3BGFB

X-ray crystal structure of the sars coronavirus spike receptor binding domain in complex with f26g19 fab
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
216
Chain Sequence
b'EVQLEESGTVLARPGASVKMSCKASGYTFTTYRMHWIKQRPGQGLEWIGAIYPGNSDTTYNQKFKDKAKLTAVTSTSSAYMELSSLTNEDSAVYFCTREGIPQLLRTLDYWGQGTSVTVSSAKTTAPSVYPLAPVCGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spike protein S1
publication title Structural insights into immune recognition of the severe acute respiratory syndrome coronavirus S protein receptor binding domain.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein/immune system
total genus 40
structure length 216
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bgfB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bgfB01
4YE4L 4HQQL 5CCKL 3WS6C 1RZJL 2VJXA 3DX6A 1U8HA 1XR9A 2FZ3A 5L7XH 3EJYD 3ZYJA 3FFCD 3U0TB 4R97C 3FHQA 1WV7T 4GMSL 2EXWC 2D9CA 4PRDA 4JO4H 4LVOB 1OAZL 4JY4B 1L7TH 2IJ0C 4KDTA 3TVMC 4PJDB 5TE4L 3DVGA 3SOBH 2OXHA 4U1NA 2YZ8A 4YXHH 1DTUA 1ZANL 5CJ5A 2X44D 3NA4A 4KJQD 1DBML 3ZKXB 1MFCH 4IDJH 4P2RD 1LE9B 5HYJB 2VISB 2EIZB 3I02B 5HI3D 1JP5A 4S1RL 1ZT7B 5LQBH 3PQYA 4KROD 1HQ4B 3PDOB 1YC7A 5KW9H 1IZJA 1I1AA 4JY5L 4X4XA 3LSOB 3NCFB 1JRHH 2H3NA 3BDXA 1T7ZA 3S88H 2IMMA 5ECJE 1BJ1H 3QUZC 5D7JD 3ARGC 3DOSA 4OFPA 3ZE0E 2FX9H 4XI5D 3VGEA 4DJMA 1GGCL 2W0KA 4GAGL 1IKNA 4YHKH 3VD7A 2V5MA 3HZVA 4PRPA 5J8OA 3SDCB 4YR6B 4YE4H 4HQQH 4KJYA 5CCKH 4OZFG 1RZJH 3RWJB 1KCRL 5CZXD 3UTSD 4JPVL 4RRPA 3T2QA 3VXSD 3AS3A 2X4UB 4PJIE 4Y16C 5T1KD 2A2QT 5IVZA 2XWBB 2VDKL 1GZPB 4FFWD 5TE4H 5EO9A 4M6NL 2ZUYA 3SDXF 4R7DA 4CU6A 2CKNA 1HCFX 3EIFA 1D5XA 5DJ8A 3P4MB 3ARYA 4OQ1A 4XBEL 4OUOA 1DBMH 2VZSA 4E5XB 1BZ9B 2Y25A 5CP3A 5DJAA 1F90L 1OSZA 4WI6A 2OI9B 4LAJH 4P0DA 1DQJB 1KLUB 3MRNB 4S1RH 2J3SA 1HZHL 3WO4C 2LFGA 2YN5A 1QLFB 1QG3A 5H35A 4JY5H 2B1AL 1U95A 5KANG 5FECA 1P69B 5JHDD 1A9BA 4YNYB 1FCCA 1UM6H 3DRQA 4OT1H 2A73A 2IAMB 3EGSB 1PYWA 1QSFD 3D9AL 2EZ0D 1F4WL 5GRJL 4DCQB 4GAGH 4X4YB 5BVJB 4HWUA 1PD6A 4LLWA 1NANI 3X13A 4ETYA 1C12A 1A6TA 2F53B 2PW2A 2VABB 5A1AA 3BZEB 1E28B 1C8PA 4ZOAA 1KCRH 1JMZA 1OPGL 3MNWB 4JPVH 4XCYB 4QKXB 5T1LB 1FP5A 4PJFE 2MQ0A 1SHMA 3PP3H 4WDIA 2VDKH 4RA0C 5ILTL 3TIDB 1CFBA 5SX5H 1YJDC 2FHCA 5D2NC 4X4MA 3VD4A 3LDBB 2MWCA 3NFNB 4M6NH 3OHXB 4KWUA 3CSYA 3DV4B 1EFXD 1EZVY 5IWLC 4HKJB 1KENL 4UT9L 1F90H 4YHOL 1FGVH 4J4PD 4OFYD 3IF1B 3CXHJ 1JHLL 4KFZC 1KNOA 4HWNA 1AGDB 4OZGB 1R3KB 3EJJX 2B1AH 1WISA 3PHQA 3JV6B 4TQEL 2LAGB 5IMLB 5CJ8A 2AQ1A 2XXMB 2R29L 2QADC 2V7HA 5F7UA 4PUBL 1YMMD 3D9AH 4PGZA 3ZT7A 1F4WH 5GRJH 4FA8A 3NBNA 3GIZL 1CICD 2NY0C 4NRZA 5EU6E 1HSAB 4WWKB 3VMOA 3MLXL 1XCQB 4P2OD 3E6FB 4CMMB 2YXMA 3ILPB 4GG6E 4OAWA 4PJIA 3LRSA 1OPGH 1Q72L 4K94L 5I74B 1YNTA 2X09A 1HWGB 5D5MB 1GOFA 3RHWF 3CUPA 3U30C 2DB8A 4XT1C 4ZPVB 5D4QA 1JZ4A 4LDOB 3BQUC 5IMMB 4U1IB 4LSQL 1LQSR 3VFMB 1O7SA 3Q3GB 5IR1A 1R5WB 4JLRA 2NZ9C 5KVGL 4PJEA 4UT9H 4PJCE 4YHOH 4MLSA 4ZAKA 3HAEA 3UZVB 1EBAA 4UINL 1JHLH 2AGJL 4G8IA 5GPRA 2EDFA 1NAML 4X6DB 3X14B 2ADIB 4TQEH 5DHYB 1MUJA 4Y5YA 1GJIA 1FNAA 1RULH 4YDIL 3L7EB 1EEYA 2YKLL 3WN5A 3WE6B 4PUBH 2WBJD 5JDSA 4CNIA 4U1SB 4J6RL 1KIPA 1RIUL 3GIZH 3P4NB 4NGHH 3MLXH 2AXJA 2GTWB 5GQBA 5IBLD 3HE6C 5BXFB 4WNQA 4YBQD 2IF7A 4JHWL 4LLAA 4PJFA 4PJ7E 2XKUA 3PWVB 3RBSA 1Q72H 4K94H 1U8IA 3HZMA 4MAYC 3RIAF 2NY3C 4MQTB 3LKNB 1JV5B 1G7IA 2EDTA 1FVEB 3O2WL 4G9FB 4MCZA 1BD2A 2JJVA 2BVQA 5KAQG 3SKMA 5CSZB 5E6ID 3MYZA 3MRGA 1OD7A 1KIRA 4MSWB 4E0RB 2P48B 3GGWA 5LWYL 1ZVSB 1G7MA 3CMGA 1DE4A 2WQ8A 4MWFB 4LSQH 2AEPL 4RNRB 5C0GA 5DD6A 2DLEA 3MRKB 5KVGH 3BZDA 3IDIA 4LK4A 3I6KA 2V2WB 3O6FC 5IMKB 3E6HA 5C0EA 3DETD 5ITFB 3V6ZA 5MEND 3S4SB 4WU5B 4C58B 4PR5B 4XMPH 1KTDA 1QFOA 2DF3A 3RKDC 4Y5XB 2AGJH 4HJ0D 4WHYH 5C2BL 2FD6H 3PJSA 1NAMH 2CLZA 3K1KC 5ACMA 1M05A 4P5KB 1CD0A 4J23A 4YZFE 4YDIH 2YKLH 1U3HA 2OJZL 1WEJL 3OPZL 3PL6C 1A14L 3PWLB 3MV8E 3TO4A 5IEKB 5IP4A 4J6RH 3U36A 3QIWC 5E0QA 1RIUH 2HG5B 4G8GE 1RFDL 4PGEB 4MXVE 1ZAGA 5JUEL 2IPKB 1OARL 1F8TL 1R3JB 2IPUK 3F12B 2F9BT 1DBBH 4JHWH 3LQAH 2DQUL 4K7PX 1LK2B 2AXGA 2PXYA 3RGVB 3BN9D 3O2WH 4XWOC 1U8OB 4U1LB 1F58L 4R4FH 3QISA 5DTFB 2LAAA 4ZUWB 5F70A 3IETB 2W0FB 4Q6YA 1JJUA 5LWYH 1Z3GL 1TIUA 3S37X 3CSPA 5J11B 1ZT1A 2AEPH 1T0MB 3U7YL 5F1IB 4B7IA 4D0BB 4PJCA 4FQ1L 4RMSA 1MH5A 3HG1B 4N0FA 4KKAC 2EC8A 1ES0B 1NMBL 2CK0L 5CP7A 4MXWH 2VITA 2WZPD 2DI9A 1ITCA 3VXUE 2B0SL 3OAYH 1IL1B 1OAKL 2VLJB 5C2BH 5F9AC 4HUXA 1NGZA 4PLJD 2E6QA 4W4OA 3L3GA 2ED7A 1J0YA 3V7MA 4G3YL 3HMWL 2OJZH 1WEJH 3OPZH 4M9OA 1A14H 3GSUA 5C0ND 1HH6A 1AQDA 3F7RA 5CBEA 1RFDH 2YRPA 3AU1A 1RJLA 4UDUB 5JUEH 4PJ7A 2P24B 3W11C 1OARH 1F8TH 1MVFA 1T4KB 4JPKL 4WO4C 5EU3B 2DQUH 4RGNE 1DBJL 1MFNA 2HJLB 5EO1B 5JIIA 4KRLB 1P84J 3V6FA 3RDTA 1B2WL 4JRXD 4MMZC 2HWZL 5K59F 3MV9D 4LL9A 3MGOB 5SX4I 3MUGB 4EUPA 3GK8L 1C5DB 4ZDHB 2HTLD 1Z3GH 4TVPL 4JAMA 4EN3D 1W0YT 5E2TL 1DUYA 3U7YH 3KPPA 3H3BC 3LAFA 4LP5A 5HY9B 3TZVD 1BF8A 3DVIA 4FQ1H 3S3SA 2YC1B 3U82B 1XGQB 2X4OA 1CFNB 2PYFA 1RI8A 3PWPD 1NMBH 2CK0H 2WINA 3OR7A 5I75B 5KSUB 2B0SH 5FKPA 1OAKH 1FIEA 3UZEA 4CW1B 3ARBD 3HRZA 2WLZA 3KDMA 4G3YH 3HMWH 4M48L 4LFHD 1ETZA 1KPRA 5AWNL 4MD4B 5ANME 3K8LA 4G8EA 5IB2A 1DCLA 4X7TB 2WANA 4XB7A 2EEBA 4RFEA 3N9GL 4GAYB 3QPQC 4BKLB 1CL7I 1JPFB 1WIOA 2BP3A 1NCBL 4MB4A 3WKNA 3EAKA 4ZUVB 4ENEC 1DBJH 2OQJA 2CQVA 3ALPA 1NJ9B 3O3AA 4QCIB 5CWSB 4YXLL 2XPGA 1B2WH 2RGSA 3G6DL 3NACL 2HWZH 3KPQB 3TIEB 2PNDA 3GK8H 4PRHB 1X5YA 2Q8BH 1KIQA 4TVPH 4QWWD 2RCSL 3FB8B 5E2TH 3ECBB 4K3GA 1IAII 5CLWA 1BX2B 3WV0A 3QJHB 4PTUA 5B8CB 2E5EA 5I1CL 1AI1L 4ZTPL 2P47B 3T2NL 4HG4J 3T0EC 3VXUA 1T7WA 2FGZA 2GSIB 1IKFL 3GBNH 3SKOB 43C9B 3DX8A 2PKDA 2X4TB 1RZGB 5I16A 1PQZB 4UQ2B 4HUUB 1IGML 2HMIC 3O2VL 1ZEAL 3QUKB 4HMDA 4M48H 3IGAA 2YOCA 1KF9B 5HYSG 4ONHB 2EE6A 4GRWE 5AWNH 3B2UC 1RPQA 2I26N 1EHAA 3RVUD 3SDAB 1RJZA 5DEFB 4YDVB 3NABL 5DK0A 1NCBH 2ICEB 1URLA 4UNVA 3MXWL 5BRZE 3QT2A 1QUNA 4RBPK 1FZOB 2YPLA 1KUMA 4OGZA 4YXLH 3MRHB 3RWGA 4QNPE 1DBAH 1FL5A 2IAMC 2YUZA 4RGOH 5BO1L 2ICWA 2ZUTA 3NACH 2ARWA 1JZ3A 3KXFD 5IEHB 1MHEB 3CPLA 4P59L 5EUKB 1YJDL 4RMWA 3VE0B 1MVUA 5HHOB 4OCYL 1UCTA 1QBMH 4KI5C 4DKDC 2DL9A 3GJFA 5I1CH 1AI1H 3CH8A 4PJEF 4ZTPH 4PRAA 4FQCL 3T2NH 3MREA 4GG8A 1SVCP 1IKFH 5FUZL 3WCYA 3BWAB 4EIZC 4DWHA 1CFTB 1QQDB 2B7DT 2M26A 4X6CA 4ORZC 3IU3B 3VXOB 4JFPB 4PREA 5IMOA 3RFZC 1MJJB 1KB5A 1IGMH 4K9EC 4HK3J 4LIQL 2X6MA 3D25A 5ID1B 4JM4L 3O2VH 1ZEAH 2J4WH 1OQOA 1KG0B 3ALWA 1UM5L 5KSAB 4TSBL 4NDMA 4LSVL 3FQWB 3O8XA 4AG4L 4L3CB 2LV4A 1JF1A 5CBAB 4B0MM 1RK0A 3MXWH 4HBCL 4IOIA 2VL5A 1QA9B 1BLNB 4LDEB 4YHYB 4H1LA 4H5SB 4L8DA 4IRSA 3IXTB 4XMKL 4EI5B 1WK0A 5BO1H 1IEAB 4OZFH 1IGTB 4Z7WF 3PHSA 2Z91B 2K7QA 5CD3B 4PJ8D 3PGFL 2GAZA 1A6ZB 1P4BL 4JN1L 4P59H 4WWKC 1YJDH 4BZ1L 5F7DB 5FYJU 4OCYH 4QRQB 5D7KE 5F1NA 4YUEL 1S7TA 1A3RL 3MLWL 3TN0B 4I3RL 1MI5E 4QOKB 4GW4B 4JY6A 3MQIA 4D9QE 5FUZH 1OW0A 1L6XA 4F2MA 3KS0H 3ZLQC 5SX5K 5C0DB 1AJ7L 3RY4A 1NBZB 3LVEA 4LIQH 4PB0L 4JM4H 5CMAA 4NJAL 3W9EB 1AD0A 3CMOL 4XX1G 5JLZA 4ODSL 4Q2ZB 4RMVA 4CRPA 2EXWD 3NPZB 4TVPD 4TSBH 1FNGB 5D1XB 3ULUE 1BP3B 3TVMD 2VDQL 1F4YL 5KJRL 5KS9E 4AG4H 2B5IB 1TQCC 1QR1A 1OY3B 3LB6C 4ZUUB 1F3JB 3QBTB 4XMKH 5LJYH 2W07A 3VWJB 2AXHA 1BPVA 4CGTA 1MY7A 4JFQA 5I15L 3RIFK 1X5IA 3PGFH 1C08A 5GHWL 4JN1H 1Y18B 1T22A 3FONB 5HGGS 1S9XB 1I4FB 2NX5E 5GSVB 4BZ1H 1YY8A 3ZL4L 4A6YA 1IC5L 1A3RH 3TGXA 3MLWH 3QUZD 5KSBA 3ARGD 2VRAA 2ARJQ 3FRPA 1ZLUH 2I25N 2OMBA 3MV01 3V0VA 4DKFL 3SGDH 2DRUA 4JZNA 3FT2B 1AJ7H 4MVBC 2AJXL 3CC5A 3VXRE 4BFBD 5KZCB 1INQA 4PB0H 4XHQA 4NJAH 3H0TA 4QHLB 4Y16D 3CMOH 5J7CC 5BV7C 1QRNB 4TRPH 3T0AA 4ODSH 3GMNB 2X2YA 2BFVL 1J1PL 2BNQA 4MX7B 2I07B 2VDQH 1F4YH 5KJRH 3EYQC 3VI3F 2F8OA 1F45A 3O3DB 5ERWA 4P2QD 1FO0A 3U4AA 2FYYA 1WC7B 2R2BA 3IFNL 2R0WL 2ZG3A 3O4LD 5I15H 3BKMH 4X83A 1U8MA 3GSNH 4LSRL 5GHWH 3WXWH 3RU8L 5DJZA 4JFDB 3ZL4H 1S7RB 1MI5A 1IC5H 4WGWB 2H6PA 3FQNA 2Y72A 3BHBA 3T08A 1FVDA 3EJZD 3D39D 5I18L 5AD0A 3CFBA 4KUCF 4DVBB 1N26A 4P99A 4DKFH 2R4RL 1MELA 4OB5L 3ARFB 2HTKD 1DL7L 2BOCB 2WWKT 1JIBA 2EDYA 2AJXH 1N0XL 5J11C 4MNQD 1BVKA 3LN4A 1CDBA 1P9MA 4YO0B 4F7CB 1J1PH 2AAVA 4C54A 3MRDA 4Y2DB 2P5ED 2BVOA 1FYHB 3SEPA 4YDLB 3TCLB 1FZMA 2K1MA 3OGOE 2OSLA 4FTVB 4HW6A 5HPMA 3ARRA 3RGHA 3B6SB 2FJHB 4Y8AA 4H26A 4YHIB 4L4JA 4F7EB 5EZIL 3ROLB 3C2AL 1GZQA 3IFNH 2R0WH 1EJOL 5GGSA 2HYMA 1MCQA 4LSRH 5SWZA 5FHAL 3RU8H 1MHPL 2NPLX 5C70A 4JJ5A 1F11B 2QADD 4P23D 5I18H 1AHWC 2BCKA 1Q8MA 3QUML 3L3JB 3HTLX 4AT6A 2X40A 4QO1A 4NN5C 2R4RH 1LD9B 2N56A 2UWEB 2XXCB 4OB5H 5IB4A 2JJTC 4JN2B 5F7NC 2EDHA 3VXRA 1DL7H 3QDGE 4J1UB 1N0XH 1KLGA 2VLKB 4ZOBA 3VGBA 3GSQA 1I9JH 4AMKL 3WFZA 1QR4A 2BY1A 4FG6C 2AS5M 4GKNB 5DC9B 2MQ3A 1ORQB 4JRYD 5C0IA 2VDRL 5TDOB 2GKIA 4HMCA 3PQYD 3BQUD 4AIXA 2Q87A 1I1AD 3BRGC 3GMMA 3DX6B 4GRMB 1U8HB 1XR9B 2ZWLT 4RWHA 2JJSA 5ESQB 5EZIH 1FDLL 3C2AH 4KKCC 3P9WB 4N5EC 2YN3A 2PYEA 5A43C 2IBZX 5FHAH 4HWBL 3IDMA 3K46A 3DVGB 4U1NB 3RVXD 1I1YB 1W0VA 5I0ZA 2EICA 4BJLA 3QUMH 2ID5A 3LS4L 4JFHE 1GIGL 2BHUA 1UJ3B 3UO1H 1WWWX 4J3UA 2YD1A 1K4DA 4WHCA 4X6CF 1A7OL 3QIBA 1NBQA 2H3NB 3O3EB 2IH3A 1NAKL 2NY3D 3HNSL 1NGQL 2QJDA 3NZ8A 1G7PA 1NUGA 2IFGA 4YK4C 2DTML 4EI6A 4LCWD 3VA6A 1TQBC 3OB0H 2VDRH 2Q3AA 3HZVB 4PRPB 2BXYA 4KJYB 4L8CA 3JVGC 1KTLA 2EDDA 2ZUQB 2R0ZL 3ZTNH 4U1JA 5EOTA 2RQ8A 2HFTA 1LE5B 3WKML 3O6FD 1S3KL 5IVZB 3MRRA 1MCNA 4U6XA 4JQIH 3WEXA 4MJ2A 1EFQA 4KUZL 4UI2A 4ZFOA 4KKBC 3DRTB 4HWBH 5EZLA 5D2LA 4R7DB 1ZLVK 3QDHA 5GGVL 3BRDA 3UP1A 1D5XB 5DJ8B 5IJVA 4B5EA 3QDJE 3L9RA 3O81A 3QIWD 5DJAB 2CXKA 4JKKA 1A4JB 1OSZB 3LS4H 2FECI 1V5JA 2F8XC 1FN4A 3EZ8A 4DK6A 1ZT4A 5IV2A 3MOBL 5H35B 2G5RA 3RY5A 1U95B 5FECB 3VXQA 1A9BB 1NAKH 5LGJA 1MCKA 3HNSH 3DRQB 5E4EB 5GS0C 3W9DA 2A73B 4HLZG 4XWOD 1PYWB 2JELL 1OTTC 4FFYL 4OZHB 3BXNB 5JMOC 3CXDL 2J8UA 3NA9L 5FO9A 1A6TB 5D93B 1JK8A 2PW2B 1UVQA 1UCBL 5DHVA 1HSBA 2XZAL 2I9LA 4V1DE 2R0ZH 1T04A 5F6IC 3I85A 3WKMH 1S3KH 2XACC 1JYNA 5E4IA 5KG9A 2VR9A 4N90E 1EHLL 5KSAC 4KUZH 5IQ7L 3FRUA 1A3QA 1QPPA 1CCZA 5C08D 1NCNA 5GS3A 3RHWK 3RNKA 4KMTL 5DJXA 2IGFL 5GGVH 4IHOA 4GRLB 4YHYC 3MOAL 1GL4B 3O2DA 3GI9L 2OTUA 3TA3C 5KSBF 1YN7B 5HPOA 5LKNA 3PWJA 3KYNB 3MUZ1 4APQA 2FBOJ 4JRWA 1U58A 1Z2KA 4UDTA 2GJ6A 1A3LL 3NGBB 4PJ9C 3INUH 3FQUA 3MOBH 3W11D 1FL3A 1KNOB 2EYTA 5HI5C 1CDYA 5K9OA 5FF6A 4WO4D 2L7JA 3G04A 1T66C 5EUOE 3PWUB 2X41A 2EIEA 2V7HB 3TN0C 1Z0NA 2BOBA 2NTFA 1KIUA 4WW2C 2DYPB 2OLDA 2VE6B 3CXDH 4NRZB 3LEVH 5EC2B 1T1ZA 3SQBA 3QDAA 1UCBH 1UZ6F 1IRAY 1CI5A 1TVDA 2XZAH 4OAWB 4PJIB 3LRSB 5GRVL 2DLGA 3UPAA 4ZSOE 5LCVL 3GM8A 4OF5A 3X17A 2BERA 1YNTB 1X5HA 5MHSD 2OTPA 4LARL 1D9KC 3O6LL 1QFHA 1EHLH 4ODWA 5IQ7H 4MA7L 5D1XC 3KPLB 2PN5A 2VZUA 3VI4F 4KMTH 2AQ2A 3MPCA 3QDJA 1H0DA 4R8WH 3MOAH 3GI9H 1BD2D 1AXIB 1JZ5A 5INDA 1PJ9A 3VWJC 3HAEB 1J9CT 5E1HB 3QHZL 2V2TA 2UY6A 4YFLI 1A3LH 2AEWA 4G8IB 4M1CC 4Z7VE 4KAQH 3ZSTA 4JQVC 5I1KL 2A6IA 4Z76A 4WFEE 1CDUA 1MUJB 3MJ8A 4ENED 1B4JL 1JPTL 1A7BA 1EEYB 5JDSB 5BZWA 4CNIB 1KIPB 2P1YA 5BV7L 1L7IL 1QKZL 1G7JB 4UMGA 4M61A 5DSCA 3DVNA 5GGRY 5I71C 4WNQB 1NKOA 4OQTA 4PJFB 4OLEA 3VXTA 5LCVH 1U8IB 3HZMB 1P53A 1G7IB 5EA0L 5F7LB 4MCZB 1SMOA 2BVQB 3BH8A 3T0ED 4LARH 3SKMB 1WT5A 2GHWB 3DX9A 2F54E 1F97A 2C3VB 3MRGB 3IXAA 1KIRB 3RZWA 3SKNA 2XY2A 3RPIA 1OAQL 3GGWB 1G7MB 1N6QL 4FNLL 4PD4K 5D6CA 5C0GB 5DD6B 1KXQE 3IDIB 3I6KB 1KB5L 3E6HB 4CBPA 3B2UD 2HH0L 3N1MC 5DJ6A 3V6ZB 3ZE1E 3QHZH 2HN7A 3SE9L 1N64L 2F58L 5EUOA 3NCCB 3PJSB 1QBAA 5GRYA 1M05B 4HHAA 1F4AA 5I1KH 1BJ8A 5DR5L 5F3BA 1B4JH 3D2UA 1JPTH 3BUTA 1DLFH 4MHHG 1KPVB 2EXYD 1AO7E 1U3HB 3IFPA 3TO4B 3PE9A 3F7QA 4P4RA 5BV7H 2A83A 4W6WB 4NKDA 3MTRA 4W81A 1ZLUK 1L7IH 1QKZH 4BUGA 4KMLB 4RIRA 4M1GL 4GG6B 2PTVA 1S78C 4ZSOA 3B9AA 1FZJA 4DTGL 4RAVA 1UXSA 2AXGB 3WFHA 2PXYB 5I1HL 3UCRA 3SPVA 4UV4L 3X3FL 3REWB 5EA0H 1GGBL 4J3VA 4BM7A 4LVNB 4WW2F 5FDYA 5IVOA 3TBVA 1OAQH 4JANA 4S0SD 3WHE1 4FNLH 5E9DA 4JREB 3X3GL 2XQYG 5GGQL 3QWOA 4AL8L 4PJCB 3KLHD 1MH5B 4N0FB 3RDTD 4OGAC 2HH0H 3QUXC 1LO4L 4R3SA 4Y4KA 5LGHL 5CP7B 3QCVL 4Z7VA 3SE9H 1N64H 2F58H 4U1GB 5F9DC 3QNXA 1CLOL 4JO1L 4NBYB 3WNNA 4HUXB 1NGZB 5DR5H 3B5HA 3MLUH 3L3GB 3UTTE 6FABL 4KUCD 1MCEA 1PX3A 2OJEB 4Z7OF 5B4MC 5DRXB 1HH6B 2NY6C 1AQDB 5CBEB 5DQDH 1VFMA 3AU1B 1RJLB 4UV7L 1I3GL 4M1GH 4WWKD 4PJ7B 1Q0XL 1WLHA 3ARDC 4NC0B 2DIBA 3E3QE 3STZA 4DTGH 5I8OL 4JPWH 3HMXL 4UV4H 4LDLB 3X3FH 5DGRA 3RZCA 2F54A 1GGBH 3V6FB 3ZDZF 1UB6A 4BFGA 4QF1B 2YUXA 4EUPB 1KT2A 4MA3A 4XMLL 3I75A 1LO0L 3U7WL 4JAMB 2VXTL 3N1GC 4LRIC 1DUYB 4X7SL 4MAUL 3X3GH 2DKMA 3KPPB 3N1PC 4AEHL 5D2LF 5GGQH 1LVEA 4AL8H 5F9WC 2C9AA 2FHFA 4TUKL 4X9FA 2PYFB 4QXTB 4K8RC 2XV6B 1LO4H 1EXUA 1PG7H 1EA9C 4L29B 5LGHH 2WINB 2Q6WA 3MRFA 3OR7B 4OF3A 3BP6A 1LGVA 1CLOH 3SJVD 2Z0BA 3HRZB 3LB6D 1JGDA 2IEPA 6FABH 3OQ3B 2OP4H 3KDMB 1ETZB 1KPRB 3EHBC 4G8EB 2XKNA 2X4SA 4J2XA 4LCUA 4RFEB 4UV7H 1I3GH 2J8UF 1UJ3C 3LN5A 1OTUC 5JOFA 3A6CH 3SGEI 3QNYA 5F1SA 2OQJB 5CILL 3HMXH 3O3AB 5B39B 4Z7QE 1H3PL 2OM5A 2XPGB 4G9FD 3RI5F 4BYHA 5L8KB 4FZEL 4XMLH 1A1MA 4HH9A 1KIQB 4HJGB 4JCLA 3U7WH 3DUUB 2VXTH 1AH1A 4X7SH 3BWUC 4MAUH 3WFBL 4AEHH 1S7VA 2ZUQC 3D3VE 1MPAL 2LE9A 2CIIA 4PTUB 2Z4QA 3SE3C 4TUKH 5IHBA 1MWAA 1T03L 4G43A 5D7LE 3VXUB 1I7UA 5HVFB 1NC4D 3CVHL 4PV8A 3DX8B 5I16B 4PIRF 3UTTA 1MJUL 1A1NA 3C87A 3LKRB 1VHPA 2EEAA 4KTDL 3S6CA 3IGAB 2BY0A 5F6HI 1NC2A 3VG0L 8CGTA 5GS0L 5SWSE 2V6HA 1RJZB 5JW4N 1ZA6A 2AEIT 1S7WA 3NOIA 3HC4L 1MFDL 4RGNB 4Y88A 5DK0B 3GBML 1HDMA 2F5AH 2P5WE 4UNUA 3RPKA 1FG9C 1FYTA 1MCWW 5CILH 1W8NA 2YPLB 5BS0A 3QA3A 1H3PH 1FL5B 2ICWB 2IANE 5JNYA 3C6LA 3JTTA 1Q94A 4W70A 2AV1A 1AIFA 5D93C 4UIKL 4ELKA 4DK3A 1MVUB 1A1OA 1XMWA 3CFDA 3WFBH 1QNZL 1MPAH 2AABL 3GJFB 1MJ7H 2V7NB 2E7CA 3DMMD 4PRAB 5F7MC 3MREB 1T03H 4GG8B 2JCCF 1I85A 1MF2L 1A6PA 1O5DT 3CVHH 5IW1A 2UZIL 1K5NA 5I73B 2VLJD 1GVIA 2E7LC 1MJUH 5FA4A 4PREB 5IMOB 2XWTA 3D25B 4P2YA 5ANMB 1MCFA 4KTDH 4NPYA 3UDWA 3WIHL 4ZUSA 1NGPL 4GRLC 3QQNA 3VG0H 3WL9A 5GS0H 4H8WC 1W72L 4NDMB 1LO3L 2H32H 3O8XB 4FQHA 2J88L 3HC4H 4MA1B 4PJXA 1JF1B 3CJJA 2XN9A 1WAAE 3GBMH 5DQJA 2VC2L 4ZYKA 3MO1A 2VL5B 4OTXL 1SMAA 1J8HA 1PY9A 3IFLL 3H7LA 4H1LB 4L8DB 3C09C 2ZG2A 4IRSB 1I9EA 1NGYA 5J12B 3BUYA 3HUJA 4UAOB 1B9ZA 2CDFA 3RWFB 1MFEL 1B90A 4ZPTA 2GAZB 1IM9A 4PG2A 4UIKH 3D3VA 1BMGA 5CZVH 1B3JA 1RJYA 1QNZH 1S7TB 2NR6C 3NCJL 1OP3H 2AABH 4MQSB 5H94A 2YPVL 1JF6A 2XTJC 3W81A 4JY6B 4L4VE 3OKMA 4QGTA 3BPNB 1MF2H 3UJIL 4GKSA 1MIEL 4L4TA 3N85L 4F2MB 1INDL 2UZIH 3QO0A 1RU9L 4OBRA 5I76A 2BHYA 4QTHA 4GRWB 5CMAB 3WIHH 2KQMA 4HUKB 1NGPH 4WV1A 3RVTC 3QR2A 2J8HA 1RUML 4PS4L 3OKEA 5FYLL 4KKCD 4QHUA 4ETQA 5JLZB 5JXAL 2NY4D 4N5ED 1W72H 1KJVA 4ACPA 2IQAB 1YQVL 4BZ2L 3HR5B 5BRZB 4YHPA 2J88H 2AK4D 1MAJA 4AEIL 4HLZH 1MQKL 1QR1B 4FQXA 2VC2H 1HHKA 4OTXH 5EO0A 3IFLH 2GSGA 4ZO6A 2EIDA 5JIHA 2DQHL 5JW4Q 1XF2A 3LQZA 3UYRL 3QUYA 1MFEH 4BH8A 1CK0L 3ZKMC 5LGKA 1C08B 4G7VL 4GW5A 4DAGL 1T22B 4Q9QL 4HC1A 2EECA 1YY8B 4A6YB 4YPGB 2JF1A 1CIDA 3KPSE 3VGAB 2P4AB 4J3WA 3NCJH 1NDGA 4Q0XL 1NMAL 5KSBB 1UEMA 2ILLA 1DVFB 2YPVH 3V0VB 3UJIH 2VKWA 4H25B 1MIEH 5AZEL 2DQDL 3N85H 1INDH 1JGUL 5TDNA 5ACZA 2F74B 4JZNB 4OZIF 1U8KB 1RU9H 1SEBA 3OKLA 4KDVA 1G7HA 3CC5B 1HKFA 1ZSDB 4KC3B 3H0TB 4GS7C 3QO1A 1T2QH 1B6DA 1RUMH 4PS4H 5FYLH 5JXAH 3S5LA 2BNQB 5I9QB 1AXTL 1X6NA 3W0WA 1YQVH 4KKBD 4AEEA 2WBKA 4BZ2H 1K85A 3BKYL 4AEIH 1NCCH 2CLVA 1MQKH 1QFUH 1WFTA 4I0PC 1JNHB 5ERWB 4DZBA 3WJLC 3ZO0A 1FO0B 5HBBA 4KQ3L 2FYYB 2DQHH 3QJFB 2XZZA 1I9RL 1XIWD 5FV1L 3UYRH 4F3FB 2K7PA 4DOHB 1YEGL 4PY8I 1U8MB 4G7VH 3TC9A 4LVHB 4DAGH 4Q9QH 4GXUN 1M7IA 5DJZB 1MI5B 3CZFB 3FQNB 1AC0A 3BHBB 4O2EB 3KJ6L 4Q0XH 1FVDB 1NMAH 3WFEL 5AD0B 3BKCL 3CFBB 5GS0D 2YMXL 4NSKA 5GRVK 5CINL 4HF5H 1OTTD 1AR1D 2P8MB 4LVNC 3AY4C 3A6BL 5AZEH 2DQDH 3SE4A 1AGBA 1MHHB 1JGUH 1P4IL 5FHBL 5C0CA 2OTWA 1MAMH 4WUUD 5HDBE 2R1WA 1GC1L 1HHJB 4JREC 1BVKB 3LN4B 1RZ8A 4NRYA 1T2JA 4U0QB 2E27L 3GUTA 3MGTA 3MRDB 1R24A 4LNRA 2BVOB 2IPTL 1MCPL 3MCLL 3BKYH 1FZMB 1FFNA 2OL3B 2OSLB 2ZUUA 4O02L 4KRPB 5J3HC 1TLKA 2D4DA 2CH8A 2NY2D 5F96H 3QCTL 5HPMB 1IJ9A 1YPZF 2PF6A 4KQ3H 3TA3D 4H26B 2XG4A 3KPRA 3LPGA 3B8YA 4NO0B 1I9RH 4PGCA 4XP5L 1Q9WA 5GGSB 4PJ9D 4M5ZL 1EUTA 4L3ED 5HI5D 4JDZB 4ZFZA 2Q86A 4CMHB 1T66D 2VLRE 5L2KD 1VACA 1XGUA 4OJFL 4JJ5B 3KJ6H 5SV4A 3MZTA 5K9KB 1ZE3C 1X44A 3WFEH 3BKCH 2YMXH 2Y6SC 3BGMA 4J3XA 5CINH 4QRRE 4ZNEE 3O4OB 3WJJA 3A6BH 5IB4B 2I27N 4K8RL 1P4IH 2BZDA 3GJFK 5FHBH 3VXRB 2X7LA 5K33A 1UEYA 4P2CG 4RFNB 1GC1H 1KLGB 2EE3A 3GSQB 4YXKL 5IHZB 2OX5A 3B9DA 1D7FA 3WNLA 2E27H 1RY7B 2X4PA 1D9KD 2G75B 1G6RA 5C0IB 1G9EA 2EH8L 2IPTH 5D1XD 5DWUL 1MCPH 3MCLH 3WHE0 1LK3L 5HI4C 2CGRL 3TPKA 4O02H 2XFXA 2R0LL 2FNBA 3GMMB 3RAJL 4BH7A 4RAHA 4M00A 1OB1A 3G08B 1TVBB 4IRZL 3UBXB 3K2MC 2ADFL 3OGCA 4CJ1A 3VWJD 5A3ID 4XP5H 2VH5L 4I2XA 1U8JA 4M5ZH 4WW1A 2Z8VC 4M1CD 5ISZD 3QZWG 5EH1A 2EYSA 2D7NA 3AC0A 4OJFH 5HYIA 5L0QB 3MNZA 5FYLD 3VFUB 1W0VB 1VENA 1ZHBA 2EO9A 3GRWA 1I8LA 5JMRA 4HCRL 4MS8C 2DI8A 3I3BA 4NUGL 4OCMC 4OF8A 4P3CL 2FH6A 3LKPA 1YQ2A 4K8RH 5ICZA 1OGAD 3UC0L 3DI3B 4Z77A 4XC3L 5I66A 2NXYD 1K4DB 4H88L 3QIBB 5DURD 5CSGA 5F9JB 2BSRA 2WMPA 1G7PB 4JQXA 4LHJB 1BGXL 5CEZE 3QEQD 4EI6B 5ESVA 5DMGD 1FFPA 2EH8H 5DWUH 1LK3H 3FO0L 5AZ2L 2GY5A 2CGRH 4PV9A 4XWGL 3TH3T 1SM3L 4L8CB 4I48A 4HMEA 4PJXF 1KTLB 1XR8B 3AREB 3BPCA 3CU1A 4QGYA 3RAJH 3QDME 4U1JB 5EOTB 2NZIA 3CFCL 4IRZH 1SYSA 2V2XA 4UB0L 1AGCA 2ADFH 4U6XB 3WEXB 4Y4HB 3ROOB 2VH5H 4PRIA 1D6EA 3HUJF 5D1QC 4ZFOB 3WFCL 2VLRA 5HJ3A 5JQ6H 2X1XR 4GJTB 4RGNC 3A67L 4QRPA 3O3UN 1L0YA 1FLRL 3VFRA 2HLAA 3WLWC 4QRRA 3MFGB 4NFCA 2Z35A 1IVLA 3L9RB 2ERJB 4HCRH 4NUGH 3T2OA 4F8TA 5FGCE 1E6JH 5HGBA 3MA7B 2APWA 4WRLA 5DJ0A 3UC0H 5IV2B 1S78D 1QLEL 4N8VG 3R0MA 4XC3H 4H88H 3VXQB 5LGJB 1VEOA 5KANI 3P77A 3W9DB 3HC0A 3DGGA 1BGXH 4LPYA 3AS1A 3AM8C 2P46B 1AQKL 5FO9B 2GJ6D 4H8WL 1H3TA 3FO0H 3HE7D 5AZ2H 4FQ2L 3P2TA 4XWGH 5DHVB 1SM3H 1HSBB 3V7AE 3JXAA 5DFTA 1T04B 4GKOA 1QVOB 4KJWC 1J1OL 4UB0H 4N8CL 3QUXD 4XGZA 1XF5A 4Y4FA 1A5FL 3WFCH 2R69L 4WTZA 3FRUB 4ODHL 4BFEA 2Z92A 2HKHL 1YEDA 1IEBB 3U79A 5FO7A 5I8EB 4JFFE 3A67H 5HYFA 1M7XA 4U1HA 1FLRH 3RNKB 5DJXB 4IHOB 5D9SA 1P6FA 2OTUB 2GK0A 3BKJL 3TJEL 2NY6D 3PWJB 4APQB 2FR4A 3KJ4C 1U58B 4UAOC 3RVVC 4UDTB 3OJ2C 4MA8L 3FQUB 1YEKL 25C8L 1FL3B 2EYTB 1VKXA 3CFKA 5K9OB 3ARDD 5FF6B 3FFDA 4NM8L 3G04B 5ALBH 5ACLA 1UWXK 5I1AA 4RA3A 5F7WC 1FFQA 1CD9B 2NTFB 1SJHA 1F3DJ 1AQKH 2VOTA 4Y19D 4Z5RA 4A2MA 3BPNC 3O9WC 3RL1A 4H8WH 3EYVB 1KCUL 1R5IA 5HGAA 3QDMA 1IGIH 3P9LA 5IBUB 3BD5A 3REVA 3UTSE 2GJZB 4XP6L 1J1OH 1YEHL 4N8CH 3GB7A 4CDGC 4NQED 4K8RD 3SCMD 4FOMA 4FQPA 2QV2A 1A5FH 4C83A 1JCKA 1T83C 3MRQA 2Z93A 4ODHH 5EPMA 2HKHH 5C07A 3WYRA 5JOPD 2A6DB 2J5LB 5H37G 3F7YA 3HI6L 3QDJB 4M93B 1H0DB 3FOLA 3IJSB 1X5FA 3BKJH 5DRNB 3TJEH 5INDB 2QTEA 3G5ZA 1YNLL 4ONGL 1U8QB 4P4KB 4MA8H 2M1KA 3T8XA 5C8JB 1OTUD 25C8H 1T1YA 4U33A 1BAFH 4NT6A 4NM8H 2A6IB 4Z76B 4AENA 4Y7MA 3BX7C 5DMIL 5HHXL 5IM7A 3WFDH 4MCYA 5BZWB 1DVFC 1OP3K 2Q7NA 3FAXA 1S7XA 1QSFE 4FMKA 4R4NC 3T3MF 4Z18A 5GZOC 3PHOA 1KCUH 2DM3A 3RUGA 5F3HA 3VXTB 3FFCA 1N5YL 3EYFA 4XP6H 1B0RA 4HIXL 3MRPB 3BH8B 1N3NA 1RURL 3DX9B 4TPRL 3BEVB 3WNKA 1ADQA 1ZTXL 3TBSA 5I9QC 5A2JH 1XF4A 1VA9A 3IXAB 4IIQC 4ALAL 3RPIB 1S5IH 3WBDA 4JG0L 4C57C 5KVEL 1KN4L 4UU9B 5D6CB 3ZKND 3A0OA 3HI6H 4MNGE 4P9HL 1MCLA 4J8RA 1K8IA 3MRCA 5IT2L 1A64A 3H9SD 5JHLL 3K4DA 4P2RA 5DJ6B 3PDDA 1YNLH 4ONGH 4AY0A 2HN7B 3EOTL 4I0KA 2X4RA 5EUOB 4LVHC 4OD2A 4G6FB 4GLRH 5SX4H 1A6UL 4PJGA 5E9DD 3SO3B 5MI0B 5F3BB 3NIDF 3D2UB 4KGJA 5DMIH 3HN3A 1QSEE 1KC5H 3DBXA 2CRIA 1AR2A 3I2CH 4OLZL 4BSJA 4LLUA 4P4RB 1QFPA 2R2EA 2A83B 4NKDB 4RIRB 4RMTA 5IW3A 4WI2A 4HK0B 4ZSOB 1FZJB 3UTSA 2BNRD 4AQOA 4O2CA 2X4NA 1F6LL 1UXSB 3VXSA 1N5YH 4H0IA 3K80A 1TZIB 3L3KA 4LHUG 5T1KA 4HIXH 4XXDA 4NO2A 5D96B 4JKMA 3T0BA 3CGTA 5ID0B 4N9GA 4TPRH 1Y6MR 3G6JF 5C1MB 1ZTXH 4AIZB 3TBVB 1ROWA 3GSRB 4WENB 2DL2A 4JANB 1J05A 4HLJA 3VWKB 5KVEH 5F7YC 1KN4H 2DJ4A 2VXVL 3LQMA 1H8OA 4KRPC 4KDWA 4LP4A 2AXFA 4P9HH 3VCLA 3PWNA 5IT2H 3RNQA 3RZCD 4LLVA 4DZ8A 5JHLH 4WHTA 1C5CL 3V95A 4R3SB 4LLYA 1VFAA 1OHQA 4Z7VB 1IFHL 3EOTH 3L5XL 3BD4A 1LEKA 4NKMA 4HK3N 1KJ2A 2JK5A 3QNXB 4F57L 4R2GB 3GSVA 1A6UH 5JHDA 3QIUC 3DHMA 1X5XA 3VGDA 2E7BA 5JPMA 4OLZH 3MLPA 1QSFA 1RZFL 5HGDA 4NQSA 2DYPD 3IRZA 4U2ZA 1T5XA 5IVXE 2MTPA 2MKLC 3ZKQD 3N06B 4MGXA 4HC1L 5E00B 3RY6C 4OIIL 4NQDE 4U0RB 2F54B 2P8LB 1UB6B 2XTJD 4TUOA 3ZT6A 5AUMA 4FMFA 1CF8L 4MA3B 3I75B 3NCYS 4DUWA 3RI5K 3LKQA 2PR4L 2VXVH 3VG9B 2JE8A 4R9HA 4F9PC 1R3LA 1EFXA 1H9VA 3BP4A 1B4RA 2CDGA 4J4PA 1C5CH 4OFYA 1IFHH 3L5XH 2Q6WB 5MENE 5ADOL 3MRFB 1C5BL 3BP6B 1LO2L 1K8DA 4F57H 3V4UL 3K1DA 4U6HA 3JZ7A 3FQTA 1UADC 1VPOL 1JGDB 4QXGL 4WEBL 1ZLWH 3NZHL 4Q6IC 5L0QC 1YMMA 4XAWL 1RZFH 1IQDA 5E94A 3CX5J 1CICA 2XKNB 3BFOA 3NMEA 2X4SB 4TTGA 3NCEB 3ZKMD 5HVGB 4P2OA 2BSSB 1TCRA 3LN5B 2N4IA 1AGFA 2O61A 1MAKA 2B4CC 2FATH 3GO1L 3ARPA 4X6FA 4OIIH 4ZS6C 4YBLC 4HAGA 1CTOA 1HIMH 3MRLB 3VXNA 1XGTA 1CF8H 1A1MB 3THML 4EJ1C 5J4MA 4HH9B 3WS3A 6CGTA 1ZXQA 3VRLE 2PR4H 3CXHK 4QYOA 3PV6A 2RAMA 3AREC 1FYTD 2CIIB 4IBLT 1RMFL 3I3DA 2Y5EA 1MWAB 4OUUA 4TULL 1MLCA 3G5VA 2WV3A 4Y4HC 1I7UB 2DDQL 5ADOH 1NSNL 1C5BH 3FO1A 1LO2H 4PV8B 4N0CC 5E8OA 3UTTB 5I1LA 1A1NB 3FQXB 4I0PD 1VPOH 2IWGA 4EQ2A 4QXGH 4WEBH 1JWMB 2WBJA 3NZHH 4XAWH 5I6XB 1NC2B 1MIML 3QEHA 5EU6D 2ERJC 5IVXA 2GT9A 2WQRA 4HUVB 5FM5M 1T5WA 1ZA6B 1S7WB 2XQYK 1FAIH 5CEXA 3AROA 3GO1H 1TZHA 1HDMB 2ZG1A 4KKLC 3QXWA 5L88L 2AJZA 1UACL 1NGXA 4IRJC 4JFED 3TP4A 3L6FA 1AC6A 2DMBA 5JNYB 5JR1L 4OZ4A 3C6LB 3HS0A 5E6IA 4G9DA 3JTTB 4JRXE 4QHNB 4WY7L 4N0YL 2COQA 3MV9E 3X11B 1AIFB 1CQKA 5IBUG 4C56D 4OV6F 4L1HA 4X7CC 1A1OB 2XN9D 4CKVX 3CFDB 5DO2C 4RDQG 4PY7A 1J0IA 3B9KC 2HT3D 2XQBH 3NFPA 3QPXL 5MENA 3L1OL 4TULH 4OBSA 4K07A 4TNWF 1ZHNA 3PWPE 1NSNH 3DO7B 1B0GB 3DJ9A 3VXMD 4ZD3L 5IW1B 4O4YL 2D4FA 2YD5A 3BEWA 5J3HD 2Y7QB 2XWTB 4F80A 4JFXA 3OV6A 2AJUL 1MRFL 4NC1E 3UAJD 4NPYB 4I18C 1MCRA 1MIMH 1KPUA 2VXUL 3ZHLA 5C6WH 5JPNB 4MD5A 3OKNA 2AP2A 4NWUL 1NFDA 2HFFA 3MRJA 4FQHB 4KPHL 2B1HL 4XXCA 4PJXB 2P8PA 1I8IA 1FVCA 2XA8L 3GKWL 5DQJB 3I50L 3MO1B 1FRGL 3RUGF 5L88H 2Z9TA 4Z7UA 1MCHA 2Y6SD 5ALCL 4RQQA 1CE6A 1CWVA 3ALXA 1U8PA 3BUYB 5JR1H 1I3RA 3ZSSA 3O6KH 2CDFB 4U7MA 2WBWB 4MB3A 4WY7H 4N0YH 3UTQA 4ZPTB 1U8LA 1IM9B 2PETA 1RIVL 4FS0A 3D3VB 3MBEC 1RJYB 4HKXA 1S7QA 2QHRL 4LGRB 5TE6L 2HFEA 3L1OH 3OKMB 4GKSB 3BZFA 3QUYD 3L3OA 4EIGB 3T4YA 5HI4D 3QO0B 2FH8A 2NW2A 4O4YH 3TNNA 3WLBB 4ZNCD 5I76B 1QFWL 1F6FB 5BJTA 4FABL 2J5LC 4PJGF 2YD2A 2AJUH 3BPOB 2ESVE 4DN4L 3MV8D 4QTHB 2J7LA 1R5VB 4KJPD 3MCKA 4WV1B 5FYKE 4G8GD 3OKEB 2VXUH 2NMSA 4LCIL 1KJVB 4NWUH 1MCDA 3U6RA 4P4KC 3LH2H 3MUJA 2B1HH 4YHPB 2P5WB 4K71B 4OFDA 1DN2A 3F6IA 5H8DA 4FQXB 4GKZA 2XA8H 3GKWH 1HHKB 3I50H 1FRGH 3C60A 5EO0B 4G6KL 3VDCA 4DGIL 1NPUA 2GSGB 4X5XA 3U1SL 5D6DA 5ALCH 4XZUA 4CVZB 4Y1AD 4JRXA 1EZVX 3MV9A 4MS8D 2BNUB 3FO9A 1XF2B 3LQZB 3MRIA 1GHFL 1FE8L 3KXFE 5CHNA 4GW5B 1JPST 3DX7A 4EN3A 3FB6A 1RIVH 4X8JA 4YFLF 4QEGA 1W2KT 3TZVA 3U9UB 3IJHB 3G6AA 4WEUD 3S8WA 1NDGB 5ICXA 2QHRH 4DW2L 4NN7B 3ULSA 5TE6H 1NMCC 5IGXL 1E4KA 1SYVB 3PWPA 1HXMB 4MJ6A 1WT5C 1RZKC 3ULVC 2D7MA 4GW1B 5ACZB 4MB5A 2EDLA 1SEBB 2C3HA 3ARBA 3TO2A 1YEEL 3OKLB 2HVKA 1QFWH 1G7HB 5EIIA 4FABH 3SDXE 2XRAL 3K2UL 2I9TA 1UWGL 4DN4H 5EBGA 5GZND 3QO1B 1XF3A 1JPSH 5TH2A 1JHTA 4QOKE 4LCIH 3PGCB 5D1QD 4Q9RL 3B43A 2CLVB 4JO3L 1CBVL 4DZBB 2OXGA 4ZODA 5MI0C 3WLWD 5JTWA 4DGIH 1W8OA 1VESA 4I5BA 3U1SH 5GGRA 2E7MA 4XNYL 1XCTA 1KXVC 4UZGA 4AYFA 4XBPA 1NAMA 1HHHA 1GHFH 3IDGA 1FE8H 2H9GA 3DTXA 1QLRA 5EC1A 2V5SA 1M7IB 4UQ3A 1OTSC 4D0CB 4WI7A 1ONQB 3BZ4A 1HXYB 3ARWA 3RP1A 1J12A 1PKOA 2ZSWA 4L4VB 4NSKB 5IGXH 1ZK9A 5JQHC 4XVSL 5H37H 3FT3A 4OLVL 4OD1L 3GSXA 4ZOCA 1AGBB 1T89A 4PJAF 5EBWB 5C0CB 1TJGL 2OTWB 2D03L 1YEEH 2DWEA 3VWKC 2R1WB 1UWGH 1RZ8B 2JB5L 1CG9A 4XNUL 4NRYB 4KJWD 1MCOL 2PO6B 4E41E 5IF0A 4RDQF 3IAPA 1KBGH 3MGTB 3C8HA 3GUTB 1HCVA 4P5TC 4LNRB 4Q9RH 1AP2A 4TVPE 5HD8C 2HFGL 4JO3H 2LVCA 1BQLL 1FFNB 2FECL 3LV3A 2M8XA 1YY9C 4XPFL 4U7SA 3PABB 4ONOA 2D31A 1UKQA 1UYWL 1YEFL 5B38G 5A2FA 3KXFA 3OB8A 3RVVD 3JV0A 1Q9WB 3TNMA 1KJ3L 3ZZ1A 1SJVA 3KPSB 1I7RB 3SY0A 2Q86B 3L5WA 1Q0YH 3NN8A 1VACB 1HYSC 4P5MA 2OL3H 3U0WL 2B39A 2X1PA 5B3NA 2AJYL 3ZMRA 1CN4A 4JHBA 4X0KB 4M7LL 3HKFA 4QHKI 1IMHC 4OLVH 4OD1H 3O9WD 3R8QA 4PJBA 3QFJA 1TJGH 2D03H 2OR7A 4X98B 2O5ZL 3IJYA 4ZS7L 3VG9C 3WDIA 2JB5H 4XNUH 3RWCA 4YC2C 1MCOH 1BBJA 1XGYL 3T0DA 5IIEA 4YGAB 1FNEA 3F5WB 5DFVC 2X4PB 5E1AA 5LVEA 3MV7D 1G6RB 3ULVF 2HFGH 5BRZD 1ADQL 2W38A 4XAKD 4M7LT 4UOW0 2HP4A 2OZ4L 3T1WA 3MNVA 2EDBA 4XPFH 5INCA 4BH7B 4FQIL 4P2QE 2AK1L 1UYWH 1M1SA 1YEFH 3OGCB 4JKLA 5HDQL 1OAUL 4PJ8A 1KJ3H 4AH2A 3O4LE 3O41A 2EYSB 3DVFA 1WGOA 1NEZA 3BP5A 1P4LB 3MNZB 4WTXA 3U0WH 3H2WA 1JNLL 2AJYH 3D39E 1DVFD 2BRQA 3Q5OA 4M7LH 3G5YB 2X4QB 5HYQA 1XGPA 2VL4A 4CDHA 1E6OL 3LKPB 4PRID 4EOWL 5GZOD 3WS6A 5I66B 5EOCJ 5GS1B 2AV7B 4IOFC 4QRPD 4BFIA 3IDYC 4ZS7H 2BSRB 4LLQA 2X5PA 2W65B 4MNQE 2GK2A 3VH8B 4LLMB 1XGYH 3FZUC 3MLZL 5ESVB 1AFVL 1FFPB 4QRUA 1JZ6A 4OCSL 3TVMA 4PLOB 3QEGL 2P5EE 1ZLSL 1NFDF 4ZO9A 4PV9B 5L9DL 1M7DB 4I48B 2OZ4H 1V05A 1NCWL 3MSPA 2KPNA 2B4CH 1PFCA 4FQIH 2AK1H 4Z7UF 4ELMF 3VFNA 2DM2A 1SYSB 2V2XB 5I6XC 1T1WA 4HBQA 4Q74A 5EU4A 5HDQH 1ZLWK 5CJOL 5E6YA 1OAUH 1D6EB 3L5IA 2VQTA 3HZKA 4HUWA 2VLRB 5HJ3B 4HX1B 3OKKB 3C5SA 3MLSL 1BQHA 2IFFL 4LIQE 4YBHA 3VFRB 1KJ2L 1X5ZA 3K4AA 2HLAB 4QRRB 3QUZA 3ARGA 5FGBC 3ZYIA 1JNLH 2KBGA 3BE1L 3K74B 4D9QD 2EKSA 3W39A 5AG9A 5CFHA 1E6OH 3RRQA 4EOWH 3DUSA 4ZTOL 3OJDA 5DJ0B 2G9HB 3T3PF 5C0AD 3B3IA 3P77B 4Y16A 3FN9A 3HC0B 5F88A 3DGGB 3PUCA 5IFJA 5L2JA 4PYHA 3MLZH 1II4E 1AFVH 4OCSH 1ULVA 3MJ9L 1XAUA 1S9YA 4GBXC 3GNML 5L9DH 3PQYE 3MOQA 1NCWH 4P2QA 1JMXA 1HI6B 1INEL 1JZ7A 3P4OA 4XGZB 1QACA 5CJOH 2NX5D 4Y4FB 3AXLA 3CLFL 2CKBL 1YEDB 2IFFH 3Q5TA 3BIBX 3QIUD 4U1HB 2ORBH 3QSKB 5JOEA 5DMJB 3D39A 5L7XL 2AKRA 1KN2H 5D9SB 5F9OL 1S7SB 43CAB 3BE1H 2GK0B 2A6KA 5C0JB 2EO1A 1KGCD 5E99L 5K59E 3RWEA 5HGHB 1S7UA 1PG7W 3BMVA 4FFVD 2LU4A 1VKXB 2UVFA 4EXPX 1E27A 1A7RL 4MNQA 5I8KL 1K9TA 2J12B 4NNYA 4R26H 4OZFA 5I2IA 1A02N 1X5LA 5GGUA 4RAUA 2P5EA 4LHUD 3W5NA 1RAMA 1BQHG 3MJ9H 4LCWE 3RL1B 1LP9A 2H2PC 3GNMH 5KW9L 1WZMA 2ITCB 5HGAB 3QDMB 5F72S 4NN6C 3P9LB 3L5HA 5MEQA 3REVB 1FBIL 3BPOC 1INEH 3BO8B 5IWLA 1KELL 2X9YA 3P40A 5IB1A 3QXUA 2FX9L 3GB7B 3U4EA 5LXGL 3VFPA 1IAOA 5CIPB 3CLFH 4C83B 5C07B 2CKBH 2Z93B 3MRQB 2C1OA 3RJQB 1KV3A 4DVRL 5A16A 4FQXC 2BX5A 4MJ5B 1UG9A 4P23A 1LDPL 2C4FU 3FOLB 3MJ6A 1RK1A 1NCUA 2CJUL 4XBGA 5F9OH 4H0GA 3T77A 5FGCB 3K8MA 1CQYA 1N0LA 3G5ZB 5E99H 1NH6A 1YYLH 1VERA 1OP9A 4JFZL 2W91A 4D9RD 1RSFA 2R4SL 3ULVL 1T1YB 2VLLA 4WWID 4X4ME 4NT6B 1UFUA 1A7RH 3MXVL 5I8KH 1UH4A 4P57B 4HXAL 4L9LA 4HEME 5IM7B 3FB7A 3T04D 2ZSVA 4X5WB 4JRYA 4LSPH 1S7XB 3QXAA 1V3LA 2QKIA 4JM2C 3BQUA 3PHOB 1HYRC 5EBLA 1ZA3B 3RUGB 4PJ5D 3CCHA 1UM6L 4Y0GA 1FBIH 3EYFB 4OT1L 1MCSA 3PXHA 1KELH 2LU7A 1B0RB 3DURA 1N3NB 2OYPA 5LXGH 2YWZA 1CXLA 4PTTB 1HOCA 1XF4B 4JFFB 2R9HC 4N0CD 4LCYA 1IAIM 4DVRH 4MXQD 5CLTA 2CO7B 1LDPH 2CJUH 5FIEA 3MRCB 1NGWA 3S3PA 1DANU 3RWDA 5ETUA 4NBXB 4GH7B 1D5ZA 1RHHA 3JUZA 3EBAA 2IMNA 3QDGD 3OJVC 3PNWA 2WWMC 4JFZH 4KROB 4R0LA 3TYFA 3HE6A 3NIFF 2R4SH 4OD2B 4PJBF 3ULVH 1OSPL 3MXVH 4PJGB 5J1AB 5ABDE 4MAYA 4HXAH 5J06A 5D7JB 4IRJD 3DBXB 4MHHI 4DGVL 4U7KA 4MJID 4PJEE 3GSNA 4LCWA 4LPVA 4LLUB 1FGVL 2R2EB 3OAUL 5F7KC 1Q9OA 1HHGB 1U93B 2XG5A 4PGDA 3UTSB 5DO2D 4KTYA 2VN7A 4O2CB 5DVMA 2X4NB 3B9KD 4M7ZB 3O6FA 4M6OL 5T1KB 4NO2B 1TMCB 2PO6C 5GSRB 3D48R 4N9GB 5MHSE 5HSFA 5HYEA 4Z0XA 1OD9A 3DROB 3EYUL 1AD9B 4YGVA 1U0QA 3PGDA 3HI1A 4D2NA 4PYGA 1EO7A 2L4OA 3GMPB 4POZC 3UJTL 3PL6A 3GSWA 1EO8L 3PWNB 4D3CL 5IFAL 5F89A 3RNQB 3SGEH 4QXWA 3QIWA 4JFHD 4LLVB 2KZWA 2M2DA 4LCCC 2A6JA 1BD2E 1Q9KA 4LSSL 4GO6B 4Z7WE 1X4ZA 1LEKB 4NKMB 4XP4L 3MLYL 2JK5B 1DQLL 3GSVB 1OSPH 5JHDB 5FCUL 1MHCA 1QHOA 4LVEA 5FM5O 1MFAL 4DGVH 5JPMB 1QSFB 4D8PA 1DDHA 4NQSB 2KZ1B 4MDJB 3OAUH 3JTSB 4HT1L 1T5XB 2CK2A 2D7TH 1G9NC 2JIXD 4HV8A 1L0QA 4WI8A 1DN0A 4J7RA 3F8UB 3MBED 4QY8A 4F7TB 1I8KA 2VZ3A 2FSEA 1RULL 2N1KA 1M6OA 3R8BB 4M6OH 3EFFA 4TUOB 5CJQL 3QFDA 5AUMB 5IKCA 1HQRA 4KTEH 3T0EE 4KVNL 4NGHL 5DXWA 3EYUH 4XCCL 4JM2F 5C08A 3SN6N 1X7QA 4MNGB 2VDNL 5DVOA 1YN6B 3KPOB 5F71A 4HS3A 2UVEA 1EFXB 1SY6L 3UJTH 1EO8H 4D3CH 5IFAH 5A2LH 4XNZC 1MCCA 4ZXBC 2E9WA 2GTZA 3BP4B 5ESAA 5BW7C 2CDGB 3HFML 4BK4A 4LSSH 1T7VA 1XH3B 3Q0HA 4P4KD 4PD4J 4XP4H 5IHLB 3MLYH 4LOUD 4CAGA 1DQLH 1K6QL 4WO4A 4U6HB 2C5DC 3FQTB 1QSEB 5FCUH 2H26A 2CLRA 1T7YA 1MFAH 3OR6A 1U2HA 5DJCA 2DD8L 1PZ5A 4XMPL 4HT1H 3QI9B 4P2OB 4V1DD 2FD6L 1AGFB 2O61B 1ZV5A 2BRRL 5GS1C 4IM8A 3QUMA 4FP8L 4UUJA 1G7LA 2KL6A 5DZNA 1F4HA 4RMRA 1PBYA 5CJQH 1PDKA 2LVEA 4UBDC 1N6VA 3VXNB 1XGTB 3ULVD 3C8DA 4XPAL 4KVNH 1F2XK 1WCBA 4XCCH 3WS3B 2Y1VA 4PJDA 2VDNH 2E7HA 3VI3E 3SKUD 1DBBL 5FB8A 3PV6B 3LQAL 3I84A 1YZZA 1SY6H 5CUSL 4JKPL 2G60L 1FG2A 4HFWA 5E7BA 2YD3A 4OUUB 4R4FL 4Z7WA 3SGJC 3L3HA 3G5VB 3HFMH 3U2SA 3M1BA 2EIZA 2P42B 3ARTA 3PDOA 1K6QH 2VUOA 1J88A 4PLKC 5I1LB 4TNWK 2HT4C 4KGLA 2WBJB 1NFIA 3IU4L 4K3DL 3VFGL 1FSKB 2ZPKL 1G1CA 1IGJA 3QEHB 5IVXB 2GT9B 3QWQB 4HWBA 2DD8H 2D7QA 4MXWL 2JB6A 3LKSA 1LP9F 4TN9A 1WFOA 4YR6A 2BRRH 2BSED 1TZHB 4GAFB 4LEXL 4NQDB 1WBZB 4TNVF 2AJZB 1NLBL 3G5XA 4FP8H 2X4UA 2D0HA 1NGXB 4KK9C 4DEPB 5D71L 3L6FB 3T0EA 5D1ZC 1UA6L 4OZ4B 4L9DA 4NIKB 3HS0B 5E6IB 4G9DB 3X12B 4D0DB 4XPAH 1XT5A 2J2ZA 3QQ4A 1P7HL 3EO1A 3VWKD 4RGMC 2NCMA 2C26A 4PY7B 4KHTH 5CUSH 4JKPH 2G60H 1WQVT 3DWTA 3NFPB 4E5XA 2G5BA 5MENB 1I1FA 2HLFC 2ED8A 4P5TD 1ZHNB 3DXAD 5HD8D 2J1KA 1C7TA 3EUUA 1QLFA 2HRLA 5DA4A 3BEWB 2NTSP 3SDDD 4JVUA 4GXVL 2FB4L 4LGPB 2YPKA 3IU4H 4K3DH 2IAMA 4P46C 3BT2L 3VFGH 3HHRB 2ZPKH 1R3HA 3EDFA 4X4YA 2A38A 4DCQA 4MD5B 3OKNB 3LRHA 2HFFB 1L9MA 3M17A 3MRJB 3BZEA 2P8PB 5T3ZE 1J0KA 5FFLA 1I8IB 2JJWA 1FVCB 2BMKA 4LEXH 3GMOB 4KZDL 1HYSD 5E8EA 1NLBH 4X7DC 3SHSA 4P48A 4RQQB 5D71H 4S0TD 1U8PB 1UA6H 1I3RB 3V7AG 4IOSD 5KSVA 2HT2C 4PLNC 1U8LB 4H0HB 3NFNA 5CGYD 2QEJA 2VDMH 3OHXA 2R15A 2IPUG 5CS7A 3C60D 2DJSA 1KB9J 5D7IA 3DV4A 1S7QB 4HKXB 3G9AB 4R6UA 1UZ8A 3RX8A 4HPOL 2YPLE 1N7ML 3OXSB 1G9MC 3ILQD 4GLRI 1A6WL 5HYSA 4HIEA 3BZFB 3IF1A 3L3OB 3VFSA 2Q8BL 4Y5VC 3T4YB 1AGDA 3UPCA 4XX1E 1EVUA 4OZGA 1R3KA 2APTA 5BJTB 1AO7D 1CXEA 4GXVH 4XCNA 2FB4H 1I75A 3BT2H 2W0PA 1BFVL 4X9HA 3EOAA 2V9TA 1HSAA 3GBNL 4WWKA 3U6RB 1L6ZA 4LVOC 4OCXL 2YUWA 2XNAA 4ESKA 2Z8SA 1UQSB 2XY1A 4X6CE 5CGTA 4KZDH 4LMQE 2X05A 5CJBA 4X5XB 4XZUB 5D5MA 4JRXB 5IB5B 3FN3A 2YWYA 3OJMB 3ZKXC 3MV9B 4NO5B 3FO9B 2WUBL 3BGFB 8FABA 2P49B 4XH2B 5CHNB 3DX7B 3FB6B 1H3WM 4X8JB 5IMMA 2DTSA 4HZLA 2FEDC 4IOFD 2DI7A 1I7TA 3Q3GA 3TZVB 4RX4D 3G6AB 4JFOA 5ICXB 1WTGT 1L0XA 4G5ZL 2Y4SA 3ULSB 2XOTA 1DBAL 4RGOL 2OR9L 4HPOH 3RX7A 1N7MH 3PWPB 2NW3B 4MJ6B 1A6WH 4R4BA 4X99B 1S5HA 1CT8A 5HHNB 1TTFA 1H5BB 4L8BA 3ARBB 3SJVA 3SDCC 3TO2B 2HVKB 1I8MA 5DHYA 1QBML 2BY2A 1PY4A 2X89D 2I9TB 1P7KA 1XF3B 1XEDA 4KJQC 5HHPA 4U1SA 5TH2B 3MROA 1JHTB 3ZDXF 1BFVH 4Z9KB 5DUML 1JZ8A 3RTQD 4G6ML 2GTWA 2AI0L 5KAQF 5I17B 1DEEB 4OCXH 4X7EC 1CE1L 4AJ0A 3PWVA 1SEQL 2P45B 4I5BB 2Y07L 2J4WL 5D7JC 4FXKA 4G9FA 1DBKL 4ZO8A 1XCTB 3WNPA 4F9LA 3MLRL 4XBPB 1HEZA 2WUBH 2EDWA 1NAMB 1SVZA 2OI9C 1HHHB 3DIFA 4HJJL 4MSWA 3ETBF 2H9GB 4YLQT 3DTXB 3QHFH 1ORSB 4UQ3B 4MWFA 1JF5A 5CZXC 4DUXA 3MRKA 5J9PA 4M7ZC 3UTPD 4G5ZH 2ZSWB 3HPLA 1RUPL 5IMKA 2OR9H 3OSKA 4X9GA 4WU5A 3FT3B 4HWZA 1NC4A 3GSXB 4FFWC 1P1ZA 1BVLA 4GBXD 4OLWL 5E2VH 5EN2A 2DQFB 2ESVB 2DWEB 1OGTA 3E2HB 3KLDA 3IYLW 3OXRA 1FIGL 5IF0B 3CLEL 5I19L 5KSBE 2HVJA 1PZUB 2Y06L 2HG5A 5DUMH 5C3TA 4PGEA 3TCXA 4G6MH 1AP2B 4AQ1B 3ET9F 2AI0H 3LDBC 2IPKA 4AEFA 3SQOL 3QFJD 1L9NA 3F12A 3HNVH 5DMYA 4UT6L 2AK4E 1CE1H 3CIQA 3SE8H 1SEQH 1FC1A 5GGSY 5FXCH 1MCBA 4U49A 2Y07H 2D31B 1DBKH 1U8OA 2DAVA 4U1LA 3KXFB 2VQUA 1T6WA 3MLRH 4X5LA 4G6JH 4ODXA 3IETA 3TNMB 4HJJH 3ZDYF 1T2XA 1NBVL 2BNQE 1T7XA 1GCFA 2QLVB 5DJ2A 1WIUA 2QQLL 3IAGC 3C5ZD 4PJDF 3SY0B 1QYGL 1UZ6E 3L5WB 3NN8B 4K3EL 5A2KH 1I1CA 1CFSA 2BSTA 4P5MB 4YHZL 3K0WA 1RUPH 2UZYB 3DMMA 5D7LD 4S1DC 3MMEA 2NXZD 4FRWA 5FO8A 2CUMA 3WUWB 3BYYA 4JZJA 5C0BD 5I1DA 4CVUA 3L7FB 4OLWH 2VLJA 1K3IA 4KV5F 3SDXB 4DOHE 2DQJH 3W5MA 3IJYB 2W9DH 3VI4E 3SGKA 1TITA 3RWCB 1FIGH 5I74C 3MODL 5SWSD 1BBJB 5J57B 2YSSA 3CLEH 5I19H 2DM7A 1FNEB 5E1AB 3Q6FB 2Y06H 3STBA 1X4XA 3VFOB 2H8PA 3PP3K 4M8VA 1HWHB 4UDUA 2FBJH 2P24A 2ICES 2PCPA 2XIDA 2P5WD 2R2HA 3SQOH 1T4KA 1H3GA 3BISA 4UT6H 1KEML 1HNFA 4BELD 5INCB 1AHWA 4NHUB 3S4SG 2IAND 4TRPL 1F3DH 2Y9RT 3MUGA 2W9EL 4XNMA 4PJ8B 4AH2B 2DBLL 4Z8FL 3F6LA 1NBVH 1A0QH 3QI9C 2QQLH 3O41B 1QYGH 4K3EH 1IT9L 2ADGA 5D8JL 4YHZH 3O11A 1P6AB 2RHEA 5JXEC 5HYQB 1C16A 4N1HB 1XGPB 3KYKH 1KYOK 1YEJL 3K8KA 3BKML 4JM2D 3GSNL 3KHQA 3WXWL 5JIPA 3T0WA 3HMXA 3MLVL 5SWZE 4KY1L 4WEMB 2EDOA 4WUUE 4BFIB 4E41B 2XKSA 4R97B 4LLQB 4F37F 3MODH 1MCWM 3IS0X 1NCDL 4OFKA 5TGBA 4E9LA 4QRUB 2R9HD 3KNBA 4BKLA 2AK4A 5FGSA 2N7BA 1KEMH 4KI5F 3RWIB 2HA1A 2WBJC 5CWSA 3VFNB 1FSKC 3U9PL 4PJHA 2W9EH 3R06A 3TIEA 2DBLH 2WWMD 4Z8FH 3HZKB 4HUWB 4OF6A 4LPXA 4Y5XC 4QT5B 4YBQC 5T3XL 1T21A 4L3EE 4ISVB 1EGJL 1IT9H 3EOBB 3ECBA 4GQ9L 5D8JH 3QUZB 2ZJSL 3ARGB 3IKCA 5L2KE 5D7IF 3Q48A 1DANT 2EKSB 3L5JA 4KK8C 3W39B 3LEYL 1P2CA 4PP2B 2V5TA 4WU7A 1YEJH 3DUSB 5TFSL 4HIHA 5EBMA 2WUCH 3VD5A 2ICWJ 5FYKU 2K3TA 4KK5C 1X5KA 2VXSL 3NAAL 2PYEE 4O2FB 3MLVH 4MJ4A 4UQ2A 4ZMAT 4KY1H 4OZGF 4MZ2A 2MNUA 3B3IB 3QUKA 4Y16B 3RGVC 2FL5A 5F88B 5IFJB 4I13B 2PO6D 3GMRA 5L2JB 1NCDH 3WDHA 4XCFL 3P0VH 1JNNL 2XICA 3D6GA 4JKWA 4YDVA 2QQKL 4X6BA 2W1NA 1S9YB 1A7QL 1G7QA 4P2QB 5BMFL 4POZD 2HJFA 1I9JL 5KOMC 3P4OB 4HD9A 3U9PH 4Z7OE 3CVHA 3STLA 1XIWA 5D5MF 5GRWA 3O4LB 3FOMB 3AXLB 3WO4B 3ZYZA 4U1KA 5T3XH 5DD1H 5ISZE 4NKOB 1EGJH 4GQ9H 3I3EA 1A47A 3D39B 2AKRB 2ZJSH 3QCUL 5K93A 2QSQA 3D0LA 5FYLE 1WZLA 2A6KB 4MNHA 3ZDZE 2H32A 3LEYH 4J3SA 5FV2A 1QFWI 3LCYA 4L1DA 5TFSH 1S7UB 4WUUA 3ARSA 3IU3A 3ZYOA 1FQ9C 2VXSH 3NAAH 1OGAE 1P7QD 1E27B 4X6DF 4MNQB 5KVDH 1FJ1B 4CU8A 4NNYB 5D2LE 3G9VA 2PTTA 5I2IB 4GQPH 1BZ7A 1V3KA 4PP1C 5GGUB 4RAUB 4EVNA 4XCFH 4WGVB 2P5EB 5KSAA 2NY0D 3QEQE 2Z31B 1ERNA 1JNNH 3WUZA 2MQCA 1BBDL 1LP9B 2MHAA 3FQWA 2QQKH 3QWRD 3UO1L 4L3CA 4FQQA 1A7QH 2GYSA 2O5YL 5BMFH 3V0WH 5MEQB 5C09D 1CGVA 2Y5TB 3TA3A 5DJDA 4E42A 4ZXBD 3O0RL 1JWSB 2WP3O 3V52L 3S97C 3U4EB 4PJ9A 2Z91A 3VFPB 1A6ZA 4L3EA 5I75C 1MCIA 2J8UE 5F7DA 2C1OB 1LEGA 5A16B 3WIHA 3S96A 5L2KA 5E6ZA 3OAYK 2DKUA 2FZ3B 2QADB 2NZ9D 4P23B 3ZTNL 3QCUH 1RK1B 5EWIL 1K2DA 1W72A 4XBGB 5AAMA 3EW3B 3T77B 3GSOA 4WW2A 4LASL 4JQIL 1VSCA 2GY7B 5J6GA 4PRDB 1G9MH 3BGFC 1RIHL 1K3ZA 3M8OH 7FABL 4ZG1A 4NQVA 4ZUTA 1IC4L 3TZVC 2DICA 4L9LB 3W9EA 1T0PB 5CKAA 3C9NA 1JPGA 1D9KA 1X5GA 4UBDD 1ITBB 4F7PA 5DC4B 3DYOA 1AKJD 3QXAB 5D1XA 1BBDH 4WI9A 3PQYB 3BQUB 3HZYA 3GHEL 3HE6D 4J3OC 1H5BC 5IUSA 5MEOA 4OLYL 2GJ6E 1I1AB 4K94C 5EBLB 3ARBC 4X4XB 2O5YH 3CCHB 5M7QA 4MAYD 1F3JA 3CX2A 5B8CC 3O0RH 4OCRL 3DURB 3V5DA 3V52H 3VWJA 4HGWA 1BJMA 1HOCB 2A0LC 4WFGE 3QH3A 4TSCH 5ISZA 5GSVA 3CK0L 4LCYB 4JQVA 2R1XA 4NZUL 3SBWC 3EKCA 4GMTL 1Q38A 5EWIH 1NGWB 2EE9A 3RWDB 2DIJA 4LASH 5ETUB 3E8UL 1JTOA 1RHHB 4M03A 1RIHH 3SDAC 1OGAA 3AGVA 4R0LB 3RKDD 3TYFB 5EOQL 5EO9B 1JUFA 7FABH 4KXZH 1CLYH 5DQ9A 3D85D 2C4XA 1IC4H 4XCEA 2NY3B 4QRSA 1D5MA 4GUPA 4QHLA 4KK9D 3PL6D 1JBJA 4GSDL 4NQCD 3V6OE 3WUWG 3QEQA 5I1JH 5D1ZD 3GMNA 4LCWB 2BC4A 2MKWA 2JCCE 3INUL 5T3XD 4Y19E 5TQ0L 1QBLL 3GHEH 1TZGL 3VU2A 4OLYH 5B21A 4PGDB 4HIJA 3Q1SL 1IAKA 3O6FB 2XT1B 4K9EL 4PG9A 1WC7A 1EAJA 4OCRH 4S1QL 5TJWK 1A6VL 4LLWB 4QHMA 3LEVL 4Z0XB 3X13B 4NQEE 1C12B 1WIPA 2YR3A 4XRCA 4YGVB 1VGKA 4Z7NF 1PVHA 4Z6AT 2XA3A 3CK0H 3HI1B 1SQ2N 3ZE2F 5JOPE 5ADPL 1EERB 4NZUH 4GMTH 4OIAA 4KH2A 3UBXI 3GSWB 4P46D 4JVPA 5F89B 4KKAD 3QIWB 4WDIB 3E8UH 4PRNA 2A6JB 3H8NA 1Q9KB 3TFKC 1HN1A 5EOQH 3S35L 2CDEA 3BI9X 3ORJA 3FTGA 1MHCB 3CSYB 4R8WL 2MOVA 4GSDH 3KYMA 4D8PB 5IROC 1DDHB 1FLTX 4EI5C 5FOJA 4HV8B 4DGYL 3HE7A 5TQ0H 1QBLH 4UILL 1TZGH 1DN0B 4KAQL 5M95B 3PHQB 4CJ0A 4QY8B 4JO2H 1I8KB 1N2RA 3B2VL 3QRFM 3Q1SH 1J10A 2FSEB 1KFAH 2DN7A 5HHMD 3AUVA 1M6OB 4K9EH 5GS2H 5F7EL 4YHIA 5E7FA 3T4AA 1D6VL 3QUXA 3QFDB 4S1QH 3L3DA 1A6VH 1CXHA 5IKCB 1HQRB 5I1GL 2EYRA 4PJHF 1FPTL 2DQGH 3VDBA 2Y36H 2QHLA 4YQXL 2CSPA 1X7QB 3TH4T 5ADPH 3PXJA 3TESA 2A74A 1IGFL 3HC3L 3NTCL 1WZ1L 5CEYA 1T1XA 4F33A 2GTZB 5ESAB 3L3JA 2WSKA 3CUPB 3U46A 3RIAK 1IQWL 4JE4B 5DRWA 4HKBA 1Z9LA 4OF7A 3S35H 3ARDA 4J1UA 2B5IC 2RFXA 4WO4B 4HS6A 4X6EA 4GFTB 1ED3A 1A6AA 2VLKA 5IR1B 2XZQL 3V6OA 1XGRA 4JLRB 2CLRB 5E9DE 4LU5L 4OIBA 4PJEB 2JCCA 3OR6B 2A9NH 5DJCB 4ZAKB 4Y19A 1PZ5B 2BVEA 5HYJD 3QPQD 3EDKA 4DGYH 4UILH 5KN5A 2E6PA 4LRIA 4OZIE 2FEDD 3B2VH 4Y5YB 3MACL 4KMQA 1YMHA 3P0GB 1DLFL 3QUMB 4GRMA 2BNRE 1AGEA 5ESQA 3WN5B 4UUJB 1G7LB 5F7EH 1MRCL 1D6VH 3WNMA 3CSGA 4NQEA 3SCMA 4EXKA 5IQ9A 3UX9B 4TNVK 5I1GH 1FPTH 3VD9A 4K7PL 1WCBB 4JFFD 4YQXH 3CNKA 1S8DA 3SDCD 5I30L 1RUKL 3QQ3A 5FOBA 5FB8B 3I6LE 5L8LB 1I1YA 1IGFH 3HC3H 3NTCH 5DEGA 1WZ1H 1FNLA 1Z5LA 2QQNL 1FG2B 1BD2B 3AMLA 4HFWB 4Z7WB 2EDEA 3L3HB 3U2SB 3S37L 2DLHA 5FCSH 3M1BB 1WBXA 1IQWH 2A9ML 1UJ3A 4RBPH 1BFSA 5CJXA 1DE4B 2DBJA 3O3EA 2HMID 4LPTA 2XZQH 4LU5H 3QEUA 1NFIB 3U83A 1MOEA 3GJEA 5K9QI 1IGJB 5C0EB 1I3UA 1UWEL 1KTDB 4U05A 2JB6B 1TVHA 3LKSB 3PDGA 2CLZB 4I9WD 5SWQA 2DLFL 3MACH 3MLUL 3G5XB 1LE5A 4HCRA 3SE3A 2E9IA 4Y89A 1MRCH 3WSQL 2IAMD 3T0EB 4GMSH 3U36B 3BYTA 2ED9A 2XTJE 5CZKA 5DQDL 4K7PH 1OAZH 4GT7A 2F53D 3DRTA 3ARFC 3QQ4B 1TCMA 5DS8A 3EO1B 5I30H 1RUKH 5BVPL 2WM0A 4KI5D 1U8NA 1ZANH 4JPWL 1I1RA 5FM4A 5T1LD 1YPZE 2QQNH 3H9SA 2OCFD 2G5BB 1A4JA 1I1FB 3S37H 4WFFD 1JFQL 4Y2DC 2A9MH 1X3DA 4YDLC 4LSUL 1T3FA 2F5BL 3NPSB 5BOZG 1ZT1B 5DI8A 5GS2D 3V9FA 3IFOA 3L3IA 3EJZC 3HPJA 1CTNA 2YPKB 4ZFGL 3QG7L 1R3HB 4OZHA 1L4IA 1GGCH 3BXNA 1UWEH 1PG7L 2VITB 3M17B 4OZIA 4MMXC 1QO3A 1RQ5A 2HTKC 3TH2T 2BNRA 2BMKB 3D1MC 2DLFH 1YDPA 5LBSL 4EEEA 5E8EB 2OP4L 3GSUB 3WSQH 1DLHA 4S1DD 5FYJL 2XYCA 4XNQA 3V6BR 4KI1A 5KSVB 1SBSL 2Z31C 2E7LA 4JR9L 3A6CL 5BVPH 4PRBA 4UTAL 3UROR 5DVNA 4Y8DC 5D7IB 3NFSL 2HJKA 4GRLA 2VWEE 4YFDB 3VDAA 1N5AA 4XBEH 5LG1A 1UZ8B 3RDTB 1FYTE 1YN7A 4YHNA 5HDLA 2VLME 3KYNA 5FA3A 4YAQA 5BS0E 5CD5C 3TM6A 5HYSB 1JFQH 4HIEB 3VFSB 1HZHH 4LSUH 2CR6A 3D5OF 4RRPG 2F5BH 2FGWL 1VB9A 1QSED 3PWUA 4XCNB 5DVKA 1QRKA 4P23C 4QRTA 1ZKAA 4ZFGH 3QG7H 2KUTA 2X4OB 3AB0B 2VZTA 2DYPA 2NYYC 2VE6A 3EOAB 5EC2A 4NJ9L 1VCAA 5FKPB 3QI9D 4KDTC 3IDXL 5EOCL 1CXIA 2XNAB 2FLBT 1AE6L 5LBSH 3R1GL 1JL8A 4L9LC 3CFJA 3EO0A 4JJHA 3H6JA 5JXED 1QZ1A 5IB2B 5FYJH 2BDNL 4JFEE 5B22A 1YYML 5ILTH 1F2QA 4I8DA 1SBSH 8FABB 3RKPA 1J8KA 3KPLA 5T1DL 4JR9H 4HZLB 1I1AC 4C56E 2F5AL 1I7TB 4UTAH 4PJXE 1JTTA 1YPZA 4JFOB 2XN9E 2X1QA 1BREA 3NCMA 3NFSH 3S35X 1QHPA 1V7NL 5GGTL 1H8SA 1J8HE 3OF6D 1KENH 2I24N 3AVEA 4R4BB 1S5HB 4O5LL 1IKNC 4WJ5A 1CT8B 3HUJE 4JG1L 1TQCB 4OV5A 4L8BB 4MVBD 1J0HA 3SJVB 2FGWH 3VXME 3D18A 1I8MB 3RVXC 2R29H 3V8OA 1P7KB 1MJ7L 5HHPB 4ODUA 1LMKA 3MROB 3B83A 1G7JA 4NJ9H 3QP3A 3EYQD 1BQUA 2EDNA 2FO1A 4R0LC 5KTEL 3IDXH 5EOCH 4L4TE 3WIIL 3KLSA 4U6TA 2D2OA 1AE6H 2YXFA 4NQDD 1DQQA 1MLBA 3R1GH 1JGVL 3BRFA 5F93C 4FXKB 4S1SL 5FYKL 4KK8D 3DYPA 2BDNH 1YYMH 4DN3L 1HEZB 4I4WA 2C3VA 4BZYA 3DIFB 4CVXA 5T1DH 3B9EA 3HRPA 4KK5D 5JW5A 2CRMA 3TYGL 5J9PB 5IB3A 3RGVD 1GPOL 1V7NH 5BV7B 3HPLB 5GGTH 5E4EC 3RWGB 4HWZB 4UINH 3FO2A 1NC4B 3IS1X 3CX5K 4O5LH 3CPLB 1P1ZB 4JG1H 1BVLB 1ZS8A 2UWEF 1ZWIA 2XI9A 3OB0K 3RJDA 5EN2B 5CZVL 4I0PA 1OGTB 3WJLA 3OXRB 1KPVA 3WO3B 5DF0A 4I3SL 3S98A 2YD8A 3TBTA 1DFBL 3HG1D 5EU6A 3WHXA 2HVJB 3SKJL 4GG6A 4X6CB 5KTEH 3NIGF 3WIIH 1MCJA 4AZ8A 1KB5B 1WBYA 1JGVH 3REWA 4JFEA 3HAEG 4S1SH 5FYKH 3AY4A 4DN3H 3PV7A 4C4KO 4Y1AE 4ODXB 3NGBC 3Q5YA 4C56A 3W0WE 5DJ2B 2MJWA 1IILE 1RK0B 1IARB 4IOIB 1JWUA 3TYGH 1CFSB 2BSTB 1GPOH 3DMMB 3MMEB 4PP1D 2FO4A 5FO8B 1VFBA 4N0UE 4JZJB 3VXMA 5I1DB 2Z8RA 1IGYA 5F1NB 3LN9A 3WMSA 2NLJA 2QL1A 3J7HA 4ZO7A 3CH1A 4CN1A 4B50A 2EH7L 2VTFA 2OJEA 4I3SH 4NCDA 5FYJD 4FG6D 1DFBH 2YSSB 5DRXA 4K7FA 1PLGL 1ZHKA 3SKJH 2H8PB 1NDMA 4F37K 4F58L 3V5KA 2PCPB 2R2HB 5C0CE 3H42L 1AHWB 2CRYA 1AD0B 1T2QL 1F58H 4NN5B 4QF1A 4ZAKC 4XNMB 1PKQE 2JLLA 4LLDA 3T3ME 1NCCL 2W92A 1BF2A 5H2BA 1QFUL 3UYPA 4Y5YC 3TV3L 1MY5A 2ADGB 4NCC1 3O11B 3WN5C 1NUNB 2QSCL 3BOVA 1C16B 4QXTA 1U3YA 4X4ZA 3ES6A 3KPRE 4JFQB 3OBAA 4L29A 3UXFA 1SJEA 4PRHD 1G0YR 4AIOA 2D7PA 5T1MA 1PG7X 1CGSL 3MV8A 3CU7A 2EH7H 4G8GA 2DQIL 4HF5L 2GW5A 2NY4B 1H3XA 1PLGH 5GISL 4OCWL 5TGBB 1JZ2A 2A0LD 4OZHF 4S2SA 5B3JF 3KNBB 2AK4B 1ZLVH 2A1WL 4F58H 1MAML 1YECL 4JPKH 1INQB 3GHBL 1J7VR 3H42H 3NIDE 1D5BA 5GRUL 5B39A 4Y1AA 3VFTA 4PJHB 4V2CB 3R06B 4NUJA 3ARUA 3SDAD 3IVKA 4TSAL 1EIBA 4HJGA 2VERN 3DUUA 3MV11 4U6YA 1T21B 3TV3H 5F96L 3IKCB 1U3HC 3TPUA 1JN6A 1FCGA 4YK4B 2GUOA 2QSCH 4N0UA 3TO4C 5MEPA 4U3XA 1TQBB 2R2BB 1P2CB 3G6JE 4WU7B 4HIHB 5EBMB 4QXUL 5EU5A 3FL7A 4I2XE 2BY3A 2ESVD 5HHOD 12E8L 2H6PB 3LKRA 1CGSH 4YHML 4O58L 5FYKD 2PXYC 1S9WA 3CAFA 4Q9BA 2FL5B 3ZE0F 2C3XA 2DQIH 4U3CA 3GMRB 4EUPG 1GH7A 9CGTA 5GISH 4OCWH 5D1QA 3VRJA 3N1FC 3N9GH 3FT4A 3FB5A 3MV7E 4X6BB 2A1WH 1YECH 1G7QB 3NPSC 5KBNC 1WZKA 2APXA 4XAKE 4FXGA 3GHBH 1V3JA 3QZWA 3H9YA