4AVKA

Structure of trigonal fimh lectin domain crystal soaked with an alpha- d-mannoside o-linked to propynyl pyridine at 2.4a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
publication title The Tyrosine Gate as a Potential Entropic Lever in the Receptor-Binding Site of the Bacterial Adhesin Fimh.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 36
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4avkA00
4J3OH 3JWNG 4X5RA 5FWRA 4AVJA 3ZL2A 4XO8A 2W07B 5JQIB 4XO9A 2UY6B 2UY7B 4AV4A 1N12A 5CGBA 5AALA 5IQNA 1QUNB 1UWFA 4XOAA 4AVIA 5AB1A 4AUUA 4XOCA 1N0LB 1KLFB 5LNEA 1PDKB 2WMPB 4XOEA 3ME0B 1KIUB 4AUJA 5FLUA 5IQOA 5IQMA 4AV0A 4XODA 3BFQG 4LOVA 4CA4A 4AVKA 2J2ZB 4ATTA 4AUYA 4CSSA 4J3OG 2JMRA 4X50A 3ZL1A 3JWNH 5F2FA 5F3FA 5FX3A 4AVHA 5ABZA 3MCYA 5LNGA 2VCOA 1ZE3H 4XOBA 4X5QA 4X5PA 4J3OF 4BUQA 5FS5A 4CSTA 3JWNE 3SQBB 1TR7A 3RFZA 2JTYA 2XG4B 3BFWA 4AV5A 2XG5B 3ZPDA 3BWUF 5AAPA
chains in the Genus database with same CATH superfamily
4O58H 5EO1A 2JCCE 3QHZL 4LLWA 3NMEA 2OK0L 4RNRB 3FFOA 4M1GH 1FV1A 3QULA 5LDUA 2QPFA 4UNUA 2PYEB 2Z31B 1JGVL 3WIHL 5GS0H 1VEOA 2XWZA 3W2DH 4XBEL 2EDQA 3AY4A 3FSWA 4PMFA 5B1AB 3L3DA 4NKDA 5HDWA 2Q76B 4U1GC 4LSVL 1EZLA 5C0BB 5CEZH 1QMUA 1EZVX 3S8FB 5KSUA 2UY6A 4PJAF 4KKCD 5IQNA 2C3HA 4WFFE 5ADPH 4EVNB 2NUTA 4HJUA 2F53E 3SBQA 2Y4SA 3LDBB 1P1ZB 2WUBH 3QRLA 1Z32X 3AVEA 2E27L 1T1ZA 3ETBJ 4PBXA 4QWWC 4WSGA 3NSXA 5FUOH 5EOCL 3FULA 3W1ZA 1GW0A 1S5IL 2UUDH 5LCVA 3AQYA 2ARJQ 3BO8B 3X14A 1YN7B 3P9WB 1ZPLA 3WDHA 5HXMA 3I9IA 3HZMA 5A2JH 4NC2B 1D9KD 3KS0J 3FHQA 4XPTH 1FH2A 5ECGA 1E28A 5I0WA 2IH1A 5TE7L 4NQVA 3WKMH 4YE0A 2XICA 4PJ9A 1QSFB 5L4MA 1O5PA 3DGGA 4HUNB 3ZIMA 1OK0A 2HG0A 4U3SB 43C9B 3TA3A 4ZK8A 3SODB 4DZBB 1WISA 5HHPA 3TTSA 1XWVA 1QFWL 2H26B 4QRSB 3O3AA 4DH2A 1EO8H 2BS8A 4NUJA 4WJKB 1JHTA 5I82A 3ARWA 1HCFX 3ZKMC 2VN7A 4E68A 1U8KA 4HFUL 1MWOA 4NB7A 5I6XC 2RH0A 2FX9H 4LCYA 4PJCE 5D7LA 3EADA 1PCXA 2A9ML 3LV3A 3OJ2C 2XJKA 4U1KA 2H3XC 3V5KA 4PWGA 2OYMA 3N43F 4I3GA 1CL7H 2RGSA 4K3GA 4W9EC 3OAYH 4WO4D 1CXEA 3PV7A 5F7YC 5KYNA 3MOAH 4ODBD 4LSRL 2Y5EA 4M62H 2O93L 2CDGA 5C0AE 1D7FA 3UYPB 4TLTA 4NIKB 4JDZA 3WE6B 5I15H 1ZLUK 1OW0A 2YD5A 3UPAA 4X5XA 2NOYA 4K71B 3HC0A 4PFEA 4PRDB 3TO4D 5LXVA 2XIBA 4HGWB 1H3PL 2XWBB 2X9ZA 2HKAA 4HX1B 3P73B 4C4BA 2NNXA 2I60L 1IM3B 3BXNB 1NAML 3MHZA 3NGBC 4JFZH 4N8VA 4OTXH 4ZUWA 4EUPB 3VDBA 3SDXE 4U4IA 3JTSA 5KYYB 3GLDA 1E90A 4FI8A 3QSKB 1C8PA 4F92B 2PCPB 3CHPA 3MNWB 4D9RE 1C16B 2FWUA 4KKBC 1AC0A 5D1QA 4YL9A 2HMID 4X6CE 3RVXC 4L5FE 2QDWA 1FHGA 5FHAL 4DQOH 1T0NB 3K3QA 2V7NA 4IGBC 1DZ0A 4L0PB 3FB6A 4HJSA 5C0FA 2HT2C 3UTTD 2IEPA 4NKIH 5MEOB 1E9QA 3INUL 3QI9C 1MKFA 1HOCB 1JIBA 3MUGB 3O3BB 3MRIA 1P4IH 5DHMC 3PV6A 4R4ND 3KHOA 4DT2A 4Y2OB 5I1HH 1J5DA 5EO9B 1A6ZA 4GBXA 5GIRA 2A73B 1XGUA 2CBTA 1R5VB 4NT6B 5DD1L 4QRPA 1PGRB 4WI6A 4GUCA 2X2UA 5I8OH 2DDQH 1RH8A 2WLJA 3OKMB 3MGTA 7CGTA 1V10A 1EX0A 2EDDA 3IVKB 1JDDA 4RGNC 4H25B 3QQ3B 4LOVA 2Z7YA 1BQLL 1ZV5A 3FZUC 3GM0A 3QZNA 4ZW8A 3X1NA 2OJZH 2WXKA 3OKNB 5FUCE 4OSUH 2WXHA 1A7RL 3U30B 2MQ0A 3DJZA 5E6SB 5SWQA 3UTQB 1AGCB 5KAQF 1KSRA 1OP3K 1JDCA 5E51A 3JVFC 4BSVB 2LR4A 2VN6A 3CHXA 3HN3A 5PAZA 1DL7L 4ACPA 3T0EC 5EU7E 1CFBA 5EZJA 1A1OB 1QEWB 4WWOA 3BGFB 4L4TD 4M6OH 4QKXB 3TN0A 3BMWA 3U9PL 2FECI 1D5RA 2NY0C 3ARBB 5GSRB 4PB0L 3NPZB 1MCLA 5ITFB 3GSNL 4ONGH 3GKWH 1EEYB 4ESKA 3KLSA 1JPSH 3KPLB 3MI6A 4XNQA 4XNUL 1TYJA 2AQQA 3F7YB 4Y5YB 4YEFA 1LO0L 4FFYA 3FRPA 1CTOA 4OJFL 3U9UA 3BD4A 3TO2B 3RWHA 1BJMA 1J87A 3RA7L 2AJ3B 3PHSA 5FS5A 3VWJA 3QHZH 2IQ9H 4R9HA 1ZA6B 4W93A 5SWZE 4JJ5B 1TQSA 2JKRM 4IMLA 1L4IA 1SN5A 4YHZL 3VCLA 1MHCB 3EJTA 4XVJL 3RX7A 4B5ZA 1I1AD 4G6AD 2EVFA 3EGDB 3CN2A 1AGBB 4MNGB 3CFDB 4RMUA 3HZYA 3P0YL 4F8QA 3ISRA 4FCHA 5J6GA 3ZT7A 3FKUS 3A21A 3HPJB 1LEKB 4GG6B 2YRBA 5D7IF 5AVXB 4Q97A 4UQCA 3R06A 4GAFB 1AKJB 3BJ91 5D1ZC 5JNYA 3B2VL 2WWOA 4IBUA 5EEWA 1UQSB 3FCSB 5K9KA 3SQBA 4G80A 3H53A 1DFXA 1F90H 3OV6A 2JK5A 1ZJAA 2VITB 3F7QA 5IW6B 2JB5H 4M7JL 4H5SA 1JZ3A 3H9SA 2WQAA 1L6ZA 1EGJL 3CZSA 1MFEL 5TE7H 3SY0B 2D4DA 1IIKA 5MENB 4PGBA 3Q8CA 3MTXA 3BSHA 1G9MH 2PUQT 2HVKB 1PZSA 4QUOA 2R2BB 4QXTA 1D5BB 1Z3GL 4WTXA 1EJFA 2N7SA 3T3MB 1YUKB 2PWEA 1MXGA 4WWKB 5DJ8B 4UILH 5HPOA 3C5SA 1NC4B 2YQ3A 5MEPA 2XKSA 5EC2B 5A43C 2OLDA 4ODTL 4ZMLA 3I6GA 3SGDH 2HTKD 3D4GA 3H9HB 2A5UA 5LXGL 3GC3A 3BOVA 2ICEA 4X0NA 4C58B 1QSVA 4L9LC 1NMCB 1DBML 1XGRB 1N59B 3WKQA 5KUKA 4LFHG 1SVZA 3T3MF 4WU7A 1FSKB 1X7QA 4LQFL 1HI6B 4H1LB 5ID1A 3QEQE 2HFFB 3EJJX 4NC1E 1G0XA 1UHVA 4FERA 4PJDB 5JDJA 4GLRI 3DDGA 3TVMA 3VXUE 1A4AA 3ZE2E 1KGJA 1WS8A 2K0RA 2OR8A 4CILA 4XC3L 1JZJA 2Q20A 3TM6A 2ID5A 2EZ0C 4M93C 2ZOLA 2APTA 2UXFA 2E4FA 2EABA 3HVNA 4ZTPL 3LY6A 1KWGA 4LHUB 1INDH 4Y4HB 4F7MB 2P5WD 2TAAA 3QNZB 1SVBA 1T6WA 2E7BA 2FJHB 3L17A 4TVPL 3ATAA 1SN2A 2YD1A 3K4ZA 4GMSL 5EU6B 2ZOUA 4Y9BA 2FYVA 4R2GC 4XAKD 2B3IA 3JUYA 1FIGH 4ZODA 1WFTA 3W39B 3VSUA 3DPDA 3VI3E 4KO5A 2JIXD 1HK6A 3GSOB 2DQMA 2XFGB 3RTLA 3WNMA 3ESNA 4KROB 4PCTA 2ZCKL 2XTJD 2YD6A 4JGJA 4Q6KA 3KWUA 5C9JA 3QG6A 1J5IA 4B5EA 3VM5A 3I85A 4V1DA 5FKPB 4OGAC 1BREA 2ZYHA 4X5WB 5AAMA 4EN3B 4X6DB 1GAFH 1T89C 2ZCHH 1OZTG 4H8HA 5K1JA 3OG6B 4HXBL 2VMEA 4ZTEA 1HINL 1MRCH 1Y1UA 2PYFB 3FYEB 1MN4A 4X7TA 1H8LA 5J0BA 1KLUA 1JYVA 1O6VA 3O41B 1U36A 4CC1A 2XSKA 3KPRA 3BLPX 4GMTL 1XH3B 4O5LH 3D2UD 4MXQD 1TLKA 3MQIA 3POCA 2W5PA 3UDWA 5EOTA 2WCSA 12E8H 1G1OA 4F57L 2D0HA 3MVSA 1A7RH 3Q6GH 3LKPA 4X6DF 4QLRA 3EYUL 3VH8A 4NDMB 4XOAA 1TZ8A 4OFPA 3ESMA 3HE6A 3WLWC 1IZKA 5I19L 4J2QA 3IRPX 4E41A 4GSQA 3K6IA 1PDKB 1XZ0A 3AGVA 3QUXA 4MQSB 1BPVA 3FC8A 4WDIB 2EH8H 4XPHL 4ORGA 4ZUUB 1N6QL 3ELAT 5EORL 5IM7B 3U9PH 4E0RA 4FD0A 2DLIA 5L4JA 1T22A 5TK4A 5GGSY 1D5XB 2QGCA 5IMLB 1X5AA 4PB0H 3IDMA 1UA3A 2EC9T 4NCC1 3GSNH 3FFCA 2X6CA 3MRMB 1NIAA 2E6PA 1S7WB 2VXVH 1YHPA 3HMWH 4QTHB 4XNUH 4ZMPA 5K59E 4FX5A 5EOQL 1C12A 3ZDZB 5F7UA 4YGVB 3RI5F 4F7CB 2CNYA 3FO9A 2J73A 4FXGB 5FB8A 2BP8A 4EZKA 4KKPA 3DVGB 5J9PB 3LEYH 2EUWA 2XYCA 3MRKA 4HT1H 3FOMB 4YSPA 5EC1A 4XBPB 2F19L 1Q9LB 5D2LB 2IPTL 3IETA 4N90D 5CSGA 1EWHA 3CAFA 1C08B 2VXQL 4KXZH 4OBSA 2VXTL 4HXAH 1CT8A 1KCKA 1WHOA 3OJDA 5EBWA 2QTVA 3P0YH 3RPIB 1TTFA 1FZOB 2R27A 1KCUL 3ZDZF 3BGMB 4JFHE 4RH4A 3ZKQD 3MLXL 3LRSA 4P4KD 1LO2L 2CIKA 3R19A 1E30A 3ZL4L 2FO8A 2ZUWA 3B2VH 2G5BB 1YLBB 3BAIA 4PGCA 3FQ4A 5ACMA 5DEZA 2X70A 4P5KA 5BW7A 5D2LF 2PR9A 4JQXA 5CBEB 3TXAA 1ZA3A 1TFHA 1DCEA 4HKBB 1NFDA 3GRBA 3GEFA 3GSRB 1EGJH 4P2OA 1FNLA 3FMGH 4C83B 1N26A 1NPJA 4MCZB 1T83C 2V3DA 4G6JL 5IJDC 1ZLVH 4B7LA 1DQJB 5F7NC 1Z3GH 3DTXA 1DBJL 3RWDB 5JXED 4UTCA 1UACL 2FE0A 3B7RL 4XO9A 5DJCA 4ZNEE 5INCA 1T0OA 1CS6A 3GXFA 5EPMB 4FULA 4WK2B 1CFVL 3FB8B 4ZBJA 3FT3A 4JKPL 2CK0L 5GGUA 2OMXB 3MYJB 4E9VA 3VFVB 3UTTB 4M48H 4ELDA 1KB5A 3ZUNC 2VJXA 1PQZA 2HKHL 2MHAA 3ZY7A 3UIYA 2AEQL 3T1FA 1HAUA 4HLJA 4AYFB 1WA1X 1DBMH 2WQXA 1SUHA 3VFRA 4PJXB 1X9LA 4LGPB 3QXTA 1KIUB 3CPLA 2VSCA 3OJVC 3VXTA 5IQ9B 2ERJB 1U0QA 4GI9A 4QNPE 1C7SA 3WTYA 1S7UA 1HWHB 4U3XA 1CD1B 3TEXA 4YHLL 3AG3B 3DUUA 1HJCA 1FRGL 3ARFD 2BZ7A 3MNZA 1M6OA 4LLDA 1U92B 5DEGA 1XT5A 2ED7A 2HPTA 1V05A 3IF1A 3O8XC 1RZFL 2EIZA 4E5XA 1U8QB 5HHME 5HI4C 4JRXA 1ETJA 4P99A 3RFZB 1CF8H 4PJXF 5EUKB 2JI3A 5I8KL 3WFCH 3AS3A 4QO1A 4YDMA 2AV1B 4WEMB 4GMSH 2I26N 1A9BA 1L5GA 1MQKH 1JOIA 4UT6A 2CCVA 3TCLB 2J12B 4BKLB 3F58L 3V4LA 1JPTH 1QQDB 4L4JA 4CADB 5CSZA 2J56A 3MRDB 4R0LB 5D72L 1JP5A 2UZYB 2ZKHH 4L4TB 1EUUA 2HPOA 3RJOA 3PQYE 1GGBH 3D6GA 4I3RL 3P11L 1MWAB 4ANVA 4AG4L 5I2IA 2XN0A 1FO0B 1NGQH 3ARGB 1QSZA 3DUSB 4J3OC 4FQLH 5E0FA 4G8GA 4RQQB 2VLRD 1FLTX 1QFUH 4HCRH 4QF1A 1SLXA 1XH1A 2WXLA 4JFEE 3BT2L 3OM3B 1KZQA 2ZOOA 3IDJA 4GMTH 1RCYA 4FI6A 5IVNA 3DMMC 1OT2A 1H15A 3BZ4B 3IDGB 4M5ZL 2DWEA 4DGUA 5I1CL 1BBJA 2PP7A 3KJ4B 4NO2B 1MCEA 1VIWA 4IK6A 2UXGA 1XBRA 2UYLA 4FZEL 1CICA 5E8PA 5FIEA 4N2MA 2GSIB 3EYUH 1BZOA 2JVUA 3BZ5A 5DK2B 2L04A 4OKDA 3EH2A 1ETA1 1WBYB 2Z1PA 3SKNA 5FV1L 1RU9L 1UWXH 4BK8A 1KGCD 1FH5H 2YD4A 5T3ZL 4XCCL 1EAPB 5IMKB 1KN2L 2WLHA 3VMOA 4WTWA 1ILSA 2CU9A 2VZVA 3T4AB 1OPOA 4R8WL 1MPAL 2FSEB 4TV3A 4XPHH 1RUKH 2QADD 3ZDXB 5JQ6L 2H47C 1M7XA 1RD6A 1NCGA 4Y4FC 1MCPL 1I7RB 4GNKB 5DT1L 3BVTA 4GKSB 4H8WL 1UB5B 4PYHA 2NY7H 4OQ1A 2AI0H 3VXRD 3HR5A 5DZVA 3H42L 1UZ6F 4UQAA 3WTVA 1PX8A 5I0ZA 1BXAA 3CFUA 4KH9A 2DL2A 5AB1A 2BH0A 4GKOA 1IEHA 3NFNB 1YDPA 1NCBL 2R1YB 1I1CA 4P23C 4ELKB 2IMNA 5L8KB 2E7LC 3IDNB 4HGMA 1T2QH 4HUWB 1Q1PA 1AIZA 4X6EB 4BEIA 3GHPA 3CFIC 3BP6A 3FU7B 3BKJL 2NW3A 3VM7A 2BVPB 3LEVL 5GS2H 5C0JB 2VUKA 2HJLB 1X6LA 3G08B 1SMOA 4PIBA 5GS1C 1EHNA 2V2TA 1EXHA 1QR4A 2IPTH 1HZHL 3BVVA 1KN4L 1I3RB 4HUUA 2VXQH 3ZO9A 4Z7NE 3GMOA 2VXTH 2EC8A 3Q05A 3TNNB 3K0WA 2GFBB 1KCUH 2IF7A 4JGUA 1ED3A 1U93A 1F6AA 1GKEA 3ZL4H 1X5KA 3O11B 4KTDL 5AEAA 1F00I 1MXDA 2JLLA 2QPDB 3BESR 1I75A 2A0LC 3WO4B 1DN0B 5JPMA 4NRYB 1WITA 1VKXB 4YPGA 4JQVA 5E08L 4KKAC 2YXFA 3LIZA 3MJWA 5LDSA 5IBTH 4GOSA 3SSGA 2JWYA 5E9DA 1WP6A 3FXIC 2XQ0A 5KJ7E 4KO9A 1VJSA 3FO1B 4Z7WB 4XH2A 3GNMH 1JVKA 2VIRB 3C8KB 5E6ZA 3S5LB 3WS3B 5IB2B 2FJSA 3ILPB 4FXKA 4A7SA 2V4LA 3PABA 3CN4A 1RP8A 4MJJA 5AB0A 1SFHA 4RGNE 1AE6L 1NCAH 3G5VA 5E99H 3RKDD 1IC7L 3HBZA 4OCSL 3JSSA 3CVDA 2ROXA 4Q52A 2EEAA 1QFWI 3VGGA 4KX9A 1CFVH 4YPJA 4JKPH 1BF8A 3VDAA 2VQUA 3G6JE 2JIXB 3GMMB 4Z7WF 3MRHB 1QWNA 2APBA 1A14L 2HKHH 3T0EE 2NR6C 2AEQH 5JW4Q 3TBYB 4AKQA 4F2ME 1NEZB 4BQ8A 5I1DA 2WXIA 3BH8B 4X2UA 1BLNB 4FQJL 2WCPA 2BCKB 2N59A 4DVRL 5I1EH 1UH3A 4QRRD 4NIYE 1YMMA 2K9UA 2GJPA 1J11A 1AQKL 1V7MH 4IEFB 3SDCB 4YHLH 2JKWA 2AK1L 1NBCA 1N3NB 1KPRB 1OGTB 4L0YA 3RY6A 2DBJA 2WD0A 1P84J 4ZW3A 3D2UB 3FB7A 1OP5H 1CFTA 5K9QG 4RBPH 5EDXA 3LEXB 1KY7A 1I9EA 3GSWB 3OHXC 5BQ7A 2UUDK 3CCHB 5F7AA 2DZEA 3L3IB 3EZ8A 2QVIA 5DXWA 3I3DA 2PNDA 4LO9A 3BPLC 2J6EA 2WKLA 3MJ8A 1AFVH 1JV5A 3L1GA 4UV7L 5J57B 4J1UB 1PD6A 2E0PA 2YO3A 2AQRA 5I17B 3F58H 4GRLC 1FYHB 4WO0A 4Y2DA 5DUPL 3CFKB 4B9KC 5DVPA 2VDLB 3D0LA 4V11A 5D72H 4QOKD 4PJEA 4ENEC 3JTTA 2QSVA 5AB9A 1HCVA 3GXTA 5F9WC 4NO5A 3EBGA 1DBBL 2VZTA 3TL5A 3PAUA 3ZTNL 1ACYL 4AG4H 3QAZC 3BEVA 1WAPA 2C34A 4BZ1L 3VWKB 1S2EA 4XWOD 2ZWSA 3D30A 1H3VA 4TQEL 4L3CB 4WNQA 1M7DB 4FQHB 4B3VA 2EVGA 4K3HA 4UTAH 4UIMB 1JK9B 3B2UC 3DO7A 5DGQA 3OAYK 2FGWL 1NKOA 5D5MA 5FDWB 2P42B 2I9TB 2D9QB 2Y7QB 1QD0A 3B7SA 3T2NL 3NOIA 4XBMA 5EU5B 5DS1A 5C0RL 1IFGA 2VMFA 3I75B 3Q48A 5JIMA 3BWAB 3PNWB 1OZUA 1ROCA 2A6DA 3GGWA 1RVFL 2ZYRA 3DROA 3P0GB 4LSUH 4ERSL 1EAJA 4D0BA 3K72B 4PRIA 2C5DC 2R4RL 5T3ZH 2DQJL 2KHAA 4XCCH 3VRLE 2Y72A 1KN2H 1X3DA 2AF2A 1OHZA 1MVYA 4WJG3 4ZOAA 3DBXB 1S4IA 3WNJA 4NN7B 4OV5A 1MPAH 1U95A 3MV9A 4FGMA 4P4KB 5DQJA 3RY5A 4MJ6B 5JZ7C 2W38A 4FLRA 1U8CA 4RDBA 3VXMA 2CJSA 3NEEA 5LJYH 1GGTA 5AYUH 2LGNA 2DB8A 2DTSA 1JF6A 1GMEA 3QNYA 4H8WH 3LPPA 3HHSB 3IJ8A 3KLHC 1GXEA 5ICXA 3QFJD 4Z7VA 3S8GB 3HHRB 4P5TA 5EMYA 2JH2A 3ZXAC 5I18L 2AK4D 3ROLA 4N2AA 4MA7H 5DGRA 3FT1A 1NCBH 3KZ8A 4HKJA 5C7XL 3G9AB 4L3EE 1AZVA 3LRHA 4Q74A 3VFUB 2PR4H 4MXVE 2BXYA 3OZ9L 1D6VL 1FAIH 2BIQA 2EYRA 4H26B 4EMZA 4XXDA 2EDKA 5CLYA 4U6XA 3LEVH 1J12A 1DJZA 2XPYA 5F9JA 1PY0A 4I85A 3RIFF 2UY7A 1FC2D 1K4CA 5EUOE 3S3JA 2CD0A 1UWFA 3NUKA 4KKLC 3ZZQA 1R4XA 1HZHH 4W70A 1CE1L 3Q2CA 4JO2H 4K73A 3RNQA 3E2HB 3TPUB 4CKQA 2A6IA 3GUFA 4JCMA 2MFNA 1KLFB 2G3ZA 5B21A 3ABLB 3HS8A 4B96A 2QVKA 1E50A 3KPNB 2H2PD 3KS0H 5DURD 3T09A 1XGTB 4JBSA 3KPTA 5CJXC 4HJJH 2O61A 2ROYA 5CO1A 2EVIA 3FPYA 5EU4A 4OD3H 1EBPA 3C08L 5FM4A 1A7BA 1XB3A 2X89D 3CBJB 4I9WE 2WYZA 5E08H 3N44B 3QXDB 3NN8B 5DUML 4I0KA 4EOWL 3EO9L 3U46B 4OZGE 4Q56A 2DI8A 1WYJA 3BGAA 4MYWB 3T8XA 2H32B 3ARFB 1FA4A 3FSVA 5KVDH 3EGXB 2E86A 4ODXB 4IRJC 5SX4H 4XWGL 4P4RA 3MLTA 3TT1H 1DSFH 3RTQC 3BP5A 4YDKL 1K6QL 5DHVH 5T5FH 4Y4KA 4Y5VB 1WICA 1P4LB 3ARDD 3P4NA 3N44F 1AE6H 4XVSH 2C4FT 3GB7B 1W0WA 2ZUYA 4KX7A 5EBLA 3ZQXA 3DC0A 1ZHNA 1P4BL 3T6WA 1G9EA 3G9VA 4CKVX 1JUFA 3F7LA 2OTWB 3F01A 4L29A 5JUEL 2DI7A 3K4DA 3RZWA 4DHLA 4RAVB 4YBLB 3T9WA 1PNDA 1J0YA 3N91A 1A4CA 1HFUA 3TC9A 1P9MA 5SX5H 3QQ9C 4JDEA 4WJ5A 4JG1L 4W9HC 1EFQA 1I85C 3LB6D 3VQ1C 1PVHA 4F3FA 4R5TA 4BCXA 4OFQA 1AMXA 5DFWH 3ES6B 4M7LH 1LO3L 4Y1TA 1P2CB 3NIFB 2VLRB 3NGBB 4JPWH 3FRUB 5D7JD 1AC6A 4MJ5B 4A38A 4N2OA 5HGBA 4FQ1L 1Q9WB 4G6ML 4LDLB 2OP4L 4P59L 5IGXL 1B9KA 3U2SB 3KPOB 5AAWC 1LO5B 1FNGA 2Y5TB 3RP1A 3CH8A 3BRFA 2ZUQC 5F93C 5I1IL 1E7VA 1WVZA 4KJPD 4OZIA 1X7SA 3ZHKA 3VXNB 1GS6X 4NQSB 5ITBH 4UV7H 5AG9A 3FTYA 5K9QI 4XCEB 3NIFF 5GRJL 5CJQH 2V9TA 2F5BL 4OZFB 4W4OC 4KMLB 4G1MB 3ATDA 4EZMA 1FE8H 2NY6C 5DUPH 2IWFA 4FABL 1IL1A 3ARPA 5FLVA 3MACH 2GK0B 2QADB 4FYTA 1DJGA 3SYAA 1DBBH 4EIBA 3B4NA 1ACYH 1FFOA 2YWZA 3HW7A 5HHXL 3SDAA 5DJZA 3RHWK 3UAJA 3G5YA 2IADA 1Y18A 1SOQA 3VXRB 1CVSC 4NI3A 4XOEA 1W15A 4Z3IA 3NRPA 4BZ1H 5CEXA 2P26A 3AFLA 2DWDA 1BVNP 4ZFFB 2B59A 2W60B 2BSCA 1HILB 3QJRB 2VRAA 3DGDA 2C1OA 2VL4A 4Z95L 1E9PB 2NY4B 2FGWH 2NY1C 1M7IA 3ZMEA 3ZKXB 3FTUA 4NPYA 3MV7B 2XTSA 4X6BA 1KTDB 4JAMA 4KRPD 3CSYA 3V0VA 4C4KT 5C0RH 2TRHA 4LEOB 1Q4NX 4KMQA 3LD8C 4ERSH 5J6SA 3WI9A 1JMZA 1GY1A 1MNUL 2WBJC 4O2EB 2NY0B 3O6ML 2PP8A 3DK2A 4X9HA 1MZYA 1AKPA 2BERA 2QV2A 4OVUA 1YVLA 3X1FA 5ISZD 1IGJA 1CCZA 4AT6B 2NY3C 2OV0A 3VFGH 3AU1A 2ISDA 1XQ4A 3NFSH 1XMEB 2Z1KA 2XN9E 2VZOA 5EZLB 4JFPA 1LQSR 4HJ0D 4WFGE 4WENB 4GRWH 4JFQA 2J3SA 4WV1A 1RJLA 1PX4A 1JNNH 2WNXA 3V6ZB 4AQZA 4HCIA 1NBZA 2GB2A 2GC7C 3L9YA 4Z5RB 2Y6SC 2VN4A 1D6VH 3A6OA 3NCJL 2DQEH 1L9NA 1DJSA 3OC8A 5F0PB 3COOA 1QRNE 4MNHB 1MCWM 5E2UH 5DJDA 1R75A 4MKTA 2MQGA 4KVNH 3KWWA 2IV9A 4RIRA 4R90L 1AGDB 1HSAB 2CJTA 2VDKH 1J9TA 2CHZA 2R56H 5CSBA 4CU6A 4RISL 3V0AC 3NJXA 2I9LA 1LK3L 2KQNA 5HPMA 3EO0B 2MNJB 2VB5A 3NPSC 1U4FA 4L37A 4N0FB 4OUUA 2Y1YA 1I8IB 1SJEA 3WMQA 5J3HD 3PGFL 1HE7A 1WUZA 3LSOB 4FXTA 4WY7H 5DUMH 4QRRB 5TQ0L 1JZ6A 3DURB 5DD6B 3EO9H 4GI8A 1BV8A 3BQVA 1Z9SB 4JM2A 1KYOK 1K5NB 7FABL 1K2DB 2GABA 4G9FA 3CNKA 3H6AA 1OPGL 2WY3B 4ZAKA 1RUPL 1ZEAL 4I18B 3GMQA 3BH9A 2IQAA 3K2MC 4AZ8A 5J1SC 4P2YA 4XMLL 2ZKMX 1TQBB 2XXCB 1IC4H 3HTLX 1TJHH 3WN6A 4UOZA 3FQRB 4X7SH 1ONQA 3EJQA 4YXHH 2Y06L 5HYJE 5LN8A 2CO6B 1I3UA 4IBTA 1YYLL 1HYSC 2NY5H 3GS0A 3MBED 2ALAA 4U1LA 5DHDA 5GHWH 3TYGH 5E0QA 1OB1A 3RDTA 5BRQA 2A74B 2XTJC 3U6RA 4QOKB 5I74B 5JMOC 5C3IA 4NNXA 2DQCL 4YHNA 3ARUA 3SDDA 4HPOH 2B9BA 1KGWA 4JG1H 2E6QA 1B9ZA 1NLDH 2YMXH 3KPSD 4F8PA 1SM3L 3J07A 4M61B 4NRZA 3GLEA 3GSQA 1GZHA 5DDHB 4TOYH 5F7MC 1TUPA 1YYML 1I3GL 4ODHL 1G87A 4TPRL 4X83A 1BZ9B 2CE6A 5FAAA 3WFBL 3GXIA 3QORD 2GJ6D 1UJ3B 3BP4A 4FDWA 4HHAB 4H1LH 3KXFD 4W9IC 2HFTA 4JO4L 2AABL 3EJYC 4P59H 4PJ5E 2IH3A 2R8SL 2HVJA 3C5ZA 2CKBH 4LSQL 4UQ3B 3QCVH 2QGEA 4AE0A 3WOVA 5BRPA 5D7IE 3ARXA 3BUYA 3CXFA 3STLA 3JXAA 2CK2A 4EUPG 5I1IH 2V3FA 3WFHB 3RPKA 1FZKB 5ESVB 5FYLL 1RULH 4HBCH 1RJZA 5JIKA 3KBEA 5IWLA 5DZPA 4GAJL 3Q13A 4GW1B 4JR9L 4RX4A 2A83A 3PPSA 3ZDYF 1F4HA 4JLRA 2WLIB 2ICWB 5EIIA 5JO5A 4NSKA 3I02A 4IOFC 4DF9A 1I53A 4BH8A 1ZLVK 2NDFA 5BOZG 1XGYL 2Z35A 3MN8A 3UACA 3AY4C 5IMOA 2XVKA 4PJ7E 4RMBA 4Z3JA 4ZOCA 1OM9A 3B34A 1AO7A 2WVVB 1OWWA 3QFJB 4H7VA 4K5OA 4M6AA 4J4PA 1E4KC 4NQCA 5FECB 1ZTXL 3MUUA 5AVSB 4FMKA 5HI5D 2VAAB 4I3SH 5TGBB 4JM4L 1E3FA 3DTUB 3AY2A 1BXUA 5KAQG 3R0MA 4MLIA 1FO0L 3WFDL 3MOBH 2KDGA 2YXMA 5DHVA 2J71A 4YVUA 3RIAK 4JFDE 2ICWJ 2CUHA 4LHJB 3GI8H 1NM9A 4AQ1B 1PZ3A 5B39B 1BVLA 3IAQA 2G4GA 4MAYA 4P5RA 3FHEA 3RJQB 5JIDA 2BRRH 3L4CA 1OE1A 1XHHA 5EBGA 4PRHA 4FOMA 3ME0B 1CDUA 1LVEA 2UX6A 4UOJA 2KPWA 2X7LB 2E8ZA 4KU1A 1OOAA 1OAZL 3CH1B 5DZNA 4PJ9C 2BNRE 5T3XD 5E03A 4BM7A 1Q72L 5GRVL 3FB5A 4J3XA 1F3DH 2PTVA 4RFOL 5DURB 3TA3C 4NM8L 4ODUB 5AKVA 3VFPB 1VGKB 1R24B 2DYPD 1FWXA 3HS0A 1XO8A 5B8CB 2WWMC 3NSYA 3T77B 1KCVL 3DVIA 5E6RB 1KMGA 1KJ2H 5F6HJ 2XI9A 1L6XA 3V0GA 1IAIH 4P2RA 2RALA 2NX5D 4F2EA 3HC3L 4I77L 1NL0L 4JHAH 1J5OL 2WW8A 4O4YL 3T1WA 2CPUA 3T0WA 4ZPVA 1ITCA 5HHNA 5T5NG 1S9YA 1PEZA 2VLKE 4N24A 4V33A 4LDCA 1YAZA 1UEYA 1QR1B 4QMEA 1N9PA 5IJVA 3PXLA 4IOIA 3JV5A 5FGBA 1PKQB 3ARDB 1OW0C 2Z3FA 1H8SA 1N68A 4EI6A 5H94B 4R90H 3SJVD 3H3PH 5DQDH 2XCMC 1FFTB 4PJGB 1JYXA 1ZJBA 2ZP0T 3Q0HA 4RISH 5L2KD 5LLIC 2PKDA 3D8MA 3OAZH 2AQ2A 3CXDL 1ECZA 1EDYA 4OIFA 3GKZA 5HVFB 3V5DB 3CDGA 3GRGA 4UTBL 5HHQA 4A6YB 1KT2A 4LLYB 1AYRA 3GIZL 3CZUB 1NDGB 5F88B 5D1QC 1CTMA 1UWXK 5JHDD 1UATA 4DESA 4TNVF 1TTGA 5HJBA 1Q0YL 3EHBD 2FJFA 1R3JA 1CLVA 3D25B 5D7JB 4PJGF 4Y16A 1T1XB 1GGCL 3DYOA 1JGEB 1F4XL 4M1DH 1OPGH 4A04A 4PJHB 3NJVA 4TN9A 3NCXA 3VTAA 1TSRA 3BAWA 1ZSDB 3ULUL 2IFGA 4XMLH 2BO0A 1E9OB 5B7EA 2VLLB 4GBXC 2FRGP 5GXBB 4F5CA 3O2VL 4X0KA 4UOW0 1QO3B 4J8RB 3FFDB 3WIFA 1YEDB 3HZVA 1OAXL 4LKXA 2BSRA 4PJBA 1UD8A 1YYLH 2EAEA 3CZNA 4CNIB 1B2WL 1PG7L 3VB9A 3OMIB 3VJ6A 4PD4J 4C56A 1AQDB 5KSVB 1FN4B 2BOCB 3BT0A 2YOCA 4TL5A 3UC2A 6TAAA 5IR1A 1SJXA 2W9DH 4HAGA 5E9NA 3F7PC 1SJMA 2E9WA 4Y89A 3W37A 4F7TA 5DSCA 3QIWA 4N0UA 1SDYA 3MGOB 4RAUB 5FOBA 2OMVB 2IG2L 2X9WA 1I3GH 4LIQE 1XSOA 1GYCA 1QNIA 2XNAA 2DQIL 3DX8A 3EYOB 2VDQH 3KCWA 3L3OB 3P40A 2ITCB 3QR0A 4H1LG 4OZHE 3VW3L 3S6CA 2H8PA 4FG6C 4LCWD 3MJ9H 3TN0C 2R8SH 3N55A 3CFEB 3L8QA 2P7TB 2Z93A 1A9EA 4I0PD 4LSQH 5DHYB 1RIUL 3PP3K 3MRBB 2CIIB 1F11B 4ZFZA 2Q6WB 5C6TH 4Y5XB 4ZXBA 1UWEH 5FYLH 2QQKL 4GJTB 3OX8A 3L1OL 3AS2A 3OBAA 2B08A 3EBHA 3UCRA 4BFIB 3O4LE 4GAJH 4HZ1A 1BX2A 1DVFC 4Z78B 1HNYA 3BQUD 3VWJC 4H88L 1T21A 5KVFE 4N22A 3MA9L 3WHE1 4NQEA 4AYGA 1HSBA 5GGRA 5ISZB 1WFUA 1FZJB 3MUY1 2YEZB 2MOVA 1AY1L 1JGDB 2Y2YA 2R29L 4JFFA 5CWSB 1XGYH 1HKFA 3LS4H 1NBYA 1BJ8A 1ZPUA 4EXPX 3BZEB 2EEFA 1J88A 4UMGA 2VDLL 4HA1A 4YDLC 5AOMA 1F56A 1A8JH 3HUJE 5BS0B 4ETYA 1KTJA 2WQRA 1ZIBA 2GQHA 4KBPA 3L5HA 5FM5O 4JM4H 3U83A 1UJTA 3I9AA 4MMYA 3ZKND 5C7ZA 5ERWA 1AR1D 1FO0H 3CHOA 1RJCA 4LLUA 4ZT1A 2V17L 2R0LL 3JWNG 3KYKL 3C2AL 3NA4A 3ATBA 1OGAA 2ICCA 3F5WB 5K5YA 1PZUB 2R69H 5CBAA 2P44B 5EIQA 3UO1L 4XO8A 3U4KA 5FGCB 2XFXB 1TJMA 4MX7B 4JHUA 3Q2VA 1WAAF 3MXWH 4MASA 4WNSA 3WAJA 3ABZA 3P4OB 4JEGB 3SO3B 5HYQA 1HXYB 1VERA 2BWIA 2WSPA 4FJYA 5GZOD 3L3HB 1T5WB 4S0HA 1EHXA 4OCRL 4KDTA 1NCNA 4KUZH 5IB1A 5F1IB 1OP5K 4LP4A 4NM8H 2D4FA 4RBPK 4U6HA 4BE6A 2NNCA 4IDJL 2CRIA 4X8JA 1HL5A 1XF5B 4UYPA 3U1SL 4PWKA 1ICTA 3K71B 4P23B 4ZUTA 1K4DB 2P80D 1QABA 4NQDD 1AIFA 1H6TA 3HC3H 3PF2A 1NL0H 3QVAA 2F74B 4O4YH 2NY2C 4WTQA 1LK2A 1VB9A 5JPNB 4Z7OB 2MPAH 2J2ZB 3EH3B 2W65B 4IRSD 2ICEC 1AJ7L 3CDZB 2RR3A 3FQUB 5I30H 4PJFB 4OD2A 4NUGH 4LZKA 4AENB 3GJFB 4I48B 3L48A 2F53A 1GTNA 1R46A 3QJXA 3TVMC 3BAXA 4A7TA 1FORL 3TBBA 2WZPD 3MBEB 2QHRL 4WHDA 2B2XL 2WTPA 2BJML 5DJ6A 3LS5H 1PCSA 3CZEA 4Z7OF 3ZBMA 5JORA 2WBKA 2XZQL 5DR5L 3LXAA 5IZ7A 1XCTB 3CXDH 1BIIB 3TNMA 4CVXA 4PJFF 3ELQA 3MJ7B 5H35B 3AAZB 1XB8A 1BCIA 1NZRA 1EO7A 2XY2A 5G55A 3KPSB 2ZIDA 4J6RL 5KANI 3QBTB 3KLKA 2CALA 2DI9A 4ES9A 3A4EA 2EDFA 4MCYB 4EXKA 3O6FD 1MHPL 1S78D 4JANA 3SN6N 4GSXA 1Q0YH 4X6FA 5K1NA 3QORB 3CVCA 4IJ3B 3UG4A 4NHCL 3PIQB 3SKMB 2GJ6B 2NLJB 1ZLSL 4M8QB 3FUJA 2FBJL 1GGCH 3KXFB 1XGPB 3N1FC 4H20L 1QATA 1JPFB 4LSSH 1LILA 3F64A 3GI9L 4YWGL 3ULUH 5I6KA 1P7KB 2QMJA 1ZT7B 2BX5A 4PJCA 3H7BA 3AREA 4IHOA 2AVFA 4PRPD 1I8UA 1J05A 2ADJA 2RMNA 1LLAA 4X5RA 2WBWB 1O7DC 2J8UF 3RILA 1KJMB 1R34A 1HHKA 4PW4A 3REWA 5LQBL 1A2YA 3BZFA 2EDXA 1QBAA 5KVGL 2KKQA 4EDXB 2CO4A 3LKQB 3MNVA 3UDWC 4J7RA 3V6FA 5LGYA 4G11A 4K3JL 4LU5L 3D12B 1J0JA 1OP4A 5JIIA 3QJFA 3HE6C 4XWOC 1KBGL 5ETUB 3SDXA 5FK9A 1ZDSA 3VFMA 2DQIH 3CGTA 2ZSWB 3LJ3A 2XQBH 3VW3H 3QUXC 3X3FL 3MCKB 5AYQA 2D3VA 4FTVD 5CGYC 2NZ9D 4HIJA 3DX9B 1QPXA 3OKKA 3R4RA 1VFAB 3D9AL 4IKKA 4N6QA 4Y1AD 2PWHA 3BRGC 5DQ9A 4Z0XB 3O6LL 1BFVL 2VABA 2QR0B 1CYWA 4I5BB 4F37F 2YD0A 2J8HA 2OQJB 3WO3B 5HYSA 3ARZA 3B9KA 3L1OH 2EYTA 4A2LA 2ADGA 5HHOE 5GGSB 2LU7A 1BMGA 2ZPKH 3QFDA 4DKAA 3VRJB 5DC0A 1R3HA 1JVOA 3D4CA 4L2YA 1YPZF 2ED6A 5I1LB 1JNJA 4M9OA 2UXTA 1X5GA 1FVEA 3MLWL 3DLQR 3NFPA 3UBGA 1DBKL 1KTKE 4G2AA 3FK3A 2VDLH 1Y0LA 3BSZA 3SYQA 4FA6A 5KOMC 1B6DA 1R3LA 4HOXA 2P8MB 4N2DA 3K6OA 1KTRL 5LGJB 2AJUH 2BSEA 3HG0A 2YLKA 5KS9B 2NX5B 3D39E 4P9MH 1OKEA 3S34L 3NIGB 3E6HA 3CN1A 4G72B 3K6SA 4NZUH 5DJYA 2R0LH 3LMJL 3T6VA 2DQTH 5SX5K 4K8RD 3MLRH 3VFOA 2BWDA 3A5VA 5I76A 3FQNA 2NT0A 1UOKA 3UO1H 5BW7C 1PY4A 1M05B 3NCYP 3BAEL 4JQXC 3H4FA 2P5WE 1A4KB 2CBQA 1BGXL 5IT2L 3HE7D 1DJWA 4Q0XH 5KS9F 5EF3A 3NCEB 3NIGF 4P2OC 5CHNA 3FTVA 3U4EB 5I16A 3CFJA 2B4CL 2ENJA 4OCRH 4UAOC 1SXBA 3D18B 1N64H 4L8DB 5L2KB 1HEHC 1VFUA 4BYHA 1EUTA 3NDZE 3B8SA 3QEUA 1ZHKB 5GISH 3TV3L 2R0WL 1CYGA 3U7YH 3NRFA 4L2LA 4IDJH 4XPGL 1I7ZA 2XTJE 5A2LH 4XCNB 1DQIA 3P69A 2M26A 4W4NA 3C6SB 3IU3A 2GT9A 3OLEA 5BZWA 5SWZA 1G6RA 3X13A 2FQEA 1T1WA 4M1CD 4LPCA 5JHLA 1C5BL 1F3RB 2IMMA 4LPTA 5JHDB 2VSKB 3LQZA 3JZYA 3MJ9A 5G4OA 4PTTB 1W8EA 3EHBB 4BDVA 1A4JA 1JWUB 4K3EL 4N5EC 4K7PX 1V3LA 1XCQA 4HZLA 5ENWA 1HHIA 4DP2X 2ZG2A 1AJ7H 1SBSL 4WW2A 3QPQD 4UINL 3LKSA 5F3BA 1SHXA 1HVXA 4AXWB 2PLTA 4AEIH 1GPOL 5IHLB 3KR3H 5LNEA 3MLUL 4JHWL 2Z9TA 5T1KD 2KZ1B 4S1RL 1SQMA 2DMGA 1D5ZB 3S36H 3S88L 2ESVE 5AW1B 1LE5A 4XMKH 1FNEB 3QCTL 3VACA 2RD0A 3P2BA 3L4VA 4X8CA 4WUUD 2C1PA 4PREA 2DV6A 1I7TA 1KBKA 4G83A 4GRMA 5DR5H 4HS6B 1G7IA 3HC4L 1RK1B 4KQ3L 4AZUA 2JSFA 2C3GA 2H1PH 3DJ9A 4N86A 4AGLA 3GSVB 2YUVA 1E4WL 4L1HA 4MB5A 3M1BB 2ZXDA 5DRXB 5KN5B 4JKMA 4QHKJ 1G6VK 4J6RH 4X98B 3I3BA 1AH1A 4OKVB 1RUQH 2C9AA 2VRQA 5C0CD 5L8JB 3C87A 4PSPA 4Q6IB 1DE4B 5DFTA 1NICA 4IRJB 3G5ZA 1R3IH 1HOEA 1U8HA 4LCWB 4XGZB 1GYVA 4UM8A 5EEXA 1TZIB 4JRYD 3GPEA 4I0PB 3P4MB 3BIKA 1JGUH 3RUGB 5A2FA 2F08A 4YWGH 2NCMA 3E6FA 4RDQF 1T5XA 2VGLM 1KGIA 5I5MA 3QA3A 3P0VL 5EBMA 2WV3A 4IRZL 3OSVA 2LVCA 3S5LG 1QHQA 5EU3B 1SJHB 1MFNA 4XAWL 2OSLA 3SOTA 3JV6B 3BQUB 5ACZA 3LZFL 3D85A 4TNEA 1HTYA 4KI5D 1BOGA 2C8NA 5I6NA 1OCOB 5KSAC 3QEQA 5IF0A 2E9IA 2G2RA 3VXPA 3MRPB 3VXUA 4XTRD 4BH7B 1HL4A 1XSIA 2OX5A 4RWYL 4G7YL 1CICC 4FEIA 2YZ1A 5CD5D 4LU5H 3WIHA 3ZJAA 4HOZA 5D6DA 3B6SB 2ZG3A 4ABUA 5J8OA 5I8CA 1NEZG 2XN2A 3K6FA 1MCNA 3QR1A 4KDWA 4J6IA 3QDMD 3QIBA 1CGVA 5IJKA 3VRIA 5C0EB 5ID0A 5KG9A 3D48R 1Y07A 2QPUA 4AY0A 4PRBA 4YFLF 3NEXA 5B3JE 3X3FH 5JA9A 1GTFA 1B0GA 4L4VE 1RK0A 5D7LE 1MVFA 2J1WA 1V8HA 1EEUA 2BIIA 4JRLA 4KRLB 4OLYL 5E8OB 5IVZB 4S1SL 1BFVH 3ARSA 2F58L 5EIVA 5TDNB 4HHWA 1KZYA 2NY6B 1AVAA 1KPUA 2XZZA 3J27A 2V2WA 4LNRA 4P2QA 3W0WD 3PHOB 1CR9H 2X2YA 2BDNH 1WD8A 3KGRA 2OZ4A 1BQKA 4N2CA 4U1MA 1UKTA 1GW6A 2VC2B 5KYUA 4J28A 3KH3A 1RSFA 5D1XA 4JFOA 2XDHA 4Y9GA 4OCXH 4E42A 2BY1A 3MLWH 5AL8A 2HVBA 1UXLA 3RVTD 4BA0A 1SNRA 2I69A 1KV3A 4AM0Q 5IEKA 5HDOA 5TK2A 3KPMB 5AW3B 1U3JA 2DS4A 2EJ1A 5A6MA 3AROA 4KFZC 5IEHA 5C08D 1ASPA 1EDHA 1JWSA 2G2NA 4JHBA 5C6WH 4NQDB 1AQMA 2CHWA 4Z3TA 1NC2A 3W9DA 2JMRA 3EJRA 3S34H 4BSWA 3PL6D 4UBDD 5H8DA 5TDPB 5D1QE 4JK0D 1ES0A 3CZKA 3GO1L 3ECBB 1WFOA 4IRSB 4R5XA 3SE6A 3BUTA 1AD0B 4NO0D 4RZCA 2WTOA 2EYSA 5CU5A 4A2DA 2XT1B 3BHBB 4U7KA 5BVJB 4H2CA 2AGJL 2WXQA 4BE5A 3BAEH 2YEVB 3OKOB 3VXQA 4FP8H 1BGXH 1S7QB 1J10A 1N0XH 5BOJA 4M3JA 5J1AB 1M53A 1KBWA 4P57B 1LD9B 3DHUA 4KK9D 4JUTA 4TNGA 3VX0A 4QRPE 2B4CH 4BZ2A 8PAZA 2XZAH 2ZYSA 1J0ZA 1M3IA 5IW3A 4C4KO 2IV8A 4JB9H 4X5PA 4CGUB 4A7QA 4KK6D 3TV3H 4FXKC 5JYMA 3EYFB 4XPGH 3MBXL 4LLAA 3E9TA 2F9BT 5BXFB 3FBKA 43CAA 5FA3B 4HLZG 2VE6A 4IBYA 3GTTA 1QSEE 5D71H 3O6FB 4TSBL 3FU3A 3BVNB 3FT2A 5D2NA 2EXWC 2YPLA 1MH5A 4F7PA 1S7VB 4XNMA 1D5IL 3DO3A 5HGHB 2A1WL 2N7AA 3C60A 1XEUA 1LP9A 1IGTA 2BNQA 4U1HA 2YOAA 2XV0A 4Q6YA 2YMTA 1DQKA 3KDMB 1A6UL 2FO4B 3ASWA 3AMKA 5DZAA 3WN5B 2EO1A 4CVUA 5KZCB 4ANUA 4HWZA 2XWJB 2YQBA 2P49B 4EIZC 4FNPA 1E5CA 4PRPB 2QEJA 5D6CA 3MREA 4AI7A 3ECVA 1BVNT 4HIIB 4YGAB 1TETL 1IGML 1XGQB 1U8LA 3RY6C 5CCKL 4LASH 1KGCE 3PCYA 2Y0SA 3WEOA 2FQDA 1NGZA 5I1KL 1UD2A 3HC4H 5EDSA 3ZTJH 2X28A 3EJZC 1JK8A 4XB3A 1UWGH 3BAKA 2X4UB 4BXVA 4F91B 2YLHA 3EDFA 1AS6A 3H2PA 1NOLA 3MMEB 5JIQA 5CKGA 2RQEA 3UEQA 1CB4A 3S3SA 3UBXA 3QUYA 4OD1H 5DRWB 2H3NA 3MRFA 3QEHA 2GEQA 5LKNA 1AD9B 1DDHA 2GJZB 4HJGB 4PYGA 4N2EA 3H85A 4RFEA 4XCYB 4Y2DC 1F4WL 4MJID 1Z5LA 4A6YL 3TBWB 3U7WL 1M2VA 2VERN 5DVLA 5BMFL 4PJ8D 4FTVB 5FO7A 1OOWA 3D7PA 3QWOA 4MYPA 4IS6A 1XIWD 1GOHA 1JPST 4Y1AB 1S6NA 5D96B 1QPKA 2IWGA 4DEWA 3HMXH 3L3KB 3EFFB 3LKOA 4YHIA 2JB6B 4AQ8A 4GFXA 3PWUA 2HJKA 2HZHA 3FTGB 5GS0D 1JTOA 4O02H 3DJRA 5JR1H 2W9EL 4GIPD 3FSZA 1XR8A 4WFEE 3W9EA 1JHLL 3I6KA 4GQRA 5CEZD 1SMAA 3NZ8A 2BIPA 3QDJE 1LEIB 4EI5A 3LZFH 2R1WB 4M4RA 1M9WA 1UT9A 4UU9A 3V4PA 1KFAL 1KENL 4B9JA 1Z2KA 4YDZA 3AABA 4BFGA 1HCZA 4E9SA 2J5LB 3V0EA 3B2MA 2AXHA 1ZAGA 2ENYA 1CTNA 2OL3H 1LL1A 2JQMA 5I28A 1MVUA 2P5EA 1E27B 4C47A 2X0WA 4KQ4L 3PNRB 1G7QB 1USQA 3PWVB 4GI6A 4MD5B 3GWJA 1Y1DA 3CDYA 4PCKA 3KG5A 2BP3A 3NAAH 1GZPB 2QKIB 4XO3A 5FO2A 4DP4X 4L9DA 4OCYL 3OAZK 1VFBB 2CM6A 2VQ1B 2X53A 3D5OF 4LEXH 1S3KH 3L16A 2X41A 2KZWA 4NKMA 1RZJC 5JTWA 3EH4B 2P4AB 1IMHC 1A3QA 4FQCH 4ZSOA 3O81A 1CG9A 4P5TC 4WW1A 3QRGH 2B5IC 3KVPA 4X8XA 3BWUC 3PP4L 3MROA 4TSCL 4J8QA 5FKAB 2XY1A 3PQYA 1FV1B 3QULB 3ZSSA 1RZ7L 3ORJA 3RGVA 2Y2TA 4ZZKA 2Y2WA 1G7LA 1F2QA 2Y7NA 3C9NB 1WWCA 3HKFA 4PLKD 3QUMB 3L3DB 4NKDB 3REVA 1X5XA 1IGCH 4WI3A 1J8HA 3S3PA 2HG5B 3CX5J 2EO9A 3M45A 1IBGL 2UY6B 3TZVA 3V9CA 4PGEA 5C09A 3F7VA 2K7QA 1Q94A 3C8HA 4ISVA 4XO4A 2NUTB 1G1CA 1CF1A 5FM5M 4ZOEA 3FTXA 1U3HD 2XWRA 4YK4C 3SHSA 4L1SA 1T1ZB 4B41A 3PJNA 3X12B 4YBQD 2UZIH 4LFHD 1N6VA 3UPCA 1JXJA 3OKEA 5E8DH 5ADOL 1CFQA 3QNXB 1N0LB 3KE0A 4P49A 1F8TH 1U42A 3WHE0 5H2BB 3QJHA 4HSAC 5MP6H 1TEYA 4AUJA 1YMHA 1FLRL 2Y9RT 4Y19A 1XSJA 1E28B 2W07A 1KGYE 2BSSB 4R96A 4NQVB 4YE4L 5ANMB 3IGAB 5HY9A 5T1KB 2E56A 4CMHB 3DGGB 2B20A 2QSCH 3TA3B 1FL6A 1KYDA 2DM3A 2WXMA 2K78A 4JO1L 2VOTA 1DQDL 5HHPB 4GP8B 4XC1L 3KNBB 4OCMC 1U30A 1QUNA 4WI2A 3VTTA 5C8JB 1M6UA 5GJTL 2YUZA 1ZY9A 4JQIL 1O7DE 2EVHA 1RUML 1RZKC 3I2CH 4NGHH 4NN5B 5JDSB 3KPRE 4Y4KC 1KEGL 3MBXH 2V2XA 3NSCA 4QXWA 4XZ4A 1MCWW 2F8OA 1MI5D 4N9GA 3UG3A 3UBHA 2FATL 5F7BA 4J3SA 4PG9A 2PPDA 2R7EB 4TSBH 4KZEL 1LE9A 4JCLA 4TL4A 5C0GA 2YK1H 1D5IH 2A1WH 1MAKA 2VN5A 5HGAA 1Q0EA 1P9MC 4B27A 4E41E 1S9VB 2PW1B 3ZDYE 2R0KL 3B2XA 4JRYB 5E2VL 5CN1A 1YYCA 1U6AL 5DF0A 4NQXB 1NSNL 1YQVH 4QY8B 2ZJSL 3JYCA 4Z3FA 4JN2A 1A64A 2YJLA 5C6PB 4N8VB 5F1NA 3T3PE 3FFCE 4LP5A 3FCUB 3WTSA 4FE9A 1XF2A 4OW6A 4U31A 3OGCA 1O6SA 2OAAA 2H0FA 4MMZB 5FFOA 3ZTJG 1ZANL 4MHHG 2GTWA 4AOFA 2ZX8A 2V5TA 2JJWA 5E4OA 1H6FA 1JRHH 1MY5A 2BVQA 2V37A 3SDYL 4UDTB 1A6AB 4QYAA 3C12A 1AOHA 3Q9PA 3FB6B 7TAAA 4I2XB 1KXQA 5C0FB 2AJXL 3CWGA 3ZE1F 4KAQL 1N7MH 1NGXA 3SIKA 3BX7C 1GIGH 2XC8A 1FYTA 3QDMB 4LDOB 3QHFL 5DI8A 3UABA 3MRIB 2AK4E 3SPVA 5BMFH 3PV6B 1NGYB 4D2NA 4IU3A 5MI0B 1P5UB 3F84A 4KI5F 1N10A 1A6ZB 2AERT 4JJOA 5GIRB 4WHYH 3UAJC 3SDAC 1Q38A 3IJSB 1RZQA 3L3GB 4Z7QB 2W0KA 1ZWIB 5BZXA 1XF4A 4WU5A 3W0WB 1IFHL 4XP9L 2WANA 3T0DA 1MCKA 1S7SA 1BM3H 5E5MA 3HZ3A 4DETA 1PMYA 3NJJA 2FEDD 1NFDE 1IM9D 1O9WA 2OCCB 1ADQH 1YY9D 2NSMA 4J27A 4EQ3A 3GFUA 4D9LL 1F1AA 2QQLL 1GY2A 2XQYG 3DSNB 4Z7QF 2FB4H 5GZNA 4A2MA 1M71A 5HYIA 5C08B 2IAND 1NTDA 4JZJB 2PCXA 3MBWA 2WBXA 4APQD 1AR1C 3A6CL 3UTSD 4AVHA 4HLEA 1W9XA 5TH2A 3R1GL 1IAKA 2VDNB 4U6YA 3VGFA 2GSMB 4EJ1C 4WCYL 3AUWB 3W81A 5B7FA 5IJBC 5CCHE 1BQRA 1FC1A 2TSBA 3FRPB 3GD1C 4XOBA 5DD3H 2CDEB 4LVNC 1X5JA 4F9LA 3MODH 4ZJ9A 4WV1C 3VGAC 4Z6AT 2IPUG 3M07A 1ZTMA 2WKOF 5CIPH 2X4SA 4DO5A 4XR8C 1J1OL 1TMCB 1RZ7H 2GUOA 4IMLB 3CDCA 1TZAA 5EFIB 4DEPB 4A63A 4IIQA 1QA9A 5DJ2B 4OQTL 3V0WL 1LHZA 4XP6L 2LLLA 5DU7A 5HD8D 4POZC 2VW7A 4OZ4B 2HJFA 3APCA 3TTYA 4NAJA 3OR7A 5E2WH 2VMJA 1FFPB 1IBGH 2YD9A 3EOBA 4AMKH 3UPRA 5T3XL 3E7JA 5DD0H 4GKNA 4HISA 4E9QA 4JRXE 3GIVA 4J3OH 4P07A 4M5TA 4UT7L 5IFJB 1JN6A 4MQTB 5CCJA 4Z7UB 5CU9A 1BDYA 4P48A 5JNYB 1E67A 5CLZA 1P6FA 5E1IA 3ROOA 1CFSA 2CUAA 1O0VA 2Q8AL 2GITB 3U4BH 1V7NL 3VFSA 3WENA 1BEYL 4OCNC 2IH9A 3DX1A 5C07A 2V5SA 2D8KA 1RUAH 1FLRH 3Q1SH 1P84K 4YS4A 1UGKA 1EHKB 3PWPA 4EDWH 3H9SB 4ONFH 4R6UA 2OMUA 4YE4H 1CXHA 3D3VA 3TESA 2MOQA 2WNKA 4L8CB 4YZFF 2VDMH 2O6PA 3UCQA 1D6EB 4JM2C 4HV8B 1A22B 4P5MB 4Z7UF 3QXUA 4AL8L 5CKAA 1QZ1A 3EXLA 1DQDH 2C9VA 4H13C 5D9SA 4D7PA 5GJTH 4ZAKC 2ATKA 3AADB 4L9LA 1GJUA 4LKCA 1GGIH 2VR4A 3DXAD 3C5SB 1KEGH 3O45A 5MEPB 3B7TA 4YHPA 2P52A 3MV8D 1IGYA 1O7VA 2XPGA 4NWTL 5KYWB 5JW5A 2QLYA 2EDOA 2NUPA 3CZJA 2FATH 3DA0A 3RL1B 5EEVA 5ICZB 3GK8L 2WSDA 4KZEH 4ZMZA 1KIPB 2MMXA 4WKZA 3QUKA 5E4IA 4MJIB 1ZE3C 3RDTC 4NPKA 1AG6A 2CLVA 2IBBA 4PJ8B 2XVLA 3HG4A 3NH7L 2VLJA 3SDDC 2BVUA 4HVBA 5C2UB 4F8NA 4HOWA 4PWJA 3IPFA 1MEXH 4OGQC 4DZ8A 3WY4A 1GZHC 1RIVH 1NM4A 3CMGA 2XWDA 3H55A 4OIBA 4DPCX 2JKTM 5CD3B 4XPBL 2NW2B 2XACC 4PTUA 1BLIA 4CMMA 3HZKA 5A2BA 4B50A 3WCYA 1MG3C 4KOBA 3A23A 4D8OA 1GC1C 3C5ZC 5D7SH 5AB2A 1AGEA 4LQ1A 1T89A 3HNVL 1G7JB 1VFMA 3HS9A 4YDJA 1MOEA 2HT4D 3SDYH 1UYWL 3GSXB 2OBGA 2AQSA 4ABVA 2WLYA 3F00A 4PCYA 1WA2X 3HI5L 1E4JA 4AW4A 3TONA 2EIKB 5IWLC 1MCOL 1GMIA 4KAQH 3BEWA 4JPKL 3B9VA 3V0HA 5C9JB 1WAAE 1F97A 2XPZA 3QG6B 5IVXA 4V1DB 4RA0C 3CVHL 2K4AA 4QHMB 1SGKA 2D0GA 2AMUA 2L7UA 3CLFH 3HG1D 5SWSD 4B7IA 1SDDA 2P3YA 3M8OL 3EUDA 4XMPL 5AL0A 5JXAH 1I9RH 1UD3A 4WHYG 3VGEA 3CZLA 4L1TA 4M43L 4YR6B 3FU9A 4RSYA 2Y7SA 4F20A 5E6IA 2CG9X 3P9MA 4UDUB 3TEUA 1URIA 2UZXA 3GF8A 1NGWB 4J4PC 2CLZB 3SPJA 3HA0A 1IFHH 4C4UA 5EWIH 2XTLA 3IU4L 4NFBA 5DYOB 4GG8A 4OAWA 2O30A 3ZVVA 5I6PA 1LWHA 1MDTA 2QVMA 4LAJH 4NXKA 1E8XA 4AGOA 5E9DE 4DFHA 1ZLEA 4HKZA 2X9XA 1A25A 3NZSA 1JFQH 3VH8B 2DLEA 1I8LA 2GJJA 3HE6B 3RNKB 3GRWL 4A7GF 2X87A 3IM1A 2DQGH 3U9WA 3MRRA 4D9LH 2QQLH 4HWBH 1HQRB 3K8KA 4PJAA 4WHTB 4L1DA 1Y7VA 4K23L 1YC7A 3S37X 3DJTA 4PG2A 3FS9A 1U3HB 4ORGB 1T6VN 4E0RB 3CFBB 3VXSD 2PYEA 2Z31A 2FT6A 3IDMB 3ULSA 4XPFL 1MRDL 2ALWA 5JMRA 4K8RC 2AJSL 3WDIA 1QLRA 2XN1A 4FNLL 3HS0C 5J12B 4GB9A 5CZXD 5C0BA 4KNSA 3CQQA 3BW9B 1RFDL 2L7EA 4DGIL 4DWHA 5I71C 1OY3B 5F7WC 3LX9A 4TLKA 4AKOA 1ADWA 1P1ZA 4Z0BL 2C9PA 1KFGA 1YMME 1QLEH 1F41A 1F0LA 5TPWL 4XP6H 1CGUA 5IFAH 2IDSA 3MLZL 1CLCA 4ZQKB 3SCMD 1TCRB 3BO8A 3IETB 4EEEA 2VC2L 3DOSB 4H0HB 3KYMA 5D4QA 5FGBC 1K9TA 1T4WA 1CT8B 2E47A 3OJDB 4DTGL 1MI5B 1A7OL 2W88A 2BVTA 4Y1SA 1BG9A 3LZPA 1QSFA 4N5UA 4DP1X 4ODVL 4JO3H 4JL2A 2ICWI 4U3SA 43C9A 1CC3A 4DZBA 5DFVD 2J8UE 1RI8A 1FCCA 4P5KB 4QRSA 4WI7A 3KL0A 3B5GA 4FKKA 2A77L 3WJLA 4PJIF 2XG4B 2CR0A 1F3JA 4PB9L 4FL4B 3IMRA 4KWUA 4X99B 3SKOB 2J1XA 1CLYL 1YEGL 2GIYA 1BIHA 2GK2A 5CILH 4IK7A 3RE0A 3FQWB 25C8L 3LNGA 4ZMYA 3EXJA 3A4AA 3BH4A 2QSTA 3FBQA 2BMKB 5AVYB 2EACA 3U36B 3PUUA 1CD0A 2AXGB 3DTXB 4KRNA 3F6JA 5DJCB 4B53A 4HULB 3UYPA 5F6HI 2Q1EA 3B1UA 1RL1A 2X10A 5FPIA 3ZE0E 4UT9L 1R3KA 3ULVC 2WVUA 4RMTA 3VDCA 4PRDA 5I1JL 4HGWA 4BSJA 2XWBA 2EE2A 3QCUH 4AV4A 1G0DA 1OSPH 5GGUB 4HX1A 3P73A 1KDJA 3UJJH 4DCQB 2KL6A 3GK8H 4RESB 3U0WL 1IM3A 3BXNA 4EUPA 1BF5A 2JXMA 3D07A 3O9WD 4HK0A 4QCIB 3T1FB 4B9FA 2PWDA 5I0YA 5KYYA 4PRIE 2X2HA 3WNOA 4ZW5A 4LP8A 3NH7H 1VESA 4JRWA 1TTCA 1MF2H 3CPLB 3VXTB 1CDCA 2FSDA 4DK3A 1YPZE 1MCDA 4PBDA 4PLJD 4LNVA 3MNWA 5F97E 1C16A 3MV9E 1ZVNA 1FBIL 2IGFH 2NXZC 3KGTA 2ITFA 3WFEL 3OSKA 3QIWC 4YC2C 4PV8A 5KEZA 1T0NA 3IMTA 2Q9OA 4HW6A 4IKNA 2ADYA 3OXSA 4OJCA 4R26H 4Z7VE 5MEOA 3IF1B 3IFPA 5IHUH 1HOCA 2G60H 3VA2C 3MUGA 3MO1A 3LQAL 3O3BA 3ZL1A 3QXAA 3AXIA 2YZ8A 4QO1B 3VGHA 1IM9B 2FAUA 1R47A 4WZ9A 5EO9A 1J9CT 3GBNL 3PDDA 4QRTB 1R5VA 4NT6A 3KPQB 7PAZA 1UYWH 4OH2A 4ZXBC 3NJIA 4LCCB 2B1AH 2HRLA 5CSZB 3HAEH 4XXCC 1BJ1J 3AACA 4LLVB 1MCOH 1X4ZA 2IANB 4YQXL 1KIRA 2ZNWA 5AFAA 2ZX9A 1OB0A 2X4RB 3IVKA 4APQB 2DQHL 3CVHH 5F9DC 1HYRC 3UTSB 3DMMA 2TRYA 2FL5A 3M8OH 3HR6A 1YG9A 2JNZA 3OKNA 5F7DB 4XMPH 3CZFB 4IDLA 3IJEB 1JXKA 1F13A 5DVKA 4M43H 1AGCA 3P1VA 4G8GB 3UTQA 4F7KA 4U3CA 1JSYA 3P9LA 4R7DB 4QJ5B 1RURL 4QF1B 4BSVA 5GS2D 2PP9A 2NXYC 4GUPB 3L1FA 2YAPA 1A1OA 5DRZB 1QEWA 2DWEB 4TULL 2E59A 4XHQA 2QFRA 3SE9L 3ARBA 5GSRA 5E8PB 1KGUA 3SJVE 3NJKA 4Y4FA 1E8ZA 3QYCA 4G8FA 3RVTC 3C6LA 5ITFA 2BZDA 3BP7B 1DCLA 1WZ1H 4P3DA 4BQBA 1EEYA 1IBFA 4YLBA 3WFZA 1R5WB 2RCSL 3KPLA 4D9QE 2COQA 4Y5YA 4Z18A 3NIDE 4K23H 3TJHC 2ZF9A 4UI2A 3W5MA 1VCAA 2AJ3A 2V5MA 1HCYA 1YZZA 4HWNA 2RHEA 1ZA6A 2E7LA 4XNYL 4PUBL 4G7VL 5D7IA 1KCRL 3RHWF 1BD2D 4JJ5A 4LSDA 4HQQL 3QRFM 5FR3A 1E5BA 1FPTH 1HKLL 1OAYL 1H19A 4KDTC 4XPFH 4OCLC 1D5MB 3CD4A 3ZR5A 1JWMB 3QIUD 4JMXA 4PVBA 4YOKA 1HQ4A 4WFHD 4TF4A 4TUKH 1KOAA 1PG7W 2YAFA 5JIHA 3VGDA 3LH8A 1SYSB 3EGDA 3HG2A 5KYXB 1G1YA 2HP4A 4MNGA 3CFDA 3F2LA 8FABA 4WF7A 4X80H 2GTZB 3HPJA 4X5LA 3TEYA 4FFZH 4CU7A 4MGXA 4Z0BH 1GRWA 5AW4B 4FG2A 5F6IC 1A0QL 3OC5A 1AKJA 4MAUH 3QWRA 5DA0B 5TPWH 3N9GL 2X5PA 5A6LA 4M29A 2O6CA 1WT5A 2OR9L 5AVWB 4ACTA 2Y6TE 2PO6C 3V4UL 2PETA 2VC2H 1EFXA 3WYRA 3F85A 3GEWB 1EEZB 4KY1H 5IW6A 2L8AA 1R9FA 3QUML 4JFDA 1DVYA 3HEIB 4OZIE 4M6NH 2F18A 2A9DA 5DD5L 3SY0A 3LHAA 2QLVB 5MENA 1MRFL 5LBSA 1F6AB 1YNTB 4ODVH 3QUZA 4MNQE 2FD6H 5JPMB 2HVKA 3BVWA 2FCBA 2I25N 4YPGB 4OLVL 4N1HB 3FCTB 2O6DA 2OTUB 5AVRB 3FQ2A 5B4MD 4QJ4B 2CA3A 3MLYL 4M7LT 4WWKA 1I4FB 2NTFB 1ZGLP 1NC4A 2JI2A 5EC2A 5LCVL 4QXUH 3CFMA 2KC0A 1TF4A 4K07A 3BVXA 2LW3A 4XH2B 3NYKA 3H9HA 2IXQB 5IKCB 4JGNA 1U8MA 1YNTF 4Y7OC 1SEBA 4FXKB 4GS7C 3PABB 3CHSA 4R4BB 4TQPA 1CZ8L 3T2QA 2OXGB 1XGRA 3VX1A 1N59A 3ZO0A 3MRJB 1F86A 4KVCH 3G5VB 1GCFA 1YNLL 1HI6A 1FHNA 2EVJA 3RWEB 3AREC 5CJOL 3Q2WA 1L7TL 4G1EB 2CSPA 1WE5A 3BKYL 2WO2B 2YR3A 5GGTL 3U0WH 4Z3GA 2IPUK 4HS8L 3V4VH 5HJ3B 4Q58C 4WI5A 5FYKL 3WD5L 2C9RA 1MHHB 4LHUA 2DKSA 2DQUH 4Y4HA 3T6QC 5T8IA 4F7MA 3HG1B 3BI9X 5SWSB 2BY3A 1WH0A 2DYRB 5C0ND 3QEGL 1X9UA 1XIWC 2FJHA 2EH7L 2IFFL 3NJLA 3O2DH 3VFTB 3IGKA 3PHQB 1IARB 1IKFH 4FN0A 5LO7A 1BXVA 1LM8V 4MB1A 2OMYB 4M3HA 2DEXX 1ZSHA 2CA4A 5D4HA 5DO2D 1PFOA 4G9FD 3W39A 4NZFA 1CFNB 5C2BL 1DLHB 4MDJA 4B6ZA 4KY2A 2NYYC 4DEUA 4K9EC 3FU0A 1QBBA 5TE6H 1CQKA 5FKPA 5T3ZD 2GI0A 1F2XK 3O4OC 4X6DA 2YAMA 3IJ7A 3OG4B 1WWAX 3K8MA 3G6DH 3RIKA 3JV4B 1DLFL 2AJVH 4BHUI 5EULV 2MOGA 3RGHA 3UTZB 4KJWD 1HZLA 1JXDA 5FUZL 3DX4A 4XP4H 3B9KC 4RDQG 5CF3A 4KK8C 2PTUA 3QJZA 4PJEB 1NCJA 4QJ3B 4AGMA 1XH3A 3JTTB 2XIDA 5E7FA 3GBDA 1GL4B 2FBRA 1U8JA 1GCYA 2IBGA 3EFOB 5ES4B 4NZRH 1MCIA 5CFAA 4QRFA 4NDMA 1LEGA 5HDBB 4WNQB 2CO1A 2MCPL 1EHLL 5T1LD 4OLUH 4XNZB 1PDKA 2IOIA 4FNUA 1UFGA 4UV4L 5FYJE 3P30H 2APWA 5D5MB 2EECA 4TULH 5IM7A 1G9NL 3SE9H 3IDXH 3BPOB 4FQXD 3APDA 3QZWB 4G6KH 1D5XA 4PLKC 5IJCC 1FL5A 4ALAL 4P9HL 3CLEH 3F3HA 4GW4A 3RVVC 3LKRB 4XI5D 1X5HA 4J3TA 4PP1C 1WBZB 3SCMB 3RWIB 4WI4A 1S7WA 4JG5A 4QTHA 2D0FA 2F0CA 2PW2A 4FYRA 4L48A 1D9KA 4PHXA 1DVXA 4GW5A 4RX4D 3Q8EA 1WDAA 3INOA 1WEJL 4OV5B 4U7MA 4YGVA 1UURA 5KSBF 4F7CA 4BGDA 4NP9A 4YBQC 3BN9D 1NMBH 3VXMB 4FXGA 3Q5OA 4HQQH 4JM0A 1QBLL 3DVGA 1X9QA 2WTRB 4GQ9L 3CLWA 3CBKB 5EV7A 1H6UA 2FIRT 4KTEL 3SGKC 2JLPA 3UJTL 4YHOH 1TTRA 2B5IB 1OE3A 5D2LA 3IBEA 1BQHB 1UH4A 1HHJB 2YWYA 3FUIA 4GPVA 3SPGA 3EG9A 3ROLB 4RSVA 4K3DH 4U0RB 3RIAF 3CFCH 3NTCH 1HAWA 4U1IA 2VDNL 3RPIA 3NZHL 1J0HA 1FZOA 2G9HB 2XKUA 3OMZA 3H6JA 4G8AC 3DETD 1MELA 4BUGA 3BPNC 1Z7JA 4WO4A 3LTVA 3QUGA 4MAYD 3TH3T 1MSPA 5HI3D 2UY7B 5HDLA 3QPXH 1CK0L 4WW2C 3V4UH 4LGSB 3EO1A 1KUMA 4AEFA 4PD4K 5CBEA 1E5AA 3EH1A 4MSWB 1HC1A 2Y7OA 4AKPA 2VMDA 2J88L 5DC4B 2E6JA 4N28A 3TO4A 4HKBA 2CJUH 2HFEA 5DFAA 4OIIL 2NRDA 1IGIH 1HN1A 1BAFL 1YEHH 1S9XB 1NDMB 1MRFH 4MCZA 1H6EA 2HLFD 2QL1A 3D4YA 4ELMF 3EJUA 1F02I 4A2HA 4OI8A 5IVOA 1MFBH 2QPEB 2WVSA 1FGVH 4OLVH 1DQJA 3RTQA 1PZAA 2CO7B 3RLSA 4ZD3H 5JW4M 3RWDA 4F7EB 4N6RA 2VO5A 4HAFA 2B3RA 3EOTL 1DZBA 5I6LA 3CZGA 2WINA 5EPMA 2R23A 3HN8A 3T8XB 4U1SA 2BP0B 2P8PB 2OMXA 3MYJA 4FNSA 3VFVA 3UTTA 1AO7E 2IGLA 1JYWA 3BP5B 3RYMA 3GMNB 3VD7A 4AYFA 5TQ2L 3H0TB 1PW3A 2OXHB 1QAWA 4PJXA 3NCMA 1QRKA 1YNLH 3TCTA 1JNHA 2QDVA 4W1TA 2WKGA 5IQ9A 2FHBA 4K7FB 1KTBA 1H8OA 1OARL 3LNIA 1JUFB 3AQDA 3NSJA 3RKPA 4IU2B 2CDFA 1K3ZA 1T3FA 2G5UA 3RAJL 3EJPA 4X5QA 4HS8H 1RZPA 1UUSA 1PLGL 3DNKA 4PRHE 3BE1L 5FYKH 4WJ5B 4HK3J 2AANA 4Q9BA 2RBLA 3PHAA 3FN9A 1ZS8B 3RFZA 3KYAA 2VJ0A 2EH7H 3KLAB 4CJ1A 2IFFH 2AV1A 3FL7A 1YEIH 2UXVA 3OR6A 5A2IH 3QJSB 4K2UL 3LNDA 3TCLA 4BKLA 5F0LB 2OTPA 1QPPA 4E9TA 1QW8A 1WCBA 2AEWA 4O58L 5AOJA 4CADA 4W4OA 3QIBC 4R0LA 5C2BH 2QFPA 3IS0X 2YGPA 5IJKC 5DMGC 3WNKA 4YSCA 4L4TA 4M1GL 1BF2A 3WUWA 4P2RE 2WUCL 1SY6A 1U3NA 5GS0L 1MWAA 3SGEH 1KACB 1ZT1B 3FSAA 3JVGC 1NGPH 5AW0B 3QYMA 3DUSA 4QHKI 4Z9KB 1DLFH 3W3BA 3WMSA 4RQQA 3UFIA 5ECJE 4YXLH 1TQTA 3B7UX 4PVLA 4HDIB 3U25A 2QZQA 4L1LA 1DANU 4TUOB 3IYLW 3OVUB 1CDBA 2WUBL 3IDGA 2HN7A 3BZ4A 4QHNB 1N18A 3V7AG 2A9CA 5D1XC 2XZCL 4UIKH 4RRPG 5CZVH 1ESOA 4YHMH 3G5YB 3QIUB 2ZOWA 2GSIA 5CEXB 1H3XA 3QJOA 5DK2A 4W9DC 1I1AA 3MZTA 2B59B 2QELA 4MS8D 3KPPA 1WBYA 2KH2B 3N40F 2Q7YB 1MW1A 3BIAX 4BELD 4MCMA 3BKML 4DERA 5IMKA 3IJYA 2X38A 1EK3A 3DHJA 3GHEH 3LPGA 3WKML 4BFRA 2IO5A 1M7IB 4QXGH 2ZKWA 4Q4IA 2ZX5A 4YZWA 2F8XC 5AG8A 3SE8H 3N6YA 1O9VA 3B7YA 1OTTD 3NP3A 4X6BB 3F12B 1ZVYA 1ZLWH 2IDUA 1ORSB 5B38G 4GKSA 3ARVA 4G59C 4JDTH 2H2SC 3AQXA 3K1KC 4PV1C 3HC2A 4WUUE 1KTLB 4HJTA 5M94B 1EO8L 1W0VA 1IT9L 4HUVA 2EDWA 1AHKA 1G5AA 4NQED 3NFNA 3MCYA 4HK3N 4ELKA 2EIDA 3IDNA 4HUWA 4Q2ZA 2VTFA 4YFLI 2FDBP 3DRQA 4X6EA 3IDYB 3KMDA 2F54D 4F5CE 1ORQA 3AT9A 1B90A 5C0CE 4UQBA 1L9SA 1CL7L 2F2HA 3GBMH 3O2DA 3TYFA 3IDUA 3S3DB 3C2SA 3LH2H 5HYFA 2XVBA 1DO5A 3MOAL 1THAA 2HJLA 4JFPB 3G08A 2WHVA 2PPCA 5CMAB 4M62L 4C56E 1IC5L 5E8NB 1ZLDA 5BRZE 5I15L 4TTDD 4EQ2A 1ETB1 3V0IA 4P46D 3TNNA 2GFBA 2VUOA 2NPLX 4UTBA 2BC4B 3US0A 5D2NC 3UAFA 3OB0H 4FFYH 4JFZL 4N0UE 4JJHA 3ZE1E 1RKRA 3C60C 4ZOBA 3S2AA 1S3RA 2G5RA 4DK6A 1DN0A 4WVRA 4YHYC 1VKXA 4FA8A 1CDJA 4XCFH 3ALPA 3GDBA 4O2FB 2XXFA 3KWWB 4TQHA 3CV5A 4W9ZA 2WIIB 3AB0B 3QDHA 3T04D 4AM0B 2AC0A 6FABH 3UTPD 1YEKH 4OIIH 2ETWA 4PWHA 3FO1A 1UOWA 3M1CA 3PJLA 4Y0GA 4Z7WA 5DLMH 5MERB 2VIRA 3C8KA 4I2XE 4NKIL 4XHJC 3WS3A 4G8IB 4KMTL 2D7OA 3KAAA 3ILPA 5IB2A 4L37B 3RBSA 3T0AA 3MRCB 4KVPA 2P5WA 3HNSH 1SJEB 3N1MC 2O4EA 4B9IA 3FHAA 4GAGH 2HLAB 5I1HL 1FFNA 1NMAL 1SYVB 4TYUA 4XN7A 2PXYD 2OYLA 3ZIYA 3RZCD 5I8OL 4HCFA 4JFFE 4KITB 3N1QC 4B0MB 3DI3B 4G9FB 2K8MA 5I9QC 5E8EA 4N0CD 2VR6A 3GMMA 4JREB 2Z0UA 1Q9OB 2OMTB 5CP3A 4F1SA 2BLFA 1BEXA 4WFFD 1VACA 4AZ8B 1N5YH 3PG2A 4HPHA 2F53D 1AQ8A 1SZNA 3BH8A 5SV4A 4O00A 2BCKA 3NP4A 2OJZL 3TBCA 2P45B 2XXGA 2K3TA 3VI4F 5EU6D 4AQ8C 1S8DA 1PZDA 4U1LB 3LVEA 4JUSA 2R2CA 3RVUD 4MD0A 2P47B 3RAJH 1GH7A 2WGXA 4KC3B 4MBRA 4PLNC 5E1AB 4NNXB 2DM4A 4YHNB 3D2UA 3NJHA 4M6OL 3LEXA 3GSWA 5F96H 2VM9A 3PGCA 3CCHA 4EN3D 3L3IA 2G3NA 1LDPH 3LN5B 4NRZB 1ZRUA 1EVTC 4NWUL 1INQB 5I0DA 4ONGL 3FT0A 2ESVA 4J1UA 1JPSL 2M8XA 2IAMD 3L4UA 4MA1C 3A24A 4GXUN 2R29A 4OCWH 5I17A 1BAWA 4TRPH 5T1LB 2HTLC 1B4JH 3CFKA 4ZUSB 1MHEA 2WJ7A 2IQ9L 4GUQA 2V5RA 1PAMA 3IXTB 2WUCH 4DGYH 4FQXB 4N8VG 4IIZA 4R7NB 1BVOA 3B5HA 4NBXB 5JA8B 3VD3A 1AHWB 2OI9C 2J1YA 3SQRA 1ZHBA 4X7CC 4S2SB 1E4KA 2CR3A 1EMTH 1KPVB 3GDCA 3L4ZA 2WZ5A 1M7DA 2MNWA 4FQHA 5EIIB 2ZWYA 5C0AD 3W11D 4GSRA 5D93C 1WZMA 1AXTL 2XG5A 2YSSB 4UIMA 1JK9A 2J6WA 3I02B 4UT6L 3RGVC 4BH8B 3ETBF 4WGKA 4YZFE 2MTAA 5FDWA 3GINA 2F5AL 2XZCH 2UWEB 2Y7QA 3JV0A 3F6LA 5EU5A 3LRLA 1DVTA 3I75A 2JI1A 4XMUA 3BWAA 4NQCB 3TZVC 1F90L 1NCTA 3IE9A 3K72A 4S1QH 1D7CA 4LF3B 5L4IA 2BNUA 3J2PA 2JB5L 3BKMH 3QH3B 3SYPA 2QSQA 5DHVB 2Q10A 3V0FA 4YLQT 4P4KA 1MIMH 2X6AA 1BVLB 1CE6A 4MAYB 2UWEF 3AXHA 4ADIA 1G9ML 3DO4A 4ZI8A 3HHSA 1BYPA 1A1MB 2KBGA 4AYMC 2EUZA 3L08A 4NQTA 4UOQA 5C9KA 5BUGA 1IT9H 4UILL 3CUPB 1EZVY 3E3QC 1SHWA 4U05A 4L4VA 4AMXA 1KC5H 2Z65C 2F1AA 4CJ0A 1LYQA 3VFUA 4XVUC 3P02A 4BRJA 1M1XA 3B9AA 4XNXH 2F7IA 2E75C 1AHMA 3HBPA 3VSTA 5J13C 1N70A 1HHHA 3F62A 3WGVB 1IC5H 3WJMB 5JXEA 3RRQA 2GCYA 5E1GA 4PGJA 5AZ2H 2ZWZA 2BCMA 1ECYA 3TPUA 3BMVA 4GQZA 2FX7L 2VR7A 4NN6B 4G9DA 4KK5C 4KXDA 5HHNB 1KLFA 5FO8A 5HVGB 4YIQA 3FRPG 3KPNA 4QR7A 4G5ZH 4PSRA 1J0KA 1XGTA 1HJBC 4W9CC 2YHGA 2WK2A 1IJNA 3ZT5A 4MLSA 3IXAB 3TEWA 1INDL 1I7UB 4D3CH 2V0AA 5TF1L 2AXFA 4FFVC 5CEZE 4HIPA 4U1JA 2DM7A 4DW2H 4EN2A 5IV2A 1QI3A 3QXDA 3N0PB 4CSTA 1GJIA 1Z3RA 2VDOH 1AZNA 2NNAB 3U46A 1SHSA 4OB5H 1N8OE 3U7AA 6PAZA 2HCZX 1FIGL 1JZFA 2HAZA 4DP6X 1FG9C 2H32A 1MFMA 3EGXA 4ODXA 3HRZB 1T20A 4KMTH 1J9SA 2NDGA 1P7QA 4L8SA 3MFFB 3N42B 4Y5VA 1TTAA 1P4LA 3FAXA 4WEUD 3JWDC 1GAFL 3GB7A 3KYNB 5IW1A 2ZCHL 1NMAH 5E23A 1WFNA 1Z9OA 2XA8H 2ZZUT 4DOHE 2PF6A 1MRCL 2FJFB 4UQDA 4Y16B 3OMAB 5F1OB 5FYLD 1FDLL 4O5LL 2QMKA 5T33L 4I9XA 3N42F 12E8L 4RMRA 1QSEA 4OJEH 3Q6GL 1DEDA 1NOAA 4OJYA 2LU5A 3HBQA 5L8LB 4M6MH 3ES6A 3TWYA 5K39A 4PJBB 3WSQH 2EXYD 5J11B 2ADFH 2OMWB 3FRUA 4PS8A 3TURA 4GEJA 3VJ6B 1ND0B 3C5XA 4MJ5A 1CBVH 3AG2B 1TVHB 1Q9WA 4GFTB 5CNHA 3KPOA 2EH8L 1LO5A 4LSPL 2AQPA 3H3BC 1USZA 4GRWB 3Q7JA 4L3FA 3GMPB 1TQCC 5DSCB 3QIWB 1KB5H 5FOBB 4NWUH 3ARGD 4NQSA 3UZQA 3VFNB 3MRQA 2VXVL 4XCEA 3HMWL 4HUXB 5GZNC 4OZFA 4DN4H 4G1MA 2FLMA 1DVFA 5K9JH 3ULAB 3V0JA 1A9EB 1MFCH 1U91A 2HT3D 2GK0A 1GYUA 3EOAA 1BJ1H 4GRWF 2YGQA 4D0DB 1KEML 3LEYL 4ZFZB 3ATEA 1YQ2A 4ZXBB 3SZ6A 3HI1B 2VDKB 4HT1L 3OX8B 3DKHA 3VXRA 3X11B 4LSTH 4AIZA 2ZKXA 4BFEA 5H37A 4PJIE 5T5NF 1BX2B 15C8H 1IBZA 4Z23A 4LARH 2W60A 2XWXA 3CXHJ 2N01B 4F9LC 4HXAL 1HILA 4NQEB 2D9CA 4ZS6D 2J6EL 3PAZA 3QEQD 1AXTH 1HSBB 1ITBB 1NFKA 1MI5E 4UT6H 2F54B 3LRGA 1FJ1B 1JI1A 1U41A 2WQUA 3OKDB 4IIQC 3G04B