3BGFB

X-ray crystal structure of the sars coronavirus spike receptor binding domain in complex with f26g19 fab
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
216
Chain Sequence
EVQLEESGTVLARPGASVKMSCKASGYTFTTYRMHWIKQRPGQGLEWIGAIYPGNSDTTYNQKFKDKAKLTAVTSTSSAYMELSSLTNEDSAVYFCTREGIPQLLRTLDYWGQGTSVTVSSAKTTAPSVYPLAPVCGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into immune recognition of the severe acute respiratory syndrome coronavirus S protein receptor binding domain.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein/immune system
molecule keywords Spike protein S1
total genus 40
structure length 216
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bgfB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bgfB01
5I8OH 2VZSA 1EO5A 3K2MC 4NQCD 1WC7B 2X4PB 5F88A 2QADD 4DUVA 3ALPA 3TH3T 1IKFH 2DQUL 3S34H 1MJUL 3MROB 1NGPL 5EZLB 5TJWK 4ELMA 5KJRL 1HDMB 1MCOL 4MAUL 5C0BE 4LAQL 4L3CA 2AABL 1A3LL 4W6WB 2NW3B 5E0QA 3B2VH 3F58L 3CSYB 4IRSC 5I15H 3DROB 4GQ9H 4N0FB 2NTSP 4MJ5B 4LPCA 4EIGB 2VXUL 4OAWA 4YHOH 3QCUL 4L3CB 4MDJA 5DK3A 3MUHL 1IBGL 2VLRE 4WI9A 1BQHA 4OD2B 4R3SB 4LSVL 2EIZB 3VWKD 1YZZA 2A9NL 1AD0B 4MJ5A 2N56A 5BOPA 2FEDC 2F5AL 2DLGA 4XP9L 1URLA 4XWGL 2HWZH 4L4TE 1FL6B 1EJOH 2OK0H 4MNQA 3MJ8A 3OGCB 5BMFL 1IQWH 4RGND 5DEGA 4FTVB 1S7XB 1FCGA 2IPKB 1ZEAH 2Q86A 3BP6B 3O2WH 4M62H 2EDXA 5JW4M 5C0CE 5KANI 5CGYD 5MENB 1QLFB 1XCQB 3ULUD 5D2NA 3U9PL 1X5FA 3X3GH 3BW9A 1QQDA 2AXJA 2HJFA 2OL3L 4L29A 4LHUD 4LVNB 2BSSA 2Q20A 4YC2C 1DQQA 4F58H 4PTUB 2ZP0T 1UENA 3EDEA 5EC2B 5MEND 5ITBL 1BAFL 3NOIA 1KIQA 4GAFB 2AXFA 1MLBB 1DDHB 3DARA 4KK5C 3FKUS 3SDXB 1XR8A 1JWUB 2P43B 5CJ5A 2AJSH 1T83A 2FECL 2OMBA 2QQQA 3O45A 3BKJH 4GKOA 3SGDH 3ARPA 2VZ3A 2X9XA 4GT7A 3VFTB 4K71B 3VXNB 3D39D 3B9VA 4P4KB 1T22B 2SEBA 3OJMB 1DEEA 4O2CA 1J18A 1YEKH 3RUGE 1N7ML 4Q9RL 1QFPA 1FLRH 3ZYOA 3GSOB 3SGKA 4JCLA 1F3DJ 1AIFA 4NKOA 4UINL 4P9HC 1F4HA 1OTUD 4ODHL 2N7BA 3N9GH 1IFHH 4LSDA 1UXWB 1DP0A 3VI4E 2QHLA 1NAMH 1FNLA 1IEBA 2KH2B 4Y5XB 2UVFA 5TE6L 2P8MB 4RIRB 4W70A 5HGAA 4O51B 1NSNH 3TCLA 4X9IA 4JB9L 5SX4H 3MUGA 4Z7VF 4OIAA 5INCA 3TO4B 1ACYH 2IC2A 4NQDB 2VLJB 2CDFA 4APQB 1MCEA 1EUUA 1A47A 2HFTA 4F9PC 3SKNB 3AMLA 5SX5K 3C9NA 2J5LB 2Y1VA 3SE4A 3SJVA 4YX2H 2J8OA 3P4NA 4YHPB 2DL2A 4U1NA 3QDAA 3V6OC 2NQCA 1U8IB 3WLBB 3HPLA 3HRZA 3QCTH 5DK2A 4I13B 4ZUTA 5CEYB 5JOFA 2PTUA 4OT1H 4MSWA 4XTRD 5T1KA 4F9PA 4PJAE 4D2NA 2NTFB 3P0VH 5DJXA 2W07A 4F37F 3BVNA 4RX4A 4Z7VB 4X4YA 1MCBA 3G08B 4XP4H 1MRDL 4JDVB 3HE7A 4L1DA 5TF1L 4F7MB 2NX5D 2QQLL 3NN8B 4FZEH 1DBKH 2WWKT 2XN9D 5C2UB 4TUKL 3VJ6A 4ZUUA 4KVCL 4HUXA 3T65B 3DVGA 1X5KA 4FQPA 3AXLB 4PJXF 5T1LA 3H9SD 3OKMB 3PABB 4AEIH 2JJUA 3E3QE 4WWKD 1KIUA 3HRPA 2VAAA 4OLWH 1AFVH 5E56A 3UPRA 4JANA 2ZSVB 2ZZUT 4X9FA 5D7IA 1RZGB 2JJSC 4WWKB 2QV2A 1F02I 2OJEA 4ZTPL 3RWJA 2XV6B 4IDJH 2QADB 3EZ8A 4JFHD 2OTWA 2AQ1A 3QEQB 4ZXBD 4IJ3B 3WIHA 3EYVB 3ARGB 1IM9D 4NKOB 3L3DB 3C6SA 3MLWH 5C9JA 4P0DA 4C83B 3QXAB 5GGQL 5JQHC 1QSEE 4OB5H 3D0LA 5EU3B 3RY6A 1KEGL 4FHBD 4P4KA 3KXFE 3QA3B 3NBNA 3VG0H 3DETD 4QRRA 3BRGC 5JDJA 4PP2B 1TZIA 2HA1A 2W0PA 4PJHA 3RNKB 5DD3L 4MB4A 3QUZA 1K3ZA 4DGIL 4PJBB 2EKSB 3EFDH 1NFIB 4HWBH 1IGMH 4M48L 1NKOA 3HE6C 1GPOH 4Z7WF 4BUGA 1LO3L 5K59E 2FB4L 4BSVB 2HT2C 5FYJH 2ZG3A 1TMCB 1RK1A 4XCNB 1DSFL 5LKNA 3WD5H 3WEXA 1FORH 3RKDC 3X3GL 3AMKA 3ZKMD 3C2SA 2OP4L 3TBWA 2M26A 4UTAH 3OAZK 4L1HA 5ESAB 1ZKAA 1F4WL 4N9GB 3G5YB 5BW7C 2O26U 1JPSL 5JZ7C 3NTCH 3H42L 4P2RD 3MV8B 3NZHL 5LGKA 1FZKA 2YUXA 3B4NA 5AEAA 1YEFL 1P7KA 2AKRA 4KKBC 2XQYG 1CFVL 4ZUWB 1TJIH 4GOSA 3RZCD 2VB5A 4XAKD 3T0VA 3KPRE 2WBJB 1ZT1B 4RSVA 3DPBA 4RDQF 2YSSB 3BDBA 3IJHA 3TFKC 2PXYB 5GGVY 2R2BA 3T0EC 1JIBA 4HUUA 5F7MC 4ORZC 3RWIA 4BH8B 5J6HB 3CXHJ 2ORBL 3MOBH 4KMTL 4JB9H 3TV3L 3BZEA 1NSNL 4C54A 3KR3H 4GO6B 4Y16A 1Q8MA 4QRPD 5E24E 2P8PA 2BXZA 3RY5A 3RGVA 4LPVA 5JPMB 1NBVL 1E4XH 5EU3A 2Q76B 3TN0D 1WGOA 1B2WL 4GW4B 4TTDD 3U7WH 4JFFB 4NN5C 3UBXI 5KG9B 4DW2H 3ZKNC 1A4JB 4XP5L 5FK9A 1ORSB 3QWRA 5IG7B 1P7QA 4PJ7B 3MGOB 3DYOA 1OAZH 2ARJQ 5ESAA 3SCMD 2BHUA 2A0LC 4LSUL 4LP4A 3V4VH 4CKVX 4RWYH 3REVB 4CW1B 3WKML 5CUSH 5LVEA 2BNRB 3IXTA 3SEPA 3MA9H 1EX0A 3C8KB 3F7YA 3P4MA 4RZCB 1QBMH 3G6JE 1CFNB 4F9LA 2E9WA 2WUBL 4EEEA 1IAKA 3QXWA 1NDGB 4GBXA 3L1OL 3VFUB 2QSQA 5SV3A 1XGPB 1K4CB 1JPSH 3LRGA 4Z7QF 1U8HA 1CGYA 4M3KB 4OSUH 5F1NA 2DQIL 3NACH 4PRAB 4YHIB 4PRPB 2GJ6B 5I17A 1VERA 4JPVH 4LSTL 4M4RA 4WFGE 4NIKB 1LO2H 4UQ3B 3U6RB 2CRIA 4P2QB 4DK6A 5HJ3A 4OLVL 4UAOC 2AS5M 1EVTC 3ZDZE 2BY0A 5H35B 4EQ3A 4ZD3L 4OCWL 3RY4A 2HWZL 3FOLB 4JY6A 3DO7A 1JGLL 2JJSA 2JCCA 1EERB 1HQRA 5DK0B 3PWJA 1MCIA 3VWKC 4JFPB 4DFHA 4FNLL 4CNIA 3KPPB 4P2OA 3TBVA 1F6AB 5ETUB 4L8BB 1H3GA 2FX8L 1AO7D 4PJGA 3QQNA 4P23D 3BPLC 1RFDL 5E2TL 1B88A 3MJ7A 2VAAB 3L5XL 1FSKB 3OKKA 4FQ2H 3D2UD 4PJBE 3NCCB 3FQXA 2R23A 4R4ND 3PIQB 4U31A 5CSZA 3MRCB 4HXAH 2DJ4A 2W9EL 4UUJB 3VD7A 1CICB 5L0QB 4K2UL 2R0LL 5F7YC 1ZT4A 5I76B 5D1QB 3TNMA 1N0XL 5DYOB 2EH8H 2MCG1 3TIEA 3WNMA 4ZFOL 4F2MA 1HILB 3QXUA 1I1YA 3KLHD 3MRRB 4LRIA 3MFGB 4AQOA 3S35H 3MYZA 5E5RB 5DEFA 1RI8A 3HB3D 4Y4HA 3LKSB 1WEJH 1SMOA 4ZFZA 5BJTB 5GS0C 5LBSH 3QEGH 4NO0B 3O45B 4JQXC 1BZ7A 3GB7A 1N6QL 3S36H 4NPYA 4HLZG 4Y7MA 4PUBL 4W68A 1KLUA 3KAAA 3W5MA 1VDGA 4MHHG 3HE7D 3FZUC 5FAAA 5HI3C 4R97C 5JNYA 1DR9A 1BJ1H 2AK1L 3ZE0F 4P4RB 1FFNA 4MZ2A 2HFFB 1A14H 3DRTA 3D39E 5F9OL 3U83A 2Y07L 2VDRH 3LB6D 4R6UA 4BYHA 2UY6A 4K55A 4NT6A 4HK3J 3TN0C 4QRRE 4Y5VB 1M71A 3WN5B 3KXFA 5ADOH 2MNUA 4PTTB 4BZ1L 2YWZA 3MLSH 3QEUA 2NY6B 4HK0A 4QHKJ 5IK3B 5T3ZD 2HMIC 4UIKL 5DJZA 2BOBB 3UJTL 5HHME 3GIVA 5KSVA 4Z7OF 5C0BB 1DEEB 1CLZH 2APWA 1CD1B 4YHNA 5HSFA 1EZVY 1FVCB 3R8QA 5F1OB 4IMKA 1JL8A 2OSLA 4PRNB 3U36B 3VA2C 1EEYA 1UEYA 2B2XH 2VWEC 1U92A 4J8RA 1U93A 4HHAA 4CL7A 4Q7DA 1DN2A 1NANH 1MJJA 2H32B 1BQLH 1JGEA 5CBAA 3DROA 1SYVA 5D9SA 2IAMA 3BEVB 1CGUA 5EN2A 1UACH 4LPXA 2CUMA 1YEKL 2PUQT 4J8RB 2CGRL 4PJDF 1XGTA 3HZYB 4I9WD 4J4PA 4LMQE 5F96H 3RPIB 5D2NB 4Y1AE 3IFLL 4XPGH 4Z0XB 1WWCA 1OVZA 5J06A 4FTVA 1L7TH 2A6DB 2DLFH 1BREA 3QFJD 1G1CA 3L1OH 3BN3B 2XTJE 3MPCA 4GXVL 2KQNA 3BIAX 1GGBH 4YHMH 4I0PA 3O3AA 4OF7A 5I71B 5I9QB 5J12B 2AV1A 1RIUH 1KCSL 3T8XA 3WSQH 1UA6H 4NQED 7FABH 5M95B 4RWHA 3DVIA 3HR5B 4OLEA 5BS0D 2GUOB 2R9HD 3BZDA 4M7KH 3IDNB 4OAWB 2Q3ZA 2WIIB 3O2WL 4XXDA 1OLLA 3VE0A 4AZ8A 3MUZ1 1WAAF 2WINB 4JFDA 3QH3A 2C9AA 5FV2A 3CSYA 4YBLC 4PJCF 2NY3C 1BIHA 4RAHA 1U92B 3KJ4C 1FNFA 2J8UF 2H2SD 2X4SA 4G42A 1C08A 4ELMB 2E27H 4X6FB 1U91B 5D7LD 3OKDA 4EI5B 1JYWA 3BWUC 4NGHL 5I1CL 1CVRA 1ZA6A 3MBEA 4EN3A 5IQ7H 3RIFK 2VDQH 1U8LB 5TE4L 2A73B 4WGWB 4K7FA 2ZJSL 5EBGA 2C4FT 2XFXA 3SKMB 1GGUA 3MQIA 3ZKQD 1LK3L 5DS8A 3RWGA 1QVOB 4PGEA 4X7EC 1NCWH 1C5CL 4XPAH 3K8MA 4MXVF 1PYWA 2X4OA 5DD5H 3ARBB 5TE4H 1EFXA 1FG2A 5D8JH 3LKNB 5ICXB 5TDNB 1F11A 5H94B 3DYPA 4LLQA 4HUVA 1HWGB 1Z9LA 2CKBL 2NY4D 2DQUH 4AYFA 4EKXA 3KJ6H 1A6UL 4HLJA 25C8L 4LGSB 2DS4A 3RFZC 1GGIH 4NKDB 3VFSB 1AXSA 3KPMA 4ALAH 3B9KC 4MB5A 3NA9L 4OIIL 2WQ8A 4NRYA 1HKFA 5FFLA 1B0GA 1ZHKA 3Q48A 3ALXA 3AAZB 4KJYA 4JQXA 1NEZG 5HGHB 5E9DD 2VXVL 3S37H 1MFNA 4ZUVA 3EOBA 3GSUB 3NPSB 4HZLA 1UZ6F 1CZ8L 5EBLA 4P4KC 4DUXA 1NGQH 5E2WL 5BVPL 2JB5H 4LSVH 2YOCA 4GS7C 1HHGB 1BWWA 1DEDA 1TETH 4LSPL 3GJFK 1FDLL 3C2AH 2BMKA 3UDWA 3MJ9L 4OFYA 3O3BA 5C1MB 1RUMH 3C60C 4RA0C 1RURH 4JZNB 1BFOA 4PB0H 1XGQB 5TFSH 1X5YA 5DRXB 1DBBH 3AU1B 3QUZC 1FE8H 1U6AH 2A6KA 4G8EB 2ZUTA 1EH9A 2OP4H 1OTSD 2D7PA 3U82B 1I7RA 3HZVA 4WI5A 3R0MA 4PJ8A 2IANE 3VRIB 4HGMA 4MXQD 4ETQA 4HAGA 3QZWA 3H7BB 4EOWL 3GIZH 5DMIL 1G0DA 2LABA 1RU9L 3GBMH 4JZJC 5EZIH 3TIDB 2HFGL 1G7LA 3PDDA 3BO8B 3TYGH 5B38B 3LHPL 1ORSA 4Z7UB 4S1SL 2V17H 3FTGB 1EXUA 4WVRA 1FHGA 2FJHB 4QXTB 2R1YA 4HGWB 2NZ9C 1OAQH 4XP1L 3WS6A 2MHAB 2DQFB 3QXDB 3MV9D 1TZGL 4MS8C 3LDBC 1PG7L 5IB2A 5HVWA 5IT2L 1A7NH 5DR5L 5F6HJ 4OZGB 4HC1A 1VFMA 2R0KL 4S11A 1NUGA 1X5HA 2NY1B 1GRWA 2HJKB 4ISVA 1B0WA 2FSEB 5JHDA 4JPVL 2JCCE 4LSTH 2DTSA 1CT8A 5J13C 4GQPH 3LEXB 2XNAB 3VG9B 4XB7A 1Z0NA 4LNVA 5DI8A 1NC2B 5EOTB 3SDXE 4C4KO 2R2BB 4TSCH 2KZ1B 3ZYZA 1WISA 2VITB 3SBWC 2XPGA 3L7EA 1BQUA 1G7MB 3F6LA 5F21B 5KSBB 5IHUL 5LGJB 3ULUH 3BN9D 4QY8B 2Y72A 5I1EL 4J12A 1DJSA 2LVCA 2Y4SA 2Q1EA 2Z35B 1HEZB 1MWAH 4OGYH 3F8UB 4HXBL 5GGVL 2DM4A 2BNRA 4QRQA 4FQJL 3ZTJH 3TBYA 3OXRB 5CEZL 1GH7A 1U3ZA 1UM6L 2H8PA 4XVTH 3L3HA 1NDMB 1X6NA 2JE8A 1KENH 1SM3L 4MQXC 5IFHH 5GHWL 4Q97A 2EZ0D 2QQNH 4MNHB 5DT1L 1HKLH 5J6GB 1KLGB 1FC1A 4IJ3C 4KRLB 3VFVB 5D1QD 4RNRA 1T20A 4UTBL 1LD9B 2CKBH 4X5WB 4YUEL 4JREC 4OV5B 4E42B 5JW4N 4IOFD 1DBAH 2CLRA 4JO1H 5EZOL 2P8PB 1JI1A 4IHOB 4I5BA 1RHHB 2D7TL 1BFVH 3ARFA 3PWUA 3HMXA 4PJ5A 3BDXA 5D2LF 5D5MA 1J87A 2F53B 1YJDH 4ORGA 4X0KA 3VGAC 1JGDB 1ZA3B 3V4PL 3X14B 1ZA3A 1QFWL 4PJ5E 3CK0H 4F7PA 4XP1H 4GRWH 4P3DA 3UO1H 1RSFA 2ESVA 5CD3A 2HN7B 2XNAA 1IM9B 1H3TA 3QDGD 5I73B 3FONB 2C26A 1YJDL 4HZAA 2EH7H 1FZOA 3UYPA 5DFWH 4WJ5A 3RKDD 3OKNA 5C0DB 4OCYL 2AAVA 1FZKB 3NIFE 4KZEH 4KHTH 1W8NA 1QRND 4X6CB 3O4LE 4LVOC 4BQ6A 1SBSL 4IRJD 4WENB 4HCRL 3RP1A 1BAFH 5C08D 1TTUA 2W65B 2X4RA 1YQ2A 2AJ3A 2FWOB 4UIMA 3BXNB 1B6UA 4KRPB 4R90L 2HFGH 1A7PL 5D6CA 5FB8B 3VGHA 4HMDA 3OPZH 4JHBA 3LQAC 3UTQB 4GAJH 1NGQL 2BCKA 2R69H 1RZKH 1AGBA 3IU3B 3DURA 1R3KA 3C8DA 5I1KH 3IKKA 3EYFB 3P30L 1YECL 4E0RB 1UCBH 2BVOB 5IR1A 1KCVL 4XNUL 5HGDA 3D85D 1IAIH 4G6FB 4W6YB 4HS3A 4F3FB 4J6RL 2IH1B 4CVZB 3QR2A 2C1OB 4OZHA 5DUMH 1HSAA 4M6MH 3TH4T 3I02B 3VW3L 1OAXH 4ONHB 1BZ9B 1R3IH 3IT8D 1UKSA 3GM0A 8CGTA 4PJ8C 3BQUD 2GTZB 5E8PB 4H8WC 3JV0A 4G8IA 4Q2ZA 3LN5A 5CBEA 2VDPL 3GBNL 1BVZA 2R2EA 5T33H 5F7DB 3ILPA 4EDXB 2D7MA 1T1YB 1FFOB 4Y4HC 1V8HA 4GXUM 5FV1L 4NN5B 1LMKA 2VISB 3EOTH 1R5IB 1BF2A 1MCCA 1NLBH 2HT3C 3LMJH 3SKNA 1MFDL 2IANA 1BJMA 1N8ZB 1LP9B 2PN5A 4ZQKA 1QNZH 3AS1A 1FO0L 1FNGB 4TUJA 2R1WB 3UJIH 1M7IB 1LP9F 3BPOB 2FBJL 3RX8A 3ULVL 1IC4L 3GSXB 5HXMA 4U0QB 4C4KT 2WUCH 5DJ8B 3ZHKA 2I9TB 4Y8DC 2JCCF 3G08A 3MOAL 1F45A 5FUZL 1MCPH 4LNRB 3P4LA 4E41B 4NZDA 2GK0B 3S8WA 3WNKA 2P8LB 2P7TB 4JAMB 1TJHH 4G42B 4Z95L 3QNXA 1DANT 4OT1L 3QQ3A 1RUKH 4GAYB 1INEL 4IOIA 4QRSB 4IDLA 4AIZB 3D69B 3Q5OA 2MJWA 1D5MB 5FYKU 4YHPA 4I3RL 4NNXB 2UWEF 4POZC 5FM5M 1XAUA 3WHXA 3RVVC 1CL7L 1VKXB 3DXAA 3EYQD 3HPJB 2VZVA 3IDGB 5HYIA 3WO4C 1JPFB 1ZHBA 4OQTH 4Y2DB 1JF6A 3BPLB 4PLJD 2J6EL 3NGBC 4PGBA 2FCBA 5I1HH 5BXFB 2LE9A 1A7NL 3SJVE 1NFDE 4R0LC 2OR9H 3AS2A 1AGEA 4HD9A 4F9LC 3OGCA 2I5YH 3QIBB 4GBXC 1IGML 5IF0B 4WTXA 1YEJL 1U8LA 4I0PC 3RBGA 1JTTA 5FECA 1MFEL 3ULUC 4M1CC 3VH8A 4GKNB 4DZBB 2G5BB 2EH7L 5F3BB 3OKOB 3K8KA 3HC3L 4JDZA 1AE6H 4IOSD 4U3CA 1JWMA 1FH5H 1B4JL 2UVEA 1ITCA 1UM5H 2GSIA 2D0FA 3UTPD 1QFWM 3E6HB 5EN2B 2W9EH 1HYSD 4PPTA 1CLYL 1SYVB 4NN7C 3S5LG 5HI5C 4DQOH 1JGEB 1DDHA 5CKGA 1BVLB 4L3AA 1E6JH 3JXAA 5CJXA 1JGDA 5GGRA 4HHAB 3NH7L 2VKWA 5E6IB 4DGYH 3WUWG 1G84A 3VXRB 5BZDB 2X1WL 4LEOA 5IIEA 1JRHI 3WNPA 2XA3A 4WW2A 4NWTL 5F9JB 2HYMA 3VFOA 5IMMB 4NC1E 1JYNA 5ANMA 3HUJB 1C5DB 1X5LA 3U0WL 3SE8H 2I26N 5HHOD 1T2QH 2V9RA 1MJ8L 5GRXG 3PGFH 5C71A 1HYSC 4RGNE 4GH7B 1IAIL 3D9AL 2H45A 5JDSB 1NGWB 3GO1L 1KEMH 2FECI 2XOTA 4C57C 5IMLA 4M02A 1I1FA 3GRWL 2VDKL 5C0CA 3VW3H 3H9SB 4ZDHB 3VFOB 5IMMA 1K8IA 1CE1L 3S4SA 3UXFA 3BD4A 3BQUC 5GIRB 2OJZL 4YHZH 2EYSB 4MDJB 2VZ1A 2A1WL 4JPKH 1KJ2L 2IFFH 4HH9A 1AR2A 5H37G 4D8PB 1QPPA 5A1AA 1TJGL 3QCVL 1JHKH 4HT1L 1D6VH 2DQEH 5IB1A 2IWGA 1AGEB 2EICA 1CT8B 2LU7A 4YHNB 2G60L 4FZ8L 5BXFA 1OWWA 3HG1D 3I6LD 4GG6E 3MXVH 3U30B 1CLOL 3J7HA 5DSCA 1JNHA 1BVKA 4KKLD 1MF2L 1IC5L 4LLDB 1ZHNA 4XVUD 3MRFA 3IS1X 1U8KB 4UMGA 4ELKB 3ZKXC 1KJMB 4L8DA 2A74A 1H0DA 2CR3A 3CZFA 4XP6H 4PJCA 4P3CH 3MUY1 4BFIB 5I1HL 4ZFFB 2FEEI 3SPVA 4L3EA 2JIXB 4XPBL 3EJYC 2MCPL 3IDGA 5MI0C 5T1MB 4P59H 2X9WA 1AQDA 1LO5A 4LFHG 2JELL 2DLIA 2FGWL 3WFBH 4ZOBA 4JZJA 3O6FB 3RAJH 4F80A 2Z31A 4EUPG 3PWLA 2F53D 4U1IB 1YNLL 2VDMH 1CGTA 1V7NL 4PJFA 4KRNA 3QDMB 3KLAB 5DFVC 4M7LL 1BBJB 2QBWA 3IDUA 5F7WC 3SDAA 4QF1B 2FD6H 2PR4H 4GJTB 3WFBL 3DVNB 2Y7QB 4S0TD 2PO6D 5F8QC 4LNRA 2MFNA 3EOBB 4JFYB 1Q94B 1Q72L 3K8LA 2C3WA 3UPAA 3SN6N 2CLVB 1DN0B 4QF1A 2ENYA 4OGAD 4EI6A 1BBJA 2IQAB 3BUYA 5H2BA 5D93C 3GDBA 4JO2L 4NZTH 2Q8BH 1I8LA 3SDCB 4JVUA 2GYSA 4X6EA 4WHYH 1CF8H 1H8NA 3AROA 3VH8G 1EFXD 2FBJH 2K3TA 4N8CH 3DRQA 4JRXA 2NPLX 3MUJA 3P4MB 3A6BL 4RZCA 1MIEH 4FZ8H 1E4XL 5JORA 1JPGB 3IETA 5EO1B 3QIBD 3H3PL 4LCIH 2P48B 2FDBP 2YBRB 4HDIB 4P99A 4CNIB 2Y36L 3FO9B 4K7PY 4V1DB 2C1OA 3SO3B 4QHLA 1S7SA 4WFHE 4LLVB 4H0HB 4JFFA 2BY3A 1AXIB 2VRAA 3CCHA 1J12A 3B9KB 2XZCH 4HWZB 3GSQB 5K9JL 2ZCLH 3PGCB 2P5WA 4Y1AB 5D71H 3PG2A 1FYTB 1A3LH 5C08E 1T0MB 1YMHA 4QGTA 1VEMA 1JMXA 3BHBB 12E8L 1JBJA 2GTWA 1OGAD 2YKLL 3NABL 4MYWB 4KDTC 1AH1A 1INDH 5MEPA 1MJ7L 4NUGH 3NPSC 4JPIB 4E9LA 5F1NB 3ZTNL 4GS7B 1NKRA 3GUTA 1L0QA 4EDWL 3CSPA 5AWNL 3VFUA 4RGMC 4JKKA 3SKUD 3C60B 4AT6B 1TPXB 4FQLH 1YY9C 1DCLA 3VCLB 3VXMA 2YPKB 1HIMH 5DJAB 1R3KB 1WV7T 3BP7A 1O7SA 1U3JA 1VGEH 3O2VL 4Y19E 3T77A 2ILLA 5DRZA 5F3HA 4LLYA 1K5NA 1K3IA 4OQ1A 3STLA 5C0DA 1G9NC 5T5FL 5KVFH 5JXEC 3QG6B 5AYUL 3QHFL 4K3DL 4M93B 1F4AA 2X4UA 4GLRI 3FONA 3C6LB 2CLZA 3F7QA 4H5SA 4MXQC 3UTSB 2L7UA 4JFXA 4YR6A 5BV7C 3UP1A 4G6FD 5FYLE 4GRLD 1NMCC 5D4QA 4ALAL 2C1PA 4WEUD 5HYJB 1RUQH 5EG6C 4YBQC 1ZLWK 4N5EC 3KVQA 1OQXA 3REWB 4U1SB 2JJTC 5F6IC 2AI0H 3I75B 4K9EH 4UOW1 1AO7B 3FQUA 4Y16B 1DSFH 1J5OH 3WEXB 1NFDF 3QDJA 4XAKE 5F96L 3L9RA 2Y5TA 2F5BL 1U41A 2IAMD 3L9RB 4I5BB 1IM3B 4UOW0 2YXFA 2V2XA 4P3DB 3VXRD 5C9KA 3WE6B 1INQB 1IARB 2Q6WA 1WFNA 3O9WC 1C7SA 3PNWA 4JQIH 4YJZL 2BHZA 2CXKA 4ZXBA 2V2WA 4I4WB 1ZT1A 1KLGA 3LV3B 4BK5A 3KS0H 3E6HA 5F89A 2ATKA 1FNSL 1C1EL 3E2HB 2ESVE 2YA2A 4XPHH 4YK4B 1HH9A 3S3JA 5CP7B 1F58L 1W0VA 4LASL 5FCUL 4JDZB 1CD1A 3QI9D 2K9UA 1NAMB 3IF1B 5DRWA 2E9IA 1MHEA 2E3VA 2VDLL 1GAFH 2B5IC 3C6SB 5J56B 2ZCHL 3CU7A 3VXUB 3QEUB 5A3IC 1T7WA 4QEGA 2JIXD 5D5MF 3G5YA 4JQVA 1OCWL 1J10A 3QNZB 3W9DB 4KQ4L 1A22B 5DJYB 3B83A 4NCC2 3UBXG 2DOCA 1CDBA 3OXRA 4ZPTA 3VXME 4P4RA 2FJGA 3FZUD 4QYOA 4H88L 3LKOB 1UM6H 3UTTA 2Y06L 3MLVH 1E27B 5CKAA 3O0RL 1H15A 3ZE2F 3WHXB 3T65A 4OI8A 4O58H 1KLUB 2PKDA 4YXHH 4HUWA 4NNXA 3C5ZB 1V3JA 3VGAB 1XIWA 4PB9L 4PR5A 4K8RD 5T5NG 1MRDH 4JDVA 3SDYH 2DI9A 4Z95H 4ZUSB 3B8SA 4MQ7B 1ACYL 3VXPA 1QSEA 3BE1H 1CR9L 4P48A 3I3DA 4ZOCA 3EO1A 4QWWD 5DD5L 3UMTA 4PLKD 5DVKA 3FB8A 3SDCD 4H26A 1JZ7A 1A5FL 1MFCH 3EYVA 1UJ3C 1TXKA 1ZANH 1I85A 2R2CA 1CIDA 5K9JH 3U4BH 4X7SH 2VDQL 1D5BB 1YDPA 4KKCD 2R1WA 4HJGA 4YDIL 1UEMA 3ECBB 5IMOB 1IKFL 4BM7A 1LE5B 2ADFH 4ZQKB 3TCLB 4EJ1C 1NLBL 3BD3A 3G6AB 4CADB 3BUTA 4P2OB 1MLCB 3MRLA 3TBVB 2XQBH 4LLUA 3MV8E 4NQVA 1UXWA 1FRGH 5EIVA 4NNYB 5GSVA 3VFPA 1T89C 3FOLA 4JY6B 1RUML 4MA7H 5B21A 3KPNA 3QIWD 3QCVH 4PBVC 5EO0B 4Z5RB 3W11C 4FRWA 1BQSA 4P2QA 4AEHH 1ZWIB 4HUVB 4P5TA 3PL6C 5KVEL 2EIEA 4ONFH 4P2QD 5FYJL 3QHZH 2ZNXA 2CO6B 2WWKO 4D9LL 5ESQA 1PGRB 5E6YA 3WFHB 4HC1H 4KTDH 4D9QD 3RA7H 1JGVH 1PQZB 4R7DB 4APQA 2WK2A 3EDKA 4NQTA 4ZO8A 5E4EC 5E00A 4BELD 4WU7B 5BCAA 3CVIL 5DUPL 4XWOC 3CVHL 3I6LE 4LARL 1MCKA 2WV3A 3P9WB 3PWPD 5LBSL 4MJIE 1LK3H 3QNZA 5TE6H 3MJ8B 4A2LA 1UVQB 5SWZD 4JVPA 1AIFB 1RUPL 4JR9L 1ERNA 1KACB 1LK2A 1S9YB 1WLHA 4JY4A 5L9DH 1TVHA 4ODTL 4MA1B 3VGEA 4L9LA 3KPSE 3WV0A 4EZMA 4TRPL 4ZOAA 4D9RD 4CGTA 3HR5A 2R4SL 2XZAL 2QR0A 3BZEB 3D0VB 1WF5A 1ZTXH 2W92A 5FUCE 4CN6A 4QRTB 3BIBX 5DQDL 5J8OA 1MLBA 4G9DA 3V5DA 5CWSB 1NGWA 2W9DL 3MRNB 1U3HA 3PHSA 3MACL 3MCLL 1J11A 3AY4C 3VFGL 1FL3B 1S8DA 4BUHA 2IADA 2PO6C 1YEHH 1TJHL 1DBAL 3MNWA 3N85H 3RVUD 4U1MA 1EJ6A 3QFJE 4KXZH 3QUMB 1J8HA 4OCNC 2BZDA 3EBAA 2NY2D 1XF5A 4N1HB 2B1AL 5ANME 3WFCH 4R0LB 1AGFB 1OM3H 4Q9CA 1JGUL 5FHAL 3WS3B 3HAEB 5GHWH 1LEKB 4XMKL 3BMWA 5LGHL 3RUGF 2J88H 4HKXB 5I74C 2EIZA 4HX1B 2ERJC 2OSLB 4PRNA 4HBQA 1XGTB 1SVZA 1YEEL 5B38G 1ZE3C 3HE6D 5F3BA 2H1PL 1NH6A 2XWJA 3QIUC 3VXSE 1F2QA 4Y8AA 2CJUH 3BRFA 4X7SL 5IF0A 5JW4R 4GAGL 1U36A 4PTTA 3VFNB 2BVPB 1FGVL 2HRLA 3H2WA 2GSGB 3QXTA 3J8F7 4YFLF 4LP5A 5J3HC 3D3VA 5IB3A 1K6QL 5C8JB 4X80L 1CGXA 4QT5B 2W38A 1X9QA 5MEPB 1KN2H 1P4LA 3O6LH 4FQ1H 4G43B 4D3CH 1LE9B 5KSVB 2R2HB 3DHMA 4X99A 3UO1L 1WC7A 2QSTA 4JFFD 4O00A 5IK3A 3JWOL 5JNYB 4KJWD 1UZ6E 1OGAE 4KY1H 4DKFL 5KANG 1QLEH 3NACL 1X4XA 4RFNC 1P5VA 4ESKA 5ALCH 4QCIA 1R24B 4LCUA 2ICWI 3LIZH 3H3PH 3OJ2C 5ITFB 3IDXL 5HVGB 1J1PH 3I50H 5CJOL 4LBEA 4P2CG 1YC7A 4NBXB 3RHWF 5KVEH 3ARFD 1MCWW 4JRXB 5F9WB 5EWIH 1CICD 4MVBD 4PY8I 1IGYB 1FE8L 2FATL 5INDA 1OGTA 5I8OL 4M61B 3L6FB 3NZ8A 5A2JH 3QJHB 5BJTA 3KS0J 1F00I 5CLTA 2OQJA 1KPUB 1KULA 3X11A 3RWCB 1OY3B 3MBEC 4EN3C 1X6LA 5D1XC 4X9GA 4WFEE 4TTGA 5FYLD 3ZE0E 4NUGL 1TZHA 2ICEB 1HHIA 1IGYA 2AGJL 1FJ1B 3RWHB 4QRPA 3V4VL 1ACZA 2BNUA 1F13A 1F58H 5T1KB 4K23L 1IGCH 2Y6SC 2VXUH 2UUDK 3A67H 1U8IA 5GS1C 4GRLB 5C0JA 2JK5B 8FABB 5DK0A 3VFSA 5TQ2H 2H41A 2DIBA 2E7CA 1MUJB 1KUMA 4NSKA 4N8VB 4PJGB 4LBEB 5D7JC 1YEIH 2X7LA 4UNVA 1UGNA 4CBPA 2FX9L 5HY9A 2ESVD 3BQUA 4PP1D 1ZAGA 4Y5XA 2E8YA 3TF7C 1YY8B 3OQ3B 2IH1A 5HYQA 3HFML 2QADC 4OLXH 5C8JA 5IWLA 3MREB 5CILH 3QB7C 3SGKC 1QBLH 3EYSL 5HJ3B 1X5GA 1OD7A 4OZHE 4ZTOH 4G8GE 1NBYA 1AQKL 1H15B 5AAMA 3BGMA 3BI9X 3JV4A 3BH8B 3W82A 2BOCA 4KHXH 2CMRL 2F19H 2AJUL 1G7QB 1C08B 4K3JH 1D9KB 4MWFB 5ABDE 3EAKA 4KVNL 4KK5D 4M9PA 4AG4H 5JR1H 3D25B 4IIQC 3GMNA 3QFJA 4QRUB 1OM3L 5L2KA 5KOMC 1LP9E 3C09B 3DUUA 4JRWA 4P3WA 3RVVD 5KZCD 1WITA 4OTXH 4RGOH 1PJ9A 1HHJA 3IDMB 3HNTH 1EO8L 1FG9C 2HKHH 4S1QH 3ABZA 4QHNB 5EU5B 3IDNA 4XXDB 4OD3L 1TQBC 3MRGA 2R8SH 3CDYA 5BRZE 3B3IA 2WNGA 2ZCHH 3REVA 4CW1A 3RGHA 1IGJB 2E5EA 4WJ5B 5JPMA 1N4XH 5DURB 3TFKD 2R0KH 1OTSC 5JA8B 1N2RB 3G04B 4R7NA 4OQTA 5JMRA 1IM9A 4BZYA 1VADB 3PJSA 1PY9A 3CSBA 5SX5H 2FZ3A 1QFHA 4MXWH 3RWIB 3IRPX 4I4WA 4I3SH 3FB6A 4JQVC 1KJ3L 1FVEA 1P4BL 4FG6D 4BJLA 1SY6L 5EOQH 2FR4A 1KSRA 4PJ5B 1JF5A 3TBTB 3MJ6A 3TBTA 2HAZA 5J6HA 3AREC 4LVEA 3JVGA 1J1OH 5FGCE 2FX9H 3EJJX 1FBIL 4PJ5D 1U3HC 5D5ME 3EGSA 4KDWA 3K81A 4KAQL 5CBAB 4RFEA 3OR6B 3QYCA 2WBJA 3EYUH 3MGTA 1MI5E 3PJSB 5JW3H 1TPXC 5DT1H 1VPOH 4F8QA 2PXYC 1R0AL 3VXUE 3S37X 1B0RB 3L3HB 3S34L 2LV4A 2A9MH 5EZIL 4KTEH 5DWUL 4KJPC 5HVHC 1I1AD 4KTYA 1MCDA 4GMTH 5IJVA 5IOPB 1K5NB 1NFDA 3STLB 5DRZB 3O6ML 1FNAA 4P46C 4R96A 3QNYA 4NJ9H 4YE4H 2NY5H 4Q6IC 3RY6C 3DIFA 2E7MA 5E94B 4N9GA 3VXMB 3IFPB 1MY5A 1UQSA 5F7UA 1HIML 4LF3B 4F7TB 4P2QE 1FLRL 3QUYD 3DUUB 3BZ4A 3R06B 2AK4A 2EKSA 5GRVK 4K3HA 2QJDA 4NCDA 4P2RA 3BPCA 5L88H 4Y2DD 3LRSA 4LLMB 1XF4B 3GMQA 1K9TA 4KJQC 3SGJA 4G8FA 3NABH 4R7DA 3LZFL 5ICZA 3VU2A 2R4RH 3RL1B 4FXKA 1KTLB 4OB5L 1ZLVH 1IQWL 1KNOB 5GGQH 3QIUD 2ZUQB 3GB7B 5CAYB 2R1YB 4HGWA 3Q6FA 5E8OB 4IOIB 3ET9F 3PWPE 1S7SB 1XT5A 4PJHB 3RNKA 4WI7A 2R9HC 3QEQA 4F57L 5KN5A 4PJIB 4M62L 2P7TA 1KBGL 4OFPA 3HG1A 3NCEB 2DICA 3NAAL 3VRJB 3W0WD 3QCUH 1AKJD 1I1YB 3VGGA 3T0DA 1I9IL 3HC4H 1XF3B 2UZYB 1A1MB 3BEWB 3WJLC 1Y0LB 1NMBH 2WUCL 5DD0L 3UPCA 2EEAA 3W39A 1JNLH 1E6JL 4NDMA 3GSXA 1YDPB 2C3VA 4UUJA 5LXGH 4LSRL 2X4NB 3Q2CA 3E8UH 3IJSA 1UCTA 1IC5H 5FUOL 4Z7QE 1U8OA 3MRCA 1YMME 3RI5F 3TC9A 5DUPH 4P5MA 3H3KA 2BMKB 5C0IA 4LRIC 1Y0LA 4LARH 1QSFE 3P73B 3DOSA 3ZE2E 1SEBA 5I75B 4LVHC 4NGHH 5I1CH 1AFVL 3CXDL 1FSKC 4OFIA 4D0DA 5GGTH 4OLUH 3P4OB 1HQRB 3FT2A 3HPLB 1BPVA 4HIHB 4G8IB 3Q6GH 3E6FB 2YRPA 2WSKA 5I30L 5D2LB 5GGTL 1QLRB 2OJZH 4YHZL 1A6TA 1CK0H 2JIXA 1JI2A 2OR8A 1FV1A 3FQNA 4JM2A 3QUXD 3HNSH 3V9FA 2A74B 2AK4B 3R06A 3VFGH 1I3RA 3K1DA 4YHML 3RWGB 3OAUH 4JHAL 5ACMA 3H9HB 1BFSA 3VMPA 4OIIH 3N9GL 3CMGA 1A2YA 2R0ZL 5DMGD 3PV6A 3O6MH 5I66B 1A9BA 4C56A 4U6XB 4BZ2H 2VH5L 3QDME 4FQQB 1AGDB 1JZ8A 1OQOA 4O2CB 5KW9L 2Z8WC 1U91A 3IDYC 1T83C 2EDBA 3KDMA 5F9AC 1RZ8B 3VXUA 1T7VA 1PY4A 3VXOA 5J89A 5LXGL 3FB5B 3QWQB 3WIHH 1KIQB 3OKNB 1H5BA 3GSWA 5C86A 2DQCL 4XI5C 2ITCA 4N0UB 2BSSB 3UTPE 2V2XB 1EHLL 1QFOA 5CZXC 5HI4C 2LAAA 4TSAL 3G5ZA 3VI4F 2J6EH 4PGDA 1AD9B 1KIPB 1T4KA 5I1DB 1YUHA 3S36X 2DQIH 4ETYA 3BP6A 2V2WB 5CJQL 5CHNB 4F57H 1WQVT 3O4OB 1CTNA 1EZVX 2FEDD 4HPOH 1FVEB 4OZHF 5I1JH 4EVNA 4FFVC 4CUCA 3D39B 2UZXB 5IFAH 3DV6A 1C5DA 4J3OC 4G6KH 5C0RL 1T6WA 4M5ZH 1AD0A 2XIDA 3FMGH 4ODWA 1FNHA 4RMUA 1P5UA 2IADB 4IRJB 1C5BH 1A7PH 5IBUG 2IAMC 4HPYL 4LRNH 4OI7A 5BZDA 4GW5A 3I9GL 4ZO7A 4U0RC 1G1YA 2FHFA 1WFOA 4HWBL 4PGJA 3OXSA 1OB1A 4TSCL 3QUYA 4HJ0C 4V2CB 5C08A 1CYGA 4BSJA 5EWIL 3MCKA 4HXAL 4AIXA 4YPGB 4OLUL 4XI5D 1G7QA 1T7ZA 1R0AH 4W81A 5F93C 2DQTL 3VFRA 3NCFB 5M94B 4AT6A 4PBXA 4MMXC 5TDPB 4JR9H 5E2UH 3QIBA 5TE7H 3O81A 4BK4A 2HFEA 2D03L 3LH2H 4LOUD 1HNFA 2NY3B 4NC2B 1C12A 2FL5B 1IGCL 3LKPB 4K23H 4NM4L 4U05A 3PWVB 1CFQB 1AC6A 3QO1A 5HY9B 43C9A 4Z8FH 1QZ1A 4ZPVB 4JHWH 4I2XB 2ITDA 4CMMB 1GJIA 2WLYA 3U1SL 4LPUA 2UWEA 4AL8H 2X4QA 2XN9A 5GRUL 1YQVL 2Z91B 3L3OB 1I1CA 3ARUA 3K0WA 1Q9KB 3DJ9A 3HLAB 4G9FD 4JRYB 2NY4B 1VESA 6CGTA 4PJAB 1F4WH 3T0WA 5IWLC 3SKOA 5GS0L 3VWJC 3I6KB 4S1RL 4PB9H 3M8OL 3W9EB 1OCWH 5HBBA 5KVFL 5F9OH 4NNPL 5I74B 1F3DH 2QSCL 3H7BA 3C08H 4RGNB 2CLVA 4K3DH 3MO1B 4XPFL 4YFDB 4OCRL 5HHVH 1I9RL 3B5GA 4ODSL 4X6EB 2V7HB 3IDXH 4HUXB 4O02L 3ZYIA 3INUL 2BDNH 4E5XA 3CNKA 3S4SG 1AKJB 3CUPB 4HIJA 5TF1H 2J8UE 1RQ5A 3CFKB 3QJHA 4NQVB 1KTRL 1FP5A 3EYUL 3L6FA 2FATH 4K3JL 5LG1A 4PJCE 3WUZA 1P84J 1I9RH 3OX8A 4Q0XH 4Z7OE 1MAKA 2BJML 5JR1L 5J1TC 3GM8A 5JUEL 1BBDH 5C6PB 2DMBA 4TUOB 3THMH 4DOHE 4P59L 5BV7L 4GG6F 1CBVH 2UWEE 1LEGA 3B5TA 1N5AB 5JXAL 3HI6L 5DD1L 5F9DC 4YHYC 1MHHA 3MOAH 4JFPA 4PJCB 4U1NB 5F7DA 4EDXA 4GRMA 1KJMA 2Z31B 4MAYD 3WXWH 4WW2F 3DV4B 4O5LL 3TYGL 5L8JB 1RZKC 2L4OA 1INDL 2Z91A 3L3OA 4D3CL 4LLDA 5KVGH 2CH8A 5T1MA 5D1ZC 2MKWA 4FXLA 1F4XL 3FO2A 2P8MA 4WFHD 2I27N 2I60L 3BRDA 2LVEA 2VJXA 4CVZA 2O5XL 2EECA 1RJCA 4FQXA 4XBGA 3SE9H 1SY6H 2ZCKH 3CUPA 4ZNEA 5FGBC 1RMFL 2VAJA 4JO2H 3QHTC 5EU7C 3BPNB 1DBJH 3MBEB 4PLOB 3RVTC 4JG0H 4EN3B 3LB6C 2Q7NA 5I19L 5JW4Q 2VNCA 1DANU 4XVUC 4FFZH 2VLKE 3LKOA 3LPWA 3TJEH 4WHTA 5AG8A 2J8HA 3WD5L 3QFDA 1SEQL 2L7JA 4TNVF 4X6DA 5B3NA 5IESL 4MDIB 2BC4B 4ZDHA 3SKOB 2PYEE 3FOMA 1OP3K 3FHQA 1WFUA 5HPMA 1A1OA 1E28A 1GOFA 3ULSA 2X4RB 2V2TA 5GS1B 4PJBF 4OLZH 4DN4H 3SE8L 1R3HB 5B4MD 2NXYD 3RDTD 4B5EA 2RQ8A 1MJ8H 3HZKB 2BSRB 2F54E 3PHQA 4FFYH 4M8QB 3TWCL 5DRWB 4NZJA 4KKNA 2WIMA 3QUMA 2FO4A 1J1PL 4OCLC 4LKCB 1G7IA 1UACL 2ATKB 2GAZB 3V8CA 5IIEB 1N64H 1KIRB 1OARH 1S78D 3W2DH 4PRDB 4N5UA 5DQJA 3LH2L 2G2RA 1U8PA 1F3JB 3O11A 3QUZD 3QDGB 1P69B 3DYMA 2AERT 2F53A 3KJ6L 4O9HH 4BFBD 1V3LA 4QRTA 2NZIA 1FO0A 4K94L 4JFOB 4D0CA 2C4FU 4JHWL 1E4KA 1EHAA 4YPGA 5J1AA 5L9DL 5C0AE 1BX2B 3WKNA 4X8XA 4YDLC 1QP1A 1D9KC 3ZDXF 3VFVA 2OR9L 5FHAH 3BYTA 4AH2A 3NFSH 3MLZH 3MX0A 3EJYD 1LO4H 1YA5A 3V0WH 1RD6A 3OZ9L 4ERSL 4FQIH 4WO4A 3D39A 1ZVYA 1ZLUH 2ADIB 5DJDB 4O2FA 3U0PA 3D85B 4IS6B 3STZA 5EPMB 4CVUA 3TGXA 2LU3A 3RA7L 4NFCA 5D2LE 2VDRL 5C09E 5CWSA 4LVOB 3BT2L 4XH2A 3B9AA 4JO3H 5BW7A 2PCPB 3MCG1 5CLWA 1A02N 3TNNB 4PRHE 5CD5D 1T4KB 1KCRH 4H1LB 2WWMC 5MEOB 5C0NC 3QNXB 3ARVA 1FQ9C 3W81A 1MH5B 1JCKA 3QBTB 4JAMA 3V7AG 4LEXH 1ZGLB 3AGVA 5D1ZA 3QDMD 4DJMA 3BT2H 3JV6A 5IUSA 3OKLB 2R56H 3MRDB 1PEZA 4XNXH 2YN3A 3MLRH 4XP6L 5DJ6B 1Y18A 5D8JL 2H2SC 3UC0L 1XIWC 3NMEA 5C3LD 4GXVH 4K3EH 4U33A 1UVQA 3WNLA 2MPAL 3IKCB 1A6VL 3OF6A 4Z7UA 4RQQB 2OMNA 3BOVA 4KZDL 4DEPB 4RMQA 3MODH 4Z77B 2P5EE 3PF2A 2OL3A 5AZ2H 5FF6B 1A1NB 2A6JB 1FNGA 4OM1H 4AY0A 1KJ2A 1SEBB 3DNKA 5ELIA 1Z9SA 1C7TA 1CFSA 4N1EA 1GGCH 4UBDD 3QI9B 5HVHB 1MI5B 4DUWA 4P9MH 4UT9H 4MD4B 2VN4A 4N8CL 2PW2A 4JM4L 2EDJA 3O6LL 5KBNC 3GEWB 1M1SA 3DX7B 3MLWL 3MODL 1D5BA 3MA7A 4MQSB 1PFCA 4OJFL 4TVPE 1TJGH 1T1YA 1ZGLP 5AZEH 1FYHB 4TUJB 3GHEH 3PWPA 3ZSTA 5I1LB 4TQEH 4MD4A 1IAII 1A14L 3O41A 3ARWA 1AY1L 4H8WL 2GEEA 4ZAKB 1NUFA 1NLDL 2H3NA 1M4KA 3BE1L 1WIUA 3CD4A 1J5OL 4UV7L 1RJYB 2NX5A 2OR7A 1IEAB 1DUYA 4JKWA 1XGRB 1E4WL 1GC1C 4G8GB 1X7QB 1OSZB 1JGVL 1PX4A 4OCMC 1SQ2N 1HSAB 2A77H 1J05A 4PGCB 3TA3A 1TVDA 3IKCA 1B0GB 1ZHKB 5MP6L 2MQCA 3P30H 1FL5B 2B20A 2VLJE 1OSZA 5C2BL 1F97A 3JV6B 2AW2A 4WTWA 1MCFA 4E0RA 3O6KL 3L3KA 4M1CD 3GMQB 1CG9B 2A77L 3LQZB 1NC4B 3K3QA 4KMLB 2Z31D 4MAYB 3CFDA 3H9SE 4QYOB 1IC1A 1VGEL 3O2VH 1YEDB 4G6MH 3CMOH 4H1LA 3HNTL 2HH0L 4P5MB 3DI2B 4D9QE 1XF1A 4PJIE 5B8CC 1L6XA 3P77B 4YH6A 1ES0B 3T4AB 1KOAA 1OAYH 2XFXB 1RIVH 1YNKH 1MI5A 4OCYH 3QJFA 1XF3A 1U8MA 2XWBB 2D7NA 2OTUB 1P4IL 1O7VA 1B4RA 1B0RA 3TVMC 4Y2DC 3VXNA 4LVHB 2W65A 4ODVL 2ZOLB 2ZPKL 1VFBA 3CDGA 1JGLH 3LEVH 4H20H 2DWEB 1CD8A 1JTPA 2EO9A 3QUYC 5K59F 2WINA 3QIBC 4JFDB 1E0OB 2CDEA 2EXYC 4D9RE 4V1DE 3DTXA 1D5XB 1IGFH 4ORGB 1AHWB 4RAVB 4G7YH 4MXVE 5B39G 1A21A 2W0FB 3MLRL 4P46D 2VSDA 2VERN 4JFOA 4D0CB 4DVRL 2YN5A 2GHWB 2ESVB 3UAJD 4J6RH 2AV1B 4JDTL 3WLWD 3QDJE 4NCC1 5DEGB 3FB7A 5FYKD 4EXPX 1F90L 3MLYH 1WBYA 3BGFC 2AEIT 1H3XA 1VACB 4Z7VE 3O3UN 2DLTA 3PGFL 3ARED 1QBML 4H5SB 1NDMA 1HHKA 4GKZA 4WI6A 4Z0BL 4OCSL 12E8H 3GMMB 4JRYE 7FABL 3SDDA 3TJHD 1I7ZB 5K33A 1S7RA 4BQ9A 1NAKH 5GGRB 2IH3B 1VENA 2VDOH 4OI9A 1MAMH 4PJXE 1IRAY 1RJZA 4YNYB 3W5NA 4P5KB 4GQ9L 1T3FB 1RZIA 3L7FA 1JZ3A 4X6DB 1U93B 3ZYJA 3MBXH 4K07A 3U4AA 5HI5D 1D9KA 3V2AR 3LSOB 3UJIL 3OPZL 1Q9WA 4BSWB 5EA0H 4QGYA 4WV1A 5EZLA 5AG9A 2PW1A 5IMKA 5F7LB 3GIVB 3ETBF 1U8JB 3RU8H 3M1BB 2ZCLL 3ARDC 3QAZB 1AJ7H 5ECJE 3U7AA 5I16B 3TA3C 5DI8B 3CFCH 4NO3A 1N59B 1KN4H 1VADA 1VFBB 5FOBB 4MLIA 1Z9MA 3P9MA 4GSDH 4Z76A 2CLZB 1E4XI 3V95A 1I9JH 5I6XB 2DKMA 1WT5A 4KROD 4CJ0A 2D7TH 3IETB 1RPQA 3I84A 4G3YH 3T1FA 1YN7A 2OX5A 1WIPA 3U30C 4O5LH 4IRJC 3BIKA 5E1AA 4URTB 5KTEL 3LQAH 3BMVA 1A3RH 1U95B 4IEFB 3FTGA 3DX6B 3QO0B 4GRLA 5GJSL 5C0JB 4FQXC 4NFBA 3HAEH 5I18H 5DRXA 4HBCL 1FAIH 3IU4L 4WWKA 4QNPF 4ZFZB 1T0NA 2QKIA 3FMGL 3OKEB 3RWFA 1UG9A 3QPXL 1N4XL 3KPLA 4HMCA 4XC1H 2F54D 4MJ4A 2NLJA 5T1LB 4LVNC 1QA9A 2WLZA 3RWEA 2ICEA 4LLAA 2D4FA 4KPHL 1FYTA 5C07D 2P5WB 1QSZA 1KPUA 3GSQA 1X5IA 5D1QA 1I8LC 3C2AL 3QEHB 2IMMA 1PKQA 4KUCD 4FQLL 3TH2T 3KLAA 3SE4C 1A6UH 5EBMB 3VXTB 3HMXH 5HGBB 4HIXL 4K9EC 3O6FA 3I50L 1UWGH 5CJOH 2YXMA 5EA0L 2D7QA 5B3JF 3PUCA 3NH7H 3A6BH 4JN2A 4QOKA 3SDAC 3UEZA 5C0AD 1LHZA 3MBED 4EN3D 3BJLA 1EIBA 1IQDB 4TNWK 2IQAA 1A7QH 1CCZA 4R8WL 2XTLA 3SDCC 4YZFE 5EUKA 3VWJB 1BJ1J 1WAAE 3ARXA 2P46B 2W9LA 4BQ8A 4Z8FL 2ITDB 4CMMA 2B7DT 3WCYA 4NJAH 4FQCL 2GITA 3IXAB 5D96C 4TULH 5IKCA 4ODTH 3AREA 4U6TA 4JFDD 1YEFH 2W91A 4JRXD 1IFHL 1Q0XH 4UTBH 3OKEA 2J5LC 2X4SB 4MA3A 1CXLA 2VDKH 1RIHH 1CIUA 3RTQA 3BKYH 2JJTA 4H25A 3QDMA 4GUPB 1DE4B 1UB6B 4MJ6B 1PG7W 2NR6C 3MMEA 1HK6A 2W60B 4U6HA 4NUJA 2A1WH 4JPKL 3KPQB 5I2IB 1EGJH 2VLLA 4Z0BH 4JZOA 1KLFA 3OKDB 3B9EA 4OFDA 4PRHD 3IXTB 3GKWL 1RIVL 2QKIB 5GGVH 1SHMA 4XNYH 1F4YH 2X42A 4XXCC 2QHRL 3CDFA 4RDQG 4PIRF 5DR5H 4KK9D 1H0DB 1XCTB 1LEKA 3DX6A 4G5ZH 1VSCA 4YHYB 1MCQA 2P4AB 1DUZA 3EJZD 4YHLH 3KWWA 2GJ6E 5JW5B 4HKZB 5CILL 4L8SB 4NQSB 3HZMA 4OFYD 4KKAD 4YDJB 3HMWH 5CSBA 1ADQA 4ODXB 4WUUD 4ZFGL 1MF2H 5GSRA 3O8XC 5IVXB 1MCWM 4I8DA 3FO1A 2CMRH 2F19L 1KELH 5ISZB 1WT5C 3IVKA 4BKLB 4M93C 4RRPG 5TQ0H 2XZQH 3SKJL 2IPUK 4YGVB 1U3YA 4HUUB 1KXVC 3B2VL 1T5XB 2C7UB 5IBUB 4LCYB 4A6YB 1QSFA 4DTGL 1N5YL 2EC9T 2RFXA 1RJZB 3RPKA 4X0KB 3A0OA 4PV9B 1A7RH 4QXUL 3ULVE 1YUHB 3RVUC 4I2XE 4Y4FD 2FO1A 3FQRA 3RZCB 5C0EA 3EHBD 1RHHA 5F6IB 3MLTA 1RU9H 3GBML 4O2EA 5IJKA 5F7FA 1H8SA 3G6DL 5F7KC 1HNGA 2C3XA 4MGXA 2A38A 2DLHA 2MPAH 1JP5A 5C0BA 1H5BB 1Q9LB 4U1GC 3Q1SL 3IDJA 1DQLH 4QHUA 1YYML 2I5YL 4MNHA 4PRPE 3WJJA 2H26A 1JHKL 5BVJB 2XI9A 2YC1B 5BQ7B 4RMWA 4KC3B 3OAYH 3JWDL 3R1GH 2H1PH 3HCVB 3LS5H 3TCXA 1NJ9A 5C09A 3EYOB 3MNWB 4YK4C 1MHCB 1WJ3A 2YPLD 5BO1L 3HN3A 5B4MC 2XG4A 4NQUA 1KGCE 4NQSA 4JKLA 2ICWB 1HCVA 1JFQH 1G9NL 4H8WH 5ID1B 3L3JB 1G7MA 1XFPA 3P0YH 2IBZY 2X1XR 1KTDB 2W59A 5C7XH 5LQBH 3LN4A 1T7YA 1BZ7B 4M6AA 3LEXA 4QRSA 4AIZA 1A9EA 1HSBB 3QQ3B 1S5IL 4NWTH 3VFWB 1TZIB 2ZUXA 1TFHA 2W0FA 1YEGH 2X40A 4H0IA 1ZWIA 1UT9A 1QEWA 1AE6L 5IVZB 1J0IA 4U6HB 4NPYB 4XPBH 1MVFA 4X8JA 2ADJB 1UYWL 2NY7L 3D2UA 4HS8L 4NQCE 1P6AB 5AUMB 4R26L 1ZT4B 3RTQC 1CLCA 4I48B 1MEXH 5TH2B 4KFZC 3W0WE 1MREL 2EE9A 3UC0H 2AXGA 3TO4D 3ZDZF 2OTUA 1E6OH 3PIQA 2ZSVA 4V1DD 2VYRE 5MEQA 5GS0D 1H9VA 4GRWB 4U6XA 3K4DA 4Y2OA 1MRFL 3PV6B 5DXWA 4YDIH 1NC4A 3LQZA 5I76A 1OAYL 1MCJA 2XG5A 1CTOA 3W11D 4LU5H 3T3PE 3SQOH 1R5IA 5IM7A 1KCSH 1MFBH 4LCWD 1UJ3B 2HJLB 1DQML 4GAGH 5AAWA 1UJTA 5TGBB 3GO1H 4GAYA 2UV3A 5FYKE 3ME0A 3WHE0 5H35A 3V79C 4P5TB 3FB8B 3NIFF 2AJXH 1X7QA 1S7WA 2E6QA 4NKMA 2BXYA 1BIIA 2VKXA 3HG1B 4PG9B 3S37L 2HVKB 4MSWB 4YUEH 4M6NH 4K8RH 3UJJL 4G5ZL 1C16A 5I8EA 2EZ0C 3CX5J 1IT9H 3Q6FB 4JJ5A 5CFHA 2ICCA 4YHLL 1GOHA 5I1LA 1XIWB 1F5WA 2YD4A 2OXGA 3RUGB 3ZHLA 3T4YB 3F7PC 4EUPH 3U6RA 3WJLA 4F58L 1IEAA 1R6VA 3G6AA 1KB5L 4PJDA 3SGEI 3HI5L 3OBAA 2DM2A 3LD8B 3R0NA 2BCKB 4EIZC 4TYUA 3W0WB 2HKHL 4UAOB 1VFAA 5IMOA 1U8HB 3ARSA 4NM8L 2CGRH 4HJGB 4ODUA 3WO3B 3EYSH 2AXGB 5D6CB 4JGUA 1P7QB 3NIDE 4RQQA 4PJEA 3QO0A 4EDWH 2ICES 4KZDH 2ZCKL 2PW2B 2P24B 1I75A 2EIDA 3P11L 4Q2ZB 1NMAH 4KZEL 4PJAF 5HYEA 2VDLH 1A6PA 1GYAA 3MV9E 1MHEB 4M03A 1XH3B 3WNNA 4ZPVA 1BOGB 1ND0B 2IBBA 5F1IA 1W0YT 2ADFL 5HYJE 5K9QI 4S2SB 3U0TB 1QSEB 4PJ7A 3UX9B 4Z76B 3IDIB 4U7KA 2YPVH 4UILH 1HYRC 2B0SL 3A67L 3QRGH 4HF5L 4JHZA 2I60H 1CDIA 4O4YL 15C8L 4K3GA 2EEBA 2ATPA 1MIEL 1QQDB 3SDXF 5FKPA 4IRZL 2IG2H 3UTSD 4TSBL 3TZVB 3H3BC 4YXLL 5FDYA 4ZPTB 4WY7H 5DUML 5I19H 4PB0L 2YPLA 3ARDA 4U7SA 4LGPB 5HDQL 3MV7E 4Z7WE 1S7UB 5DMJB 5GRVL 2DD8L 4HC1L 1EA9C 1A6AB 4KQ3H 1RZKL 3G04A 5E8EB 5ITBH 1I7ZA 3WIFA 3FFCE 3H0TB 2ZOKA 4YXKL 1QFWI 5ERWB 5AD0A 1Q9OB 1Q9OA 1MPAL 2PO6B 3RVWD 5D7KD 4LIQL 2P44B 5SWQB 3LKRB 2AJUH 1OAZL 5I18L 3PXHA 1L9NA 2OS7A 4JVWA 2XN9E 4FQHB 1VPOL 4J3TA 1S7UA 3AY4A 3A6CH 1DQJB 4L4VB 4Y4KC 3Q0HA 3WN5C 2VXSH 4K2UH 4N5ED 1J7VR 3LKQB 3FB7B 2Y23A 2F58L 4R4FL 2G75A 2WP3O 4P57A 5DA4A 43CAA 4JCMA 2FGWH 4JKPH 2BY2A 5IFJB 4I0KA 5LAXA 1FVCA 1IM3A 4RMSA 4B53A 4LKCA 4U2YA 2ZUSA 5D6DC 4HWUA 4O9HL 3WJJC 3NCBB 2XKSA 3MFFB 2DQGH 1NFIA 3HZKA 5DQJB 3L3DA 4JRXE 2RJMA 1S7QA 3ZDYE 1XZ0B 4OBRA 3GMPA 4HJJH 4UT6L 4HQQL 3BGFB 3MJ9H 1FDLH 1R3JA 2VXQH 5J57B 4QRRB 4YXHL 2BC4A 3HUJE 1K4DB 4O02H 1YEIL 2H6PA 1ZLUK 1GIGL 3ARRA 1XH3A 3GSVA 1JPGA 5EO1A 3MLPA 4LLYB 2XA8H 4OZIA 2PF6A 4KJQD 3QPQC 4AM0A 2ARJA 5E08H 4BH7A 1MUJA 1EHNA 3VCLA 1E28B 3ULSB 4CJ1A 2BP3A 1QR1B 5HI3D 4PJEB 2ZSWA 3JUYA 1NCDH 5HDQH 1DBKL 3GSNH 4OZIE 3BUYB 5H2BB 4PV8A 3ZL4L 2BFVL 3IYLW 4F7EB 4X7CC 4NRXA 3HI5H 3JSSA 1HHGA 4Y5XC 1Q0XL 4Y89A 1J1XH 2VL5B 4KTEL 3DSNA 4WUUE 5DWUH 1P6FA 2GY7B 1KV3A 3ES6B 3DECA 1LNUB 1AP2A 4OV6F 2J6EA 5IT2H 15C8H 1JTOA 1BEYH 1MFAH 5D71L 3D5OF 3ZL4H 1KCUL 4EXKA 5CGMA 5IBLC 5E99H 4YBLB 1CD0A 4L3EE 3QRFM 2F9BT 4PGCA 3TA3B 4Z7VA 2IGFH 4P23B 4HJ0D 3SJVB 5CSZB 3K2UH 3MYJB 4JN2B 4EI5C 4WWID 4KHTL 1G7LB 5JOPD 1LEGB 3ULVD 4YHKH 2CDFB 3S5LA 4FQ2L 4N8VA 4ZUTB 5EUOA 1F6AA 3DRQB 5FCUH 4PJ7E 3VFMB 1L6ZA 1HN1A 4BFIA 3D3VD 3FHAA 5GGUB 4YX2L 1A7BA 4RIRA 1FGNH 4P23A 2A6KB 2N1KA 2ORBH 2W1NA 4Y4FC 4KKCC 1QRNB 1XGQA 4ZS7L 3KPSA 3S96B 2EC9U 1OT2A 2VDOL 2I9LA 2IPTH 4NQDA 1AKJA 4TVPH 5H8DA 3BP5B 2Z4QB 4K7FB 5IQ7L 2BNUB 1JNHB 5KSBF 2V7HA 3JZ7A 3V8OA 3GK8L 3GSOA 4JFYA 3AS3A 1CI5A 3C6LD 3I3BA 5D7JB 1QO3A 1RZ7H 1E4KC 2V5SA 1P4LB 3DVFA 2EXYD 3MV7A 2B4CH 4XMKH 4PJDE 5IBTL 4HBCH 4UI2A 2VR9A 1XR8B 3VGFA 4U1IA 4JRYA 1QR1A 2J2ZA 3NTCL 3QH3B 4J1UA 4X98A 1FIEA 3U0WH 4OLWL 1G0YR 1KFAH 4L29B 2EYTA 1UA6L 1SY6A 5MHSE 3GI9L 1XGUA 5FHBL 4P2RB 1CFQA 2O5ZL 2FHCA 3H9SA 4JO4L 5L2JA 3X3FL 5FDWB 5HD8D 4M7LH 1HHHB 3IAQA 3SCMC 4U1JB 3CPLA 1I7UA 5EC2A 5EPMA 4H20L 3SKMA 1FO0H 2A73A 3HE6B 4IBLT 4XRCB 1HCFX 3GJEB 3JWOH 1EFQA 5I30H 4G9FA 1XEDA 5ANMB 1ZEAL 3D1MC 3PWVA 7CGTA 3O4LB 1K8DA 5DD3H 4CN4A 4OM0L 3PP4L 1KPVB 4C56D 2JLLA 2RIKA 1F2XK 2XQYK 4YHOL 1D3CA 2EDEA 3FQWA 2BVPA 1NGXA 1IC4H 3UBXB 4R4NC 1JUFB 1REIA 3SBWA 1FIGL 3CC5A 1NC2D 3EGSB 3OAUL 4JHAH 3LDBB 2NW3A 3PP4H 1UKTA 4WUKH 3VXQA 1JPST 1MCOH 4NQCA 3UZQA 3NAAH 5FYKL 4CN1A 2XY1A 2NY1C 4UIKH 3I9GH 4X6CE 5C92A 1YMMB 3RZCA 2V5RA 3VG9C 2CK0H 3M17B 4MCZA 2X4PA 4LLWB 5BZWB 4WHYG 5KS9F 4QO1A 2YK1L 2IJ0C 1AGFA 3ARZA 3W2DL 4A6YA 1OARL 3H42H 1U6AL 1CN4A 4R2GC 3D9AH 5DHVH 1S3KH 5LWYH 5HTSA 3ARGD 5L6YH 3NFPA 3IVKB 2AK4E 2DIAA 3QDHA 4R7NB 5MERB 1G0XA 1G7IB 1A0QL 2IQ9H 1FFNB 4XCNA 1NGYB 1TCRB 4TSAH 3S36L 5C09D 2EDHA 2Y5EA 5JTWA 1EEUA 3KWWB 4DK3A 1F6FB 2CDEB 1X4ZA 2W9DH 5T5NF 2V2TB 3WDIA 2DLFL 3JUZA 1A1OB 4HPOL 4LFHD 1GVIA 1T5WA 3L3GB 1QPXA 4UT9L 4MWFA 3U0TA 2ED8A 4ZFOA 5DMGC 2MQ0A 4K7PX 1LO4L 1BECA 1RFDH 5E2TH 3MRBB 4TRPH 4L9LB 1NCCH 4YEEA 3VDBA 2D31B 4I3GA 1AGDA 4J1UB 4X98B 2BVYA 4NHUA 1XGYL 4QRRD 3STBA 5CJBA 3LY6A 1UXSB 3MJGX 3O2DL 3TIEB 1RZJC 3ARGA 1OW0A 3B5HA 2X41A 3PXJA 4MA3B 4AENA 5IB5A 3VDAA 2NNAA 5SWSA 3TT1H 1MLCA 3MRLB 4OLYH 4PBWD 1BFVL 4DKEL 4JM2B 4KUZL 5IHLB 2P5EA 4XMPL 4BQCA 2DM3A 2CRYA 5EIIA 4UU9B 3OKKB 5A16A 3G6JF 2CKNA 2EE6A 1HQ4A 1I1AC 3SY0A 3OF6D 3N1FC 5HYSG 1GSMA 4R4BA 3NPZB 1PZUB 3HKFA 4PJGE 3G9VA 4NO2A 1BMGA 1P9MC 4QHMA 1UCBL 2F53E 4UQ2B 4QOKB 3NVQA 3D69A 1DL7H 1PG7X 1DLHA 3GMOB 5BV7H 5I0DA 3QEGL 2AVGA 1I1AA 2OK0L 5CINL 4HIXH 1IILE 5D1XD 4JEGB 4M3JA 3TO2A 2G9HA 1NPUA 1DLFH 3E6FA 2AV7B 5DTFA 1A3QA 1DBJL 5TPWH 4F15B 5DYOA 4S0SD 4U6VH 4ZAKA 3KPNB 5EU6B 3ULVC 5DJ8A 2OQJB 4UQ2A 3WFDL 3FT2B 2VLJD 1GHFH 1MCLA 1P1ZA 5JHLL 1K4CA 3P4OA 2YWYA 1CICC 1YYMH 4JLRB 4LLUB 4MVBC 1VB9A 3MA7B 5IW3A 2XQBL 1IT9L 1CLYH 3CSGA 4OGZA 5IHZA 4PD4J 2N7AA 3QI9A 1WBXB 2FJGB 1WWWX 5EIIB 4Y88A 5F6HI 5I8KH 4ZODA 2IANB 1U8OB 4WV1C 3W9EA 3M45A 2VLKA 5TH2A 1FFOA 3PWJB 4I48A 2EDDA 4TNWF 4LHUG 3V4PH 1EEZB 1SVCP 1T03L 4XNZB 4X6CA 3TT3L 3QISA 5D7LE 3LPGA 3TVMD 4NN6B 5E8PA 1KTLA 1AXTH 1I85C 2EDRA 5DJ6A 1DFBL 3MFFA 5SX4I 2DJUA 5DDHA 3S35X 4QOKE 5AYQA 4X99B 2DBLH 4W6XB 5KN5B 1EMTH 2GJ6A 5I17B 4GG8A 1FPTH 2DQHL 1NGPH 4R4FH 4PRAA 2VN7A 3AVEA 1AI1H 4AJ0A 3ZLQC 4U6YA 3IDYB 2HFEB 1NCTA 2I07A 2FHBA 3GJFA 3HI6H 4U1HA 5JQ6L 1EHXA 4OZGE 3ARQA 5E8NB 1A6VH 3HS0B 1BM3L 3IJHB 1T89A 3M1BA 4PJEF 5EFIB 3QEQD 1UH4A 4LDEB 2NY6C 4FQHA 3LRSB 3BW9B 5KSAC 3F7YB 2HTKD 5CEZH 3QDJB 5CMAA 5MENA 1YYLL 5SWQA 3NZHH 1H3PH 5IEHA 5IFAL 5T5FH 5HHQB 2AKRB 4J3XA 1S7XA 2IPKA 3GGWA 4HG4K 1ZT7B 2FX7L 4HWEH 3MNZB 1ONQB 5FKAB 4YNYA 1R5WB 1A6AA 3O4OC 5I1IL 1OB1B 4QXGH 1JE6A 2YZ1A 4GW4A 1CDCA 1KCVH 2HLAA 4HPYH 4LRNL 3LVEA 2C4XA 4HKBB 3VGBA 4N8VG 4XZUB 3MNZA 3GMMA 1HZHL 1NAMA 3IF1A 3UYOD 5E08L 1W0VB 3CXHK 4PRHB 3OSKA 1WVZA 3DV6B 1V5JA 5IROC 3MC0A 1FCCA 4ZNEE 3ZZ1A 5JOPE 4HGKC 2LQRA 2Z0BA 4KMTH 4OIBA 5HHXL 3F7VB 3V5KA 3VXRE 2VLME 5DHYA 4PJFF 3CLFH 3WL9B 4ZTPH 1MJ7H 1NC2A 1WBZB 1NCAH 5K93A 1JVKA 4NQDE 4S1DD 1KCUH 3SO5A 5JMOC 4PYHA 1BEYL 1MFAL 4ISVB 2NXZB 3RGVD 3TP4A 4LK4A 2DDQL 3I75A 1D7FA 4Q9BA 3EFFB 1ZLSL 1HINL 3TZVC 4YWGH 2EXWD 3GSWB 1G6RA 4M6ML 1DQDL 5LCVL 1OTTC 3QUXA 1LK2B 1S9YA 2D2OA 4L9DA 1HXMB 2P42B 4I3SL 5EUOE 1EEZA 4Y4FA 2CRMA 3LEYH 5CIPB 2J3SA 5DF0A 3TEUA 1U42A 5CGTA 2KBGA 1ZT7A 3ZT6A 4K71C 1I8IB 3QSKB 3TBWB 3WUWA 1RZGA 4CU6A 4PD4K 3TBYB 4XNYL 2MQ3A 3QJFB 3HTLX 1QHOA 1WZ1H 4KROC 1WTLA 2XICA 2X05A 5DJ2B 5GGSA 1ZGLM 1N26A 4JFEA 5EFIA 2EDOA 5JA9A 3R8BB 3P77A 3JTTA 3EDJA 3FN9A 3LQMA 4Y4KB 4UT7L 1GZQB 2E6PA 4QXGL 1CQYA 1T21B 3NN8A 5HYQB 3INUH 5JO5B 1OHQA 5E5MB 2VXTL 1QLEL 1SM3H 3AB0C 3JV4B 3BQUB 4HZLB 2GITB 2CIKB 1FFRA 4RGNC 2DQJH 5C2BH 5IEKB 4WI8A 4WW1A 3D0LB 4TSBH 1CE6B 1CS6A 3DLQR 1MAJA 1LDSA 5AZEL 5EUKB 3VWJA 4X7TA 1Q1JL 5EC1B 1FNSH 2DQFA 2PYFA 2MHAA 4DQOL 1T04A 4PJFB 3TT3H 1VHPA 1YY8A 3K46A 1ZTXL 4V1DA 3CVHB 5E2UL 2OTWB 4NKDA 1FN4A 4YLQT 2OJEB 1GGTA 2YBRA 5IVXF 5EUOB 5HHPA 2AEPH 1D9KD 1TENA 4B50A 3MACH 1MREH 4NSKB 4P4KD 4PY7B 4PJXA 1FJ1A 3RWHA 2VLRD 3P11H 5HGBA 8FABA 2JK5A 2J7LA 2AGJH 1T2XA 4P9HH 4JLRA 2HT3D 4PGEB 4UOJA 1BFOB 4IDJL 2LTQB 4P49A 2X5PA 4YBQD 2F58H 1AP2B 5MI0B 4DAGL 4X83A 3RIFF 1QA9B 3RWEB 4JFDE 1HHIB 2AK4D 2NTFA 3MO1A 1QRNE 2J88L 2NXYC 3RDTC 3G5XA 3X11B 4KJYB 5D72H 5JXED 3ULUE 1ED3B 3KYKL 3I6GB 2YUWA 1A9EB 3WFZA 4LGRB 1G6RH 3R4DA 1OGTB 4D8PA 4Z7NE 5IVZA 1PSKH 4JDTH 4BH7B 3FFCA 3VRLE 4P46A 4XP4L 4MX7B 5IV2A 5EIQA 1G9ML 2BVQB 3V0WL 2X4QB 2XN9B 4LHQB 5A16B 4UV7H 4I77H 2VABA 3X17A 3KYNB 3F5WB 1BFTA 4PUBH 3ZKND 1IEBB 2Q86B 1KTDA 3IB4A 5FYLH 5L6YL 4GKSA 4XH2B 2NNAB 4M7JL 5SWSB 1G9EA 5IB5B 4QT5A 2V5TA 1NUDA 2A83A 3QUXC 2DLEA 2ICWA 3A6OA 3GNMH 1B90A 3EO0B 4M1DH 1U8JA 5JQ6H 1GZPB 1XMWA 1Z6JT 5IJVB 1Q9LA 5IOPA 2BK8A 3EYOA 1L7IL 5KS9B 5IP4A 1KC5H 1JV5B 2IPUG 2BVUA 5IW6A 3T0AA 2CK2A 4X4MA 3AC0A 4GRWE 2G75B 2F74B 4RFEB 5CZKA 3CC5B 1OW0C 4KMQA 3CFIC 2Q6WB 3I3EA 1FNEB 1IGTB 1NCCL 1ZXQA 2WIIA 2YRLA 4NRZA 4ZO9A 2HJFB 3QHZL 3T2PA 3ZE1E 4WDIB 2FH8A 1CDJA 3GMLA 4ZFGH 2Y5TB 1QD0A 4ODWB 4PJ9A 3FO1B 3SDYL 1P4BH 5CIPH 1RZJL 3OGOE 5E8EA 1JYXA 4U1SA 2VQ1A 1RIUL 1BWMA 3GJEA 4XRCA 5J9PA 4YDLB 1U8PB 4UT7H 3HZMB 2C7UA 3P40A 3KXFB 1RZFL 2B1AH 3WFCL 1G6RL 4YGVA 2A83B 3GRWH 1PLGL 1CL7I 2NX5E 1WEJL 2DKSA 2YD2A 5E2VH 2DWDB 1NCBH 3QWOA 1W2KT 2X1QA 4QXWA 5DMYA 4CRPA 1RZJH 1RUKL 2HFFA 3UDWC 3GI9H 5GSRB 2FO4B 4MQXD 4X4ZA 1KGCD 4XC3H 2HMID 3GK8H 3B3IB 2GKIA 2GJJA 1LO0L 3MRIA 4HFWB 4AMKL 5JLZA 2ADGA 1J8HD 3KPQA 4M7ZC 3GRWA 3GKZA 3BKYL 4LCCC 5GRJL 2NY2B 2WUBH 1NMCB 1DQLL 4HLZH 1JUFA 4XWOD 1YN6A 1IZJA 2CPCA 3VXSD 2B1HH 4H25B 1FRGL 3D25A 1ED3A 4WHTB 1UH3A 2QQKH 1KPVA 2X1PA 3LS5L 2BOCB 3MROA 3O4LA 2XWBA 1TVHB 4JY4B 5AZ2L 3L95B 5CCKL 4QOKD 4NO5A 2WWMD 1A2YB 4OM1L 1ZHLA 2P24A 2I9TA 3TPUA 3GFUA 2LAGB 1PBYA 2XWTA 4XCEB 4U1JA 3H9HA 3OB0K 4RFOH 2NZ9D 4OUUB 3PHOB 2FIKA 1U9KA 3L5WB 4XMLL 4Z9KB 3DRTB 1VCAA 1HI6B 4D9LH 1BLNB 3KR3L 2H2PC 4ZS6D 3W0WA 1YEDA 5A3ID 1TDQA 1OF2A 3QEQE 2FX8H 4MAYA 3MJ7B 3OJVC 4FS0A 1A7QL 5KAQG 2CO7B 3QI9C 1B9ZA 4HEME 4YEFA 5EU4A 3GI8H 2R0ZH 5EO0A 4D0BB 2NW2B 1IVLA 1FL5A 4F7CB 5M7QA 3LN5B 4KI1A 4XVSH 1OL0A 4Y4HB 4NNYA 5MP6H 1XF2B 2B4CL 4PG9A 4NKIL 3BD5A 2PYEA 3SDAD 5FO8B 4E41A 4ONHA 4UQ3A 2CR6A 4XC3L 3CLEL 4ZYKB 4X7FC 5J11B 2YEZB 2JB6B 4P5TD 1DQTA 3ECBA 5L0QC 3VFPB 5FM8A 1EAJA 1A3RL 35C8H 1YJDC 3BPOC 1UJ3A 2HJLA 4FFVD 3IJSB 2F15A 2X2YA 4Y4KA 2X4NA 5IM7B 1M7IA 4RA3A 1F4YL 4WFFE 5DZOA 3I2CL 3DX7A 4CADA 5ICYA 2P5WE 1H3PL 4FMKA 4RBPH 5GGUA 5EBWA 1AGBB 2HLFC 4LSQH 1QYGH 2Z93A 1LP9A 4H26B 5MEQB 3DGGA 4MNGE 3SGJC 1SJEB 2X4TA 1FH5L 2ZUVA 5C0FA 4JY5H 3V7AE 3VRJA 2F8OA 3V0VA 3CFCL 2EIBA 2VISA 5JHDE 5CBEB 4KV5E 1P7HL 5AUMA 3GMPB 3D2UB 1MIML 4IRSB 3UTZB 3V52L 5I16A 1G6RB 1JHTB 4I2XA 2NY0D 4PS4H 3HC0A 1I3GL 5TDOA 1MH5A 1XF4A 2PW1B 3VXPB 5IMKB 4OZHB 1BZQK 3O0RH 3VFWA 3VI3F 3WO4B 2Y9RT 3SHSA 4CVWA 4P2OC 5ID0A 2NY0B 3RJDA 4PR5B 5EU7E 3T3ME 4Y5VC 3EYQC 3HMWL 1T3FA 1WZMA 2OM5A 3L3JA 3FO0L 4ZOEA 4OTXL 4XCCH 1WIOA 4PP1C 4KQ4H 3F7VA 1U8NA 5B39A 5IFHL 4OCXH 3VMNA 3UTSE 5BRZA 4YAQB 2EYSA 2KZWA 1YECH 1TTGA 1S7VA 3S35L 2H6PB 3MRQB 3HCVA 2Y06H 1K8IB 3MLVL 3BP4B 4Z78B 2KPNA 4TULL 5D1ZD 5AD0B 2HRPL 2VIRA 2RB8A 3MGOA 4S1DC 4HKBA 3OG4B 4YC2B 4FZEL 4WUUB 3S88L 5L2KD 1RMFH 5DA0B 1RULL 1S7RB 1SBSH 2JB5L 4FA8A 1Q72H 1JJUA 4HWEL 4DKFH 2YA1A 5KSUB 1E4JA 5E4EB 1INQA 2EDQA 1OAUL 4NN6C 4U1MB 5D2NC 4OKDA 5I1GL 1Z5LA 3TJEL 2APTA 5F9JA 2V9TA 3LIZL 4HG4J 2L0DA 4PREA 5DHVB 4WO4D 4YAQA 3T04D 5FKPB 3WFEH 4WEBL 2BHYA 3WL9A 1GPOL 4P57B 3LPFA 1ZSDA 3LKQA 4WNQB 3TPKA 3GJFB 1W72H 4U1HB 1KIPA 4QTIH 4WTZA 1VGKA 1WAAA 2BX5A 5A2IH 4WEBH 1MI5D 3WYRA 5ADPH 2QR0B 2HTKC 4ACPA 2E27L 1P84K 5KSAB 2ENSA 2PO6A 5F1IB 4DVBA 5A2FA 1MPAH 5D7IE 5F1SA 2J8UA 1NCAL 1T20B 4ZO6A 5KSAD 4LMQI 3T77B 1YC8A 4X9BA 4ZMAT 2R8SL 4JGMA 5HD8C 2ZJSH 4QXTA 4WUUA 5KZCB 5IB4B 5HPOA 5FKAA 3ROOA 1OSPH 4MJIB 4DKAA 3EJZC 5DEZA 3BO8A 3QFJB 2J12B 1UM4H 1N0LA 1WCBB 3QFDB 2ZWLT 2DYPA 4XCFH 4FQQA 3DBXB 1ZV5A 4ELMF 2VLLB 5I66A 3VRIA 5IHZB 1SJHA 1MWAL 3RL2A 3AXLA 1LDPL 3FCTA 3QPXH 1HH6B 3RZWA 3T4AA 5CEZD 3DX8A 3MRKA 3HE7C 4GUPA 1RJLB 2YHGA 1NAKL 3WFHA 4Y19D 1IE5A 4M6NL 4JN1H 1S9XA 4FQXB 3NA9H 5FO7B 4JGJA 1CK0L 4RMTA 1DLFL 3ARBC 1CU4L 2BNQB 3FT3A 1HXYA 2IG2L 3WDHA 3SDDD 4ZUVB 1MCPL 1ND0A 4K7PL 1CLOH 5JIKA 3F7RA 5HGHA 4KJPD 4LCIL 5C9JB 3GMRB 4EUPA 1AQKH 4WWKC 3O6FC 1OGAA 3TYFA 5JIIA 4WCYH 5GSVB 3SDCA 2B2XL 3V52H 5K9KA 3OKYA 1PZ5A 4R4BB 1GL4B 5HDBF 2FLRT 1X5AA 4RCAA 2D9CA 1JPTH 4ODBD 1CFTB 1YMMD 2Z93B 3VA6A 1ZLSH 5D7LA 5D7LB 1NBVH 2OZ4A 3D3VE 4EI5D 4XVJL 4EOWH 5JPNA 1N8ZA 4FABL 4IMLB 1FFQA 3GNML 3OX8B 4N0YH 1TZHB 4Y1AD 3AU1A 5K9OA 4RMRA 3SDAB 2XWTB 4XCEA 4DZ8B 1FZMA 1JRHH 1GHFL 4F7MA 4ONGH 1FVDA 3VI3E 1KC5L 5FHBH 4S10A 4JPWL 35C8L 3PWLB 5DJXB 2VWEE 5E03A 3FL7A 1I7TB 4JM2D 1EK3A 2FJFA 2Z8VC 1MFEH 4JZJB 3ARBD 1YEEH 3MJ9A 4MHHI 5DMKB 1YPZF 4GW1B 1YNKL 3F62A 2BNQA 4ZUSA 3WSQL 2X6MA 4PRIE 5ITFA 3WLBA 1GOGA 4KU1A 1R24A 4LCUB 3BJ91 3C5ZA 4XNXL 5E95B 4QHMB 4D0BA 1AC0A 5GS0H 1J8HE 1JGUH 5IHUH 1MCHA 3BAEL 3ULUL 4MQTB 4G7VH 4M7KL 3SGEH 4ELKA 5FA3B 1QACA 1UC6A 1AQDB 1LO5B 1ZHNB 2VQUA 5DJCB 4Z7WB 5DLMH 5DJDA 3U0PB 1A6ZB 1WZKA 2GI7A 4ZFFA 4H1LH 1T1XB 3EOYG 4J4PD 3WXVH 2DBLL 4G43A 4DVRH 4PLJC 4N90E 1XR9A 1PLGH 5FUOH 4OUUA 3ULVH 2PTTB 2AJ3B 2FWOA 4UIMB 4RMVA 2AJZA 1RV6X 3QQ4A 3MRFB 1TNMA 3PGDA 2X44D 4O2FB 2NY5L 4W4NA 1HE7A 2XKNA 4YE4L 3C5SB 4M8VA 3QNYB 2YD8A 3DGCR 3PL6D 1MRFH 2VQ1B 3IFNL 1T66D 3U2SA 3ALWA 3QULB 4L8SC 5CGYC 4C56E 2EXWC 2R4SH 1NLDH 3C87A 3FRUA 4I18B 3CJJA 4XGZA 2HH0H 5GZND 5J1AB 1GXEA 3EOTL 5DVNA 3O8XB 4BFEA 3U4BL 5D7JD 2HN7A 3H9YA 2VR5A 5D9SB 4HS8H 5I15L 3DX9B 3F58H 4QTHA 4ZD3H 2CUHA 1Q1JH 1KB9K 1D5IL 3ELAT 1ZSDB 1JZ2A 2YUZA 1MAML 5DUBA