3WFHB

Crystal structure of anti-prostaglandin e2 fab fragment pge2 complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
216
structure length
216
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKINRVEAEDLGIYYCLQGSHVPLTFGAGTTLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords mAb Fab H fragment
publication title Crystal structure of anti-Prostaglandin E2 Fab fragment with Prostaglandin E2
rcsb
total genus 53
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2013-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wfhB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wfhB01
3QXDB 4HPOL 1N4XL 5GHWH 2UVFA 4HMDA 4IHOB 1JZ5A 4BH7A 1MCJA 4POZD 4MD0B 2ADFH 2P49B 2G75A 3QCVL 2OI9C 3QCTL 5EUOE 4XWGL 1BZ7A 4TULH 4HS8H 1UXSA 4FQXC 2VH5H 1WT5C 1N64L 4FQ1L 4G6KL 1ORSB 3DRTA 4RAVB 2APBA 5KSVA 3ULVF 4GH7B 3I02A 2F54B 2NTFA 4JHZA 5C70A 2QQLH 1SMOA 3C2SA 3D5OF 1GC1C 1ADQA 3HZMB 4K07A 4OCSH 3HMWL 2A9ML 3CVHB 1I9EA 4FFWD 4Z7QF 4RBPH 3VWJB 1MFEL 4O2CA 3QH3A 3V7AE 4QTIL 2VDPH 4M6NL 1A3LL 4S11A 4MNGB 2NYYC 5HYJD 2J5LC 1IGML 4WEBH 1S9XB 4U3HA 3STZB 1NCAL 2L7JA 2WWKO 3RZCD 3QR2A 5J6GB 1A8JH 3MLZL 2FATL 2F74A 3O2DL 2HFEA 4MDJB 3OHXB 4KK8D 4PJEB 5E9DB 4NFCA 3QXDA 3VG0L 5FGRA 1BOGA 3RWCB 5IP4A 2ZUWA 1FP5A 1A7NL 1VHPA 4MXQD 3VXTA 1B6UA 4IHOA 1LO4H 3QEQE 4NUGH 5F89A 3H7LA 5HY9A 1FNEB 1QFWI 4ELMF 3PHSA 4PJCB 1SHMA 4BQ9A 3UDWA 1CIDA 1CICA 3A67L 1MJ8H 3NPSC 2XA8L 3NZHH 4JRXB 5HVHC 4GKZB 2VLJD 5EWIL 5JTWA 3HMXH 3VJ6B 4GG6B 4DFHA 2F54A 3CK0H 4JQXC 2ICWI 1OTUD 3FONB 1TCRA 4LL9A 4U1GB 3EKCA 1CL7L 4RWYL 3SE9H 4DOHE 2FWOB 2IPUG 1J05B 2F53B 1PG7X 3EOYG 1YEFL 3TESA 1L0XA 5E56A 4WO4B 4XXDB 3O2WL 1BGXH 5F7KC 4R4BB 1FRGL 1FV1B 3STZA 3L95B 4P5MB 3QO1B 3QIBD 1RHHB 5J1AB 4YUEL 5D7LE 5EU7E 3UTZB 2UZYB 4RMTA 1Y0LB 3OHXA 4OCLC 1BWWA 4PJEA 4WHYH 4MD4B 4PTTB 5KS9E 1EJOH 2NY6B 1FL6B 4M7LT 5KJRL 3PQYE 3UPRB 3ALWA 5JXED 3JWNC 4WFGE 3FMGL 4MQXC 4O58L 5HGGS 3ESUF 3B5GA 4WI4A 3MR9B 4R7DB 5IHUL 2VE6A 4BK4A 1GC1H 4OFYA 4LRNH 1I85A 1E4JA 4B7IA 4GG6A 4OF3A 1MIMH 1UM5L 1WSST 4CVWA 4TSAL 4PV9A 4Z7VA 4PJXE 1NGXA 1OAXL 4GMSH 3V8OA 2F5BL 2HN7B 2J12B 3TBYB 4NSKA 2BJML 2FEDC 2EYSB 1KTLA 3O6MH 1J05A 4LIQE 2CDEA 4KTDH 2EH7H 1OL0A 4Y2DC 4RNRA 2BSTB 1QFWH 2QADC 4R4ND 5HHME 4GSDL 3D3VA 3L95A 2WINB 5E7FA 3QO1A 3CUPA 3O6LH 4K55A 1RHHA 5J1AA 4N8CL 3UTZA 3IDGA 3QT2A 1Y0LA 4D3CL 3ZE2F 1RZJH 4YJZL 2GY5A 2W0FB 4PJGF 4PTTA 5C09B 1UB6A 3BISA 3Q6GH 1FL6A 1P7QD 4L9LA 5D2LE 3MRLB 4M6MH 2HT2C 2BNRA 3CDGA 3DV6A 2XKNA 3OR7A 4AEHL 4Z77A 1BIIB 1A1OA 2WIIB 2DTMH 3KHQA 3ILPB 3CXHK 3DNKA 3MR9A 1I9RH 5KSBF 1KN2H 2BRRL 3U4AA 4LLUB 5ICZB 1DLHA 1BIHA 2ZCLH 4EUPH 4YHYC 3P9LB 3FZUC 1FNAA 1CI5A 4AJ0A 1W72B 2OLDA 3VRLE 3MBED 3TBYA 5T1MB 2AAVA 4DN4H 4FP8L 4YFLF 3KDMB 4XC3H 3MRDB 32C2B 3OXSB 5DRNB 2UUDH 5DEGA 2BSTA 2V9QA 4RAUA 4QHMB 3RVWD 4WU7A 3UZQA 3LN5A 2WINA 4HIHB 5FCSH 1UCBH 1FPTL 2DQCL 2DQFA 4EI5B 4FABH 1H3PL 4FXKB 4ONGH 1Y6KR 1T1ZA 3ALXA 1CFBA 4MAYD 2BK8A 4CAGA 2E9WA 3Q6FA 4OZ4B 2R4SL 5C09A 2CJUL 5GISH 4PJIE 5ISZA 4HGKC 1OTTC 4PLJD 4ZFOB 5A2FA 4WFHE 1KTRL 2IPUK 5TE7L 5CBEB 4FXLA 4P4KA 3CNKA 2AK1L 2A6IB 3E8UH 3ZYZA 5J3HD 1BVLB 1FG2A 4TVPD 2HWZL 4Y16C 5IJVB 1MCNA 4HZAA 1RK0B 4RISL 5EO9B 7FABL 1IQWL 3EJYC 4U1HB 1MCQA 3OB0K 4JPWH 1AFVH 4H0GA 2LV4A 2ZKHH 1N0XL 4ONHB 1BAFL 1EDQA 1CBVH 4KJQD 5ESQB 3P0YL 5E5MB 1JZ4A 3GMPB 3BKML 2YD2A 5DTFB 3MRDA 4Z78B 3OXSA 4OZHB 5A3IC 1YECH 4ODHL 3NCYP 3W11C 4Y4FB 2PR4L 2J6EL 4QHMA 5DUML 5GRJL 1ACYL 4HIHA 3RPKA 3O3AA 4DZ8B 3V4VH 4PRDB 4HD9A 4RMVA 1HHKA 3V4PL 4M1DH 3DX8B 4OFPA 4GUPB 2X4NA 1MQKH 3CD4A 3MRBA 3PWUB 4FNLL 2DI8A 3EHBD 3HRZA 1NBVL 3IDMB 5CD5D 1RJZB 4KH2A 2AEQL 5D7JD 3SJVD 2WP3T 3BPLC 3MRNB 3S4SB 3NIGE 2A6IA 1I8KA 3QFJE 1BVLA 2HTLC 3P4LA 5LQBL 4NQEE 4NC1C 5DRXB 5F72S 2OTPA 1S3KH 4UT9H 3MBXL 4AZ8A 4P2QA 4KQ3L 4X6BB 4XI5D 4O4YH 1FCGA 2X7LB 3GMPA 2DQJL 3QQ4B 4WI7A 5DTFA 1B88A 4Z78A 2NCMA 4OZHA 3MXVL 3GMQB 3WNNA 4IMLB 3TNMA 1I7UB 5K9JH 4MDIA 2VXQL 3CSYB 2ZG2A 4DZ8A 2YD4A 1Y6MR 2BMKA 4PRDA 1KELL 5DURD 3HLAB 3QFDB 1JHLL 4EDWL 2X44D 1XCTB 3VXSE 2E6JA 2ESVB 2EYTB 3VFVB 3ILQC 3GSXB 3X11B 4MA7L 4G8IA 4KVCL 4PRBA 4LSQH 2Z4QB 1A4JB 1KGCD 2X4OB 1JGUL 3OF6A 4JZNA 3E2HB 4X7TB 2O5YL 5D7SL 4PP1D 2JK5B 4LCIL 3UBXA 3F5WA 1OQXA 4Y19E 3WS3A 1VESA 3MRNA 1WQVT 2NY2D 3S4SA 5CJOL 5JZ7D 2NLJB 1IGTB 1UWEH 4XBEL 2EC9T 4PJ8C 1Z5LA 2GJJA 4AL8H 3UMTA 1KCSL 2X7LA 3CZFB 1S7QA 4NHCH 3X13A 1NDMB 2IANE 1UT9A 2RFXB 3WXWH 4IMLA 1MAJA 1CK0L 3GHBH 4W6XB 4YBLC 2HT3D 3QXTA 2HKHH 3QG6B 1U8QB 3HLAA 1SQ2N 5IB1B 1FORH 4RGNE 1XCTA 1F00I 1G9MC 4XTRC 4JG1L 3TO4A 1CFNA 5HI3D 3VFVA 4ZOEA 1FE8L 3GSXA 3X11A 2DQGH 2P7TB 3UROR 1CR9H 4EQ3A 3QUXA 4A6YH 1I1AD 3NN8B 5FHBL 1U3ZA 5EBMA 1OTSD 5GS1A 1UKQA 1DQLH 3VWKA 2IG2L 3DHJA 2JK5A 4V2CB 1U3HC 4ZTPH 2NXYB 2NLJA 3MLYH 4P9HL 4MJID 1FJ1B 1IGTA 2EE9A 3TBSB 5F88A 5C0JA 1ULVA 4NOFA 4FXGB 4WW2C 3VDBA 3BWUC 4Z6AT 3FB7A 2EZ0D 2W9DH 4QXGH 1QRNB 3BO8B 5I74C 1GH7A 1S7RB 5HHQB 3D39D 3A6BH 4YR6B 3MCLH 5EUOF 1NDMA 2V2XB 5DD1H 3ES6B 2Y72A 2KQNA 2RFXA 3D87B 4E41D 2E3VA 1Q0YL 3U36B 2GJ6E 5E2UH 1NLDH 3KXFB 2X4TB 3QG6A 5ETUA 1JI1A 4BFBD 1TPXC 1PSKL 1R3IH 5IB1A 3VXOB 4DGVH 1KULA 5JQ6H 2X4RB 5BRZB 1R5VB 2HFGL 3VXUB 4LNRB 2P7TA 4KJWC 1EHLL 4Z9KB 4KUZL 1MH5A 3NMEA 3REWB 1CGSL 1C12B 5AZ2L 5GZND 1ZSDB 4TNVF 1NEZG 2XG4A 4NNPL 3TN0B 3C6SA 5L88L 1VKXB 1QZ1A 2A74A 1CDCA 3LY6A 4KMLB 4LLVA 2BXYA 5E2TH 4FXGA 3UJJH 2I60L 5F1SA 3I6LD 4XC1L 3SDCC 1ZS8B 3HCVB 4FRWA 5FYLH 1QRNA 2GW5A 3U7AA 3WE6B 5JA8B 4GRMB 3U30C 2V2XA 2DWEB 4APQC 1DJSA 1T4KB 5K9QI 1MPAH 3PGFH 2AJYH 4YDVB 1X5HA 5DD3H 3U36A 1G9MH 3KXFA 5F3HB 3EFDL 4I0PA 3VXOA 5CD3A 4F2MB 3DX7B 2X4RA 3QUZA 1E0OB 2VLRE 5BRZA 4UT6H 4JN1L 2YPVL 1GL4B 1H3GA 3MV7D 2Z35A 4EXPX 3OKDA 2BY2A 2FCBA 1KCVL 4O2FB 2V5RA 3REWA 5HHOA 1C12A 1TJGL 2C1PB 1ZSDA 5T3XE 1A0QL 1CE1L 3MLVL 1V3KA 2N4IA 2ILLA 3D85D 5LAXB 4XCCL 5SWZB 2B0SH 3HG1B 3VXQB 5TQ0H 5KS9F 1XGUB 5KW9L 1CZ8L 1D5IH 1S7WA 2DLFH 4PJ7B 2LTQB 1IAMA 3C5ZD 3DO3A 3WE6A 2JJUA 5CP7B 2IADA 3HB3C 3BMWA 4YBQC 2ZZUT 2Q7YB 4YHPB 2YRPA 1XCQA 4YDKH 3VRJA 1KPUA 2PCPA 1HHIA 3RWHB 5DVNA 5M94B 35C8L 4PRPE 4PLKC 4TPRL 1BQHA 5C2BL 1NDGA 1OF2A 4OGAC 5IHZA 4FN0A 5EFIB 4JCLA 4PJXF 5I66A 3VCLB 1TJHL 5FKAB 3HFML 3JUZA 3FKUS 3PQYD 2VDLH 2XIDA 1L4IA 3IDXH 4QXTB 4O2FA 2ERJC 3MA7B 5ACZB 4ZFGH 3B9AA 1RURL 3ZE1E 4OLYL 2C1PA 2IBZX 3BJ91 3STBA 4LBEB 1U92B 5BMFH 4I2XB 5EU4A 1E6OL 2Q20A 3FT3A 2O93L 1CFTB 4N0UB 4Z7NE 5E6ID 5LAXA 4YE4H 1GGBL 4I4WB 3QZWG 2G60L 1XGUA 5C07E 5CEZE 1U8MB 1YNKH 3SKJH 4PJ7A 4U1KB 5CGYD 1VACA 4F57L 1P9MA 2VXSH 1YEDB 1IC1A 5D1XD 2E27L 4GBXB 2VNCA 5C8JB 1VCAA 5HHMD 2PTUA 2Q7YA 3ULUE 3GK8L 4EN3B 5JIPA 2HLAB 2NX5E 4YQXL 5FV2A 4PJ5E 5I1KH 5IQ7H 5SWQB 2VLME 2VR9A 3EOAB 4S1DC 4PGCA 5FB8B 5J8OA 1WTGT 2AJUL 1W0WB 4Z7UF 3HNTH 3MCKA 1CDBA 3HUJA 5I1GL 1IZKA 1AD9B 1KPRA 5A40E 3RTQC 1G6RH 3MA7A 4NCC2 5ACZA 4NKIH 3FOLB 3VXRB 5JDSA 5DS8B 2XWJB 5C3LD 4PJ9D 2I9LB 3BKCH 3LHPL 4I2XA 3AY4C 4HS3A 4PRIB 4UV4H 3HE6B 2ADGA 3HE7B 1CFTA 4DCQB 4FQCH 4XRCB 3MRFB 4I4WA 4L8SC 3SO5A 3GSOB 3QIUD 3U79A 5FEBA 1J86A 1U8MA 2J8UE 4ONFH 3QO0A 4U1KA 1EERB 3GSNL 3CSBA 2HVKA 4PRHB 2WLZA 1HCVA 5C0AD 3KVQA 3V0VA 5IW1B 3U1SH 3VH8A 1JPTH 5C8JA 4HEME 1NAKH 1A21A 2ZJSL 2VIRB 4TUKH 3TWCL 5SWQA 1JGLH 2VDKH 5CIPH 2VAJA 1LDPL 2OI9B 4R3SB 3MUGB 3ROLB 2VO5A 5C0FB 1SBBA 4QTHB 5TE4H 4FQXB 4X0KB 5F1OB 1A64A 4G42B 5GS3A 3O6FD 4P5TA 2LQRA 1LMKA 4C56A 3EO9H 1MFAH 1K3ZA 4Y5VC 3VFOB 1QSFA 3MMEA 5ALBL 1AD9A 1JFQH 3KLDA 4MXWH 5FOBA 3QNYA 3MRGB 2DWDA 5IVXE 1NEUA 5KVFH 2EDHA 1KEMH 3FOLA 4TVSa 5EOCH 3VXRA 3FB6B 3HMXA 4XCFL 3OKEB 4ZNCD 2FX9H 2XWJA 5CP3H 5I1JL 2XTLA 2A73A 3D9AL 3SOBH 2I9LA 3PWPE 3NBNA 4PRIA 3HE6A 1CD0A 3T3MF 1U8JB 3SN6N 3O8XA 1LWRA 4U2ZA 4DCQA 2D7MA 4XRCA 3MLSL 5C0EB 2BVOB 3TVMC 3O3BA 1KF9B 4IOFC 2MPAH 1J8HA 5EU3B 3FN0L 2WUCL 5IFHL 3GNML 1T7ZA 1A14L 2F58H 5IW1A 5FAAA 4NZRL 3LV3B 3JVGA 4OIBA 1I3GH 4OLVH 2JJSC 1U8IB 5L8JB 4B5EA 3NIGF 1I7RB 1ZLWH 1IGFH 4BKLB 5BQ7B 5BVPL 2ICWB 4D8PB 3HNVH 3IDYC 3NPSB 4R26H 1J0KA 4QTHA 3SE8L 5I17B 2V6HA 3GGWB 5HVHB 3VFOA 5T33H 4X80H 1BJ1J 1DP0A 1KIPB 1A7QL 3BQUD 1GCFA 1P2CB 3O6KL 3MRGA 1LO5B 2IFGA 5HVFB 2VXTL 3FB6A 4D2NA 2DM4A 1YEEL 3LRGA 1BZ9B 2QKIA 5BS0D 4QHLB 4EUPB 4FZEL 4D94A 4JO1H 4HXBH 5FO7B 4Y4HD 1GPOH 1ZANH 4I77H 5CSZA 5C0EA 1T3FB 2BVOA 4POZC 3MCG1 3OKOA 2ZOKB 4BH8B 1DBAL 4HKXB 4M9OA 1K8IB 1OB1B 5J1SC 1NC2D 4IOIB 2EIEA 2AQ1A 5JIKA 5MEQB 2ZOLB 1CGXA 1KXTB 5KVGL 3RL2A 3QUMH 3UYRL 5FKPB 4F58L 4LRIC 1FGVL 1U8IA 2W91A 3MV8B 1I7RA 2Y6SC 2EDWA 1QLEH 4HBCL 4BKLA 5BQ7A 4LLWB 1F6LL 2F19L 3JUYA 2OP4L 1R24A 2DQUH 4M61A 4BFIB 2GAZB 1P2CA 4WUUB 5EU6D 3QHFL 3BP6B 3OGCB 4NQVB 4QRQA 3RZCC 4PGEA 1JPSL 4HWBH 4QRPE 4WI5A 1M6OB 5KAQF 3ULVC 1BZ9A 2XRAL 5IEKB 4EUPA 2VC2H 4K7PH 4L4TE 5EC2A 5IHLB 4Y2DB 3RFZC 4MXQC 2QADB 1ERNA 2ZCHL 4H20H 4DKFL 1SY6L 1DSFL 5JPMB 1A6PA 2BVPA 3X3GH 2ZOKA 4HKXA 3KYNA 5GRVK 1SJXA 2VITA 4PJAE 3LKOB 1NLBL 3WIFA 5MEQA 5IMMA 2CUIA 3GHEH 2G2RB 2ZNWA 5GS0D 1LO3H 3PGDB 1VSCA 3JV4A 2R29H 5FKPA 4JAMB 3G08B 2OZ4L 3VFTB 4R8WL 2ZPKH 1HSAB 5I6XC 1HSBA 1S9WA 3L6FA 4NKDA 2APTA 3V0AC 1FO0L 4ZUUA 1MFDL 2XTJD 3KPPB 5FF6B 1U8KA 4PLNC 4W70A 4U0QB 3WN5A 1MAMH 5TDNA 2GAZA 4EQ2A 5HSFA 2I24N 1I7TA 4M93C 2ORBH 4WUUA 5GGRY 3OGCA 3QIBC 3TZVD 1M6OA 1Z2KA 3O9WB 4YK4C 5IB3B 4E42B 5IEKA 4GKOA 3X14A 4XVTL 4GLRI 1O0VA 1FDLL 1PZ5B 1MCCA 1TXKA 3H42L 2X1QA 3FT4B 5DVMA 1H3TA 2QHLA 3KJ6L 1CTOA 4Z0XA 5JPMA 5JXEC 3TIEB 3BZDA 3MRPA 1F3RB 1W2KT 1F58L 4GJTB 1JZ8A 1JYWA 5SWSB 3L3HB 3LKPA 5JO5B 3KYMB 4NQCB 1KFAH 1A6TB 1QLRB 4K8RC 1Z9SA 3PHQA 3LQAL 1CLCA 1NBZB 4DZBB 1YEIL 2GJ6D 3G08A 1ZT4B 2E7LC 4OKDA 3VFTA 1HSAA 2UVEA 5LCVH 4I9WE 3B2VL 4URTB 3ZL4H 5MEPB 4KKBD 1EGJH 3BGAA 2BXZA 3MRQA 4HBQA 4Y16B 3ULVH 3GI8H 3OPZH 2LE9A 2C4FU 2IH1B 4EEEA 5HBBA 5FA4B 3D25A 1T1YB 2C7UA 3MRKB 3S36H 3TM6A 4BQ6A 4A2MA 2F5AL 4P2OA 3B4NA 4KMTH 4HWNA 2R2BB 1RFDH 2P8MB 4Z7WA 1PZ5A 3O11B 5GXBB 2BX5A 3QDGB 4NP4H 5I18H 1JNLH 1I8IB 5JW4N 1D7FA 4PUBL 4X6DB 2PO6D 2R1WB 1KACB 3U4EB 1WWWX 2ADIB 5B8CC 5SWSA 2EDDA 4UAOC 4RFEB 5E2VH 3S5LB 1A6TA 4P9MH 1QLRA 1UB5B 2GTWB 4WEUD 3VFSB 5JUEL 3MRHB 1VFAA 5I1CH 15C8H 4QRUB 4KRMB 3EGSB 4NGHL 2V5TA 4GKNA 3MBEC 3ZYIA 3KPLB 4OM1H 5ITBL 5KG9B 2BDNH 1WBZA 5MEPA 3D48R 3TPUB 3BPLB 3PL6D 1K8DB 2HH0L 5TE6H 3TJHD 1S8DB 4Y16A 4IRJD 1AQKL 1E27A 1U8OB 4ALAH 3RVWC 5FA4A 1N5AB 1ZV5A 3ZDZE 1GGIL 1MREL 1JP5A 2N7BA 2MCPL 2OL3A 3HPJA 2H3NB 2R2BA 5DZOA 5JOPE 1EZVX 2APWA 4YHKH 3IJHA 3VFRB 2VDNH 2GHWB 5T3ZL 1YYML 1AO7B 3BZ4A 4ODXA 5D93C 3S34H 1I8IA 3U9PH 5TFSH 4NM8L 1XMWA 3FQRA 3ZSSA 4KUCD 3FL7A 4K8RH 2ADIA 3BP5B 4OBRA 4PLJC 3FO9B 1DL7H 3ZTJG 2VZVA 4M3JA 4P2YA 1IJ9A 3S5LA 2LABA 5DJ6B 3H9ZA 5K9KA 2GTWA 1P1ZB 5EO0B 4W81A 3ZE1F 5L2KA 3FO0H 4JZJA 4P3CL 3HNSH 4OZIE 2Z8SA 1S7TA 5J3HC 5HI5D 2YOCA 3MRHA 3LIZL 4D9QE 4PRPD 1GZPA 4YHIB 3MLWL 1T5WB 1URLA 4Z7NF 1AHWC 3MLTB 3L5WB 4LSPH 1FSKC 4A6YA 4HCRH 4KJQC 5BV7C 2IEPA 1YA5A 5C0RH 4QOKE 1H5BA 3B9KD 1G7LB 1S8DA 3T0EC 2RHEA 1R3LB 1ZT1B 1U8OA 1A6AA 1N5AA 2D9QB 3ARFA 3P4NA 4Q9CA 1X4YA 1TTUA 5I73C 4X6CB 3ULUF 1KOAA 2B39A 1A7OL 2GSIB 2VZ1A 2H3NA 2J88L 5DVOA 4F7CA 4Y4KD 5GGQL 3ZKND 5EO1B 4NC2B 2BVEA 3CXDL 1OCWL 1AO7A 1FZMB 1I3RB 2XV6B 4JFOB 4MVBD 5CEZD 2DF3A 4TN9A 1XF3A 4YBLB 3EHBC 4LVOC 5JLZB 1JWSA 4WFFE 4LMQI 2FSEB 4G5ZH 3VGFA 3MUY1 4AM0A 5D7JC 4NQDE 5EO0A 3O4LE 2AK4E 3QULB 4PJ5D 5DWUH 1MLBB 1G9NL 5L6YH 2VSCA 3F7QA 1MHPH 2P5EE 1QSEA 4Y2OA 3KPSB 3MLTA 4XI5C 2V7NA 3K2MC 1OAYH 4UDUB 1T21B 2J8UF 5D1ZB 5ESAA 4XGZB 4YAQB 1CG9A 1U3HB 5GJTH 1G7LA 2VDOL 3MLXH 3VWJD 4XMPH 1XGYH 4HWEL 2EDBA 1YMMB 5D2NE 4X6CA 4DQOH 3P77B 1BFTA 4PJ8A 2AV7B 4MXVE 1KIQA 3NACH 4CVXB 2RQ8A 1P4IL 4Y5YB 1AGCB 4CU6A 1G7QB 1FZMA 1I3RA 3H9SE 4LVNC 4P2RB 5E9DD 2H2PC 3N1GC 2F9BT 2DMBA 3SY0B 4WDIB 1F42A 5DUBA 1R0AH 5JLZA 2FSEA 4PP1C 1TPXB 3CFDA 1MVFA 3LS5L 4PV8B 5EUKB 5IVXF 4JHAL 4M62H 1SJVA 1TMCB 4XPAL 1A9BB 4JQVA 1DBJL 5FDWB 5JZ7C 1MCBA 4X8XA 1U9KA 4JRXD 2ZUXA 4LVHC 2RGSA 4KJPC 4M5ZL 5BV7H 4Y1AB 3EDKA 3ZE0E 3DYPA 3OKYA 2F8XC 4FFVC 2MKWA 3S9DB 2FECI 1HOCA 3CLFL 2EH8H 3IS0X 1FYTA 4V1DB 4ZUTB 5C0BA 3TYGL 3IDUA 1T21A 3OKKB 1WZMA 1WBXB 3JWDC 4WFEE 5ICXA 4N90E 3GM0A 4LPUA 2HAZA 4XAWH 4LPWA 4LEXL 5F7EL 1Q94B 3PIQA 4GW5B 3SQOH 5MP6L 2F53D 2XN9A 1I1CA 3R06B 4MNQE 6FABL 4OQTH 4WW2A 4WO4D 1YMMA 3SDCB 1SMAA 3MRIB 3OAUH 4I5BA 1HZHL 1NBQA 3MLPA 1MUJB 4CVXA 4ORZC 6CGTA 1LP9E 3U30B 2N1KA 1INDL 1AGCA 2HG5B 4HLJA 1G7QA 3NTCH 4G9FB 5EZIH 4DVRL 4YNYB 4F9LC 3NABH 1D5BB 1I1AC 3LB6C 1ZHNB 4Q7DA 3U0PB 1RSFA 3T08A 1OTSC 4WDIA 4ZOBA 1KNOA 2R23B 1UXWA 4FZ8L 1CU4L 2HRPL 1RZ8B 1EO8H 1IGYA 3MRJB 4X99B 1A9BA 1GAFL 2CPCA 4HJ0C 1QVOB 2YPLB 1YEJH 5DI8B 2EIDA 2YD3A 1MIEH 2J8OA 3MJ7A 1CXFA 3WIHH 1JVKA 1A6UH 2C3VB 4IRZH 3AU1A 4L29B 4Y1AA 1VPOH 3BKYH 4MLIA 3VXMA 2OSLB 1RPQA 4LCCA 2EDJA 1GZQA 2ITDB 1OGAB 3SDXE 4ZUTA 2BY3A 2EZ0C 2DYPB 4ERSL 1YUHB 3KPQB 1NUFA 1WBXA 1G6RB 4HUMB 4OCWL 2VLKB 2YA2A 4JM4H 5IM7A 4GW5A 5LBSH 5A1AA 5GSRB 3R06A 3TBWB 2DQEH 1EHNA 2Z8WC 3Q5OA 4OGXH 5HYQA 1Q72L 4HSQA 1DN2A 2C3GA 3VE0A 1EBPA 4OAWA 3FHAA 3MRIA 1J11A 1L6XA 4X7DC 5DT1H 1SVCP 4X8JB 1MUJA 1FNGA 1PKQE 4GRLC 2HG5A 4APQA 2ZUYA 4YNYA 3U0PA 1KB5A 1JMZA 1LD9B 2ENYA 1IBGH 1DVFA 2YK1L 3BH8B 3W9DB 2PYEE 4KGLA 1RZ8A 2R0ZH 5CIPB 4C83B 4RWHA 3GMLB 1QVOA 3DROB 1A7BA 1FVEA 2C3VA 3X12A 1S7VB 4L29A 2NY3D 3JWDH 4FQQB 2ERJB 2OSLA 2D7TH 1Z9MA 3CGTA 4YDIH 4G7VH 1UZ8B 4XPGH 3WHXB 4LDLB 3AXLA 1OGAA 3I6KB 2DYPA 4MJ5B 2MJWA 1YUHA 2AJVH 1G6RA 5HPOA 3WNOA 1XR8A 4PJAF 1DANU 2H32H 1QQDA 2VLKA 4HPYH 3WMSA 3IDIB 3NVQA 2XZQL 3IU3A 1JNNH 5BJTB 1Q9LB 5GSRA 2FGWL 3TBWA 3MACL 5IMOA 2Z9TA 3EZ8A 4NCDA 4MX7A 1OAZH 4QXUH 1NANI 3QUKB 2UY7A 2CLRB 4PS4L 4L4VB 4P48A 2GT9B 4EI5D 3F58L 3MJ9H 5C2UB 3KJ4C 1F90H 5AD0A 1P84J 3QPXH 1MCOH 4RFNC 4LCWB 3V9FA 5EOTB 1YDPA 4Z0BH 1T0NB 3UTTA 4FQIH 1BBJB 3VXNB 2QQKL 4GAJL 3VGEA 3BH8A 5HD8C 3FO2A 5DVKA 5JHDB 3W9DA 5DMIH 1WCBA 5F3BA 1ZLVH 2Z93A 5CIPA 3W5MA 4LLMB 1J8KA 3DUUB 5EIIB 5JIHA 1UJ3C 3B8SA 3STLB 3U6RA 1PLGH 4M8QB 1S7VA 5EOCJ 3GBLA 4QWWC 5IT2L 2D7NA 4UT7H 1FNSL 3WHXA 2WBJA 3EBAA 1IC7H 2C3HA 3UZEA 4MJ5A 2W65A 4HGWA 5E08H 2AKRB 4KROD 2AW2A 1MFCH 3O0RH 4XPFL 4Y4FD 5EU7C 3TBVA 3ARZA 4MJ2A 5E2WL 1MRCL 4M1GH 4UINL 4YHLH 4KXZI 2GT9A 3CFCL 1AXTH 1G0XA 2D4FA 3G5VA 5HHVH 3WKNA 3VD9A 4R0LA 4U6HB 4AEIH 4OD1L 3KPMA 2R1XB 4HZLB 3RKDD 1HYSD 3DI2B 3SGKC 3PJSB 1U2CA 3VD5A 1RZ7L 4RGOH 4MA8L 5JXAH 1T0NA 1CXLA 3VXNA 4YFEA 3PP3H 3KAAA 1IVLA 1KLFA 1YEKL 4MQSB 4NO3A 5JHDA 1J1XH 5AYQA 3OF6D 3M1BB 5IBUB 5F9OL 2XY2A 4QHUB 4YXHL 1NAMH 3MGTB 4X4ME 1AKJB 5I1DA 4PB0H 4KGJA 3H7BB 1YYLH 4J7RA 4Y5VB 5DGRA 4FQPA 1X5KA 3KR3L 4P99A 3HPLB 3RWDB 3SKNB 1RJLB 1XGRA 2AS5M 5EIIA 4L3CA 5E6IC 5D7IB 4CKVX 4F3FB 3QA3B 1RZKC 4M8QA 5L8LB 1QR1A 1II4E 2FYYA 1MI5B 3RTQA 4IRSC 4JPIA 5I1EH 1ND0A 2AXFB 3TH3T 3JWOL 4BM7A 1A3RH 5CGYC 5F7UA 1CGVA 2VL5A 1Q0XL 2DD8H 1NMBL 3RWIB 4XP4H 3AY4A 1HI6B 4F8QA 5D1XC 4JY6B 3FQWA 3N85H 2AKRA 3PP4L 3RY4A 2DDQL 1DN0B 4M3KB 3TP4A 3TVMB 4L8SA 5B4MC 2A9NL 2I07A 5ANMB 1TVDA 3DXAE 3PV7A 3KPNB 5GRUL 4JR9H 1IAII 1XF1A 2OJZL 4QRTB 3KPRE 3PV6B 4H0HB 4HJGA 3TH4T 2WK2A 3RVUD 2P5WB 3I84A 2R1XA 3TEUA 4YHNB 3LEVL 3R0NA 3PJSA 5D1QD 4HJJL 4NJAH 4LU5L 2ESVD 1KB9K 1VADB 4DKAA 3GMMA 3WUWG 2DL9A 5CKAA 3QUMA 1H3WM 1IKNC 4P4RA 4JO4H 3M1BA 3IDYB 3ZDZF 3HI6H 4QHUA 4HULB 5DUPL 3G5XB 5LGJB 2UY6A 3RWDA 4Y5VA 3SKNA 3HPLA 3KS0H 1RJLA 2HJKB 5D7IA 1B2WL 3QNZB 4JFZL 4F3FA 5EPMB 1YY8B 3VFMB 5GQBA 5JR1H 1RZFL 5F7DB 2IBGA 1AR1D 2IBZY 4J3VA 2DQHH 5I1HL 1MJUH 4OLWL 1JF1A 2ATPB 4HWBA 5FM5O 3IDJA 4ZUVA 5C08E 4PIRF 1V5JA 4NO0A 4OZIF 5ANMA 2UWEB 3FN9A 5IFAH 4XH2B 1BD2B 2YN5A 3FCTB 4PJFA 2XPGB 5MENE 4JPKH 1S7SB 5IFJB 1X4XA 3RUGA 3AS3A 2ZUSA 3O6FC 2FX7L 4YHNA 4JJ5B 4OZGE 1K5NB 2JJSA 5T1LB 3MJ8B 3SBWC 3ZT7A 3RVXD 4HGMA 1NEZA 3V6OE 2VDQL 1B0RB 1PDKA 43C9A 4OZFG 4Y8AA 1V7ML 3CMOH 1YEGH 1YNTA 4N5EC 5DSCB 1KJ2A 4ZXBD 3G5XA 1M05B 4D9QD 1UYWH 2DKMA 4NBZB 1A6ZA 2FHFA 5CWSA 2HJKA 1AGBA 2BSRB 4LIQH 2IH3B 2NXYD 1U8LA 5DQDL 1MF2L 1IAIH 1S78D 3HI5L 3DECA 3RGVA 5FGBC 3W82A 3VFNA 3MLUH 3DX6A 1TTGA 2PYFA 1C7TA 5I16A 4TUJA 5J11C 5H8DA 2Y7QA 5I0DA 4XH2A 2IPTL 4JB9H 5CINH 4NT6B 2ZP0T 3LS4L 4XVSH 2RBLA 1JHTB 5D6CB 4XVJL 1Q9KB 4JFEE 3GSWB 3KXFD 4JDVA 4XP1L 3UC0L 4M6OH 1WEJL 4UTBH 3MA9H 5GJSL 1RK1B 1QOKA 4LRIA 1K5NA 3DVGB 1N3NA 1JYNA 3N50A 2R0LH 2XZZA 3BQUC 3MJ8A 5DR5L 4WFFD 3VXUD 2H1PL 5DJYA 1B0RA 3ABZA 4GAGL 5I30L 3SQBA 2YKLH 1U8PB 2YA1A 5DSCA 4ZG1A 1UWGH 1SBSL 4ELMB 3V4UL 1YPZE 2XQBL 1EFXB 4D0DA 4H26B 2K3TA 3TA3B 1M05A 1TNMA 4MXVF 4AMKH 5CLTA 4TSCH 5FK9A 3TN0D 2DJSA 2IH3A 5HYJA 4JKWA 2EDOA 4JN2B 1S9YA 5CKGA 5DK2A 1CLOL 4RFOL 1NSNL 4IBLT 3RZCA 1B4JL 3QIBB 5C0CB 1WUNT 3G04A 4YK4B 3X3FH 3IRPX 1NCWH 2DJ4A 4LFHG 4XNYL 2YZ8A 4JZOA 3GRWA 2CXKA 5HJ3B 4OD3H 2VDPL 4HC1H 1E4KA 1MWAA 1FH5L 1Q9KA 1QPXA 3ZE0F 5L9DL 5EOQH 3GSWA 1R3HB 3GB7A 1X5GA 2CKBH 1RK1A 2VLJA 4LCUB 4JVUA 4XBGB 1L7IL 3TCLB 5D72H 2FD6H 4HIXL 3G5ZA 3QQ9C 1LO4L 1KCRL 1KLUB 2V2WB 4QLRA 2ZUQB 1FL3A 1U8PA 2DLTA 4ELMA 3QZWA 5DFVD 1T89C 1NUDA 2IFFH 4PBVC 5FM5M 3WD5L 1RIHH 5GGSA 3K74B 1LP9F 2CLZA 4JN2A 5LVEA 4HXAH 4BSVB 1D3CA 3QIBA 4OCYH 1OD7A 4NRZB 5SWZD 5IR1A 1E6JL 4WFED 3HG1D 3FFCE 4YGVA 1ONQB 3DX9B 3S98A 3VGBA 5GS0C 1YN7B 2XWTB 4F7PB 2VQ1B 2A6JB 4Q9RH 4WHTB 1S5IL 5JXEA 1MEXH 4TOYL 3KNBB 3SE3A 4HK3J 1UA6H 4PR5B 5B8CB 5JW4M 5C92A 5IBLC 4KDVA 4RGNC 4UAOB 1TZIB 4MS8D 1R3HA 1FIGL 3KGRA 3L3DB 1CWVA 3SDXF 4UQ3A 5T3ZE 5FUZH 2W0LA 1JNHA 3KLHD 3TCLA 4UOW1 4K7PX 1EJOL 1FC2D 1MRDH 3QCUH 4PJGB 1OAUL 3PXJA 3NA9H 1GRWA 3FAWA 3TZVC 2VN7A 3VA2C 4NUJB 3F12B 4FOMA 2LAAA 1WITA 2BSED 3PUCA 1AGFA 5J89A 5IMLB 3WV0A 1HILA 4HCRA 4V2BA 5CJXC 4KRLB 4IIQC 5KSBB 1JL8A 1LE5B 3QRGH 4NRZA 4QYOA 4EVNB 4L3EB 2MSPA 2VISB 1AY1L 3AMKA 4M5YL 1YN7A 1BF2A 5J4MA 1S7UA 4DTGL 2CUMA 4IEFB 4Z7VE 1P7QA 4GBXD 4WHTA 5F6IB 3QJFA 5TF1H 5DMKA 1OD9A 3GI9H 3KNBA 4W6YB 5B8CA 1ITCA 1DUZB 4EN3D 5IBTH 1YMHB 4MA3B 3MODH 2SEBA 1TZIA 3WKMH 1JE6A 4KKBC 1IKFL 3GIVA 1L7TL 5C0GA 1I1RA 1JGDA 3U2SA 4J6RH 3BH9B 5AG9A 3D3VE 4NIKB 3ARED 3WLBB 1HXMA 2UZIH 4JG0H 5E4EC 4PGDA 5I1LB 3MBEA 4NUJA 3F12A 1J0JA 1FSKB 2D0HA 1I9JL 4K23H 1LILA 2WBWB 4K3EL 4XNMB 4Z5RA 5BV7B 2Z0BA 3VXRD 1XGTB 4NN7C 5HGBB 4KKLC 3VD3A 2P8PA 3T0EB 2X4UA 2BNRE 3DYOA 5IMLA 2J4WL 5TGBA 3RNKA 5F7YC 3HE7D 1SEBB 2X89D 5GS0H 5DZLA 5I73B 1ZOXA 5C0NC 2YMXL 4M00A 2FL5B 4OGYH 4MAYA 3CX5J 4XB7A 1I8LA 5GGUB 4ODSL 4HKJB 4PRHD 4U1NA 4WRLA 5C9KA 4JVWA 1ZHKB 4LVOB 2IAMC 4PP2B 4HDIA 1T83C 2R4RL 2X1XR 4H25B 3UZVB 5D7JB 3S36X 4BSJA 5DJ2B 1FG9C 5BZWA 3S7GA 2XA3A 3TJHC 3BH9A 5GGTA 4EBQL 4FQXD 3H3KA 1NL0L 3CH1B 3OJVC 3R8BB 1S9VB 1IAKA 2DI7A 1OARH 1I1FA 1YNLL 3BPNC 3LD8C 3WJLC 5I8CB 5JW3L 2X6MA 5I1LA 1AHWA 1WFNA 3BP4A 3F65A 5HGAB 4XNMA 1P6AB 4Q6IA 3MRRB 4AENB 3Q3GB 4F15C 5E1HB 3MOQA 3QP3A 1A6WL 5HGBA 4JO3L 5AAMA 2AJXL 4JFFB 1X9QA 5ISZE 4GG8B 3WSQL 3CVIL 3QPQC 4HFWA 2Q87A 5CSGA 3E8UL 2FECL 1SEBA 1QFUH 2NYYD 1CE6B 2FJHB 2DQTH 1OAQH 4HT1L 1PG7H 1H3VA 2CRMA 4U6VL 4OQTA 3U46A 3LPGA 2E7MA 2YPKB 1BX2B 2WLYA 4LVNB 1NCDH 3BUYA 4KQ4H 5HI5C 3BESR 2KBGA 1LQSR 1P5UA 3QDMB 2X10A 1DBKL 5CEYB 1FGNH 1ZHKA 4HUXA 3EYUL 2EICA 1FAIL 3UO1H 3NCJL 3CC5A 4OF8A 1X6NA 3SKOB 4AIZA 1P5VA 3WIIL 4H25A 5D7JA 2DJUA 3SJVA 4CJ1A 4LQFH 3B9KC 1FVDA 4PGBA 1PYWB 4LVHB 2G9HB 3CH1A 1BEYL 1S9VA 1KYOJ 1PJ9A 5ID0B 5EBLB 4K3DH 4XPBL 5AAWA 5BZDA 5HGAA 4HHAB 4ZSOA 4NZUL 3KPOB 5DRWA 2X42A 3UJTH 5CZKA 4Y4KC 2K7QA 3ZKNC 1YEHL 3CCHB 5BXFB 1KT2B 1JHKL 2NZIA 2FX8L 4MVBC 3RJQB 3MYJA 5CLWA 2H32B 4FG6D 1QD0A 3W39B 1AR2A 3BPOC 2D7OA 5A2LH 4PY8J 4HV8A 1SEQL 3MUHL 3RX5A 1EZVY 4DKEH 5F1NB 4LLYA 5C6PB 2FZ3A 2D03L 3V52H 4EI6B 2HJLB 3U48A 3L9RB 2FBJH 3IDNB 4LK4A 1PX3A 4Z8FH 4G6MH 3K0WA 3DXAD 4P2QE 8FABA 2MHAA 2R0WH 4ENED 1AD0B 3MV8D 4Q58C 3OB8A 2YHGA 4BFEA 2DICA 2ICES 3MZTA 3LZFL 3LEXB 3C8KA 1PYWA 1Z0NA 3QWOB 2G9HA 4YPJA 5T3XH 3QNXA 2EYRB 4RRPA 1T1XA 5IESH 1C1EH 4WWKC 1J0IA 4WUUD 3K2UL 5TDOA 1FHGA 3NIDE 3S4SG 4HHAA 5KSUA 4B50A 4MZ2A 4GXVH 1OT1A 1VERA 3DO7B 1CDHA 3CCHA 5DZNA 3RU8H 3OJDA 4XPTH 1ZXQA 3C5JA 5A16B 4U6XB 4Y2DD 3QYCA 1J1OH 3BEVA 4KI5E 1RUPL 1SYSA 2YRLA 4OZGF 4POYA 2A1WH 5DC0A 2VOTA 4DUVA 4RSVA 4M48H 2OL3L 4KPHH 3ARBC 4KTEL 5F1NA 1HNFA 4XCYB 4GRLB 1U6AH 1SJEA 3VFUA 4C58B 4K2UL 5C08D 3IDNA 1F8TH 4F9LA 1I1AA 3L5XH 2I25N 3BIKB 1BJMA 4OD2A 5EUOB 4U31A 4OTXL 4CMHB 3OKMA 2HT2D 2KPNA 1VB9A 1QFOA 1OW0C 3CJJA 5TH2A 1I9IL 5KVDH 4JKPH 1HH6A 3H2WA 3BRGC 4F7TA 4HLZG 4YEFA 4J2XA 3AS1A 1XF5A 1C16B 2YN3A 4LDOB 4YHOL 3DGGA 4EIGB 5IHBA 2EYRA 1NAMB 4P59L 4LAJH 4A6YL 2I9TB 3OJ2C 4XAKD 5DEZA 4UUJB 5CEZH 3D39A 3HC4H 4M7KH 3DO7A 1JF5A 3O9WD 3DUHA 1ROWA 4XP9H 4E41A 4BZ1L 2RCSL 5A16A 3N9GH 4U6XA 5DJAB 4PYGA 5DJCB 1LEKA 3T1WA 5INDB 3ULUH 4P3DB 2JLLA 3HR5A 4NYLB 5DF0A 5I8OL 2M26A 3ETBF 1KBGH 4L8BA 2C4XA 4NKOB 4DN3L 2ATKB 3KJ4B 4QXGL 2Q8AL 4AQ1B 3QEQB 4NQCD 4RFNB 1XT5A 4S1QL 3GFUA 3NCCB 1XFPA 4HF5H 4LPCA 1IILE 1YPZF 2GFBA 4HPOH 1IEBB 3HC3L 5DDHB 3F7PC 4MHHG 1YC8A 1CDGA 3IKKA 2G5RA 3NGBB 2JB5L 4DGYL 4OBSA 3DV4A 3QCVH 4S2SB 3T65B 5HVGB 3QCTH 4CN1A 3BD4A 3IJSB 4DAGL 5C6TH 4XWGH 3IFLL 1C16A 5I76B 5IGXL 3QEHB 4TNWF 3D85B 4JY4B 1QP1A 1UJ3B 1N64H 4FQ1H 3SDYL 4G6KH 1WFUA 4QHKI 4N0FB 4Y16D 1YY9C 3V6ZB 1MCFA 5IOPB 4DOHB 1NGWA 2BHYA 2H26B 3HMWH 2H2SD 5AYUL 2A9MH 4L8CB 5EB9A 1QFPA 1GOGA 1V3MA 4KDWA 1MFEH 5DJAA 3E0GA 3QDGD 1KN4L 5D7LB 4QTIH 4M6NH 5INDA 5FO8A 4P3DA 1IGMH 1NCAH 1X7QB 5CUSL 5E5UB 5KS9B 3QWQB 3MLZH 3P4MB 2FATH 3O2DH 3PQYB 1JGVL 5I8EA 5J1TC 2MOVA 3MV7A 2DL2A 1OHQA 3VG0H 1QHOA 3QQ3A 3RL1A 1XAUA 3DTXA 2NY3C 1A7NH 1FN4A 2RR3A 1QRNE 1H15B 1XGQA 5CMAB 5DRZB 5ESVB 1UC6A 5TPWL 1G9ML 3EYFB 3RX7A 3T65A 1HHHB 5T5FL 3KS0J 4Y7MA 2R1YA 3A67H 4GXUM 3KLAA 4MQ7B 2FB4L 3S96A 1HINL 3D85A 4JY4A 4PJXB 1RVFL 1UJ3A 3NH7L 2RB8A 1G7IA 1UQSB 5EWIH 2UV3A 4IRSB 2G5BB 3VD4A 3V6ZA 3KYAA 4UBDC 1EMTL 4HUKB 2BRQA 3C5ZA 1HIML 2NY1B 5FUOH 2J8HA 2CRYA 1SYVB 1WV7T 2H26A 5DXWA 1LEIB 3NFNA 1CL7H 2IF7A 4L8CA 2QBWA 5HHMB 4PBWD 1FZOA 4RWYH 3REVB 2O5XL 4TUOB 2OTUB 5E70A 1GIGL 3GSQB 1YEFH 5HHOE 3UPCA 1AC6A 5IIEB 4HUWA 1WFTA 3O2WH 3UTPD 5HYSB 3FFCD 1FRGH 3LVEA 5CSBA 4S1SL 1ZVYA 3PWLA 5KS9A 1OSPL 3J8F7 3P4MA 4YUEH 5FOJA 3SCMB 3PQYA 5HDQL 2HP4A 3SGKA 4XT1C 4ZODA 5ID1A 3ALPA 3DBXA 3MPCA 3IF1B 4PRNA 4LSDA 5KJRH 2VLLB 5HHXL 1H15A 5ESVA 5IB4A 3TNNA 3FMGH 4O58H 3DYMA 4MQ7A 5FGCE 3GSVB 3QXAA 2X9WA 4KROC 4PJXA 4DK3A 1T7VA 5E6IA 5IHUH 2Q8BL 4HH8A 3TIDB 4Z7UB 4Z7VF 1UM5H 1XH3A 2CO6B 4TSAH 1I7ZA 5L0QB 3WFCL 1OAXH 1AGDB 3FHQA 4G6FB 2F5BH 5D1XA 4GFTB 4KAQL 2BJMH 3PWJA 5BOPA 3P30L 3RKDC 1XGPA 1HYSC 2OTUA 2ITCB 1U3JA 4LSRH 4YGAB 4M9PA 5FYLD 5IIEA 3PNWB 1J5OL 1PG7W 3IYLW 4GSDH 4JDTL 1XR9B 3MGOA 1NH6A 2WP3O 3SKJL 2COQA 3HTLX 4X5WB 4H88L 5JPNB 1U0QA 3QHZL 3PABA 1F2QA 4D3CH 1KB5L 2A2QT 4I1NB 5B21A 1MNUL 4ONOA 4NQTA 3LDBC 2CKBB 3EZJB 2VXUL 3ZDYE 2QSCL 3RJDA 1PY9A 4XZUB 4PJ9A 4AEHH 3KPSD 1P4BL 2VDRL 3BFOA 1JWUA 3JV5A 3L3KA 5JW5A 3G6DL 1W8OA 5D1ZD 2C1OA 4C4KT 3T0BA 1U3HD 3HAEH 1FFPA 2BRRH 2VR4A 4Z7UA 5EG6C 3BRFA 1JPGB 3GMRB 5F1IB 3L7EB 4PTUB 5CJ5A 1DQJA 4MAUL 4YBHA 2Q76B 1FCCA 3O81A 1AGDA 3LSOB 3HN3A 1AI1L 4LSUL 3HUJE 4U1MB 5C0AA 1BLNB 1NPUA 3RVUC 4Y88A 1A7PL 3BXNA 2KUTA 2AXGB 4Y5XC 1P53A 2GEEA 4FP8H 3IU4L 5TDPA 1T03H 5D1QC 5J11B 2ITCA 1HHJA 4P2RD 4AEFA 4L1HA 4ODVH 4KK6D 1RUML 1OLLA 3BAEL 1BECA 5ILTL 5J06A 1FPTH 3DJ9A 1QA9A 5JPNA 1S7XA 5ALCL 3O6FA 2VAAB 2OCFD 1H3PH 4ZFFB 3BQUB 2FLRT 1CVRA 1GXEA 43CAA 2R4SH 3C8DA 3MV9E 4WNQB 5HGHB 5DJXB 4Q0XH 4I3SL 1AR1C 2CJUH 1DQML 1JGLL 2EO1A 3JV6A 1D5MA 2M2DA 4XZUA 3H3BC 4L1DA 4JE4B 3QFJB 4ZS7L 1LO2L 3ARYA 1INQB 3BN9C 4V1DD 4WENB 4WHDA 1KIRB 5TE7H 4E0RB 3HRPA 4M03A 4BYHA 1CXKA 2UZXB 4NM4L 1JI2A 1OLZA 4LPYA 1RU9L 4NQEB 2IGFH 3BD3A 1HQRA 5TE4L 1DLFL 1IGCL 2AK1H 1JPGA 3C87A 2YBRB 2HWZH 5F1IA 1JFQL 3VMPA 3L7EA 4RISH 7FABH 1IQWH 2Q76A 5GIRA 2I5YL 3LSOA 4C56E 3MV11 3SDCD 4U1MA 3BRDA 1BLNA 1QSFE 1N0XH 1BAFH 4R6UA 3BMVA 2AXGA 2ZUTA 3P0YH 1DQQB 3BKMH 4YEEA 2LVCA 4ZUWB 4G9FD 4ODHH 1SM3L 5E8NB 3KLSA 2PR4H 3EFFB 4F37F 2J6EH 5GRJH 5E03A 2JKXA 3UTOA 1ACYH 3VXSB 3OKNA 4ZXBC 3AM8A 1QEWA 4MB3A 2Y06L 4I3RL 4HX1B 4WHYG 2F58L 4U4BA 2WANA 4AH2A 4KY1L 1RMFL 3BQUA 1J8HE 1BF8A 3RNQB 1LEGB 1I3GL 2YPLD 3P2TA 3WO3B 5DEFA 4WNQA 5HGHA 5DJXA 1S78C 4R7NB 1INEL 4RMQA 4P2CG 5BS0A 1NBVH 1KIRA 2AEQH 4Y4HA 5ADPL 1ZHBB 1MHCA 4NJ9L 3K8KA 1U91B 4OLZL 2NTSP 4FQHA 2VTFA 5T33L 4JRYE 1G9EA 5E8EB 1K9TA 1U3YA 4U7MA 1NC2A 1ODAA 5LQBH 3P11H 3MBXH 5GGRB 1OM3L 2IANB 4KQ3H 2X4QB 2YWZA 4NZDA 4P9HC 5DC9B 3L7FA 2EDLA 1DQQA 3IFOA 2DQJH 3GEWB 1OGTB 4P23C 1AQDA 3MXVH 4WUKL 5JW4R 5E8NA 1M7IB 3ROOB 4F9PC 1R3JB 3EFFA 3CAFA 3S88H 3RVTC 4RGNB 2VXQH 3MQIA 4DKDC 2E7BA 1LNUA 1GYAA 4OGAD 1KELH 5DQ9B 2EXYC 1JHLH 2QL1A 3NIDF 1IL1B 1VFBB 3PXHA 4JREC 5DLML 5EU6A 1LEGA 1T6WA 3QUML 3HS0A 3VFGL 4MZ3A 4UQ2B 4MA7H 1WZ1L 4KVCH 3TZVB 3RIFK 1JGUH 4RZCA 4RBPK 2KZWA 4KI5F 3U9UB 5F7HA 5EBWA 5A2KH 2O5YH 5D6DC 5D7SH 4LCIH 4LSSL 1BWMA 2HYMA 1ZHBA 3EUUA 1NCNA 3CSGA 4PG2A 2BY1A 5CJOH 5D2NC 1BFOA 4IIQB 5E8EA 3HZVA 4LMQE 5C0IB 3LKQA 1Q9OB 4EUPG 4E5XA 4QCIB 5GGRA 4XBEH 2P24A 2Z8VC 4WI6A 1HE7A 5FYJL 4NQSA 3WUWB 4UILL 1X4ZA 4L4VD 1U93B 1KCSH 4NDMB 3RAJL 2GJ6B 1OGTA 2IBBA 2PTTB 4NKMB 5T1KB 1C5DA 4LCWD 3ROOA 1R3JA 1DFBL 3RWGB 4GO6B 4LKCA 1CK0H 1OT2A 3SDDC 4Q9QL 1E4WL 5DFVC 2C9AA 4C55A 1J10A 1ZVSB 3KWWA 1MHHA 4KWUA 1C5CL 5JMOC 4JG1H 1MCPL 4PD4J 2XFXB 1FE8H 5E4EB 4UQ2A 3NAAL 3OAZH 1ZA3B 3CFKA 3TZVA 1KJ2L 3ZT6A 3LRSA 3U9UA 2IG2H 1ZHLB 4FS0A 1G7HA 4NN7B 3SGDI 5KVEL 2H9GB 5L7XL 2DM7A 4F7MA 5CJXA 4KK5C 4QHNA 3PHOA 3E6FB 1IEHA 4P9HH 3FQTB 5L2JB 3T0AA 3O3UN 1LO0L 4MS8C 3IETB 1AGEA 4QRRE 5IKCB 3T4AB 2AP2A 3WUWA 1DR9A 5DHVH 2QQQA 1U93A 3KLHC 2GJ6A 1TLKA 1MVUB 1QBML 4QNPE 3R1GL 1Q0YH 2IAMB 4MA1C 2WBKA 2DQIL 2H8PB 2VLRB 4Q74A 2EIBA 2VXVL 1PSKH 3IGAB 2D7PA 1KFAL 3GSUB 1IC5L 3F6IA 4N5UA 4ELKA 3W0WE 3MUZ1 3RDTB 1AKJD 1RZGB 5T5NG 3LD8B 2XFXA 3BPNB 2HFGH 3G6JE 5F96L 3GBML 5IQ9A 1DCLA 1EHLH 2QHRL 1P6FA 3T1FB 1MI5D 4KUZH 3B43A 5FYJU 4F15B 5IK3B 1CGSH 3BYYA 5AZ2H 1BFVL 2GITB 5E8DL 1VEOA 4IS6A 3BGFC 5SX5H 2H9GA 2VWEC 3UTQB 1MCLA 4GBXC 4NNPH 3WFZA 3RI5K 2PO6A 1K2DA 3E6FA 1AE6L 3EYOA 5L88H 3L3IA 1T04B 3CFEA 1F11A 4G7YL 3TVMD 1BFSA 3B2UD 4IOFD 5A43C 1OY3B 5GRXG 2BVUA 2XKUA 2I60H 4XC1H 3VMNA 5IKCA 4FQLL 3LH2L 4OZFA 2OR9L 3GRWL 1KJMA 3AREC 4PRPB 2B1HH 2P5WD 1U8HB 3BSZH 1XEDA 1MWAL 2BNUB 4WW1B 4NWUL 1UZ6E 3MJ6A 1T83A 4HWZB 1QSVA 4Z7WE 4F33A 2VLRA 3MROB 3K1KC 2L7UA 3PL6A 5EIVA 3EFDH 1JTOA 2P1YA 3IGAA 3GSUA 3IKCB 5D8JL 5E8OB 2W60B 4K3HA 4IRJA 4K7PY 1DEDA 1TVBB 2UWEF 2NY5L 4JN1H 3HE7C 2YPVH 3HHRB 3VMOA 4WI9A 4X7CC 3WJLA 1UENA 3RWFA 3H3PL 1U95B 2E9BA 1H8SA 15C8L 4OI9A 2UYLB 1KCVH 2ZWLT 2E7CA 4J3TA 1KENL 5IK3A 4G9DB 3IB4A 2GITA 4Y4KB 1TJGH 4IOSD 2VL4A 2UUDK 1E28B 4I0KA 1A0QH 3UTQA 3JV0A 1CE1H 25C8L 3BDYL 5CZVL 5C07B 3CFIC 3MLVH 4RQQA 4JFDE 1T04A 1RZIB 4MB4A 2B7DT 5KN5B 3BPOB 4XCCH 4MNHB 3MTRA 5GPRA 2O26U 5KW9H 4ZQKA 3WEXB 1FNLA 1BD2D 1CZ8H 4ISVB 1CTNA 2ZSVB 1IC4L 2NX5B 2IALB 3MFFB 4PJ5B 4XPHL 2O61B 1ACZA 1P69B 4PRPA 4OGZA 3MZGB 3S5LG 5TFSL 5T1LD 1YJDL 4ZPTB 4I0CC 1NJ9B 2Y6SD 1NGZB 35C8H 4TPRH 5C2BH 4GMTL 3B9EA 1CLZH 3IAQA 3B9KA 1TJHH 4JCMA 1Z3GL 3IKCA 5E8OA 5B38B 3HFMH 4IDJL 3O3DB 1OP5H 3HZYB 3FO0L 4WWKB 1U95A 2WM0A 4WTZG 2BC4A 2NXZD 5IMKB 2FR4B 2R2EA 5L2KE 3BP7A 4WCYL 1RURH 4G9DA 3ULVD 5F6HI 2DQDL 4Y4KA 4OLYH 1R3KB 4GAYA 1X5YA 2AABL 4J4PD 2KKQA 1IAOB 2Z91B 4YHZL 2J8UB 2XWBB 2BSSB 4LKXB 4EKXA 5BW7C 1RZIA 2DLEA 1O7SA 1GGBH 4MD0A 2MQ3A 4D9RD 1NGPL 2G60H 1RZJC 3ARBB 3QXWA 4YWGL 4XBPB 4WGVB 4F57H 2X1PA 1TQBC 3MFFA 4PJ5A 4XNQB 5E1AB 5GRVL 2E27H 4NC0B 1QLFB 3L5HA 1ORSA 4BUHA 2DI9A 1KEGL 4RAVA 4XMLL 1AJ7L 4UIKL 3GK8H 3D69B 4YQXH 1NGZA 3RWJB 3LAFA 4DWHA 5ITFB 3HZMA 4NNYB 2AJUH 4G5ZL 1T66D 3CVHA 1WTLA 3LKNB 1G6VK 1ZTXL 4Y0GA 2R39A 5FYKL 3OTTA 3VWJA 1T80A 3HUJF 1EFXD 5IVXB 3TA3D 3HZKB 5I1GH 3TPKA 4WWKA 4MNGA 4FG6C 4N1HB 4XX1G 1S9XA 4LF3B 5IMKA 2FR4A 1MLCB 5J6GA 3U4BL 5C0CD 5LWYL 3L3GB 5FO9B 4MDJA 4HIIB 4XP6L 4J1UB 5F7FA 3LHPH 4AQOA 1IAOA 2JIXB 5E9DA 3AVEA 1QSEE 3RWCA 3WFEL 2BSSA 4RDQG 1GOHA 1Y6NR 4ENEC 3WFDL 1FNEA 4PJCA 3DVIA 4XBPA 3RGHA 3GSNH 5CJQL 4DQOL 2FO4B 3EYVB 3GDBA 4K8RD 4XNQA 5E1AA 4JRXA 1VGKB 4GKZA 4H1LH 4CN4A 4QXWA 2JJTC 3VJ6A 2ZJSH 3EOBB 3O2DA 3TWCH 2DOCA 4RCAA 1OW0A 3RWJA 1LDPH 3K46A 3FONA 2B2XL 1DQTA 3DETC 4MWFB 4XNUL 4TVPL 5GGTL 3AGVA 2ZG1A 5I0ZA 3BPCB 1B0GB 3MV9D 2FWOA 2A6DB 2Y36H 2Z31C 4RAHA 2F53A 2D0FA 2J1KA 4X5XB 1WICA 5ALBH 4MYWB 4WO4A 4XXDA 5MHSD 3AB0C 4R4BA 1FV1A 3ARDD 2W92A 4P5MA 1MLCA 3Q5YA 2IPKB 2GK0B 4RX4D 5FO9A 1FZKB 2XI9A 3EJJX 3F7YB 3UJIL 5I1JH 5J7CC 1NFDE 5EC1B 3D9AH 3EYQD 2QSTA 1OP9A 1BHGA 5CAYB 4MD4A 3QDJE 2YZ1A 1FYTE 4N0YL 5C0BE 3UPRA 3MLSH 5FECB 3D2UB 2BVQB 5J9PB 3KYOB 2WUCH 1KLGB 2XN9E 5FYKU 4HUVB 1ZLUK 5IFHH 3GNMH 3EOTL 4R7DA 4NZRH 4RMSA 3V6OC 2PNDA 2VRAA 1YMME 3NTCL 3EO1B 4Z95L 2NY3B 4KHTL 4ZOAA 1ETZB 3ARPA 5IROC 3EOBA 4EDXB 4R4FL 3OAYK 3CU1A 4PRAB 5KSAD 1J88A 5HDOA 3OX8B 4UTAL 2HN7A 5BVPH 2W0KA 4DW2L 2EYSA 3O9WC 3DVNB 4NZJA 5E00B 4MQTB 1B0GA 3SE8H 2A6DA 2BNQE 4R9HA 4CMMB 3RIAK 4QRPB 3B6SB 2MQCA 1A7QH 3O6KH 1VPOL 3C6LB 2V9RA 4L4TB 3O45B 3HAEB 2IPKA 2VXTH 1FZKA 1YEEH 2ARWA 3F7YA 4L3ED 3QDHA 2EE6A 4FZEH 3VXME 2W0FA 1VGEL 3IFNL 3EW3B 4PJAB 5KANG 3ZLQC 3WNMA 4WY7L 3QB7C 3MRLA 2BVQA 1TZHB 3BIAX 5J9PA 3WFBL 1DBAH 1PZUB 1BIIA 1RJYB 2WIIA 2DBJA 2VZTA 1KLGA 5DT1L 3ILPA 3V5DB 2FRGP 1T20B 4WHCA 1WZLA 2HVJB 5KVGH 3Q5TA 4LLUA 3UYRH 5ICZA 4F58H 5CCKL 1FGVH 5EORL 1X5ZA 4MJ6B 5CZXD 3P9LA 5GGVL 4X6FB 1W72A 4HBCH 3LQAC 4ZS6D 4FQJL 2F19H 2H2SC 5E00A 5T1MA 3I2CL 3EDFA 2PN5A 2JB6B 4KROB 3KDMA 4M4PA 4CMMA 2OP4H 2EDEA 2M8XA 32C2A 1GGYA 1FBIL 5DRNA 3T0ED 3PDOB 2B5IB 1U8NB 4PLOB 2Y07L 1HKLL 3O45A 1JK8B 2XT1B 2D7TL 1EEZB 3P73B 1QUNA 1CDJA 1M1SA 4K9EL 1JPSH 4EI5A 1GOFA 4J8RB 1I75A 2XRAH 4FXKA 5D7KD 3WJJA 4OZ4A 5KZCB 2BERA 1UEMA 4MD5B 4CNIB 4YH6A 2ZCHH 4DKFH 1SY6H 1DSFH 2CK0L 3ECBB 1TZHA 4KK9C 4ZFOA 4M4RA 1OAZL 5IB5B 3V5DA 1T20A 1W0VB 1NLBH 3RRQA 1FFOB 5DJ8B 5CBEA 3TO2B 1TNNA 5H37H 2FNBA 3ZHLA 1B9ZA 3LDBB 5J12C 4EZMA 5IJVA 2IQ9L 1RK0A 5EO9A 2OZ4H 4X4XB 4U1HA 4R8WH 3B9VA 4ONHA 1YQVL 4YHML 5K33A 5ESQA 4EXKA 3UTTE 1FO0H 5E5MA 3UDWC 1MFDH 4BJLA 1NCCL 1DBML 1CICC 4JFFD 4Y4FA 1U8NA 4YDJB 4G8GE 1PLGL 1UH2A 2JELL 1JK8A 4LARL 4G3YL 4QNPF 1EEZA 3SGJC 3M8OL 1IARB 4J8RA 5E8PB 2VMFA 4Y5XB 4XVTH 5D1QB 4ZO7A 5E08L 1FDLH 3DX8A 4MD5A 1MY5A 3H42H 4GUPA 4BQ8A 4GS7C 1ORQB 3KJ6H 2H2PD 3ECBA 2PXYD 3QDMD 1MY7A 4QRRD 2X1WL 3PWUA 3G6JF 1F58H 5GRZA 3TT3L 3IDMA 3K4DA 1RJZA 5IB5A 4M1GL 1W0VA 1FFOA 1X44A 5DJ8A 3TO2A 1TZGL 3F6LA 3KPTA 3LQAH 2ICEB 3NA4A 1YEIH 4WJ5B 4YXKL 5D71L 4KJPD 5GSVB 5CFHA 2E6QA 5DRXA 3ZSTA 4FFVD 4X6BA 1RUKH 1ZA6B 1K6QL 3W9EB 3B2VH 3W0WD 1NGQL 4R97C 3QQ4A 4KJYB 4ZO8A 2EEAA 4N8VB 3GMQA 3THML 1I7UA 1D6EB 2EXWC 1IM9B 3CSYA 4LLAA 4OFDA 4RMUA 2E8YA 1G0DA 1UZ6F 2F5AH 1A3RL 2AJZB 1P7HL 3QFDA 4OCRL 4Y5XA 2NZ9C 4Z7WF 5HVWA 4GT7A 5CHNB 5D1QA 4OSUL 2ESVA 2EYTA 1EHAA 4LDEB 3X17A 3OR6B 4PUBH 4ZFZB 4D9LL 3LB6D 3IXAB 5M95B 2Z4QA 4NPYB 1A4JA 2X4OA 5EBGA 5K9OB 1BVZA 4M43L 4X7TA 4ZXBB 4OZIB 4ODTL 1SVZA 3WS6C 3ARGC 2FHCA 5D1ZC 3FQXB 4HJ0D 2VZOA 4JFQB 4N9GB 4WJ5A 5IBUG 3RZWA 3S3PA 3GKWL 4TRPL 4QOKB 4G6JL 1GJIA 4L9LC 2NY4C 4YIQB 5H35B 4NGHH 1ZA6A 3U7YL 5ITBH 2YD8A 4O02L 2XY1A 3PWVB 2M1KA 3CZFA 4Y5YC 1QFWM 2HH0H 4N8VA 3RHWK 1AQKH 4KK6C 3VD7A 2CIKB 1V05A 5DD0L 3WDIA 5LGHL 2GUOB 1IM9A 1GGIH 2H6PB 3CFJB 4YX2L 5AG8A 5C9JB 1MREH 1U8QA 2GY7B 2MCPH 2FJFB 1P84K 4GRLD 4JFDD 4P23B 5T3ZH 1YYMH 5ELIA 1NCBL 5DHVB 4NM8H 4ZFZA 3NN8A 1F4AA 2EDTA 1L0QA 3DMMB 4ZXBA 2AK4B 5FYJE 5DYOB 1NMAL 1N0LA 4X7SL 1PX4A 5I1IL 4UNTA 1Z6JT 5ERWB 2P5EB 4JREB 4X4YB 4P3CH 4LSVL 5JIIA 1FJ1A 3LIZH 4PJFE 3TBSA 3MLWH 3RUGE 2X2YA 5H35A 2NW3B 1I3UA 5D70L 4U7KA 4OLUL 2FIKB 3VRIB 1J7VR 3BO8A 3SHSA 3PWVA 1O5DT 1RZKL 2B4CL 1S7RA 5HHQA 1RUAL 4YR6A 5DK0B 1JCKA 3ES6A 4QT5B 1MCWM 5D2NB 3WXVL 1W8NA 1EXUB 4P4KC 2X4SB 4PG9B 2GUOA 1MFBL 3CFJA 4NFBA 1N6UA 4OF6A 5C9JA 1CVSC 2X4TA 3H9SB 1A7OH 5DMGC 3DVFA 3H0TB 4OJFL 2J88H 3IFPB 1JUFB 5GGQH 1ZLWK 1R5VA 3QEQD 2C3XA 1OCWH 3BW9B 3CXDH 3VXUA 4E9LA 4LNRA 4F9PA 1OSZB 4LASL 4QKXB 5DHVA 2AGJL 3RA7L 1N5YL 1KJ3L 1G7JB 3SDDB 3SO3C 2CGRL 5HD8D 5C1MB 1ZAGA 5DVLA 5DYOA 2EEBA 3HI1B 5ERWA 3TN0A 4UTBL 1QBBA 4X4YA 5FM8A 1BREA 2E9IA 1VKXA 1YN6B 1G9NH 3U83A 4RIRB 2JF1A 3HKFA 3EDJA 4QWWD 4W4NA 3RWEB 1NC4B 1ZS8A 3HCVA 2W38A 3S8WA 5BOZG 3OBAA 4MNQB 4GRMA 1EVTC 1IGJB 2DWEA 1MCWW 5D2NA 2VDOH 4UDTB 1T4KA 3L3OB 4HIEB 1IM3B 3N0PB 1N59B 4B7LA 3EAKA 4YDVA 4HWEH 2EDYA 1LP9B 1JBJA 5D7LD 1VDGA 1EO7A 4NRYB 1PFCA 3S35L 5F3HA 1JV5B 3VW3L 2CO7B 2ED7A 5LJYH 1WIPA 2VZSA 5HYJE 3H0TA 4F2MA 3DX7A 3W2DL 3QSKB 1P4IH 1DZBA 2VYRE 3FRPG 5I9QC 3BW9A 4OLEA 4MA1B 1G7JA 4WFGD 1OPGL 4OV5B 1T5XB 4F8TA 2CQVA 1JJUA 4NNXB 3WO4C 3M45A 3LS5H 4JHAH 5ENWB 4XPAH 1K4DB 3IS1X 1CGUA 1KCUL 1DBJH 4R90L 3VG9B 4LPTA 1NFDF 1YN6A 4AY0A 3SDXB 3P9WB 1F4XL 5D72L 1F4WL 4M5ZH 1FVCB 5SWZA 4IRSD 3HG1A 3VXQA 5D9SB 2R0KL 4QRSB 2VLJE 5AWNL 1HH9B 4EJ1C 3H8NA 3CLFH 2X9XA 5D2LF 2HTKD 3TYGH 3UTSE 2NY1D 3BGFB 2CIIB 5CP7A 4LEXH 4HK3N 1EAPB 1RIHL 5F7EH 2VZUA 4HIEA 2JCCE 4ODWB 4YHPA 4WW2F 4BZ2L 1QYGL 1PKQB 3BHBB 4MB5A 5B4MD 3RWHA 5I8KL 6FABH 4LNVA 4OF5A 3V95A 3VFPB 1MCHA 1JV5A 5EFIA 3UBXI 1TTFA 3VCLA 1FL5B 1FIEA 1HZHH 3GJEB 4WU5B 5FKAA 3QDJD 3VRLF 3AREB 1INDH 3SCMD 3N1PC 1F13A 3QJHB 2PYEB 4CADB 2NMSA 3D6GA 4M7ZC 2FEEL 4QXTA 4OV5A 4U6YB 1UA6L 4NNXA 2A77L 3GUTB 2EDKA 4HK0B 3UXFA 2W59A 4FZ8H 4LBEA 1CU4H 2HRPH 1U92A 3DI3B 3EDDA 5E99L 5FFLA 1J0ZA 2MQ0A 2YA0A 4N0UA 3QEGL 1FVCA 4N0CD 3TV3L 1HH9A 3VDAA 3QUXC 1NMCC 4LHUB 3ZT5A 4PJIF 2BNQD 1YEDA 5GS1C 4ERSH 4G6FD 4NHUB 3VWKC 2CIIA 4GBXA 4NN6C 3C5SB 4HKZB 4OCWH 1DQDL 1EAPA 2ADJB 2LAGB 1H3XA 4EN3A 2HLAA 3BHBA 3T8XB 4ETYA 2CR3A 2Y5TB 3EOAA 4FFYL 1Q72H 5FB8A 4YZFE 2ARJB 1KPVB 4AIXA 3B5HA 2O5ZL 5E2JA 1FL5A 1W0WA 2F15A 3GJEA 5E24E 3EYSL 4R96B 3AREA 2YD1A 4JY5H 2PW2B 3GSNB 4CVZB 4ESKA 4FA8A 3E6HB 5FUCE 4WFHD 4H1LB 4GAFB 2YK1H 4J3WA 4ZTOL 4HK0A 5DS8A 4N5ED 4HQQL 1T0MB 4XP5L 3HE7A 5F44A 1F6AB 2EEDA 1KC5L 2X89A 3P40A 4H5SB 3FFDB 1LVEA 4U1LB 3MRFA 3VI3E 3GSOA 1IFHL 3B2UC 1WK0A 4JG0L 2HKFL 5ADOL 5INCB 4MHHI 1RAMA 4PRHA 4QGTA 1H0DB 4HAFA 4NHUA 5FYKE 4KVNL 4G8EB 3C5SA 2A38A 4HKZA 3LQZB 3JWOC 2XZQH 2VIRA 2P43B 2FGWH 3MACH 1G84A 4CU7A 1BOYA 1EJ6A 1REIA 3MUGA 4PJBE 4R3SA 3ROLA 1RIUL 1KPVA 5C0FA 3C09C 3P4OB 4PS4H 1TQBB 3F8UB 1J9CT 4FQXA 4UV7L 4X0KA 1WT5A 4G42A 3F58H 2ZSWB 3V5KB 3T2OA 2PW2A 1PBYA 3GSNA 5D4QA 2FH6A 2ZCKL 5DQJB 2Y25A 2EKJA 1FC1A 2QQKH 3QI9D 4H1LA 4GAJH 3ARXA 4O2EB 1H8OA 1RHFA 1U58B 1ZKAA 3DUSB 3OKEA 5JNYB 1T0MA 3QFJD 4LAQL 3CLEL 1U8JA 4I0PC 4OUUB 4FTVE 2APXA 3PE9A 4NQED 1G7PB 2FHBA 5I71C 3QUZC 2YR3A 1A5FL 1K4CB 1HDMB 3ARUA 1CD1B 5EU3A 5IT2H 5AUMB 3F62A 4TVPE 4OM0L 3QRFM 4Z76B 1H0DA 2YXMA 5JDJA 4YPGB 4S0TD 3Q2CA 4G8EA 2VR5A 2ICWJ 1U2HA 3LV3A 5LKNA 3DXAB 3LQZA 3HC0B 4OT1L 2VDML 1T2QL 2YRZA 3K4AA 3KPRB 2DM3A 5HDBE 4XPFH 5B3JE 2ICWA 1E4XI 5E2WH 1MRCH 4D8PA 3VXSD 4UINH 2CK2A 5I17A 2R2HB 2XNAB 2ZSWA 3GGWA 4JFPB 4OD1H 1DE4B 3GSRB 5DQJA 3FB5B 3AAZB 1RZ7H 2XXMB 4JQXA 1KIPA 4PREB 4MA8H 2Q3ZA 4X4MA 2NXZC 1LO5A 4O2EA 3QQ9D 5E6ZA 3BI9X 4Y19D 1YEKH 2OQJB 1AIFB 4QHLA 2R15A 5F9OH 4YXHH 3ZTNL 2Z31B 3LKSB 4J4PC 1Y18B 4LQFL 4OUUA 5FO7A 4RMRA 4W6WB 1HXYB 3KR3H 1A47A 4M7LL 3AB0B 1T3FA 1EAJA 5E5RB 1HDMA 3SJVE 4BH8A 2IMNA 5AUMA 1K8IA 1OB1A 4IOIA 3JWOH 2KDGA 1Q0XH 1IQDB 1NMBH 1LK2B 5C08B 2IAND 2ZOLA 1DDHB 3DXAA 3QQNA 3S35X 4NRXB 1JZ2A 1RULL 1CD8A 2DDQH 1BM3L 4ZSOE 5MENB 2R2CA 3MV8A 4OIIL 4UB0L 2A9NH 5GRUH 2B8OT 4LLWA 1JRHI 5IBLD 2OJZH 4NQUA 4RGND 1GGTA 4OZGB 1T66C 1M7XA 2XNAA 3U7WL 3TA3C 4JFPA 2W07A 3GSRA 4P0DA 4BFIA 3LEVH 4KDTC 4G6ML 4P5KB 2KQMA 3BP6A 1JZ3A 1A6VL 4NQVA 3IVKB 3K81A 1S9KC 1TJIH 3QEUB 4B41A 4KKCC 5FDYA 1AIFA 4RRPG 3T0VA 3LKSA 1MSPA 4OCXL 5DUPH 1F3JB 2CLVB 4Y2DA 1CLYL 1MQ8A 1A1NB 4KHXL 4JFZH 1FO0B 1RZFH 3LMJL 4CW1B 4FMFA 4ORGB 2WUBL 3LKOA 4ZNEA 3CX5K 5I1HH 2FGZA 1LK2A 5C08A 4DGIL 3WYRA 4OLWH 2G2RA 4NZTL 2MCG1 4HS6B 1JGEB 4H0IA 3PGDA 4NRXA 2OX5A 3BYTA 1UVQB 4JAMA 4BK5A 2AI0L 1UM4L 4JFEB 5T1KD 1SJHB 4P46B 1Q1JL 4PJFF 4OZGA 2ZUQC 3RUGF 1SY6A 3KPPA 1PQZB 3MNVB 3V6OA 5FF6A 4Q9BA 2FX7H 4AEEA 5IROA 3WLWD 3ZZ1A 5TQ2L 4WIQA 3NCFB 3ARDC 1ADQL 1HK6A 1YPZB 2VDQH 1Q38A 1T7XA 1V7MH 4BH7B 3FJTA 3O9WA 2G75B 3WNLA 1QKZL 3GO1L 1X5LA 1L6ZA 4E42A 5IB3A 3INUL 3EYQC 5EA0L 4O5LL 3ZMRA 4WVRA 3DSFL 2CLVA 1BZ7B 4KKLD 1UXSB 3FT4A 2AEIT 4KZEL 4P5TC 4FHBD 4LPVA 3U0WL 3DRTB 4LOUC 3TIEA 5DQDH 1MF2H 5KSVB 4CW1A 3L3HA 1NBYB 5C0ND 4MJIE 3KYMA 3BKJL 4ZD3L 5JO5A 1D9KD 4NQCA 4HFUL 3QG7L 3NZ8B 1JGEA 1NBZA 4DZBA 1UVQA 5EZOL 1ZT4A 4O2CB 3QH3B 1XIWD 3D39E 5KSAC 3O8XC 2IAMD 3SPVB 4JQIL 3B5TA 2WSKA 3LS4H 4E41E 2YC1B 2AJ3B 4XVJH 2R9HD 1JYVA 4GLRH 2VLRD 1KTDB 3MNVA 4XP1H 3UC0H 1WEJH 2F74B 5J12B 3FAXA 1D6VL 1KYOK 3RDTD 2IH1A 4CUCA 5C7XL 3JVGC 1BOGB 1T1YA 4Y8DC 5DA0B 5DR5H 4P57B 2GCYB 1YPZA 3MRKA 2H1PH 3VXTB 3CVHL 5F89B 4GAGH 4OLXL 5HY9B 5I30H 3UPAA 5T3XD 2QTEA 5BO1L 1SBSH 1TFHA 2FIRT 3V4UH 2P8MA 2XQBH 3FQUB 5C6TL 3O11A 1CICB 3QDGA 4S10A 2R69L 5F6IC 2OMNA 3QPQD 3FFCB 4X6DA 3V7AG 2R1WA 2Y5EA 1CLOH 2CKNA 3U4EA 4RFOH 1NSNH 1B4JH 1NBYA 2WQRA 2WMPA 4RFEA 3CFBB 3NIFE 4DEPC 1TCRB 1UB5A 1DEEB 4NWTL 4XNYH 1R5IB 3NZ8A 4UMGA 3I6LE 4OB5H 2DIAA 3VFSA 2EECA 4GS7B 3BX7C 4H8WC 4XMKL 4KV5E 5CZXC 1MHEB 4QRUA 4ZS6C 3EGSA 3SPVA 4KU1A 3KPLA 5KG9A 2YC1A 2V2TB 2AJ3A 1FH5H 1I1YB 5IVOA 3TPUA 5L9DH 1KTDA 3QIWD 4WTZA 3BE1L 1K8DA 4YLQT 1UACL 3BEWB 5DHYB 1L7IH 4P57A 3GBNL 2CR6A 2GCYA 5JW4Q 4HIXH 1KCRH 2JCCF 5DMYA 3WCYA 2Q86B 3MV7E 1JWMB 4R97B 3OZ9L 1CN4A 1QSZA 4KRPC 1JZ6A 3FQUA 3VFRA 5D96C 3WD5H 4JPVL 2VE6B 5C07D 3FFCA 1VENA 3ARWA 3L1OL 3BP5A 3SGJA 5BVJB 3FO9A 4GW4B 3UTSD 5FHAL 3UYOD 4PV9B 4Z7VB 3CFBA 1E6JH 3G9VA 2MFNA 4C54A 5FUOL 1NGXB 3WDHA 3TJEL 3BDXA 5DJ6A 1DEEA 1R5IA 3GJFH 1P1ZA 4NSKB 3ULUD 5CILL 1KTLB 2NX5D 2VLMD 4AYFA 1S5IH 2CDEB 4TOYH 4YHIA 3KYKL 1MHEA 1ZLVK 5LGKA 1T5WA 4RNRB 2Z92B 4XWOC 3MXWL 1U36A 3L5WA 4FQ2L 5F8RC 2V2TA 1VFUA 3D3VB 3C8HA 5K93A 3ARGB 1I1YA 1NQBA 3CUPB 3QDAA 5CJBA 1JPST 3MGAA 1FIGH 3QISA 3ZYOA 3IDGB 5IB2B 1ZEAL 2X09A 1UADC 3BEWA 4DUWA 1R3LA 5DHYA 1ZT1A 2RAMA 1UB6B 4L9LB 2NY4B 1OAUH 3CIQA 4WWKD 2BNRB 2C4FT 3CDGB 2Q86A 2GSIA 2XKNB 3DV6B 4EOWL 3OR7B 1JWMA 4Z77B 1A1OB 4YZFF 5EO1A 5FCUL 12E8L 5GGSY 3T3PE 4JFOA 4S1RL 1UKSA 1ZLSL 1UM6L 5B22A 4YFDB 4FFZL 4BQBA 2NQCA 3TT1L 1IGIL 2PXYC 3LN9A 1DLHB 3WN5C 5BVJA 4GW4A 3D18B 3I9GL 1AXIB 1KG0B 3AS2A 1BJ1H 2GSGB 3ARBD 4H8WH 3LEYL 3WHE0 3C60D 7CGTA 4LSTL 3C08L 1AY1H 4M5YH 2DBLL 5HYSG 1F4YL 3PP3K 3QULA 4DTGH 5SV3A 4LPXA 1MLBA 5GS2D 4LSRL 1C5BL 1DBBL 1ED3B 1N6QL 4Z7OE 4CVUA 2YSSB 5DEGB 4KZDL 4L5FL 3KPSA 3V79C 2Z92A 4RAUB 4WU7B 3LN5B 5JHLL 3VI3F 3DRQB 3WS6A 3ARGA 4UDUA 1IKFH 5D1ZA 2DQFB 1L7TH 4XGZA 4YAQA 5A2IH 2J7LA 1U3HA 2AEPL 5IB2A 4AG4L 1T1ZB 2OR7A 3Q6FB 1W72L 4JHWL 3ARRA 1QNZH 4PFEA 2QJDA 4TNVK 4K94L 1B4RA 3A6CL 4CRPA 3P77A 3PWPD 2AV7A 3MUJA 5ISZB 1I9JH 4K3EH 1OP3H 5DO2D 4PJBF 4ZO9A 4Y5YA 4JFXB 5I15H 2J4WH 4P4KB 4P2RA 3VGDA 1MRFL 2JIXD 2R8SL 3G5YB 3MO1B 2EDNA 3SY0A 1FG2B 3D18A 1KG0A 5DD6B 3IJYB 1CXHA 2EC9U 5FYKD 3ZKMC 4PV8A 1J1PH 2GSGA 3F7RA 5EUKA 2YMXH 3I3EA 3IT8D 4Z7UE 3DGCR 4P2OC 3D1MC 4ODSH 1UWXH 5FDWA 1CGWA 1RIVL 1T03L 3IRZA 1CF8L 1ED3A 5C0AE 2C26A 4ZFOL 2CMRL 3SO3B 2YSSA 4ODVL 3E3QE 4V1DA 2R4RH 3DRQA 2BVTA 3OKKA 1BBDL 3O3AB 3WNPA 3ZYJA 1Q94A 4EBQH 4YXLL 1HHKB 1NL0H 5JW3H 1GSMA 1YNLH 4X5LA 2X4NB 3ME0A 1YY9D 4Q0XL 3MRBB 2ZUUA 3SDCA 3TFKD 5HDBF 5B3JF 1EV2E 3HRZB 4FTVD 4JFXA 3S37L 1A6WH 5EN2B 3LOWA 4JO3H 1MAKA 4G9FA 2AJXH 3AUVA 2IGFL 1WWAX 3WSQH 1D5BA 3CVIH 4O9HH 1ZHNA 3G5YA 5GRYA 3MO1A 1I8KB 2R56L 2CRIA 2KH2B 4CMHC 5DD6A 3D2UD 2R23A 3IJYA 1VFMA 1QR4A 3HA0A 4XNXL 1EUUA 4HT1H 4P2QB 3MRJA 4U6VH 4X99A 3LKRB 4OCMC 5I9QB 2YPLA 5DI8A 5HI4C 4L3AA 1GHFL 5F7MC 1DBKH 5E0QA 2D31B 3EYUH 3TNMB 1FAIH 1YZZA 2ITDA 3NCJH 3WO4B 4MDIB 1U41A 3WIIH 3KPQA 3T09A 2YUVA 3W81A 1Z9LA 2BMKB 4JJHA 3T3ME 2PW1B 5DJ0B 4X9BA 4ZOCA 5GRWA 2MMXA 1BEYH 4JZJC 4QRPD 1QBLL 1CFVL 2KL6A 4UBDD 4G8IB 1UFUA 4PRBB 4XPBH 2LVEA 2JJVA 1LK3L 3C6LD 4JZNB 2AJSL 1BQSA 4L4TD 1P7KB 4UIMB 4NZUH 4X8JA 3MLRL 4N68A 5EN2A 1YEHH 3T04D 3UBXB 3F5WB 5JOEA 1JHKH 3WS3B 1L9NA 3DPBA 1H5BC 5BS0E 2GIYA 2FX8H 2A6KB 5TF0A 1LD9A 1DUYB 4UNUA 5H94B 2VKXA 1GGCL 3P11L 3NGBC 2WWMC 3AC0A 3ARFC 4M8VA 1SEQH 4C83A 4XB8A 4KKNA 3GMLA 3LKRA 3OG6B 2D03H 3MOBL 3DROA 1Z5LB 4ZDHB 3X13B 1S7QB 4M7ZB 1F3DH 4FQQA 2D31A 1UZ8A 3V6FB 3S88L 4KKAC 3I6KA 3TF7C 3ET9F 5B39B 3LZFH 2PW1A 5DJ0A 2YUXA 1JTPA 5DD5L 5IWLC 3IDIA 1U42A 1X5JA 5BJTA 5CP3A 1Q9LA 1EX0A 1AP2B 4LLDB 3TO4B 1CFNB 4ZYKB 5I19L 3QUXB 3K2UH 1NMCB 3QUKA 5EBMB 2CLRA 1P7KA 4L4VA 4UIMA 5EU6E 5GS1B 3VWKB 1WAAE 4M1CD 4CBPA 4NN6B 5EZLB 4LCWA 2QQNL 2K1MA 1R5WB 4HW6A 5EOTA 5KZCD 3QWRD 1R6VA 2A6KA 1IT9L 1BBJA 1DUYA 4LHQB 5DFWH 3CDFA 1RUPH 5D5ME 5H94A 5KAQG 5C0JB 5F88B 2OL3H 4GXUN 4KTEH 3NFSL 2V7HB 4LLMA 1HHGB 1G7MB 3FB7B 2NR6D 3GM8A 4K2UH 1T7WA 4ZDHA