamily
1ZTXH 1HTYA 3GXNA 4Y19D 5CHNA 2W07B 4L3EE 4P5MB 2NQDA 5KW9L 2VDKH 4PLKC 1WZMA 4OZIB 2JKIS 3LD8B 1W8EA 5FA3B 2Y22A 4ZQKB 1ETB1 4A55A 3RNQB 4MXVE 2P48B 4X6CA 3NACH 5J1SC 1OAXL 2X3AA 2HTKC 1H3GA 3MBXL 4RDQG 1LO3L 1WZLA 8FABB 3D2UA 4FABH 3RZCD 3FFCE 4H0LC 2XJLA 4P57A 4FC3E 3LKOB 1BJ1H 4OD1H 1UD5A 4ZUWB 5HJ3B 1HFUA 1HKLH 5KVFL 4GAGH 4K94H 4ZFOB 3ILDA 4PJXF 4NQUA 2UUDK 5GGSA 1HZKA 1A3RH 4NKMA 2OJ1A 4GXFA 4JRLA 3SDCB 1EUUA 4L3ED 4NEHB 2JXMB 2WQWA 2ODHA 1CG9B 2X05A 3SE3A 3IF1A 2O26U 3MJ9A 4MZ3A 5MERB 3GLDA 4I8DA 3FSOA 4FEMA 2X6AA 1SFDA 3CD4A 4HKZB 4LKXB 4M3HA 3ULVD 4J6RH 1RLBA 4MNGB 4G1MA 4HWUA 4J3OG 4OTXL 2D31A 5D4IA 3ZHLA 1D5IH 5HHOB 3VDCA 1X9QA 2W60B 3QH3A 4JAMA 4POZD 1DJZA 1TNMA 5B3JF 4M5YH 4OM0L 2ESVB 2FJSA 5C6TH 3MRQA 2JIXA 4FA7B 3N5AA 2DTMH 3NT0A 2KKQA 4RWYH 5ILTH 3QRGL 4B60A 1EDYA 4ZFFA 3QFJE 1U36A 3ZVVA 2EICA 3BZEB 1UWGL 2EINB 4F20A 2CJUH 1DZBA 2X7LA 1UUNA 4FNSA 4U7KA 3DI3B 5DHDA 2LVEA 3UTOA 1RFDH 3WNNA 4LBAA 3EG9B 5CZKA 3N1QC 4JDTH 3OSVA 1QNZH 5CJ5A 3VXSD 3SYCA 1CUOA 2GSGB 3NCYS 1NCNA 1SEQL 5T3ZL 1JGLL 2CHNA 3CZNA 3CVHB 4GINA 5AOJA 1K5NA 2ZCHH 3OAUL 4PCYA 5DSCA 5KW9H 3S8FB 3V79C 1SM3H 5FGCE 4GAYA 1SOSA 3BGAA 5EEZA 2P80A 4PHZA 1J8HD 4DKFH 1LVEA 2BMKA 4QRTB 5D2LB 1E67A 2DDQL 1AO7D 4F9LC 3LIUA 2Y69B 5FF6A 5HYSB 2DM3A 1ZGLM 2WNGA 1GHFL 4P9HC 2VIRA 4GP8B 1KGIA 2VLLA 1IQWH 3RAJH 3J8F7 1O6VA 5C07D 2FR4B 4TTDC 3TNNB 5TK4A 1MCNA 4TSAL 4YMPA 4MAUH 2VZ1A 2HG5B 3DRQB 3BMWA 3VJ6B 4AG4L 4PJ5A 2G3ZA 3KPLA 5I74B 1QVOB 4BCXA 2K6YA 4XWGL 3FCBA 2VL5A 2Z9TA 1YYCA 2VXUL 2VR7A 2W0KA 1FP5A 2R7EA 1YZZA 5I6XC 1AD0B 1AVAA 3W0WB 1G6RA 1NFDE 5L8LB 2BXYA 4PY8I 1FA4A 2VAJA 2GBVA 1YY9C 4PJAE 5JHLL 5I0WA 1MLCA 5BOPA 1GGIH 5BS0A 1Z6JT 2AZAA 4BKLA 2JB6A 5IOPA 3WFCH 4QXTA 2IOOA 2BSSB 1ZDQA 3VQ2C 4GXVL 3K0WA 2JQMA 4ALAH 1J5HA 3BPNB 4JHZA 4R7DB 1FLRH 3CLEL 3DJZA 3I9GH 1EMTH 2PW1B 3NABL 3ZHFA 3CMOH 3DDGA 3PWJB 5LNEA 3TA3A 5BZZA 3Q6GL 4P3CL 5F0LB 4U49A 3CXFA 3U1QA 2BP8A 4B5ZA 4N0UE 3ZT6A 1GL4B 1HXMB 2CO7A 3FCSA 5IBLC 2MEJB 5JOPD 1EMTL 3KS0J 2Q6WA 3LKPB 1KJVA 3G5ZB 3BJ91 4RAUA 1FYTD 4CKVX 1TJHH 2QBWA 3MRRA 4M6AA 5D1ZC 1HSBB 3MNZB 5AD0A 2AITA 2AMUA 3QFDB 1SN0A 2CA3A 5E4EB 4KKAD 3CIQA 3NEOA 3M86A 2Q8AL 1J86A 5HJDA 4K8RD 5AW6B 3MFFA 1KCVL 1JFHA 3HFMH 3TFBA 5IGXH 4WI5A 4L5FH 3ARED 2H32H 3V4VL 1BFVH 3TYGH 1Y1UA 3CFKB 5E2VL 4LCCC 4N20A 4HDIA 5F1IB 4WW2A 2C4XA 3H9SA 4LFHD 2CDFA 1KT2B 3EH3B 3PQYD 4HX1B 4N9OB 4XWGH 3QORA 1HEHC 5CSZB 5KSUA 4JVPA 5JW5A 1WFNA 1AO7E 2WVVA 4AIEA 4LLVB 1CDBA 2NNAB 1ZLUH 3M07A 3CH1B 1S9WB 2GIYA 2WTOA 3ULUC 1B4RA 2AABL 2PPAA 3FO2A 3L3OC 3BVTA 3NP3A 4IMLA 4NHCH 2CMRH 4LPTA 4M6NH 4JG5A 3KYOB 4XMKL 3SGJC 1O75A 3VMNA 2IQ9H 3KLDA 4ETQB 2MCPH 3LHPL 3QWRA 4XCFL 3N2JA 3GT6A 4OZGA 4GQRA 5HYQB 4CADB 2G2NA 2L3BA 2VDMH 2D7PA 2OMTA 4NUGL 1ZSHA 1S7SB 5FYKL 2BJML 1SQMA 4XN8A 5BZWB 1E2WA 4NLAA 4NN6B 1F3JA 3DJ9A 5BS0E 1HX0A 2DKUA 1NCBH 5DYOA 3LVEA 3S5LA 3WIAA 5EU6B 2WZPA 3ULVC 4HHAA 1KEGL 5L2KD 3IAQA 4G1MB 5J1AA 5DJ8B 1R5WB 5EEYA 2ESVE 1PKQE 4LEEA 3L3GB 2YFOA 2TSAA 2ED8A 4URKA 1VACB 5ICXA 1O9ZA 3KYNA 4AT6B 3MBEA 2UWEF 3KWUA 3DK0A 3ZE1B 2A4ZA 1UWGH 2QZ5A 4K23H 4AEHH 4QRSB 4UOQA 1Z9LA 2QQLL 4GBXD 1KXQE 2C9UA 5JQ6L 1BBJA 2ZOTA 1IBBA 4QRPA 3BWUC 2XA3A 4KVNH 3RZWA 1DQTA 1BM3L 4MCNA 3PPSA 5KSAC 3QDME 3RX9A 3PWNA 2EYRA 3BN3B 1L6ZA 3INUL 4MX7A 3GYRA 5DUPL 4WI3A 4OZIE 5CGYD 1SBBA 3EYQC 3DX7B 4NZUL 4APQD 5JHBA 3NZSA 2BINA 1IM3A 5ITFB 1R3HB 1XCTA 4MCZB 5HYSA 3V0GA 1RURL 1P84K 3K6OA 3X1GA 1YLBB 4Y4FD 5FECA 5D2NC 5FIEA 5F7LB 1S5IL 4DKEL 5T1JA 1OARL 3GMMB 4BZ2L 1J1OL 1QPXA 2LHAA 3APNA 4NNYA 1A14L 5HPMA 4PWKA 5I1HL 3SJVB 3O0LA 5K9OB 1I7UB 2NY0B 1WZKA 1NJ9A 4OZGE 4O5LL 4A2HA 2O5NA 4JB9H 5K9KB 2DWEA 4OSUH 3VFGH 3B2VH 3E0GA 5IEKB 4YBLC 2H5UA 1UOWA 1RZGA 3CXDL 4P9HL 1DQML 1UM4H 2FSDA 4UAOB 1WG3A 1O7DE 3H3PH 4DH2A 2Y25A 5HDOA 3TO4C 2VDKL 3HZ3A 1U8KB 1OGSA 3EO0A 4NO3A 1ZGLA 2K7PA 3TBSA 3RVXC 4JFFA 1NL0L 3CPLB 3T0BA 3E7JA 1ZTXL 3TESA 4EEEA 1IJ9A 4R7DA 4DZBA 4X83A 3LKRA 4L4TE 5SX4H 3ZT7A 1TMQA 3VVWA 4Z78B 4AM0A 3MNVB 3QJQB 3OMNB 1BREA 4GMSL 2E27L 4V11A 1E4KC 3FB7B 4ZMYA 5L7XL 5DEGB 5DRWA 4P2QD 4DO6A 1A6TA 5EIVA 4FEIA 3KW8A 1BBDL 1AOHA 3HHMA 1CYWA 2X2YA 4HUNB 5I8EA 5DVOA 4AQZA 5H2BA 2YJLA 4GKZB 4QO1B 4BXSV 2J57A 4CN1A 4U1NA 3FDWA 2VW7A 3U25A 2VAAB 3ARXA 4HIEA 2BVPB 4QEGA 5D5ME 4EI5D 4R8WL 5KYYB 1IM9D 4JY6A 4FXGC 4MAYC 4NNXA 4DQOH 5CN3A 1T7VA 3GXDA 4HPOH 4TQPA 5G5DA 4Q9RH 4RAUB 2OZ4A 1HYSD 3VXSA 2F8VA 2HKHL 5MEOA 2XN2A 1OSZB 3MV9D 4IRJB 3TO4A 4HJEA 3TA4D 1TZIA 4NPKA 1KXVA 4ORGA 4YGAB 3L3KA 3OVUB 2XETA 1JK9A 1WSST 5F70A 4MFHA 5KOMC 3BFWA 4E9SA 4P9ML 5KBMA 4NM4H 3SE4A 3D18B 2B59A 3FQUA 1KYAA 1BEYL 2JTDA 2VC2H 2BSRA 4YFLI 4C56A 1JGUL 3D39D 3DX3A 1OE1A 1F4WL 2C3GA 4U2ZA 2MCG1 2X89D 3VWJD 3U9PH 3A3YB 2J6EA 4J2XA 5KANI 3B2PA 2FYVA 4WNJA 1XIWC 4PWGA 1PG7L 4Y7MA 2X09A 4ZSOA 3SDDB 1Q0YL 3ZE0B 4OW6A 1A4CA 3IRCA 3W0WE 1NFDB 2DW5A 3FTGB 1OF0A 2R2BB 2G9KA 4FRWA 4F33B 1B0GA 1OAUL 1RIUL 3CDZB 15C8H 2IADA 2NT0A 4UT9H 2BP0B 2QELA 3IMUA 1PNCA 3UP6A 3EYOB 3ETBF 2XHNA 2COQA 4L2YA 3FTUA 2PR4H 4NZUH 3FT3B 1W9XA 2HTKD 2GUOB 3H85A 3K6IA 5BZXA 3ESMA 5F88B 4WFFD 3JUYA 5AUMA 4GSDH 3H2QA 1JFQL 1QABA 2A9DA 4L1SA 2ATKB 3BH9B 4N5EC 1HCYA 2JCCA 3GK8L 4EI5B 3VFNA 4JFOB 4QF1B 2KDGA 2YIHA 2YC1A 2YKLH 2OYLA 3EXLA 3V5KB 4GQ9H 3VTTA 1YPZE 1FNEA 1QLRB 1T21A 3PUUA 4A2DA 4B53A 1N4XL 4EI0A 4QNPE 3O3EB 2ED7A 2IWGA 5IUCA 3FMGL 1JCKA 1ED3A 3EF7A 1S7RB 4KKBC 3BUQA 3AITA 4X5RA 4XAWH 3QIBD 4C4UA 1T89A 3BQUB 5C0BB 4PJ8A 3PNWA 3PNRB 1Q9KA 1NLBL 3MR9A 5LJYH 3MOBH 2NYKA 2E59A 3C09B 1FZOB 1AZBA 3IDIB 2VSKB 1R3IH 3BKCH 1MRCH 1SOQA 2R29A 3Q9QA 3QFGA 2F7IA 4LMQI 1MCDA 3TASA 1I1FB 3OHXA 4M93B 3MV01 4LPCA 1M9SA 1NGPH 4K8RH 2NSMA 4OLXH 4PLNC 2VXVL 1LM8V 1AQMA 5EZLA 2IQ9L 3L54A 2XKNA 1IO4C 4L9LA 3S34H 1DVSA 2EIJB 2WWMC 2GQHA 3DO4A 5D7SH 2F53E 3QIUD 3UG5A 3FNKA 2JIXD 4NNYB 4WWKD 1G7MB 3HLKA 5CM1A 4LF3A 2XBDA 3MOAH 1FN4A 4FQXD 5HDQH 3RI5F 4UIKL 1WWBX 4IBVA 2H45A 3UBXG 5EO9A 6FABL 1I53A 1V3KA 7FABH 2FAUA 1FQ9C 2EVHA 1P7QA 3SCMB 4M5TA 3RBSA 1RVFL 2WANA 3FULA 4OGXH 1UOKA 3JV0A 2XTSA 2R56H 2J5LB 3NJNA 1I1RA 5LG1A 3G5XB 2OX5B 5DT1L 3ZE0F 5KVEH 3Q8CA 2ICWA 3ISRA 5C0FA 3BSGA 1L7TL 2OJZH 3BH4A 3P30H 4P4KB 2EDEA 2X4SA 3SKOA 1HE8A 2XVLA 1HXYB 2UZXB 3MNMA 3C60A 2KLSA 2DQGH 3L6FA 5GGTL 3U7YH 4E42B 1IBDA 2NRDA 1S7UB 9PCYA 1RK0A 3S9DB 4LEXL 2ZOLB 3EH5B 4BFJA 3N40P 2QHLA 3ZTJG 1IB5A 1AI1H 2LAGB 3HR6A 4KH2A 4UU9B 5KAQG 4XNBA 3MUHL 3TL5A 2CBMA 1WZ1H 4MZRA 1BMWA 3T6QC 1NPJA 3D5OF 5MHSD 3QJOA 2Y7OA 3FUEA 5KYUB 1E2ZA 5GGSY 1LE9B 5IHZA 3EBHA 3QHTC 2A83B 3M17A 2AQPA 3MRCA 4YFLF 4XP9H 4Z95L 1O7VA 3FT0A 2XPZA 4NO2A 4AMXA 4DJMA 3RNQA 3VB8A 1B3JA 3QFJB 2G5BA 5I15L 1ZHKB 1ZWIB 1RIHL 5C0ND 4YEFA 1M05B 2X9ZA 3KYMA 3M1BB 4PGZA 3K4DA 3O3DB 5E6IB 2OFQA 3U6RA 3KM2A 3HE7D 4DW2H 4LCIH 3RPIB 4ZX6A 2MTAA 3W57A 3C9NA 1TNNA 4M1GL 4PJEE 3EHBB 3IFOA 4XBPA 1KJMB 2H2PC 3TBTA 1BAFH 1SEBB 2NUTA 3KVDD 3OC8A 4F9LA 3QULA 4KU1A 1DVXA 4CMHC 1DN0A 4E9QA 1MAJA 5F0JB 1XF2B 4JBSA 4XCNB 3LKNA 2Q2EB 4YDIL 1RZPA 2N7AA 4L4VA 3VFOB 2BK8A 1CZ8L 5DMGC 2NY4C 2UYLB 3H3KA 3M1CA 3WJMA 3N1PC 2ZCHL 1U8MB 3VYOA 2VKWA 1D7BA 2EADA 3GEFA 3CVIH 1OSPH 1AIFB 3P77B 4HWZA 2FO8A 4TQHA 5GIRB 1BAGA 4F2MA 4ZTOL 4IOFD 3O8XA 5AUMB 2LV4A 1XGRA 5EZJA 2EQDA 5T33H 1RFDL 1BG9A 1U41A 3WLBA 4F58L 3HPLB 1ZT4A 3VGAC 5B3NA 4LVHC 3LKPA 4DN3H 4CC0A 1T1XB 1U3YA 2AQ2A 3QJXA 5DJXB 5HGBA 5DZOA 3DX0A 5A6MA 3FB5B 3L7EB 1VZHA 3RYMA 5C0BA 5A16A 1RXLA 1AXSA 2ILLA 4KPHH 5C0RL 4HCFA 4WKZA 5GGQH 2VDKB 1UXSA 3CX5J 2PETA 1VADB 3ML8A 4ACTA 4P5KA 5HY9B 2VLJA 1UZ8B 1SXNA 1XZ0A 4PBXA 5KS9A 1Z9SA 4PWIA 3MUJA 4MJ5A 5C0RH 3W39A 1F8TH 3WTYA 3OZLA 3A22A 1V10A 2IAAC 2WMPA 2WO3B 3WNJA 1XF4A 1GCFA 3ISWA 1EHLL 1CXEA 4KOBA 4DN3L 3PLYA 1TETL 1A9EA 3DTXB 4Y5VB 5JDJA 4KV5F 4ZMTA 1KUMA 5DGRA 5MEPB 2AXFB 5CU9A 1QBLL 2WINB 2FEJA 4N2AA 3GMLA 2X2IA 4Y5XA 2DBJA 5DYFA 1E8XA 1HKLL 1AQKH 3BPOC 1W0YT 1BD2D 4IW4C 3FQRA 4GQZA 2RD0A 5ID0B 3I6GA 1MFNA 3RFZC 1G0DA 3RWIA 1G84A 1UH4A 5F9WC 1XCWA 1P2CA 1XHHA 4X9GA 5DYOB 3S5LB 4DVRL 1F11B 3DV6B 3MSPA 4OLVL 3Q5YA 4IDJL 4FTVB 4WUUD 4PJ9B 1R19A 1U3HD 2JKJA 3NJVA 3Q6FB 4J6IA 1N59A 4DO4A 1TKWA 4X6CB 1HJBC 1ZA3A 1FFRA 5DZLA 3QZPA 2XWDA 1IE4A 1K4CA 1ZVSA 4L9DA 4MNHA 5CJBA 4FQLH 7CGTA 3MREA 5DQDH 1BVZA 3PAUA 4MXQD 2HG0A 3WNLA 4Q89A 4YDVA 4RISH 1U93A 4OH2A 2A6IA 3MBED 1J8HA 3GM0A 1BOYA 1EJ8A 5D70H 3WXVH 4BZ2A 3TU6A 1FFNA 1MAKA 2X4UA 1JPTH 4NCC1 3ATBA 4Z76A 3ZKXB 2YO3A 2C3XA 1HVXA 3LS4L 1I7ZA 1PSKL 2O5YL 4H0HB 4XNYH 1RUKL 2AP2A 3WO3B 2BWDA 2MNUA 3DUSA 3O9WD 4HLJA 3IJYA 5D7LA 4WFEE 3D25B 4Y2DC 3S3CB 2NZ9C 4M1DL 4BFBD 3U82B 1N67A 1PVHA 1NIFA 1K3IA 5FLVA 1GZHA 1AI1L 1DE4B 1KACB 1NBYA 2Y06H 3QQDA 1CURA 1L3NA 5F44A 3JWNH 5FECB 4LDEB 4A2EA 4XXCC 2NDGA 3FU5A 1KV7A 3U7YL 3L4XA 2WNXA 2LU7A 1HXKA 5C0CB 5AW8B 5C7ZA 3FB7A 3VTAA 5LBVA 2IBZX 3PDGA 3ROLA 3AS2A 4APQC 2WTPA 3CG8A 3DX6A 3L5JA 1OP3H 1WFUA 4UBDD 3KL5A 4R83A 4OBSA 1LQSR 4AQAA 4DIXA 3QNZA 5E1AA 3CBJB 3E6FB 4YHOL 1CK0L 4MBRA 3NCEB 2HFEA 7PCYA 2K78A 3QAQA 4CA4A 3TBCA 3AWEA 1MFVA 1RH8A 2R29L 3ZIMA 4N0YL 1BQ5A 4QTFA 4FKHA 3WY4A 5CEZH 2CE6A 5CZXD 1XGPB 3KPSD 3R8BB 4HT1H 1L0YA 5CUSH 4CVZB 3R1GH 4Y4KD 2RTTA 4DEUA 2AXGB 4I1RA 4RFOH 3HHSB 1CD0A 1AP2A 4JN2B 3FAWA 5FGCB 3FU7B 2IAMA 3QIWD 3NZUA 3BYYA 3VGBA 2JV6A 4BRJA 3U4EA 5BJTA 1I8IA 5FW7A 4ECNA 2VDQL 3ATDA 1L0QA 3FUIA 2BCKA 2OSWA 1S9YB 4PJ5B 1PCSA 5LN8A 1FH5H 3S96A 2CO4A 3RP1A 2DN7A 2Z31B 5HYEA 4WHYG 2GSIA 4FZ8H 2LLGA 3MRBB 1N0XH 2XXGA 1CD9B 1TQWA 4H2CA 2XXMB 5B1JC 2E9IA 1E4XH 5JQHC 5BVPH 1YQVH 5DCCA 5H94A 1I3GH 4ZI8A 1K72A 5IK3A 5JTWA 5C09E 5CLXA 4LFHG 2IALB 3MUY1 4KZDH 1KPRA 1NMCB 5TGBA 5K39A 2IJ0C 1PX8A 4KUZH 1UA7A 2D2CC 2J8UB 1XF4B 4RGNE 2RALA 2BVOA 4FFVC 3ARDB 1IBGL 3JWNG 1IUZA 4JK0D 4IOSA 1LNUB 1FNAA 1MFBL 2DI8A 4B9FA 3SGEI 1N4XH 2UZIL 2O30A 1SHSA 4P2QA 1WAEA 2XV0A 1EANA 2QQKH 1E4XL 3OB8A 2PO6A 5BRZA 1QBLH 4NM8H 4X99B 5CNHA 3VD9A 1U8OB 2WN2A 4G43A 5I8CB 3ZE1F 1USQA 2DL9A 2YKLL 5FO2A 5AEAA 5T8IA 1TO4A 2EIBA 2YK1H 3NAAL 1MFDH 4OZFB 4UILL 3EOAA 4ONGL 4ZFFB 4ZPVB 5I26A 2X89A 4NQDA 3MUGB 2ZOKB 4N0UB 3CZKA 3HTLX 4NC2B 4PJGB 1B0GB 2R23A 5D7JA 1JRHH 2Y07L 3BIKA 4H13C 5GJTL 4ZMXA 2WLNA 5L0QC 2XZQH 2F15A 2WKOA 4J5VA 15C8L 3EHBC 1CYXA 3N3EA 4PWHA 5A43C 1JZ8A 4NERA 4N90E 1MCKA 1NEZG 3QGVA 2OMWA 2QVIA 1QSEE 1FZOA 1MCPH 3BRGC 5JW5B 4NN6C 4WY7H 1MHCB 4AGNA 4F58H 3BMVA 3ZJAA 1CK0H 1NUFA 5GSVB 4X4ME 4ZQTA 1KPUB 3C6EA 2HRPL 1G0YR 5CMAA 1O6TA 2V9TA 5KYXB 2QV2A 2UVFA 3CVIL 4JGJA 1KTLB 3NSYA 1MFAH 3OR6A 4TVPH 4QAMB 4Q4EA 3RUGA 5IW6B 1I85C 4QTHB 4OZFH 5T3XH 4H1LA 1INQA 5L9DL 2X70A 1QP1A 2K8QA 2YUXA 3HC4H 2VNCA 3UTTE 4JO2L 4FN0A 1DVQA 3HNSL 4XWOD 1AD0A 3O2VH 2VTFA 3O4LA 4TL4A 4LP4A 3W81A 1X5XA 4YDIH 3G7TA 3NN8A 1I9IH 3FO9A 4G6JH 1N68A 2XZZA 4AL8H 2CIKB 2O5XL 1Z3RA 2DB8A 4NUJA 4DP2X 5E2TL 1EAQA 5AG9A 5BMFL 1I31A 1U3NA 5JIDA 2FLRT 3KZ8A 4OGZA 4K3GA 1MJ8L 2CRMA 1J18A 3X1FA 4BHUA 2K45A 5JORA 3U1SL 3VGHA 3ASOB 3K1KC 1UC6A 4QHKJ 4HKXA 2BIIA 1XXFC 3O4OC 5DMJB 1C16B 4RQQB 4FULA 5D70L 3WXVL 4FLOA 1A3LH 1T0PB 1FZMB 2HTLD 2NXYD 1AG0A 3UJIH 2PTVA 4NGHL 1MAMH 2D0HA 2ZWYA 5DQDL 2QVMA 2B4CL 4YLBA 3L6FB 1VPOH 5JQIB 3AQYA 2FL5B 4JO3L 1VEOA 2B1OA 4V2CB 3ZTEA 1T1WA 5I0ZA 3F6JA 3GMQA 1Z3GH 3BUDA 1A4JB 5E2WL 5FKAB 5FYJD 4IDJH 4M48H 5E2TH 2PO6C 3EDFA 3Q01A 4DVRH 4AZUA 3CXDH 3MX0B 3S35L 5I5IA 3U83A 5CEXB 1RJZB 4OZGF 4WWKB 1I9IL 4ELKA 5F89A 5EBLB 1D9KC 1ZVYA 4QOKE 1I7TA 3V9CA 3WO4C 3C75A 3CFBA 2ZJSL 2NXYB 2AVFA 1ROWA 3HCVA 3LZLA 5C0BD 1DCLA 1Y6KR 3W38A 1U91B 3KPPB 2MOQA 3Q5TA 4MWFB 4K4KA 4PBVC 4PSPA 5BV7B 2GTZB 1YC8A 1YMMD 4POZC 4P2OB 1COBA 3HS8A 4JY5L 1ZY9A 1R47A 4TXVB 1PIGA 2BVUA 5AVQB 1JPGA 4BH8B 1CXFA 4G5AA 3QQXA 4TM9A 4JUTA 4BXVA 2WGNB 1CE1L 3STZA 3ARDA 3VFOA 4R6UA 5HDLA 4F7MA 2OZ4L 2OTWB 1NCAL 3QQ9D 2LFEA 2FECL 4OFKA 4DP0X 5TGBB 5H2BB 1TJIL 1MFCH 3B4NA 2PF6A 2EAEA 4OF8A 5B7FA 5C0GB 1Y0LA 3HHRB 2RB8A 2V7HA 1MCLA 2ZP0T 4GG6F 43C9B 2C7FA 1WBZB 2B9BA 5GRJL 3LKQA 3B3IA 4XH2B 5ESAB 5I9QC 4KPHL 4XE5B 3TONA 3HPLA 5I1CL 4YVNA 1EUTA 3O3AA 4I88A 3L3GA 2QT6A 4HLZG 1OF2A 5SWQB 5GS0D 3HZYA 1UWFA 2NLJA 4HWZB 1OAKL 4LEBA 1B0IA 3VI3F 1NDMA 4CJ0A 2YKKA 3KWTA 4B3VA 4YR6A 3KJ4C 5DHEA 1JZ7A 2K9UA 4X7DC 3U46B 1R3IL 3WS3B 4PJBA 4M1CC 4ZS6C 5C0AB 2NUPB 2WUBL 3MBWA 5IG7B 1X7QB 1YJDH 3WFDL 4Z7WB 4L8SB 1DQKA 4DTGL 3S3PA 1CBJA 2HKAA 2B16A 4MCYB 3VFVB 3GJEB 4XXCA 2ZAHA 3DECA 1E90A 4MQXC 3P1VA 4HSCX 4TNEA 2ZUTA 2NZ1A 3MXWL 2H0EA 4RNRB 1I1AD 1PLAA 4P57B 4TQEL 3KAAA 1LDPH 2CR3A 1HXYA 3H53A 1Y1DA 4JCWA 4GQ9L 1QW9A 1XCQB 3MJ7B 4QRQB 1YY9D 4FZ8L 4I48A 4L37A 5TE7H 5DS8B 3UPRB 4ZUWA 1WC7A 1DANU 2CUHA 5ID0A 1GIGH 3LB6C 3T71A 4AQ8C 1KLGB 4UZSA 1HHJA 2AJXH 4KRPD 1SOXA 5D1QD 1K2DB 5AB0A 5JW4Q 5I1EL 5KBLA 3QXTA 4HA1A 2V37A 2VN7A 2WJ5A 3ETTA 3QK0A 3MLTA 3GMLB 5IGXL 5I5JA 5F7FA 4AXWA 4ZAKA 1UWXH 4MNQE 4O2CB 5F0MB 5I5MA 2ALAA 4DAGH 5IMOA 5KS9F 3R1GL 5E00B 5PCYA 3ZW3A 4UT9L 2WIIB 4Z7NE 1QFWM 1LEKB 4NO2B 4ANWA 4G9DA 2JJUA 3RVTC 4EXKA 2R39A 2NCMA 3O0RL 4LPYA 1QWHA 3OG4B 4W68A 1SJEB 3O4LD 5J4MA 4OLWL 1G87A 4HUVA 1AS6A 1XO8A 4IOFC 4YDKL 3AVEA 3OSKA 3V9FA 5EU3A 4APQA 1N5AA 3K71B 2EKJA 3EKCA 1PDKA 5KG9A 1V3MA 3LEYH 1FLRL 3CLEH 4MNHB 4TSBL 2WAHA 2H2SC 4EUPG 3CSFA 3FQXA 5HHMB 2VOTA 1FI8C 2R4RH 2R51A 4F1ZA 2ED6A 3IDIA 4NSKB 2F54B 1BZEA 1C5DA 5CEZD 1C8QA 2CDEA 5IQMA 4LHUA 1HEZA 5AVWB 5F0PB 1JHLL 3V4LA 1BYPA 3FU9A 3MVSA 2YPKA 3EJTA 1KGCE 2J8UF 1XGUA 4DOHE 3CVDA 5DO2C 4N0FB 2BVQB 3D33A 4FF9A 1FUNA 3S4SA 7FABL 1FO0A 5CN1A 3I74A 4K71B 2B39A 1LWRA 3RY6C 1CTMA 4GW5A 4F8TA 3VW3L 4B9YA 4EZJA 4A7GF 1WFTA 2I9LA 3NCJH 4BJLA 1J0JA 5B1BB 3JTTA 4FQPA 4HPYL 1WWWX 1IAIM 1ZTMA 4U33A 4Y19A 1JPFB 2GW5A 3P3YA 2VMFA 1NQBA 2VXQL 3VXQA 4DPRA 2E27H 5IM7A 1J48A 1NC2B 3RZCB 4KHXL 3B1UA 3KYAA 4Q9CA 3WFZA 1FL5A 3HG0A 2VUKA 5KSAB 1EBPA 5I17A 1Q9WA 2NW3B 3WG7B 1RIVL 3RL2A 4FQQA 3K8MA 3LQAH 2FBJL 2EE3A 4F33A 3H55A 3MOBL 3CC5A 5DA4A 1IZJA 2ROXA 2LE9A 3B2VL 4U6VL 1F13A 4JDVB 4CMMB 1UA6H 2A5UA 4P46C 4FQHA 5D1XD 2XPGA 1A6AA 1BVLA 3HS0C 2XV6B 5A2KH 4YE4L 2UXGA 3VDBA 4LLUA 2OL3H 5CBEB 3V0HA 4BUGA 2IPUK 4MJ4A 3KWWA 3K72B 5FKPA 3U0PA 2VLMD 4G7VH 4E41A 2H9GB 1T21B 5KEZA 5D5MA 1WTLA 5MEND 1TZOA 2FWLB 1YUHB 3PP4H 2VL4A 2ZPKL 1YEFL 4J3XA 3HS9A 2DQIH 4CU7A 3Q3GA 4OFVA 3UP1A 4A2LA 3CIAA 4GSDL 1X5FA 3QUYB 3P9LA 4GS7C 2IFGA 3DPDA 5F1KC 2NPLX 2ADIB 1S78D 1JRHI 4ZX3A 5G4OA 4JZNB 4F57H 3BDBA 1MCEA 1JI1A 3D1MC 3RZCC 1F58L 3L3OB 2VIRB 1E5UI 5AOLA 2X4OA 5DHVA 3BSHA 2X40A 4F15B 1P7HL 4BZ1H 1Q0YH 4NZFA 3HUJE 4TL5A 2OMTB 2PNDA 3NIDB 4MZ2A 4GBXC 4ZMZA 5CZVL 3ILPA 5EZLB 5ITBH 1P7QD 5CFHA 3HE6A 2Y1VA 4GAAA 3BP6A 5JW4R 4ERSL 3K7UA 5T33L 3MBXH 4IRZH 2ZAGA 4WVRA 4K9EC 3C6LC 2CLVA 2Z7ZA 5J11C 4DEPC 3V4PH 3POHA 3E38A 3VXMA 4YHYC 4UM8B 1XV8A 2A9MH 1YUKB 1VFBB 1YNTB 1PQZB 3QO1A 4PJ7E 4S0HA 3Q2VA 3EF4A 2YD0A 1RJYB 2DI9A 4AKQA 4OJFL 2QKIC 4OFYD 5EZOL 1RI8A 3QI9D 1U9KA 2DQEL 3CDFA 5IB2B 4KGJA 3QQDB 5F3HA 3O11B 4OVVA 2F54D 3VX1A 4AKOA 4LIQH 4UDUA 3AU1B 2CMRL 5AL8A 3BPNC 3AS3A 1IAMA 1UWYA 2JJVA 4B41A 4UMGA 3B9AA 4W9ZA 3FYEB 4X98B 2R8SL 4MB3A 3UYRL 1CI5A 3RNKB 2VLKD 3F04A 3NBNA 1DZ0A 2JJTC 4WWID 5F72S 4R90L 2XVBA 1QI4A 3TCTA 2KH2B 4JHUA 4V33A 3SE9H 5ITFA 2YA1A 4RGNB 3EJYC 4QYAA 1CB4A 2J43A 4EI6A 4F37F 3APFA 4QD2E 3RHWF 3V4VH 3GSNL 3O45A 1BX2B 1HEZB 4YZFE 1T0OA 1U3HC 2IDFA 3PXLA 4U1MA 2VDLB 2IO5A 2CDEB 1UASA 1BQHA 2CR0A 5HD8D 5HGAB 2HVJB 4LCYA 3FT4A 1QW8A 1DEDA 2BIQA 2ZCLL 3NUKA 2ZKWA 4GP4B 4GKSA 2NY3C 4NT6B 3HUJA 3L13A 3VA6A 5DVPA 4G6MH 4YHIA 1C5CH 1KN2H 1ZHKA 1ZWIA 3MKKA 3QJSB 2QHRL 1JG9A 1CGTA 3SQBA 5C0CD 1VSCA 4LAQH 4PW3A 2X1PA 5HSFA 1XL4A 3EYQD 4ICXA 3W9EB 1DBBL 1RLWA 5AW0B 4PJGE 2Y72A 4FQCH 4HUWB 4S1DD 4HXAL 1UJ3C 1KZQA 5JW3L 1SFHA 3K3QA 4ZMPA 3PV6A 3IU3A 5DJZA 2MHAA 5JXEC 4GG6E 3CLWA 4OCLC 3Q44A 1ZHLB 2A6KB 1RP9A 1CIDA 4EDXB 2XWEA 3ECWA 5EU4B 1UEMA 2EIDA 5M95B 2GTWA 3UG4A 2O6EA 5DT1H 2VYRE 3GHPA 4P99A 4YO0A 2FR4A 1SJHB 1AGEA 1PX3A 2M83A 3X17A 3K8LA 4DFHA 1CDCA 5FFLA 4N2BA 1I9JH 4JJ5B 2Y4SA 3INUH 1M71B 4EVNB 2VERA 3RX8A 3FFCA 2EXYD 4G8GB 2Y36L 1KTJA 2MMXA 4XO4A 3PWUA 2Q0ZX 1INEH 3CPUA 2EH7L 3IRPX 3NK4A 1WIPA 5J12C 4L9LC 1K5WA 1XBDA 5JQ6H 1LYQA 1J5DA 4U1NB 2NY5C 4BK5C 2YHGA 2Q3ZA 2X0WA 4TSAH 1LO5B 1WITA 1E4WL 3QEHA 1P1ZB 4YWGH 1QSFD 2LLLA 3JWDC 1MREH 3FF8A 1IGFH 5FUCC 2HLFC 1G6RH 1BMGA 1S7WA 5IB1B 2NW2A 4OKDA 1CD1A 1S7TB 2VLJD 4GLRH 4CGTA 1GW0A 1MNUH 3MV7D 3QEQD 3UG3A 5BQ7A 4HK0B 2BY1A 3PQYA 3BT0A 2Q2LA 1NOAA 4G80B 4PV1C 4DGWC 4ZNEE 1E6OL 5IWLA 3AXLA 1DL7L 3FN0L 1OL0A 5FK9B 1NFIA 4XNQB 5E8EB 1ID5I 3QZWG 1HZHL 2IMMA 2NQCA 3MRQB 4NXKA 5DQJA 1J5OL 1NCBL 1SEQH 2HVKA 1UJTA 3DSFL 3SE4C 2QMJA 3ZHNA 3BHBA 2YWZA 3AU0A 3VXNB 2BNQB 1KJVB 3G5ZA 4KK9D 4YNYA 4KK5C 1FL3A 3QQ3A 3GNML 3DNKA 3C5SB 4H8WH 4HV8B 5LKNA 3LN5B 1GYAA 1IGTB 1OTUC 3UYPB 2JKRM 1CGVA 3GTVA 4PY7A 4XMKH 4Y0GA 1DVFA 4PP2B 4GLRI 2VZUA 3CLFH 1FYTB 1QRNA 3IJHA 5AYQA 4LSUH 4XN4A 2ZG1A 5INCB 1KTDB 4J8RB 1OPOA 4NRXB 1HNYA 3ZZ1A 1DQQB 5E6UB 2DQJL 5IMMB 3MRGB 5KSBB 1R5VB 2VDRL 4KHTH 2W92A 3RWCB 2ITDB 3WEOA 4B9CA 3ERXA 4HX1A 1H0DA 4WK4B 4XN2A 2D3VA 4NUJB 4G8IA 3PL6A 3QAZB 1FCGA 1K8DA 1GRWA 4LSRL 4PS4H 4OLYH 5DK3A 1Y6MR 4F1SA 4KKRA 4L4TB 1DBAH 1QVOA 1JZEA 5E5RB 1LO4H 5FO7B 4QKXB 4YX2L 2OMYB 1DR9A 4Z1PA 1B0RA 2H3NB 1NKOA 2BS8A 2QQQA 4PJDF 1N19A 3IXTA 4FQCL 1SN5A 2C7UA 2Y7QB 2ADFL 3S96B 4PJ9D 2P26A 1PJ9A 2GSIB 4B96A 4AMKL 1PD1A 2R2EA 3U0WL 2N0KA 3KPSB 4M3JA 1C5CL 4J2QA 4MA3A 4KGLA 4LEOB 4EDWH 4Z76B 2F68X 2R2HB 1NAML 5DD6A 3PHQB 5ID1B 5D55A 3D50A 2G3MA 4GBXA 4YHZH 3S2AA 1DCEA 1WEJH 4ZUUA 2IBBA 2FUQA 3T3ME 3X14A 4DERA 2PWHA 1CLVA 4LQFL 1A4JA 1FF5A 1F3JB 4APXB 1A1MB 4JJHA 5IHUL 1G1KA 2W65B 2YUWA 3NCWA 2I69A 1ZHBB 3B7TA 5AENA 3L9RB 4Q6KA 5FPIA 3FO0L 1NAKL 2I9TA 2I85A 5IIEA 4XVTH 4OJYA 5TPWH 3P4LA 2BIOA 5HGAA 1NDTA 3ZQXA 4HPOL 2ZOKA 4N0UA 3ZSTA 1BLNA 5IVXF 2VR6A 2YAOA 5LXVA 1GYVA 1F1AA 2UY6B 4J3OH 5EO0A 5HVHB 3HBGA 3SCMA 4W4NA 2LT9A 1MCJA 4KK6D 3RFRA 3TP4A 4H8QA 4YXHL 3LZRA 2BO0A 4J4PD 3O6FC 1PNDA 1S7VA 4MA8H 4H8UA 3ZY7A 2GJZA 3KJ6H 2C3HA 1BBDH 5JA8B 1A6WH 4EJ1C 3VD1A 4YAQB 4KZEH 2FO4B 3ARBD 4MDIB 3QNYA 4X6DE 2ZYRA 4PJ7B 2HJLB 2AJSL 1JK8B 2ZONA 3EJZD 4AQ1C 2ZKXA 5DLML 3S8GB 1MRDL 3PWUB 1GR7A 1IFHL 1XB8A 4ETYA 3OAUH 1E40A 1M71A 1G94A 2WNWA 2XWZA 3CN2A 5DD3L 1JGLH 1ZA6B 3KCPA 2X42A 3TV3H 3H9SB 2FQFA 2MPVA 5D93C 4KMQA 8PAZA 1NANI 1SUJA 3WKNA 4JB9L 4ERSH 4FX5A 1XD0A 4LOEA 3QHZL 4GT0A 3CFDB 5FHBH 2P1YA 4KVCH 3T6XA 4NFCA 2R4SH 1HNFA 3FBKA 3DX2A 4LHJB 1N5YL 5E9NA 2CHZA 1I82A 4EN3A 4C4KT 3DDFA 4NI3A 2DTML 5EV7A 2HPOA 3FJTA 1GC1C 1B0WA 4GQPH 5JOEA 4MD0B 4MDRA 1MEXL 4F57L 2ESVA 3TH3T 1J9RA 1QZNA 2VDQB 3FH5A 5ETUB 5KVMC 2Z34A 4LRNH 3VFSB 5E8EA 5JXED 4S1RH 2OMVA 1IILE 1RUPH 4DCQB 4F7EA 4WEMB 1BYNA 4FLQA 3QEGL 1Q9OA 5E6SB 2DQIL 3DGCR 3TYFA 2QGBA 3RUGF 3IN0A 1YDPB 1A25A 2Y1ZA 1O7SA 2HJKA 4PJXE 3VI4A 1G9NH 4ZFQA 4FJZA 5EIQA 3J07A 4G7VL 3FL7A 3T0XA 4GOSA 3P4OA 1SZNA 2WIMA 5KVFH 2WBXA 2FBOJ 4MX7B 1SEBA 2GIMA 4YHNA 5C0NC 4NQCB 3BFOA 3JTSB 5D2LE 4MA1B 1X5LA 3DVGA 4I4WA 3WHE1 1FFPB 4GG8B 4OZIA 4UQ2B 5E08L 1RZKL 3D2UB 2F2HA 2V5YA 3GC3A 2TRHA 3NDYE 1NCGA 4BE6A 3DPBA 1U8PA 1SQ2N 4L48A 5INDA 4CU6A 4XP5H 4JKLA 5EOTA 4CILA 4ES8A 2H2PD 5JUEL 3HG2A 4Z7QF 5SX5H 1X4XA 2ZXWB 4YHMH 4OFQA 1KTBA 1GYWA 1GZPB 3LEVL 3UJTH 2L8AA 3LHAA 4MMXB 1ZRUA 2DMCA 4ZODA 2ZWLT 4HH9B 2VUYA 3QNXB 4HS6A 4S0TD 2F7QA 4XCFH 3S3BB 4KZCA 5FUOL 5IVXA 1QYGH 2PYED 3H6AA 2VLME 2F6AA 3Q5OA 4QWWC 4EF3A 4NP9A 1WS8A 3E8VA 1Z9SB 3WSQL 3ZL2A 2IBGA 2EC9U 3VWKB 1EZVX 2GY7B 3QJVB 5CP7B 3W5NA 4IS6B 4XN9A 2O4EA 2Z35A 5D8JH 5C09A 1FJ1B 4L05A 2GK0A 4PJ9A 1A4KB 4ELMB 2XZCL 3HI5L 4LLWA 5HYJA 5BNXD 3LS5L 3BZ4B 3CSYB 1FO0H 4N68A 4M8RA 1H3TA 1GZQA 4FAAB 2F8OA 1NCHA 2Q8AH 4LRIA 5C07B 4AKPA 1N9PA 3OPUA 2YA2A 5KSAD 5EA0H 3PGFL 4CDHA 2HUEA 5GZOA 4ZXBB 5C0JA 3MTXA 2IH3B 1JHKH 3OKOA 5EORL 5CZXC 1G9ML 4YE0A 2J88L 1QLEH 2WLJA 1A5FH 5ISZB 3LN9A 1AE6H 1H8OA 2G60L 4OUUB 2WLLA 1KB9K 1A1NB 1RU9H 2J8OA 5FF6B 1IMHC 2QVFB 2WY3B 4PJEB 5CJQH 4EUPH 2PXYC 3VH8A 1KDJA 2E6JA 1RZJH 1IGML 2RHEA 2WYHA 3CDGB 3US9A 2ZSWB 2E47A 3S36X 5HHXL 4LSSL 4K7PY 3X13A 4KQ3L 5DFWH 4FG6D 2IPTL 3T0ED 4ZMNA 2VDPH 4DAGL 3HG1B 4N8CH 1E8WA 2AJVL 1MWAB 5KUMA 2ICEA 3N42F 5JHLH 3PUCA 5CCGE 2YXWA 3WU1A 2Z1KA 4JZJC 2AQTA 3QWOB 3OKMA 5I1EH 2X4PB 1QSEA 4HGKC 3RKPA 3O9WA 5D7LD 3OXRB 1V3JA 1WBYA 5E1GA 2ZKHL 1EAOA 2X4QB 4Y5VC 4FFYL 4Z3EA 1EZSA 4Y4FA 5MEQA 3L95B 4XRCB 3SPVA 4Y2OB 3P2DA 5J5EA 3NH7L 2C3WA 3N85L 4IK6A 1ZVSB 2OCFD 3DIVA 2UY7B 5IFJB 4ZOBA 1D5XA 4JHBA 1NWOA 3IXAA 5JPMA 3UC0L 1M57B 1PZ3A 1T83C 2BHUA 1CLYL 1HHJB 5B7EA 5C08A 5DI8B 3MXWH 3HLAA 1DQIA 3TBYB 1D7CA 3BFQG 3O4LE 4ZFGL 4O4YH 2BSDA 2DWXA 1ZAGA 2D31B 3ILQD 1TJMA 2EIZB 3EGXA 4Z0XB 3D4CA 4L29A 5HYJE 5I1AB 4KDVA 4XBMA 1PW3A 4P48A 4LIQE 4B9GA 3C6SB 1VACA 3LKSB 2OZNA 5ICXB 2ENJA 2JCCE 4XP4L 4BWWA 4WUUA 4RBPH 4PH8A 2LFGA 2J2ZA 3O2DL 4AZ8B 1JD7A 3FONB 3PDOB 2MNWA 2NR6A 3RKDD 3FT1A 2VDOL 4DCQA 4F7EB 3VD7A 2XWBB 3HMWL 3Q13A 4Q2ZB 1R34A 4AENA 4NWUL 4WSJA 4PY8J 1PZAA 1RULH 5E2UH 3VXPB 4BSJA 3V6ZB 4XP4H 3BAWA 3UBXA 4DWHA 1EBAA 2CJUL 4OKVB 5CIPH 3UGEA 2JLLA 3IFPA 3SYQA 3HB3D 1EGJH 25C8L 3PGDB 3T3PE 2OULB 1PCXA 3N41F 3V4PA 3QRGH 3OQRA 4QY8A 5LVEA 3AUWB 2R69A 3UZEA 2ZOOA 1DBMH 1W72L 5AZ2L 4HLZH 3QO0A 4IEFA 1TF4A 4LLYA 5K69A 4Z7NF 1A0QH 1U42A 1FDLL 2WZAA 4FG6C 1E4HA 4J3BA 1ROCA 3QORB 4CNIA 5C2BL 5IMKB 4AYDC 5DRNA 4FERA 3QXDB 4K07A 4G5ZH 1JWUA 5F3BA 4WTWA 3CFKA 1NC2A 4R97B 4YDJA 3IDMA 4G8FA 1PEWA 1PYWA 3C2AL 5E6IC 4Z7UB 4PRPB 3WBDA 1D7FA 3SD2A 1V7MH 4IGBB 2AJVH 1KC5L 3UOAB 1CT8A 1XGQA 3E8UL 3N91A 3ZE0E 3GS7A 3RJDA 3O2DA 1NINA 4Y4KB 5H35B 4BFEA 4FABL 5HHPA 1A7NL 3MYJA 5DJAA 2X6VA 3MPCA 2QV4A 1OAXH 4JPKH 3F00A 3LKNB 1DVTA 1RU9L 3K46A 1LDSA 5K9JL 1RZ7L 4FNTA 4YPGB 5CAYB 2IOMA 4ZFOA 1AE6L 4HXBH 1AHMA 4JO3H 1X6LA 5CCJA 4YK4C 4G6AD 4G11A 3VFMB 1ZXKA 3ECBB 3TA3D 1I8AA 1VFMA 1RZ8A 3I9PA 5BRPA 4GAJL 5ACZB 1XCXA 4FQJH 4N0RA 5GRVK 3VNZA 5T1DL 3AT8A 3FQWA 3TN0C 2VGLM 3ZKNC 3C5JB 1IC4L 4K3JL 4RSYA 3FW6A 3BPCA 4ZNCD 3K71A 2IDUA 3PFUA 4XPAL 4NQDB 2VXTH 3WKMH 3OKNA 2CBOA 3IVKB 1A21A 4OBRA 3MLWL 3MRFA 2APBA 5FW6A 2EDMA 4UANA 4D0BB 4K9JA 1MLBA 4LCUA 5ACMA 4ONOA 2AAVA 4P5TA 4MA3B 4OFPA 1JF1A 4Y8DC 4KKZA 4U6HA 5IHZB 5J9PA 1JUFA 3GHBL 3IS0X 2VR5A 3DX7A 1BZDA 3HMXL 4N2LA 3EZ8A 1E8ZA 5C9JB 4DHLA 3JVGA 1QSFE 1HHIA 4BUHA 3QBTB 1WD9A 4L5FE 5KYWB 3QJFA 1D9KB 3BVNA 2X1WL 2HVBA 3HNSH 3V0FA 5BUAA 3HC4L 2IOIA 1IAKA 3NIGF 4XC3L 5IKCA 2AS5M 4P23A 4CSSA 1ZV9A 4GRMA 4KI1A 4OCXH 2KLRA 2YWYA 5DDHB 2DYPD 2YXVA 4ADGA 2HRPH 1UTDA 1HAWA 2AAAA 4FNLL 1W0VB 1DFBL 3OV6A 1WFOA 2HCZX 4EBQL 5DMKB 2MQCA 5IVOA 1J9CT 4RETB 3B9EA 1RPKA 4I0PC 1L9QA 1AANA 4X80L 4KC3B 4TNGA 3WTUA 3OKLA 4PEEA 3OR6B 1MG2C 2WV3A 2EVIA 3DTUB 1CXLA 3QRBA 2OW6A 1ZLVK 4D3CL 3MNVA 1TSRA 4PRAB 1ZGLP 4KQ4L 5E6ID 3TTYA 1DUYB 3MODH 35C8H 2OQJB 1IEBB 1JWSA 2VLKE 1DJWA 1MJJA 3KWVA 4F2ME 1DVYA 4JFFB 3NSCA 1AXTL 3C5SA 5CXPA 1AKPA 1IGTA 4QRUA 1CJYA 3IDXH 3QUKB 5SWZB 1JGVL 1OVZA 5AVTB 4FLHA 5CD5C 5F21B 4ONGH 4U3SB 4EZLA 3T0EC 4ZDHA 3X1NA 3HNTH 3AQDA 3TIEA 4X6BA 4X8JB 3T3MB 4PCKA 2DEWX 1O0VA 3QB7C 2DKMA 5F9AC 3MV8D 2OAAA 1U4EA 1JZ2A 2B59B 4J4PA 1KBGH 4RVBA 4X4XB 1NFKA 2V2WB 4Y4KC 4I2XA 2BNRE 2F1BA 4GB9A 2V2TB 2ATPA 1AY1H 2OR9L 3BVDB 3KPNA 4WW1A 1N5YH 3MV9A 4PRHB 1P84J 4KUZL 1R3HA 1XCTB 4MCZA 3TCLB 3QDGE 4QRRD 4LSDA 4NO0D 5I1JL 2OTUB 5LGJB 1BF5A 4XXWA 3BX7C 3MACH 5FO8A 1OB0A 1HT6A 3H6JA 1FG2A 1PFCA 1QMUA 5DJ6B 5FA3A 2J72A 2PYEA 4I87A 4G6KH 1XL6A 1IVLA 1YEKH 1P4LB 1BVOA 1KGXA 1OTTD 3UTPE 3IMBA 2IV8A 1AD9B 1UZGA 1JF5A 2VDOB 3DJRA 4PMFA 4AC2A 3VM5A 5DEFA 3WJLA 3BP5B 1U91A 3KPPA 4MRCA 4Z5RA 4MWFA 4GUPA 2EYSB 2EDLA 1FE8H 2PWFA 4XX5A 3VB9A 2FH6A 3P4OB 2G9HA 4ZMQA 4OLUH 1MVUB 2HX9A 3FT3A 1XF5A 4OLEA 5T5FL 1CGYA 2GFBB 4QXTB 3EYOA 5B38A 3BSZL 4E9VA 1NMAH 2R2BA 3F3HA 2IADB 5IESH 2HX7A 4L3CB 4XTRD 5CLYA 2HJFA 3BWAA 3I75B 3QAZC 3SDXE 1PTZA 2K3TA 5CJXC 2CUIA 1UB6A 4M5SA 4WCYL 4YHOH 3GQFA 4OQTH 1YY8B 2G5RA 3G6DH 4XP6L 1IGYA 1KIUB 3MLVL 1F2QA 1UCTA 1TG8A 2VZOA 3A6BL 5E6RB 5B22A 1KBBA 1ZANH 1PU0A 3F64A 2B5IB 4IOIB 4W1TA 1NFAA 2AVGA 2V7NB 1GGTA 4D94A 2FWOB 5L88H 2G2RA 2VN4A 5GJSL 1CFMA 3EFFA 3L3JA 4E9XA 1G7QA 4M93C 1KENL 4BFKA 4IHBA 2Z31C 3PF2A 4AQOA 2V2XA 3LOWA 2OCJA 3TO4B 1W6WA 2FT7A 1KNOB 3DMMC 3CZJA 4HMDA 2LVCA 5DHYA 3U0WH 3M8OL 3T04D 1E9OA 1A8ZA 3ISYA 2CRIA 1UM5L 1AGFB 4YBLB 1KV3A 1PGRB 2P5PA 2X38A 3B9KC 5KVDH 2FZ3A 1X9RA 1THCA 1KCRL 3BQUC 3MRJA 1PL3A 3FUHA 2FTAA 2Q9OA 3F65A 1DE4A 1E4JA 3VXUE 3ESOA 1N7MH 4PV9B 4JDEB 1GGCL 4R9HA 1IAKB 3OC5A 5GS0H 3QW9A 1JPTL 2AF2A 2FX8H 1J8SA 5HDBB 1Z5YD 1G7PA 1U2CA 5ANHA 3PAYA 5C0IB 2YEVB 5CBAA 1T1ZA 1OCOB 2X4TB 1QTSA 4YXLL 4KXCA 2HFTA 2WUCH 3DGDA 3MRNA 3FN9A 4LPXA 5AWNH 2A77L 2PXYD 1W0WB 4WI2A 4W6XB 2CNZA 5INCA 1ZV2A 3GI8H 2VLRE 4HULB 1FG9C 1GKOA 2HT3C 5FB8A 2XPYA 2A73B 3MCKA 3RKDC 1ZSDA 3SQRA 5LWYH 5I1KH 3S5YA 3T1WA 3A24A 2ZNXA 2VZSA 3P69A 4JM2F 2BSSA 2ZF9A 3FHQA 3AUVA 3UTPD 3IEAA 4HUUA 4U1KA 3CCHA 4N85A 5J12B 3FK3A 3VCLA 4EOWL 2BHFA 2BZDA 1UD2A 3CLFL 2KHAA 2BP3A 4IMKC 3IGAB 4IU2A 3L2LA 2VH5H 2WQAA 2YPVA 4AVIA 3WKPA 3GGWB 4BSWB 1KCUH 1HHGA 3D06A 4XHQA 4FXTA 2ZXBA 1UCBH 4MYPA 3VSTA 1NBZA 3SDDC 5DZJA 4QTIL 3KPOB 2JF1A 3I50L 4UDTA 3X14B 1WAAA 1CFBA 4H1LH 3QIUC 4HK0A 5CD5D 1WCBB 1XVSA 3GMOB 2Y1YA 4TUUA 4G3YL 5E8PB 2QQNH 4DP7X 3ULUE 3G04B 1TEFA 3QEHB 1WA0X 3AS0A 3C5ZC 3U2IA 1MCWM 5JNYB 5D4HA 3UAFA 4NQQA 4X8CA 1LNUA 3INOA 1EEQA 4KO5A 1E3XA 4PJIA 3M1BA 1BGXL 5FHAL 1A2YA 3I9IA 4KNTA 3EGDB 2X6UA 3GSUA 1PZBA 1T83A 3FFOA 5H4YA 3PIQA 5L4IA 1N64H 4Z77B 3LX9A 5DJ6A 4LU5H 3TVMD 3NSDA 4P2QE 3WY2A 1J0ZA 1E4WH 1P53A 1A1OA 2OTUA 3VXTB 5K5YA 1P4LA 4KMLB 2FX9L 4ZO9A 4JFPA 5CBEA 3ATEA 3VI3A 1M7DB 2DIJA 1CGUA 1FGNH 4X7TB 1OM3H 4XMWA 3L95A 4XRCA 1HCVA 4W4OC 4H8WC 5AOKA 3EG9A 3L4UA 1IT9H 3X11A 3TBWA 3IGLA 5F1OB 4BWUA 4WHYH 2Q8BH 4XVUD 3V4UL 4D8OA 1JZ4A 2F5AL 1WA1X 4PCTA 3BVXA 3K81A 5BW7A 4G8EB 1Q0XL 2KL6A 4HFUH 1JIBA 4XCEA 4KKAC 3SQOH 5IJKA 2Q76B 5TE6L 2Q7YB 4PVBA 2N0MA 1AGBA 4OIBA 4G1EB 4UIMA 5T5FA 5DJDA 5I17B 5HI4C 3SY0B 4CBPA 1JP5A 2VDLH 4OB5H 1S7SA 4WV1C 5E4EC 1DQJA 3ESNA 3WN6A 2YPLE 1ZE3H 2HSIA 1AIFA 3P77A 4XVJL 5GIRA 4F2MB 4IBYA 2N59A 4FP8H 2ZQKA 3GINA 3QQNA 1J0KA 4OIIH 1X5AA 5GGVY 1D5MB 3GSQA 4ZYKA 1R3LA 1RAMA 2B77A 1HCFX 1WICA 5IEHB 5I8OH 3KH3A 2UYLA 2R0WL 4NJAH 3WN5A 2HKFL 3ZDYE 1FFOA 3VRJB 2K1MA 4PJ5E 4HIIA 2JXMA 5E24E 5HDWA 1QUPA 2NY4D 2KERA 5EIIB 3CWGA 1Q72L 1TU2A 4PWEA 4OCRL 3MYJB 1J1PL 1M6OB 2UZYB 43CAB 2XLLA 2XN9D 5FYKU 3REWA 1C5BH 1RJLA 1V54B 1JOIA 4A67A 4I7ZC 1TO5A 5MP6H 4YBHA 1DVUA 4WEEA 1DLHB 5CJOL 4BEIA 4L0YA 1UYWH 4LGSB 4AGOA 3SY6A 3GO1L 2BVEA 4R96B 4NCDA 3LRMA 2CLZA 4LVNB 4PB0H 2D7TL 1TYEB 3C8DA 2KZWA 4UUJA 1BWWA 1MHPL 3RY6A 3LDBB 1FAIH 5B3SB 4R90H 3D3VA 5JYMA 4IKLA 4QXUH 4XI5D 1N2RA 3BXNA 1A47A 3NIGE 4QRRA 4K3EL 4C56E 3OXRA 2NY5L 4S11A 4CVXA 3GXPA 4OAWA 1VCAA 3NVQA 3BLBA 5A1AA 4PLJD 1S8DA 1O5PA 4HKBA 2P5WD 4U1JA 3F7VA 3D69B 3V7MA 2QR0B 2JH2A 3LNIA 3REVB 3DXAA 2XCMC 3N43B 1T6WA 1A3ZA 4J27A 4Y5XC 4H2AA 5FCUL 5J9PB 5GS1C 1T3FB 4NPJA 4XO9A 4H5SA 1RY7B 1UJ3A 3HJ0A 3BAIA 4LNVA 4UV4L 4XC1L 5DJCB 5MHSE 3NK3A 1N18A 3DX8A 4X9HA 1GSKA 1CF8H 3WI9A 1JHTA 4P46B 3N40F 3SDXB 3RWIB 1P2CB 5EOCL 2VL5B 4ODUB 5KANG 3VWKC 6FABH 5ERWA 2NY0D 3I6KA 4P2RD 5F9OL 4MMYB 3FONA 3PDOA 4KK5D 1Z66A 1LEIB 1BVKB 2OKMA 4HW6A 1QLFB 2Z7WA 5HGDB 4DGYH 5JPNA 3DHMA 1TLKA 3DUHA 4HIHB 4XCCH 5HD8C 3EJSA 2GY5A 4NKOA 3TNMB 1EHAA 1Z9PA 3FT2A 4JG0H 2J8UE 3AW5A 2ZXCA 1X4YA 3CHRA 3D87B 2R69H 4LF3B 5ESVA 2KZBA 3HKFA 1SDDA 3EUUA 3HZMA 5GISH 3RPBA 3E6HA 3IJ8A 2WXGA 4LK4A 4XXDB 2P8MB 3CHXA 4MD0A 4S1DC 5KWYC 2R59A 3TZVD 2WXQA 3K2UH 4P49A 4FGMA 3EYSH 1MH5A 2W9EH 2ED9A 4KTEH 3EH4B 4Z0BL 4P4KC 3NZ8B 2R0KL 5DD5L 5LAXA 1PKQA 1JF6A 3QIWB 5DWPA 3L1OL 3OAZK 32C2B 4M9OA 5EZIL 1OLZA 3LB6D 3P0YH 1E7VA 4KTDH 2CO3A 5EUOF 2ZCKL 1YMHB 4PTTB 4TRPL 3OBAA 3IGKA 4Y5YC 1MFMA 3VFPB 4CVXB 1T66D 3U7WH 1Q4NX 3MGTB 3EJZC 1H6UA 3RGVC 4AI7A 3P11H 1SXZA 4I18C 5HHMD 3U2SA 5GRVL 1KWKA 2P9RA 1MDTA 2P5EB 4HUXB 4NBYB 1RCYA 2B2XH 3KVQA 2CLVB 1D9KD 5K33A 4YJZL 3WMQA 4LCWE 3OKKA 3TIEB 5ANMB 4GAFB 1FVEB 1NC4D 2VMJA 3ZMRA 2RQEA 3O6MH 2EZ0C 4RCAA 2F18A 2R69L 1XSIA 4Q4IA 4LLMA 1D5MA 2A77H 2GBTA 2IDSA 3QJZA 1JTPA 4NAQA 5FOJA 3UIZA 5E95B 3VFNB 2PCPA 1JXKA 2WTRB 1ZT1A 2Z8SA 3G6AA 1HILA 4PB9L 2Y5QA 3WL9A 2GT9A 3WIHH 3NCJL 2FX8L 2CAKA 4HIIB 1MXGA 2GUOA 4EMZA 5GS0L 3VA2C 3QCVH 2NUTB 4DN4H 2YUVA 2I7OA 3FO1A 4HIHA 2B08A 1IEAA 3R18A 1KCRH 2HLEB 5TQ2H 2A9NL 3IETB 3FRPB 1KFAL 4FFWC 2EDDA 3P4NB 2DKSA 5ICUA 4Y16A 4A04A 1FJ1A 4TNVK 5JPMB 4MAZA 1YSOA 1B90A 4NUMA 1KJ3H 1U33A 4PJAA 1YNLH 2NYZA 3HLAB 4RIRA 2VQ4A 1CLZH 1HHHB 2EUWA 3GI9H 3PWVA 3IDJB 1GGBL 1IAIL 5D2NA 3BP7B 3RU8H 1OAYL 3DROB 3U36A 2Z92B 1A7PL 3FFDA 1TTAA 3H8NA 3KVPA 1AMXA 2FD6L 2DLEA 1XGTA 4ADJA 1KIRB 3QJFB 3KDPB 2DWDA 5E9AA 4PGBA 4ZG1A 1NEPA 3UABA 3B2UC 3TVMA 4TLKA 2CH8A 1C16A 2OL3A 1ZLWH 4XO3A 2VC2B 1AGDB 4KXAA 1FWXA 4QNPF 4PRPD 3FU8A 5K1NA 3S0PA 2J44A 3ULVE 3TIDB 5EEUA 2WKOF 3O0RH 3AXHA 4OCYL 2GC7C 2NX5B 1XH3B 2FATL 1OIOA 4LCWA 4HOZA 2ZWZA 2ZXQA 3II2A 2FYYB 2AJUL 4Y4HD 5B39G 3FQ2A 5LBGA 4L3EB 1OTUD 4OLUL 3H9HA 4R84A 3BQVA 3RA7H 3CDGA 3VXSE 4MKTA 4YHLL 1SYVA 3NCMA 3TEUA 2X6MA 4X6DF 1NL0H 2JELH 4MQXD 1Q90A 1XH1A 1UJ3B 1R5VA 1JN6A 2Z0UA 3BRFA 4WEBL 1AOZA 2NTFA 4EQ2A 4BZ1A 4HOXA 1RHFA 1OM9A 4OZHA 3WUWB 4UQAA 4P9HH 3LQMA 4E0RA 5D7KD 4Z7OF 3P02A 1EJOL 2VE6A 4IRSB 4WUKH 4O2FB 1YY8A 4XMPH 4IRZA 5IVXE 3TF4A 4XVOA 1Z5LB 1ZGLB 1B9KA 1XXDC 4X8JA 3VFRA 5D4QA 4HZLB 4CU8A 1RZGB 3PJSB 1A65A 1Q8MA 4BZ2H 3CHQA 1XGQB 3QUZC 3ARDD 1D6EA 1S5IH 4FKKA 4JANB 5DD5H 2HB0A 5GRXG 4DKEH 1VLXA 1T1ZB 2H1PL 4P2OC 1DANT 1HHKA 2GJ6B 2H6PB 2OR7A 1KXHA 4FXGB 6PAZA 3EYSL 3L4VA 3TT1L 3CCHB 3L3IB 4QLRA 1NJ9B 2WUBH 1NAMB 1MF2L 2OM5A 3EO9L 4O02B 2Z7YA 1NFIB 4XNQA 2AJ3B 1DQDH 3AREA 3CE1A 4EAEA 2Z8WC 3S97C 5E94A 4UQDA 5IBUG 5DVNA 5I1IH 4X4YB 2FZ3B 3BW9B 3KXFD 2VJXA 2C3VA 2P49B 3O8XD 3NIGB 1T2XA 1IT9L 2JQAA 4XBGA 3O81A 2JSFA 2PO6B 5BRZB 3KM1A 3MJ9L 5BZDA 5JHAA 4WJG3 3T0EA 2FIKA 3FH8A 2W0LA 1Q1JH 3OF6A 4AE1A 5CLTA 1KTKE 5CGMA 3BVVA 3GXIA 1A6ZB 35C8L 1RZIA 3UJJH 5IW1A 3OKEB 2WO4A 3KPMB 4XN5A 1EEZA 1ZT7B 5TDPB 2AQNA 2PN5A 4WFED 3GZOA 2F54E 2EDHA 4WFGD 1U8HB 3UBXB 3GPSA 4HIEB 4AQ8A 4B0MB 4H8PA 1KIPB 1U8CB 4Y4HC 1HQ4B 1BXAA 3Q48A 1J8RA 2VXSH 4X8XA 2XWRA 2DJUA 4LSVL 2W8CA 3BAEH 2QQNL 4C4KO 4C54A 3BQUD 4XMLH 1OE3A 3GSRB 2VMCA 3S37X 4RNRA 1F42A 2H1PH 4OZHE 1PY9A 5TJWK 3D8MA 4ELKB 1IBHA 1IGJB 1AO7B 3LNEA 3KBEA 2TAAA 5HVGB 1ODUA 3Q9PA 5C8JA 5ECGA 4BIKA 4PU2A 5DK0B 3KPOA 3SQBB 2VH5L 4ZSOB 3PABB 4FYQA 4N5UA 4MNQB 2G5UA 4G72B 4GRLA 4K3EH 2E5EA 3KD4A 3W56A 1XD1A 4EOWH 3VXME 2W81C 1K8IA 4Z7NB 5DUBA 4GS7B 1OLLA 1MHPH 5IB4B 5ID1A 4TVPE 2D7TH 3CFQA 4FXKA 3KPSE 4ONFL 1L9OA 4JFDD 4OUOA 1E9QB 5LLIC 1Y6NR 5D72L 2YR3A 2ZD0A 3MRMB 4I0KA 1NIEA 1MUJB 3GO1H 2COVD 1R6VA 4I9WE 1BFVL 3TYGL 2QPFA 4LLVA 2B4CH 3MROA 5MP6L 2ADGA 3PHAA 3AFLA 4ODWA 4LNRA 4PRIA 4XPGH 4NBXB 1NMBL 3QISA 4K3JH 3UJIL 4DGVL 2VN5A 1LO5A 4QCIB 5D7EA 2D03L 2MH4A 4YXLH 1B4JH 4JFTA 3T4AC 4FQJL 2FHBA 2CO6A 3DGGA 4XBGB 3NMEA 4J7RA 3D2TA 2FE0A 3HNVH 3WN5C 5KJ7E 3HS0B 4JN1L 5E0QA 1Y0LB 1AKJA 5ENWA 1FNHA 5GS1B 4NRZA 2J1YA 4RRPG 1QSED 2OMUA 3VXRD 1G7PB 2HKFH 2WLZA 4JE0A 4PW4A 4R3SA 1LD9B 3ZSSA 2XFXA 4XPFL 4JPWL 3B7SA 3F01A 2AC0A 3MJWA 1RZIB 1F1GA 4XGZB 2QVKA 4NO5A 4QJ3B 1PLGH 1ETZB 3FPXA 1YYLL 4TSCH 3RGBA 3MGAA 2O5XH 3IGUA 2X1XR 5TH2A 1IAII 1WFIA 3ULSB 5AD0B 4N4YB 3MDJA 3DRTB 4GXVH 4ALAL 4AEIH 4NJ9H 5FYLH 1JNNL 3BKMH 3F7QA 1EFXB 2A7BA 4G42A 3K4ZA 1S7QB 2MNJB 1ES0A 2DQTH 3LH2H 3HRZB 4W6YB 3DBXA 4UNIA 1GGIL 4IYKA 3QPKA 3LRLA 1HWGB 1QHOA 2VE6B 3ARBB 1KJ3L 4NQEB 4MJIB 2YPVH 2WXKA 3BKJL 2VITA 4D7PA 5B4MC 1ITCA 4WO4C 4OQTL 2YD1A 1ORSB 4YPJA 2YD5A 3EDDA 4IOSD 2VXUH 3LXUX 1NMCC 5IROA 2ICWI 4XOAA 2WSPA 4QHPA 2XA8H 4P5TC 3HZVB 4KXZI 3W0WA 1F4AA 2WBWB 5B38B 1KJ2B 2BOLA 1MHHA 3WFBH 1ORQA 2HFEB 4ISVA 4LKCA 4ZS6D 5CZRA 2XRAL 2XXFA 1ND0B 2QKIB 3NRPA 4AYFB 3HA0A 4QHLB 3RVXD 1KZYA 4Y9BA 4RFEB 1T04B 4JJ5A 4EVNA 4B97A 1WHPA 3Q8EA 2DDQH 5KBNC 2HN7B 2OMYA 3WTXA 2E7HA 3WUZA 4E68A 2VMDA 3NTCH 5I82A 4JLRA 4EZMA 3ZDYB 1OB1A 3C6LB 4N9GA 5J11B 4TVPD 2YK1L 1FYHB 3NAAH 3NJIA 5BRZE 4KKPA 1CF1A 3S3DB 1LJMA 1UACL 5C7XL 1KB5A 3H0TB 1BBJB 3D9AL 4WF7A 1AQHA 2OMUB 4HK3J 5BZDB 5EBGA 2NX5E 3OKEA 1UXLA 4RDBA 4F15C 2E76C 4I85A 2V2WA 3UTSD 2B1HL 4JREB 3BD4A 1C12B 1NC4A 4HC1L 4KI5D 1OW0A 5AZUA 3QUZB 1ZLWK 1QUNA 2AEOA 3IU3B 3E1ZA 5D1XA 5DS2A 1I3GL 5C6TL 4YL4A 3OX8B 4FI8A 1MRFH 2IEPA 1KULA 1UM6H 4POYA 3T08A 4K55A 3QUYC 4GO6B 3ZT5A 1ET5A 3QQ3B 3QXWA 4I3RH 1JV2B 2LR4A 2ZP8A 1FH5L 5FOBA 4AIXA 3PG2A 3X13B 3QCTL 4DNLA 3DO7A 1GTNA 5CJXA 2FO1A 1HU8A 2P80D 3VXQB 2OYMA 1TZGL 3WFHB 3ECUA 4JE4B 3JTTB 3E9UA 3WEAA 2EIEA 1UB5B 2WXJA 2WZ5A 4XCCL 4MJ6B 5FV1L 3X1EA 2WYTA 3PJNA 5IB3A 4RFOL 3FT2B 3ZKND 1ECZA 3CZFB 3G5VB 2P44B 3CH1A 3OJ2C 4UQCA 5DTFB 1FVEA 3ARFC 2X3BA 1ZLVH 5FC9A 2ADJA 3ZKSD 4ANUA 2H7WA 4ZT1A 5EOCH 3QWNA 4XCNA 3WFEH 5IFHH 5EBWA 4DVBB 3RDTC 1SXCA 2P5EA 4G9FA 5KVGE 1S7TA 3EIFA 1CQKA 1QG3A 4G70B 2AQ3A 2OMXA 4MD4B 3ZTNH 3EDEA 1TQSA 1XB6A 3BZDA 2VDNB 4WKXA 2OPCA 1UGNA 2NSXA 3CSYA 3BWZA 2VLLB 2CDGB 2J56A 2FQDA 4TQIA 2HLFD 3VWKD 4G8GE 1HI6B 2PKDA 2CKBL 2SEBB 1BZ9B 2XN9A 3E80A 1JHKL 4I0CC 3EJYD 4WFFE 2BSCA 4AL8C 1HZLA 2WWNA 1TTRA 1MW3A 4WJ5B 3UZQB 3R8QA 5I0XA 1L9RA 1PDKB 4CMMA 3NSXA 2A1WH 2VM4A 2X1QA 4HJUA 3MU3A 4P23C 8CGTA 2NY2D 3QUML 4J28A 1Q38A 1W91A 2JI2A 5IMKA 4CNIB 3C2SA 1PAMA 3FB6B 4ODXA 4W9LC 5JPMC 2UV3A 4ODHL 2X4OB 3DROA 1QUNB 2Y9RT 3NZHL 2LLNA 1VFAA 4PD4K 1BD2B 3N42B 4NZ8A 1CXKA 4IEFB 1IC0A 2JB6B 5DD1L 2VMEA 5I6LA 3SD5A 5ICZB 3ILPB 4QR7A 3IAPA 4WHTB 2JIXB 1KTCA 3BUYA 4JVWA 4NQEE 5C70A 5FYJH 2MSPA 1IC4H 12E8H 3L5WA 3HG1E 4R5TA 1A6VH 5IR1B 4FQLL 4WNSA 2YEZB 3V0EA 1KBKA 4BFOA 3BZ5A 1I8MA 4G7SB 4GT7A 1U21A 1QRKA 3LQZA 3MXVL 4AE0A 5LXGH 4LCWB 2F53B 4OVUA 1L0XA 2JWYA 4O9HL 5B8CA 1JWMB 2HT4D 3IDUA 3L3HA 5E8OB 5C08D 3ZDYF 5B39A 3HB3C 5BOZG 1JYWA 4WTQA 3ZTNL 1ZLDA 4H1LG 4FP8L 4X9FA 1Z0MA 5I1JH 1CD8A 1TTFA 2ISDA 5I6PA 2Y7QA 5JDSB 3GS4A 4GKNA 5KSBF 5HHPB 1VA9A 5TTRA 4N6QA 4ZUSB 1IGIL 1X5HA 2B1AL 3WFEL 5IFHL 5C9JA 4W9JC 1MHHB 5ICYA 2GHZA 3FUKA 3IB4A 4I18B 4HU2A 4P07A 5TF1H 3WDHA 3RGVB 3H9HB 3NDZE 1XGTB 4AH2A 5DSCB 2GG1A 1Q0XH 2XN9E 3O6LL 2DJ4A 3OKNB 1VGKA 3GBNL 1A6AB 1H3VA 3B7RL 3HZYB 3HNTL 1AGCB 1QFHA 3VU2A 4HIJB 1P4IH 2G75A 4U6YA 3TWCL 2W0PA 4NX0A 5EU6D 3ETSA 1KF9B 3MHZA 1RUPL 3QCTH 2NZ9D 2E74C 2ATAA 3TM6A 1XQ4A 2P8PB 3WGUB 3B8SA 4X7FC 1NGWB 3F12A 4GO8A 1DDHA 2FEEI 3H7LA 3S7GA 5D1ZI 3V6OC 5E00A 3CN1A 3CFJB 3IBOA 4URTB 3EOYG 1RHHA 4L3AA 3REWB 2AJYL 3VYPA 4N8VB 1CE6A 1CLOH 1X9UA 5HTSA 1S7RA 3DX1A 3DVFA 4PJCB 1IC5L 1GJUA 5CSGA 3C5ZA 1A1OB 5E2JA 1AACA 2VDNH 5AVSB 4JFZL 1SXAA 4KDWA 3KLHD 1V8HA 5D96B 5E99L 4KVCL 2DQFB 4JMNA 5KJ4A 4P4RB 5CGTA 2ENQA 2OYPA 3WIHA 1G7HB 5D7IF 2WBKA 4X5WA 4MXWL 2E4TA 4G3YH 3RIFF 2Y3AA 2PPCA 3MNWA 2Z65C 1OEZW 1D6VH 1HL4A 3GMNB 5T3ZE 4PVMA 1ZS8B 1R1CA 2CIIA 4GRWH 3FO1B 3D4YA 1IBZA 4PRPA 4LHUG 4LLDA 4KX9A 3GJFB 1KG0B 2DEYX 3R06B 3NTCL 3VD5A 1BEXA 3HCVB 1L6XA 3LZPA 3HBPA 5DTFA 1TZHB 4NCC2 3UTQB 2AJSH 3NPSC 4P2RE 5L0QB 1ET8A 2AANA 5F8RC 4BCYA 4KROB 4WGKA 3HMXH 4LVOB 3GHBH 3R19A 4PLKD 5GRYA 2PW2A 1TTCA 2YQGA 3KJ6L 4A37A 4UYPA 1JPSL 2CJ3A 1TSHA 4JHAL 1HE7A 5JHLA 3KYMB 2DQCL 3JZYA 4M8UA 1MFEL 3P0VH 1WBXA 3IN2A 3SY0A 2BNQD 2YFNA 3I2CH 5I30L 4NPYA 3GI8L 4P2OD 5C0DA 3SJVE 2YAQA 3T6WA 4Y16D 2SEBA 1P5VA 5EUOA 5F7EH 1B4TA 2CALA 4FFYH 1BZ7A 4CBZA 1J8HE 4NUPA 4JQIH 1FVDA 3SCMC 5ESVB 4FFVD 4XVTL 3P54A 3IMTA 5TPWL 4BFIB 1TQBC 5MEQB 4W70A 4W9CC 3CFMA 2R2EB 5DS8A 3I6SA 4ZTPL 5FUZH 2O93L 3QUXB 2PCYA