4JKNA

Mercury metallated pseudomonas aeruginosa azurin at 1.54 a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Azurin
publication title Mercury metallation of the copper protein azurin and structural insight into possible heavy metal reactivity.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 29
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature ec 1.20.9.1: Arsenate reductase (azurin).
pdb deposition date 2013-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4jknA00
2A3TA 4G70B 1L9RA 1ILUA 4YSQA 4JHUA 1QNIA 5I6LA 2GHZA 3FSAA 2BP0B 1BQRA 4DP8X 3ASNB 3JTBA 1AG0A 1AAJA 3H4FA 1NINA 3T6WA 2GSMB 1AS7A 2IDSA 1SFDA 2YQBA 3CDZB 4E9XA 3DIVA 4PCYA 3T9WA 2HX7A 2VW7A 5I28A 4NERA 2XWZA 1OF0A 2MRYA 4G7QB 3N55A 4HZ1A 3IBOA 3OM3B 1TU2A 4AKQA 2YAPA 3GYRA 1R1CA 2IWEA 2Q9OA 2VN3A 3NJJA 2BW5A 2BWDA 3UADA 2JXMA 4DPBX 1OCZB 2FQDA 1ASPA 4UANA 1A4BA 2IDQA 5I5JA 4ZK8A 2UXGA 1OV8A 1RCYA 1JVLA 3OQRA 3IEAA 1BQKA 1MDAA 4BWUA 1BXUA 1ADWA 2PP7A 3NJIA 1KBVA 4JHVA 1JERA 4CSZA 4YSEA 3FQYA 4AKPA 1BEXA 2UX7A 2XXGA 3QJTB 5TK4A 5B1JC 4A2HA 1V10A 1ID2A 2OCCB 3EH5B 5AKRA 2AVFA 1X9UA 3S8GB 3QPKA 3WNIA 1A65A 4ENZA 2P80D 3FT0A 1L9OA 3FSVA 2XX1A 2IDTA 3SBRA 1WA2X 3NJHA 1EZLA 2FNWA 3BQVA 1M9WA 3QQXA 4KO9A 4DP0X 3NJGA 1DZ0A 2VW4A 3C75A 3NYKA 1CURA 1OCRB 1BXVA 1GS8A 1IBYA 2XYBA 2FT7A 1JXFA 4UAHA 2AZUA 5AZUA 2CCWA 3AG2B 1J9TA 1NZRA 2HX8A 1SDDB 2IH9A 2OJ1A 2YAEA 2XU9A 1GY2A 3QJSB 1V55B 1M56B 1F56A 3GDCA 4GXFA 4MFHA 4GP5B 1J9QA 1TKWA 1AZUA 1XMEB 2XV3A 4KO7A 5I6PA 1BXAA 2WO2B 3X2QB 3WNJA 2I7SA 3S8FB 1NIEA 5B1KA 4RH4A 1FFTB 7PAZA 1SHWA 4W9ZA 2H47C 1AANA 4YSUA 1PF3A 2GI0A 3ZIYA 2QT6A 1ZPUA 2OV0A 3QJRB 3WG7B 3T6ZA 3ZX1A 4A2DA 2W88A 1PMYA 1RKRA 4DPAX 1VLXA 3PCYA 3UACA 1L9TA 2EIMB 2TSAA 4E9QA 3DKHA 4HCFA 4NB7A 2CUAA 5EHFA 3NJLA 4YVUA 1PAZA 3PXLA 2MTAA 2DYSB 2J55A 2J56A 3AG4B 4G71B 3N2JA 1V54B 1A4CA 2EILB 4M4RB 2IWKA 2LLNA 5D4JA 1GR7A 4UF7C 3UABA 1PZCA 4YSAA 4YSCA 1RZQA 4DP9X 2PP8A 4N4YB 1CUOA 3CZUB 3ASOB 3H56A 2J57A 1JVOA 3PLYA 1HAUA 3U25A 1NPJA 2HRHA 1CYXA 1A3ZA 2CBPA 2RACA 2HXAA 1NIFA 2TSBA 2DV6A 1IC0A 2XVBA 3IE9A 1PLAA 2DYRB 3ERXA 1KV7A 2HLEB 1YLBB 5PAZA 1IKOP 2YAOA 1T5KA 4PAZA 4KNSA 3TASA 1MG3C 1GS7A 2R7EB 3T71A 5TK2A 2PLTA 3ZDWA 4F2FA 2H3XC 3NSFA 4W1TA 1XB3A 4BK5C 3NSYA 5A7EA 3EH4B 3UAEA 3QJVB 7PCYA 1JZJA 5D4HA 2PPEA 4GP4B 5B1AB 2N0MA 1AS8A 1KCBA 3PAVA 4KNTA 9PCYA 1BAWA 1URIA 2AANA 4GP8B 5B7FA 1B3IA 2XV0A 3ABMB 2BP8A 3FQ2A 4DPCX 1TEGA 3IN0A 4NAJA 1KCWA 3S3CB 2B08A 4A2GA 4G7SB 3G5WA 5PCYA 2PCFA 1KGYE 3S3BB 4BDVA 2HZHA 2DY2A 4YSOA 3AG3B 4YSRA 1PZAA 5B1JA 1WA0X 4Q89A 1GW0A 4KO6A 3FS9A 3V9EA 2YXWA 4M3HA 1GS6X 1NICA 5I6MA 1AS6A 1SHXA 2BP0A 3AZUA 1N68A 4HIPA 2UX6A 1WAEA 1AIZA 3PPSA 2P80A 3FYEB 3TU6A 3JT2A 1ET8A 2XXFA 1UATA 4AKOA 4WTQA 4F7KA 1N70A 2WO3B 1AOZA 2VW6A 3ABKB 1ZIBA 3NJKA 4AI7A 3ABGA 3SQRA 4DP2X 3CG8A 1ILSA 2FTAA 2HRGA 3FPYA 3UGEA 4A66A 1RZPA 4YSDA 1OE2A 1NDTA 4E9TA 2NRDA 1E5YA 2UXFA 1AG6A 3X1FA 3RYMA 2FT6A 1WS8A 3OMIB 2VM3A 2XLLA 1AR1B 3HEIB 3WI9A 1PLBA 3CVBA 4E9SA 2B3IA 1PCSA 4WKXA 1GYCA 4AZUA 3ZBMA 1A8ZA 4YVNA 1AQ8A 3NP4A 3SBQA 4BXVA 4G72B 4N8UA 2VMJA 5B7MA 3GXUB 3IN2A 4L0PB 1E67A 4A68A 4K9JA 3FQ1A 4X4KA 4TXVB 4YSSA 5B7EA 1W6WA 4A2EA 4GY4A 4P5RA 2CAKA 4E9VA 4A2FA 4DP5X 1BYPA 5I5MA 3ABLB 2PPDA 5B1BB 3FU7A 5F7BA 1JZIA 3EH3B 2BW4A 1JZHA 2XX0A 1NWOA 3HB3B 4GYBA 4E9WA 1W8EA 3H4HA 2GIMA 3WIAA 3FYIB 1HFUA 1TEFA 1KDIA 2BHFA 4DP4X 4A67A 1OE3A 3CVDA 2I7OA 3OMNB 3AG1B 1X9RA 2BO0A 3D12B 4HALA 1QLEB 1SDDA 3FSWA 2J5WA 5I6NA 1KYAA 2VM4A 1J5DA 2E86A 3NP3A 4HCGA 2DWSA 2VSMB 2HX9A 1AACA 1PLCA 3TBBA 1NIBA 3OD3A 2BP8B 1AZBA 2EIJB 1ZDSA 4BWTA 4F2EA 2GC4C 2JKWA 3X1NA 2JFCA 4BDVB 2Y1AA 2FQGA 1E30A 5D4IA 4AX3A 1GY1A 1NIAA 3NJNA 2YXVA 1HAWA 5F7AA 2VSKB 4HHGA 2UXTA 1NWPA 2FQFA 2GB2A 2H5UA 1MZZA 1JXGA 1IUZA 3NT0A 1SNRA 5IY5B 3T6XA 3EHBB 4KOCA 2IDUA 3FPXA 3TBCA 1J9SA 1PY0A 2YAFA 2Y69B 3T6VA 2QPDB 1ZDQA 2CALA 4E9YA 4DP7X 5I5IA 6PAZA 2XUWA 2PCYA 1OCOB 3QJQB 2W8CA 5AFAA 2EIKB 1AZRA 1BYOA 1NTDA 3EF4A 5ANHA 2YAMA 1AZNA 2AZAA 3NSCA 1DYZA 1NIDA 3TA4D 3AW5A 2R7EA 3CDZA 2DWTA 2QDWA 4FA7B 2WSDA 5I26A 3X1EA 1SJMA 4BWWA 1L9PA 5I6OA 2I85A 3FU9A 3SBPA 2PP9A 1PNDA 3S3DB 3OMAB 2BWIA 1AZCA 2IAAC 2PPCA 4P5SA 4YL4A 3FU7B 1M57B 1SF3A 1CYWA 1I53A 2X88A 2FQEA 1L9SA 1PZBA 3PAUA 1JZEA 3KW8A 1A4AA 4DP6X 4E9RA 3QJUB 1QHQA 3WKQA 1WS7A 2XV2A 4KOBA 3DTUB 1ASOA 2GC7C 1BQ5A 3CVCA 1PNCA 3KW7A 2YAQA 2X87A 4DP1X 1GSKA 2UXVA 2FT8A 5FC9A 4HHWA 2ZONA 4YSPA 2CJ3A 1FA4A 3NJMA 3L45A 5LDUA 2YARA 1JOIA 4BXSV 2IWFA 3MX0B 1MZYA 1ZV2A 2AFNA 4G7RB 3WKPA 1W6LA 3BVDB 4EF3A 3X1GA 1NPNA 2IH8A 1FWXA 1J9RA 1CC3A 1L9QA 4HCIA 4QKTA 2ZWNA 1XB8A 1ET5A 2BZ7A 2YAHA 1JXDA 2PPAA 3UAAA 1ETJA 4QLWA 3X1BA 1ZIAA 4KNUA 2GBAA 3AY2A 2FJSA 1WA1X 2PPFA 1OOWA 1ASQA 4JKNA 2QDVA 4KO5A 4FAAB 3FU8A 6PCYA 5I6KA 1ET7A 1E5ZA 2ZXWB 1KBWA 1XB6A 2EINB 1J5CA 3FSZA 1SFHA 2IDFA 5E9NA 4HAKA 1MG2C 1EHKB 4YSTA 3PAZA 3NSDA 4CSPA 1E65A 1SF5A 1OE1A 3MBWB 2FWLB 2QPEB 3V9CA 8PAZA 1JZGA 4Q8BA 1IBZA 2BZCA 1KDJA 5B3SB 1JZFA 3NJFA 1OCCB 2Q5BA 2ZOOA
chains in the Genus database with same CATH superfamily
3CSYB 1PKQE 3D69B 5CEZL 2ZCLH 4LL1A 5EPMB 5DQJA 3ESNA 5F3HB 1HOEA 1HYRC 4X4YA 1OKEA 2A6JB 4HWEL 1GZHC 3ULVC 5DUBA 2CUHA 1TJMA 1CLYH 5CZRA 3OKDB 3FQWB 4ZX3A 4LAJH 1O7DC 4ERSH 5H4ZA 4ES8A 3CDZB 4E9XA 3J07A 1S5IL 3RY5A 4F80A 5LG1A 4AYDC 4AYSA 4XMPL 2ZX5A 3PL6C 5I30H 3TVMA 5MENB 1MQKL 2YQGA 1OSPL 1MFUA 3VXQA 5SWZA 5MHSE 1QHOA 2P8MB 4FQ1L 4PV9A 3TZVB 4DZ8A 1DANU 5T1DL 4L37A 4EI6B 4XODA 4AEIL 4N8CH 3VFVA 4XPGH 1J5OL 3BKJH 2V8LA 4X6CE 5AAWC 1YA5A 4HJ1A 3QQ9C 3O2VH 3WJMB 3O6LL 2NY2B 1MAJA 3M8OH 5EU4B 3LRHA 1KFGA 1ZVSA 2EDTA 4LESA 2F7OA 1NFDF 1KLFA 4HMCA 5F2FA 2VLJB 4M9OA 2VDNH 3IT8D 5FO7B 4NO2A 4J3OD 4K7PL 4RA3A 3WO4C 5DD0H 1OANA 4W9IC 2PP7A 3LH9A 5J6GA 1VKXB 3BSZH 3HMXH 2P24B 1SRDA 8CGTA 1ID2A 2OW7A 5J57B 2ZQKA 4UMSA 4MD5A 1TZGH 5AENA 2HVKB 2K6YA 3BP7A 3BKMH 4GMTH 4CKVX 2UZXB 5DD3H 2CK0L 1P4UA 4NS0A 1FG2A 2Y22A 2FSEB 1V3JA 3NJHA 3NJXA 3E2HC 4GSDL 1X5FA 2O1AA 3EHBC 7TAAA 4PSRA 5FDWA 5HVWA 1XFPA 3GXTA 4Q74A 4PG2A 1K4CB 5AOMA 5EN2B 3MV8A 2ZXCA 4JS7A 2FX8H 2OTWA 1JWSB 2LAAA 1OW0C 1TYRA 2A73B 3ZRCC 3DTDA 2B9AA 4TNEA 1DLFH 1PZ5B 1QSEB 5T1KD 1PX3A 1CXIA 3OBAA 3ZYOA 2Z0UA 5C09B 1Z3GH 2YKLH 4CVXA 5D5MF 2NY0C 1QTSA 4U3HA 5C0ND 4GXFA 4XC3L 2QADC 4XI5D 1BPVA 2NNAB 2DTML 3H7BB 3B6SB 4P2RE 1PZDA 3IF1B 2BCKA 3J2PA 4W9EC 4Y4FD 3FU6A 1MWAA 5L0QC 4XOCA 3ULUF 2DM2A 5LGYA 4Q6IC 4GO6B 4S10A 2P5WE 1BD2E 2V5TA 4HSQA 4NJ9H 4QO1A 1THAA 2FO1A 4GFTB 5D2LB 4XB8A 4KY1L 1ZPUA 3ELAT 4Y1AD 3CN4A 5L6YH 3C8DA 4IRJB 1JN6A 5HHPA 3DDFA 2B5IC 2WBJA 5KJ7E 1SYVA 4R5VA 3LZRA 3PCYA 5DS8A 5TQ0L 3ZT5A 5T5FL 1GGCH 5DQJB 3F6JA 3EUUA 3FUIA 4X4YB 1MCIA 3QDAA 5K93A 2WXFA 2V7HA 1SHMA 3ZTJH 2K9FB 4G6MH 1XIWC 2EDNA 3I6LD 2ORBL 4PB9L 3MLYH 4KK6D 1SJEA 3VGDA 4ACTA 1XCWA 1E4XI 3TVMB 1EHAA 4YSAA 5FR3A 1P0SE 1RZQA 3L3GB 4HUWA 1JZ3A 1HK6A 1EBAA 3U25A 1I7ZB 3NFSH 1FGNH 1UM5L 4MBOA 4WEBL 5MI0C 4LPWA 2J20A 2H9GA 2BM3A 4HBCH 4PY7A 3ZUCA 3TO4B 3GIVA 2X9XA 4U6HA 5FA3B 3UBGA 2HLEB 5PAZA 2AXWA 2J1KA 1ZVSB 1AVAA 1N8ZA 5FYJE 3CMOL 4LSRH 1FHNA 2FHFA 3PL6D 4JM2C 2PLTA 3THML 3JWDL 3MTRA 4WW2B 5E9AA 1T0OA 2MQ0A 1WRFA 4GW5A 3HR6A 3UTSB 4NO2B 5JIMA 4LSTL 5DJCB 5ICXA 1CLOH 4DAGH 5KVEE 4X7TA 5CFAA 5J6GB 2HT4D 2O6PA 4P46C 3BJ91 3S37L 5HPMB 5B1AB 2AJUL 3BYTA 4RLDA 1CXFA 2VO5A 4Z7VB 1EDQA 3SKMB 2X2UA 2BVOB 3DLQR 1UURA 4U1JB 2BP8A 1JZ2A 1WAAF 4XNXH 2ENYA 3AFLA 3P9LA 4Z3TA 2EDQA 4KMTL 4LRIA 4NNPL 4V2BA 3ATFA 2N59A 4KK5C 2K6ZA 4UQIM 1RIHH 5D7IE 5JW3L 2HG5B 4LSQH 4OCRH 5B1JA 4XN2A 2OTWB 3BIKA 2AMUA 5J8OA 1X4ZA 1CLZH 4FG2A 4NM8L 5C07D 1G7JB 4UQEA 2I32A 1R24A 4WKZA 2BOLA 4FLOA 4YJZL 5DT1H 2OMYA 1NCBH 4PJIF 4ABWA 4L3CA 2YMOA 2FX9L 5GJSL 5F9AC 3ARWA 3WL9B 4CGTA 3O8XD 2ICCA 4LGPB 2W9EH 1IBDA 2A9ML 5FS5A 5BUPA 5D1QA 3RVUC 1C16B 2BCMA 2A6KB 3VW3H 3O3AB 1CGXA 3VD5A 1LK3L 4QO1B 4YBHA 3S3PA 4J3BA 3KJ6H 3CJJA 1JN6B 5HHPB 1JAEA 2M8XA 5IOPB 1W72A 3BISA 2WBKA 3LKOA 3SBQA 1BAFH 2AAAA 1XZ0B 5DS8B 1Q1JH 1YMME 1ZK5A 2APSA 2OA9A 5F96L 4A6YA 1U30A 1UXWA 5BO1L 2V7HB 3OMZA 3DA0A 5BRZE 3KBHE 4LQ1A 2VDLL 1W6WA 5MEOA 4Y16A 1R19A 4QYAA 4J28A 5ID1B 5EC2A 1HJCA 3GJEA 4PLNC 1SJEB 2NX5D 5ACZA 4KWUA 4BUQA 2AK4B 1CDYA 1YEKL 1MI5A 1R75A 3QT2A 2PXYA 5C7XL 3S7GA 3QVAA 4FDWA 5EMYA 5CGYD 1JPST 3FTWA 3QDGD 1JZHA 3DSFH 4HDIA 1II4E 4Y89A 4B5ZA 3M88A 3H4HA 1YJDL 4JO4L 2Z8SA 4PS8A 5C8JB 5J11B 1KDIA 1QUNA 4ODTL 3GIVB 5GS1A 2MJWA 4LEXH 2X5PA 4L18A 1XGPA 4KQ3L 2MCAA 5KANI 1MUJB 1PKQA 2VZVA 2Z93A 1ZXKA 2VITA 2ZT9C 3EO1A 3ZE0F 1UCBL 4JEGB 5FKAB 1Y1DA 2R29L 4Z9KB 1X9RA 3RWCA 4RZKA 2WZAA 3HBZA 5JHMA 5ICXB 1KPUA 5EZJA 2VDKH 3PWPD 4P9HH 4X7TB 5JPNA 4P2YA 4L8CA 1DL7L 2FYVA 1N6UA 1MHEA 2R0LL 3DUUA 4UB0L 1IGTB 1QSZA 3GI9H 5IB5B 4OIBA 4E42B 3I2CL 5JHAA 5FYKH 4NN7B 1NIBA 2DYPD 3RHWK 3Q2CA 2BP8B 2ZUVA 3ZDYE 2OCJA 5HHXH 2XZAH 1UT9A 1VEOA 1G9HA 1OGPA 2QQNH 4X6CA 4NQVA 5EORL 5CCKL 3H85A 4WV1B 5BVPL 3TEXA 4JZNB 3RGVB 3HAEH 3D18B 2Z1KA 4GKSA 4NUJB 2K8QA 1JPGA 4IQHA 1HSBB 3BFWA 4U4BA 1XR9B 1YYCA 2IGLA 4OCYH 5I17A 4I3SL 3D0LA 3CLWA 2OMUA 1FUNA 1UJ3C 3ROOA 3WXVH 4RAVB 2WNWA 1EHXA 1KUMA 2V2WA 4L3CB 3F7VA 5FUCC 5E56A 5BMFL 2EQDA 1M05B 1J9SA 3BGAA 3LB6D 4AGNA 3HN3A 4ZZFA 3ULUL 4BFIA 3TLRA 4O02A 4LSUH 1X9QA 3BZ5A 4AJWA 3BD3A 5J13C 3BZFA 2IPUK 4CN1A 1C08A 5D1QB 2XUWA 3C5ZD 3UTPD 1KG0A 1AD0A 4ECNA 4PWFA 2PCYA 3RIAF 2ZXBA 2QGBA 3IMWA 1AQDB 3CHQA 3ZKXB 4AIZB 2AV1A 4ADGA 1AZRA 4HUUB 4Z5RB 4WI8A 4LCVA 3AABA 3WKML 5D72H 2MCPL 1AZNA 2QV2A 5I1LA 5I74B 1K6QH 1MHCB 5ENWB 1OGAB 1KGCD 1QLFB 1QO3A 3A23A 3F3HA 4YHZL 2R7EA 4OQTL 1BQLL 2X40A 1G9NC 3EYSH 2C4FU 4WHYG 1SEQH 2I85A 5ESVB 3S96A 1UXWB 4KKCC 5LWYL 2V5SA 3VFNB 1RUAH 4JPSA 2IALA 4TSCH 4MZRA 5BVJA 5MEOB 4Y16B 2VRKA 4ZMTA 3HRZC 5DFWH 3L5WA 2FVNA 3K71B 3A6CH 3GJEB 2ZUXA 4P2RA 4PEEA 2OXGB 4IRZH 5L8LB 5IM7B 1H5BB 4MNGE 2PXYB 4NHUB 4UBDD 4YGVB 3OR7B 1G9ML 4Y7OC 1YYLH 1CYWA 2VM9A 2ZXAA 3OF6D 1ONQA 4XWGL 3VG9B 2P5WA 1BD2A 3L1GA 3L4VA 1BJ1J 3M7OA 4JFXA 1CQYA 2XYCA 1S7RA 1EV2E 2F8IA 3VI4B 4DCQA 2VDMB 5GS1B 4GIPD 3CVCA 1JTTA 4GKLA 1JPSL 5GS0C 1PKQB 4W4NA 3TH2T 2KI6A 3DVIA 3QG7H 1E7VA 3RWCB 2JTYA 1S8DB 3MCKB 3DO7A 2D31A 1A4KA 2IWFA 2OJZL 4JFDB 4KMQA 3BE1H 4K9EC 1ZA6A 3PWLB 1NPNA 1YEGH 5CKAA 3GXFA 1YSOA 3DUUB 1CC3A 4OFDA 1FCCA 1BZOA 1ET5A 2J8UB 3TTYA 5B38A 1KJ2A 1HEHC 5ITFB 1IM9D 4G3YH 4JO2H 4BK8A 3ESVF 1KTDB 4NQVB 3GBNL 1GYWA 1RUPH 5EU6D 3ES6B 4F9PA 4YHML 1H15A 3G6JE 3FCBA 1YECL 1E40A 5A6LA 1JPGB 1UKSA 5TH2A 2HVJB 2EINB 5JNYA 3D0LB 1INDH 2DQDH 3HNTL 4U1NB 3QZNA 2ZYIA 4FZ8L 4YZWA 4Y1AE 1YN7A 4KQ4L 2V2WB 4V2CB 5ETUA 5CCJA 3BZEA 3F7VB 3IE4A 1SF5A 2ZKWA 1RI8A 1F1AA 3HBQA 3BVNA 4FNTA 2R59A 1OB0A 2VN5A 4H13C 2LTQC 4BFIB 1KF9B 5LCVL 1PPIA 2WQWA 4C4KO 2O72A 4M5YL 5EF1A 1FG9C 1JZFA 1C08B 1AAJA 5TE6L 1N10A 4LP5A 4OZFA 1HEZB 1TVHA 3I6LE 4EUPG 5TQ2L 3HG2A 2X1WL 2GHZA 4EUPB 5L88L 2XI9A 3I02A 5D7IA 3RU8L 3HHMA 4ZUWA 4OIIH 3U1PA 2DM3A 3IVKB 2VT0A 4F9LC 5D4QA 1E4WH 2BJMH 2COQA 5A3ID 3NABL 3AY4C 4UM8A 4OF5A 2E9WA 1SFDA 4PJ8A 4G6JH 1FL6B 3ECBB 4IOFD 3PJLA 1R3KA 4AEHL 1OO2A 5BOJA 1RIVH 4WHDA 4GB9A 3O2DA 2NW3B 4P2RB 2EE6A 4M8QA 3IXTA 3LIUA 4MMXC 5EO0B 5DD1L 3X13B 1OWRM 2YUWA 1ZE3H 2BOBA 5HI3C 3VXTB 4QJ4B 2AEPH 4M7LH 4HGMA 4LAQL 4PCSA 2F08A 2P5WB 1BD2B 4LPCA 2NY3D 2VISB 2Y5TB 3MCLH 4YFDB 4AJVA 1URLA 3SQOH 4LVNC 5EIVA 1JVLA 1NCCL 4AE0A 3PNRB 4LVEA 5TF1H 2Y7QA 3KPLB 4OZIA 4WNJA 5T5NG 2AJVH 4MAUH 4TRPH 1JP5A 1S9KC 3JSSA 3GSWB 1YMMA 4MD4A 1QLRA 4G1MA 4A04A 1BA9A 3W39B 3NTCH 3KCWA 5HDRA 2ATKA 3DO7B 2D31B 2EDBA 2IGFH 1IRAY 4FTVB 4WDIA 1U8LA 5JQ6L 5BRZA 1ZA6B 2D7QA 4TVPL 1FLRH 3EFDL 1AXTL 1EJFA 1QFWI 3GXIA 4KMLB 5MEQA 4L29A 5C0BD 3MCYA 1WA2X 4OFVA 3BQVA 2PUQT 5DXWA 2VLRD 5FGBC 3NJGA 3K6SA 1ZKAA 4AMKH 1OCRB 5KSAD 1KEML 3FB7B 4M6NL 3P2DA 4HXAH 4MDJB 4BCZA 4U33A 5F3FA 1H15B 2AQ3A 4UT6L 4KI1A 1RVFH 5DVMA 5F44A 3TN0A 3WTWA 1TTCA 5JNYB 4Z78A 3UAJA 4MYPA 2F58H 2NT0A 4N3TA 2H1XA 3UTTD 3CFEA 5I71B 5I18L 5AW8B 4FP8H 1M1XA 5AOKA 1BSIA 3UJIH 5LVEA 4KH9A 5D1XB 4LCUA 2EDKA 1KENL 3RBSA 3HNVL 1A7QH 4LSSH 2H47C 1SPDA 2WZ0A 2Z7YA 3ARFA 5GZOD 2NLJA 3TV3L 3ZIYA 3QPXH 5I82A 1JGVH 3MGAA 2JKRM 2BVYA 5FYLL 2PYED 3T0BA 1O9WA 3KS0H 3X11A 3RY6A 2NX5E 2TSAA 3QZOA 4HHAA 3QYMA 2AS5M 3EADA 4M56A 4K5MA 2C26A 4XB7A 1P7KA 1S7UA 3C6EA 5AWNL 4G8EB 4N6QA 1WFNA 1N2RB 3V5HA 2ZP8A 3QDGE 5F9OH 3ZGHA 2OXHA 15C8L 1A4CA 5C86A 1S4IA 4FNUA 4NZTH 4PJ8B 5ECGA 2ZYHA 4LU5H 1GGUA 3MOBH 1NUNB 3D39B 3V0EA 3MRRA 2PP8A 1CUOA 1P6WA 3PLYA 1HAUA 3LKSB 4Y4HD 2O61B 1EBPA 3MV7D 2QQLL 4BQ8A 3RJOA 2QHRL 1D7DA 4TN9A 1V27A 1YEFH 4XTRC 1AGFA 3NCWA 5DURB 1EZSA 1IIIA 3RX8A 1KV7A 4MDIA 3PWPE 3I9PA 3LQAH 4FTDA 4PAZA 4UT7L 4UT9A 2Y7NA 4HIIA 3KDPB 1NMAH 4JK0D 4PV8A 4LB8A 3JT0A 5KAQG 4G7VH 1CCZA 4WJ5B 5AL0A 3TNMA 1QLRB 2PPEA 4G1MB 3ZR5A 3DIDA 2VH5H 4JDVA 4WWKC 2DLTA 1AC6A 1KCBA 4M93C 4M6OL 4X6CF 5DD6B 1BAWA 3SD5A 1WEJL 2YZ1A 4FERA 4FI8A 4WDIB 2XV0A 2R69H 1I9RH 5GRXG 3K2UL 1J5HA 1N5AA 3IS1X 3OLGA 5TF0A 2VR4A 1TEGA 5FGCB 4LKXA 3RX5A 3U1QA 4Q6YA 3S2AA 1DVSA 1VB9A 1UD5A 2VR6A 4GG8B 4U0RB 4MNGA 2ITCB 2AF2A 2FX7L 3CN3A 3K6SB 1PZAA 3QQDB 4MQXD 2AQ1A 1E6JL 1A1MA 1T21B 2P5PA 4JN2A 3AS2A 3PHQA 2WWMD 4E0RA 5IEHB 4NIKB 2XPZA 1G7HA 2CLZA 2UX6A 1AIZA 5FYKD 3UTPE 5C6PB 2VLLB 1QRND 3TN0B 5ESAA 4CNIB 3KLDA 4GBXB 2OZ4A 1KLGA 3MROA 4MS6A 4JPVH 3CFEB 3NGBC 1ZLVH 4N86A 2R2BA 2RIKA 1D6VH 1GGYA 1M1XB 3SODB 1F45A 5A2FA 1CGSL 2KS0A 4ZPTA 2YSSB 2A83A 1KGCE 4LCUB 2FT6A 3W82A 1DVQA 4D8PA 3LS5L 1WS8A 3RPIB 1GSMA 2EDJA 4HH9B 4XGZA 5T1KA 5JMRA 2ZOLB 4JPKH 4AUJA 3ARFB 4PB0L 1AR1B 2NLJB 4Y2LA 2RBLA 4XMLL 3ZDYB 2OR8A 3II3A 1HZKA 2YN3A 3SKNB 25C8L 2OR9H 2AV7A 5L8JB 3VGHA 1A6AB 4Y4FA 3F7PC 5J3HC 2X41A 4K9JA 5IW6B 2E7LA 4GI6A 1S7UB 3G6JA 5T3ZH 4DKDC 3UPRA 1MXDA 5CUSH 5I76A 4LLDB 5EU7E 4OFPA 1FPTH 2YD2A 3MGTA 2ADFL 5B3NA 1RHHB 4K8RL 3CSGA 3MO1B 5IF0A 4BHUA 4Y1AA 2GCYA 3KE0A 4NRXB 2BNRD 1E4XH 1K8IB 1GGIL 3ZRSA 3SGJA 3DOSB 2EE2A 2P43B 5F0MB 4Q9CA 1EO7A 2H2PC 4H40A 2OW6A 3RVXC 3VG0H 2NQCA 3ZKSD 3CHRA 1AGFB 3CFUA 1VENA 2LQRA 3A6OA 3PG2A 3WE1A 2LU7A 5I1AB 1PX8A 1F3JA 4Z7WB 3GRWH 2DLFH 4LF3A 3FQUB 1L0YA 1OE3A 4B9KC 1AHMA 1ACXA 5IT2H 4HIIB 4GEJA 1MFDH 4HIHA 2D3NA 4I8DA 3LNIA 4PV8B 4WU5A 4HLZH 2CCVA 5I6NA 2J5WA 1C8QA 3DIFA 3GSQB 2VM4A 1J1PL 3HNSH 4JFZL 5I0XA 1RZJC 4APQC 1OGSA 3U0PB 3HS8A 1M7XA 1P4LB 3BEVA 4ODVL 4OLWH 2H0JA 5J12B 3FAWA 3GJFK 2AABL 3DX7A 3KVDD 4BWTA 3PL6A 4LKXB 3TYGL 3VD7A 4GUCA 1V8HA 4EZKA 5GGVH 3INOA 4CA4A 1CDBA 3DK0A 4L23A 4XCYA 4MNGB 2Z35A 2WB1A 4D0BA 3EIFA 1E27A 3WMQA 4ADJA 3UZVA 2XZQH 4WSGA 4JB9H 1HAWA 1A1MB 1JMZA 4JN2B 3UTQB 1QFOA 4KTEL 3PHQB 4GW1B 3W9DB 3QA3B 4AT6A 1N6QH 2NXZC 3FMGH 4PRPD 3C2AH 3PV6A 1NGQH 4FNLH 4Q9QH 4OV5A 1TLMA 2KKQA 3U36B 5ESAB 4J2QA 3P0VH 4OCSH 1E7UA 3LTVA 3MROB 3WV0A 1VZGA 1XF4B 2A0LD 4JR9H 3KHQA 1W72L 5DHVA 2R2BB 1IO4C 5D7IF 5DFTA 2XA8H 4X8CA 4KK8C 4DNLA 1UA6L 1HHHB 3MLUL 2HLFC 4A6YL 1QFHA 2D9CA 3JWOL 2YD8A 2YEQA 3M1BB 1LO3L 4RESB 4XGZB 3T2PA 2W8CA 4UOQA 2PR9A 4PJAE 3MN8A 4ZW8A 4W9HC 3WIHA 5F1OB 2OMWA 4B95C 4FG4A 4HC1A 1NLBH 5I66B 2ERJC 1WC7A 2QSTA 5E6IC 1S5HA 2E7MA 3O8XA 4HJEA 3EOTL 1CL7L 4U1KA 1SJMA 1MY7A 1NUFA 2DMHA 3TV8A 3V4UH 4HJGA 1ACCA 4YEEA 1RU9L 2CHXA 1KB9K 1NCUA 3FT9A 5H37H 5E08H 4HGWB 5ESQA 5I76B 1KC5L 3UEQA 4EI5C 4R7LA 2VDML 4ZTPH 5K9KA 4NC2B 2Z6FA 5IF0B 1U93A 3IFOB 4Y1AB 1RZ7L 1PG7H 3VFPB 4ZW5A 4OZIF 2DQJH 1TVBA 2LABA 2NNXA 2X88A 4UV7H 2R0KL 2WLMA 3MOAL 1Z9SB 4Q58C 4F8NA 3OGCA 4ZS6C 3JTSB 5IK3A 5A2CA 3J7HA 1RQ5A 3F00A 1A25A 5AVUB 4B9CA 2B1HL 1NCAH 2X1QA 3IJSA 4KKAC 3UAFA 2YSTA 2O5YL 1RMFL 4LF3B 2NX5A 1N7MH 3CTTA 5C0BE 2OAAA 2VLRE 2BC4A 5IMLB 2XZCL 4IRSC 1WYJA 3DIFB 3QDGA 5DYOA 3JV0A 3OPUA 1XF2B 5CSZA 1OF2A 2P47B 4JO3L 1R0AL 3ZTNH 2BSSA 2G3XA 1OALA 4HT1H 2YA2A 2DM7A 3RQ3A 3VMPA 3WUWG 5IFJB 1NFAA 3VGBA 3PL6B 3EZ8A 5LQBH 4IEFA 2X42A 1FO0A 3WUWB 2Z7WA 3CHXA 3UTTE 1OAQL 4XCYB 2EXSA 2Z35B 1OOWA 4AQZA 2CA3A 1E27B 2P8LA 5IB3A 3PWPA 4HV8A 3SYPA 3CDCA 4O02L 5E1AA 4NO5A 1BOGB 3CBJB 5F1IB 3TOPA 2DYPA 3MBXH 5EA0H 4KFZC 1EO5A 1K2DB 4DZBA 5E51A 3ZDYF 2PYEE 1HCFX 2R9HC 1E65A 4ZFGH 4IS6A 4JFFD 2FWLB 2ZAGA 2G60L 2WGXA 2QPEB 4NKOB 1DDHA 3WO4B 3QJXA 1F6FB 5I8KL 5CJQH 2ODHA 3T0ED 4OSUH 2A3TA 3UBXA 3VWJD 2R2EA 3WKNA 2E76C 2Z31C 5SWSB 2PETA 3ZYIA 1JZDC 1R5IB 4QRTA 3FH7A 5E00A 5AZ2H 5DR5L 4DGIH 2XG5A 4NKDB 2K7QA 3T2OA 4DKFH 5JQIB 1S7SB 3FRPG 3JTBA 3KH4A 4OZGB 1HYSD 1ZEAL 1BVKB 1IB5A 1JS4A 2OMWB 3E2HB 3F6IA 5TDOB 4B9YA 3WN6A 3MV7E 4G6FD 4TNWK 4M4RA 4ZO7A 4QTIL 2GIXA 4AEFA 3MLXL 1IKFL 4OGZA 3T9WA 2P42B 3K7UA 4KKLC 4NPYA 9CGTA 3F7LA 4MHHI 2HLFD 3C5ZA 3Q2LA 1MRFH 2YBGA 3JVFC 2VDPL 1KIUA 2CGYA 4ZS7H 3LS4L 3V79C 2OSYA 5IMOA 2NY0B 4KPHL 3PDOA 5A1AA 1ZGLP 2QADB 1QATA 1NAMB 1TVBB 2ALAA 4Y5VA 3SCMC 4PIRF 5KSVA 5D71H 3WJLC 2FQDA 4O51A 1VCAA 3MMEA 5EBGA 5TE7H 3UPCA 3A5VA 4ZI8A 3EYVA 5L0QB 5IK3B 4F93B 3U6RB 4DETA 1FBIH 4J2XA 4MLSA 1D6EA 4JKKA 1IZJA 3IJSB 2WKOA 4X9BA 2JB5H 4ZODA 4PV1C 1RUQL 5EO9B 4N9OB 1UM4H 2VERN 3BAEL 4N2AA 2AI0H 1ULVA 2B5IB 3I9GH 4DQOH 3TURA 2BC4B 1UXSA 1X9UA 3B2VH 3OF6A 1KJ2L 1UD4A 3QHFH 4J3OF 5DUML 4ZUUA 3WNIA 3QDGB 1P7BA 4HMEA 1F4YH 5DYOB 1CS6A 4R7DB 3ZXAC 4BD4A 3WTVA 2Q3XA 3E38A 1DQTA 2NZ9D 2BSSB 1XIWB 2EC8A 3EDDA 1EANA 5FYJL 4CJ0A 5FYKE 4F57H 3WU1A 2QKIC 1QRNE 4W9JC 5DJ6B 4G82A 4S2SA 3ZTCC 1F02I 1FO0B 2FD6H 2OSXA 4OJDH 3NG5A 1D5ZA 5KVEL 1SVBA 3AG2B 4O2FA 1I31A 4FXLA 3ZUNC 3BPCA 3ZR6A 2P8LB 2YAEA 1EXUA 3QJSB 4F24A 2VN7A 2XU9A 2AP2A 3DJ9A 3O2WL 3PWPB 1S46A 4MCYA 3S34L 4NO5B 1NEUA 4JDTH 2LAGB 3OGOE 2BIQA 4HJJL 5LBSH 5CINL 4JM2B 3GTVA 4F58H 3WNJA 3LNHA 3WFBH 3IU4H 3VJ6B 1X7QA 5K33A 4IS6B 1IM9A 4Z7QF 3DBXB 5IJKA 2GBTA 5C0JA 3BSZA 3HMXA 4QY8A 2FDBP 1DDHB 3E1F1 2I9LA 4X6BB 5DZLA 1XR8B 2WC7A 4IGBC 4P46B 1GIGH 2KQMA 3G6JF 4DPRA 3BP5A 3MNZA 3VVVA 3UBXB 4XPAH 2EVHA 2R2EB 5T1MA 3EF7A 4AXWA 4L0ZA 3BRDA 1TTGA 3KBPA 3LZQA 4HW6A 4PQXA 2XG5B 4ABUA 4P99A 4J4PD 1G6RB 1PZ3A 1U3JA 2BNRE 5E1QA 4OM1H 1BGXH 3O2DL 4NWTH 5AYTA 1BM7A 3NCJH 3N2JA 5FDYA 1CGYA 2DOCA 4M4RB 1XXFC 5C0FA 4GI9A 5ABDE 1JBJA 1OTUC 1AKJB 1SBBA 4LPXA 5IB1A 4U31A 3UABA 1L9MA 2Z31D 3BI9X 5J1AA 1JVOA 1LO4H 1ZLVK 2W92A 1Q9OB 1WF5A 3U4EB 5IMOB 2TSBA 3CVHB 3AITA 4JRFA 4L48A 4N0CC 4YXLH 4M61B 1G1YA 4WUKL 2KPNA 4PH8A 1WG3A 3AWFA 4Y5VB 1WH0A 3LYRA 1YEWA 1I3VA 5T3ZD 3V6OE 3MMEB 3QULA 2NTFB 3DJRA 4PJAA 2YXFA 3R4RA 4F2FA 2JH2A 4FF9A 4OT1H 5F7MC 4BK5C 3QXDA 4PRHB 4U05A 1W0WB 1JIBA 1QR1A 1CTNA 4I2XE 2C34A 3T2QA 3NAAH 4M6AA 1RP8A 1WBXA 1I1AD 2B20A 3RNKA 3L81A 1UXSB 1URIA 1IAIM 4GP8B 3U7YH 3MHZA 4IHOB 4K2UH 4JDEA 2ITEA 2EDMA 4K7FA 4ZUUB 5LNEA 1UTDA 2AAVA 4X0NA 5AYUL 2V2XA 3P30L 2DQHH 1BVLA 3AQDA 1E42A 1QFWH 4FQHB 1EA9C 2P45B 3HRZA 4PRPE 1J8HD 3DURA 5ILTL 4YSRA 2HFEB 5IEKA 4OJAA 3M6DA 3RZWA 4UAOC 4S2SB 2J3SA 2QVIA 5GPRA 12E8H 2XQ0A 3OZ9L 3BUTA 1FHGA 3OWRA 1CFQA 1NBVH 1AS6A 4FMVA 1P7QD 1UZGA 3BPCB 3L3DA 5GGVY 2HA1A 3CVIL 1U3HD 2B77A 3W56A 4Y8AA 3G9AB 4MCYB 4PM1A 2D03H 2XXFA 2F53D 5C0BA 2IEPA 2K4WA 1PIFA 4AI7A 2AK1L 2VLRA 3VH8A 4XO5A 4KJQC 2VSCA 3NSJA 3U9UA 4QAMB 3HHSA 2O6FA 4XVJL 2NRDA 3ALPA 4XN9A 5KSAA 1X7QB 1N4XL 2VDQL 2JLPA 2DMCA 2GABA 4U1IA 5C0JB 4BCXA 4QY8B 1BFVL 3BWUC 2YOCA 1KV3A 4YPGA 2EVIA 4JM4L 4PJGE 4Y5XA 2GJZA 5ICUA 4PMFA 4E9SA 4WKXA 1KEGH 5L8KB 3BP5B 2UZYB 4LEEA 5I1HH 2FR4A 3Q6GL 3V5DA 1T66C 3LRGA 2Q8BH 3HCVA 3UTTA 4L0PB 4U7MA 2Y6TE 2ZXEB 5D55A 5T33H 3TBYB 5D7SL 1I8IA 3IGLA 3FQ1A 2DJUA 4WW1A 2A6IA 1L4IA 4M8RA 3HZKB 4AOFA 5DHYB 5GZOA 2G0KA 3C60D 4YDVB 1DQMH 1MHHA 3LRSA 5IB1B 1IC4H 2IFFL 2PYEA 5INDA 1Q94A 2PTUA 3EH3B 4QRPE 4UT9L 2A7BA 1G43A 5CLXA 3CZJA 4PJ9D 1Y7VA 1HH6A 4Y0GA 3INUL 5IUCA 2HUEA 3QJHA 1PTZA 1KXHA 4MJ5B 2UZIL 2GSIA 2EXYD 1FGVH 2ZYRA 2P46B 3VXOA 4NNYB 4WEMB 3TBTB 3PS6A 4JAMA 5IQOA 3TT3L 4QXVA 5J13B 1I1FA 1DUYA 3GZPA 4Y4KD 4BZ2H 4PJAB 3AG1B 4IJTA 3V0VA 3CFIC 4FGMA 1ITCA 3Q8CA 4M1DL 4JE0A 4Y4HA 1ES0A 2CA4A 1GAFL 3MV7A 4LT7A 3BD4A 3NP3A 5KG9A 1H6UA 5ICZA 4F9LA 1MFMA 5E4IA 3RNKB 2A1WH 2VZ3A 4M7KL 1XF1A 4IKIA 4QUOA 1ZVHA 2QLYA 4JDEB 2CXKA 1TJGH 4K7FB 2NY3B 4MQ7A 1N5YL 1R6VA 1QPKA 1CXKA 3SDXE 1YYML 3E6HA 3HRZB 4M7JL 1CICC 5EEYA 1JRHI 3DURB 3KG5A 2WXHA 3BUBA 2N1KA 2OZ4L 2Y1AA 2E9IA 4OGAD 1ZANL 2G9KA 4LVHC 4JFFE 3ENEA 1T04A 2UYLA 3AQZA 3VFTB 2H5UA 3L3DB 2OL3H 1NCGA 1S7WB 3NT0A 4YX2L 3T0EE 2X38A 5C0BB 3W2DH 3VH8G 2IDUA 1ZGLM 5KYUA 2VLRB 3VH8B 1I9JH 2QPDB 2Q8AH 3STZB 3CFQA 1J8SA 1ZLSL 3WFDH 3CFCH 3HHSB 3PFQA 4DP7X 2VMEA 1UOWA 2WK2A 3FTXA 1G1OA 1ZTXE 2KLTA 4WHCA 4DW2L 4QXUH 3TA3D 5CR1A 4GAJL 3QXAA 4A7SA 1KTRL 4YPGB 1C9SA 4JL2A 4RMUA 2GJZB 4UINH 1BPLB 4HIJA 3UDWA 1QRNA 2O26U 1TQWA 3IFNH 3GSVA 2BPBA 3T4YA 1RL1A 3D4GA 3V5DB 4A63A 5CD5C 1NIDA 1PDKB 4P2OC 3NUKA 5FGBA 3HCVB 3UTTB 3L7FA 3PDDA 3VFUB 4U7KA 3LHPH 2Y3AA 4JZJC 3HKFA 1I8IB 5G55A 5K1JA 3LEXB 1L3WA 1I4FB 4HWUA 1TFHA 3KH3A 4PJCE 3HAEA 5IJDC 4HUVA 4C58B 1B9ZA 3CZKA 3RIKA 4L0YA 5JW4R 3GUTB 1CFTB 4KJPC 3US1A 1QYGL 1GHFL 1SMDA 4CADB 1KBBA 2JVUA 4MS8D 4WFFD 5HD8C 1D3CA 2I24N 4ES9A 2LGNA 5GZNC 1VSCA 2OBGA 2PYEB 5E99H 5L4JA 2WKOF 2VKXA 3CQFA 3PAUA 1E90A 2I27N 4B3EA 1HH6B 1E5BA 3ME0B 1WHOA 1F8TL 1W8NA 4U1SA 2FRGP 1D7FA 4DKAA 3FUHA 4C4KT 4M3KB 3ARTA 4FEMA 1GGBH 3VXOB 2LTQB 1V3KA 3G5XA 4KHTL 2ALWA 4TQIA 3PHOA 1MLCA 5DMGC 5JHDB 2Y2YA 2R4SL 2UV3A 2XN0A 3P9MA 4YHKH 3U48A 1FA4A 4KRPD 2IV8A 2Z0BA 3ZHDA 3GMQA 2BNRA 2YARA 4Q0XL 2EH7L 3UGUA 1WO2A 2GT9A 2NR6D 4G7RB 4ZBJA 1ES0B 5JLZB 5DCCA 2YQ2A 1UD6A 3NK3A 3I50H 3WLWC 4HS6A 1L7TH 1RP9A 2CDFA 2VDOB 2B59A 4FS0A 5F6HI 4X5WB 1P69B 2PWEA 1I1YA 2XTJC 2C3VB 5CN2A 3IDJB 4MQ7B 3BP4A 4PHZA 4ZMQA 4L8SC 3HJEA 1HEJC 2AQ2A 1ZIAA 3EYQC 1KBKA 3ISWA 1T0NA 4IRZA 6PCYA 4KO5A 3E3QC 4M43H 3D2UD 3S36H 4MMXB 4BINA 2G2RA 4AMWA 1G87A 3RY4A 2PO6C 4FQJL 3V6OA 1XB6A 1OK8A 4YK4C 1P9MC 3QC6X 4HWBH 1T04B 5EO1A 1TZIA 5ISZB 2APBA 4G9FB 3EFFA 4WFHD 1UG9A 2QLVB 4LVNB 1MF2H 1MCDA 4B9GA 4I2XA 5KS9B 3DO4A 4EN3D 2ZD0A 1CICD 1ZLDA 3WIHL 1UWEH 4EDXB 1JZGA 3VNYA 3DXAB 4HC1L 2PCFB 1NGZA 1T1XA 4WWKA 1R3HB 4BCYA 3RDTD 2Q5BA 3UYPA 2BRRL 3ZL4H 4X7FC 3LKPA 4PRPA 3MXWL 4O58L 5ES4B 5LAPA 1QWUA 4HIJB 4DP8X 1CO1A 4PG9B 1IGCH 1QRNB 3JV6A 1NINA 4I3RH 4NQDB 3T4YB 1XF5A 5JDSA 1R17A 5JOEA 4NZJA 1U42A 4HLEA 1K3IA 5EF3A 4F3FA 4X6EA 3DIVA 1NAML 1QABA 4RBPK 4FKKA 5G5DA 1E4KA 3EYOA 1QBML 4PU2A 4XNYH 4YOKA 3TO2B 4DFIA 2XCMC 5T3ZE 1CFVH 4GW4A 4XVSH 1MLBB 2GQHA 2BSRA 1NLDL 4AVIA 3SGDI 2IWEA 4MQTB 3SBWA 4PJAF 4AL8H 3ARDC 4I48B 1YC8A 2DBJA 3KVPA 1X5GA 2JXMA 2PF6A 5C6WH 4F92B 2R1WB 5D7LB 1PD1A 1AR2A 3K6FA 1A4BA 4BQBA 1ODAA 1VFOA 3FCSB 1RCYA 4PJGA 3ZZQA 1E2WA 1CBVL 3JWNH 5DS2A 3L7EB 3VCLB 4F2ME 4GT7A 3EJPA 3PGCA 1MRDL 3G5XB 4AC4A 1H6FA 3DSNB 2KL6A 1T5XA 4GS7C 1OZUA 2Q10A 1KN2L 5LXVA 3D0VB 3P9MB 3OAZK 4POUB 4LVOC 2EEFA 3GMQB 4NIYE 1Q9LA 1J8HE 2Z34A 1KGIA 3SPCA 1IBFA 1GJUA 1FO0L 1A6PA 1MVFA 3S5LA 1QOKA 4CC0A 1R34A 2A6DA 3GS4A 1WZLA 3L3IA 3U30B 2H8PA 4HS6B 1UACL 2B59B 1WZ1H 2Z8WC 3GSRA 3T0AA 1KB9J 1I1YB 4Z0BH 4MX7B 2KDYA 3KXFD 4QRPA 1NAKL 3C75A 3NYKA 5JIPA 5KYYA 2IFGA 1MCSA 3DPDA 4MJIB 2F53E 2HSIA 2P8PB 3WGUB 1IMHC 3FUMA 5DUPH 3D7PA 3FB8A 1T0NB 3OR6A 1ZLUK 1TOXA 2G2RB 4TULL 2WSPA 3MODH 3PWJA 1M56B 2CLVB 3WY4A 1F56A 2V2TA 2JI1A 3BCFA 5EO1B 3N06B 3QDMD 4OI8A 3FOMA 3EFFB 2DB8A 3PWUA 4AYID 3QO1A 4P2QD 3R8BB 5DMIL 4I2XB 5DC2A 1XH0A 2OMTA 2ZUWA 1MIEL 1W80A 3V4PH 2FBJH 3L9RA 3ROLB 1SHWA 3LKQA 1T6WA 5LB1A 4IU2B 3FONB 1PF3A 2H1LM 4H8WC 5LAXB 2UUDK 4WWKB 4M93B 2ITDB 3WG7B 3TXAA 5AOZA 4AUUA 3SDXA 3DX4A 3LKPB 2CRIA 4PRPB 4JN1H 4E9QA 3P3TA 1NCDL 5HHOB 1RZGA 4Y1SA 2HH0H 5HYSG 3JV6B 1WTGT 4N2LA 1JGUL 3CVHL 2VAJA 5HYSB 1DJSA 1H8LA 4JFFA 5HGGS 3RLSA 2EILB 5KVGE 3DJTA 2DLGA 4F3FB 3RE0A 4AGPA 4X6EB 2EADA 4P4KC 2O6DA 1R3IH 4DSYA 3EYOB 4M5ZL 3OHXC 5B39A 3DV6B 1PG7W 5JXED 3VWJA 3T0EA 5JIKA 3IB4A 2BSRB 4KRMB 1YY8A 1Y6NR 1NIFA 5GISL 5I19L 2VQ1B 1PZ2A 2JXMB 1YLBB 3NGBB 2H2SC 1FQ9C 2ZCLL 2CR0A 3SKJH 5KBLA 2C7UB 1NMBH 1DBBL 2IADA 2ZOKA 1VRSA 2QMJA 2YMXL 1CLYL 4JVPA 2XTSA 3ARGC 1D5XB 5CEZH 4PRNB 5E8OB 2SODB 3O9WC 4WY7H 4YAQA 1G7MA 4HWEH 1JZJA 1LNUB 4MJHA 5I30L 4TVUA 3QK0A 3VXNA 5DEFB 1P4BL 3B3IA 3IGUA 4JJ5A 3SGKC 1MHPH 5D7HA 4Z8FH 1Q9LB 4XMUA 2JJTC 4PJCA 1MCCA 1S5IH 1W0YT 4N8CL 4R7XA 1ZJBA 3QR1A 2A6DB 4HWZA 3L3IB 2NPLX 3O2VL 3QZLA 3GHPA 3ZKMD 4TTDC 4FQ1H 3M8OL 4G7SB 4YR6B 4ZX6A 4HF5H 4OBSA 5ECJE 1OLLA 4QRPB 2ZPKH 4BDVA 4NYLB 5K9QG 3MTXA 1KNOB 3QNXA 3Q0HA 2BRQA 3RP1A 3NZHH 1N6VA 2QTEA 3KYNB 3IFPA 1PL3A 4NN6C 4NSKA 3BH8B 3OR6B 4X80H 4UYQA 3KPRD 3D08A 3V95A 5DD0L 3NQKA 3RKPA 1R9FA 1F4AA 3BSZL 3HMXL 2G5BA 3PWJB 4PN6A 1ET8A 1QEWA 2V2TB 2O5ZH 3UO8B 4EVNA 2W94A 1JNJA 1UQSB 2CJTA 1A1OA 3ABGA 1FL5A 4WK0B 3KS0J 1MDTA 2PNDA 3PWUB 3H9SB 3O81A 3BKML 3C8HA 4GMTL 4E9TA 3QO1B 1EJ8A 5DD3L 3RL1B 3X1FA 4JDZA 5D7KD 1S7TB 1T22B 1DVZA 3L9RB 4HWNA 5ANME 3HR5A 2Z8RA 3VX1A 3LKQB 2L7JA 3KWUA 2X2JA 2NW2B 1PJWA 2A74A 2F5AH 4K94H 3GXNA 3H6AA 4APQB 4R26H 3ZE1E 3FZUC 1LHZA 1TJIL 2HJKA 3TESA 1AQ8A 2E9GA 3QPQC 2NCEA 5D8JL 4UNUA 4BH7A 1JE6A 3SDXB 4XBEL 4NGHH 2I9TB 4OCMC 4YHPB 4WFFE 2FIKB 4OGXH 4R96A 5KBPA 4X4KA 1AFVH 4YH6A 3WEBA 1UYWL 3L54A 1FVEB 1QP1A 4QRSA 2GBUA 4GY4A 2BNQB 5L2JA 1SXNA 1T1ZA 1I7TA 3BMWA 1NMCC 3KGSA 2AQSA 1XAKA 4XC3H 3MRIB 3OKLA 3T0EB 3U7AA 4NJ9L 4F37F 4KX7A 5EIIG 2NXZB 4LFHD 2DQIH 2CDEB 1XGQA 3OAWA 4GYBA 3QRGL 5L6YL 2YZ8A 2X89D 5ACMA 2G75A 2GIMA 4J4PA 3KLHD 4ZSOE 1IGYA 3GSNH 1MJUH 3CX2A 1A02N 2PW1B 2IBZX 4TLUA 3FQTA 1GGCL 4LDOB 5E9DB 1LEKA 2IADB 3RKDC 2P44B 1OB1A 4FYTA 1G9NL 3OC8A 4G9DA 2WQXA 4PUBL 4FXKA 1HDMB 3OPZH 2Z31A 3IDYC 1ANUA 5TQ0H 2DWEA 4Q14A 3MACH 5T5FH 3D34A 3MLYL 1G7MB 4RGNC 3UCQA 3WN5C 2ISDA 3MREA 2DQMA 1BIIA 2CJUL 3VXNB 4JJ5B 3TONA 2HX9A 2ERJB 4GAAA 2JWYA 4PJCB 3NFSL 4PB9H 1FGNL 2JSFA 1ZDSA 2W0KA 5KW9L 4DTGL 2GC4C 4G8IA 4FA8A 2JKWA 2RH0A 4CU6A 4ZOCA 4XPBL 4EI5B 4Y2NA 4WEBH 4WFHE 4BDVB 1T0MB 2D3LA 2H1PL 4LSRL 2WOYA 5F8RC 1JCKA 3C5SA 1WZMA 3FCTB 4NQED 4NKQB 3RTQC 4MDRA 4RVBA 2VSKB 4HHGA 4XOBA 1I1AA 2UXTA 1G4MA 3IFPB 4I18A 5E6SB 3SY0A 5AB2A 1IEBA 1KBGL 3EGXB 4ODWB 2GB2A 1MAML 4F2MA 3CC5A 3JYBA 2APFA 4ZXBC 1JXGA 3KYKL 4IBVA 3HB3C 3JWDH 1SJVA 4QCIB 4AEEA 2RB8A 1A1OB 1FL5B 2WP3O 4G5ZH 5C0IB 1J8HA 1F6AB 3IDIA 2CALA 1JGIA 4XNXL 5HHMD 1B4RA 1D5IH 3VUAA 2HT2D 1EWHA 4JDZB 3KL3A 3NACH 3Q06A 4F15C 1QHPA 2PCPB 1B2WL 2BP5M 2X44D 2ZKXA 1U8KB 4IRSB 1P7QA 1HKLL 4LSQL 2GAZB 1EHLL 1DE4A 2AJSH 1HXYA 4UV4H 1U3HA 1S7VA 2JQAA 3HUJE 4NNPH 5DMKA 4NZUH 4QYOB 4RFOH 5DEGA 2FWUA 1CLZL 2HJKB 2F53A 1BF8A 3W81A 1ORSA 1DYZA 3NCEB 2AXHA 5DFVD 2VKWA 3QORC 4BH7B 1A9BA 1DP0A 1WSST 3IMVA 5DT1L 4FA7B 5E7BA 1L9PA 3WO3B 2GIYA 5CLZA 3F65A 1TO5A 1XGZA 4ENED 4QRSB 2P7TA 5M95B 1QI4A 2W9EL 5BO0D 5FOJA 4NUGL 5L2JB 4Q9BA 4AZ8A 1T1ZB 3VRLE 1X5KA 2FX9H 4AH2A 4PJGF 3UC2A 3VW3L 4GAGH 5C71A 3DETD 5IB2A 4LHUD 3ARYA 3MLRL 5FO9B 2FQEA 3CX5K 2J1XA 2D7NA 1OAYL 3UYRL 5CZXD 3KJ6L 4M03A 3BQUD 1EAOA 3OB8A 1INEH 1FH5H 2WQAA 2WYTA 1GCFA 1IGYB 4OD2B 1MCBA 1U3NA 4MWFB 3FQTB 1GSKA 3I6GB 2B7DT 4HAFA 1U8PA 1JFHA 1W8OA 2OMNA 2QBWA 3SE9L 3U2SA 2ZONA 3C60A 1UWXH 1B4LA 3VXRB 4ANVA 4BFNA 2Z31B 1MCLA 3KXFE 4PJ9A 3EYFB 3B9EA 3L6FA 2NT1A 1JI1A 5BO1H 4ONOA 4W4OA 2UY7A 1BIIB 1IT9H 2VDLH 1CMOA 4Y19D 5FM8A 1SEBB 1TIUA 4KDTA 5D6DA 5JHLA 4ZFOB 3D0AA 3QZMA 4ZMPA 5DRZA 2QFPA 5I15L 2DIBA 5H37A 4YPJA 3B9KC 2V17H 3IDGB 4Y4KA 2HTKC 4QLWA 3V10A 5DC4B 2LU5A 2IH1A 5FGSA 4LEXL 3G5ZA 3N9GH 1TZAA 3CUPB 4ZMOA 3W5NA 5JMOC 4N6RB 1AGDA 3QNYA 4P2QE 1YJDH 2BHZA 1AC0A 1JRHH 1KT2B 1T83C 3C5SB 4MAYD 4MZ3A 1ZHKB 2BSDA 1I1AB 3R1GL 2FLBT 3SCMB 4B53A 4H7VA 5I8CA 4RZCA 4XH2A 4F2MB 2VDKL 3CC5B 4P9HL 4EAEA 5AUMB 3FU5A 5DZVA 3TJEL 1EPFA 2L3BA 4B41A 4JY6B 5AVXB 3GI9L 1LO5A 4HX1A 1U2HA 5FKPA 5FYKL 1JXJA 3BKCL 4PW3A 1I75A 4L3AA 3SDXF 2H6PA 4AYGA 4MMZA 1J8HB 1RJLA 3DGDA 5HHXL 2R1YA 4E2OA 4XP5L 2R0LH 4UB0H 4PGEB 4MXQC 4LLUA 5GRWA 2QQNL 3IM1A 1ZHBA 3VFOA 4ABVA 3EGSB 3MGOA 4A2LA 4Y8DC 3WMSA 2ARJQ 2IGTA 4FA6A 1TMCB 2W0FA 3GSUB 3SGEI 5DMKB 3ASNB 4HYTB 5DEGB 1A21A 1QA9A 3UIZA 1LWHA 2PYFA 5CCKH 3GRBA 2ESVB 1ORSB 2IDSA 1A9BB 1KXTB 2DQUL 3WXVL 5I1GL 3A4AA 2QKIB 4XBPA 4M1CD 1NANI 3B83A 2WXOA 4LDCA 3NDYE 5LG6A 3C6LD 3TA3A 2XJLA 3VNZA 2MRYA 2P7TB 3MRHA 3OM3B 4ANWA 4OIAA 1W9XA 2YAPA 3AS1A 4AH2B 1M7IA 3NJJA 2BW5A 4XMTA 4N25A 1DN2A 1RK0A 1TENA 3QWRD 4NOFA 5ANMA 1I8MB 2IDQA 3O0RH 1UHVA 1HQRA 5FFOA 1OV8A 2JK5A 3N41F 5D72L 5HHVH 3GKZA 4XMZA 2C7FA 1K6QL 4QAWA 4JE4B 4WWNA 4PJCF 5MP6H 3WE6A 1AJ7H 2YN5A 1XH1A 4JREC 1KULA 3EYSL 4IGBB 3ZHNA 1S9YB 4NZRH 4Y9EA 5IQNA 3PHAA 4M7LT 3NIFB 3QXTA 4TSCL 1BQLH 4YNYA 1OD7A 3A6CL 3ZDWA 4PJ9B 1F4WH 1F41A 5LWYH 1EAQA 1U92B 3FSVA 3WEMA 3S3JA 3KPRE 4DP0X 1BXXA 4UOZA 2W38A 5DRZB 3VQ1C 5CEZD 2GJ6B 1BXVA 1LWRA 4S1DC 4NQCD 1UD8A 3P73A 1JPFA 3GC3A 3G5ZB 3NQIA 4N90D 5HDLA 2KDGA 5JPMC 1YNLL 4ZSOA 3BZ4B 3VSTA 2NR6A 3GO1L 4ZO6A 1FH2A 2VXSL 1AGDB 3VE0A 1Z2KA 3RWIA 1XH3A 4N0UE 4UQCA 5DVKA 5D7KE 4KI5D 2ZJSL 3QG7L 5C3TA 1IAOB 3OXRB 1B0GA 1DJXA 5FLUA 4XH2B 3PJSA 3OKMA 1BXAA 1AGEA 1YEGL 3MLTB 4JQVA 5EUOE 5EBWA 1GYVA 4XN8A 3K8MA 1A5FL 7PAZA 2J2ZB 1QTYT 3I6SA 2R1YB 3D2UA 2VABA 1UT1A 5E0FA 3VFOB 4G3YL 1ZHBB 4JO2L 5C08E 2FCBA 3MGOB 3PQYD 4NXSA 1K8DA 1KGJA 3K3QA 3QEGL 2W0FB 2OX5B 1VADA 2CUAA 2YA0A 2FEEL 3PXLA 4G5AA 5ABAA 4EN3A 1INDL 1HT6A 2DQDL 2YPKA 3GBNH 3U7WL 1CICA 4G42B 4BQ9A 5BV7C 5D7JD 1YECH 1HX0A 5D4JA 4HLJA 4FFWD 1CD1A 2ZUUA 1GR7A 3RDTA 4F8TA 4Z77B 4DP9X 3FQNA 2D0GA 4JMXA 3TA3B 3FRUA 3H56A 1ZSHA 2J57A 3MRHB 4FZ8H 4KQ4H 2RACA 4JMNA 1X5XA 1PG7X 4W81A 4DKEH 3RB7A 1I85C 2UY6A 3FF8A 3L3OA 3CV5A 1I1CA 3SGDH 5LBSA 1RK0B 1IGIH 2EJ1A 5F7HA 5LCVH 5T1JA 1IKOP 5CJXC 3HS0C 5ANMB 3FO2B 1U95A 3EFOA 4M5YH 4OIIL 1HQRB 3A6BL 3SE6A 5TE6H 2BJML 3HUJA 1A9VA 3NPSC 5TQ2H 3ZE1B 2BHUA 3GIZH 2ICWJ 5L88H 3P9WB 1T7VA 1K3ZA 3RU8H 3CK0L 3EJCA 7PCYA 5IVNA 4MZ2A 5D4HA 4JCWA 1D7BA 4QTFA 1W91A 4HULB 3PWVB 1RIVL 1ND0A 2YD1A 1KTKE 4NQEE 5EOCH 4F7TA 4JZJA 3R18A 3VYPA 2CHNA 1MW3A 1U2YA 3LZNA 4AEHH 2AEPL 3HMWL 4M7LL 1O6SB 5TPWL 2B08A 4WFGE 3S3BB 1CI5A 3L4TA 3EJYD 4Z18A 4Z3EA 2CXGA 3SQOL 4C8XA 5IESH 5FK9A 3D3VB 4D0CA 2R83A 4LAQH 5F72S 2AJVL 1NUGA 1KIPA 4MCZB 5HHME 5FEBA 4ADIA 1F97A 4TRPL 5HJ3B 2X53A 3FUEA 3VE0B 2CPUA 2WN3A 2YUXA 3H6JA 5D2NE 1XH3B 3RWIB 1NCCH 4G8GD 5GRJH 4F20A 5IKCA 4XCFL 3NFNB 1E8XA 1ZT1A 3RGBA 4A39A 3T6QC 1MWOA 2IGFL 1KGUA 4KV5E 3TX4A 4PJ5D 2H26A 4JPIA 1FLRL 4EIGB 3KXFA 3NIGE 3DUSA 3GRGA 2WQUA 1OE2A 5FA4A 3ZE2E 4JRYD 1S3KH 1CI3M 1VFBA 2WLIA 3A22A 3PNWA 4RGOH 5EBWB 5JQ6H 5IVZA 2XKSA 2N7BA 4TVPH 4BFOA 3GK8L 2VM3A 3EFDH 3OMIB 2FJGA 4AMKL 4XHJD 3HPLA 4YHIA 3HEIB 3VD9A 2HKAA 3ZBMA 3QIUD 3NP4A 3HC4L 5ID0A 1KYDA 2NSQA 3TT1H 4N8UA 4UILH 1TYJA 1K8DB 2EDFA 1YMHA 2V33A 1KEMH 5KZCD 1VADB 4P2QA 3OLIA 4KKBD 4M6NH 3WYRA 3ALWA 4LSDA 2HVBA 1CICB 4RMBA 1I8LC 1ZTXL 2AJZA 4FP8L 3JTTA 4DP5X 2R0ZL 3UJIL 2NZ1A 2NY6D 1SY6H 4LVHB 4O2CA 3V52L 5MERA 3POCA 2CM5A 2CNZA 3FQNB 4OFKA 4LSSL 5JIQA 4YDMA 3B2MA 1YY9C 3DVNA 3ZDXE 5I1KL 3KYOB 4FQLL 1JGVL 3L3OB 1KENH 3HNVH 3GSXA 4TQEH 4XT1C 4KKNA 5H94B 4BA0A 3BCDA 3HG4A 2BVPA 3N42F 2CO2A 2PWGA 3EFOB 3KMDA 4EMZA 3V0JA 5F89A 5BQDA 5FYLH 2F54B 3U9PL 3OZLA 1WT5C 5JXEA 2Q86B 1E4JA 5F9OL 2OFQA 1M53A 3JWNE 2F19L 1AYRA 4N2HA 1KN4L 3B2UC 3O3UN 4LU5L 2UWEE 2XIDA 4R4ND 4MB4A 2WVUA 4H44C 2FWSA 1TU2B 5AWNH 3UJTL 2GBVA 1MCQA 6FABL 5AZEH 2VSMB 3R06A 1A2YB 4BUHA 4P2OB 4Z7UE 4K15A 2OMXB 4JZJB 3K2IA 3EBAA 2WINA 1YEFL 3B8SA 4RSVA 1EZUA 3X1NA 2Z3FA 3B8YA 3LQAL 3B3BA 1NIAA 3QIWD 5FK9B 2XWTA 2L04A 1NMAL 2V9QA 2QSCL 1QAWA 3AUVA 1KIPB 1E50A 2A77H 4XNQA 4ATTA 4UT7H 2A9NH 2YHGA 4L4TD 1BM3H 5CD3A 3RVWD 2LV4A 1BQHA 3AAZA 2JI2A 4LLYB 1DVFC 5JR1H 2VRAA 1B6UA 3TBCA 3FHAA 4BZ2A 2H26B 3AXLA 4JPIB 1L5GB 3GB7A 1ZDQA 3DUSB 1FN4B 1ZMYA 3K5SA 4M6OH 4AM0A 3JVGC 3PNWB 1KJVA 5TDNA 2ATPA 1CDUA 3FAXA 4UTBA 4HIEB 1OCOB 1IV8A 3KPRA 3ETBJ 4OVUA 3V0AC 1A47A 1KFAL 3VFMA 3HPLB 4ETYA 2WXPA 2VZTA 4WI6A 2AZAA 5ID0B 1AP2A 3GMPA 2XTJB 4IKKA 1U8JB 4TKWA 3VI3E 4CGUB 1O7VA 2QDWA 2CMRL 1E6JH 5I26A 1EHNA 4QJ3B 1WLHA 4N0UA 2GSGB 2XV6B 1F90L 5IMKA 2D2CC 3BH9A 4JPVL 3FH5A 4XCEA 2HMIC 3HE7C 5GSRB 2KZKA 4LCYA 4OFQA 5IWLC 3BH4A 3US9A 2X05A 2PO6B 4E5XA 1YN6B 2Q3ZA 4EOWH 4YK4B 5EUOA 2Z91B 3Q3GA 4O2CB 2OL3A 2NY5C 4JZOB 5GGUA 5MERB 4ZAKC 2EH8L 4RMSA 4TSAL 3GDBA 5FXCH 4ZOAA 1XGTA 2Y07H 1CGSH 3RWEA 1A4AA 3DVNB 5GQBA 1JHLH 2X1PA 2A9CA 4E9RA 5CGMA 1UWGH 3DI2B 4N2MA 4RIRA 5J5EA 3LS5H 1OAKL 3DGGA 2OR9L 2Z92B 2GC7C 3G08B 1AE6L 3F2LA 2C1OA 3IRCA 5C08A 3KW7A 4PB0H 2HPOA 3D25A 5I6XC 4ZFOL 1B4TA 1E6OH 1P5VA 25C8H 5T3ZL 1JTPA 2DKUA 3GXMA 1NFIA 3HI6H 4O2EA 4NJAH 3OAYH 1JOIA 4EZJA 1FPTL 4XZUA 2WGNB 3KM1A 4S1SH 2IPUG 4NQCE 3QEQD 3T77A 5HYQA 2NOYA 4N90E 4AW4A 1GMEA 1EAPA 3C87A 2UZPA 5GHWH 2E4FA 3HN8A 4W9CC 1JGEB 3O6FD 3IYLW 4PCTA 5JW5B 1HILB 4KI5E 1XH2A 2RAMA 2G2PA 3U2IA 5EUKA 4JL1A 4LCCC 3E8VA 1NGPH 1HVXA 2BIIA 4YNYB 4N22A 2X4NA 3VO0A 3D85D 1P4IH 2AKRB 2DLFL 2LT9A 4MXWH 2XWTB 3ARDB 1MFDL 3BRFA 4D8OA 2V9RA 4XNQB 1G7IB 1TLKA 3D8MA 1YEEH 2FZ3B 3EG9B 1EHKB 2ENPA 2WVSA 2ZUSA 2QEJA 5F1NB 1CK0H 4AYEC 4CSPA 5KN5B 3PQYE 2APTA 3IJYA 4LCIL 3NA9L 3H9HA 4J3VA 2ADGB 2IBGA 3O9WA 3AXLB 3D33A 4N2OA 3GB7B 3ARUA 4GS7B 4FQPA 2BZCA 1KDJA 2FECL 5IHUL 4TLKA 4Q4IA 2OSLA 4NQEA 1KJVB 1CDJA 3EJJX 4LVOB 4OFYD 4X9YA 1E9OA 1H3WM 5GGVL 3SGKA 1U36A 1L9RA 1WFIA 1ILUA 4PTUA 3ESUF 1NGXA 3WEXB 4NN5C 3ZMNA 2AABH 4R97B 1O0VA 4JB9L 3VFMB 4UIKH 3FHEA 2C5DC 4ODSH 3ZO0A 3RA7H 1PGRB 2GSMB 1WPCA 1AP2B 3GMPB 5HGDA 3S4SG 3MR9A 2IDCA 4X6DB 4FNLL 1EK3A 1F11B 4YFEA 3S4SB 4NERA 4IKNA 5D2NA 4F1SA 3P0VL 4KTEH 1LVEA 2L7UA 4DERA 1FFRA 4M5TA 3QP3A 4UQ2B 3BH9B 4LKCB 2BOCB 4JR9L 5CP7B 5IR1A 2MCG1 2XA8L 1NQBA 3FBKA 4HWBA 4IMKC 1WFJA 1CYGA 2GVYA 3HUJF 5FO2A 2YUVA 3SE4A 3OJMB 4ELKA 2NXYC 3KD4A 3B5GA 1QASA 1T6VN 4EN2A 3S5ZA 3RWEB 4TM9A 4JKMA 5I5JA 4ZK8A 1UA6H 2RMNA 1ECYA 4RIRB 4Z23A 2MH4A 2ARJB 3MLUH 4BSWB 5I0VA 3DGGB 1UXMA 3JWOH 3OKEB 1NLBL 5KVGL 1LO3H 1CGWA 4I0CC 4WHYH 2C1OB 5C08B 3D25B 1EZVY 1TFPA 4E41E 4QLRA 2VXVH 1HU8A 1P5VB 3VRLF 2YPLD 4OD3H 1NFIB 2E3VA 4O2EB 3SOBH 1V10A 5AKRA 4LFHG 5F9JB 3VWKC 4LHUA 2F5BL 2VLMD 1I3GH 3MLZL 3MYZA 3QJZA 4ZTPL 4WSKA 3ZW3A 2P80D 1RU9H 2IQAA 4L3EB 3O3BB 3T77B 1PG7L 5HYQB 3R4DA 3BQUA 1ID5I 2BVEA 3SBRA 2DQJL 4PJ7B 5DZPA 1A9EA 2XG4B 1DLHA 4OD1L 1AQHA 4UV7L 1C8PA 3LKNB 2X3AA 1XGUA 1J88A 4G8GE 4Q56A 3BUIA 1UC6A 1RZ7H 1FRGH 3PF2A 2RTTA 3VSVA 3TZVD 3V9FA 1FYTB 4PJ5E 4QRBA 1S2EA 3JUYA 5EBLB 1RJCA 2XWDA 1QR4A 2IH9A 1N7ML 4JRYE 4NRYA 3CX5J 2TRHA 4Z7NE 1ETZA 2HJFA 1ETA1 2B1HH 5DDHA 4TV3A 3X3FL 2E47A 2FYYA 2O5YH 2I60L 3TNNA 3RZCC 4XPFH 4K0OA 2X10A 3LPOA 5ACLA 3V0HA 2UWEA 2VJ8A 3LQZA 4GSUA 3ZTNL 2XZCH 2OYLA 3ARGB 5B1KA 4HT1L 4K3JL 4TNVK 3FT3A 4BRJA 1DVUA 2X9ZA 3O9WB 2WIMA 4Z7UA 4B60A 5IFAH 1X4XA 1XEUA 5HHNB 4JO3H 4RDQF 2OSLB 4NQEB 1L0QA 2OV0A 4MAYA 4CAGA 3ETSA 4A2DA 2BP3A 4WTXA 4PTUB 1NGXB 1HL5A 2H32B 3UJJH 4PJ6A 2NY4C 3ILQC 2MIZA 2DLHA 3NPZB 4HKJA 1UH2A 3DKHA 3QB7C 1GZPA 1SOXA 3SGEH 3FUDA 4EE2A 5FO8B 3TFKD 2AJYH 2H3NB 1IGJB 3MBXL 3MR9B 5EA0L 1TSRA 3F5WB 5HHMB 4N3UA 3JV4A 3FB5A 3RTQA 3TM6A 1GZQB 1JJUA 1QSED 5D2NB 4I4WA 4L05A 3UBXI 5IB4B 4NN6B 1NANH 1MXGA 4KXZI 4KJWD 3LKRA 3KLAA 2ZKYA 2C3GA 3QG6A 3ZZLA 5HPOA 3RWFA 2N1TE 4EUPH 5CJQL 2ZWKA 3NIGB 4PJHF 3U6XS 1O9VA 1ZV9A 2DYRB 2G60H 4ZUVA 2XQBH 1E2VA 2BWQA 4I0PC 5AZ2L 1NKRA 4Y5YC 4ONGH 3N40P 5B4MC 1T5KA 4QXTA 2HFTA 3V4PA 1R4XA 4DKFL 4QIRA 5C0DA 1IEAB 5J6HA 3RWDA 3EJSA 4RMRA 4PWKA 4JG0L 2Y6SC 3C6LA 1U4EA 3EH4B 4MLIA 1HCVA 3MI6A 1T20A 5DR5H 4IRJD 2WD0A 1C5DA 3ETBF 3VI3A 1ZEAH 3OB0H 4OI7A 5E5UB 2ENQA 4LHUG 3ECQA 5E70A 4X83A 1JFQH 1MRFL 3IK2A 1UUSA 4ZS7L 4QTIH 3N43B 4LHUB 5DI8B 5DSCA 3QWRA 2V7NA 2WQRA 2IQAB 3UEZA 1Y18A 3BQUB 4H25A 3MRQB 4C56E 3N0PB 1A9EB 1DLHB 3LS4H 5FYLD 1GOHA 3P77A 4AV4A 3ILPB 4IKLA 4L4TE 1J12A 1XGUB 4KPHH 5TE7L 3TVMD 3TJHC 2DKSA 1JI2A 5IBLC 5AW3B 3ZDXB 1P5UC 1CFMA 3DMMC 1UD2A 2HLAA 2C9VA 1CXLA 2NYYC 2YFOA 2Q6WA 5BNXD 4XOEA 2CRYA 3S36X 1S3RA 1SHXA 3VXSB 5DYFA 5F7KC 1MRCL 3RIAK 2JJSA 4F8QA 3WS3A 2VB5A 3PPSA 3TO4D 2AI0L 1A7NH 4DQOL 5J7CC 3NEXA 5DDHB 5E6ZA 3DHMA 3O11A 3ABKB 1G4RA 1ZIBA 3B2VL 3DRTA 3QHFL 4H5SA 4PJFB 4RISH 5CO1A 3BKYH 1RUQH 1F4YL 2FTAA 3ARZA 3ISYA 5LNDA 2XVLA 1RAMA 3LX9A 4YSDA 2IMMA 1NOFA 5CXPA 3UTSD 3LQZB 2J43A 2VUYA 3VB8A 4QMEA 4NQCA 1FNEA 4W9DC 3IDYB 2NYZA 4DOHB 2JKTM 4AWJC 2H0EA 3WN5B 4IOIA 4AQ8A 3AM8C 3GBLA 3VXPA 2FD6L 2AXJA 3LN4A 4UDTA 5E03A 2YEZB 3HZMB 1FNGA 3QI9C 3RZCD 2VMJA 4QHUB 3SE3A 5EUOF 4QEGA 1JD9A 3Q8AA 4EIBA 3VGAC 1JHKH 3O2WH 4FOMA 3B7YA 1QI5A 3JV4B 3G6AB 5MEPB 3FB5B 1T83A 3RTQB 3D30A 3WFBL 4F8OA 3B7SA 3K6IA 4I4WB 3C5XA 3QIBC 1X5YA 3FU7A 4JVUA 5C3LD 3PQYA 4XVUC 5F1KC 2X0WA 3LKRB 4HJJH 2D3VA 2ZUQC 3POHA 1ZSDB 4U6TA 4ZXBB 4N2IA 1L3NA 5A2BA 1NWOA 3HB3B 1GIGL 2ADJA 4YFLF 3B9AA 2WP3T 2WXJA 2CIKB 3T65B 1UD3A 4FHBD 3K0YA 1G7PB 2PCXA 3UTZA 5BCAA 2HT3C 5D7JA 4QXTB 4DP4X 3QEQE 1DJGA 5C0DB 4OM1L 1BGXL 4NWTL 3RWDB 1J86A 2YJLA 4RFEB 2XOTA 4F15B 3HI5L 3NCJL 4L2LA 3C6LB 4F7PA 1U3ZA 1T20B 4A1RA 2GTQA 3IKCA 3VI3B 1MH5A 1EQWA 1IBGH 2WV3A 3QE5A 3TBBA 3H2PA 3QORB 4WAFA 5B4MD 5DSCB 1GJIA 1QWNA 4ZFQA 1AY1L 1AZBA 3MYJA 1NEPA 4YXLL 1OAXH 3VRJA 2HKFH 3BGFC 1Y18B 3GMOA 2WSKA 1BBJA 3HC0A 5I9QC 4EQ3A 4QWWD 1EGJH 4KX8A 4X4ZA 2AK4D 5BJTB 3MBEC 1N26A 3A24A 3LAFA 5D4IA 3BPNC 5CMAB 4WUKH 3FULA 3KCPA 1A3RH 3GFUA 2Q6WB 3W37A 2HLAB 1LM8V 4OT1L 1LWJA 2X4QB 3W38A 2X7LB 2OJEA 3QQ4A 4X4ME 3V5KB 3QNFA 2EABA 4F5CE 4JO1L 4ZDHA 3GSNA 4R84A 3UMTA 3AT9A 3NAAL 1V05A 2DI8A 3FH8A 4N2DA 4XXCC 3FF7A 1H8SA 4G1EA 3U7YL 3MBWA 1HHKA 3M07A 4H5SB 4R6UA 2XPYA 4MCMA 1KCRL 5F9DC 4BSVA 2CKBA 1FZKA 4JHWH 4ZQTA 2VDRB 4CN4A 2DQHL 5T5FA 1FNEB 1QFWL 4QR7A 2QQQA 2L8AA 4J8QA 4PLKC 3IETB 5DRXA 4POYA 3MRDA 3WNLA 3NCMA 4G8GA 5DUJA 3RPKA 2J4WL 4UIMA 4UDTB 5ILTH 1NGYB 4CKQA 4PJ5A 1FNGB 4KV5F 4ORGB 3RL2A 2GTZA 1TF4A 3NIGF 5EFIB 2D03L 1QVOB 4JRYA 1LK2A 2X0VA 3ZE2F 1SYSA 2MQ3A 5JPMA 1FAIL 3RGVD 5GS2H 3D05A 1SVZA 3CFJB 1F6LL 1XCQB 1WTLA 3GJFB 3IJEB 1USQA 2CGZA 5HI5C 3FU7B 1BF5A 1F86A 1NC2D 3QIUA 2R56H 4IDJL 5AVZB 2Q20A 3KW8A 2Z64C 2ZSWA 4HKBB 2YPLE 1KEGL 4JFHD 4UTCA 5I1HL 4A7VA 5C0EA 1BQ5A 1BFVH 2Q8BL 2VLME 3N43F 1HOCA 3CFMA 5DVPA 1IX2A 1HHGA 5D7JB 3U46B 4AV0A 1OY3B 5D1QD 3HG0A 3C8KA 4I1RA 5KYXA 4MJ2A 2O4EA 1DN0A 4P57B 2K1MA 1BZ9B 5LDUA 3SDAC 2Z4TA 4H8PA 3T8XA 3GS0A 2AFNA 3GPEA 3WKPA 2QJDA 3NCXA 1BZ7B 1DQML 1IFGA 1OGAD 3B9DA 4XN1A 4ZPVA 3ZDXF 4BK4A 1AIFA 1FWXA 3AVEA 1IC4L 4WTZG 4HCIA 1OPOA 4OGYL 3T1FA 1WFUA 3H3BC 1JXDA 3OJDA 3IBEA 1UZ8B 5DHDA 2PPAA 3AS3A 4U7SA 4UWQB 5FWRA 1GH7A 4NC1C 3VRJB 3GMOB 1S7QB 1KJ3L 1BBJB 3HC0B 4GRLD 4X9FA 5FAAA 1IQWL 4PS3A 2WO4A 3INUH 3FU8A 2EUVA 2UWEF 4BZ2L 3KCPB 3VA6A 3ML8A 2ZOTA 1U4FA 2OJEB 2OULB 2P4AB 4FQCH 4QRFA 5CGTA 3N1FC 4HAKA 3FQXB 4Z7UF 3TT3H 4CMMB 1DZBA 4UTBL 3HG3A 2NCMA 2A9DA 5C9JA 4J39A 4E41B 1FORH 4K7PX 2DJMA 2A1WL 3MBWB 1ED3A 4JREB 4WJKB 3MBED 2ZIDA 4F27A 3CAFA 3OXSA 4BE5A 2CKBB 2ADYA 3QIWA 3NK4A 5GRUH 3DX9B 4FXGA 1IZKA 2WANA 3IPBA 4JFDD 1EFXD 4M7KH 2YRPA 4FFVC 4P48A 2EDLA 1ORQA 5CIPA 1IAKA 3KPMA 4C56A 3HZVA 5DRXB 8FABA 1D7CA 5BZZA 3V2AR 1PW3A 1QSEE 4L4TA 1OM9A 4Q7DA 4WLCA 5LGKA 4G8GB 3A4DA 4UIMB 5MHSD 1Q0YH 1AS7A 4F33A 1U8MA 1B0RB 4PJ5B 2FO4A 2KYIA 2OL3L 3T0VA 5DVOA 5JORA 1KWKA 1U8IA 1NDGB 2GTZB 2DQTH 2VW7A 4OCNC 1RJZA 3W2DL 3SDDC 4Z7NB 2Y1YA 1OF0A 1SYSB 2EC9T 5JPMB 1I9JL 2WJ5A 3CFCL 3WFDL 3OZKA 3VFRA 2XWEA 4ZNCD 1BP3B 4Z7OB 3FSOA 3CH1B 4X99A 1WBYB 4N5ED 2QVKA 5D2LE 4F7EB 3QIUB 4JPWH 4PGBB 2MHAB 3ATAA 3GMLA 4UINL 2ZSWB 3VI3F 4KTDH 1QKZH 1VJSA 3QFJB 4DW2H 4PREA 1Z5LB 2X4PA 2FK9A 4FQXC 1FNSH 2LVEA 2WY3B 3VACA 1HOCB 5DK3A 2VQ4A 4C83B 1HHGB 3NSXA 1JG9A 3OG6B 3LHPL 1SLUA 5DZOA 3C8KB 5GGRB 1WUNT 1CFBA 4TTGA 1WP6A 4JG5A 4XBGB 2UX7A 3QJTB 5FYLE 1HWHB 1OOAA 2VLKB 5DMJB 1GCYA 3IDNB 2LW3A 3GEWB 4PY8J 1A65A 5FCUL 4HJ0C 4ANXA 1L9OA 5K1VA 1AIFB 1T1WB 2ZE0A 1U8HA 5IV2A 2BVQA 5BV7B 3APDA 4ZW7A 3HS9A 1I8LA 4MD0B 1XGRA 2X12A 1EUUA 1MCWM 1JPEA 1QYGH 3PIQB 3KPQA 1WIOA 2AJXL 2PWFA 5FHBH 4QRUB 1KELL 1T80A 1YNTA 5IG7A 2WXNA 1RUML 2H0PA 1B4JL 1GGBL 1W2KT 2X6CA 3AB0C 4P2RD 1COBA 2HKHH 5LN4A 2X70A 1SDDB 3HBPA 3N50A 1F8TH 3DTXB 3UTSE 2EIDA 2WUCH 4YHKL 1OGTA 3EKCA 3QEQA 4OUUA 1F3DJ 2WLYA 4AL8C 3ULVH 4U6YA 1BD2D 2X4OB 1OP5H 1E5CA 3HS0B 1AZUA 3I3DA 3K80A 3MLSH 3O6FA 4Z7VE 1FCGA 1KYFA 2BX5A 4KI5F 1BJMA 3I50L 4K07A 3ZYZA 1WT5A 4Q0XH 4KKRA 5HGHB 2VXTL 3STLA 4WO4C 3S37X 3QCUL 1B9KA 3LJ3A 2BZDA 1FFOA 2FGZA 4M5SA 1AXIB 2G4GA 3W3BA 4FXGB 2MTPA 4N0FA 4FTVD 5DRNA 3PP4L 5T3XH 3TCLA 4D9LL 4NNXB 3T6ZA 3ZX1A 4QHNB 1ORQB 5CIPB 1IAKB 3KPMB 3QWQB 4XAKE 4HXBH 4TQHA 4C56B 3OX8A 3D09A 3CHPA 1QQDB 1GA2A 4NC0B 4HWBL 3UCRA 1PU0A 5FLVA 1JV5A 4ORZC 1U8MB 5KVMC 2FO4B 4X4MA 5IHWA 2BHYA 4FQJH 4F5CA 1OEZW 2NNCA 1SM3L 1MF2L 2A99A 2NSXA 1GPOL 1QUPA 3DROA 4OFYA 3W5MA 4WUUB 4JVWA 1NPJA 3ARPA 2Z65C 2ATAA 3ZT7A 4CVZB 1MELA 1CG9A 2XVBA 5E6UB 5HYJB 1PLAA 3EJZD 3ZL4L 4U1MA 1HC1A 2JKIS 4HC1H 2CM6A 5D1XD 4AQ1C 4LOUC 3GEFA 1V7MH 1IGCL 2B4CC