4AVKA

Structure of trigonal fimh lectin domain crystal soaked with an alpha- d-mannoside o-linked to propynyl pyridine at 2.4a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
publication title The Tyrosine Gate as a Potential Entropic Lever in the Receptor-Binding Site of the Bacterial Adhesin Fimh.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 36
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4avkA00
3MCYA 4AVIA 5FWRA 4X50A 5FLUA 4X5PA 4AVHA 4ATTA 5ABZA 4CSTA 1QUNB 5AALA 1KLFB 2UY6B 2W07B 4XOBA 5FS5A 2XG4B 4AV0A 4AUYA 4XO9A 4BUQA 1UWFA 1ZE3H 4AV4A 2XG5B 5IQNA 5F2FA 4X5QA 4AUJA 3SQBB 5IQMA 3BFQG 4J3OG 4J3OH 3JWNG 3JWNH 4AV5A 5AAPA 4AUUA 2UY7B 2J2ZB 1KIUB 5F3FA 5AB1A 4XODA 4J3OF 5FX3A 4XO8A 5LNEA 2WMPB 1N12A 4CA4A 1PDKB 1N0LB 3BFWA 3ZPDA 2JTYA 4X5RA 4XOEA 4XOAA 4XOCA 3JWNE 3ZL1A 4AVJA 2VCOA 4CSSA 1TR7A 5JQIB 2JMRA 3ZL2A 3ME0B 3RFZA 5IQOA 3BWUF 4LOVA 5LNGA 5CGBA 4AVKA
chains in the Genus database with same CATH superfamily
3MX0A 3NQKA 2BIIA 3CK0L 4JRFA 3RP1A 2JCWA 3TX4A 3WELA 2H6UA 1JHKH 3FT2B 3QPKA 3TIDA 3VFOA 5LB1A 2C9PA 4ENED 1U2HA 3QFDB 2FBJH 3C08H 1EMTH 2QVKA 1VFOA 4JFFB 4NC2B 3APFA 1ZSHA 4GUPB 4YGVB 4KY2A 3QRLA 4YSPA 3LNDA 1UWGL 4O2EA 2XQYG 2MCPL 3NJIA 3GO1H 2ZICA 4WCYL 5CJOH 4HW6A 5HP5A 3ARBA 1R9FA 1SOXA 1A14H 3EGSB 4MVBC 1QG3A 3GRWH 2AK4B 1MIEH 1OAKL 4JZOB 5GRVK 2CO7B 1K2DB 1X7QB 4GBXD 4WY7H 1D7FA 4XAWL 5CCKH 3LD8C 1UEMA 1QRNE 5AFAA 1OD9A 4OT1L 3STBA 3QI9D 1ASQA 4U1SB 3WY1A 2AMGA 1RVFH 1PYWA 1ZLUK 1JHKL 4X99B 1DYZA 1ROWA 2HCZX 4PAZA 1ZANH 3C08L 5HHMB 1EMTL 1GHFH 5D72H 4BE6A 4M7ZB 1WBYA 4XZUA 3RZCB 5JDJA 4PSRA 3BVNB 3QO0A 3ZY7A 5ALBH 2BIMA 2IAMD 2OFQA 2K6ZA 5FO9B 5F3FA 1EXUA 1QFOA 1FYHB 3GO1L 4BQ9A 3UBHA 3EHBC 1A14L 3LKPA 3LKNB 3GRWL 2WO2B 1MIEL 5ID0A 1B3IA 1KTJA 2FSEA 4FZEH 4G9DB 3LNFA 4WY7L 5CCKL 5C09B 1JWSB 3IDNB 1KSRA 1DL7H 3FU5A 4P5MB 1YYMH 5IVXA 2J3SA 5HI4D 2P5ED 3EYQD 3RPKA 4IJ3B 2VT0A 4X5LA 1ZJAA 5M94B 4JFHE 1RVFL 2VXTH 4O02B 1S7WB 4M5YH 3H9SE 1LO5A 4B95C 3C5JB 3FRUB 3PV6B 4QGYA 5C0CD 5FYKL 3PHQA 3VFVB 2GI7A 3L17A 3ZGHA 4X0KB 2NLJB 2HTKD 1MY7A 4LSQH 1GHFL 5D72L 5ISZD 4H25B 5CBAA 3DUUB 2X87A 2CK0H 1CBVH 4OJAA 5ALBL 4JFOB 2HKHL 3EOYG 4X6FB 4GUOA 5C0RL 2V2TB 5TJWK 3CFIC 3IDGA 2X1XR 1OTTD 4JLRA 1YEWA 4WFFE 4AEHH 3CPLB 3HBZA 2X10A 4R7VA 5D7KD 1QBML 4YDLC 5HJ3A 5IB2A 4FZEL 5DHDA 4QRTA 4QRBA 5TH2B 4OZFA 2NSMA 4LHQB 5B1AB 1DL7L 2PPFA 2OYPA 2IH3B 1YYML 1IM3B 5AW6B 1CJYA 3LX9A 4WTXA 3P9MA 1YN6A 3MVSA 2O6DA 5BPPA 5D1XE 2NYYD 5DCCA 3VFTA 4M5YL 4PCSA 3SKJH 5CWSA 5CLTA 2WVTA 3JTSA 4XCNB 3WEXA 3ESVF 1G7PB 1BFSA 5ECGA 3KBPA 4U49A 4EIUA 3LRLA 5FM4A 2VQUA 4QXVA 4Y16C 1X4ZA 4KJYB 4LSQL 1AHWC 4MS6A 3TBWB 4B9CA 1A4CA 1GJUA 4R6UA 5B39G 2CK0L 4GLRI 5D8JH 1CBVL 4XMUA 5EF0A 4F5CA 2J57A 1HYRC 2XV6B 2VSMB 3QJUB 1YMMB 3QDGA 4AEHL 1TJMA 4LLVA 5EZJA 4UYQA 1YO4A 1LEKB 3NFPB 1GYUA 3FSVA 1J10A 1YVLA 3T77B 1HYSD 1B0RB 5GXBB 4A38A 2O72A 2IF7A 3MLRH 4B6ZA 1Z9MA 4G2AA 4JHUA 4PRPB 3V0EA 2ICWA 3LXCA 3MAWA 4XMPH 5F2FA 1YQVH 1JV5A 3P4NB 4E9QA 1YPZE 5B1JC 3SKJL 1NCHA 3ARQA 4EI5A 1QX1A 4PJEE 6CGTA 4NN6B 2MOVA 1IKFH 4GXVH 2R1YB 3G6JB 4K8RC 3EJZD 4M8UA 1FORL 2OL3A 4N24A 4W6YB 1FCGA 2CO3A 3UG5A 1ACCA 1TTGA 2H1XA 1HHJA 1XD1A 1KYDA 1XVSA 3DROA 5GRJH 3EGDA 1IFHH 1X5MA 4XO4A 1ODUA 4DTGH 1ASOA 5D8JL 4PBWD 4BA8A 1FVCA 1WICA 2HN7A 5FK9A 1BZ9B 1R24A 1J8SA 1L0XA 3IMTA 3V5HB 3FF7A 4AC4A 4HMCA 3B8SA 3GMPA 1FWXA 1G9MC 1M7XA 2WKGA 4C57C 4D3CH 2ZAHA 1A4KA 4KXCA 5E9NA 3OGOE 3MLRL 4I2XA 3I6GB 4G6AC 3AS3A 4JDZA 1T1XB 2A6JB 3U2SA 4XMPL 1NDMA 1NCBH 4X4KA 4BKTC 5JPNC 4LSPH 1YQVL 1CLYH 1Z7JA 4ONHB 1VHPA 2Z0BA 4A2FA 1PZCA 2EIZB 1IKFL 4GXVL 3GWJA 4FYSA 1IAMA 3NESA 3SE4C 1A66A 5PCYA 3VI4F 3T5WA 5E8PA 1WGOA 4LCYA 5FA4A 1YNLL 3BAXA 5GRJL 1IFHL 5T3ZE 1KPUA 2QVTA 4J8RA 2XX0A 2E76C 4JL2A 2XZCH 4TTDC 4DTGL 4TQ8A 1P4BH 2BNRA 3B9AA 4JM2A 2C5DC 3QJZA 5MERB 2OMXB 4U6TA 32C2A 3P2BA 3SE6A 3IAPA 1MRCH 4DK6A 2YQ3A 3HG1E 4OCYH 5JW4R 4CVWA 2QKIB 5EN2B 5EN3A 3MRJA 2ODIA 5DWUH 4RX4A 2FGZA 2YXFA 3AXLB 1B4LA 1NCBL 1UUNA 2F0CA 1P53A 1RUPH 3D34A 3BYYA 5EO9A 1CLYL 4LPWA 3VSUA 4JN2B 3N06B 3WIHA 1RPUA 5EBMA 2APVA 4U6HA 4DSYA 5LHDA 2P8PB 1OGAD 1V7MH 5LGHH 1PZBA 1U8CB 1OT4A 3UYOD 2D7TH 5B7EA 3FAWA 4I0CC 3BP6A 3IMWA 3RWHB 5HHQA 3IRPX 3FPYA 3X1NA 3EDJA 4MRCA 1NFIA 3CVDA 2XZCL 4L4VD 2XN1A 3OKLB 4ANUA 2G2RA 3CFBA 2WP3O 1P4BL 4JFEE 4WO0A 3TVMD 4ZOCA 2YPLD 2X6CA 2BXYA 4PD4K 3ZE1E 4JJ5B 1F0LA 1TZ8A 3GSUA 5DUJA 4YJZL 1QZNA 4PYGA 1MRCL 5ENWA 4UQ3A 4OCYL 3TZVA 4JRLA 2VB5A 5DWUL 1AO7E 1ZA3B 3EFOB 3O6FD 4HKBA 1RUPL 1WZMA 2HT3C 4MMZC 4WTZG 1F45A 4ORGB 4F92B 3K1KC 3MRHA 1A65A 1XXDC 1MVUA 3BCDA 4PG2A 3V7AE 2OMYA 3MV7A 3HLKA 1SYSB 3RGBA 1L9SA 3LNEA 4JY4B 1V7ML 2A2QT 3EO9H 1YMHB 4KRNA 4MXVE 3FDWA 5LGHL 2WVSA 2LU3A 3QJXA 5I17B 3FK3A 1HEHC 1SJEB 2R0KH 3R06B 4N9OB 2F18A 4Q56A 3C8KA 1YSOA 4GB9A 4KVNH 2CLZB 1JZEA 3A6OA 2EDJA 2OMUB 2PYFA 3DX6A 4P07A 4XBPA 5IB3B 4DH2A 1E9OB 4PGDA 3JWOL 3LN5B 1HS6A 2FWLB 1N10A 2BNQE 3CFQA 1W2KT 4F7MB 4X7DC 2CIIB 2EDYA 1XGRA 4DAGH 4BH7A 3GLDA 2VM4A 2C9VA 2XBZA 3E38A 3UPRB 1L9PA 1RURL 3B9EA 3O41A 4HUVA 2XY1A 3ESPA 3I02A 5CP3H 4AQAA 4S1QH 3GC3A 2O30A 4PGBB 2E8YA 3S5LG 3ZE2B 3AWEA 3IS1X 3WNOA 4WI0B 1TKWA 2Z0UA 3DSNB 1XF2A 3EO9L 4U1KB 3CDYA 2FJGB 4LIQE 1DSFH 4AYSA 1EERB 1KB5H 1HH9A 2YD8A 3DMMB 1BJ1H 4MJ6A 3WG7B 3UAAA 4YHYB 2R0KL 4MX7A 3VXRB 3UFIA 4KVNL 4GP5B 1DUYB 3NIDF 1OXYA 4JREC 4ZUSA 1WHPA 4UU9A 2LTQC 3FFDA 3QNXA 1FF5A 1ZS8A 4XNUH 1BQHG 1KJ2A 4AQ1A 5F3HB 3GBDA 1OZUA 4JHZA 1M7DB 4DAGL 1LE9B 3PWPB 2CA3A 3LHPL 4Q6KA 2JQMA 1R34A 3OF6A 4JFFD 3EYFB 2BSED 4D0DA 1INDH 5ETUB 4S1QL 5D7LE 3SD2A 2OZNA 3S35H 3SBWC 1T1ZB 4J4PA 1IRAY 3FO0H 3L4XA 4XOBA 4JPVH 3RFRA 4V2CB 5F0MB 1PL3A 3I6KA 3QUGA 1TCMA 4XBEH 1FQ9C 1DSFL 3ATFA 1KB5L 4K5OA 3GSVA 5JMRA 2AK4D 4OFYA 4Y5YB 2BVPA 2X4SA 4NWTH 2BVEA 4YBQD 3FQ2A 2AJ3A 2X4PA 2NTFB 4A1RA 2YD0A 3VI3F 1S5HA 4X9FA 3RWJA 4XNUL 1S7UA 4HSQA 2YUXA 4N2OA 3VA2C 4JR9H 4TVUA 2DMBA 5J9PB 4NQQA 3K2MC 4M6OH 4MKMA 1OGSA 2WINB 2P49B 5DVNA 5HHMD 5E5UB 4DIXA 2QDVA 1INDL 2NDGA 4EI6A 3RZCD 1J0IA 1MRFH 1XMWA 2NZ9D 1QFHA 2VZSA 2X7LA 3X17A 1DE4B 4KRPC 3C09C 3VWKB 1JZ6A 5H35A 1RZKH 5CU9A 1JGDB 3WFBH 3FO0L 3L9YA 4MAYB 5DUBA 4JPVL 5L8KB 1M05A 3BMVA 4XBEL 1E90A 1N64H 4F9PA 4UDTA 4ELMF 4G9FA 1PZSA 2L3BA 2BFVH 2JTYA 3QUZB 3QEGH 4NWTL 3VXPA 1ZWIA 4MXQD 5C09D 4YBLC 1S9KC 3GM8A 3TYFB 2D73A 1D3CA 3DGCR 4J6IA 2RACA 3I6LD 4MDJA 3RTQB 4WU5A 1CGXA 3NCCB 1ZTXH 5EIVA 4JR9L 2EO9A 1PY9A 2OJZH 1UA6H 2FX8L 3ARTA 4ODUB 1F86A 2NY5H 2AV7B 4M6OL 3IT8D 5CINH 4ZUTB 2VZVA 1AGFA 1SYVA 4X5WB 1A6VH 2BMKA 1SDDA 4BD4A 5ITFA 3ULVC 5C08A 3TF4A 1MRFL 2VJ0A 3BGFB 3GB7A 2YARA 1JOIA 5D2NC 2HZHA 4P5KA 5AVQB 1RZKL 5MEQB 4M6NH 3WFBL 1EEQA 2VDOH 1N64L 2P5EE 1G7JB 4PS4H 5C6WH 2BFVL 4OZGA 1D5BB 3QQ3B 3KEDA 3A67H 5I9QC 1R17A 1JZFA 1OCRB 4QOKA 5CZVH 5C0CE 3SGKA 2MSPA 3DWTA 1IM3D 3OQ3B 4OFQA 4LEOB 2E7MA 4AYGA 1ZTXL 5BRPA 1PYWB 4Y4KA 1CDYA 2OJZL 1UA6L 2GIYA 5JHDB 1B4JH 5CINL 3P73A 1A6VL 4CKQA 5EBWA 3EFDH 2BRQA 2W07B 2W60B 4NAJA 4YC2C 4KV5F 3PFQA 5DJYB 3RWIA 1DSWA 3OAWA 4UIKL 5AVTB 2AEOA 5D7KE 2IFGA 3RBGA 1GC1H 4TRPH 4M6NL 3TEWA 3WFHA 1YMMD 1CXKA 2VDOL 3B2UD 3NSXA 2X88A 1DUZB 1T4KA 2P7TB 1DDTA 4K94H 2IPKB 4PS4L 4N2EA 2Z35B 3QXDB 4JANA 3A67L 3BZEB 3RNKA 4J3OG 5GGTH 3RX9A 1ZHKA 3MV8B 5CZVL 3A3YB 3J2PA 4F20A 4Y9EA 4PRPD 5DTFA 5DVKA 3VXNA 5M95B 1P1ZA 2ZG3A 2EIJB 2JB6B 2PR4H 2NOYA 1PZUB 4Z7WF 3BXNA 1B4JL 3V6OE 3PHQB 3BT2H 4E9XA 1CICB 3EFDL 4FQXB 3DHJA 3EF4A 3VH8G 3PIQA 1E6OH 4OVVA 1I7ZB 3GT6A 3ZPDA 3IN0A 2Q20A 5CBAB 4AKOA 2WBJD 4TUOB 4P06A 4MHHG 1GC1L 3F7KA 3NN8A 4TRPL 4ZFQA 3F6JA 4FFVD 5D1ZB 1HSAB 4XOEA 1QBAA 2AP2A 1QYGH 1AQ8A 4XOCA 3IDGB 4PHXA 4JLRB 4RMRA 4LCWA 4NAQA 2XBDA 4K94L 1Y0LA 3O0RH 4WV1A 5HY9B 1KIPA 3GM0A 3APMA 5HJ3B 2ESVB 2W9LA 4KU1A 5DSCB 1LL1A 5HHXH 3KJ4B 2YOAA 3S3PA 1T04A 4R4ND 1MCLA 4KWUA 4TNWF 3VX1A 2JMRA 1TUPA 2PR4L 1QHQA 1I8KB 4DUWA 1JVLA 3MHZA 4GQQA 2PYEB 3BT2L 3OV6A 4LMQI 1XF5A 1QATA 3QWNA 3VYPA 4PRHB 1K72A 4OFDA 1E6OL 4ADGA 4A37A 1A6PA 1RZ8A 1G7QB 2EO1A 3EBIA 3GSQB 3L5WA 3LS4H 4XX5A 5F1OB 3SBQA 1C1EH 4GP8B 5D2LB 2Y72A 4HXBH 3ZOAA 1E4JA 1QYGL 4KDTC 4NPJA 5INDB 4FD0A 3OD3A 5I16A 1TZAA 4Q4IA 4KPHH 1J0JA 5L2JA 2UX7A 2AXGA 3O0RL 5LVEA 3VGEA 4FE9A 2V7NA 1JZ7A 2A9DA 5ABZA 4LLUA 4ZOAA 3W2DH 1FNEA 1WWWX 2OX5A 4HA1A 4EF3A 3ZBMA 3R7QA 3IGAA 3B5HA 3RX5A 2GSIA 4EI5B 3N43B 4M1DH 4MNGA 4BCYA 1SEBB 1ITCA 3WE1A 1HHJB 1KLGB 3DROB 3RUGE 3FSOA 3JYBA 2F8OA 5D7JB 5AVWB 3X1BA 4G6FD 3TN0C 3QQ9D 5F9OH 3LS4L 3HE7D 1HILA 2V17H 1FVCB 1C1EL 5FK9B 5HJDA 4HXBL 4YHZH 1KT2B 4OIFA 2OMTB 1LLAA 1P4UA 3TCLB 1A6ZA 2VR6A 4QXUH 4KPHL 2P43B 2CHDA 2GQHA 3KPNB 4JX0A 4Y4FB 2VW6A 4RFOH 5KSBE 3FZUC 2W0KA 1WDAA 1KYFA 2E47A 2ARJB 4FNPA 3QZNA 4HIHB 4DEPC 3NIFB 2R23A 4NO5A 3U2SB 1NDMB 1EHKB 1KPRB 3WNKA 3L4TA 5B38A 2Z8WC 1T0NB 4K9EH 4PGJA 1GMIA 4B96A 2DBJA 4AJWA 4M1DL 3MROA 4L4VE 4PWFA 3L4UA 3IF1B 5E8PB 3HA0A 5GS0D 4KNSA 4POZD 4ZFFA 3LDBC 2YPLE 4ODBD 4OJFH 4WI9A 3C5ZB 2YEQA 1F4YH 5DRWB 5F9OL 4J23A 4BINA 2V17L 2YN3A 2OAAA 4YHZL 3WL9B 5C3IA 1VESA 2G5RA 4JM2B 2UX6A 3EYSH 4QXUL 1U8QB 4ZJ9A 4RFOL 5IFJB 3P3SA 4HZLA 2X2IA 1AYRA 4BZ2H 4B9IA 2V8MA 1ZGLA 2D9QB 1BGXH 3K0WA 4N2FA 3MRJB 1DQMH 3HNTH 3DARA 3WTTA 4EXPX 4HCIA 5JNYB 1TPXB 4OFIA 3VUAA 4K9EL 1TEFA 4U6HB 4YDIH 3FCSA 4TL4A 4WFHD 3K81A 1ZT4A 4AK2A 3G5ZA 2Y5TB 2UXFA 3LYRA 3OKNA 2AQQA 2FRGP 2DQFB 4LCCA 5LGJA 3DMMD 4OJFL 1BFTA 1LVEA 3MUY1 1UM4H 2APBA 35C8H 1TSHA 1FC2D 3MV11 1F4YL 2P42B 3VXRD 4PJGE 1N8ZA 3OC8A 2OJEA 3MRKB 4R26H 3SEPA 3H7BA 4JW3A 4NAMA 4LFHD 4XCEA 3VRJA 2R51A 2P5WA 2ENJA 3FTVA 3KH4A 4OAWA 2PKDA 3EYSL 2WV3A 3MNVB 1WC7A 2Q2EB 1H8SA 4HCFA 1OQOA 3S2AA 4TOYH 3V0AC 4URTB 4BZ2L 5ENWB 3PWPD 4UQ3B 4FQHA 1BGXL 1DFXA 2WWMD 1N6VA 2V4LA 5E4IA 1DQML 3WKPA 3HNTL 3IWUA 5H8DA 1AD0A 1D5RA 4HKBB 5DLLA 1S8DA 1YY8B 4AUYA 2WANA 1MCWW 3ARYA 4F2FA 4YDIL 5CZXC 2DIEA 5JHLA 4Y88A 3F62A 4C55A 1JFHA 3PWVB 4AOFA 2WIMA 2EDMA 1EK3A 2A9MH 2JJSA 4I4WB 4EOWH 4QXTB 5C0BA 1UVQA 4AM0B 4AZ8A 4H7VA 1UM4L 2PLTA 3W9DA 4S1DD 5MEND 2F5AH 3M6DA 2BOBB 3C8KB 4YVNA 5DO8A 2A6IA 2DQDH 4R26L 4ZZKA 3DX6B 3UBFA 4DOHB 4YS4A 2EKSA 5A2KH 3VI4A 2FQEA 3PAUA 5AG8A 2XN2A 4ZMXA 5FA3A 4DKAA 4JRWA 4LKXA 1IUZA 4HIIB 2VDMB 2XTJB 4GPVA 4OB5H 1IU1A 2EH8H 3OKKA 3AU0A 3UMTA 1G9NC 4AQAB 1EHAA 2XV0A 4WGKA 2VLJA 4CDGC 1NLBH 2AK4E 2NZ1A 4JPIB 3VWKD 4N2NA 1XTMA 5D7IB 3ULVF 1DDHA 1F18A 3D3VA 4MAYD 1MCWM 1Z0MA 3GZQA 5JNYA 2IBGA 1UXSA 4ZMNA 2A9ML 5HYQB 4EOWL 3QXAA 3QUZD 4M4PA 2F5AL 3BD3A 2VDLH 3W37A 1KB9J 2EJ1A 5I66B 4M00A 2DQDL 3ZE0F 1KJ3H 3V4VH 2E0PA 1J8KA 3KPSB 3DX9A 4JO1H 4UU9B 4Y2DB 2XKSA 1FO0B 1INQB 1RLBA 3RTQD 1ZS8B 1BMWA 1LP9E 4JFZH 5LXVA 4PR5B 3AM8A 3L3KA 1SUJA 4LVHB 4I87A 4OJYA 4OB5L 4AVKA 4ZQTA 5K33A 5H94B 3UZQB 4HS6A 2EH8L 3DO7A 4P2OC 3BAWA 2XICA 5DYOA 5LWYH 2XN9A 3O8XC 1IEBA 5FOBB 4HJEA 1NLBL 4AG4H 1I85C 1ZGLP 3GTTA 3BUYB 3MJ9A 3N44F 3ESMA 1U8JA 1U58A 5FO7B 1OWRM 3H3KA 3I6KB 4XMTA 3I9AA 2WPGA 3IAGC 1E8XA 1UCBH 4LHUB 3ROLA 5EU7C 2DQGH 3I6LE 3ARVA 3BWUC 2VDLL 2UV3A 2VXQA 2AJ3B 1KJ3L 3MOBH 3V4VL 2UZIH 3OJDA 2G60H 5EC2A 4CU8A 2YFNA 2QQNH 3CHPA 2FBRA 4DKDC 5SWQA 4OGQC 1XF3B 1XH0A 2QADC 4H4NA 1HE8A 3QJFA 4JFZL 1NDTA 4PHZA 4AKQA 1V27A 2BH0A 1Z9NA 4ZZFA 3V7AG 1TLKA 3NA4A 5JHDD 4XO9A 4PSPA 1NPNA 2J56A 2ILLA 4PJ8C 3BGMA 3JV6A 3VJ6B 4AMXA 1KCKA 3NZSA 5GGVY 3VDBA 3OLEA 1DQLH 3UG4A 4G83A 1OB1A 1QSEB 5LWYL 2WZPD 2X7LB 1UATA 2R2EA 4HFWA 3JTTA 4AG4L 3OKDA 1XL4A 4NUGH 3QXWA 5TF1H 2F7RA 5DUBB 2QVFB 2Y3NA 3NIGF 4NENB 4EJ1C 1AKPA 4JVWA 3ISYA 3OPZH 1UCBL 1INEH 2D3JA 4UTBA 5I1LB 2DQGL 4OZFH 3VXPB 1ZCRA 4XTRC 4G8FA 4R4BA 3TGXA 5SWZE 3MOBL 6PCYA 1W6WA 3MV8D 2UZIL 2G60L 2V5SA 3E3QC 2QQNL 4YLQT 4UB0H 3GMLA 1P1VA 1F00I 2ARJQ 1I1FB 1GJIA 3U36A 3NDZE 1A9VA 4LASH 4UNVA 4IOFC 3GIVA 4F24A 3K4ZA 5AVYB 1CICD 4QYOA 3L1EA 3S2CA 3ULVL 1WZLA 3BRDA 1DQLL 3KL0A 3PDOA 3QRGH 3GB7B 3RGVA 4K7PY 3KJ6H 1EV2E 2YPKA 1AMYA 4NUGL 3C6LC 4WSGA 5TF1L 1E4WH 4H8QA 4WNQB 5D1ZD 4CMMA 3F8UB 2HB0A 2NQCA 3K4AA 3OPZL 2XIDA 1INEL 4FFWC 5BZWA 4OZGB 1P2CB 2ESVD 4KJWD 5EORH 2VZ3A 4FQCH 4WNSA 1V10A 4QOKB 3G6JE 4GFTB 4B9FA 4UB0L 1A1OA 1QPKA 5IEKB 2V2XA 1BCIA 2FX9H 2VDNH 5A43C 2ZF8A 3FOMB 2IADA 4Y4KB 4BFRA 4LASL 4U3XA 1E3ZA 4XNYH 4ZT1A 3E8VA 2PYED 1E4HA 1GS7A 2X3CA 2P1YA 3TYGL 2AQNA 3DX4A 2FBOJ 2L8AA 3OKOA 3MRNA 4G3YH 3QRGL 4PRHD 3VI3A 4Z7QE 2RR3A 5HHVH 3KJ6L 3LZLA 2NNRA 1OHZA 2WCPA 3DPDA 3D51A 1E4WL 3NFNB 1ECYA 4UV7H 1RV6X 1P4LB 1REIA 3U6XA 3EXJA 2IALA 3VO0A 3SQRA 4RDBA 1AMXA 3D30A 1CDJA 1MH5B 3GHEH 5EORL 4FQCL 3DX3A 1BJ8A 3DTUB 1QSVA 1ZHKB 4KJPC 1VRSA 5GJSH 2F15A 4NNXA 3T0DA 3IMSA 4DP0X 4NUPA 5DTFB 4ELMA 4XMZA 2FX9L 1IEAB 1KGWA 1AQDA 1KV3A 2VDNL 5K1VA 3EYVB 1FFPA 4BBWA 4EI5D 5E2UH 4Z1PA 2IFFH 4XNYL 3NCJH 1QZ1A 4KY1H 4ZMTA 1KY6A 1NH6A 4NZ8A 4PLKD 4G3YL 5D70H 3DTXA 5HDBE 1U33A 5ADOL 1F1GA 5D7JD 4NZTH 5HHVL 2HJKB 4JPKH 2HTLC 3NZ8A 4JRXA 1QSFB 2R2HB 1FZMA 3UGEA 2CD0A 2AXHA 3O3AA 1ORSA 4LAJH 2YWZA 3HFMH 4L8DB 3B7YA 4LCWB 4Y4FD 4Y16A 1PLBA 1WLHA 3GHEL 1MFEH 5A6IA 4TKWA 5GJSL 2MPAH 1G94A 2JI3A 3D1MC 1HHIB 3MLUL 3QP3A 1KC5H 3FUEA 3UYPB 1J5OH 4HU2A 4GI6A 1MW2A 5MHSE 4P2QA 4GP4B 1OM3H 1KXQE 2MNUA 5C0AB 1BFOB 5E2UL 4BCZA 3K8LA 3HE6C 3ZHLA 3NCJL 4KY1L 4ZNCD 5C86A 2NDFA 1XF5B 4J3OC 1EWHA 5D70L 2I27N 1SQMA 1N68A 1NCDH 2YEZB 4LLQA 3UTTB 4JNXA 3C5ZD 5IJBC 5JQIB 1NGZB 2EYSB 4JPKL 1YJDC 4ZUUA 3EDFA 4H1LA 3ZRSA 3EJUA 5B3NA 5B1JA 1EZLA 4AH2B 2AXFA 4DP2X 3CZGA 2JLPA 1UD6A 1NAMH 4JM2D 3HFML 4RLDA 5C71A 4LBEB 5I16B 2A3TA 2YC1A 1JK9B 5AAMC 3HR5A 2V7NB 5F1NA 3I3BA 3DPBA 1SF5A 2YXWA 3TS8A 2WGXA 1MFEL 4LLUB 3VCLB 2MPAL 4A7TA 4DF9A 5JXEC 1F4AA 4LNRB 4XBMA 1KC5L 2YLKA 3IGAB 1E40A 3GFUA 3BVTA 1J5OL 1FFOA 2IANE 2B59B 2GSIB 1T3FB 4WW1B 2CO4A 3PAZA 5KJ7E 3C5XA 4MNGB 2OYMA 4LL4A 2PPDA 3TBYA 5BZDB 2KS0A 4P46C 5TK2A 1D6EA 3K74B 3KYNA 1NCDL 3KWVA 4G1EB 2ENYA 1X5HA 3VXSA 5CF3A 1KCUL 1MEXH 4Z7WA 1Q1JH 5JPNA 1U8OB 3QO1B 2F08A 4KROB 2AZUA 4N2MA 4Y8DC 4CBPA 1NAML 4TTGA 3SE4A 4GRLB 3U30B 4FQPA 4OI8A 2XY2A 2YK1L 3CQQA 3C9NA 3QZWB 2OTPA 5DDHA 4EUPH 1ML0A 1MUJA 3QXTA 4Z7OE 1BHGA 5CCHE 1OLZA 4QHUA 1NEZA 3VQ1C 2OYLA 2JIXA 4I0PC 2AEQH 4PJDE 3LZFH 4MHHI 4FC3E 5B38B 1XIWB 3QIUA 2XWCA 1R33A 3MRBA 1VDGA 3SDXE 4Z3FA 3REWA 4X98B 3LEXA 1JDCA 3IWVA 3N41F 4HPYH 2Q76A 4HWNA 2H0FA 5CSBA 3EDEA 2EXSA 3TIEB 5KYUB 4ZFFB 3X1EA 2ZG2A 4F37K 2H8PA 5L4JA 4PVBA 5FYLE 2B1OA 4NZRH 1MEXL 4NQSA 5GRWA 1PIGA 4LDEB 1Q1JL 1BVNP 2ISDA 3X14B 1IAKB 5BRZE 2P48B 1W0VB 3ISRA 4NIKB 2D7NA 4KGJA 4P48A 3ML9A 4Z8FH 1RK1A 5I1CH 2APSA 4P5RA 1ZLSH 3NSJA 3TEZA 4HZLB 4GUQA 4PLOB 2XTJD 2D2OA 2Z31C 4YHML 1TU2A 2XT1B 1AOZA 2YFOA 3DX1A 3TEYA 4AVJA 1HXYB 1H9DA 2AEQL 1T66D 4K5LA 3LZFL 5F6HJ 3IJYB 5D6DC 3T0VA 4BCXA 4X6DF 2CR0A 2X5PA 3GMOA 1OP9A 4HPYL 4RRPG 1C5CH 4K3EH 3D4YA 2B1AH 3FBKA 2QGBA 3HCVA 4JHWH 3WE6B 3EADA 4F27A 2OS7A 1HNGA 4NZRL 2R7EA 1EO8H 3FCTA 2PWEA 2HWZH 2WK2A 3PDDA 3BWUF 3KPSD 4NFBA 2EIEA 4Y2DD 2P5WB 4Z8FL 1MN4A 3AROA 4J3TA 5I1CL 3TC9A 4F7CB 3QZBA 5AW5B 5TQ2H 4NN5C 3S96A 1A6TA 2J8UE 1UC6A 4HJTA 4PJFF 5BQDA 1S9WA 1HHKA 1ZV5A 2WHVA 3U4EA 3VRLF 2CCWA 4FQHB 5GZOD 1DR9A 1M42A 3SD5A 4PTTA 2DKMA 4ICXA 4ODTH 3OF6D 3KBHE 4ZMYA 3RVUC 5CMAB 5D1XC 4BGLA 1AZZC 5FGBC 3BRFA 3OR7B 3LZOA 1J5HA 5FO2A 2Q3XA 3TBBA 4OUUA 3RAJH 1JDDA 5I74B 1UXWA 1C5CL 4C4KT 1X9QA 2FAUA 1IGTB 3ILDA 4K3EL 4YR6A 2B1AL 1I8UA 4JHWL 4LHUD 3V9CA 2NX5E 1P9MC 4NOFA 2XKNB 1QA9B 2AERT 3K72A 3HPLA 4AV0A 1OF2A 4Z76A 2ZWNA 2EKSB 2XG5A 2HWZL 5D96B 3VI4B 1GGTA 3BCFA 2WVUA 1P84J 1XO8A 2VDRH 4UTAA 4YHIA 3SDAA 1CLVA 5TQ2L 2BSRB 4ANKA 3KLLA 5HJGA 1MREH 3AG3B 3Q8AA 4HJGA 4HCRH 2DEYX 2X0UA 2IBBA 3FCGA 3OXRA 2R56H 5DRNA 3QULA 1WZAA 4ODTL 3OKKB 4OLEA 2BP5M 3KWWA 5K1JA 1QSED 1F1DA 3C6EA 3G5YA 1MCCA 1MJJA 2VLJB 1NC4B 1J1XH 4W9FC 4YMPA 1U8IA 3KBEA 3RAJL 2NMSA 4N25A 1IVTA 4EN3B 3TURA 4GRMA 4QMEA 1YEKH 4KI1A 1A2YA 3V0VA 4LGPB 2GC4C 4YL9A 3FTYA 4YIQB 2OP4H 1JDAA 3TWCH 1AE6H 3I75A 1CIUA 3FQ4A 2XX1A 1QBLH 3HB3B 3L6FB 1PFOA 3VXUA 2OW7A 3Q1SH 5KSAC 2BOCA 4DESA 1KXTA 3SBWA 2UY7A 4CW1A 1M4KA 5D1QB 1GW0A 4JRYB 1WEJH 1C8QA 2VDRL 3EO0A 1ZJBA 4XE0A 3T4AC 4E2OA 1M57B 5GS1C 1MREL 4IEFA 3HI1A 4HCRL 4R3SA 2R56L 1JYWA 2QPFA 3S37H 1LJMA 3AB0B 4HIJA 3RDTA 1HJCA 1A5FH 2XN9B 5I1GH 3L3IB 4ZOBA 1J1XL 3WLWC 4YSOA 1I8AA 1FFNB 1NIEA 3U1PA 2DS4A 4WI5A 3MODH 4JFQB 3MV8E 1U58B 1N19A 4N0UE 2O1AA 1YEKL 2G9HA 1OPOA 3B3IA 2CCLA 2F2HA 1GYAA 3KLAA 3HG5A 2OP4L 3MUUA 4NBZB 3ROLB 4NQDA 3FB7A 5CGBA 3ARDC 2BW4A 4PJXF 3DJ9A 4FQQA 4QT5B 1AE6L 3OQRA 3TWCL 1G0YR 3P2DA 3R19A 5F9DC 1QBLL 3OJDB 4QOKD 1ESOA 5EC2B 1O6TA 3Q1SL 4WFED 4UI2A 2XVGA 1E67A 3BO8A 1WEJL 2OK0H 4R7LA 1HE7A 1DQTA 1QFWI 3FN9A 5F7MC 5E03A 1JXGA 2C26A 4Y4KD 4ECNA 2OTUA 2CO6B 2FUQA 3QR0A 3CN4A 4PV8B 1OCZB 3UBXG 4G7SB 3JV6B 4OGAC 3E1F1 3IXTA 2CLRA 5HPMB 3QXVA 2GB2A 3DUSA 5AALA 3S37L 1HT6A 1J0KA 3MC0A 1A5FL 4GSUA 5I1GL 2EKJA 3RBSA 2QFRA 4HFWB 3BUQA 2EDRA 4NRYB 3HAEH 3AADB 5ACMA 3S5YA 3MODL 3NCXA 1OANA 3T8MA 2P8MB 5I76B 4HD5A 3TJHC 4K5MA 5I0DA 3INUH 3N42F 1QR1A 4IBWA 5SWSE 3HN5A 1KTBA 4ADIA 5FYKD 4ZW3A 3S35L 5DMKB 3IJEA 1FNFA 4R4BB 5EU5A 2VITA 1PQZA 5GRXG 3ARPA 1SVZA 3C87A 4X8GA 2IBZX 1BQLH 1C12A 1MJ8H 3GMLB 4B3EA 2OK0L 3DECA 1T6WA 3V0GA 4L1LA 2Q7NA 4W4NA 3U36B 1S4IA 3AS2A 3PY9A 3NIDB 3ARRA 3F7LA 2KQNA 1T5XA 2EICA 5D2LE 2Y24A 3HVDA 1JK8A 3PDOB 2QPSA 2XWBB 5C0ND 3X11B 2IQAA 1HCVA 5FOJA 4J3OF 1MCJA 1CC3A 1WJ3A 1E4XH 2H9GA 1RPQA 2ZCKH 7PAZA 3CLWA 1QSFD 1AD9A 1J12A 1FE8H 5FHBH 1VZGA 1NGYA 3INUL 4LCWD 3WXWH 4IHOA 2L04A 1Z9PA 4G7YH 1G7LB 4L3EA 4IGBC 5AVXB 3HZYA 3FAXA 4JDVB 2GJPA 2A74A 5G5DA 3TFKD 3FFOA 3IGKA 1BQLL 1F2QA 1MJ8L 2V2XB 1AXIB 2M1KA 5I23A 2WMPA 5TF0A 2IADB 1A7NH 5C0AD 1QD0A 1GYWA 5DQJA 1HI6A 1PAMA 1IBDA 3JZ7A 3EHBB 3IEAA 1CS6A 4QRPE 4YHLH 1ES0A 4KX8A 4AQZA 5HYFA 1V5JA 1GXEA 5HGDA 4A6YH 3VI3B 3F6IA 5DMGC 3UTTD 4DP7X 4KTEH 2ZQKA 3FT4A 1HC1A 5G55A 1E4XL 2XQYA 2ZCKL 3P9LA 3LOWA 1DQQB 5L0QC 1CF1A 1Q94B 4A7SA 1JWUA 5FHBL 1XBRA 2DQEH 2OMVB 3DJTA 3DXAE 2MOGA 4GRWH 4ADJA 3WXWL 2A83B 4W4OC 4G7YL 2ZXCA 3DIFB 3HHSA 3WEOA 4WF7A 4MBOA 2WLJA 4Z6AT 3M45A 3VMPA 1C08A 4L2YA 1MDAA 4NNXB 5J1AA 1D7BA 1O9WA 3ARGC 2GJZB 2W5PA 3FU0A 4BFKA 5F7DA 3P1VA 4ATTA 3TL5A 2ICCA 4Z78A 3D18A 1FFPB 1A7NL 2JKLA 2NR6C 4YHLL 2N56A 3OAUH 3EZJB 3ZDXF 4F37F 1JUFA 4YDLB 4HZ1A 3B2VH 3CSPA 4A6YL 5AD0A 1NFDE 1SVBA 2WZ5A 4P23B 3ULUH 2DTMH 2FWOA 4KTEL 4X9IA 3SKUD 2D31A 3RE0A 1I7TB 5IIEA 5CJBA 4KROD 1FZMB 2XV3A 3IFOB 3SKOA 4F33B 3O3AB 2DQEL 3D52A 1ZMYA 4PWIA 1ZKAA 4GRLD 2VLKB 2ZKXA 3DV4B 4WI4A 2PPEA 2J55A 1UD3A 4YE0A 1AHWB 2WZ6A 3AVEA 2DD8H 3CBJB 4YVUA 3QDJA 5I0XA 4TF4A 2DJMA 2DQHH 5F96H 3AY2A 4P2AA 1XIWD 2X9XA 5D9SB 5KVGE 1Q9OA 1YUHA 2FO8A 1J11A 5IMKA 4HX1B 3OAUL 4P4KC 4FG6D 4S2SA 3B2VL 2PO6C 4M7KH 4MCMA 3ULUL 4N22A 2DTML 5LBSA 1YJDL 3FO2B 1J05A 3LPOA 4R0LC 3MRRB 4K7FA 2O6EA 2R2BB 3IXAB 5GGSA 5HPOA 2ZXBA 3QUXB 4XR8C 4HT1H 3HR6A 4RWYH 1R3JA 5ERWA 4BHUI 3PNRB 4JFDA 2HT4C 3DOIA 1TNMA 5BMFH 2FT6A 1OP4A 2FYVA 2LQRA 2WP3T 2YRPA 4LSUH 2DD8L 4FFYA 3TN0A 2PW1A 1BSIA 3IU3A 5EO0B 3FQTB 3FUNA 4JFPA 4ZS6D 1QI3A 2DQHL 5F1KC 3BKCH 4PTUA 5F96L 7CGTA 2ZX6A 2E3VA 2VDKH 4L4TA 4NQCA 1U8NB 3ARXA 4RAVA 4YEFA 2OMWA 4GG6E 1AIFB 3MNWB 4Z3GA 2O61B 5E4OA 5F7NC 3F00A 3H6AA 4AWJC 1I31A 2IAMC 3CAFA 4WLCA 3RPBA 3IFLH 3TBYB 4M7KL 4DOHE 1D6EB 4P9HC 3KYNB 5B39A 3K6NA 4N6RB 3VXSB 5KJRH 3LKQB 1RL1A 2Y7NA 3FB6B 4N3TA 1SNRA 2BHZA 4XN8A 4KK6D 2DW5A 1PU0A 5EU6B 1NIFA 4JCWA 1MKFA 3VFRA 3QCTH 1IL1A 1F6AA 5G4NA 2P5WD 4HT1L 4IMKC 4RWYL 1GCYA 3EYQC 5IJCC 3OLDA 1L9TA 2O5NA 2YSSB 3KYOB 4OQ1A 5DHVH 5FLUA 3UTZB 5CFAA 1EHLH 2IH8A 5BMFL 1MUJB 4LSUL 4PI2A 2ADIA 1JXKA 3FNKA 4QHUB 5E2WH 2AGJH 3HI6H 2GHWB 1OQXA 2JIXB 1JN6A 3BKCL 3F12B 3G04A 1CXIA 3MGTB 5FFOA 2P8LB 2HTKC 3BIKA 3CQFA 1I82A 2VDKL 2XVBA 3C5SB 5L4MA 1V05A 3QUML 1R47A 4L8SC 4QLWA 1M2VB 1E27B 4AITA 1YPZF 3BLKA 3TPKA 6FABH 3IFLL 4PJEF 1W8EA 3KPPA 4BWTA 4EQ3A 1F5WA 3UTSA 1OTTC 2EVFA 1E2WA 1WGVA 4XN1A 1DJIA 5KJRL 3LKOA 4TUJB 2NT0A 2YPVA 3IFPB 2ZIDA 4OLYH 4R97C 1CPUA 1PX8A 2PETA 4GQ9H 5I15H 3DJZA 1DBMH 2ARWA 2KZKA 1AHMA 3QCTL 4XCYA 3CU1A 4W9IC 5CUSH 3BFQG 3DVGB 1EHLL 2NYYC 4KK9C 3SGDI 3D85A 1BXAA 2DQ6A 1QVOA 4KOBA 5E2WL 2AGJL 3HI6L 3ZZSA 1NMCC 1UWXK 2AVGA 3EFFA 4XODA 2WO4A 3KGUA 4KKQA 1CFQB 3MRPB 3DRQA 2VLJD 1U8PB 1NC4D 3MJ9H 1VACB 1UB6B 2GIXA 3LRKA 3V6OC 3Q3GB 4EN3D 3QWOB 4TL5A 5KVEE 4KDVA 3D69A 5F7HA 6FABL 3BJ91 5ICYA 1AR1C 4DP6X 5BXFB 2DJ4A 2WXRA 5GZNC 5EUOB 4KI5E 1A4JB 3PJSB 5J8OA 3I74A 2YD7A 5DJ2A 2J73A 4OKVA 2FCBA 2R7EB 4OLYL 1PW3A 1DVFA 2BZ7A 3FCTB 4GQ9L 4MMZB 5I15L 3HB3D 1DBML 4HAFA 1WS8A 4S11A 1BX2B 3CSGA 3ROOA 1O6SA 5CUSL 5IROD 5D1QD 3KLHD 2XNAA 4HXAH 4AQEA 2GKIA 2WOYA 4RGNE 4PY8J 5IOPB 2NW2A 3B9DA 1QSEE 4BJLA 1EANA 3BAKA 3U4EB 5B4MD 3IM1A 3R7RA 5MP6H 2OMNA 3EJZC 3G08A 4PTTB 5E6IB 4QF1A 2RD0A 4A2GA 3QAZC 4OLWH 4YBHA 3T1FB 1USQA 2XN9D 3V0WH 1EDHA 3MJ9L 3BUBA 4OUUB 5J6GB 4PGCA 3IKCB 4UQ2A 1J8HE 1QLRA 3LY6A 2OTWB 1QQDA 2G3ZA 2R4SH 2J6EA 3OWEA 4AQ8C 4K9JA 4MS8D 4FCAA 3HS0C 3GQFA 4P4RA 4Z76B 1LXMA 4N2AA 2IPTH 1U92A 1BF8A 4R7NA 3TT3H 4HXAL 4A2HA 1LDPH 4H8VA 3UCQA 5J3HD 2VXUH 2SODB 3NP3A 3FOLA 3HMWH 4HJGB 5DJCB 3ZE1F 4FG4A 3OXRB 5MP6L 4WTZA 4MA3A 1FSKB 3VSTA 3SBPA 3U4AA 1DN0A 2CLVA 3IMVA 5IBUG 1NBYB 4OLWL 4HWZB 3G5YB 3V0WL 5I8CA 1BEYH 2F54A 2LTQB 1ED3A 4NM8H 3CD4A 4F57H 4EDXA 5DEGA 1L9MA 4H20H 2Z7YA 4HJIA 4N2KA 1M71A 4YSRA 2R4SL 3LRGA 5DRZA 2ITCB 4G6KH 2P52A 1D9KA 2DIBA 4IBSA 4UIMA 1VAHA 2IV8A 5GISH 3CFUA 1WFMA 2NCEA 2C9XA 5E99H 2KPNA 5IW6A 3AY4C 3O8XA 1N6QH 5JW5B 2EVGA 3VXUB 1YAZA 5EIQA 1CLZH 4PB0H 1I85A 3US0A 2UY7B 1K9TA 5KYXA 1FP5A 1X9LA 3TT3L 1TO4A 2F1AA 1I9JH 3QJHB 3NRQA 2R8SL 1LE5B 3KGTA 4PREA 1LDPL 4NKDB 3IB4A 2VXUL 3HMWL 4MVBD 5BQ7B 1H6FA 1LWRA 1RHFA 3NACH 3O4OB 5HDRA 3RYMA 3NRPA 4X5XB 3S5LA 2VDLB 3VYOA 3WN5C 4HIJB 3AAZA 4F1SA 4KKPA 2FH6A 5DC9B 3STZA 4MLIA 3V4VB 1BEYL 4QXGH 1IKOP 5FGCB 1X5XA 4PJFA 4TLKA 4WI3A 4NM8L 2Y7QA 4M8VA 4E5XG 1NJ9B 4F57L 2R69H 2ZOKB 4H20L 1HNYA 2GITA 1SXNA 3KLAB 4G6KL 4JK0D 4NQDB 5GISL 3HS9A 5E99L 4WI6A 4CAGA 4JGMA 3W57A 1N6QL 1BQHA 1FYTE 3I9GH 1CLZL 4Q7DA 4PB0L 2QQQA 3FQ1A 4HMDA 4G1MA 3O6FC 1IV8A 1I9JL 1O7SA 3GDBA 4HJUA 3UC0H 4DUVA 2O5ZH 1WUNT 4FMVA 1MCRA 1CLOL 2OTUB 3L95B 3MNMA 4Y1AE 1MJUH 1VLXA 4DJMA 3EHBD 3UOAB 2ZKWA 4O51A 3TH3T 4PFEA 3WIIH 3NACL 2VLMD 3DBXA 3K91A 3IXTB 3TLRA 5HGBA 4EN2A 3DUSB 4X6BA 4YBLB 1NBZA 3CX5J 3HI5H 1S9XA 3WKMH 2YAOA 4QXGL 3PRZA 5LCVA 2YRZA 5A16A 1R3LA 5I6XC 4D0CA 4OF6A 2DQIH 4FLRA 2R69L 2IOMA 2VSCA 4UTCA 1EQWA 5HHNB 2CBQA 4Q6IB 2BVOB 3T0AA 5K59E 1J18A 3R18A 1FIEA 1M7IB 5A2AA 3IJEB 3EJPA 1EJ8A 4GT7A 1A7RH 1HJBC 2X2HA 1TYRA 4NZDA 5CJQH 1Q9LB 3MFFA 4OZIE 5D2NB 3HZKB 4JO2H 3C6LA 4XVUC 3UC0L 5I24A 4LCUA 2VISA 2O5ZL 5IHZB 1L9QA 1M6UA 5FS5A 1DJYA 3GXNA 3I9IA 3ZE0B 5FCSH 3QH3B 2F19H 3PXJA 3DUHA 4JDEA 4OV5A 3WIIL 1A6UH 4AGPA 5I9QB 3M1CA 4YZFF 3RL1A 4OBSA 3G5XA 1ETZA 1T22A 1Y6MR 2CXKA 3HI5L 2D7PA 3WKML 5B8CC 4H1LH 5IZ7A 2B14A 3M07A 4JRXD 1MI5B 1O7DE 2DQIL 4I3SH 4IU3A 1RLWA 3ELAT 1D5MA 1QSZA 3QZOA 2VLKD 1T0MA 1XR9B 2JELH 4IHOB 4L3EB 1JERA 1A6AB 4YC2B 1T1YA 2YS4A 4MCYB 1A7RL 5CJQL 5AB1A 4ZSOA 4X6EB 5E8NA 1ETJA 4JO2L 3HN3A 3RWFB 5KBKA 1NPUA 3EBGA 1ERNA 1U8MB 2WMPB 5JQ6H 4PJXA 4ZUVB 1E65A 3V0FA 4Z0XB 1HI6B 2N7SA 4N2DA 3VXMA 1NCAH 2VDQH 1AGEA 2F19L 3QGVA 4DCQB 1A6UL 5DS8A 5FHAH 3QDMA 1OD7A 2HKAA 4F8TA 2VCOA 1WQVT 3Q05A 5TFSL 3OXSB 4PCKA 2EEFA 3CHRA 4YBQC 4I3SL 3QUXD 2VDNB 2GT9B 3IDUA 4K8RD 3WY2A 2JELL 2GVYA 2LV4A 3M1BA 3QWRD 1RIUH 1WA0X 1MCIA 1LGVA 5A2LH 5G4MA 3NIGB 4LPTA 5J1AB 4HIEA 1PSKH 4YX2H 4U1LB 4QRRA 3VD7A 5EBGA 5AB0A 3CWGA 2Z7WA 4M7ZC 4TNEA 2G5BA 3D18B 5JQ6L 5IMMA 1MAKA 3RDJA 4FLSA 1NCAL 2VDQL 2X3BA 4OVUA 4FLOA 5L88H 3OWRA 2Y6TE 4TSBH 5FHAL 3VDCA 3AC0A 3VXSD 2FWOB 4MZ2A 1U8HA 4PS8A 4U1NA 4FXLA 5IHUL 5J5EA 4MXQC 1SLUA 1HQRB 2XETA 2Y3AA 4PJCE 5EU6D 1CTOA 3HE6A 1IBGH 1JPSH 4IJ3C 2YAPA 5L7XH 2Y4SA 4X80H 1ETB1 1RIUL 4I77H 3RWCA 2FK9A 1EFXB 3WTYA 2N1KA 2MEJB 4W9DC 4HHAA 4TTDD 4Z3EA 1PSKL 4YX2L 4NQTA 2JIXD 3GMRA 2LLLA 2ZOTA 3N1PC 1S46A 5DD6A 5DK0B 1ZDQA 1UWFA 4AL8C 3UPCA 4L0YA 2BY3A 5DZPA 4KH2A 1F6FB 2BDNH 3VH8A 5AAMA 4FABH 1A8ZA 3T6QC 1ZK5A 4UMSA 4HUNB 1SM3H 4TSBL 2DBLH 3AUVA 2VZTA 4XXWC 1NWOA 1URIA 4K7FB 5GGSB 2B15A 2HPOA 1JZ8A 2XLLA 1WAPA 1PZAA 4V1DB 5CHNA 2BSTB 3WS6C 4UT9H 1JPSL 2VO8A 4L05A 4PM1A 3QSKB 1GKOA 1FL5A 1A9EB 2OQJB 2YN5A 4I77L 4P46A 4RMTA 4X80L 1MFMA 5T1MB 4YAQA 1DANT 1URZA 3HRZC 1R4XA 1H8LA 1RKRA 1V3KA 2O26U 4ZO8A 3TN0B 4FG2A 4HGKC 1BLNA 3H4HA 1SBBA 2VR5A 3QFJB 4YNYA 1ODAA 4PTUB 3SZKC 3Q6GH 1CVSC 1J1PH 2ZOWA 5JXAH 3CDZB 5C8JB 3CDGA 1HHHA 2KUTA 1XF4A 2DQCL 3CSYB 4NQCB 4QKTA 4IQHA 2OMWB 1ZT1A 3DX8B 2HP4A 4RAVB 1N4XH 5AG9A 3SQOH 2BDNL 3VE0A 4FABL 4S0TD 3H3PH 4A2DA 2GSGB 1SM3L 3NP4A 3OMAB 4F8NA 2DBLL 4AYBA 1TJIH 4DEPB 1QRNA 1UGNA 4R9HA 4FX5A 4E68A 3IJHA 1L5GB 2DQJH 5IG7A 4GKLA 2C3XA 1MHCA 4OY9A 4YDVB 1IGIH 2BSSB 2HT3D 4LDOB 4YXKH 1XCQA 4DEUA 5I1JL 4Z7UB 1P5VA 3BDXA 4QJ5B 4UTAH 1Z9SA 4PJBB 2FJFA 4PIBA 4UT9L 4FFTA 2C8NA 2X9YA 1IAII 4Z95L 5LGYA 2H2SD 5E00A 1KTKE 2CO2A 1FVEA 4I7ZC 4JFXA 3BN3B 3NMEA 4HS8H 3BP7A 2K9UA 1NANI 3E9UA 2CZNA 2PP7A 2XXCB 3CZJA 5CNHA 1YEIH 4GAGH 3AMKA 5E6ID 1JN6B 5AW9B 3Q6GL 1J1PL 2BS8A 5JXAL 3BIKB 4YSQA 3T0WA 4D9QE 3RWGA 2BY0A 4G8GA 4MD5B 1WA1X 4APXA 1N4XL 5I1KL 4BK8A 3SQOL 4KHTH 3H3PL 4FFVC 4Z7VA 1N2RA 3KPPB 5IT2H 4L1DA 2Z31A 3SBRA 4DGVH 1TJIL 4Q9CA 5D1QE 4JRYE 2IGFH 9PCYA 3LKOB 3CUPB 2HJLB 3D12B 5MEPA 2DQJL 3RUGF 4JGJA 3P0GB 4YN3A 5JIHA 3FSZA 1IGIL 5D6DA 1UUSA 2WLIA 3H9SA 4YXKL 4DVBB 1THCA 3IDIA 3NPZB 4UTAL 2WIIA 4M4RA 1BG1A 4OI9A 4WO4B 4AW7A 2AQTA 2GCYA 4HS8L 2ORBH 1BPLB 1FNSH 4TQPA 3NZHH 5KSBF 1YEIL 3ILEA 4GAGL 3PE9A 2I9TA 3SY6A 4KQ4H 3VA6A 4BSWA 3VFPB 2A9NH 3B8YA 4Y19B 2X09A 2BCMA 2DMCA 4KHTL 1UZ8A 2XN0A 5C70A 1GRWA 1AG6A 4HC1H 4ZO9A 5IT2L 4DGVL 3TA4D 2HVBA 3NOIA 2IGFL 4XAKD 2CDEA 4LLMA 4PRNA 3QNZA 4ANVA 4N2GA 2EEAA 4ZI8A 1U8KA 3KL3A 1CTMA 1EPFA 1N3NA 1V54B 5D1XA 5DXWA 3STLA 3NGBC 2EYTA 3ZDZB 4TNFA 3IPEA 5SX5K 3UTPE 3VXUD 1MCNA 2H3NA 3NCBB 5E9DE 5LNEA 4NO3A 5JYLA 4HLZH 3UH8A 4AQEB 2VWEE 3FXIC 2NW2B 1JIBA 2J5LC 4I85A 4LRNH 1U3HC 3TV3H 2ORBL 3KVQA 1FNSL 1P9MA 3NZHL 2N0MA 3FQXB 4QF1B 5KSUA 4KQ4L 2VL5A 1DFBH 2A9NL 3CZNA 3QQ9C 5CBEB 3QS2A 2WXGA 1X7TA 2CH8A 5LG1A 1XCTB 3BN9C 3E9TA 3RHWK 4HC1L 5KAQG 5TGBB 3JUZA 4KNTA 2YAMA 4KHXH 3ERXA 4NQDD 4IOSA 3U0PB 3N41B 1YPZA 5T3XH 1OSYA 4TN9A 2B77A 3RG1C 2XDHA 5IQOA 3VXQA 3M8OH 2WY3B 4LRNL 3RFZB 4HSAC 4HGWA 3TV3L 3FOLB 2GBVA 2RMNA 3KPOA 1KNOA 1A4BA 2EDQA 4U4BA 4UILH 1OHQA 2B08A 3NABH 2IMNA 1ULVA 1ZTXE 2LLGA 1DN0B 1PGRB 3GSWB 3JV4B 4IU2A 4U1IA 5KSAA 3CDCA 1DFBL 3NCFB 4EXKA 1ED3B 2ZUTA 1J9QA 2JK5A 3CMOH 4TV3A 3T4AA 1QUNB 4W9GC 5GS1A 3T8VA 5EPMA 3PREA 1M71B 5AQ0A 4KHXL 4X6DB 3M7OA 5JIKA 4AYFB 5AWNH 2HT2D 4P2OB 5F1IA 1J86A 3U9UA 3ULVD 4ESKA 3O8XB 5T3XL 1C16B 4G8EB 3UAJA 2FJSA 4XH2A 1WD9A 4LHUG 2IPUG 5KVFE 1GA2A 4IBVA 3E6HB 3M8OL 1K4CB 1SN0A 1UH3A 5FDYA 3H6JA 2VE6A 3IDJA 1IE4A 1SPDA 3ARDA 3TOPA 4UILL 4MZIA 3NABL 2XPZA 1D5ZB 1THAA 3WU1A 3S5LB 5E56A 3ZTNH 1VEPA 1FRGH 3MRDB 4LOUD 4QRFA 4YHYC 3TPUA 1XD0A 3LRSA 1XGQB 4IMLB 1GVIA 4PJFB 1MI5D 4O58H 3CMOL 1MELA 1WBZB 1L7TH 5ACZA 3IRCA 4BFEA 4GKZB 2WYZA 4PJ8B 1TFHA 3K8MA 4KTYA 5EZLA 4PJIA 1TQWA 5EEZA 4ISVB 4L3ED 1WAAA 4QLRA 3MCG1 5AWNL 1TQVA 4NP4L 1ZHNB 3KPRB 2YQGA 1BQHB 4GG8B 4XI5C 1ZHBA 4RQQB 1T6VN 3RL2B 4ETQA 2G4EA 1UJ3B 5CEYA 3VMNA 5HSFA 3BPLB 4YDJA 2CRIA 4ONGH 4PJAE 1I9IH 5DJ6A 3ZIYA 1XX9C 5H2BA 1BXVA 1LP9F 1HXMA 4O00A 2EUXA 1TOXA 3CFJB 4PV9B 1K8IA 3OG4B 5HGBB 4LVNC 4WUUA 1X9UA 3J8F7 4X6BB 1C5DA 3VQMA 1NBZB 3RKDC 1JGVH 1FRGL 3GMQA 4JFEA 1AGCA 4Y5YC 2Q7YA 3QK0A 2EDWA 2WBKA 1DZBA 4FXKB 4O58L 3VG9B 2WSKA 4V2BA 1L7TL 4BXSV 3UZEC 4ALAH 1IIKA 3CCHA 2YGPA 4EKJA 3VWJC 1BLIA 4AE1A 3LSOA 2WNGA 4DP8X 4NYLA 3F64A 1MCDA 3Q06A 1ADQH 5INCA 2HX8A 5B7MA 3R1GH 2WLLA 3OGCB 1IGYA 1A6WH 1FNLA 1I9IL 4F9LC 1PAZA 2C7FA 2XWDA 3HNVH 1EAPB 3GMNB 3JXAA 4FQJH 4IGBA 2B1HH 5FPIA 3RL1B 5LBSH 2CIKA 3MLYH 3G5XB 1V3JA 3ARFB 3FQUA 5E4AA 1EEZB 1VERA 1JGVL 2L0DA 2V33A 4XB3A 1GYCA 1HINH 3QUZC 5HHPB 4N6QA 1UA7A 3TONA 4JS7A 3SY0A 2DIJA 4YQXH 2OZ4H 2W38A 3QR1A 2EC9U 4HIXH 4LF3B 4IU3B 4M9OA 4ALAL 1QW9A 2P24B 3ZTCC 1D5MB 3DGGA 4HV8B 3T71A 1RZQA 2VGLM 2YMOA 3H1ZA 4RMSA 3RTQC 1EFXD 5F0PB 5HVGB 1NBCA 5AYUH 1LD9A 4ZAKC 1G0XA 2VAAB 3W0WB 2Z93A 4ZSOB 1ADQL 1UENA 4UAHA 3R1GL 3LV3B 5IQNA 1A6WL 3LQAH 4UANA 3U6XS 3CN2A 3PJNA 4DK5A 2ZX8A 1Z66A 3HNVL 5CEZD 4W4OA 1ZLVH 3D4CA 2CBTA 4N3UA 2XWTA 4WHTB 4FQJL 2B1HL 5FW7A 1X6LA 2SEBA 4I9WD 4OJDH 3MLYL 5LBSL 1CT8A 1WIOA 4Z5RA 3GUTB 2CM6A 4HF5H 3ARGA 1HINL 3A22A 1KBWA 4J2QA 2OZ4L 4YQXL 4V1DD 1BZ7A 1PG7H 2NR6A 4APQC 1KN2H 4YEEA 3U2JA 4YWGH 1XSOA 2NTSP 1O5DT 1D7CA 2FX7H 3TJEH 4N0YH 2EDEA 2RFXA 3OG6B 4XT1C 5D7LA 5AYUL 1ZIAA 2H1PH 1R5WA 3TN0D 4RFNC 4KZEH 2NT1A 3F05A 3QFJD 1IO4C 1LMIA 4QRRB 2XQBH 5F7FA 1OAQH 2DYPB 3N42B 4Y5VB 3QIWC 2FUTA 2QLVB 4NQCD 1P6FA 3DVIA 3G6JF 3LQAL 4NC1E 2GEQA 5IHHA 4FFZL 3T0BA 3ZO9A 3Q01A 5BZZA 3FZUD 3VFMB 1XGPA 4XHQA 5DD3H 1KJMB 2OSLA 2UYLA 3OKEA 3R0MA 1W0WA 4Y89A 3DJSA 5I8EA 3MYJA 3NVQA 2IWEA 4HF5L 4N4YB 5DVOA 5C0EB 2ZYSA 5E7BA 3KYKL 1T5WA 4M93B 5FUOH 1HVXA 3IPFA 5IM7B 1MCHA 1PG7L 2V3EA 1KN2L 4RZCA 4P4KA 4RESB 5GGVH 1AGDA 4J7RA 2PO6A 4Y4HC 2XIBA 4KKAC 3QEQE 2FX7L 5CEXA 1JZ2A 2QVMA 5DJXA 4N0YL 3TJEL 2H1PL 4ODXA 2X4TA 4TSAH 5HYSG 3U83A 4KZEL 4R0LA 1CICC 2XQBL 1OAQL 3H2PA 2H6OA 4FQXC 4GBXA 2X4NA 1M7UA 1LK3H 5EUOE 4MJHA 5L6YH 2KLSA 5KYYA 3HIZA 2QBWA 3QI9A 3VH8B 2XTSA 1WFOA 2CDFB 1TTUA 3D25B 2D2CC 3LXAA 3H9YA 5D1ZC 3D33A 1WG3A 5ALCH 2YD6A 1PLGH 4H2CA 5DD3L 3UL4A 3WYRA 2JNZA 1XB6A 3CFKB 2PXYB 1NFKA 5F7KC 4MA8H 2DWDA 4H26B 2DRUA 2YKLH 5HDBF 2FQDA 3RIFK 3ZU8A 1I7UB 4G7VH 1GYVA 4KJWC 1IAIL 1F11A 5CHNB 3L7FB 2HVJA 2RGSA 4WFGE 3QFGA 1BIIA 3N9GH 1ZE3H 2FO4A 2IAMA 2YXVA 5ESVB 2X42A 5GGVL 4LU5H 4P46B 4WO4D 2OXHA 2YJQA 4YAQB 4JHAH 1NUFA 1UH2A 2VLLB 1GS8A 3VFNB 4NJAH 4K7PH 3K2UH 4TSAL 3W5NA 1KGUA 4JAMA 4DKEH 1LYQA 3LRMA 1WA2X 1LK3L 1FZOA 3QZWG 5L6YL 2G2PA 2Z92B 4Y19D 4HS3A 4IMKA 3RHWF 3HC2A 2P5EA 3GKZA 3A4EA 3NDYE 5DEFB 4RISH 4YFLI 2ZCZA 5DZOA 1AOHA 3P4MB 1PZDA 5ALCL 2P47B 1A3LL 4ABQA 1PLGL 3CDFA 3LNIA 2OI9C 1XHHA 2WNWA 5C0CA 1G7IB 1QRNB 4XWOC 3WIFA 3F7RA 4BKLB 3AQYA 3OMZA 4MA8L 4I0PB 2YKLL 3EO1B 4TUUA 4G7VL 1TITA 1DN2A 3WHXA 3L8QA 5H4ZA 1FHNA 2VDKB 5CZXD 1P5VB 2F74B 3WN6A 1Z9SB 3BIBX 3QUMB 2Q10A 3N9GL 1S78C 4LU5L 1FL3A 1FVEB 1Q8MA 2MPVA 3BVDB 4JM4H 1I3RA 4JHAL 2F53B 1S7RA 3VXTB 4QHLB 4K7PL 3K2UL 5E6RB 1E3FA 3HMXA 4XBGA 4DKEL 3VFWA 4C8XA 3OKMA 5D7JC 2ATKA 3GRBA 3AU1B 1OPGH 4HCGA 4ODVH 4BRJA 4APXB 4CJ1A 4BXVA 3T3PE 1IAOA 3I50H 5SX5H 4RISL 1WBXB 1E0OB 3UXFA 1ZLWK 1J0HA 5DHVB 2DAVA 5T33H 1KBBA 2Z31B 3OHMB 4U3HA 2AMUA 5DA4A 4MA7H 4DZ8A 4DZBA 3BH8A 4X6CA 4Y4FC 4FNRA 4JFVA 1E28B 2NRDA 4ZFOA 1ID2A 1RHHA 1YAIA 3H9SB 2WC7A 4U2ZA 4XMKH 2RH0A 3IDIB 5EU4B 1JI1A 2YUVA 4L8BA 2WIIB 5DJ0A 2OSYA 5T5FH 1IJ9A 2OCCB 4ZMZA 4M4RB 5B1CA 3CH1B 4B41A 5B3SB 4JM4L 1S9VA 5GZNA 5C0IA 1RJZB 1J9TA 5FGCE 4IHBA 1D5XB 3MBEC 3S8FB 2MNWA 3AZUA 3DTDA 4Z7OF 3ULAB 3UDWC 1BZOA 1NWPA 2ICEB 2LGNA 3E7JA 4EE2A 4ODVL 3HHMA 3VB8A 4PJDF 2EDBA 4ZXBB 3GJFA 3I50L 4M7JH 4XB8A 4R96A 3BHBA 2WQXA 4G42B 2CKBH 1HZHH 1UZ8B 4BSVB 3SDXF 4NN5B 1NM9A 5LXGH 5T33L 1PVHA 3PHOB 3EW3B 1FJ1B 3AQDA 3TEXA 4D8OA 2VSDA 4MA7L 4PRNB 2QHLA 4P2OD 1J5CA 1IX2A 1K8DB 1U8KB 2APWA 1R6VA 2YUWA 2EYTB 4DPAX 3O8XD 4OH2A 2OR9L 3KHOA 2I9LA 1KN4H 2EYRA 3V7MA 1FLTX 5T5FL 1R1CA 4EIZC 2K0RA 4IBYA 3TESA 5MI0C 4S0HA 4G8IA 4AENA 1IGJA 3L48A 5KTEH 1X5KA 2WTOA 1PG7X 5AAPA 3D05A 3BW9A 1MLCA 4IOIA 1SN2A 1GMEA 3HUJB 2VR9A 3ZHKA 1AKJB 2BC4B 3HS0A 4AGNA 5I30H 2ADGA 5LCVH 3W1ZA 3G6AA 1UD8A 4RRPA 2K45A 4HK0B 3FTWA 2K7PA 2DOCA 4M7JL 4DKFL 1UOWA 4RNRB 2CKBL 1HZHL 3JV0A 3CZFA 3LIUA 2X9ZA 4Z18A 2HLFD 3VM5A 3SGEI 2P4AB 15C8H 3GHPA 4X8JA 2V9RA 4PJ8D 3BVWA 3RQ3A 3L4ZA 1I8MA 4LEEA 4CVXB 1II4E 2EADA 3FU7B 2EEXA 1YPZB 5JO5B 4PJEB 4RMQA 2F58H 1KN4L 3L3DA 2K78A 5DJDB 4CSZA 3KXFB 1EIBA 1S7SA 2J1WA 5KTEL 5IQ9B 4KNUA 4ES8A 2ZXDA 4HGWB 1EVTC 4XPTH 4F2EA 1B3JA 4NKOB 4HOXA 2H47C 4XTRD 4JKKA 4IKLA 4MRBA 5LQBH 3MRIA 3TBTA 5I30L 1KCLA 1E9QA 1JNLH 3AY4A 4PJ7E 4IU2B 3QUHA 4JBSA 4OZ4B 3V10A 3P0VH 5E0QA 3DK2A 4MNQB 4MMYA 2XHNA 4XMLH 2JK5B 3MKKA 1RJYB 5KSBA 1GR7A 3TXAA 4PCTA 5GS1B 15C8L 2GK0A 4IOFD 1N0XH 5FYLH 3IMBA 3Q0HA 3G6DH 4G6MH 3CVHB 3MJ7B 4F5CE 4K73A 2VSKB 3FO9A 3RY6C 1E4KC 1W72H 2BSBA 3WN5A 3QDGE 3B43A 4ZMWA 2E9IA 2W81C 4FLQA 2XJKA 2F58L 3U9PH 4H88H 3C6LD 4L4VA 5I6NA 4UQIM 2UZXA 1T66C 1JZ4A 4KO6A 4JG1H 1UH4A 1Y6KR 5C07B 3TVMA 4NCC2 3SGJC 1Q4NX 1XL6A 2YPLA 4QAMB 4FFWD 4X7FC 5DJ8B 4B7IA 3VGFA 4LPVA 3IDJB 4KNQA 5CAYB 4XXDA 4UQCA 1TVDA 5LQBL 4LLWA 3OB0H 1O5PA 3V5DA 1JNLL 2PR9A 1UXMA 2ADFH 2XYCA 2C9QA 3FU9A 3MA7A 3P0VL 3LRSB 4P3DA 5I75C 5CP7B 3CTTA 3O6FA 5AOLA 2XC8A 1TTRA 4XMLL 3S8WA 3ETBF 4PJHA 4GAYA 4ZTPH 2ITDA 3O3EA 4H0LC 4ABUA 3HG1B 1N0XL 5FYLL 1KIQA 4QY8A 4WU7B 3G6DL 4G6ML 1N7MH 2HG0A 3X1GA 2G2NA 3OR6A 3DDFA 4H8WH 1W72L 3UP1A 4HLEA 2PCFB 2ZWLT 4GINA 3JWDH 5FYKU 2E7CA 3C6SA 3W0WD 1AP2B 4ELKA 3DI3B 3U9PL 5CEYB 1DJGA 1BJMA 5DJ6B 4JG1L 4NPYB 4I2XE 1FC1A 1S3RA 1HOCA 1C5BH 1DHKA 3L4WA 4J8QA 1HXMB 2BW5A 4B97A 3ZIMA 1K8IB 4IKIA 1R5IA 2ZP8A 4KJPD 3QDMD 4XRCB 4JFEB 2ADFL 2XFXA 3UGUA 2HFFA 3D0VB 4PRAA 3GK8H 3M86A 5D6CB 4AYEC 3ZE1B 5HYIA 2J72A 4M5TA 3AUWB 4ZTPL 1BOGB 1UADC 4J1UA 3BP5B 1TT6A 3H53A 4KI5C 4I48B 1N7ML 1FCCA 2ALAA 1KENH 2WKOF 2IPUK 1AO7B 3MRFB 3QQDA 2BNRE 1RUAH 4H8WL 4YSAA 43CAA 3O45A 1XEDA 1OAXH 4D0BA 2CE6A 2MQ0A 4NFCA 5B8CA 2YD1A 2HTLD 1N0LA 4NHUA 4QRRD 5INCB 1ZTMA 3UTOA 2E9GA 2DYPD 1QABA 5CS7A 4TVPH 4I9WE 3H0TB 3BZ4A 4RGNC 4YDNA 1LQSR 1MRDH 1QFWM 1QEWA 1HH6B 5DHMC 3UBXA 1C5BL 2MNJB 3TNMA 1KTRL 2B9BA 4G82A 5KG9B 3K1DA 3LQZB 4IGBB 4YFLF 4XC3H 3X1FA 2G0LA 3MLVH 2AHIA 3ZHDA 3RIFF 1CFVH 2NPLX 1KIRB 1UURA 3QFDA 5B3JE 1OP5K 4KMQA 1TVHB 3I6SA 4K0OA 3GK8L 1HK6A 4JFFA 2BNQB 2BSEA 3DHUA 3MGOB 3GTVA 4GUPA 4YGVA 3IFNH 4JFYB 3E80A 2YOCA 3DGGB 4DQOH 1N26A 4W1TA 2I24N 4J3OD 2HFEB 1KENL 1KYOJ 1RUAL 4CN6A 5I26A 3IE9A 4F80A 1OAXL 4O2CB 2EDFA 2VN4A 2AK4A 4JZOA 3VD4A 1K2DA 1KLUA 1X7QA 4TVPL 2OW6A 1MRDL 5H37H 1E8YA 1KZQA 3MCLH 2ZUQB 3EUDA 4CN1A 2J1XA 1I4FB 4XC3L 1ZPLA 1NMAH 1TLMA 5IREA 5IY5B 4X99A 4GO8A 5DFAA 1G1KA 1CFVL 4WK4B 1AY1H 3SYQA 5JXED 2PXYD 4PJBE 5D2LF 3QJVB 2PWFA 2NY3B 3P3RA 4NT6B 4W9LC 4KJQC 1CXHA 5HD8C 3X3FH 3SDCB 2RAMA 3V2AR 4N2LA 3BVNA 3TA3B 2ZYRA 2XXMB 3IFNL 3WD5H 3WEBA 4DQOL 3SE8H 4P46D 5FO9A 5JUEH 4ZRGA 1SHMA 1FZKA 3QEUB 4R5TA 1BQUA 2PP9A 1GOGA 3GEWB 2CO1A 3HFFA 3VM7A 3LKNA 4ZFZA 1W91A 4G9DA 1EUUA 4RFEB 1PKOA 3CFTA 1JWSA 3IDNA 1Y18B 3AT0A 4P5MA 3MCLL 2IBZY 2F7OA 3RVTC 3NCWA 5EG6C 4O02A 1S7WA 3X2QB 1NMAL 1XGPB 3C5JA 3QUKA 3FRUA 3ATAA 2UYLB 3PV6A 1AY1L 1QRND 1XZWA 3MYJB 4FTVE 4I0PD 4X0KA 2IGLA 3FPXA 5CN1A 5TE4H 3MRMB 4NUJB 3X3FL 1TFPA 4H25A 1T5WB 3HBQA 3DUUA 3CNKA 4D9RE 4OD2B 3C8DA 3F6LA 3WD5L 4JFOA 4P4KB 4X6FA 3SE8L 1NC2B 2PO6B 4KTDH 1X5IA 4Y19E 4FRWA 2YA0A 1K5NB 2LVEA 4XNBA 2OMBA 4DO4A 2Q3ZA 2R0ZH 4R5XA 4XXWA 5I73B 3MV9E 1LWJA 2DM2A 4R0LB 3KPLB 5TH2A 1H9VA 3S6CA 2X4NB 4UV4H 2EE9A 1BW8A 4DHLA 3WS6A 2IH3A 5C2UB 1IM3A 5KYYB 3H9ZA 4KKRA 1NQBA 1MLBB 3W39B 1J5IA 3BC9A 2H2PD 3ZDZE 4HEME 1EH9A 2DQTH 2AJYH 2Z31D 4XCNA 4AVIA 1G7PA 1P4IH 1PKQB 3CC1A 4RAUB 4KRLB 3S34L 4HQQH 1GOFA 1NFDF 4KJYA 3BKJH 1U6AH 2WQUA 2MQGA 4JFHD 4XXCC 5TE4L 3TBWA 5I1EH 3H9SD 4K2UH 4A7QA 2W59A 3ALXA 3F5WB 3P3TA 1UGKA 4IBUA 3Q5YA 5CZRA 2I69A 2OXHB 1BOYA 2YO3A 2UXVA 2WTRB 1YMMA 4LPUA 5D55A 1ZLWH 1RZ7H 2R0ZL 3NFPA 1SFDA 3K3QA 4YFEA 3L5JA 1LO0H 3T77A 1R46A 4XP9H 2B16A 3EOAB 3V4PB 5ITBH 4UV4L 3X13A 3TCXA 3OMNB 4XC1H 4WFFD 1VKXA 1TZHB 1G1YA 4PRPA 4ZXBD 4MMXC 3R0NA 4ZX5A 2NY2C 3P4NA 2H0PA 2DQTL 4W93A 2AJYL 4JN1H 5LG6A 1RSYA 1P4IL 3G6JA 4XGZB 3WIFB 5FLVA 3E1ZA 3N91A 3QHFH 4HQQL 1ICTA 4R7DB 3SPVB 3EDDA 3THMH 3RVUD 3BKJL 1M1XB 1U6AL 2KHAA 1O7DC 5I1EL 3WJMB 4G9FE 1T20B 4K2UL 4L8SB 5HVWA 1NICA 2R59A 3GXUB 4BA0A 1BZ9A 2PCXA 5DLMH 5I5RA 2BSCA 1S7RB 4FI8A 3IDMB 2EE2A 4ELDA 1RZ7L 1AKJD 4WI8A 4R97B 5DZAA 1LO0L 3OKMB 4XP9L 2DH3A 3B6SB 5ITBL 1KGCE 2ATKB 4N28A 3QYCA 3I6GA 4XC1L 5JW4M 2RQEA 2PTTB 5JZ7D 4XX1E 1EO5A 1T1XA 2A6JA 5EO1B 3FT3A 1SXAA 1MW3A 4ONHA 4GG6F 4J12A 4A67A 5IKCB 4JN1L 4NGHH 2EIZA 1KCSH 4XNQB 4YHNA 3MYZA 5B7FA 2EUVA 2WNXA 4CSSA 3QHFL 4I3RH 4OIBA 1WWCA 4JKWA 5EC1B 3O9WC 1JJUA 1NIAA 4CGTA 1U3JA 4MSWA 3P9WB 3L3JB 4L8BB 5I8OH 4IJTA 4UNIA 3TBSA 3KXFD 4EO5A 3WJLC 2CG9X 1AR1B 1QASA 1XIWC 5DLML 4Z7IA 1SJVA 5T8IA 5DU7A 1TXKA 3G3LA 3K6SB 5KAQF 2ZOOA 2OMXA 4RMBA 3WDHA 3LAFA 4FG6C 4NBYB 3UEZA 1HCFX 3LCYA 1ASPA 4ZQKA 4GXFA 4LEXH 3O3DA 5D7IF 3V0JA 2QKIA 5EN2A 5IWLA 4GSQA 4MNQD 1AGBA 3AXLA 3WDJA 4R96B 5HHOB 2ZOUA 5FAAA 2OR8A 4GH7B 2XQ0A 4JN2A 1GGCH 3KPRE 4H40A 4XN7A 3N2JA 4NGHL 1KCSL 1XMEB 4LSVH 4LVEA 2HG5B 2J4WH 2P8PA 4G8AC 1FPTH 4I3RL 1AS7A 4AJ0A 1U8CA 1KPVB 5EEXA 3QAZB 2BHUA 1Q9WB 2WYTA 1KXQA 3RWHA 3E6FB 3D7PA 2E9BA 3WLWD 2WXHA 3V6ZB 2J25A 2EYRB 5I8OL 4K5NA 3TFBA 4X7SH 1B9ZA 2X53A 1IGJB 4QRQB 5C07D 4KZDH 4PRIB 4A66A 5T3ZD 1MLCB 2HX9A 4JJ5A 4HUMB 3SPJA 1FFTB 2QR0B 3M46A 3HS0B 2NXZC 3MREB 2EIKB 1ZXKA 3O2DA 2CPUA 3G6AB 1JPFB 1CU4H 5IUCA 4N20A 1ZA3A 3EFOA 4GI9A 4BZ1A 1H6UA 2APFA 5CD3B 5JDSB 4YSEA 1GGCL 5DFVC 3HG1D 4XN4A 1ZSDB 2AVFA 2LAAA 2MTAA 1MW1A 4LSVL 2VN5A 3AQXA 1FPTL 4PLJD 1YMHA 4DGYH 1I8MB 3F83A 4DVRH 2IANA 4KI5F 5I17A 1YYLH 3CHOA 3GUFA 3BH4A 5DQ9B 1EJOH 25C8H 3R06A 3RB5A 3L3DB 3GSXB 3JV5A 4X7SL 2OMUA 1NUNB 2VQ1A 5IB3A 4KZDL 1UM6H 3RUGB 3TJHD 1E9OA 1HEZA 3I3DA 3BFWA 3TO2B 4LOEA 3JT2A 3LN5A 1BMGA 1SXBA 3VGGA 2FZ3A 2ZSWB 4U3SB 5I74C 4F7MA 3MA9H 2IEPA 4MLSA 3MRIB 4X5RA 3L3HA 1E9QB 2QSTA 4JFED 2ZOLB 1CU4L 4MJIB 3UPRA 1VEMA 4L18A 4J3SA 1J88A 1BAFH 1GOHA 4OLUH 4KXDA 4DGUA 2R29H 3CLEH 2GJ6B 3P4OB 4GKSB 5E1HB 2C4FT 3ESOA 3B34A 6TAAA 4WI0A 3FS9A 4IK6A 2WXFA 2FT7A 3KDMB 1AO7D 3D6GA 3FO9B 4U1KA 4X83A 4DGYL 4DVRL 2GTWB 3DVFA 3QORC 5T1KB 3WN5B 1JNNH 3ZGIA 1YYLL 4OFKA 1W8NA 1EJOL 25C8L 1MQ8A 3VXRA 3U6RA 2UZXB 3U0WH 1DUYA 2X12A 4OIAA 2ALWA 1UM6L 3BDYH 1F97A 4LSDA 2NNXA 2WO3B 4NKIH 2G4GA 4IGBD 4EN3C 1UZGA 3MA9L 1LE9A 1CFTB 3V5DB 3PWPA 4L8CB 2TSBA 2ZE0A 2COQA 3MA7B 4E0RB 4L48A 1CN4A 1BAFL 4OLUL 2BNQD 3BWAB 5JHBA 2R29L 3CLEL 3HB3C 2JKNA 4ZO6A 4ANXA 3DV6B 4LBAA 4MCZB 5D1QC 4XP6H 3SN6N 3KLHC 1DEDA 1KXHA 3LEYH 1DLFH 2BWDA 5DMGD 1QWNA 4KKCC 1JNNL 3GHBH 1S2EA 4MBRA 1OE1A 4GRWE 4Y5YA 4ELKB 3L2MA 5IEHB 1SY6H 1JV2A 3PL6C 4QWWD 3U0WL 4HETA 3WKNA 1MHEB 5TDPB 2NTFA 3BDYL 4J2XA 1HOCB 4QEGA 2RB8A 1I1YB 4NKIL 4N8CH 4PJGB 2ZP9A 4JG0H 1KLFA 1OW0C 2G30A 2P9RA 3OJMB 4TPRH 1AAJA 2NY3D 2WINA 4E5XA 3U82B 1QLEH 4WWPA 5KYWA 3K71B 2VQTA 3SDCD 4F9LA 3TA3D 1H0DB 3ULUE 2GJRA 4ZYKB 1DE4A 4J1UB 4X9BA 1Q72H 3FHQA 3WNNA 1JGDA 4XP6L 3FRPB 3QQDB 1YN7B 3LEYL 1MWAB 1USZA 4L5FE 5FF6A 2EDLA 1DLFL 3CZUB 5D7LD 3GHBL 3S9DB 5J3HC 2DDQL 4L3FA 4LLDA 1F2XK 3QUZA 5KSVB 1OEZW 1N0LB 1CDCA 1EBAA 2OKMA 3HJ0A 3FUMA 1SY6L 4E9WA 4CN4A 4UM8B 3F7QA 2VWEC 1S5IH 3BEWB 4NC0B 4UT6H 2CWRA 1OAUH 2HJFB 4I1NB 1OE2A 3TYFA 3RTQA 3MMEB 1N67A 4ZBJA 2Q8BH 4KKLC 4N8CL 4DWHA 4JG0L 4NUMA 4QHNB 4ODUA 4HG4J 1TENA 1M56B 1K3ZA 3PNWB 1WAEA 2AV7A 4M8RA 4TPRL 4ZAKA 4ZUTA 4BUHA 5CIPA 4LDLB 4X5WA 4YO0B 3ETSA 2Y1ZA 3GBLA 4X7TB 4XN9A 1QLEL 2F1BA 2ZONA 4I13B 4Q6YA 1AXSB 4LZKA 2ZNWA 1Q72L 3EJQA 3PPSA 5KS9B 3CN1A 4P4KD 5MEQA 1NC2D 2PO6D 2JKJA 1E5AA 1RZKC 2H32H 3ME0B 1ZAGA 3GSNH 3H8NA 4CU7A 5K59F 4DN4H 1G7JA 5F7AA 1D5BA 3QQ3A 4HGMA 2NY4B 3BH9B 4OW6A 3EZ8A 1NPJA 1KLUB 5F89A 3IBEA 2WQRA 1KCVH 1S5IL 4UT6L 1CDUA 4OZIF 1OAUL 3CN0A 3CSBA 3T6WA 5JW4N 1I8LC 3BAJA 4MQSB 4ES9A 4LEOA 1M9WA 2HT4D 2J21A 2PNDA 3UTQA 2QT6A 4OCXH 1M6OA 4XP1H 3A5VA 5JHDA 1N59B 2FBJL 2NY5C 4WHYG 2W60A 1RFDH 2W07A 1I75A 1WISA 1LP9B 3Q2CA 5DJYA 2F53E 3MR9A 2IWKA 2K4WA 5C0BE 1TEGA 5HBBA 2WZPA 1DANU 3SKMB 1X5LA 3OAYH 4NCC1 4QRUA 5E8DH 5EFIB 4YUEH 1MCPH 3ZMEA 3RVXD 3O3BB 4I0KA 3V4UH 1FZKB 3SDDC 2VNCA 3GSNL 5CJOL 1DUZA 2P7TA 4AMKH 2R2CA 4AIOA 4DN4L 2IPKA 4PJ9B 4WRLA 2Z35A 3QXDA 4ZFZB 1L3NA 2DWXA 3MLWH 5FEBA 1YNTB 2ITEA 5E6YA 4NKQB 4XNXH 3BZEA 3QJOA 4KTGA 2WKOA 3MV8A 3PAYA 5E2JA 4UAOB 3Q48A 4N0UA 3BQUC 1KBKA 1NKOA 1S7VB 2VW4A 3QS3A 5E2TH 1G6RH 3H42H 3WSQH 1MFVA 1A9BB 3BYTA 4NRXB 4TQEH 4Y4HA 2BHYA 2JB6A 3VD5A 3QUKB 4OCXL 3UEQA 4XP1L 1PZ3A 4FNUA 5IVZA 4UQAA 4L1TA 1CICA 1ZANL 3A4DA 3H85A 4QRAA 2GHZA 5F9JB 4E9LA 4FQXA 1RFDL 5EV7A 4K3DH 2Y7OA 3Q9QA 4PJ6A 1I7ZA 1JPST 4JCMA 4WAFA 5BV7H 3ARWA 3FTZA 4TUOA 4WIQA 1NBQA 5E8DL 2I25N 2QPDB 5D1ZA 1GC1C 1HSAA 1MCPL 2E6QA 1ZVSA 2Z7ZA 5IVOA 3V4UL 1JHTB 4K55A 5FO8B 4AMKL 2C9RA 5HY9A 3ZL4H 4ZMVA 3MLPA 2F8IA 2ESVA 2IDSA 1DQVA 3MLWL 4K94C 3QQNA 4F58H 1A02N 1LNUA 5DSCA 1TQBB 1T83C 4NZFA 4P23C 3CE1A 3GJFH 5A2IH 5E2TL 1GZPB 3AXIA 1QPPA 1G6RL 5SWSA 2FYYB 4QRSB 3WSQL 5CD5D 1JNJA 4TQEL 2CRYA 5F1SA