3BGFB

X-ray crystal structure of the sars coronavirus spike receptor binding domain in complex with f26g19 fab
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
216
Chain Sequence
EVQLEESGTVLARPGASVKMSCKASGYTFTTYRMHWIKQRPGQGLEWIGAIYPGNSDTTYNQKFKDKAKLTAVTSTSSAYMELSSLTNEDSAVYFCTREGIPQLLRTLDYWGQGTSVTVSSAKTTAPSVYPLAPVCGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Spike protein S1
publication title Structural insights into immune recognition of the severe acute respiratory syndrome coronavirus S protein receptor binding domain.
pubmed doi rcsb
source organism Sars coronavirus
total genus 40
structure length 216
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bgfB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bgfB01
5CJOH 3MLXL 3MCLL 1OAYL 1MCNA 3Q6GH 3KYMB 4QRPE 1U8JA 1WICA 5DA0B 4HHAA 1R3IH 1T7YA 4J3XA 1FO0A 3T08A 4ELMA 3D48R 2HT4C 3MSPA 1AI1L 3PWVB 5E2WH 2FX8H 3QO0B 3WUWA 4V1DA 5BZWB 4UTBH 2HKFL 2DI8A 1XF5A 4WVRA 2DM4A 5IBTL 1OAXL 3MRJA 4MDIB 2X7LA 4X4YA 1JRHI 3G6DH 2P8PB 1XH3B 4Q74A 3BN9D 4LSPL 1ZLVH 4N0UE 4ZFFA 3KLDA 4M3KB 4JCMA 4J1UB 3MRBA 5ITFA 1BEYL 2UWEB 5BJTB 3CPLB 3HZKB 4NIKB 3GM0A 3HN3A 5D1ZC 4P4KA 5FO9B 4JEGB 3ROOA 1FSKC 2RGSA 3Q5OA 4QXGH 1KJVB 2V17H 4ZUWB 2PW2A 3CUPB 4UT9L 4NCC2 1AJ7L 4WY7H 5FOJA 3LB6C 1G0DA 4EN3A 1MQKH 4IHOA 3QCVL 2N7BA 4XVJL 3ULVH 1P1ZA 1U8JB 3QNZA 4GMTL 1HHGA 4HHAB 3OR7A 2PW1B 3KPSD 1FO0B 4HCRA 1JMZA 4KJWC 5I75B 3QAZB 1YEEL 2APVA 4RGOH 2VAJA 4PJ5A 1CICD 2PYEA 1XF5B 3CDCA 2VXVH 3MRJB 3DGCR 2X7LB 3DECA 3KVQA 4X4YB 3MLWH 1LE5A 2DQDL 5IBLD 5D71L 1GPOL 1QSFD 1NMCC 4LK4A 1FZOB 4Z7NF 1TJHL 3SQBA 4MCZA 3MRBB 5ITFB 4AQ1B 1XGYL 2W9DL 5BV7L 5FO8B 3S3PA 5HYQA 4XGZA 4LOUC 3QRGL 2YWYA 4BFEA 5HY9A 5HI4C 3O3EA 4P4KB 3ROOB 3P40A 5D2LA 2AXHA 2VZSA 3ZE2E 2PW2B 2YR3A 3TO4C 4NP4H 1JZ3A 4U7KA 4EN3B 1GGIH 4IHOB 3U48A 3ARRA 1P1ZB 3QNZB 5D7JA 1HHGB 4RGNB 3WFDL 3QXVA 5D2NC 32C2A 4KY1H 3RA7H 2EDTA 2PR4H 2HVKA 2PYEB 4ONGL 2DMKA 2CK2A 2R4RH 1K9TA 2V9TA 1LE5B 4WCYH 3K46A 4LF3A 5D7IE 3IFPA 3VXNA 4TPRH 3TJHD 2XWBA 5I8KL 4LP5A 1YPZF 4MCZB 1U3HA 4O2EA 3K7UA 1BWWA 4OFYA 3UROR 1PJ9A 3CXDL 2ADFH 2EDDA 4NGHL 2LTQB 3JSSA 4XGZB 5HYQB 2DQEH 1BAFH 5DD1L 5HY9B 3HI5H 1ZHNA 3O3EB 4OKVA 2D31A 4PGEA 1HCFX 3CFCH 5D7LB 5GS2D 2EO1A 4FNLH 3WYRA 5FYJD 1PSKH 3BIKA 1HXMA 3LRHA 2E7CA 4GRLA 4J4PA 4O4YH 2M1KA 4I48A 2FWOA 5D7JB 4Q9RL 1DL7L 1X7QA 1FN4A 4U05A 4H8WL 3WIHA 4I0PC 32C2B 1DUYA 3W5MA 4KVNH 1DN2A 1FFNA 2QLVB 2UVFA 4O9HL 2XZAH 2AEWA 4ZOCA 2HVKB 4X6FB 4DJMA 4NN7C 1QRNA 1OQXA 4BQ8A 4DEPB 1M6OA 4LF3B 3RIAF 4NO0B 3VD9A 4OCNC 4GXUM 3IFPB 1AQDA 3IDXL 5TPWH 3VXNB 4LHQB 4PJBF 2XWBB 5IFAH 1JYNA 4WHYH 1U3HB 1AXTL 1XIWA 4O2EB 4YQXL 3VXRD 5C0RL 4QGTA 4HPYL 2P8LA 3AS1A 3KJ4B 1S7QA 2VTFA 3S8WA 1B6DA 5M95B 2MQ3A 3UAJC 3TEUA 5C0CD 4FS0A 3BGFB 1ZHNB 4OKVB 2D31B 1P4BH 5GGRY 4OF3A 3KXFA 4PGEB 4ZXBC 3VE0A 4BSVA 3M45A 3VFWA 4NHCL 4DKFL 3BIKB 5CFHA 1HXMB 1OWRM 1YECH 3MV9A 3P0VH 4YDKH 3ULSA 5FDYA 3G5VA 1MCDA 3IJSA 1QBLL 4I48B 2FWOB 4O2FA 1X7QB 4OM0L 1KCLA 2P42B 4MNGA 3BN3B 1DUYB 1FNAA 4OCWL 1DCLA 3VG0L 5FYJE 1C5CL 1T2JA 4OTXH 5DUPL 1QRNB 4U1SA 5I71B 4MVBD 3PP4L 5T33H 1LO0L 4LDLB 1M6OB 2DQHH 3GIZH 4ZQKA 2ADIA 2FJGA 1AQDB 4FZEH 4PRIE 4UAOB 3NH7H 4Y4KC 5GRXG 3HNTL 4OZFH 4ZO8A 5ESAA 5MEND 3DMMD 2HJKA 1EDQA 2P8LB 3FRPG 1S7QB 2BVQA 3VDCA 3DVGA 4UQ3A 1EO8H 2F5BH 4WWID 3KXFB 3VE0B 4MJIE 4QLRA 3U82B 2BRRH 4NT6B 3VXRE 4BSVB 3VFWB 1BVZA 5CJXA 4BH8A 2F54A 3MV9B 1HKLH 3L3HA 2DKSA 3G5VB 2GUOA 3IJSB 4G6ML 4PRNA 5C0CE 4O2FB 2YZ1A 4Y4HC 2WP3T 4HXAL 4MNGB 1C7SA 3QSKB 4KRLB 1B0WA 5J12B 5A2JH 4G3YL 1N2RA 3QEGH 1N3NA 4U1SB 2D7OA 2ZG2A 2GK2A 5T3ZL 3LEVL 5IB4B 1CCZA 1OSPH 4QRTA 1ZK9A 3CXHJ 3A67H 1KJ3H 4ZQKB 4LNVA 5C0EA 2ADIB 2FJGB 1FCGA 1ZKAA 2VDOL 4OZGE 1O7VA 4HZLA 4GKOA 3T2OA 3Q0HA 3SGJA 3DETC 4K9EL 2HJKB 4F33A 2EDNA 1EHLL 5EBWA 1FL6A 2KL6A 3H7BA 2BVQB 3DVGB 4UQ3B 4ZNEE 4GRWF 1EJ6A 5AYUH 3ARBC 3LOWA 1Q1JH 4J6RL 3OB0K 5KSAC 5LAXB 4M1CC 1OTTC 1G9EA 3C6LA 5MENE 2NY2B 5KN5A 4BH8B 1IVLA 2F54B 5FYLD 4CN4A 1J0HA 3L3HB 4LSVH 1QD0A 5DO2C 5EH1A 1MRCH 5C0AE 5I18L 2GUOB 1XR8A 4TUOB 4FQXC 4PRNB 4EI5C 1OD7A 1Q94A 4PJAE 2L7UA 2R2BA 2R9HC 3MLRH 3WS6C 2A0LC 1KB9K 1RFDL 4KRPD 5C09E 4Z8FL 4NNYA 1EGJH 1N2RB 3O4OB 5EO0A 4OBSA 1N3NB 3TNNA 5JIIA 2DMCA 4JO1H 3CSGA 4QRTB 4A6YL 2G9HA 4Y16D 1EAPA 4Q6YA 5C0EB 4WFGD 3RBSA 6FABL 4HZLB 5EORH 2JCCF 4GG6A 3D85A 5F70A 4GS7C 1U95A 4X80H 4KK9D 3QJFA 4F33B 4I3SL 5EBWB 1C1EH 1FL6B 3VI3E 3HNSH 4HLZH 1MCLA 2XOTA 2EXYD 2JJVA 4JQXC 4Y5VA 3VU2A 4C56D 4UIMA 1MWAA 3C6LB 1HSBA 2IH3A 4YXHL 2PXYD 5KN5B 1JGLL 4D9RE 5FYKH 3QFJA 5KZCD 3VGGA 5HHOA 1XR8B 4MD5A 4BZYA 1Q94B 4QYOA 1W2KT 4OV5A 1QO3A 2W9EH 2Y07L 1A6TA 1KCUH 3MX0A 4OD2A 1ZLSH 3T0EC 3PE9A 5FYLE 4NNYB 5EO0B 4LEOA 3ZDZE 1A6AA 3TNNB 5EOQH 1NMBL 3ALXA 5L88H 1BIIA 1OB1A 5HI5C 1MY5A 2G9HB 2EDOA 1EAPB 1A6VH 4P5TA 5K59F 3PJSB 1MCCA 2MPAL 2B20A 1JWUA 4GG6B 4U6XA 5KSVA 3BUYA 2Y36H 2OX5A 1GZPB 4NKOB 1U95B 4L4VD 4ODUA 3QJFB 4M6OL 3WSQL 2UY7A 5EU7C 1MCIA 3CMGA 4EBQH 4WFGE 2FBJL 3SCMC 3REWA 2Q86A 5EA0L 4RSVA 2YD2A 1LK3H 1KB5H 4JFFD 2EXWC 3KYKH 4Y5VB 5C1MB 4UIMB 1MWAB 1HSBB 2IH3B 5HVGB 5DXWA 2LAGB 3FQXA 4RMTA 3VFVA 1NLBH 4RISH 5HHOB 4MD5B 1T0NB 4QYOB 5D72H 4OV5B 2QQNH 1QO3B 1GGCH 2NY6B 4HBCH 4C56E 1A6TB 2OM5A 3BZFA 4WO4D 1UJ3C 5AUMA 4OD2B 5C0FA 1IGCH 1MJ8L 4LEOB 3B6SA 2PO6A 1T7WA 1OP3K 1A6AB 5KVEL 3N0PB 3WFHA 4XTRD 3CVIL 1DBML 1BIIB 1OB1B 1GOGA 4P5TB 2Z8SA 1ZLUK 4P59H 1JWUB 2OR9L 2XRAH 4U6XB 4ZUVA 5KSVB 1E27A 3BUYB 3QHZL 2IFFL 2RFXA 2EIDA 4ONHB 4KJQC 3G6JA 1F6AA 3PDGA 3CFIC 2YXFA 4ODUB 1QG3A 2W0FA 4NWTH 3ARGA 3WXWL 2AQ2A 3REWB 1K3ZA 1T89C 4OF5A 1LO2H 3D87B 2Q86B 2OTWA 3AGVA 1RZJL 3I3EA 3S4SG 1KXQE 3FQXB 5GXBB 5IK3A 4ZS6D 3VFVB 3IVKA 4G6FD 3B2UD 4M48H 3CMOH 2EKSA 2IPTH 3SDCA 5I73B 5C0FB 1VGEH 1S5IL 2YKLL 1RHFA 5E6IA 1QNZH 4N1CA 5BS0A 4NCC1 5IHLB 2ZUSA 2PO6B 3B6SB 3HR5A 1Y6KR 1CIDA 2HRLA 3WFHB 2RB8A 4B41A 5FM5M 3C2AH 5I9QC 3MBEA 3AB0B 1B90A 4LLUA 5C6TH 4JKKA 2VDPL 5DJZA 3TH4T 3FAXA 3NIGF 1G84A 3SO3C 4X7SL 4ZUVB 3ZL4L 4OZFA 1JTTA 5ADPL 1E27B 4OZ4A 1QFWH 1QQDA 2RFXB 3G6JB 3HG1A 5KW9L 1ZGLP 1AD9A 5DD5L 2FO4A 2W0FB 3UMTA 3ARGB 4K7PL 5D9SA 3HI1A 5IROC 1SY6H 2OTWB 1YJDC 5J3HD 4WI2A 3RZCA 1JZ7A 2VAAB 5EG6C 5L2JB 1QFWI 5IK3B 4WEBL 1KIUA 3IVKB 5JZ7C 1F4XL 4JPVH 3VWKD 1INEH 2EDJA 1NEZA 2EKSB 3VWJC 3U4BH 5HHNA 3SDCB 1WWAX 3DVNA 5E6IB 5BS0B 2H2SD 1UCTA 5F7WC 4M8QA 2ZPKL 5C6PB 2R39A 1JNLH 5DWUL 3MBEB 4PY7A 5ACMA 3SDAC 4PRPA 3EJYD 2EIZA 1WFUA 5F1IA 2B1AH 2IBGA 3HMXH 4WW2A 1IGFH 3AROA 4LRIA 4OZFB 5IW1A 4OZ4B 1QQDB 3O4LA 3HC3H 3QEQE 3U36A 2VUYA 3HG1B 3ZE1E 3ZDXE 1AD9B 3IDMB 2FO4B 5BRZB 4L4TD 4S1DD 1ZLWH 2CXKA 3MRCA 4LCYB 3W0WA 3LS5H 2GIYA 3E3QE 3RZCB 4WHDA 4F7MA 4YH6A 3UP1A 3WHXA 5F7KC 3VRLE 4HXBL 2FH6A 4LPYA 5I1CL 4RDQG 4EKXA 2J8OA 4G5ZL 4J12A 4X5XB 2MJWA 4G7YL 1T83A 1WITA 5J56B 1SEQH 3RWEA 5B38G 1UENA 5L0QC 4DAGL 4HS8L 5CAYB 5CKAA 1NEZB 4M7LL 3LPWA 4CU8A 1DBAH 2PN5A 1INDL 5HHNB 4XNUH 3DVNB 3T04D 1MQ8A 3WNLA 4MXWH 4M8QB 4OIAA 1WK0A 4BKLA 5GGUA 1JFQH 2DM7A 1CU4H 1WIOA 4PY7B 5F8RC 4PRPB 2R4SL 2EIZB 3ALPA 3TVMC 1FL5A 5F1IB 4ETQA 1IMHC 1K4DA 4QGYA 4XC1H 1JTPA 3QHFH 5IW1B 4TULH 4GAGH 3SE4C 5C71A 3O4LB 3QIWC 4QXUH 3U36B 3VXTA 3UZQA 2YRPA 4OZHE 4V1DD 3V6OC 5T1LA 1OP5K 5JW4Q 5DJAB 1SBSH 2LV4A 3MRCB 3SOBL 5HVHB 3W0WB 4YHMH 3FRUB 4F7MB 5FYKU 3WHXB 5HVFB 1OGAB 1UB5A 2APXA 1JPGB 4BQ6A 5B4MC 3IETA 1VB9A 3RWEB 1TETL 4MAUH 4MJ2A 3MR9B 5EN2A 5BVJA 3SJVB 4XCEA 1T22B 2B4CC 4P9MH 4LVHB 1G6RL 4P4KD 3I84A 4BKLB 3BH9A 5GGUB 4PJEA 3VI4F 1A5FL 1WAAF 2D4FA 2IF7A 4XVUD 4LSRH 2OZ4H 4LAQH 1FL5B 4ETQB 1K4DB 1U2CA 3QFDA 4B50A 4OBRA 4OCSL 2R1WA 4RGND 3LAFA 4JG0L 2V5MA 4JHWL 1BMGA 1CGXA 3VXTB 4M6NH 1A7OH 3N1GC 3EZ8A 1UCBL 4U0RB 5DMKA 4PJ5D 5LGHH 5J11B 2FH8A 2Z31A 2X10A 5DFVD 3O3BA 5FIEA 1ZTXH 1UZ8A 1A7PL 5J1AA 1T4KA 1KB5A 2DL2A 3HI6L 3LIZL 4IJ3C 4OGXH 4UNTA 4NQDB 3T0BA 2AJUL 4OJFL 4ELME 2AEPH 2W0PA 3BDYH 4OLUL 1AIFA 3FO2A 1J18A 4PLJD 3G04B 3PHQA 2I27N 3IETB 4JB9L 3CK0L 5EN2B 5BVJB 2OK0L 3U46A 4R4ND 5DD0H 4XCEB 5IQ7H 1FAIH 5F1NA 1GGBH 4HKXB 4AEHH 3E2HC 3TYGL 1OT2A 2YOCA 2R29L 2LVCA 1NCAL 4XCYA 4YHYB 1BREA 3BH9B 2HH0H 4PJEB 5DRNA 5I8OL 4ZFOL 1C8PA 3O3AA 5I2IA 1CL7H 1I1YB 4ACPA 3MODH 4KMTL 3GJFH 3QFDB 5D6CA 4D2NA 5FM4A 4H88L 1JHLH 1YJDH 3DJ9A 3MLPA 1RIUL 3DVIA 2DBLL 3BD5A 3OKLA 5DMKB 5M94B 2IAMC 2CMRH 2Z31B 1QBML 4G9FA 5EWIH 3ZYOA 1J1XL 3P4LA 3O3BB 2YK1L 1UZ8B 4LCCA 4RGNE 1T4KB 5J1AB 1KB5B 1YC7A 3KPPA 4QTIL 1DUZA 2ADJA 1X5IA 3B9VA 1Q9WA 1PAMA 1JNJA 4PJ5E 3FO2B 3H42L 3KWWB 2PYEE 1YMMA 3TFKC 1K6QH 3V4UL 5IV2B 1U3HD 5F7LB 3QBTB 5FYJL 3BQUC 1XT5A 43C9B 2P5EA 3U46B 1G9MC 1OD9A 2VDRH 5EZIL 1KCRL 1R3JA 2WWKO 4M7JL 1F58L 1MSPA 3ZDYF 4XCYB 1TJIH 2FCBA 4JANB 4ISVA 1F3DH 5IHZA 2GTWA 5DRNB 2WBWB 2QHLA 1Q72L 3B3IA 4G6AC 3O3AB 5I2IB 4ZTPL 4GRLD 4J4PD 3ARDA 5JDJA 5D6CB 3UXFA 3W81A 4KDTA 1IGIH 4F9PA 12E8H 5D2LE 4TVSa 3W9DA 3OKEB 1QKZL 3OKLB 3NIDF 5C8JB 2W38A 1GH7A 1T20A 5EZLA 3UJJH 1IQWH 1QTYT 4NZRH 4YE4L 1SY6A 2I9LA 4LCCB 1Z6JT 3VXOA 3KPPB 1DUZB 4TQEL 2ADJB 1DSFH 3ZKXB 3FOMA 1Q9WB 3U9PL 3P30H 3MJ7A 4QY8A 4K3EH 2AK4A 3O2DH 3O6FA 1YMMB 1BIHA 5SX5H 2NCMA 4G8FA 2FHFA 4OFIA 4FHBD 1XIWD 3FMGH 3GK8H 2DI9A 2P5EB 4MJ6A 3GMMA 2ZCKL 1ZT4A 5D96B 1EIBA 4ISVB 1VHPA 2JB6A 3D0LA 2GTWB 3TM6A 3MV9D 3QCTH 1A22B 5DFWH 2A9MH 1A47A 3ARDB 5FUZL 1RUQH 4Z0BH 2EE2A 3QDMD 1E0OB 4ZOEA 1MEXL 3W9DB 1MFAL 3F7PC 1T20B 5EZLB 5JOPE 1JBJA 4JPIA 3HZMA 3I2CH 2HLFD 2G5BA 1L0YA 2I9LB 3VXOB 4DWHA 3QZWG 1FL3B 4RX4D 4ZAKA 3C6SA 3ZT5A 3FOMB 4FZ8L 2ICEA 4B5EA 3MJ7B 4QY8B 2AK4B 4UV4H 2FHBA 5D8JL 3O6FB 4MZ3A 1QRNE 4G8FB 3D25A 4W6XB 1IM3A 5E70A 5DMIH 5A2LH 5TE7H 5C3LD 2EYSA 2CJUL 2PTVA 4CADA 4O58L 2Q8BL 4P46A 5EC1B 4MJ6B 3QG7L 3CCHA 3GMMB 3U0WH 3CDFA 1ZT4B 4RWYH 4M5YL 2A38A 4I8DA 4OGYH 3BKML 2JB6B 1CIUA 3D0LB 5D70L 4YK4C 3U0TA 2NY2D 2IG2L 3JWDH 4JGMA 5C0IA 3RNQA 3H3BC 7FABH 2Z8RA 1YEHL 2ZOLB 1T80A 1A7QH 3KXFE 1GOFA 5DT1L 4J2XA 5EUKA 4J3TA 5EULV 3MV9E 1U8QA 4JPIB 3HZMB 5JUEH 3CZJA 4L1HA 3P9LA 5JQ6L 5D93C 1KEGL 1NANI 2Y1VA 3BP7A 3DURA 5J0BA 4L9LC 4PJDA 5DVOA 4MNGE 3V4VL 4YWGL 2FD6H 1DVFA 1FYHB 2ICEB 4TOYH 1VFOA 1ROWA 5EC2A 1IKNA 1IBGH 4NC1C 3V9FA 3IRZA 1W0VB 3D25B 2WUCL 1IM3B 2GTZA 4OM1H 2EYSB 4CADB 2WUBH 4NCDA 5FYLL 3TV3L 4P46B 4WI3A 3MFGB 3ARQA 5DJ2A 3CCHB 4M6AA 5E2VL 4JCLA 4AEIL 3RKPA 1GOHA 4NKMA 2IQAA 4UU9B 3VXQA 4LLMA 1MFCL 4LNRA 4H0IA 5BVPL 4PJ9D 1I85A 1YA5A 3U0TB 5C0IB 3RNQB 3UO1L 3FN3A 2FRGP 1BQUA 3ULVD 5DQJA 1I1CA 4KUCD 1KSRA 3H3KA 5I1DA 3O0RH 5D7SL 5EUKB 3ULUH 4X9IA 2F54E 2WWMC 2VDLL 1U8QB 2VLJA 4HW6A 1HQRB 1L7TL 2JF1A 4XNXH 2PCPA 3VXMD 3P9LB 3BP7B 1OM3L 3DURB 4PJDB 3D0VA 3K8LA 3QIBC 3VA6A 1FIGL 1DVFB 3ZE0E 1FQ9C 1OW0A 2ZJSL 4EOWL 3D85D 1CDGA 4KZDL 1V3KA 2GTZB 2OJZL 4R90H 5B22A 2R8SL 4ODHH 3K3QA 4OQTA 1OCWL 1T7ZA 5DJ2B 1QLRA 2VXQH 5ERWA 3HHRB 1XCTA 1MIMH 5IVXA 5DJYA 1IAKA 1UA6L 4NKMB 2QKIA 2IQAB 3H2WA 4LLMB 1LQSR 1NBZA 5FOBB 3TBSA 4LNRB 4OGAD 3IJHA 1G7LA 2R1XA 4U2ZA 2NY0C 3FQRB 3QFJD 4RAUA 4PS4H 4AJ0A 1XR9A 3GJFA 3K0WA 3RVUD 3L5IA 3UTPE 2QQKL 4JO3H 1BFTA 2HN7A 3QQNA 5I1DB 3U1SH 5HYSG 2X1QA 1QEWB 5CEXA 4OD1L 2VLJB 4YXKH 5GGRA 5DD3L 1F3DJ 4GRMB 3ULVE 2PCPB 4EI6B 4TUJA 3MLYL 3PP3H 4M1GH 3D0VB 1LMKA 3UYRH 4P2RA 1EEUA 4AG4L 3P11H 3WJLA 3QDGA 2MKLC 2FNBA 4HK3N 2FDBP 1U8LA 4OT1H 4DUVA 4H8WC 3DYPA 1ZANH 3MXVH 1ITBB 1JVKA 5K9JL 5KVFH 2EDEA 2DQCL 1QLRB 3OGCA 4XT1C 5ERWB 1XCTB 2X4NB 5DJYB 1IAKB 2ZUUA 2ZSWA 1RQ5A 1ZVSA 4IMLA 4IMKA 4GG6E 2QKIB 2CRYA 3S97C 1NBZB 3TBSB 3GSOA 3TJEH 2JJTA 1T6VN 1G7LB 2R1XB 3IJHB 1B88A 3G5XA 1B2WH 1I7TA 4RAUB 4HGKC 3IYLW 2FX7L 3GSVA 1XR9B 3GJFB 2VDMH 1W8NA 4QHKI 3H9HA 3RDTB 2HN7B 3O6LH 4KHTL 3V7AE 4GO6B 4YHKL 1TMCB 3DPBA 1F3JA 3CFDA 5CEXB 1AO7A 5FA4B 3QFJE 5ANMB 3O2VL 5HHOE 1DANU 3PF2A 5K33A 4TUJB 4HJJH 3MRIA 2E8ZA 4UNUA 2ICES 4P2RB 5C2BL 3CU1A 2P46B 4HH8A 4ORGA 3QDGB 4XPAL 2ESVA 1MCHA 2HKFH 1EAJA 1FLRL 2XKUA 3O2DA 4R2GB 1U8LB 1FZKA 5IBTH 4IRJD 4Q58C 2FL5A 1NUNB 3TP4A 1UWXK 2X4RA 4WFHD 1NL0H 4CW1A 3H9YA 3OGCB 5MEQA 4JM4L 1ZVSB 4IMLB 4OUUA 2CRIA 2VNCA 3GSOB 2HFGH 3G5XB 4NBXB 1I7TB 4F8QA 3BKCL 5L2KA 3GDBA 4HWEH 5F7UA 2EDKA 5C07A 2OS7A 5JHDA 2QQLL 3H9HB 2VJXA 3TIDA 4HS3A 4UT9H 5IFHH 3PWLA 1WZLA 5CLTA 3SDCD 3ME0A 3CFDB 3QCVH 4OCYL 3BSZL 4GMTH 5E00B 3OKMA 4PJXF 2VLMD 3MBED 3HE6C 1A1MA 1NCCH 1X4XA 1G7IA 4QF1A 3HC4H 3LY6A 3IAQA 4ORGB 2ESVB 2PNDA 3C5ZB 1NGYA 2BHYA 1QBAA 3QQ9C 4FFWC 3ZMRA 3GMLA 4PLKD 4XVSL 3RWFA 4FFVD 5D71H 1X5HA 3HG1D 1GPOH 2X4RB 5I6XB 3RGVD 3W11D 1PG7X 4JM2A 3BP6A 4CW1B 1T7VA 3BMVA 1TJHH 3MUJA 1CWVA 4OUUB 5MEOA 3L3IA 5DQ9A 2DQUH 3FQWA 5BV7H 3G6JE 1X6LA 1CZ8L 5EO9A 4WFHE 2NTSP 5FXCH 5L2KB 4MJ5A 4C55A 5C07B 5C70A 3JUYA 1S7WA 1XCQA 2WBJA 4PJFF 1G6VK 1X4YA 1WZ1L 1Q9OA 4HS3B 3PWLB 2QADB 1IEBA 2J8UF 5JQHC 4LPUA 4P9HH 3S34L 1B9ZA 1ZVHA 3TZVD 3FN9A 1LDPL 3OKMB 5SWSD 3QUZC 1FFQA 3DLQR 4PJGF 1S7SB 3J8F7 5ACZA 1A1MB 1EBAA 1G7IB 4QF1B 3MLZL 2BOBA 4PRPD 1P69B 5FGBA 1NGYB 4KTEL 5BS0E 3EO1B 5DRXA 3VD7A 3GMLB 3O4LD 4KKBC 3RWFB 3WO4B 1MIEH 2VLME 1XGUB 4HJGA 5AAMA 5LCVL 4D9QD 15C8L 4JM2B 3BP6B 3H6JA 3F7RA 3W0WD 1VA9A 5MEOB 3L3IB 5DQ9B 4J3OC 4JFHD 1K2DA 3CXDH 2GT9A 3HG1E 4OCRL 4NGHH 4K8RD 5EO9B 5EUOB 1TZGL 1OQOA 5BRZE 4MJ5B 35C8H 1D9KA 2EH8H 2ED9A 3V6ZA 5DD1H 2W0KA 4LRNH 2AJVL 4XMPL 1EUTA 1S7WB 1TCRA 1SJVA 1XCQB 2WBJB 4U3XA 5HI3C 3ILPA 3A6BL 2HTLD 1IEBB 4Y2DC 1IT9H 1VCAA 2VB5A 4KTYA 1KCSL 3Q6FA 1P5UA 1DL7H 1FO0L 4Z7VF 5DEZA 5ACZB 1TQBB 2IANA 1I3VA 5DK2A 2BOBB 4O9HH 5DYOA 4YEFA 4I18C 3TA3D 1QFUL 5DRXB 3HE7A 3AUVA 1CK0H 4HJGB 4HX1A 5I1AB 2WNGA 1TNMA 3WXVL 1KOAA 4PRPE 3GMPA 5T1LD 2ZUWA 3I3DA 2IPUK 4BK5A 4TSCH 3MLUH 3EFFA 4PRAA 1AXTH 3O4LE 4Z7QE 1K2DB 1FHGA 2GT9B 4HPYH 1N26A 3EKCA 3GMRA 4XXCA 5GZOC 1RV6X 1D9KB 1PYWB 3V6ZB 3EOTH 2EZ0C 1I1AA 1MJUL 1ZGLM 1TCRB 1V7NL 3W0WE 3ILPB 3TNMA 4JFHE 4NHCH 5HDBF 1NDGA 5CSBA 2A83A 1GRWA 3I50H 4UDUA 5TFSH 3TH2T 4FABH 3BH8A 5I1JL 4H26A 2NX5D 3Q6FB 1U2HA 3KPRA 1HH6B 2WLYA 4OM0H 1C08A 4KKAC 4OCWH 2IANB 2D2OA 5DK2B 1C5CH 4WI6A 3VG0H 3ZE2F 1MCJA 5C6WH 4NN6B 1VENA 5DYOB 1ACZA 2ICWI 2AXFA 3RNKA 4LHUA 3HE7B 1LO0H 1HNGA 2Q3ZA 5SWZB 3KHQA 2CDGB 4KZEL 1ZAGA 4BQBA 1JNNL 4HX1B 3GMPB 4UILL 3S96A 3HNTH 2CLRA 1GC1H 3D18A 1JK8A 3EFFB 4PRAB 1YNTA 4QHMA 4MAYC 3GMRB 4WU5A 4YBLC 1Y18A 2N1KA 3C87A 4X8JA 4ENED 5D7IF 1B3JA 3GHEL 3U30C 4NZUH 1BJMA 3TNMB 2BMKA 3DGGA 1NDGB 4LMQE 2XACC 4MGXA 2A83B 1F90L 4UDUB 3UBXI 3VD5A 2A6DA 1NGQL 5FYKE 3BH8B 4TRPH 4G6MH 4H26B 3KPRB 1AY1H 3EO9L 4F7CA 1NGZA 1RZJC 5DJ8A 1JL8A 1J8HA 2NY1B 4FQLL 4HXAH 4NZTL 4MA8L 1OPGL 1C08B 5HYJA 1RUAL 2YEZA 4G3YH 5E0QA 1N6VA 1I8KA 4X83A 5GRUL 2FGZA 2VQTA 4I2XA 1T2XA 4IRSA 2AXFB 3RNKB 3DX9A 4LHUB 5T3ZH 3TPKA 3TT3H 2ZG1A 4F15B 4PJEE 5GGQH 5ESVA 5ICZA 1LGVA 1BWMA 1MHPL 3NCBB 1A3RL 1D5XA 4ZODA 1I1RA 5B39G 4LPTA 4G9FD 5ALCH 1HOCA 3B9EA 2C4FT 3S96B 2VDQL 2CLRB 4S1RH 3QXUA 4K9EH 1E4JA 3D18B 3WHE1 1BFSA 1JK8B 1YNTB 4QHMB 4TTGA 2Q20A 2QTEA 4L8SA 1JGVL 5GJSH 4WU5B 1YMMD 3ARWA 1Y18B 4Z7WA 3ARFA 4X8JB 4J6RH 3DHMA 2NTFA 1MELA 4MXQC 2BMKB 2I5YL 3DGGB 4NQCA 5TF1L 2UZYB 2FX9H 3V0WL 1A64A 2A6DB 5IBUB 4ONFL 1EX0A 4OF0A 3WIHL 4LU5L 3SQOL 4W4NA 4JFDA 1HZHL 1J8HB 1NBVL 1S78C 4HIJA 4PD4K 4YGAB 5DJ8B 3MV8D 3VFRB 5HYJB 3FO0L 4Z8FH 2YEZB 3K2UL 1I8KB 2YZ8A 3CSPA 1F2QA 2YSSA 4XP5L 4I2XB 3CX5K 3FQTA 4IRSB 3DX9B 4ERSL 1I8MA 9CGTA 4Y19A 2JJSC 5ESVB 3Q2CA 5ICZB 1QFPA 4A6YH 4YFDB 5D1QA 3VA2C 4H1LH 5ICXA 3GMNA 1D5XB 2DAVA 3KLHD 1VFAA 1M1SA 6FABH 5TDOA 1E4KC 4FFYL 1RHHA 3QULA 4XPTL 1AR1C 4Z77A 5IJKC 2LVEA 3QUKB 3OX8A 4XPBH 4WTZG 1LE9A 4L8SB 4K23L 2VQUA 4Z7WB 4G9FE 1U93A 1BFVL 2M2DA 2NTFB 3PWNA 1CGUA 1JGLH 2H6PA 4NBZB 1ZA6A 2VYRE 3DBXA 1EEYA 4JDTL 2V2WA 1YMME 1OOAA 3RVXD 4G6JL 4HIXH 4HIJB 2ERJC 1ZT7A 2P5EE 3WFCH 3PXHA 3UPCA 3OAYH 2YSSB 2DIJA 2J1KA 3FQTB 6CGTA 2GW5A 4Y19B 1N6QL 1VERA 5D1QB 5ICXB 3GMNB 5GRWA 5BQ7A 1HYSD 1VFAB 2MPAH 4HF5L 5TDOB 4ZNCD 4G9DA 4L9DA 1RHHB 3QULB 2X4SA 1U3ZA 4XI5D 4ZAKD 4Z77B 3V5DA 1YNLL 3NTCH 4JQVC 5BMFL 3OX8B 4M6OH 5BV7B 1LE9B 3ZLQC 4P49A 3P9WB 1AFVL 5D5MA 1U93B 3NFSH 5EA0H 1CR9L 4OZGF 4IS6A 3SEPA 2Q8AH 3PWNB 1C7TA 4P46D 2YUWA 3V5HA 3BO8A 2BVTA 2H6PB 1P9MA 1VDGA 1ZA6B 3DBXB 2AK4E 1EEYB 4YZFF 5HHVL 3LV3A 1R3IL 3WJJC 4C4KO 2WIIA 4LSUL 4YHNA 1DBKH 3UTZB 1ZT7B 5E2WL 2FX8L 4RMQA 3I6LD 3LD8C 4IBLT 3OL2A 2ICWJ 4EXKA 1WGOA 1MUJA 4NC0B 3FTGA 3GSWA 5C0BA 5BW7A 2WINA 2DL9A 4ZYKA 5BQ7B 4HPOH 4K3HA 4G9DB 3HKFA 2X4SB 4PJ8C 4JZOA 4TNVK 3V5DB 4XPFL 2VXTL 3TC9A 2FEEL 3CC5A 5F88A 2H32H 5D5MB 5GSRA 4QXGL 3DI2B 5IBLC 4XCNA 3T1FA 3P73A 4IS6B 4Z0XA 3JV0A 3MNVA 4WY7L 3V5HB 5TE4H 4C58B 4OLZH 1REIA 5JPNB 1KIQA 2BFVH 4NC2B 3ULVL 3V79C 1RAMA 1EV2E 1H5BA 1RU9H 2GITA 3VI3F 3LV3B 1LDSA 2WIIB 4YHNB 4OI9A 5J13C 4RGOL 4Q6IA 5FCUH 3QCUH 3M17A 1S5IH 2YKLH 4M03A 1V7MH 5FV1L 2DB8A 3MLWL 5ICYB 1MUJB 1EJOH 3FTGB 3GSWB 5C0BB 2WINB 1F4YH 1NUFA 5CD3B 4ZYKB 4K2UL 4X7SH 3ZL4H 3TO4A 2YPLB 2EICA 4JZOB 3ZDZF 2B1HH 3NA9L 5KW9H 5DD5H 1DLFL 1V3JA 1X4ZA 3CC5B 5F88B 4K7PH 1UB6A 4N0YH 3FFCD 1CD8A 5GSRB 3G6AA 1FBIH 1MWAL 4XCNB 5E8DH 4RFNB 3T1FB 3P73B 3ZKQD 4PJDE 5ESQA 3MNVB 1E4WL 4WFED 3SO5A 4GBXA 1GGIL 1IE5A 3UDWA 1KIQB 3TJHC 1A1OA 3RI5F 1H5BB 3TESA 2GITB 1F4XH 4P57A 1DQTA 4JFYA 4OF8A 3T3PF 2R1YA 3VGEA 4MYWB 1G1YA 5DSCA 2PR4L 4GKZA 4Q6IB 3HTLX 3M17B 4G6KL 5F9WB 4KI5D 2XNAA 4FA8A 5KJRL 4U7MA 1NCBH 4KC3B 5E9DD 4R4BA 4WCYL 4IM8A 2GK0A 5DWUH 2MFNA 5E4EC 4WUKH 4A2MA 3MJ9A 4TPRL 4MJ4A 1LWRA 3KAAA 2D7NA 1S5HA 4P2RD 4WV1A 2ADFL 4RA3A 3UJIL 1R6VA 2EE3A 1AHWA 4W6WB 3QDGD 5EBGA 1UB6B 3B9AA 4YR6A 3HI5L 2C3VA 2VLJE 5KVGH 3QHTC 3FRPA 1IGJB 4I0PA 1XF1A 4FNLL 1U3JA 4JQIH 4M9OA 4YHLL 5ESQB 4HXBH 1CLZL 4G8EA 3VRIA 4GBXB 2W91A 4G5ZH 4O4YL 1A1OB 1F4WH 3WDJA 4M93C 4P57B 2VZ1A 3C8KA 2DLHA 4JFYB 4MMZC 4KVNL 2R1YB 4HS8H 5DK0A 5DSCB 4OAWA 4GKZB 3B2VH 3BUTA 1R5WA 4XPGL 1INDH 3BAEL 3UTQA 5FEBA 3U9UA 5MERA 4PY8I 3VXSA 3DOSA 1S9YA 2O5YH 5IVXE 4R4BB 3P4OA 4LFHD 2GK0B 1UH4A 3X3GL 2WSKA 3QXDA 1CD1A 1AO7D 2R4SH 1S9VB 1WT5A 4KI5E 1SVZA 5F96H 3S3JA 4PP1D 2E7MA 5KOMC 1S5HB 4WV1B 5F21B 1AHWB 3NOIA 2ZUQC 2ESVD 2XZCH 4YR6B 2VR4A 2C3VB 2H3NA 4MVBC 4D0CA 1P4BL 1R24A 3SOBH 1MCWM 1QFOA 2NR6D 5LXGL 2GHWB 4P2RE 4YHPA 3RX5A 4G8EB 4N8VG 3P0VL 3SE3A 5A43C 3QDGE 5GQBA 3GFUA 2C4XA 3GKZA 1V3LA 3BX7C 3C8KB 4EXPX 3EDKA 5DK0B 2MCG1 4OAWB 1R5WB 5FFLA 3E1F1 3UTQB 3U9UB 5L2KD 3VXSB 1BD2A 3S37X 5JHDD 1I9RL 1CG9A 3P4OB 4FQQA 2DQHL 2B39A 1A5FH 3ZKMD 2GQHA 1BLNA 5BOZG 2BXZA 3QXDB 4A6YB 1CD1B 3EYSL 1I9JL 4WI8A 1ZHKA 3TF7C 4JG0H 1ZLVK 1KT2A 1A2YA 3GMOA 3RU8L 3WLBA 1UM5L 1EO8L 4PJIA 1I9EA 1AO7E 3LKRA 2H3NB 4D0CB 1R24B 1AXSA 3HPLA 1FRGL 2DDQL 3LHPL 1QFHA 2BRRL 3I6GA 2AJUH 4OJFH 4YHPB 3S88L 1HKLL 4OLUH 2XG5A 4G80B 4DK3A 1T5WB 1F2XK 2ESVE 2VRAA 3MLVL 1ULVA 3CK0H 2I07A 5D6DA 2OK0H 4GMSL 4PJCA 2EIBA 1A9EA 3QEHA 4Y88A 1BD2B 3QEGL 3VRLF 4KROC 1CG9B 2R29H 4MCYB 1KNOA 5E8PA 3B4NA 4FQQB 1PG7L 3L5WA 3BESR 5INDB 4DZBA 4WENB 1BLNB 5ILTH 4XMLH 1GSMA 5L2KE 4KMTH 1ZHKB 4NJAL 1GIGH 5C07E 2RJMA 5JHDE 3HB3D 1TIUA 3F7QA 1KT2B 3NACH 1RIUH 1A2YB 2RCSH 3QPXL 3GMOB 3WLBB 2Q7YA 1I1FA 4PJIB 1QBMH 1TENA 1G9NH 5AYUL 3LKRB 3ZT6A 1CQKA 1J1XH 4X4XA 2YK1H 3RY4A 5GZNC 1AXSB 3HPLB 4XAKD 3O8XA 3S6CA 5E2JA 3F8UB 2NY7L 3MROB 4QTIH 3EFDL 3I6GB 3L5JA 4K8RL 5JPMA 2BY1A 2X09A 4MQXD 2UY6A 1DLHA 1NUDA 1T3FA 2WBKA 3H42H 2NY3C 4S11A 3ZKSD 2AEQL 5C9KA 2I07B 3MLRL 3OG6B 2CIKB 4HLJA 2RHEA 3HMWH 4KAQH 4PJCB 4HEPG 1A9EB 3QEHB 3LKPA 5FB8A 3NIFF 4JN1H 4F7EA 5K9OA 4Y5XC 2K9UA 1RD6A 3W2DL 2XXCB 1H3WM 5E8PB 3QIUD 1CDCA 1OTUD 5T5FH 5CKGA 3W39A 4DZBB 2PXYC 5DHVA 3VH8G 2FB4L 4WFFD 4NQEB 4ZTPH 5GSVA 5EORL 4EQ2A 2JELL 4JQXA 1CD0A 3N1FC 3RJQB 4Q9CA 3S5LG 2IAND 4XNZB 1QKZH 1C1EL 3L3DA 3WE6B 3HNSL 5CSGA 4UNVA 2Q7YB 1I1FB 5K9QI 2UWEF 4JKWA 4IOSD 4PV9A 5DQDL 3HE7D 3O8XB 4YE4H 4XBEH 4TQEH 5JPMB 1N59A 1DLHB 2AVGA 5FYKL 1T3FB 1U42A 1RY7B 3RIFK 5B21A 3S4SA 3UPRA 2BERA 4XAKE 2W9EL 1KCUL 1ZLSL 2GSIA 1A7NH 3LKPB 5FB8B 4F7EB 4X9GA 5K9OB 1B0GB 1BJ8A 3M07A 3ZO0A 3QNYA 4HSQA 1S9WA 1I1AD 2IBBA 2Y25A 2ZCKH 5EOQL 3NPZB 4P4RA 5F1OB 2JB5L 4XWOD 5L88L 1X44A 2BY3A 5J1TC 1HXYA 1KIRA 4U1GB 3RPIA 3W39B 1C5DA 1NPUA 3S3SA 3LN9A 5IMKB 4M62L 5GSVB 3PWPA 4KUZH 5AD0A 2FECL 3KPRD 2Y36L 5FUZH 4JG1L 3VMPA 1FNEA 1MEXH 3LSOA 1P2CA 3L3DB 4EBQL 3RUGF 2W60A 2JE8A 1B6UA 3ULUE 4WFFE 2D03L 3CD4A 3T0WA 4F57H 3D1MC 3C5SA 5L8LB 3MXWL 2R0KH 1Q8MA 1KB5L 4R6UA 5DJ6A 3ZZ1A 1PX3A 2IANE 1N59B 4FZ8H 2NPLX 4WEUD 5DVMA 1NLBL 4MXVE 3QO1A 4RISL 3VFTA 3S4SB 3UPRB 2LU4A 5D72L 1H3GA 3GI9L 3ZKND 2NY4B 5DJ0A 3OSKA 4HBCL 1EHNA 2Q7NA 2CJUH 5ENWA 3WNOA 5JW5A 3P4MA 4O58H 2GSIB 2Q8BH 1FVDA 3QG7H 2HT2D 4F37K 3BRFA 1TTGA 1ZMYA 4Z6AT 3AFLA 3RY5A 3QNYB 3O41A 1S9WB 3L5XL 1N0XH 2FLRT 4P4RB 4M5YH 1A0QL 1HXYB 3BKMH 1KIRB 3RPIB 5D70H 4GUPB 1I75A 2IG2H 1NAMA 3PWUA 4J8RA 4P59L 1T89A 2ARJA 3PWPB 5AD0B 5TF0A 4RRPG 4Z18A 3B2UC 1YEHH 3ES6B 2N56A 1FNEB 1L0QA 2OTUA 1RVFH 3LSOB 1P2CB 4OLXL 5DT1H 4JZJA 2W60B 1IAOA 3IDNA 1LO2L 4QT5A 4IRSD 2Y4SA 3C5SB 4TSAL 4KMLB 5JQ6H 3KPRE 4F58L 5DJ6B 4NQUA 1MAMH 2RR3A 4YWGH 5JW4N 1P84J 1HEZA 2IPUG 2DJUA 3QO1B 1VSCA 4M7ZB 3ROLA 3VFTB 3E3QC 4UOW1 5IW6A 5DJ0B 3PL6D 4P2OC 2Y06L 1KCKA 4IOIA 4EVNA 4N1EA 5ENWB 4ZFZA 5FYLH 5JW5B 2IPTL 3P4MB 5B38A 2V6HA 1EA9C 1I8LA 1VGEL 5DRWA 1FVDB 1ONQA 4AIZA 1QNZL 1W0WA 4YGVA 5E2VH 3ARFD 4KHXL 5J3HC 3MCG1 3RQ3A 2JJUA 3LEXA 2I60L 3C2AL 1UZ6E 3KPSA 5C0DA 5BVPH 5C6TL 4NQCD 4WHCA 2OTPA 2X1XR 1XGTA 3PWUB 4J8RB 1CICA 4XMKL 4XCFL 3VWKC 2CLVA 2DKUA 4JFDD 4RMUA 2OTUB 4GXVL 5D7SH 1QSFA 1OLLA 4JZJB 2WWKT 1IAOB 2H2SC 3ESUF 2VDLH 3IDNB 4QT5B 1SY6L 4U6YA 1OM3H 4Y19D 1J8HE 2P5WA 1SHMA 1KPRB 3SKOA 2H2PD 5D1QD 1FIGH 5HYJE 1T5XA 1HEZB 1MJJA 3UYOD 1JZ2A 3CJJA 3C60D 2ZJSH 4EOWH 1PW3A 3AU1A 1FFPA 3QXAA 4GW1A 4I2XE 3WV0A 1CLCA 5IW6B 4NBYB 4KQ3L 1YNKL 2JCCA 1LO4H 2OJZH 4IOIB 3TBWA 4EVNB 1IAMA 4FFZH 5KAQF 2R8SH 3U4BL 4ZFZB 5IFJA 5B38B 4AIZB 1AR2A 3QT2A 1W0WB 1BHGA 1OCWH 1PBYA 1RMFH 1MLBB 3EDEA 4S1DC 5EFIA 3DX6A 2QHRL 3N1MC 3KS0H 4XVTL 4IOFD 1DE4A 1JNLL 3MYZA 2Y7QA 3LEXB 3KPSB 2R2CA 1IC5L 1S7XA 5C0DB 4RAHA 1MNUH 1K5NA 4FQJL 1WLHA 4RMSA 4JO2H 1XGTB 1U8OA 1CICB 4U4BA 5E5MA 3ZSSA 4Z7WE 5KG9A 2CLVB 3RTQA 3KG5A 1KLUA 3HC3L 4YPJA 4I77L 1QSFB 4NQCE 3OPZL 3S98A 3C09B 1RUKL 2BX5A 3GI8H 4QRRA 5DD3H 4DQOH 4YXLL 1MJ7L 1P7KA 4IDJL 1O0VA 4Y1AD 3UX9B 2VZOA 4JFDE 2P5WB 3SKOB 4AG4H 1D5IH 1T5XB 1AQKH 2C3WA 2A74B 2EC8A 2WW8A 1BVKA 5FYJU 3AU1B 1FFPB 3QXAB 4GW1B 1WEJH 3RBGA 2AAVA 2JCCB 4Z95L 5I75C 5IIEA 2YD5A 3TBWB 3QAZC 1FPTH 4Y19E 2DQFB 5IFJB 3H9SA 4XNUL 2BNQA 2AJZA 4FG6D 5CD5D 5K9JH 2OL3H 4NO2A 5KS9F 2DQCH 5EFIB 2R23A 1HYRC 3DX6B 4MLIA 3S35X 4POYA 1DE4B 2Y7QB 1CU4L 2HT4D 4FP8H 1S7XB 4K94H 3RKDD 1K5NB 1BZQK 4U33A 1U8OB 4CJ1A 3RZWA 2E5EA 2SEBA 5KG9B 2FX7H 4GAGL 3RTQB 1KLUB 5GGVY 3DI3B 4KHTH 4P48A 1A6UL 1RIHH 3B9KA 1OWWA 4P4KC 3O2VH 4N9GA 4JFXA 2IEPA 1P7KB 4CMHB 4LVNB 4NZDA 3QNXA 4XVUC 5ID0A 5FM8A 2DJ4A 4L5FH 4EN3C 5F9DC 3IAGC 4XPAH 4ODXA 3MUGA 1BVKB 4RGNC 2P43B 3K1DA 1Y0LA 2YN5A 4PR5A 5IIEB 5IMOA 3H9SB 2BNQB 3HS0A 3D39D 4Y4FA 4NO2B 2R23B 4HG4K 5JORA 2CO7B 3V6BR 1P7QA 5I8CA 1X5AA 1ITCA 1D5ZA 4OV6F 2VZTA 2HTKD 4LAQL 3ESVF 1DQLL 3JTTA 2AXGA 5IR1A 4PLJC 4P2QA 3EIFA 3BKCH 3RX7A 3DXAA 2E9IA 1EVUA 5LBSL 1J88A 4DK6A 2QQLH 5D5ME 4UI2A 3C08L 4FN0A 4M6NL 2LTQC 4YO0A 1JTOA 1PDKA 3B9KB 3LH2H 4OZIA 2OI9B 3EJJX 4BFGA 4N9GB 3CSBA 2H8PB 3BSZH 4JFXB 3FT4B 4J3VA 4AYFA 5A3IC 3DRTA 5D1XA 4OGXL 3VXRB 3QNXB 3DMMA 2AEPL 5ID0B 3BDYL 4LOUD 1UM6H 5GRVK 2Z35A 1TZHA 2FIRT 3CZFA 5D7JC 5F93C 4ODXB 5C0CB 3MUGB 4DUWA 3CFKA 3TO4D 1Y0LB 1T1ZA 4XVSH 4D8PA 3WFEL 4PR5B 4OQTL 3WEXB 4RGMB 1A14L 3ULVF 5C0BE 5IMOB 4AEHL 3HS0B 4Y4FB 1IZKA 1MF2L 2DQTL 2APWA 3PV6B 4M02A 4DEPC 4I9WD 2RQ8A 5I8CB 3INUL 1D5ZB 1I9IH 5I1KH 4GBXD 5IR1B 1CL7L 3JTTB 2AXGB 4P2QB 2X1PA 3MODL 1Z5LA 4OIBA 3LVEA 3DXAB 4B53A 2ITDA 5C9JA 3CVHA 3N1QC 1U3HC 1MCFA 5F6IB 4YBQD 2FR4A 1WZ1H 4M3JA 3KJ4C 4YO0B 2V5TA 2VL5A 3JVGC 1WWCA 4H0HB 4OZIB 4DGIL 1JGUL 1KTKE 5EWIL 3BGFC 4KKCD 2X40A 3OBAA 1LDPH 1U8IA 3T77A 4YX2H 3DRTB 5D1XB 1KEML 4XHQA 3DMMB 1NC2A 2YD6A 3MLZH 1WV7T 3LS4L 2Z4QA 4J4PC 5B8CA 4Q2ZA 1TZHB 3CZFB 2CUMA 3FN0H 2XWJA 1YDPA 3QZWA 5H37G 3CFKB 4R4FH 1T1ZB 2XV6B 5K9KA 1OVZA 4HUKB 3T2NH 2LQRA 5DF0A 5I71C 4R97B 1TJIL 1SEBA 2HKHH 4I0PD 1SYSB 3IKCA 1ZE3C 1ZXQA 1CD9B 4UAOC 4JO4H 1FE8H 3LPFA 1TZGH 1Z5LB 5C9JB 2ITDB 1G0YR 4XMPH 1HILB 4I9WE 2FR4B 4ZDHA 4Y16A 5GRJH 3A6BH 2VL5B 3VXSD 3KS0J 5I74B 3FB7B 1NCTA 4NZRL 1QOKA 5IEKB 1KCSH 1OP3H 3QDHA 1U8IB 4U7SA 1K8IA 1W72A 2WLZA 4ODWA 1DSFL 1NC2B 4Y2OA 3P30L 1OSZA 4K3EL 2Z4QB 3O2DL 3UAJD 5B8CB 5HXMA 4Q2ZB 3MUY1 3OZ9H 1YDPB 3QZWB 1QFUH 5F8QC 3SKMB 4M1DL 1WFNA 1CDUA 4EEEA 5K9KB 2XWTA 5J12C 4NN5B 4RNRA 4J3UA 2NY5L 3K4DA 3IU4L 5CJQH 3R8QA 3HR6A 1NFKA 3NPSB 2HLFC 2NLJA 1T66C 3D2UA 4LPVA 5IOPA 1FGVL 3IKCB 5EZJA 1T2QH 2O26U 4KRPB 3QCTL 3SDXA 3WBDA 3FZUC 1FP5A 1A4JA 4DZ8A 1MJUH 1NCDH 2HRPL 1KIPA 5CGTA 1HCVA 4ZDHB 4Y16B 1I3RA 1H15A 1HIMH 4JDZA 5I0DA 1X6NA 4Y4KD 3Q1SL 1TLKA 1Q0YH 3E6FA 4HIIA 5I1JH 2Q3AA 3R4DA 4GH7B 2MWCA 1OAUH 4HH9A 1K8IB 4UV7L 5MEPA 3K2MC 5CJXC 1W72B 2NY2C 4ODWB 1RSFA 2HA1A 1VKXA 4L4VA 4R7DA 2ORBL 5FGSA 4CMMA 1OSZB 3VXSE 3ALWA 4S2SA 1V3MA 1MLCA 5HYEA 1WC7A 4JFFA 2DN7A 3QDAA 1T04A 2XWTB 3CSYA 1Z0MA 1JNNH 4RNRB 3O4OC 4LLWA 5KZCB 3QRFM 2OL3A 4UILH 1XEDA 2NLJB 2XA3A 3F58L 4RWYL 1QPXA 3D2UB 4Y4HD 1J86A 4AENA 1BQLL 5IOPB 5I19H 5E6YA 4K71B 2AEIT 5EZJB 4EIZC 5EOTA 1UADC 4BYHA 2XKSA 3SDXB 3SGJC 1EHXA 5FGRA 4OFPA 1A4JB 4DZ8B 3ZYZA 5ISZA 4P2YA 5SX4H 3GHEH 4P99A 1KIPB 3AMLA 1I3RB 1H15B 4JDZB 3MACH 5JUEL 4L29A 1F11A 3E6FB 5HYSA 4I4WA 3UEZA 4HH9B 4QWWC 3C6LC 3L95A 1J12A 4FQLH 1OPGH 2VUOA 4L4VB 5HTSA 1VKXB 4R7DB 3GSXA 5DLMH 4CMMB 4KVCH 1BD2E 3SN6N 3ULVC 5HHMB 1MLCB 4OF6A 3B5GA 5CCKH 4QCIA 5F3BA 4M1CD 4JFFB 3QXWA 4XP9H 5FV2A 1KB9J 1T04B 3CSYB 2M8XA 2ZNWA 2DQGL 3CH1A 1A3RH 4LLWB 4DW2L 4EI5D 2OL3B 2VLLA 4JJ5A 3BEVA 2VDQH 3O8XD 4AENB 4Y5YA 2HFFA 2R9HD 5F9OH 5EOTB 3KPNA 4WO4B 2VLKA 3VGHA 3U4AA 4PJIE 4O2CA 4JRWA 3BKYH 1N7ML 2GY7B 4CBPA 5JO5A 1FH5H 2X1OA 5TF1H 1TQCB 3V0WH 5ELIA 1UYWL 2R0LL 4ONFH 4Z7QF 1F11B 4PBWD 1EFXA 5HYSB 4YDVB 4Y5VC 5GIRA 4I4WB 3EGSA 4HAGA 4X7TA 3SQOH 3WIHH 1JP5A 4Z7NE 5JHLL 3FB8A 3A0OA 1MH5A 1ZV5A 3GBML 3GSXB 3DUSA 3FO0H 4PJCE 3K2UH 2VERN 1JWSA 4POUB 2C3HA 4DVRH 4QCIB 5F3BB 2NY6C 4ERSH 5IGXL 5MI0B 4ODHL 1FNLA 1SJHA 5DI8A 3LKQA 2UVEA 4FQCH 4GKNA 3CH1B 2VXQL 5B3JE 1MIML 3FFDB 1J0YA 1WF5A 2VLLB 4JJ5B 3BEVB 2KZ1B 4Y5YB 4PB9H 4FFYH 2HFFB 5FUCE 5GGSY 4WEMB 4P5TC 3KPNB 2OXGA 4DKDC 2VLKB 3KYNB 3EAKA 5L9DH 3NFNA 4K23H 4PS4L 4MA7L 4O2CB 1DR9A 4JO3L 2Z8WC 1BFVH 1FC1A 1E4XI 1MCSA 5HI5D 3U1SL 5JO5B 2IFGA 2AJXL 4PREA 4JDTH 3DX8A 4TN9A 5GIRB 3SPVA 4X7TB 2X4QA 4G6JH 4OD3H 1UG9A 1OAKH 3F12B 3P11L 1MH5B 1M05A 4LCUA 3VFSA 3DUSB 1J8KA 3PWPD 4L4TA 4HKZA 1JWSB 2DM2A 4BH7A 1X5KA 4O5LH 4OT1L 1T0PB 5FO7A 2BCKA 1ZANL 3MXVL 5FUOL 1SJHB 2O5ZH 5DI8B 3LKQB 1IC7L 5I73C 3V0VA 4GKNB 5SX5K 4EUPG 4JFEA 2PO6C 5C0JA 3SY0A 5C86A 4HF5H 3VG9B 4ZD3L 5JNYA 2O5XL 2ZWLT 3AB0C 3T4YA 2L4OA 3DUHA 3MRMA 1YNLH 1B2WL 3V7AG 4Q0XL 3F5WA 3EDDA 4JLRA 4MS8C 2GEEA 1AFVH 4LARL 3MLTA 1TDQA 1RZ7L 2PKDA 1CR9H 4K07A 4Z7UA 5C3TA 4N8PA 3KNBA 1MI5A 4OZHB 3ARGC 2K7PA 5IWLA 4PREB 5CZXD 2UUDK 3DX8B 1R5IA 1UM4H 2ADGA 1CFQA 3LDBB 4HJJL 3O11A 2X4QB 5HHVH 3SPVB 4KJQD 4LSUH 4ZUTA 1GVIA 1FDLH 1M05B 4LCUB 3VFSB 3WKML 2NYYD 1QFWM 4L4TB 4TSBH 4HKZB 4BH7B 5FO7B 3JTSB 1CS6A 2KKQA 1UQSA 4RBPH 1DBJL 3SDCC 5ITBH 3V0VB 1XGPA 5E6IC 1NL0L 4JFEB 1WZKA 3SY0B 4O51A 3PGDA 3PWPE 2XA8H 5JNYB 2HT3D 3MBEC 2HFGL 4WNQB 3T4YB 4HUVA 1CLYL 1I4FA 4CJ0A 1ZA3A 3MRMB 4XPFH 4NRXA 1J11A 2VXTH 4PGBA 2X2YA 3F5WB 1J5OL 4HEME 1HI6A 4HWEL 2EDFA 4JLRB 1R0AH 4WWKA 2J88L 3A6CH 3MLTB 3QQ4A 2BNRA 4FFVC 5IFHL 4Z7UB 4ALAL 2WV3A 5DHYB 4NHUA 5LWYL 4I1NB 3NAAH 2I9TA 5I1EL 5TQ2H 3MRNA 3ISWA 1EPFA 4OFDA 2ADGB 1CFQB 3O6ML 3RZCC 3O11B 2FEEI 1NCCL 4ELMB 4ZUTB 3CFBA 3IDJA 3HC4L 5IB1A 2IMMA 4PFEA 3WUWB 4V1DB 4MNQA 2AJYH 1CDYA 4LLQA 1PY4A 3WO3B 3L5HA 1BBDL 2CIIA 4UQ2A 1UQSB 4WHYG 1XGPB 4ZFFB 1S9XA 2V5SA 3MBXL 4O51B 5E08H 4K2UH 1NJ9A 1FFOA 3MC0A 3LCYA 5DZOA 2DQUL 2P5WD 3VWJD 4HUVB 4G7VH 1I4FB 1ZA3B 2K7QA 3CDYA 4NRXB 3NA9H 4PGBB 1DLFH 1CDBA 4LRIC 1V5JA 4WWKB 2VXSL 3QQ4B 3GHBL 2BNRB 1MWAH 1DEDA 5LQBL 1BECA 3ETBF 5EBLA 4YIQA 3SDAD 3I75A 4NHUB 1E4WH 4P9HL 3R0NA 2APBA 2I9TB 2HJLA 5HVHC 3MRNB 2EEDA 3DHJA 4OKDA 3OR7B 3CFBB 3IDJB 4XNQA 4K8RC 1JHTA 5IB1B 4PJ5B 4X99A 4JGUA 1T83C 4MNQB 4G6KH 5FHAH 1EERB 5KJRH 4E41A 3RTQD 1JF5A 1UACH 3IDYB 4KJPC 1MIEL 4GRWE 2CIIB 4UQ2B 5LVEA 3K1KC 3KPSE 2Y5TA 3EDJA 2BHUA 5AG9A 3KR3H 5HDLA 4LVHC 4S0TD 1VFUA 1GYAA 1S9XB 4QRRD 1KYOK 4HUMB 2A73A 1NJ9B 1FFOB 2ILLA 1D5MA 1OT1A 3FAWA 4HK3J 3T0AA 4L1DA 2FSEA 2ID5A 1RPQA 3UJIH 2CR6A 1QSFE 35C8L 2EH8L 4RZCA 4MSWA 4LRNL 3PGCA 4HWNA 5D2LB 2P8MA 1EUUA 1YC8A 2DLIA 2P5WE 4YHLH 4U0RC 5J11C 3H9SD 4YIQB 2BNQD 3I75B 1CLZH 3TVMD 3IXAA 1IT9L 1BQHA 3NCFB 2DWDA 4NRYA 1CFTA 2HJLB 4K3JH 2JCCE 4HJ0D 5A2FA 4XNQB 2OCFD 3T3ME 1JHTB 3U79A 1FIEA 4R3SA 4U1IA 4X99B 3BAEH 4XPGH 2B0SL 4NKQB 3BRDA 1OL0A 3PP3K 2VIRA 4E41B 3NGBB 3ZTNH 4UB0H 4QRSA 1CK0L 2Y5TB 3X3GH 2C3XA 3T0DA 3L3KA 1CT8A 2ZUVA 3B9KD 4TVPD 4YHYC 2A73B 4TSCL 3W5NA 2IALA 4NPYA 3MLUL 1D5MB 1S7UA 4C4KT 1T21A 3MUHL 5B39A 5CMAA 2FSEB 2NW2A 4QXTA 1ZEAL 1HNFA 4FQHA 3L3GA 4U1LA 1CBVH 4RZCB 4MSWB 3EOTL 1OAZH 5FCSH 4FXLA 2OXHA 3PGCB 2P8MB 1N5AA 5LXGH 2D3VA 1MOEA 3I50L 2OJEA 4XRCA 2Z31C 4NDMA 4Y4FD 4YFLF 3IXAB 5TFSL 1BQHB 2DWDB 4GRLB 1CFTB 4NRYB 4FABL 3BHBA 1HH9A 2D7TL 5K59E 3DARA 1FN4B 1P7QD 2HP4A 3QDMA 4NUGH 1IAIH 4EDWH 1FFNB 5CZVL 3H9SE 1D6EA 2BNQE 4P2QD 4U1IB 3WKNA 3DXAD 3DSFH 2VIRB 3EZJB 5HJ3A 1I9RH 4OSUH 3VXUA 1PVHA 4D9LH 2L7JA 2X89A 4RX4A 3L3KB 1CT8B 4ZPVA 3EYSH 1I9JH 1FAKT 1GC1L 1QLFA 2IALB 5IMLA 2MKWA 4NPYB 4HLZG 1JIBA 1S7UB 1T21B 1XIWB 5D1XD 5B39B 5IT2L 4PJXA 5CMAB 3TCXA 1J0KA 4QXTB 3RU8H 4FQHB 2RAMA 2YUZA 3L3GB 4U1LB 1BQSA 3TCLA 4PJHF 1UM5H 4TVPE 3GMQA 4LKXA 4GXUN 5AAWA 4KGJA 4MLSA 4WTZA 1FRGH 1DQQA 2DDQH 4NZUL 1N5AB 3LHPH 5GJTL 5IHUH 1WCQA 3J7HA 3S88H 4XRCB 4NDMB 3ULSB 4X9HA 1Z9SA 4TRPL 3KPMA 1HH9B 4R0LA 2FATH 1LD9A 1AY1L 3K81A 5TGBA 3MLVH 4JPWH 5H35A 4Z7OE 3QDMB 4GSDH 4HFWA 1LVEA 5CWSA 3ZKXC 2OMNA 4GMSH 4HIEA 4LL9A 2JLLA 1D6EB 3VDAA 5JIKA 5HJ3B 1E6OH 1PQZA 2CRZA 3BE1H 3ILQD 3TT3L 3VXUB 3MOBH 4CUCA 1PG7H 5GGQL 3VCLA 3L7FA 1W8OA 3MJ9L 4QO1A 2Z91A 1IJ9A 4ZPVB 5ALCL 2A6IA 3QWOA 4P2QE 3AC0A 5D96C 5I76A 4S1RL 3DXAE 3P0YL 4NJAH 1QLFB 5IMLB 3UJTL 2FJHA 2DOCA 5ESAB 1KCVH 1NC2D 4PJGA 3QPXH 4N5EC 5IB5A 2FIKA 5GJSL 3ARDC 4KTDL 2HYMA 4QNPF 3TCLB 4OZIE 3GMQB 4LKXB 4KDTC 1CXHA 3SKUD 2DS4A 2YBRA 4F9PC 5INCA 1DQQB 4PJ9A 2NY7H 1WVZA 2P49B 3EFDH 4G6AD 2PF6A 4K8RH 4U6VL 2FX9L 3BXNA 1EVTC 2AS5M 1T0MA 3KPMB 4R0LB 4HZAA 1LD9B 5TGBB 1Z9LA 2AEQH 5H35B 4ZFGL 4IRZH 4HFWB 3MREA 4YHZH 5CWSB 4HIEB 3MV7D 5BCAA 3NA4A 5JW3L 2B5IB 3O6FC 5BOPA 3WN5A 1BF2A 1PQZB 3VXMA 3W2DH 3CFJA 4QOKA 3VCLB 1V8HA 3AM8A 5LG1A 2Z91B 2YRLA 4LSSH 4GQ9H 3K74B 2A6IB 2FB4H 3QWOB 5FGCB 5I76B 2C1OA 2JELH 2P47B 4M61A 2HMIC 2XQYK 1EEQA 1JPFA 5FAAA 1JPSH 1LK2A 4U1JA 4Z7VA 4XPBL 2G60L 5IB5B 2FIKB 3H7BB 2UZIL 1F4AA 2F5AH 4CNIA 4EIGB 2YBRB 4KV5E 2GJJA 5DQDH 5INCB 3IT8D 1XZ0A 2X42A 4PJ9B 2Z92A 5CJBA 2GKIA 3AY4A 1UWXH 3LKNA 3BXNB 1JYWA 5EBMA 1HYSC 2YN3A 1T0MB 3QUYA 4GG8A 3D2UD 4NOBA 4HIXL 4XI5C 3IRPX 2R2BB 3MREB 3WFCL 1KTDA 2EKJA 3WN5B 4LMQI 3VXMB 4D0DA 1MREH 5HYIA 2JB5H 4QOKB 4J7RA 3MRLA 4P46C 3BDBA 3NCYP 1D3CA 5F6HJ 1Y6NR 4M62H 5DVKA 3D85B 2WANA 2QV2A 3MRQA 4JG1H 1JPFB 2ZUXA 1LK2B 1U58A 3NTCL 2E7LA 4MD4A 5HHMD 4CNIB 2D03H 3NFSL 5IF0A 1ETZA 3MXWH 1XZ0B 2Q8AL 1YQVL 5KTEL 2Z92B 3GEWB 3DUUA 5JOFA 3LKNB 2RBLA 5EBMB 3QFJB 1UH2A 3KPOA 1U41A 3QUYB 4GG8B 1DQJA 3GI9H 2VC2H 1QACA 4LDEB 1DBKL 1JJUA 3DNKA 1DVFC 1HHKA 1J1PL 1KTDB 1IKNC 5DR5H 3QUXA 3V95A 3CDGA 5DJXA 4F2MA 3L5XH 4D0DB 5ISZD 1A0QH 3MRLB 2B7DT 4MA1B 1JV5A 1ORQA 1F5WA 5CINL 4HPOL 3SDXE 4XXDA 3SE8H 2EDXA 4IRJA 3MRQB 1I85C 4HQQL 1ZVYA 4JM2F 3U7WH 1U58B 3OXRA 3Q3GA 4OLXH 4MD4B 1JN6A 4UBDD 4TSAH 5IF0B 1ETZB 4GQPH 4F58H 5EUOF 1KJ2H 1NH6A 1A8JH 5TE4L 3V2AR 4OLZL 3EYUL 4L4VE 2D7MA 1LEKA 2BFVL 4U1NA 3KPOB 1RU9L 2AW2A 2ZG3A 5HHME 4P23A 1HKFA 4WJ5A 2Y06H 4JFFE 1ORSA 3HCVA 5CP7A 3BZFB 1HHKB 1NC4D 5FCUL 3E8UL 3QCUL 1WCBA 2D7PA 5AUMB 2VLKD 1OW0C 1CDIA 2YXMA 4EQ3A 3QUXB 4XX1G 3CDGB 1V7ML 3VFGL 5DJXB 1A7RL 4F2MB 4GAYA 4KHXH 3O81A 5GHWH 5IUSA 4APQC 1EJOL 2I60H 2DQJH 3TBTA 1A7BA 1JV5B 3KPTA 1ORQB 1F4YL 3PIQA 4XXDB 2DBJA 3K4ZA 4XMKH 4XCFH 2BDNL 1JZ8A 1EFXD 1A02N 2DQIL 1YYLH 4IRJB 5ISZE 1CLOL 2W65A 1F6AB 2B1HL 3OXRB 3Q3GB 4GXVH 5IW3A 3SKNA 3RGVA 1EEZA 1YY8A 4KI5C 3MPCA 4N0YL 1JN6B 2DJSA 1FBIL 3RDTC 5E8DL 1IILE 2AV1A 4RMRA 1FFRA 2JTDA 1S8DA 2ZZUT 3LKSA 2NY0D 3QDJA 1LEKB 2CXGA 3GIVA 4U1NB 4Z76A 1OF2A 2P1YA 4P23B 3IFLL 5J7CC 3M1BA 4N8VA 2R2EA 4KQ3H 1YNKH 4WJ5B 1AKJD 3WS3A 4KK8D 3ULUF 1PEWA 3HCVB 5CP7B 3PDOA 5JR1L 2Y6SD 4RFOH 1WCBB 3WJLC 5T3XH 3QPQC 4R2GC 1AXIB 3DV4A 5HGHA 1MVUA 2R56L 1BJ1H 1NCBL 4UT7H 3HR5B 3TZVA 2QHRH 2VZ3A 4LCIL 4XVTH 5SWSA 4MXVF 1IC5H 4LLUB 4KDWA 4WUKL 5DJZB 4TNWF 4FQJH 4M4PA 5CEZD 2VLKE 4ZPTA 3PIQB 1K8DA 1KLFA 1NCWL 4IMKC 1G7PA 2VSCA 2F19L 3BGMA 2UYLA 3ARVA 2JJTC 3ARYA 4B7IA 3SKNB 4DN3L 3RGVB 4F9LA 4I77H 1EEZB 1YY8B 5C08D 5D9SB 3OPZH 3NZ8A 1A4KA 3HI1B 1RUKH 4URTB 5KVGL 4X7FC 1Z9MA 1MJ7H 4YXLH 4IDJH 2C3GA 2AV1B 4JQIL 5HYFA 1S8DB 4JHZA 3LKSB 4XAWH 3KHOA 1FZJA 5CIPA 4CVZA 3QDJB 4JFED 3GIVB 1F4WL 4Z76B 1OF2B 2FZ3A 3M1BB 4CVUA 3UTTD 1T03L 2R2EB 1DTUA 3WS3B 1JPST 4Z95H 1DEEA 1ES0A 1F6LL 3PDOB 4RMVA 3B2VL 2FJFA 1RJZA 3C5ZC 5I30L 2HWZH 2O5YL 4KRNA 5HGHB 1MVUB 3TZVB 4R7NA 3DV6A 4RQQA 1X9QA 5SWSB 3UTOA 2NR6C 2GJ6A 1MFDL 2F53A 5DVLA 1RURL 5I6XC 2FEDD 1MI5D 1HE7A 1NAML 1QSZA 1GGYA 4PRHD 4PRBA 4ZPTB 1GAFH 1TVHA 3TA3A 1J9CT 1K8DB 4WW2B 5F96L 1G7PB 4P5KA 4JFZL 3BGMB 1P7HL 1KPUA 2DYPA 1A1NA 2J5LB 1A6UH 1PG7W 3PQYD 2XZCL 1UZ6F 3LN4A 5CEZE 3NZ8B 1A4KB 4OGZA 1ZOXA 3X14A 3OGOE 2EC9T 4XZUA 3EHBD 2QADC 5CIPB 1FZJB 1KXTB 4YFLI 3W82A 4CVZB 4ZTOL 1KPVA 5C92A 3FT2A 4R9HA 3GB7A 3QI9A 4L4TE 2FZ3B 2VO5A 4L3EA 2PTTA 1Q9KA 3BI9X 3OMZA 2FJFB 4JAMA 5DURB 1RJZB 5JDSA 4EZMA 4JFEE 5A40E 4WWKD 4JPKL 2EC9U 3DV6B 2NX5A 4RQQB 5CUSH 2BNRD 3WO4C 1NKOA 1X5LA 3HE6D 2GJ6B 2E9JA 2F53B 2KH2B 1RULL 4JM2C 4PRBB 1DQLH 2CQVA 4JRYD 1UT9A 43CAA 1UGNA 1N8ZA 1TVHB 3TA3B 3QQ9D 2BVPA 4UDTA 5LBSH 2DYPB 3C08H 5H8DA 1A1NB 5I17A 1GZQA 4Z7UE 3CLFL 3JWDC 3CU7A 1MI5E 4MNQD 1L7IL 3LN4B 4M4RA 5T1LB 3S5LA 1JHKH 2ICCA 2J2ZA 2VWEE 2WBJC 3X14B 1QYGL 4U6HA 5DJCA 3QJHA 3B9DA 4XZUB 3BPNB 1KPVB 3FT2B 4V1DE 2FO1A 1UB5B 3GB7B 1SYVA 3I85A 3QI9B 3HB3C 4L3EB 4LPWA 4YDIL 2PTTB 1Q9KB 1TQBC 3WFEH 4OQTH 1A14H 1BVLA 4JAMB 4PB0H 5JDSB 1ZT1A 2E9WA 5FGBC 1MF2H 2BC4A 2DQTH 5HHQA 5CSZA 2NX5B 3QUZD 5MHSD 1N64H 3INUH 4HV8A 4MQXC 4OCXH 5ILTL 4XMLL 5HBBA 3WLWD 1QR1A 1N8ZB 4LLDA 1GIGL 1MCEA 2BVPB 4NUJA 4UDTB 2EYTA 5IMMA 2R1WB 4YHOH 3IJYA 5GGSA 3NACL 2BNRE 2RCSL 3F65A 5I17B 5EZOH 1GZQB 2Q1EA 1D9KC 4BM7A 4DGIH 1JGUH 1G9NL 3S5LB 1EHAA 1QSVA 4E41D 4U6HB 4W70A 1CL7I 3QJHB 5DTFA 1KEMH 1KJ2A 1DJSA 1TCMA 3ULUC 1AIFB 3QP3A 3LS4H 1RZ8A 1U8HA 3PHQB 1KUMA 1SYVB 4MNQE 5GISL 4U1HA 4KGLA 1FG9C 4OLVL 2ZP0T 4JFOA 1LP9A 4ZO6A 5HI3D 3X3FH 4W6YB 4KAQL 3HMWL 3TLRA 4UOJA 1BVLB 2J8HA 5F1NB 4NN6C 1ZT1B 4JN1L 4DGVL 2BC4B 1I7ZA 5BZDA 2FBOJ 3LMJH 5HHQB 3HE7C 5CSZB 5E6ZA 5T5FL 3DRQA 3MV8A 4HV8B 4D3CH 2E8YA 5CILH 1QR1B 1E6JL 4LLDB 3JWOH 4NUJB 2EYTB 5HGBA 5CJ8A 1Z9OA 3IJYB 4N90D 5MHSE 5GGSB 4HUXA 1UH3A 3T2QA 3MRFA 4KKLD 4AY0A 5J1SC 2BVYA 3H7LA 3HRZA 4XXCC 1R3LA 3EW3B 4TVPL 5KSBA 1BJ1J 1RJYA 4G9FB 1Z2KA 4HT1H 4XWOC 4XBEL 5EO1A 5DTFB 1KJ2B 4BFBD 3BPCA 3N9GL 4WU7A 4HUWA 2EE6A 5D5MF 5GZOD 1RZ8B 1WIUA 1U8HB 1RZFL 2EZ0D 4BK4A 5FK9A 4U1HB 5JXEA 5EU5A 2NY1C 2MCPL 4E41E 1FORL 5MP6L 2BZDA 3CNKA 2DKMA 1LP9B 1YY9C 4JFOB 4M1DH 1AGCA 1ODAA 4XNYL 1A7NL 2LU3A 4QXWA 1KACB 1R3JB 2NY5H 3IU4H 1NSNL 3QB7C 5FF6A 3RVVC 1I7ZB 2AV7A 5BZDB 1C16A 3OJDA 2AJ3A 4LDOB 1KN4H 3EO0A 2E7BA 4F15C 3O9WA 3SGKA 5GS1A 1FGVH 2AK1L 3DRQB 4KKAD 5TDPA 5IHZB 4LQFH 3U6RA 4IIQA 3MV8B 4X6CF 3B3IB 3SGDH 2NXZB 1IM9A 4KUZL 3TN0A 3B5HA 1CXFA 2IH1A 4HUXB 2HRPH 3MNZA 5IJVA 3MRFB 4F7PA 3HRZB 1PLGH 1R3LB 2EDRA 5KSBB 3HFMH 1RJYB 4WTWA 3Q1SH 4F57L 3JWNC 1U36A 2R0KL 3VXUD 5ADOL 3DO3A 2XY1A 5EO1B 4N90E 4MAYD 2COQA 4UV7H 4D94A 5C0NC 2X89D 2GY5A 2M26A 3BPLB 3BPCB 4WU7B 4HUWB 2ORBH 1XF2A 1Z0NA 4JHAL 1P5VA 1QLEH 1CN4A 5FK9B 1OGTA 4ZMAT 5EU5B 1NCUA 1ND0A 4FOMA 3GSUA 1AGCB 3S37H 5FF6B 4IRSC 1IL1A 1N0XL 3OJDB 3AS3A 3O45A 3F58H 2AJ3B 3EO0B 3ELAT 1BQLH 3O9WB 1FYTA 3F7VA 5GS1B 5TDPB 1S9KC 1IKFL 4IIQB 1JMXA 3BEWA 4POZC 1IM9B 3UC0H 3CVHL 3GSRA 4JE4B 4YUEL 3TN0B 2IH1B 3KJ6L 5CP3H 4K55A 1N5YL 2DM3A 1WZMA 1RVFL 3MNZB 4XP4H 3SKJH 5IJVB 4L8SC 4F3FA 4MQ7A 1YYMH 5HD8C 2G75A 1NGWA 4P2CG 2B2XL 1NFDF 5DMJB 2G5BB 5C2UB 1MAML 3QDME 4ZAKB 4LHUG 3C6SB 3IAPA 1XF2B 4JFPA 3REVA 1II4E 2X6MA 1OGTB 4P0DA 3RWHA 4F80A 3VXUE 1FVCA 3NFPA 4MXQD 1ND0B 3GSUB 4KXZH 1RZIA 4C54A 5IQ9A 3ZTJG 4NQTA 2DQGH 3P3YA 4DW2H 4Q7DA 3CX5J 3O45B 2LU7A 3D5OF 3F7VB 4OIIL 5F7DA 1FV1A 5D1QC 3RY6A 1X5GA 4PJXE 3BEWB 3GSRB 5CGMA 4MHHG 4LKCA 3X12A 3AVEA 2MOVA 5IVZA 3T0XA 4X4ZA 5EOCL 1N7MH 5BV7C 4PP2A 4F3FB 5CZKA 2G75B 1NGWB 2OLDA 1UYWH 2R0LH 4IOFC 4H5SA 2YWZA 1AR1D 1W72L 4QOKD 3HZYA 4DGYL 1F42A 1CDJA 5JHLH 1NGPL 4LP4A 4M7KH 3GBMH 4JFPB 4P9HC 5EC2B 3REVB 1MRDH 3FFCA 2ZOKA 1LO4L 3VW3L 1FVCB 3NFPB 4FFZL 5IGXH 3GGWA 4RA0C 1RIVL 3I02A 1RZIB 3OAUH 1RMFL 3WNKA 1CGTA 5FGCE 1OTSD 5GS0D 1XF3A 2UWEA 3VXQB 5BJTA 5F7DB 1FV1B 4XCCH 1MNUL 4JO2L 4PJGE 4CVXA 3NN8A 3QUYD 4OLYH 3GSQA 4LKCB 5DQJB 1JZ5A 5E9DA 4MA7H 5IVZB 4AH2A 3H3PH 1TNNA 3V4PL 2WQRA 1JRHH 5CD5C 4J3WA 4FG6C 4PP2B 4AM0A 2AJXH 5GPRA 3GI8L 3PDDA 4DQOL 4H5SB 2PW1A 1GHFH 4X4MA 2XTJB 3HZYB 4PPTA 3RKDC 1D5IL 1AQKL 1P9MC 1FZMA 5KVMC 3FFCB 2XKNA 3RFZC 1WEJL 4LVEA 2ZOKB 3VXME 1TFHA 4ZOBA 1HN1A 4QOKE 2UV3A 1FPTL 3FKUS 3GGWB 2XZQL 5FUOH 4W68A 2OR7A 3I02B 1IC7H 1FZOA 2OL3L 3RUGA 4UOW0 5IVXB 3SDDA 2CKNA 1K4CA 4X0KA 1XF3B 4ZD3H 1OLZA 5FO8A 4FP8L 2O5XH 5BW7C 4K94L 4Z7VE 4NM4L 4CVXB 4Q0XH 3TGXA 4MDJA 2JIXA 3N06B 3NN8B 3GSQB 5E9DB 4LARH 4AH2B 4LCWA 1RZ7H 1WSST 1CGYA 4N0CC 1RIHL 1IEAA 4AM0B 3QUXD 5GGRB 1ZHBA 3DYMA 4RFNC 3MYJA 4PJ8D 4NJ9L 2DLGA 4PJIF 2HTKC 1ACYH 4L5FL 4LIQE 3EDFA 1B0RA 1BOGA 3WKMH 1FZMB 1H5BC 5DUML 2XKNB 2XQYG 4MHHI 5HDQH 3U2SA 4Q6IC 1DBJH 5J89A 1YZZA 5F9WC 2ATPA 3BMWA 5HDBE 3RUGB 4UUJA 3SDDB 3PUCA 1K4CB 2ZSWB 5HPOA 4X0KB 4X7CC 4PUBH 4EUPH 2V2XA 4PJCF 5DK3A 4DTGL 1CLYH 3EOAA 3RWDA 3PWJA 4MDJB 1J5OH 2JIXB 4X98A 4I0KA 1QVOA 4P23D 3GSVB 3O3DA 4FRWA 1GC1C 5D7LA 1IQDA 2J88H 3KYOA 4LCWB 5B3JF 1LNUA 2IBZY 4ALAH 1P4IL 3VRJA 1IEAB 2YUXA 2NXYB 3LH2L 1F3JB 4X5WA 1AO7B 5LWYH 4MB5A 5I1EH 1ZHBB 3MYJB 3O6MH 5T1DH 1WJ3A 3MRIB 4JY4A 2DTML 3S36X 3OAZK 3U7YL 4AEFA 4GBXC 1UM6L 4X6FA 2W92A 3UDWC 1B0RB 5GRZA 1BOGB 1MFEL 4MQTB 3BP4A 1O5DT 1FZKB 2FL5B 4YBQC 1JYXA 1XGRA 4NO0A 3U2SB 1BBDH 3VFOA 4BQ9A 3KPLA 1MCQA 4XPHH 1NLDL 2ATPB 4KKCC 5MEQB 3MBXH 4UUJB 3GKWL 2V2XB 1N4XL 4G43A 5I8EA 1X5JA 1WFOA 1I9IL 4ODTH 2CO6B 5I1KL 3JVGA 3EOAB 3QDJD 3RWDB 3PWJB 3DTXA 3SBWA 4FQ1H 3W9EA 4X98B 1QVOB 1PY9A 3EBAA 5JHDB 3K8KA 3O3DB 4K9EC 1IQDB 3CLEL 2VXSH 3KYOB 3HPJA 1DN0A 3GHBH 1J0ZA 5CP3A 4WV1C 3TIDB 1LNUB 2DIBA 2EDYA 4PJ7A 5LQBH 3VRJB 5CEZL 1AHWC 5IESL 2E27L 2BY2A 1CE1H 4X5WB 3RI5K 2BY0A 3QA3A 2GFBA 1KGCD 1HWGB 4YX2L 1SJXA 4JY4B 5DMGC 4PRID 2P7TA 1MY7A 3NCMA 3U4EA 4BA8A 3FN0L 4PG2C 1HHHA 3BP4B 4L4JA 3ZSTA 4R4FL 2QL1A 5DC0A 1XGRB 1ERNA 3VFOB 4UT6L 5AYQA 3KPLB 3UBXG 3T2NL 5FECA 2OP4L 4MJID 3FJTA 2HKHL 2EEAA 1U6AH 4G43B 5I8EB 3FQWB 3BD4A 1FNHA 3KPQA 1AGEA 1P4LA 4JO4L 1FE8L 3DTXB 2NNAA 1WT5C 4X6DA 3W9EB 3RWIA 3H0TA 2V2TA 4LLVA 4NT6A 3HPJB 1DN0B 3QIUA 5AWNH 2FGWH 2H1PL 1Q9OB 1SQ2N 4PJ7B 5GRJL 5DURD 3TWCL 3QDJE 4NQXA 2BSSA 1CGSH 5KS9A 4W4OA 3QA3B 1IC4L 2GFBB 2GJ6D 1S7RA 2F53D 1YMHA 5DHXB 3BGAA 2P7TB 4ETYA 4N9OB 3U4EB 2X4TA 4WIQA 3SE3C 4E9LA 2XG4A 2B0SH 3OZ9L 1HHHB 3BIBX 3R0MA 4H0GA 5IB4A 3RVTC 2DYPD 1KGCE 2J6EA 5SWSE 1ZS8A 3EUUA 2YMXL 3KLSA 1CGWA 3NCEB 3MOAH 5FECB 3WIIL 3S35H 5CJQL 4GKSA 1IEHA 1EFQA 4U49A 3G9VA 1UKSA 1X5YA 3QISA 5B3NA 1T2QL 5C0AD 2DF3A 1KJMA 3KPQB 1AGEB 1IC1A 1ZEAH 1P4LB 2CD0A 4WI9A 4TUKH 4HC1A 1IGML 2NNAB 4D9QE 4X6DB 3QI9D 3RWIB 3H0TB 2V2TB 1NCDL 5LAXA 4LLVB 4KK5C 4L3ED 4JREB 2D9QB 3QIUB 4TTDD 5C09D 4BSWA 3FQUA 3MTRA 5LGJA 1HIML 5J6GA 4JR9L 1VACA 4TUOA 4Y7MA 2Z0BA 4NQXB 2BSSB 1Q0YL 4XP1L 4XP6L 5KS9B 2D7TH 1OAUL 2Y72A 2HFTA 1S7RB 1UEMA 1YMHB 1MCPL 3V5KA 1AE6H 2X4TB 1UVQA 5CZVH 2V5YA 1RZGA 4H1LG 1NEUA 1MCRA 5D6DC 2GJ6E 1ZS8B 2XFXA 3UZVB 2F53E 4RDQF 3F62A 4GKSB 3LRGA 5I19L 1RZKL 25C8L 1DFBL 4D9RD 1EBPA 5F1SA 4YZFE 3K8MA 1FJ1A 2EH7L 4M00A 2BSRA 5IT2H 2F8XC 4YC2B 1KJMB 1WIPA 1F45A 1QPPA 4KROD 5IVOA 5L8KB 1I1AB 1IRAY 5FUCC 4KQ4H 3DIFA 4PRDA 2X4UA 4BSWB 3EJZC 2VITA 3FQUB 4XNZC 5GJTH 5LGJB 3LQZA 5J6GB 3GSNH 4TYUA 3MACL 1VACB 2YRZA 5E95B 3O8XC 5IB2A 3AREA 4L3EE 3GRWH 3V5KB 2X4OA 5IVNA 5DLML 1UVQB 4RFEA 4KVCL 1WFTA 4Z78A 4QKXB 4LVOB 2BHZA 5GZND 1RZGB 4GW5A 4JY6A 5DD6A 5CCKL 1LEGA 2NX5E 2HAZA 3RAJL 4XP9L 4UMGA 3B5T