3WFHB

Crystal structure of anti-prostaglandin e2 fab fragment pge2 complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
216
structure length
216
Chain Sequence
b'DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKINRVEAEDLGIYYCLQGSHVPLTFGAGTTLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mAb Fab H fragment
publication title Crystal structure of anti-Prostaglandin E2 Fab fragment with Prostaglandin E2
rcsb
molecule tags Immune system
total genus 53
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2013-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wfhB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wfhB01
3AB0C 5FHAH 2ZSWA 3QUZA 4HT1H 1DSFL 4YK4C 4RGOL 1XAUA 5ISZE 1FO0B 1ZHBB 2VDOL 3PHSA 2G5RA 3KPSA 1G7JA 3JV4B 3MNZA 1ACZA 3P30H 1YEIH 1BFVL 3MLVL 1KPVA 5CIPH 4KJYB 1JHKL 2UWEB 4U6VL 1F6LL 1ZT4B 2VLKB 3MRJB 4HIIB 2VDKL 3EYOB 1RZJL 3WHE0 1HCVA 5FO8B 4Y5XB 4OFYD 4OZHA 1FDLH 5C2BL 1TZHB 5E94B 3CVHL 1KCLA 5T5NG 3VJ6B 4UILL 1KG0B 3MLZL 2GTZB 5I6XB 2VLRD 1J05A 2X42A 4WV1B 1KSRA 1UM6H 1QYGL 4GKOA 2ICWB 5HYQA 4WGWB 4RAHA 3BUYA 4DKEL 4F33B 3BKCH 5TJWK 5KANI 5C0CE 5FOBB 1HXYA 1BLNA 1EAPB 1BM3H 5DD6A 3QCVH 1FORH 3C08H 1KYOJ 4GT7A 5B8CA 2I25N 1UZ6F 2H1PH 4OF3A 3W0WD 1D9KD 3GIZL 1WISA 2VZTA 5EBMA 4PJAA 1P7KB 1NAMH 3PUCA 2DYPD 3MJ8B 2X1XR 4X0KB 5IFHL 1KCSH 1IGML 5JQ6H 5KVGH 3G6AA 4B5EA 5F21B 4P2RD 1I3VA 5BZWB 3LKPA 2FZ3B 2KQNA 4FTVD 4XVTL 5E00B 5L2KD 3ARDD 1RFDH 4ACPA 3JWDL 3MRMA 4LLAA 1RURH 5E8DH 1GGBL 4KUCF 2X44D 1U3JA 3OHXB 2X4NA 4I3SL 1JHTB 2OZ4L 3IFLL 1MRDH 3T0EA 2HFFB 4FQQA 4MNHB 1A6WH 1IFHH 2FRGP 1FNEB 4QOKA 1QKZL 1RJCA 5C0IB 3VD3A 4EBQL 4BSVB 2X7LA 1J8KA 2YKLL 4U1LB 2BHUA 3MNWA 3NIFE 4HXAH 1BWMA 5T1KD 3GBNH 3KPRB 4YNYA 2EIZB 4HUXA 4ZXBC 3T4AB 1XIWB 3CLEH 3D87B 4PJFA 2IFFL 1FVEA 1DFBL 4NQCE 3B5HA 1QRNE 3IU4H 4OUUB 4OQ1A 2JB6A 1QFWH 1JNHA 2D2OA 1XF3B 4L9LB 4WTXA 3B5TA 1B6DA 1ADQL 1JRHL 3NCJH 5B3JE 3HRZA 1KJMB 4POYA 3KXFE 3JWOL 4V1DB 4BQ9A 2V9TA 5HHXL 1S7VB 4X9FA 1S5HB 4GW5A 3P11L 3O2VL 5EBWB 3L7EA 3V0AC 4N9GB 1ERNA 5D5MA 3PWVA 4PJ7B 2OMNA 5DK2A 3FO2B 1A6VL 2EIDA 1UZ8B 5DJ0A 1A1OA 1PKOA 1RZ7H 4WWID 3WMSA 4NZDA 3Q6FA 4JRXD 4YHYB 4M02A 5FM4A 1PG7W 2EDTA 3HZMB 5DEGA 1WBYA 1MJUH 2ZUQB 2ESVA 2HVKB 4NO3A 5JXED 1OM3H 2B39A 2MSPA 3SE9L 4KI5D 5IEKB 4XWGH 4G8FA 1K8DB 4KKLC 4P46C 2CKBL 5F9WB 1FYTB 1T89C 2OR9H 4F7MA 1EFXB 3P77A 4MQ7B 4KI1A 2BSSA 4JFFB 4FZ8L 4G7YL 3NGBC 1CDHA 4GFTB 3SY0A 1UKTA 1RZGB 3BISA 5JW4Q 4QHUA 4WEBL 4QTHB 5CEYB 2Z8SA 5ENWB 3WUWB 3O3DB 1M7DB 3HZYA 1MH5B 3C2AH 1WF5A 2XN9E 3DX7A 2PXYD 3VDAA 2ARJB 5JPNB 4M6OH 4BUGA 2BNRB 1FLTX 1S9XB 3VFPB 5FUOL 4TN9A 1FBIL 3SCMA 4AIXA 1FNFA 3DMMD 3MNVA 5GS0L 3ULUE 5CZVL 2CMRH 3F65A 2HLFD 2AGJH 3ETBF 4X80H 1Q9OA 1NCWH 5A2KH 3WS6C 4XTRD 2MPAL 4D8PB 1DBAH 4OCRH 2OJEB 5JHDA 4TVSa 3SDDA 1ZHLA 5J11B 2P5WE 1AQKL 5IT2L 1EUUA 4IS6B 5BQ7B 2R0LL 2XTJB 3OJDA 4OCYL 5T1LD 3BD3A 1E6JL 3EYSH 4YR6A 4KQ3H 3WDHA 4E42B 1I9JH 5IBUG 5MEOB 1ZLSL 4LQFL 4U1SB 1GGCH 5CBEB 3AS1A 2QKIA 5CKAA 3X13A 1UEYA 1HIML 1MVFA 3QO1A 4GAJL 1MIMH 4K7PH 3VGFA 3U6RB 4ZPVA 2E6JA 2OTUA 2C26A 1OB1B 4H25A 4C55A 2I9LA 1OQOA 2I27N 4WU7A 4PJBE 4YGVB 1S7TB 2VUYA 1XF2A 5HDOA 2X10A 4I0CC 4UNTA 1ONQA 3HZVB 3QEQE 1ZWIA 1GHFH 1NFDE 1KN2L 5FA4B 5SWZE 2O5XH 1MCCA 3FRPG 1CE6B 4PJ8D 5A16B 2XY1A 4JPKH 3RI5F 2Z35B 1J0KA 1MCOL 4MD4A 4R96A 3TWCL 1GCFA 4NKDA 4HWUA 2VMFA 3UTZA 4NYLB 5FYKU 1JYVA 4FQ2L 4HFUH 2OZ4A 3QEQA 1LNUA 2Z8RA 4M7LL 1UWXH 5SWZA 1D9KC 4GAFB 2PCPA 3GMLA 3OKMA 3GRWH 3K81A 1EHAA 3BHBA 35C8L 3AREA 4LNVA 5DQJB 5ANME 4L9DA 5DMIH 4R3SB 1QPXA 5IQ9A 1IC7H 3QJHB 4OZGE 3TBTB 1CIUA 4MD0A 3QUZD 1IGIL 3ARDC 4CN6A 2CUMA 4DZ8A 5I73B 1VGEH 2VH5H 3KPSD 1FFRA 2X1WL 3W9DB 3L7FB 4LCUB 5BVPL 4MQXD 4XXCA 3QUKB 3FOMB 4Z7UE 4X4ME 5GJSH 4EUPB 4FQCH 1ADQA 1AGFB 4S1SH 5BXFB 1BQHB 1MFCL 3QRFM 1T6WA 4PJIF 3K0WA 5DJXB 3V52L 4X6BB 1CD1A 3DX8B 1R5IB 1ZSDB 3D2UA 3MQIA 1RHHB 3DETD 3QFDA 1IE5A 1RIHH 1CFNA 5BV7L 1YEEH 3VG0L 4RFEA 5ETUA 3U1SH 1F58L 3LSOA 2UZXB 5T1DL 3EYUH 4XNMB 5IKCB 4OGZA 2H9GA 2ATKB 4PG2C 2X41A 2A83B 3IXTB 4OFIA 1CT8B 2EC9T 3GMNA 4NM4L 1YMHB 4OM1H 1KUMA 3RWEB 4M1GH 2NXYD 1A02N 3D0VA 4LVOB 3FHAA 4OCWH 4NQDB 1BZQK 4Z6AT 4IRSA 2CKBA 3EIFA 4EKXA 4P9ML 3D39A 3V7AG 4QRPE 1BBDH 5HJ3B 4ZTPH 5JDSA 3PDOA 4JPVH 4N5ED 5CINH 5DA0B 4NUJA 4NFBA 1BVKA 4MDJA 4OF5A 4WU5B 1V3JA 5F9JB 1MWAB 1T1YB 5DEFB 5J12B 4S2SB 4WUKL 1LEGA 1I9RL 1NJ9A 1SYSA 2P45B 4ZMAT 4LCWE 4XPBL 3Q1SH 5JXEC 1BZ7B 4XNXL 4KI5C 4MA1C 2JJVA 1R6VA 1X5HA 3T0ED 5H94B 4UBDD 1FAKT 1G7HA 4ONFL 4OLEA 4QOKD 3PF2A 1ZA6B 2P24A 1UC6A 2K3TA 4O51B 2W0KA 3LEXB 3QQNA 4P3DB 4WWKB 2CDGB 2UY6A 5F3HB 4YDKL 4ZFGH 2YD6A 4ELMF 2XWBB 1T7WA 4GMTH 2QADB 1Q0XL 5DMKA 4PJ5B 2VN4A 3DRTA 1BX2B 1DE4A 2F53A 4MA3A 4Y2DB 2V7NB 4F7CB 5LGJB 5E5RB 1LO2L 2PXYC 2XG4A 2R8SH 4C56E 5CEXA 4HS3B 2YK1H 4D2NA 2R23A 5FHBL 3AU1A 1UJ3B 4O02H 1FZJB 3HUJA 4YJZL 1GPOL 3DSFH 4KHTL 2FLBT 2NTSP 2A73B 3S37L 3DMMC 4K3EH 2EYRB 1IAOA 2AJVL 2FO4A 1DLHB 4R90H 2HLFC 5HPMA 5C0AE 3MUGB 3SKOB 4XTRC 5CUSH 5I1AA 1WT5C 1F4XH 1YUHA 2VO5A 5F6IC 5FA3A 4E41E 2JE8A 4U1GB 5D72H 2Y5TA 4KROB 3P9MA 3IAGC 4XCFL 4RGMC 2R69L 1T0MB 1YEDA 5ESVB 2AV1B 4P5KB 3H9ZA 3GIVA 4H88L 5FYLD 1RMFH 3RNQA 5FYKL 1H8SA 3IAQA 5C0BE 5GGQH 5DLML 1WBXB 2ESVD 3G9AB 1JF1B 3HNTH 4GS7C 4PV8A 1OGAE 5CAYB 1KCRL 5JIIA 3IDYC 3OGCB 4JVPA 3QRGH 4A2MA 4JO2L 1BEYL 5J3HD 3OTTA 5F1KC 4PY7B 4PJCF 1N64L 4PJ8C 1IJ9A 1JNLH 1WTLA 5HBBA 2HKHH 2BSRB 2N1KA 5AD0A 7CGTA 5HYSB 2HMID 3HZKB 3RPIB 3O6LL 3WHXA 4AEHH 4X7TB 4ISVA 5FYJD 5IVZA 4PGEA 2DWEA 3RWJB 3H3PL 5IVNA 1HQ4A 1QFWM 4ONHB 3FCTA 2A6KB 2FDBP 3BKML 3SDCB 1UFUA 4DGYL 5I1CH 2Q86B 3E1F1 3GSNB 2ZZUT 4QRUB 2ZCHH 3SCMD 3UZEA 4ETQB 1V3LA 4OF7A 4U6HB 3PWUA 3QUZC 5GRUH 4NPYB 3ZDXE 3PWPE 5JHDD 4TUOB 5HHNA 3SDDD 3TYFA 4I8DA 3M45A 4UU9A 4MQXC 3A67H 5IP4A 4ELKA 1NEZA 3OKEA 2CGRL 5GSVB 4PB0L 4KDWA 1FRGL 4LPWA 5FKPB 4Y4HB 5BRZA 3TBSB 2P8MB 4NQVB 3O3AA 1EO8L 2E7HA 3GB7B 3ZL4H 2RQ8A 4TULH 1XMWA 5I1KL 3SKMA 1AP2B 4F58H 4K3DL 1QSEE 3C09C 1GZPA 3P9LB 2YZ8A 3OKNB 3VGAB 3T2QA 3CZFA 5EU5A 2VLJE 1H3VA 3DETC 2G60L 5KSBA 1CG9B 1UGNA 4YFDB 1Q38A 1T7YA 5GGSY 4XPGH 3F62A 5AZ2L 1VFAA 2H26A 1YN6B 1ND0B 3THML 4U2YA 2A9ML 2XPGA 1M4KA 2HG5B 3BPNC 3TBYA 3CFEA 3L5XH 1MFAL 5B8CC 4NQXB 3TT3H 1D6VL 2NXYC 3QEQD 4FOMA 5SWZD 3MOAL 3D85B 1HH6B 5IG7B 5J7CC 1T20A 2Y06L 1NCNA 1IEBB 3NIGE 3ARED 1JPFA 2FEDD 3QIUB 4N5EC 1YMME 5D8JH 3WFDL 5KVMC 2D0FA 3GI9L 2DOCA 5LCVH 5H35A 4NC1E 4UAOB 4EI6A 1QA9A 3IDNA 4P4RB 2PYFB 4HUVA 3MRPA 1FG2A 2Z92B 5HYIA 3TVMA 1J10A 1ETZA 1N6VA 2A74A 1NC2A 3QUYA 1XCTB 3T0EC 3ULVF 4UBDC 1F4WL 1CVSC 1E28B 3NIDE 1CDGA 4G6FB 2CRZA 2WMPA 2AXFB 3QIBB 4HJJH 5HGHB 3FO1A 1MUJB 2LVEA 4LRNH 2YN3A 4FQHB 4J23A 1RI8A 1CLYL 3WYRA 5FFLA 2VL5A 1ZLVK 1N3NA 3FHQA 5F7NC 1FPTL 5JLZA 4P5TB 2EE6A 4JKPH 3D2UD 3HG1B 4I18A 2VSDA 2XWJB 3G6JA 2VDNL 4JQIH 2B0SH 3MODL 5EPMB 4D9QD 4YDLB 3F7YB 3A6CL 3LEYL 1QFHA 3CJJA 4FQ1H 5EUOA 3SPVA 4NRXB 1JGLH 2O5ZH 3L5HA 2FO1A 1GAFL 3VXSE 2DDQL 1U8OB 1UADC 3WO3B 3NCCB 1I4FB 4DKFL 5FYLH 4ZFFB 5KS9A 1LILA 4IRSD 1I8IB 2VLME 4NHUA 5F71A 3D39D 4LKCB 4PJGB 4DJMA 2GFBA 1HKLH 1LDSA 3REWA 1YNKL 4OCSL 2BP3A 4RMSA 1JTTA 4LCIH 4XCYB 4I48A 4CNIA 4QRQB 4Z7VF 1TDQA 4Z76B 4XP1L 2MCG1 3IDGB 1FGNH 1W0VB 4LMQI 2PYEB 3ECBB 1P4BH 1QBMH 3WUZA 1T22B 1TJIL 1Y6MR 3P3YA 4YHMH 4JKLA 4OZFG 4YHPB 5GJTL 4ERSL 4J12A 4PRHB 2ID5A 3O4LB 2QSTA 1DSFH 5I18H 1A22B 3ARQA 4ZUTB 3STBA 3TN0A 2VDOH 5IBLD 5GS3A 5J3HC 1KIRA 1R3LA 3VXMA 2UWEE 5FYJH 2R0WL 1IM9A 4K55A 3AS2A 4XP5L 3VD5A 2VLKE 1CD8A 1S9KC 2FX7L 4U6VH 5GS0D 1ZHBA 4PJXE 3CFDA 2VZOA 3JV4A 3NCEB 1DQDL 2VDKH 4PS4L 2E7CA 1RZJH 5EH1A 2HMIC 1OAKL 3ZSSA 4KJYA 1YC8A 3GSXB 4PJDA 2F53D 2UWEA 1LEIB 1DCLA 1HINL 1ZT4A 3EOTL 5D2NB 5C2BH 1S9WB 2VLKA 3T0XA 3MRJA 4HIIA 3EYOA 4UILH 1K9TA 5C6TL 1QYGH 2GYSA 1XGPA 4GXUN 1RZJC 2DQGH 3O9WD 3PIQB 4DKEH 2WANA 4O9HL 1TZHA 1EHLL 3SDAA 3SCMC 3IVKB 3VJ6A 2GTZA 3DWTA 3ROOA 4WV1A 3ULUH 1IMHC 4HQQH 3CZJA 2CR6A 2ICWA 3TEUA 3H9HB 4UV7H 3MGTB 5E6IA 3QXTA 3SDDC 5E2TL 1MFBL 5TPWL 4FXLA 2AEPL 1HOCB 1EAPA 4NNPH 2IPKB 3GIZH 4PJEF 1BAFL 2Y25A 2EE9A 4PR5B 5SV4A 5T5NF 4B0MM 1CD0A 5IFHH 1IGMH 1KF9B 3V6FB 1J5OL 1NANI 1V8HA 3HCVB 1SBSH 1P7KA 3OG6B 5TDPB 3JWDH 2Z93A 3JTSB 3MJ8A 3OR7B 3FRUA 4Q6YA 4X0KA 1GGBH 3ZKND 4LDLB 3FKUS 1IM3B 1T5XB 4I3SH 1AO7B 2OZ4H 2FZ3A 2YD3A 1C16B 5E00A 4IJ3B 3CFCL 1OP3K 5K9JL 5C7XL 4P23B 4D94A 3OHXA 3JWDC 1OAZH 3GSRB 4JO4L 2F19H 4I3RL 4XXDB 5C08B 1P5UA 1IARB 4QF1B 1FNEA 4APQB 4LPVA 2A9NL 1KTLB 3KDMB 4BSVA 3MV9B 1DFBH 1DBBL 4U1LA 2DMCA 3RWIB 4LP4A 4AG4L 3ZE0F 1CGXA 3KJ6H 2R39A 3AREC 3KPRA 4QHNA 2EIZA 2FEDC 3T4AA 1SMAA 5FCUL 4GBXB 3ZTJG 4UDTB 1ADQH 2XQYK 5DJYA 1C12B 4Q7DA 4KRMB 5F7LB 3JWOH 1JMXA 3GI8L 3NTCL 4U1HA 1XF3A 1RQ5A 4L9LA 1OARL 3LN5B 3MJ7A 3P11H 3TT1H 3KPQB 5CJOL 1C7TA 5I16A 4XXCC 3ZT5A 4ALAH 1M6OB 2E9WA 2FEEI 5LBSH 12E8L 1XF4B 1NGWB 4V1DA 3MRDB 3TPKA 1S7VA 1A6VH 3OAYH 5BRZD 3VE0B 2NY3D 3JWOC 5EBWA 4N9GA 5E6ZA 2VSCA 3TYGL 4P59H 3RZCA 5JXAL 4PJ7A 4JLRB 4AK1A 2J12B 3FO2A 2OYPA 4ZODA 1IGCL 1U8QB 1I1CA 5C9KA 3SKJL 4G8IB 5EOCJ 1FYTE 4BFIB 3SE9H 1MEXH 4NRZB 3QB7C 3TP4A 4JFFE 4NZUL 4CJ1A 3WNNA 2CKBH 2H32H 3U46A 4HS8L 5FGCB 4QXGH 2GUOB 4LIQL 1G9ML 4O5LH 4FZ8H 1J0ZA 4G7YH 4LLWB 3RVVD 5IEKA 1BGXL 1K8DA 1JVKA 3MZGB 2Q76B 3TJEL 4X6CB 2BXZA 3BPLC 3CFJA 1EFXA 2KZ1B 4GG6A 3KJ4C 4IRSC 5T33L 3MO1A 4MHHG 2BRRL 1I8KA 3H6JA 1KIQB 2VOTA 5K93A 1R24B 3MA9L 1RZGA 4MNQA 3T8XB 4FA8A 1MY5A 1VCAA 2H45A 5T3XL 3BOVA 4NP4L 2ZNWA 5ENWA 3WUWA 3O3DA 3VRIA 1MH5A 4OLXL 1MI5B 5BS0B 1NSNL 2B1HL 4F37K 5GS0H 2YN5A 5CZVH 4L8DB 2BNRA 3VGHA 1TZIA 2VRAA 2DICA 5FXCH 1PEWA 2F9BT 1S9XA 3QYCA 1NC2D 2XTJE 3QUYD 1AQKH 5IBLC 1JZ6A 1NDMA 5KVFH 2R0LH 4Z95H 2AXJA 4D8PA 5GS0C 4ELMB 1KEMH 2OJEA 3BZEA 1X5ZA 1ZLSH 4LQFH 3RUGF 2OM5A 4CMHB 2PKDA 1F2QA 4IS6A 5BQ7A 1G6VK 1HIMH 2DM4A 5D1ZB 3MR9B 4UZGA 2MKWA 4GAJH 4U0QB 2BERA 3LMJH 5MEOA 4JDTL 1JNJA 3P0YL 4U1SA 4ODHL 5CBEA 1CQKA 1HHIB 1W0WB 2O61B 3O9WC 3WE6B 4CVXB 5ICYB 2KBGA 1V7ML 1FE8L 2BSTB 1KN2H 1A3RH 3LKRB 1OB1A 4RRPA 1S7TA 4Y16B 1C1EL 4IIQB 3B2VH 3HZVA 3PGCB 2ARWA 4WY7L 1KIPB 1QLRB 3HLAB 2C5DC 4FQ2H 1CE6A 5A16A 3X3FH 1J11A 1U41A 4M7LH 3BZDA 1NMCC 15C8H 4ZFOL 4NT6B 3WXVL 3QULB 2ZOLB 4NYLA 5HHOA 35C8H 5AAMA 4JFEB 5E03A 5FUCE 4NO5A 4TNVK 2FWOB 4OF6A 4HLZH 5DI8B 3ZE2E 4JZNB 1YPZF 4RISH 1ZHNB 2BNUB 1IGIH 3CXDL 2EDFA 3LIZL 2DQIH 5DQJA 3TN0D 3ZKNC 3CU7A 2P5EE 4R3SA 1AH1A 4LPCA 3VXMD 2FBJL 2EO9A 5BVPH 3TBTA 1IM9D 3QHFL 4PJCB 4Y88A 3VFMB 3QAZB 4GH7B 3HPJA 2PETA 4HGWB 4RMQA 3OJVC 2IMNA 1MFCH 5FUZH 1VACB 2P7TA 1EK3A 4LCUA 3V6ZA 3QUKA 1PG7X 4PRBB 4EUPA 1AGFA 1N0XL 1QACA 2W65B 1BQHA 2JCCB 2WP3O 2VLKD 3HI6L 1RUKL 1N8ZB 5JMRA 4WW2F 2DIJA 4CVZB 3VG0H 3DX8A 1HYRC 3SDAD 3QFJE 4GKSA 3L9RB 2DLHA 3GJFB 1R5IA 3IKKA 1P9MA 3ZDYF 5T1DH 2DWDB 3QNYB 3QZWA 4XVJL 5E6ID 1YEGL 4NQDE 4NM4H 1CE1H 2ZCLL 3N06B 5BV7C 4GUPA 1D5BA 4N0FB 4XNMA 5IKCA 1ZK9A 2EDNA 1N0LA 1HNGA 4BH8A 5BO1L 5E5MA 4HG4K 2A83A 4WEUD 4P9MH 3IXTA 4JO3H 1CT8A 1A47A 3X12B 3L5WB 4AH2A 1NFIB 1YMHA 4LMQE 3RWEA 3LV3B 2NY3C 1PZUB 1T80A 2L7JA 3MRRA 3PGDA 4KHXL 2V5RA 3HI5L 4WUKH 2M8XA 5DJ2B 1NGQL 4XPBH 1F13A 4OZIF 5I0ZA 3E6FB 4WU5A 2XNAB 3RPKA 1MCRA 2VXUL 4QY8A 1MWAA 1T1YA 3MACH 5D93B 4S2SA 4DTGL 4ONFH 2NY2D 1HHHA 4NN6C 4G3YL 3VW3L 3GSWB 1WTGT 1BZ7A 4U1NA 3DECA 3RVVC 4NKOA 4PRPB 3MYZA 2VWEC 3VXUB 1SMOA 2XZCL 3SJVA 3S34L 3S9DB 1Q0XH 1ZA6A 3GEWB 1GH7A 1X5KA 4P3DA 3LEXA 2R2BA 2CDGA 3KYKH 5D7SL 4PTUB 5CMAB 5C09B 3BESR 4OB5L 1LO2H 1U3HB 1C8PA 1FVDB 3KPRD 4NKMB 4PJ5A 2B1AL 25C8H 1U58B 4WENB 3WJLA 2BK8A 5EZLB 4I0PA 4HMEA 5FHBH 4HHAB 4Y2DA 3LS4L 1LHZA 1ZVHA 2V7NA 4KHTH 4X4ZA 4R4ND 4YH6A 2VXVH 5IUSA 2AJVH 3MRNA 5HVHB 1A2YB 1OSPL 3BH8B 4HS3A 2E3VA 1UJ3A 2DIAA 4P4KB 1FZJA 3QUYC 2A73A 2WBJB 2EYRA 1FZKB 2MOVA 1DLHA 4V1DD 3SKOA 3GFUA 4HG4J 1DQLH 1CFSA 4XCFH 2R69H 4Y89A 4Z7WB 4H88H 5J13B 3RZCD 3L1OH 3FQWA 2YD8A 4MJ4A 4WI9A 2JF1A 2AK4B 3DOSA 1WIUA 4HIEB 1T0MA 4O58H 4I18C 3EHBD 5ESVA 2AV1A 4ZFOA 3IKCB 1KCRH 5EUKB 1H3UA 1J8HB 4GRMB 4DN3H 3DROB 4OLUL 4JO2H 4QHLB 1XGQB 1SBBA 4JPWL 4BZ1L 1WBXA 4UT6L 1JF1A 5K9OA 2ADFL 1JPGA 2XQBL 3OGCA 1FN4A 1U8HB 2YWZA 2DLIA 3O6LH 1KLFA 4G9DB 1YECL 1KJVB 2ED7A 4OD3L 1EFXD 4JQVA 5DVMA 4JFOB 1DQJB 1ROWA 3PHOB 4UNVA 5I1JL 3VD9A 2Q8BL 3H3PH 3TA3A 1FZMA 2BSRA 1KB9K 3AROA 5HYSA 3HZKA 2D7OA 3RPIA 4MNQD 4X7TA 4Z7VB 5CLWA 2AQ1A 3BKMH 6CGTA 2HLAB 2IAMB 4H0GA 4DGYH 4JR9L 5D2LF 3RWJA 2AEQL 1JGVL 3SDXF 3T3PE 2DJ4A 1INEL 1UWGL 2AV7B 4ONHA 4MNGB 4PGJA 2FYYA 1FO0H 2A6KA 4S11A 2BNRD 5DVOA 3KS0H 3SDCA 1F90L 3TN0C 3KAAA 2YMXH 1Y18B 2J5LC 3CK0H 3B9EA 2JELL 4QRUA 4LSRH 3T65A 4LASH 4ETQA 1PKQB 4X4XB 3MRFA 2P42B 4U6HA 5IK3A 1F4YL 1BVZA 1OGTB 4JY5L 4GRLA 1TZGL 1CDJA 1KB5L 5ECJE 4OGYL 1CFQB 4PB0H 1FRGH 5T3ZL 3MBXL 1I9IH 2E7LA 2EH8L 3HC0A 3V7AE 1EO8H 4KZDL 1RZIB 2Y6SD 5M95B 3O0RL 5GSVA 1B0GB 4K3DH 4RAUA 2GK2A 5FKPA 4XRCB 3CCHB 2P8MA 2JJTA 2NZ9D 4U6YB 1KTKE 1KCVH 2VE6A 5F44A 2YXFA 4WGVB 1QNZL 3MREA 5K9KA 2G60H 1CU4L 3SDAC 3P9LA 2GEEA 5I6XC 1HHJB 1T83A 5AZ2H 4KPHL 3UPRB 4CU6A 4WV1C 3MOBL 1J12A 3THMH 2JJSA 5E6IC 4I3GA 2D9QB 1CG9A 3BEWB 1MFAH 3QEHA 4OKDA 2DB8A 2FHFA 4AZ8A 1FYHB 1Q72L 1QRKA 3CD4A 1QBLL 1NLDH 1HHKA 1ND0A 3VXQB 3CX5K 4RWYL 1DBKL 5HHOD 3WFHB 4JM4L 5HHQA 5CSGA 1N5AB 5EO9B 5L9DL 3O6FA 5C0GA 1DUZA 3K1DA 3LRSB 5IIEB 4UT7L 1F02I 3ALPA 2X4OB 1AGEB 3D85A 1HH6A 1RV6X 5FO7B 4NKIL 5DQ9B 1MNUL 5GRWA 5DC0A 3QIUA 1I7UA 4L29B 3GMRB 2ITDB 2DS4A 2Z31B 1T21B 4N1HB 4LAJH 4OFPA 4U31A 1CFTB 1F4WH 3KYNA 2PYFA 2J8UF 2NY2C 3NH7H 1YJDH 2Z92A 5AWNL 1NMAL 1KPRB 4F2MB 3MXVH 2LTQC 2QQNL 4S0TD 3LPGA 1XCTA 3VDCA 1MJJB 5DFVD 3QDGE 4IOIB 1E28A 3PJSB 4X98B 1FNLA 1RUAL 5DRXB 1FPTH 3QIBA 3FL7A 4NZJA 5HGHA 3G5YB 4BH7A 4QRRA 1YJDC 2J4WH 3EOBB 1F6AB 3GMOA 4FQHA 1RIVL 2VDNH 2X9YA 3MODH 3A6CH 1AD9B 4J1UB 3LEYH 4MXVF 1HSBB 4N90E 2DQTH 4NCDA 4ZAKB 3HG1A 1GAFH 4R4NC 2VTFA 4RGNE 1BFTA 5F7UA 4L9LC 5B38G 5E1HB 4DKFH 4O2EB 1QSFE 4PJGE 4LLDA 3B8SA 3BSZL 1AGBB 1MQKH 4G9FB 3MBEB 4XAKD 2IBZX 3CX5J 1TPXB 1YNKH 4OCSH 5CP3A 3G08B 3UCRA 1KLUA 3KLDA 3KYOB 2D7TL 3SKNA 3BI9X 1GL4B 1KGCD 4XP1H 4PRHE 1I8IA 3O4LE 3RZCC 4LKCA 5HD8D 2PO6B 2CDEA 1T66D 4ERSH 5GJTH 3RZWA 4YQXL 1UWEH 1BPVA 3EHBC 5DSCB 5AZEH 4Z76A 5HGAA 3IDGA 1VADB 1W0VA 4YHYC 1SJEB 2PYEA 1O7SA 3ECBA 1T22A 5T3XD 3QJFB 5F9OL 2R0WH 4M43L 5LGHL 2FL5B 4XP5H 1Q9WB 5DS8B 4ZUTA 1TNMA 2ZNXA 1BZ9B 3RVWD 1TJHL 4M7ZB 1ZS8B 1Y0LB 1KELL 3SJVD 5D2NE 1OAKH 3QXDA 4FXGB 3WDJA 3BP7B 3EOTH 1JGEA 1ZTXL 1ZVSB 4ZO8A 2Q1EA 5C6TH 2QADD 5IMOB 1BD2E 4PJ5D 1CWVA 2XZAH 5DQDL 3VH8B 2D0HA 4I0PD 4N5UA 4L5FL 4Y2DD 1LEIA 1EHLH 2X70B 1W8NA 1P2CA 4P2CG 2HT2D 3GNML 4Y1AB 1XGRB 1CI5A 4RBPK 1JMZA 4RX4A 3VGBA 5E2TH 4JHAL 4ODWA 5TPWH 3IVKA 4IHOB 2AEPH 3UC0L 5IR1B 2XQYG 4XP4L 2VKXA 5D4QA 5FECA 3H9HA 4M93B 2GT9B 3RUGB 3DO7A 1BAFH 1U8JB 5C0DA 3SGKC 4FXKB 4JY6A 1KTRL 4CADA 1V7NH 3H2WA 2Y6SC 3VFSB 3DBXB 4BSJA 4KROD 2IPKA 2C9AA 5JIPA 3RWGA 4W4NA 1NEUA 4PR5A 3TO4A 4F7TB 2NZ9C 4ZNEE 3S36H 1SHMA 2V5TA 3SGDI 3V6FA 4MJIB 3AB0B 4UB0L 1JZ4A 3HCVA 4PP2B 5TDPA 3JTSA 3OR7A 5C08E 1GIGL 3GHBL 3W9EB 4ZOEA 1GRWA 4ZUVA 2ADJB 4FRWA 1T5XA 3QH3B 1A6AA 1AO7A 1VHPA 2PW1B 3FQRB 4I3RH 4X6DB 4XMKL 5M94B 1C16A 2GJ6E 2E9BA 5F88B 4RDQG 5KVDL 4JY4A 4L4TB 3B3IB 4LU5L 4P23A 2A9NH 3TA3D 5ITFA 3O3BB 4HWNA 2DIBA 4LCCA 2WIMA 2AEWA 2N56A 5JIKA 1OF2B 4AG4H 1S9YB 5DJ8A 5CIPB 1AGDA 2Q87A 3KDMA 1AC6A 1SM3L 5FCUH 3MV9A 4XNQA 1L9NA 5E8NB 2HFGL 1IBGH 1I8LA 4WUUB 4KRNA 4HKXA 2R1XB 5E08L 2IPUK 3GI8H 4ODVL 3NTCH 4RMWA 3HKFA 5DRWB 1OARH 5CJ8A 5GQBA 1YEFL 4EUPH 3KG5A 1C12A 1AIFA 1U8KB 2FX8L 4RFOH 4GRLD 12E8H 3U48A 1M05B 2CD0A 2EYTB 5C0JB 4XC1L 3LN5A 2V6HA 4ZDHA 1M6OA 2EKSB 3TYGH 3WFZA 3NFPB 2ERJB 5I76A 1I9EA 1CDUA 5DFVC 4CBPA 1AD0B 3OXSA 1MAJA 1XF4A 1C5DB 1JBJA 4U7KA 3VE0A 2VDLL 4YHIB 2YRZA 4WW2B 3SKJH 1AQDB 4HK3J 2I60L 4HS6B 3HR5A 3U9UB 1AKJB 2XYCA 5A2FA 5FGCE 3LHPL 2AI0H 5KSUB 4JLRA 1JL8A 4I1NB 3RX7A 4K3JL 4PG9B 2EDXA 1U8QA 5EB9A 1NAMB 4MMZC 1P9MC 4HS8H 1VPOL 4LIQH 1FGVH 4JM2F 1G9MH 2ICEB 2YD9A 4Y5YA 5E99L 3FB5B 4G8IA 4X6CE 2XA8H 1T1WB 4OFVA 1YN7B 4NRZA 4OJFL 2DQEL 3TJEH 4M48L 1U2HA 4WI5A 2UYLB 2GUOA 1BJMA 3VA2C 3H9SE 3LAFA 5I66B 5T33H 3ZT6A 4LLWA 3KPPB 4O2FB 2BRRH 1G9MC 3CU1A 4X5XB 5HGGS 2Q76A 3MA9H 4KH2A 2N7AA 1MWAH 4LVOC 3O6FD 1QZ1A 1U6AH 5D7JB 5T3XH 3T0AA 3WSQL 5IB1A 1B3JA 3D85D 3S35L 5HD8C 4HV8B 2X4TA 1T66C 1R24A 5L88L 3FT3A 1NSNH 2B1HH 4LNRB 3QIUD 5FK9B 5IVXF 3T8XA 5IBTL 4OZIB 3D9AH 5C07B 4P2QE 5DUMH 4Z9KB 5J12C 4XB7A 1NLBH 1EO5A 3FN3A 4URTB 1MI5A 4KUCD 4W4OA 5ITBH 5BS0A 4Z8FL 2DM3A 4HBCL 4J6RL 1CGWA 1KBGL 4MDIB 2GHWB 2A6DB 2NW3A 3RVWC 3FFCB 1D5IL 2VDRL 2CIIB 2XXMB 1N4XH 4MGXA 3QIBD 4XX1E 3SEPA 5JHLL 4UIKH 3KR3H 4ELMA 3BW9B 4QRRD 4LK4A 4HFWA 4UIMB 4JDTH 3KPNA 4I77L 2EDDA 2QADC 3CMOL 3WJLC 2BCKB 4OI8A 4I0PC 4Z77B 2CK2A 3SE3A 1X44A 4Y2DC 1WCQA 3HG1D 1XR8B 2HT2C 3QDHA 1HHIA 3ULVL 4ODTL 1W0WA 3HI1B 3NOIA 3OBAA 4FHBD 4DEPB 5TE4L 2O61A 3PHQB 3WE6A 1UJ3C 1VFBB 4ODBD 4CVXA 2CLVB 1K4DB 2R1WB 4WY7H 3LKRA 5DC4B 1MQ8A 5C92A 3RX5A 4Y16A 4GRWF 1JI1A 3TO2B 2KH2B 3L3IA 4EIGB 4GAYA 5F7DB 4S1QL 1QLRA 3HLAA 3VXPA 3V5HA 2FSEB 3C8KA 3UAJD 4KROC 4PJHE 1U8MA 2ZOLA 1U42A 3LIZH 4JFEA 2J8HA 3GHEL 4PFEA 1DP0A 2FWOA 2PYED 1WITA 2FBJH 4WHYH 1J1OL 3QHFH 3RKDD 3BGMB 1LGVA 4G6ML 4WTWA 3MV8A 1G9EA 1FL6B 1AFVL 5MEQB 1PW3A 3QDMB 1ZGLA 3RKPA 3U2SB 5C6WH 4M6ML 4JFXA 2W9EL 1GC1L 4HIHB 4PJCA 4XMPL 2JCCE 2RFXA 1H8NA 4JQVC 2LVCA 1CR9L 1G0XA 1QO3B 1A14L 1N0XH 4HGWA 1II4E 4XI5D 1TMCB 4UINL 3TA3C 3WFCL 4FQLL 1RHFA 2F5BL 1RUKH 1VACA 3HR6A 2X09A 4DVRH 5T3ZD 1JZ3A 4MB4A 3CDYA 3KVQA 1MVUB 3SDXB 2W65A 3NACL 5MP6H 4DK3A 1K4CB 1UQSB 3T3ME 5JPMA 2DQJL 4RX4D 4XVJH 5DJDB 8CGTA 1YEGH 4HH9B 5BOPA 3GJFA 2ZCLH 3P73B 2DWDA 3QNYA 2IG2L 4GRLC 2OJZL 3BZ4B 4L3CA 3P4OB 3P0VL 1PYWB 2E7LC 4YC2C 1N59B 3W0WB 4PGDB 2V17H 4WI8A 1JN6B 3HE6B 3VFGL 3TO4D 3X12A 3L5WA 2BVPB 5AYUL 2JJTC 3C9NA 4AMKH 1NGQH 5C0EB 1K6QL 3QG6B 4W68A 4G42B 4P2RB 1NBYA 4FTVB 3L3KB 3GMMB 1FSKC 2X40A 3TPUB 5HGDA 3F7RA 4S1RL 1T83C 4YBLB 4HZAA 2JJSC 1AO7D 4Z5RB 1OVZA 3C6SA 3UBXG 1YEHL 2XZCH 3S34H 1MIEL 2WIIA 4P23D 1SEBB 4JHWL 4WI3A 3SQOL 3GSWA 4K9EL 1LO4L 3CSGA 4PRPA 1D5ZA 2EC9U 3G6DL 4OB5H 5T1KB 3VXUA 3WEXB 4L1DA 5DJ6B 3O6FC 5E0QA 3LD8B 1MFNA 3MV9D 5CMAA 4Y19B 5C09A 2WP3T 3MJ6A 1S7RB 2JJWA 4Y2OA 1U3HA 3T2NH 1FL5A 1FVDA 4U3CA 5HXMA 2V2XB 3QIUC 5D7KE 5JW4R 4JRYB 1D6EA 1PX4A 3L6FB 1EAJA 4UAOC 1IKFH 1PBYA 1JGUH 2J8UB 1NBVL 5HYJE 4M03A 1J87A 3AAZA 5B22A 3PWJB 4HF5L 1A2YA 4KMLB 4Z7WE 3BH8A 4LSPL 3VWKB 4WI2A 5E2WL 1UM5H 2WBJA 5SX5H 2GIYA 1FZKA 2I5YL 3IFNL 3VWJA 3MUHL 3QIBC 4OCNC 4GJTB 3S88L 2DLTA 1J8HE 4YFLI 1RULL 4OD2B 3QO0B 1NGXB 3FQTB 4JRXB 4C57C 3PDGA 2V5YA 5C2UB 4YDIL 1TLKA 2AJZB 2AK4A 4BZ1H 2QQQA 5BMFL 4Y5VB 1QFPA 3K80A 1B4JL 4HXBL 4HIEA 2GSIB 4UT6H 1ZLWK 1NCDH 3IKCA 5EUKA 5CP3H 4GRMA 4KKNA 3Q6GL 4TSCH 4QHLA 1XGQA 3GBLA 3PXJA 4OD3H 1YECH 5B39B 4IM8A 3VFTB 2YS4A 2NY7H 1WC7A 4HWBL 3WCYA 5I1JH 5FM5M 3WL9B 1U8HA 5GGRY 2YPLE 4M4PA 4R8WL 2H3NA 4M6NL 3U36A 1KJVA 2NZIA 5I8OL 4J4PA 4MNGE 4JFOA 1DQJA 2GCYB 4JR9H 3VXNB 5DXWA 4QRSA 2AEQH 1JGVH 1MCPL 3U83A 3UAJC 3EUUA 1UWGH 3RBSA 3KPLB 1Q1JH 4OIAA 4Z7VA 1BBJA 5A40E 2HLAA 4XCNB 1F90H 1FHGA 3NZ8B 1NUFA 4HC1A 1FIGH 3IRPX 3DMMB 5GZOD 1MI5D 2F54B 3FB8B 2AV7A 5BS0D 1QPPA 3RKDC 4L3AA 4LVEA 4JY5H 1TZGH 4OGYH 5IW1B 4ZNCD 4X6FA 1KEGL 5T3ZH 1Y18A 3MBXH 5F6IB 5F72S 1X5AA 1EEYB 1BOGB 1PKQA 1PJ9A 4MA8H 3DVFA 1OLZA 4X4XA 4X9BA 4KZDH 4JFQB 5T1LB 2G9HA 4OI7A 1OGTA 4PV9B 4JVWA 1BREA 4X99B 3V6BR 2R9HD 4XI5C 5GGUB 2YRLA 1JF6A 4ZQKA 3IRZA 5C0FB 2GSGB 5F8RC 5TE6L 2MWCA 1QNZH 4XMLH 1CU4H 5E8EB 4GS7B 3E8UL 4JO1L 3CCHA 5HYFA 4U6YA 4ORZC 3IDYB 2EEBA 5HDBE 4JVUA 2DD8L 1I1FB 3MOBH 5D7IE 3BMVA 4LF3B 4JDVA 5F6HJ 2P4AB 3MLWL 4PJ8B 1K2DB 1Q72H 4YDJB 1HHJA 4H26B 3UPRA 4Y16D 1NKRA 1RIUL 4MCYB 1Z9MA 3FQUB 2XKNB 3P4MB 5GZND 2C4XA 3QQ4B 3BEWA 4Z7NE 2EZ0D 5J6GB 3U4AA 5I17B 5GRYA 5L9DH 5JUEL 4PJEA 4UT7H 3VXQA 1N2RB 5DRNB 3BZFB 3TO4C 4OTXL 4NUGL 3WFHA 1MNUH 3QUXB 4JFED 1N5AA 5EO9A 3MLTB 2Y72A 4LEXH 4OUOA 3LRSA 1EEZB 4JFDA 1IAKB 1UA6L 4OKVB 2X4OA 2ZSWB 3IJSB 3MX0A 2A6IA 2M1KA 5FO7A 1WAAE 5DQ9A 2DKSA 3RIAK 3WLWD 3VGDA 3MV8D 4WHTB 4L29A 1MCFA 5AWNH 3V4PL 1NMAH 3GMRA 2ITDA 4QKXB 1T21A 5JW5B 2QQNH 4IJ3C 4PB9L 2W38A 4JGUA 4QCIB 1OP9A 4OM0L 4P23C 1RUAH 3CLFH 5I1GL 3QNZB 4AEFA 2OP4L 4K3HA 4KVNH 4LCCC 3SE4A 3EFDL 1MJJA 2W0PA 1DQML 4MS8D 4U7MA 4IOIA 4OZHB 5DD3H 1K85A 2OK0L 3SQBA 4MVBD 3MV7B 4N0YL 3EOBA 5HYQB 4IOFD 3Q48A 1IQDA 2BHYA 5F3BA 5MEPA 1AD9A 4J1UA 3GBMH 4G9FE 1HXYB 5KG9A 4ZAKA 3BSZH 3UTQA 3UO1H 3MTRA 1ZT7A 4L4VB 5GRJL 3BPNB 1IAIL 2IH3B 5JW3H 3UJIL 5L8JB 1T2QL 1XR9A 1PDKA 4Z7OE 5GSRA 4OIIL 4KMTL 1J1XH 1WGOA 1AGBA 4F7PA 5EBMB 1PVHA 3MBEA 2BVOB 2FGWL 4HWBA 3OJMB 4ZG1A 3G08A 1T2JA 4YQXH 4MLSA 3KPTA 3G6AB 4MSWB 4QHKJ 4GAGL 3E6HB 2EE3A 5CEZE 1RZ8A 3DX9A 4JPIB 3NCMA 5F9OH 3K4AA 5M7QA 4JM2B 5LGHH 1LE9B 3ARVA 4LFHD 2HJLA 4Y5YC 1BMGA 5FAAA 3UTSB 2F5AL 4P0DA 1Z0MA 1TJHH 1SJEA 3T0EB 4FQQB 4HWEL 1KELH 3QJFA 2FL5A 5HHPB 1Q9WA 4J3UA 4I13B 5DS8A 1NMBL 4ZSOB 2R2HB 1CL7I 1XGUB 1BZ9A 3L3JB 1CZ8L 4PRPD 1ZTXH 1ZS8A 1GYAA 3VXUD 1AXSB 3MCLH 3CDCA 3O6ML 4HUXB 4BM7A 5GRVK 3B83A 4LHQB 3UTPD 5C71A 4PJFB 5ALCL 4Y1AE 4ZS7L 1EPFA 4L5FH 1AJ7L 3E3QE 3OAUH 5C09D 2ZG3A 4JHBA 2DMBA 1ZVSA 1YZZA 1U3HD 3GNMH 2JB6B 3BAEH 2ARJQ 5IVXB 2VZSA 5IMOA 2XIDA 4YHOH 5C6PB 2E8ZA 3LN9A 3VH8A 5EO0A 5EWIL 2X70A 5FO9B 2ZCKL 4N9OB 5GZOC 4W4OC 3UC0H 1CFBA 2R4SL 3BXNA 4JFPB 3I2CH 3UROR 3OWEA 3ULVD 2X4UB 3SHSA 1PGRB 2F15A 2WBJD 4IHOA 4G8GB 1CBVL 5IR1A 3VWJD 3DARA 1JZ7A 2GT9A 4NRYB 5GGSB 4L4JA 2R9HC 3RUGA 4W70A 3IXAB 4LKXB 5FM5O 1U8JA 1I75A 1X6NA 2SEBB 4MJIE 4CMHC 4FXKA 1LK3L 4LEOB 3UTTE 4OIBA 3DUUA 2AK4D 1WBYB 1UH2A 3SE3C 4UB0H 3K46A 1J86A 1OP5H 5I8KH 1S3KL 4F7TA 4X6DE 5HPOA 1GIGH 3GHBH 1JWSB 4G8FB 1BF8A 4L4TE 4XMKH 1U3ZA 3NZHL 4MD5A 4PP2A 4F7MB 5JR1L 2BSSB 5KVDH 4LU5H 4XCEB 3W9EA 3FO0H 4Y16C 2OTWA 5L6YL 3QNXA 1NCCL 5HI3D 2PW1A 4X6DA 2DF3A 3ES6B 4QHUB 5GZNC 3QEGH 3O2WL 1H3PH 3QPQD 2EZ0C 2FJGB 4J4PD 5HHME 4Q6IB 1T7XA 3V0WL 1V3MA 4H0IA 2FLRT 4WUUE 2H41A 3DX7B 2HFGH 5JO5A 3GMQA 3CVIL 1S9YA 1H3WM 1NH6A 2QHLA 2VXSL 5E08H 4ODVH 3ZYJA 1JGDB 4P3WA 4AENA 4X4YA 1YPZA 1YEFH 3FRPA 1YDPA 3TNNA 3CVHB 1Q9OB 5INCA 2FX8H 3WLWC 2DBLL 1OTSD 2R1XA 2RBLA 1ZHLB 4OD1H 5DRWA 5K59F 4I9WD 2B4CH 3BT2L 1U8KA 3OJDB 3JSSA 4YR6B 2FIKA 2VNCA 2EICA 1M05A 1CXIA 3G5ZB 1ORSB 5ID1B 3X13B 4ZUSB 1JTPA 4RIRB 3NFPA 4ZPVB 4MS8C 2MMXA 3GJFH 1AD0A 3B9KB 3EAKA 2B4CC 1C5DA 3LHPH 4H25B 5LVEA 1Z3GH 4K3JH 1R3JB 4YHIA 4MVBC 5JMOC 2VITB 2W9LA 5J1AA 4WW2A 4R2GD 1AQDA 4IOFC 4F37F 3U9UA 1AKJA 1UXWB 5KANG 5ILTL 4OJFH 5J1SC 3UJTL 2P8PA 1OAXL 4M48H 5DURB 4HUUB 1MRFH 4NQEB 4RZCB 1LO5B 2FH6A 1TVDA 2ICEA 4MD4B 4R96B 3REVB 3FB5A 4J3VA 1T1WA 1YN7A 2OR8A 3HMWL 3GKZA 2QL1A 1LNUB 2QQKL 3MLXH 3B9AA 3BDYL 3ISWA 1EUTA 5I66A 2Q7NA 4O2FA 3DJ9A 2V5SA 4WEMB 3I6GB 3S35H 4X5XA 3WHE1 3BHBB 2AJXH 5L88H 5C07E 1Z0NA 3HN3A 2WUBH 5F1NA 1ZHKB 5D7JA 5IBTH 2WWMD 2BNQA 5IQ9B 1HXMA 4JFDD 3QCTL 1J1PL 4WW1B 4MD0B 1GZQB 3MRIB 4HLZG 1MY7A 4WFFE 3BP6B 4EOWL 4LNRA 4Z8FH 5FK9A 4OZIA 4HBCH 4YBQD 5GRXG 4J6RH 1KBGH 1DN2A 2OI9C 3ARGB 1D5IH 1RU9H 5CBAB 4D9RE 3IFPA 3WIHL 4HPOH 3DRQB 1CVRA 3VI4E 2IWGA 3S8WA 1EX0A 2J88L 4YWGH 3RTQB 2A6DA 4D9LL 3FFCA 1K3ZA 4I77H 2CIIA 1AGCB 4YHNB 4K94L 1KNOB 4R7NA 3L95A 4TNVF 3BW9A 4UIMA 3VI3E 1MRCL 1U3HC 3QFDB 5DGRA 5I75B 3ALXA 3RRQA 2O5YL 3EKCA 4RFEB 5TE4H 4Z77A 4FNLL 3ZE1E 1G7PA 1A3LL 1NEZG 4ZAKD 4UQ2A 1XR8A 2H9GB 4BK5A 5DUBB 3EO0A 2CIKB 4F9LA 2CKNA 3C6LA 2R15A 1ACYL 1IEAB 2CQVA 2PN5A 1C5BL 1VFBA 2CLVA 3ULVC 1T89A 1I1AB 1K4DA 4QT5B 2CKBB 2WBJC 1NUDA 3H7LA 4CDHA 2W59A 4KTEH 5ICZA 1FFQA 5T5FL 4KJPD 4DUWA 3VWJC 3MBED 3TO2A 4BQCA 4EQ2A 4NUJB 4WJ5B 4J8RA 5F7DA 1BVKB 1A5FH 1UENA 4MDJB 4N8VG 1PQZA 5J13C 1R0AL 2FSEA 4NSKA 1TETH 1LEGB 1J1OH 4HZLB 3JWNC 4M3KB 4OFKA 5EIIB 4GLRH 4G6MH 3CFBB 4L8CB 1AFVH 1X7QB 1CXLA 3K1KC 2P48B 1TCRB 2VERN 4M6MH 1FC2D 2W9EH 1GC1H 2P24B 4XNYL 4DN4L 5L8KB 1A14H 2FECI 1FL6A 4UINH 5MEQA 5HI3C 2F5BH 3QDMA 5TF1L 3U2SA 2ZUXA 4HIHA 4HC1H 5SWSA 1DE4B 2VLRE 3QPQC 4J4PC 4MA3B 5D96B 1QO3A 1GC1C 1IAMA 4HDIA 3MLUL 4U6TA 4TQEL 4K7FB 2QQLH 2CUHA 2DQJH 2Z8VC 3O9WB 3AU1B 5D2LA 1AXTH 1L7TL 1MVUA 3SDXA 4OF0A 1G1CA 1CGUA 3X11B 1K4CA 1UQSA 1AI1L 1IAOB 1DL7L 1MAML 2FO4B 2Z0BA 5CHNB 3D6GA 2G5BB 1CLCA 1OTSC 1IGJA 2IG2H 4NJ9H 3W0WE 4PRAB 4KK5D 2NW2A 4NOBA 1YUHB 1RJYB 3P0VH 5GS1A 3P73A 4HWZB 5I8CA 4IBLT 1FAIL 5MENB 3BZ4A 4K2UL 4P2RE 4U1MA 5FGBA 5AYUH 4FTVE 1PYWA 2AERT 2IALA 3SGEH 4G5ZH 2VC2H 5L2KE 1JYNA 5HDQH 1K6QH 3Q0HA 4PGDA 1KC5L 1S5IL 1JN6A 1F8TL 3HE6A 4XH2B 4BQ8A 4PV8B 1WZLA 2BVPA 2QSCL 2ADIB 4S1RH 5C0EA 4C58B 2APWA 4R2GC 4G42A 4P2RA 4NZRH 3MRQA 4PUBH 3L3KA 3GMMA 5C8JB 3ZSTA 4NWUH 1SVCP 4I2XE 1ZLUK 1WZ1L 2IBZY 4JHWH 2FHBA 2VR9A 3D69B 4K9EH 5E70A 1IQWL 3DXAB 4Z5RA 3WHXB 3LDBC 5IHZA 4LSSL 1FP5A 3G6DH 4M62L 4PGEB 5E5UB 1SJHB 4Y19E 1SEBA 3LQMA 1HQ4B 1RY7B 3WIHA 1T04B 3Q3GA 3W82A 4OF8A 1PSKL 1N6QL 4K9EC 1P6AB 3WEXA 5DJ6A 5LQBL 4DGIH 2D03H 2WWMC 2UV3A 4Y19A 2P43B 4JG1H 2AK1H 1NBVH 1S7RA 1P7QA 4LSTL 4WFGD 1IKNA 5HHNB 1OWRM 2V2XA 4JRYA 4YBQC 2Q6WB 5BV7B 4UU9B 3L6FA 3LKOA 5E2WH 4ELKB 3N50A 3OKEB 4MQSB 2J8UA 5SX5K 5IMKA 2YPVL 2I5YH 1GJIA 2A77H 5SV3A 4JRXE 4ZD3H 3T1WA 4GMSL 1I1RA 3GSQB 3VWKA 3O3AB 3LN4B 1QR1B 3SE4C 3H9YA 1NCBL 3F6LA 2CDFA 5I1LA 2RCSL 1SJVA 2OBGA 4WHCA 1F42A 4YDIH 2DQHL 5E9DB 1QLEL 1T0PB 1L6ZA 3CZFB 4KI5E 1B4JH 3JVGA 4HXBH 3V79C 3R8BB 3QO0A 1NGXA 1XT5A 1WIOA 3NABL 5A43C 4MJ5B 1AKJD 5KSBB 3TV3H 2N7BA 2YA1A 1NL0L 4Y5VA 3QDAA 4NN6B 4ZAKC 2GSIA 1VFAB 3DSNA 2H26B 5IMLA 2XPGB 5MHSD 4HWBH 3EFFB 2DQDL 1KTDA 4PYGA 3O4OC 4KQ4L 2IPTH 3PP3H 4YEEA 3ZO0A 1EEQA 4M6NH 1QBAA 5EC1A 1R3HA 5I8OH 1T7ZA 4F15B 6FABL 4KJPC 4YHZL 3TBVA 1MCPH 3MBEC 1CFVL 2W92A 1B0WA 1TPXC 3VG9C 1RAMA 5E2UL 2AABL 3NFNB 5D7JD 2BNQD 2FB4H 1H8OA 5ESAB 5F7EL 3VXNA 4EI6B 1QA9B 5IFJB 3IDNB 3N0PB 5D9SA 3A6OA 4YHKL 3MRPB 1FG2B 3KPLA 4H0HB 2LABA 2HRPL 4XT1C 5DJAB 3I6LD 3OSKA 1F2XK 1IEHA 3LS5L 2F54A 1A1NA 1JRHI 2EDEA 2HVJB 4HIJB 3FO1B 3BIKA 1AR1D 1CCZA 3AMKA 5IW1A 4M7ZC 2PR4L 3FFCD 5EBGA 1YYLL 4XNUH 2VL5B 1N3NB 1F4HA 4JFQA 2VABA 5TE6H 5DTFB 4X99A 4RMUA 3S5LB 3SE8L 3E8UH 1HH9A 3ARFB 1YY8A 2YD5A 5EN2B 1LP9E 2DRUA 2DD8H 4OV5A 1SJXA 5EUOB 2EE2A 5TDOA 3D3VB 5E8EA 5I15L 5J89A 3C6LD 1FCCA 1RIUH 4NQTA 4B50A 4GG8B 2CUIA 2DQUL 4LF3A 4KK5C 2RJMA 1EBPA 3MLRL 1K2DA 4YDJA 3NIFF 2GFBB 3FQNA 2R29L 4M93C 5E56A 2AP2A 3ZKSD 4NGHL 5CGMA 4N0UA 2DBJA 5D6CA 4OTXH 4NUGH 4CNIB 5J6GA 5I17A 1RZFL 4JHZA 4P49A 1A4JB 3HTLX 5IM7A 5DRNA 1OPGL 1RUML 1YYML 2ZPKL 2DTML 3QUXA 3MLTA 5B3JF 1MF2H 3L3OB 2J5LB 3V4PH 4ENED 3H42L 2APFA 1R3LB 1EEZA 1QSVA 1G9NL 3DV6A 1IM9B 4OKVA 3EZ8A 3IJSA 4PB9H 2ZUWA 4JRWA 4OM0H 1KFAL 4U3HA 4Z18A 3IGAB 4WHTA 5FM8A 3CFDB 5DMYA 5I1GH 2OP4H 3QDMD 4OZHE 2E6PA 4Y4FB 5JW5A 5I1EL 2K9UA 5CSZA 5SWSD 4PJDB 1DQMH 4QCIA 3WUWG 4W81A 5IGXL 4J3TA 4WCYH 3QNZA 4NCC1 2OK0H 2J7LA 3TBWA 4NNXB 5B21A 4KC3B 1XGPB 1B90A 4M3JA 5DK0B 1VFOA 3FMGL 2LQRA 3SDAB 1F11A 2H6PA 4XHQA 3ROOB 3UYOD 4LLQA 3MV7A 1UT9A 4NBZB 5FOJA 3VXTA 3MGOA 5E6IB 4JJ5B 1YQ2A 5GRJH 4LPXA 5KTEL 4CN1A 1TFHA 3UJIH 4PJAE 1T2QH 2I24N 2B20A 4OIIH 4Y4KA 1DBML 3OX8B 4L4VA 4WDIA 2Z4QB 3GSVB 3CSPA 2IH3A 3PABB 3N85H 4J3SA 2L7UA 3SGJA 1QLFA 3CH8A 1F4AA 5ADOL 2ERJC 3DVGA 4GAGH 3HE6D 1RZKL 4QGYA 1I3UA 2BVOA 2Z93B 4RRPG 2CH8A 3FRUB 1MCJA 4KTYA 5H37H 3T0EE 2VDQL 4WW2C 1PLGH 4MSWA 4LBEB 4QOKE 3WIIL 3ULUF 4TRPH 1RJZB 3E6HA 4BK4A 4JPIA 5TE7H 3NPSC 2NY2B 4JM2A 1YEKH 2BVTA 4NM8L 1LE9A 2HKFL 4BFBD 3UTSA 1NMBH 4CVWA 2LTQB 1CZ8H 4K7PX 4PJFE 4KUZH 1A3QA 1ODAA 2AAVA 2AJSH 3O6MH 3WN5A 3HPLB 5HHPA 5ALCH 1J0IA 4ZS7H 4ZSOA 1AJ7H 2R2HA 4NOFA 1XGUA 3JUYA 5TQ2L 5KN5B 3L3JA 1TTGA 1IRAY 1AXSA 4QHNB 2L0DA 5D7JC 2XKUA 4PJBF 5EWIH 2IANB 3VA6A 3JV5A 5DJYB 4Y19D 3IDUA 5H2BA 1P7QD 2OQJA 1NFDF 5IVXA 2QJDA 4U1HB 4JRYD 2R4SH 1LO0H 3MJ7B 5D5ME 5I16B 2Y36L 4HKBA 4JEGB 5FO9A 4EUPG 3UX9B 2IQ9L 2DLGA 1CBVH 1BQHG 1I3RB 1WFNA 5FYLE 1BFSA 4JFPA 3VWKD 2D0GA 1AR1C 4R7DB 2X4UA 3GGWB 1I85A 1K8IB 2C3VB 3RAJL 4H1LB 3RZCB 2ESVE 1LK3H 4G8GA 4TNWK 1IVLA 4NRYA 5GGSA 3IXAA 4LKXA 1OP5K 2X4SB 3NCYP 4O2CB 2SEBA 1S3KH 3QZWG 1EVUA 4OZGF 2W07A 4LEOA 1GOGA 4OLYL 4PRIA 4FZEL 4GXUM 3U46B 2IBBA 2WZPD 4ZUWB 3HC3H 1JFQH 2R56L 1JWMB 2ORBL 4F9LC 1GGIL 1JWSA 4Z7UF 3C6LC 3VXOA 1C5CH 1ZOXA 3R0NA 5E1AA 3U7AA 4DEPC 5FYJE 1NCCH 2E9JA 1E4XL 3O3UN 1XGTB 5CILL 3CFJB 2V2TA 2MTPA 4J3WA 1W0YT 4GG6B 4ESKA 3O2WH 5DWUL 3MO1B 1U36A 5D7LB 2FIRT 4P9HL 4XCEA 1I8KB 3OPZL 3V0WH 5CJQL 3QT2A 3EDEA 2NY4B 3I3DA 1UCBL 4U4BA 4WVRA 4MNQB 2XICA 3ES6A 3CUPA 1BJ8A 3CVIH 5CKGA 3MXWL 2HN7B 2FJGA 4FQIH 2VXTH 4Q6IA 3TIDB 3LEVH 3VRIB 2ZUVA 5JHDE 4G6JL 1OOAA 4MB3A 1U91A 1O7VA 4PRDA 1TZIB 1A6PA 1OHQA 2EH7L 4IMKA 1UACL 4TYUA 5EZJB 2HH0L 2WBWB 5J6HA 1JGDA 4ENEC 2RB8A 5EU6B 1NDMB 2YA2A 5IFAH 1JNNH 2F54D 3CVHA 3ZTNL 5E8PA 3BZEB 3OJ2C 3H0TA 1G6RB 4MWFA 4TSBH 1P4IL 4DGVL 3D1MC 1YQVH 3ORJA 1L9MA 3PGFL 5EU3B 4GOSA 4KAQL 5EIVA 3G5ZA 1ORSA 3ZT7A 1XF5A 5ID1A 2CLZA 4ZUSA 4POZD 2WWKO 2HT4D 4RIRA 4F7EB 1C08B 4DAGL 2FNBA 4DQOL 3B9KA 2AQ2A 2H8PA 5F9DC 1R3KA 2CJUL 3UJTH 5JORB 4HKJA 1R3JA 1B6UA 1J7VR 5JOPD 2VITA 1ITBB 4U0RB 3M07A 4IRJA 4XPAL 1UXWA 4E9LA 5GS1C 4HUUA 4MJ6B 2H2SD 4NQEA 4RZCA 1LO5A 3I9GL 3REVA 3MZTA 4YZFE 3EYFA 2D7QA 5HHOB 5FGBC 4UUJB 5F6HI 4NO5B 2RIKA 4JB9L 5GGVY 1CXKA 1P69B 3HE6C 1J1PH 5EULV 4GW1B 3I6GA 4JFYA 3ZYIA 3QUXD 3IJYB 1ZHKA 5SX4H 3QQ3B 3WD5H 5KJRL 4P5MB 5INDA 5IEHB 1IT9H 4WW1A 3C2SA 1GZQA 3MRIA 1X3DA 3HPJB 3HB3D 4WHYG 1HE7A 1MLCB 4P3CL 1CL7H 3V7MA 3WIHH 5CCKL 1HKFA 3BP6A 4LOUD 5IOPB 4YBLC 1KLGB 3OL2A 4UV4L 3U7WL 2P7TB 5HYSG 2J88H 1FL3B 3V6ZB 3ARGA 4D9LH 2F74A 4U1JA 5CBAA 4K94H 3DRQA 5D1QB 4D9QE 3RTQA 5CJ5A 1IC5L 1MRCH 5FDYA 1AGCA 4YHNA 2WM0A 3RHWK 4JANB 1KNOA 1KJ2L 4GKSB 3SO5A 4K94C 2YD7A 3K74B 3LD8C 4FNLH 3IJHA 4GKZA 1A3LH 2ENSA 1JTOA 3MV7D 1IILE 1MHHA 2NY0D 4AJ0A 3QZWB 2ICWI 1IKNC 3U4EA 2BDNL 5DHYA 1JF5A 1ACYH 5EO1B 1C5BH 3D39E 4GUPB 4FP8L 1D5BB 4Y4KD 5DUBA 4BH8B 4L4VD 2CIKA 4FMKA 5E5MB 5T5FH 1KOAA 2QR0A 4AH2B 2WV3A 1IEAA 1TNNA 1MHPL 4R97C 3RIFK 3VWKC 1U93A 2W0LA 4M5YH 1I1AA 3BO8B 3MRRB 2O93L 3PGDB 4JAMA 4QT5A 3OR6B 2JTDA 3CDFA 2ADGA 2UVFA 3JVGC 5IWLA 4WJ5A 4M9PA 3UJJL 1G7MB 3I85A 4XC3L 3P30L 4QY8B 4Q9QL 2Y9RT 4HUWA 3BWUC 1WWCA 3NCFB 5ISZB 1ITCA 3ZDXF 4Y5VC 3INUH 1HHHB 5I1HL 1YNLL 4HZLA 4JM2D 5EIIA 4DN4H 1A9BB 4AY0A 4U1NB 3UTSD 3CFBA 1CXHA 4NKOB 1L6XA 4WNQB 4QHKI 4L8CA 1X7QA 4MXWH 2F53E 3SJVB 1TCRA 4YEFA 5D1XB 1CICB 1FDLL 3PWLA 1VENA 3DHMA 4M7KL 2R2BB 5EORL 1UM6L 5GIRA 3KLHD 1IL1A 3HUJE 3LQAL 2BC4A 4JFZL 3BKCL 4I0PB 3W39A 4LARL 2VQUA 1L7TH 5L0QC 3ESUF 2DQFA 4UI2A 1EERB 5K9QG 2D7NA 4K7FA 5C0CB 1MAMH 1DL7H 1MREH 3MRNB 3ARTA 3C08L 3NA4A 3O9WA 2R4RH 4O4YL 4EXPX 4KXZI 3LCYA 4HUMB 3X11A 1H0DB 1L0XA 5CHNA 3F7VB 2G5BA 2WBKA 1FAIH 2EDWA 1CFSB 4P99A 4PRAA 2LV4A 5KVGL 1N7ML 4K2UH 2MHAB 1RJYA 1CF8L 4F57H 3OKYA 5KAQG 2G2RA 4G8GD 3FQWB 4HWZA 3NIGF 4KFZC 5IV2A 2A6JA 2WLYA 3DVIA 5MENA 1CGSL 4ZFOB 2QSCH 5EOCL 1EA9C 4POZC 2HT4C 1ES0B 3BN9D 2BMKA 4PRID 5DFTA 1NUNB 4XH2A 1EHXA 3IB4A 1JPTL 5K9OB 2GITB 1K5NA 1JPGB 2ADIA 3Q5YA 3QP3A 1FN4B 3QSKB 3T08A 1IQWH 3NIDF 1NDGA 5C8JA 4M62H 2H2SC 5CZKA 3TA3B 1FZMB 3I84A 3D69A 3OMZA 3DXAA 4TVPL 1PSKH 1N6QH 4OLVH 1B0RA 1QFWL 4NQCB 1Z2KA 3VCLB 1QRNB 4EQ3A 1MCNA 1SJHA 1E6OL 3NCJL 2YPKA 2XRAL 1JIBA 1T04A 1N5YL 4WTZG 2FYYB 1JPST 4AYFA 4N1EA 1MPAL 3QUXC 2EDLA 4DUVA 3T65B 1EIBA 3ZKMD 4H20L 3GK8L 4DKDC 3MRFB 4KV5E 5IK3B 1KJ2A 5BRZE 3HMXL 3HB3C 5IHBA 3I02B 4GRLB 2YPVH 5J06A 4LOUC 2DLEA 4NZTL 3WNKA 4YC2B 2Q6WA 1X5XA 3HC0B 4WO4B 4AL8L 3IDMB 4XZUA 2RCSH 5DRZB 1DVFB 4RAUB 4L3EA 1T4KB 1QLEH 3GSQA 4LDOB 5KSBE 3LN4A 1QR1A 2VE6B 3NABH 5EFIA 3MREB 5K9KB 4LP5A 3LKQB 5I74B 3B9KD 1FSKB 3SDYL 3PWNB 3WKML 5ALBL 2OR9L 5F1SA 5E9DA 3HC4L 1NL0H 2NX5D 5AG9A 1MCWM 5BW7A 1Z9SA 2VWEE 1ZXQA 2NY0C 2UWEF 4J2XA 1OSZA 4IRJD 5IJVB 3DYPA 3U9PL 4MJ5A 4D3CL 5F97E 2DQDH 3FQXB 3JTTB 3PP3K 3QEHB 4LVNC 3VGEA 4PJXF 5DURD 3FJTA 4NQED 1HHKB 4Y4KC 2E7MA 3C2AL 6FABH 3BKJL 3EFFA 5HHVL 4YHZH 2YOCA 5HHQB 4YXKL 2AABH 3O6FB 3SGJC 4RFNB 5C0GB 1DUZB 2MQCA 5J56B 1HZHH 3V4VL 2AGJL 1NCWL 4NHCL 1I7UB 4OCRL 3NFNA 1QG3A 5ESAA 4ZOCA 3LPFA 3S7GA 5IFJA 1MJ8H 3NCYS 3CPLB 3LS5H 4C83A 3KYNB 1EZVX 1WZKA 4JM2C 3EYSL 2ENYA 4KQ3L 1I9JL 1XF1A 1GGCL 4L8SB 2Y07H 3O45B 2W60B 5TQ0H 4C59B 4MAYB 4JJHA 3ARGD 5DJAA 5E8OB 3U7YH 1YYLH 5FB8B 3I6KA 1CS6A 3WN5C 5DVLA 3M1BB 2HYMA 3G6JE 4XCCL 3MLSL 2HVJA 4HIJA 4BH7B 4QRRB 3GMOB 3RTQD 3SE8H 1HK6A 4QXUL 5EUOE 3RWCB 3KLHC 1O5DT 1T1XB 4NFDA 4PRNB 1GHFL 4PJBB 3NPZB 43CAA 2FATH 5LGKA 5DTFA 3S5LA 5I15H 3ARFA 2GW5A 5EN2A 3W5NA 1FNSL 3RIAF 5KS9E 1P4LB 4RMVA 1KV3A 2DQUH 3M8OH 4ODXB 4YHLL 4LLDB 3D3VA 4KRPD 3G04B 4NO0B 2CK0L 1W72B 4H5SA 1BQLL 5EOTA 5I9QC 4PLJD 4GO6B 3GRWL 5GISL 3OKKB 2R29H 4GG8A 4NGHH 1KLUB 1I1AD 1I85C 1OCWL 2ZJSL 5DMIL 3SKNB 4KRLB 3NBNA 2OXHA 4S1DD 2Q20A 5IB3B 2CDEB 5B4MD 2V9RA 2VDPL 1VGEL 3STZB 3W2DH 4OZGB 2YWYA 1RUMH 3VXME 3K2UH 1YYMH 4XP9H 3KPMA 1PZ5A 5HGAB 3FB6B 4BZYA 1R5WB 3BN9C 5FKAB 1A4JA 3SKUD 1G9NH 5GJSL 3AY4A 4ODUB 4X7FC 1X5YA 2EXWD 4RGOH 3GMPB 4Z7UB 1U8LA 1ZA3B 3UZQA 2BFVL 1KFAH 3L3OA 4PJDE 5TDNA 3BX7C 1BFVH 3LKNB 3MLVH 4N8PA 4WIQA 3DUHA 3QXDB 4ETYA 3BP5A 5I1EH 1JHKH 5C0RL 1G9NC 3VXRA 3IGAA 1JGEB 3HMXA 1XCQB 5EC2A 3QXVA 1KB5B 2XFXB 4Y4FA 2F58L 4KJWD 1BFOB 2ATPB 1ED3B 2HAZA 2CR3A 3LRGA 4Q6IC 1P2CB 3CVHH 2Q8AL 3MLZH 4NNXA 5DK0A 5BVJA 4IMKC 4BYHA 5I1DA 2HFTA 2CRIA 4ODWB 4OCWL 3ZKMC 1G6RL 3TNMA 2W9DL 5FECB 1X4YA 4JJ5A 3DO7B 3MGAA 5C0DB 4ZTPL 1KJ3L 2HWZL 3HAEB 4JY6B 2BJML 3B6SA 4CADB 3QR2A 3O3EA 2IADB 3STLA 2X4QB 2IC2A 5ADOH 3OX8A 3RWGB 1H15A 2LAGB 2Z4QA 1RZKH 3GSVA 3C60A 3TO4B 4IEFB 5MEND 4XX1G 4TUJB 3V5DA 3PABA 1CGYA 2VDQH 3WIIH 5LKNA 4U3XA 4XVTH 3OKOB 1WIPA 3B9KC 5GGRB 4DW2L 4Q9BA 1RZKC 3I50L 2AQ3A 3QDJA 4ZUVB 3BRFA 3SO3B 2HKFH 4IRJC 4LBEA 1A6AB 3QWQB 2VR4A 3IFLH 1RJZA 3MUY1 3HS0B 3IU3A 3VFRB 2Q3AA 4X6EB 4JY4B 4FN0A 1QKZH 5A2LH 4NQSB 1L7IL 5ITFB 4EBQH 3MA7A 3KPRE 3WS3B 4LCCB 4E5XB 5TQ2H 1Y6NR 2YKLH 3DXAD 4GSDL 2BVQB 3ARZA 5DJ8B 3CMGA 1AGDB 4O02L 3HPLA 1KIUA 4XNQB 2IFFH 4C56B 2C3HA 5KN5A 4K3EL 1TITA 2WSKA 1KCKA 1S8DA 4HKXB 2LU7A 2PTVA 2IANA 4V1DE 4EI5B 1JRHH 2Y36H 5D72L 1AIFB 1J88A 1Z5LB 2EC8A 3TF7C 5SWQB 2OTPA 5HHXH 4E41B 2M26A 1JI2A 1X5LA 3O2VH 4PJ7E 2IH1A 2FR4B 5EG6C 1RMFL 4ZDHB 3ARGC 3MFGB 3O6KL 5I76B 3OXSB 5EZIL 4L3ED 1I3RA 4PJIB 1QFUL 5C0BB 4R7DA 4OZ4A 3RTQC 4X5LA 3GGWA 2C3VA 1K8IA 3HR5B 3ZE2F 4H1LA 3MLPA 4NFCA 4OLYH 3QXAB 5E9DD 4FZEH 4ONOA 3BEVA 2X4SA 1JUFB 4UDUB 2AXGB 4O2CA 5F7HA 3VDBA 1DEDA 2FX9L 4Y5YB 2A2QT 2HKHL 3KYMA 1GGIH 4OGXL 1TVBA 5I75C 5JIHA 4AEIL 4KZEL 2F8VA 4GG6E 2D31A 3DUSA 1VDGA 1E4XH 4LPYA 4XPFL 5CILH 4M1DL 4KRPC 4ZUWA 2G75B 1JWMA 5DWUH 4MNQE 4P9HH 4PLJC 3OPZH 4FFZL 2B5IC 2FD6L 2ZWLT 4QNPE 1UCBH 1XGTA 1I1AC 4WEBH 5FYJU 5E7BA 2LU4A 4KGJA 2BX5A 1S7XA 2YR3A 3MXWH 5D7LA 5IB1B 2BNRE 4S1DC 2Z91B 2X4TB 5GRUL 2BVYA 2R1YB 2XY2A 5FCSH 5B4MC 3FT3B 4P9HC 3DPBA 1D5XA 5IWLC 5EOQL 3FONB 5I2IB 2HN7A 2EH7H 1UACH 5FUOH 2HH0H 3TIDA 1FBIH 3BPOC 1PY4A 3PWPB 3MV01 2APXA 3ZMRA 4MZ3A 4NO2B 5K9QI 4FQXB 2EXWC 4XVSL 2MPAH 3ZTNH 4HKZB 1HI6A 2NW3B 1GGYA 3DTXA 5EZJA 5IT2H 5EU6A 1GOFA 1P4IH 5I71B 3ZL4L 4TULL 1EFQA 4YPGA 1A8JH 4F80A 4OCYH 2CSPA 1E6JH 1G6RA 3PGFH 3PQYA 4HFWB 4KAQH 4PLKD 3KPNB 4LHUB 1P1ZA 3SGKA 2V2WA 1QSEB 3BJ91 4FABL 4KJWC 4M6AA 2VLJB 3PXHA 5DK3A 5D96C 4DAGH 4DQOH 5EU3A 2XTLA 5E4IA 4ZOBA 3ARFD 4KK8D 3BFOA 3L5XL 2R2CA 3OZ9L 4F7EA 1C08A 3B2UD 5FYKD 4HK0B 3D3VD 3K7UA 1KXQE 4P2OB 5JORA 1LO3L 5HHOE 4DUXA 5AYQA 3C8HA 1MCOH 1A21A 3TWCH 1T0NA 3L3IB 4GAYB 3ET9F 3RFZC 3VXPB 3V5HB 1X5FA 3WDIA 4MJ6A 3C8KB 3ZYZA 1DZBA 3DIFA 1UWXK 1A0QL 1YMMB 1Q9KB 1U8MB 3L3HB 4RMRA 2FECL 3CH1B 5J0BA 3CGTA 4DK6A 2OL3L 2ZUTA 3V2AR 1LD9A 4TOYL 4TVPD 4UUJA 4M1CD 3QG7L 4X83A 5KJRH 2ZOKB 1CGVA 4LGRB 3V6OA 3AVEA 4GW1A 4U6XB 4P3CH 3MV8B 3V9FA 2Z8WC 1TCMA 1HSAB 3IJYA 3QQ3A 1ZGLB 4UV4H 4P5MA 5IEHA 4JFXB 4P2YA 4R4BA 1EHNA 2RFXB 1ZLVH 4ZYKB 1MLCA 1WBZA 5FGSA 2EDYA 3U0WL 3VXRD 5IOPA 1KLGA 5AEAA 2P46B 3QI9B 1FL3A 4Y4FD 3U0PA 4JZJB 2GJJA 3V52H 2JB5L 4NN7C 4FQ1L 5D1QA 5I8EA 1KJ2H 1JJUA 2L4OA 1JGLL 2J2ZA 3RA7L 5GXBB 5JPMB 3T0DA 4XB8A 3K4ZA 1VSCA 5EA0L 3VU2A 4XAWL 5BV7H 3VXSB 2BDNH 4JANA 2X1OA 2WWKT 1F58H 4L8BB 3UBXA 4FP8H 2Y5EA 4LIQE 4MMXC 3F12A 4XAKE 4M7JL 1HKLL 3OXRA 4L3CB 1CDCA 5EO1A 3SN6N 1KGCE 3BH9B 1MHPH 1FGNL 1H5BB 4YHML 3C60D 2GK0B 5I18L 1BIIA 2UZYB 3C9NB 2IMMA 5GPRA 4AT6A 3FAWA 3T3PF 3UJJH 5T3XE 3BO8A 4NN5B 4JREC 1NBYB 4XC3H 1S7WB 3OR6A 1I8MA 2NPLX 4Q9QH 5FYJL 3AXLB 2PW2B 3BD4A 3GKWL 3DO3A 3RVXD 1I9RH 5HGDB 3MRLB 3CXHJ 1YNLH 5I1HH 5BW7C 5DF0A 3QDJD 1G7MA 3SJVE 4XNXH 2OI9B 3C6SB 5ISZA 4ZFZB 3D18A 4PJXB 2WIIB 5IMMB 4ZPTB 1PEZA 1Q94B 3F6IA 1A9BA 4M7KH 4JFHD 4Q2ZA 4PJ5E 3ILPB 4YDKH 3HFML 4WNQA 3MRCB 5EORH 1D5ZB 3T0BA 5DD5L 2DQGL 4PTTA 2FJFB 4QWWD 3LQAH 5HGBA 4JFZH 1CICA 5D1XA 4LARH 3FB7B 3V0VB 4F15C 1OAUL 4EEEA 3ULUL 2EEAA 4HQQL 5CJXA 5KW9L 1FL5B 4UV7L 5HY9B 4M00A 1D6EB 4N68A 3O11A 1DJSA 1QQDA 1T1ZB 2IAND 4O4YH 3LQAC 1GPOH 3D5OF 3S37H 4NNPL 3AAZB 3QEUA 5C0CA 4TSAL 1UB6A 4WFED 2C1PA 1DQQB 5DR5L 1N7MH 1CF8H 1HWGB 1H0DA 2XI9A 3VWJB 2IQAB 1SBSL 2J8OA 3RWDB 3F7VA 3UYRL 1VKXB 1M71B 4PP1D 4XGZA 4PLKC 1CGSH 2MHAA 5EOCH 1V05A 1EH9A 5FYKH 5ESQB 3CSYB 1U8PB 5DLMH 1PD6A 2DQCL 1OP3H 4M61B 4Z7QE 4X8XA 1JPTH 1J18A 3ARFC 3AGVA 1OAZL 4KK8C 1EEUA 2F19L 2MJWA 4KVCL 1ES0A 1BEYH 2OL3A 3VD4A 1T5WA 2AJ3B 3ALWA 5IF0B 3B2UC 3K3QA 3TZVB 1W72L 5ACZA 4HLJA 5L2JA 1E4KA 1N64H 5KAQF 2GITA 3C5SA 1WC7B 3MSPA 4NJAL 3KJ6L 4TVPH 2H3NB 3S6CA 1I7TA 3U36B 3ZHKA 5I1IL 1A6ZB 2JIXB 5D7LD 4QRSB 1E6OH 2NY4D 2XRAH 1JHLL 1N5YH 3ZDZE 1REIA 1BBJB 4NQCA 3VCLA 3TCLA 1QRNA 1MPAH 4R0LA 3ZKXB 3TT1L 4M1CC 4ALAL 4BKLB 1FCGA 4H20H 3GK8H 3AY4C 5DGQA 3EBAA 1BOYA 5LBSL 43C9A 3HMXH 2IGFL 5DJCB 1S7UB 1YNTB 4PJGF 4K7PY 1QOKA 1G7IB 1TIUA 1XH3A 3MRHA 4X6FB 3KXFA 3B43A 4K8RL 1U8NB 3BN3B 5EU6D 2BOBB 4NZTH 1OT1A 4PGCA 4Y0GA 3V4UL 4P59L 3W11D 4AL8H 4ZO6A 1N6UA 2G9HB 2LU3A 2CGRH 1A7NL 3I02A 2HJKA 3PQYD 2XACC 5CFHA 4ZQKB 4XBPB 4Y4FC 4WO4A 3O2DL 1MEXL 3VH8G 3IDMA 5DRZA 1DVFA 3ARYA 5I1KH 3SDYH 3S3JA 3WKMH 5ALBH 1T4KA 4QXGL 3HC4H 3PL6A 4O5LL 4R2GB 1X4XA 5IVOA 4JDVB 3U9PH 4KKAD 4D3CH 3LKQA 3PWNA 4DCQB 2AJYL 5DD0L 5DFWH 5HI5D 1UZ6E 2A38A 4L1HA 3LQZB 5IJVA 2A9MH 3ARBA 5DHVB 3AFLA 2BVUA 3BKJH 3F5WB 3LDBB 5HHVH 1F3JB 3FQXA 3JTTA 2YUVA 5KZCD 4RA3A 1D6VH 4YXKH 3RWFB 2Y7QB 2ILLA 1IGYB 4PJEB 3WIFA 3VRJB 4Q58C 3MOAH 3V4VH 3C60C 2Y06H 4FFVD 2GKIA 1LEKB 4NHCH 3WFDH 1HDMB 2XN9A 4UT9L 3GI9H 4JFDB 3NAAL 4JKMA 4RA0C 2A6IB 5KVFL 5J9PB 4JG0L 4V2BA 3H3BC 4MB5A 3RVXC 4Z95L 3RP1A 3NVQA 4DFIA 4EZMA 1KEML 3S96B 5DYOB 1Z6JT 4UTBL 3UXFA 3VGGA 5MERA 3CPLA 2H2PD 2P5WA 4JGMA 4QRRE 1FJ1B 1E4WL 5JZ7D 4A6YL 1Q0YL 3LMJL 4XCCH 3MLSH 3S97C 4L8SA 1V5JA 3O45A 3S36X 2W60A 4HIXL 4MAYA 2K1MA 1ZT1B 2APBA 3U30B 3VMNA 5E8OA 1CLYH 4QXUH 2B7DT 5FB8A 3HG1E 4QWWC 5D1QD 3M1BA 4G80A 1A3RL 3RY6A 3PP4L 1UVQB 2D3VA 2ZUUA 1MSPA 1IQDB 2QEJA 3RWCA 1DTUA 1DN0A 5F3BB 1T1XA 3B2VL 4KXZH 5MEPB 1FNSH 1I7ZA 2GY5A 4PRNA 4PJBA 1MHCB 2ZSVB 3IDJB 2DKMA 5KG9B 3JBG7 4I5BB 4YHLH 5LAXB 3UTQB 3X3FL 3QWOB 2CK0H 2ICCA 1NFDA 4WFHD 1ZT7B 5ELIA 3VFVB 15C8L 1BQLH 2DDQH 3O4OB 5GISH 3IAPA 1P4LA 4TTDD 2NNAB 4H1LH 4ODXA 1XR9B 3KPOB 5GSRB 1OCWH 2DM7A 3G04A 2FBOJ 2ZJSH 4NO0A 4Z78B 1W72A 4F7PB 1A7BA 3I75B 5DA4A 1EBAA 4RISL 5ICXA 3OKKA 3VG9B 4PP1C 2VDPH 2DQIL 2PYEE 5JNYB 1MJ7L 8FABB 4KGLA 1P5VA 5CD5D 4F8TA 3ULSB 5E4EC 2KUTA 3DX9B 1RZ8B 1TJIH 2KKQA 2DI7A 2V7HB 5ANMA 5IB3A 2P5EB 4RWHA 2X2YA 3STZA 1WCBA 4OZGA 5LG1A 2HJLB 2WINA 5H37G 4CW1B 5FUZL 2BFVH 3FB6A 4PY8J 2OSLB 1R5WA 4QTIL 5ISZD 5FKAA 1NBZB 1G7LA 5EU7C 4YXHL 1P6FA 1VFUA 2UUDH 3X3GL 4CU7A 4ODUA 5FGRA 2YEZB 2FX7H 1TJGL 2FGZA 3GMPA 5C0RH 3GO1L 1ZA3A 4X4MA 4Z7UA 5T3ZE 5KSVA 1DQDH 4PS4H 1MCKA 3LKNA 1OTTD 1Q8MA 2F58H 5D1XD 1CICD 3FT2A 4Q0XL 1HINH 4FFWD 1EJOL 1XCQA 4FQPA 2Q8AH 3KWWA 5TFSL 2NY4C 4IRZL 1KB5A 1MCSA 2XFXA 2VZUA 3QFJB 3S4SA 4LVHB 1IGFL 5EO0B 2NQCA 1BFOA 2ATPA 1ED3A 1CE1L 5IW6B 4O9HH 3E2HB 3O2DA 4X6CF 5C0CD 4CDGC 1G6RH 2H32A 3MOQA 2W9DH 1A9EB 4JO3L 3UMTA 3BXNB 3MUJA 2K7PA 1KJ3H 2HWZH 3AS3A 1MFBH 2ZG2A 3DURA 2BJMH 2AEIT 2YUXA 3CFKB 3W11C 5KSAB 2C7UA 2OR7A 3Q5TA 1BF2A 1HHGB 3WNLA 3HAEA 4JKWA 4QRPA 4U05A 3CC5B 5KOMC 2IADA 1UG9A 1J5OH 2X4QA 3DUUB 3MACL 5GHWL 4JN1L 2VIRA 4DW2H 1KXTB 3UZVB 1MOEA 1AO7E 4TUJA 3I50H 1B2WL 3EJYD 4K71B 2RHEA 2C1OA 4X7SL 5FV1L 3BIBX 2GY7B 4KKAC 4LCWA 4YDVB 2DAVA 3OKOA 4MD5B 1TQBB 5GGRA 3CFCH 5K9JH 5C7XH 4LLVA 5HI5C 2OTWB 3KYKL 4U0RC 1L7IH 3QNXB 5IBUB 4GLRI 4JO4H 3HE7B 4RNRB 5ID0B 5LXGL 3R06B 4GSDH 1NPUA 2D4DA 3HS0A 1PAMA 1XFPA 25C8L 3J8F7 3MV9E 3VFRA 3IYLW 4X6EA 5JW4N 5E24E 4HJGB 1DEEA 4NQSA 1U92B 2YC1B 3WS3A 5GGTL 4E5XA 1DBBH 4TNWF 2VXVL 4A6YA 5JO5B 4FFVC 3GMQB 2BVQA 4NQCD 5HVFB 1QRND 2GJZA 4AENB 4X4YB 1YPZB 3GDBA 4C56A 1YDPB 4WI6A 3TNNB 3V6OC 5IB2B 2X05A 5INCB 3FAXA 1DQLL 4LRIA 4B41A 2GAZA 3KXFD 3NA9L 5C0AA 5CJOH 2YHGA