4AVKA

Structure of trigonal fimh lectin domain crystal soaked with an alpha- d-mannoside o-linked to propynyl pyridine at 2.4a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords FIMH
publication title The Tyrosine Gate as a Potential Entropic Lever in the Receptor-Binding Site of the Bacterial Adhesin Fimh.
pubmed doi rcsb
source organism Escherichia coli
total genus 36
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4avkA00
3JWNG 4AVJA 5FS5A 2W07B 2J2ZB 4CSTA 5IQNA 1N12A 1ZE3H 4J3OG 3ZL1A 4ATTA 3BFQG 1N0LB 5FLUA 2JTYA 4J3OF 2VCOA 5FX3A 5AAPA 4CSSA 5JQIB 3SQBB 1TR7A 4AUYA 4AV4A 5IQMA 4AUJA 3MCYA 4XODA 3BFWA 3JWNE 5FWRA 4AUUA 2XG5B 4XO8A 5LNGA 4CA4A 4XOEA 2UY7B 1KIUB 4AV0A 3ZL2A 2UY6B 3BWUF 1KLFB 4AVIA 3RFZA 4XOCA 4AVKA 4XOAA 2XG4B 4XO9A 4BUQA 5F2FA 5LNEA 3JWNH 4LOVA 1UWFA 4AVHA 4AV5A 4X50A 5AALA 3ZPDA 4X5QA 2WMPB 2JMRA 4X5RA 1PDKB 4X5PA 5AB1A 5F3FA 4J3OH 5IQOA 1QUNB 3ME0B 4XOBA 5ABZA 5CGBA
chains in the Genus database with same CATH superfamily
5H37H 2R1WB 4FF9A 4WKZA 5I1KH 2M26A 3EJSA 2JFCA 3J8F7 4L3CA 12E8L 1K8DB 4HKBB 1IGTB 4Y9GA 3GXUB 4N4YB 5L2KB 5DSCA 2AANA 2X0UA 2NW3B 2YA2A 3V6ZB 1FL5B 3N2JA 5DJCA 4KKQA 2Q3ZA 4HHAA 3TIEB 1WBZA 3FUNA 5C09B 4JY6A 3Q2LA 3RVUD 1IGJA 1U2CA 4G8EA 4QRAA 4EZKA 2K3HA 2IAMA 3Q3GB 3MLWL 4NS0A 5JMOC 4N8UA 3CVBA 5D7SL 2DQDH 1YUKB 5E4AA 4KKLC 3I9IA 1HH9B 2VLKA 3RWHA 1WF5A 4KXDA 4X0KB 3RUGB 4JG1H 3EJRA 4P5MB 1OZTG 3DO4A 4IDLA 2DEYX 4AV4A 4Z3TA 3QYMA 3NSDA 5HGGS 5C0BE 3ZDWA 1KTRL 3QUXB 2EDEA 1XTLA 1BVKA 2VDML 1WFIA 5GGQL 4FQHA 3SQBA 3PFUA 2BC4A 5HI4D 4UILL 3IGAA 1JPSL 2ESVD 4TPRL 4KY1L 3I6SA 3WIHA 2DPKA 3LNIA 5CHNB 3LZFL 1TLMA 4FFYL 1G5GA 2BY2A 2EVHA 3D52A 5CCJA 2CDFA 3ULVE 1NGZA 3OQ3B 3VE0A 3BAIA 1OAJA 3RPIB 3S96A 1XGTA 2QFRA 1ZK9A 1WCBB 2ZUYA 2CK0H 3PWPB 4GI6A 3L3GA 2VDPH 3E7JA 1IFHL 2WUBL 2BRQA 3P0VH 2MH4A 4FMKA 4L2YA 4NENA 5IMLB 3BAKA 1AIZA 3HAEA 5EZLB 1LEIB 5ID1B 1L9TA 3SPJA 4UV4H 3C60B 2LU5A 1W72H 3WTVA 2JCCF 2J43A 2IWKA 1BAFL 4YUEH 4ZX4A 3MJ8A 3H3BC 5FDWB 3IT8D 2QMKA 4NDMB 3PE9A 1JZHA 4E9VA 2DTML 4HU2A 3UX9B 4AC2A 5AD0B 2OL3A 3AS1A 4JKKA 2FLBT 1FFPA 3AU0A 2CPUA 3I6GA 4FCAA 3IPFA 2DI7A 5T1DL 1Z7JA 5FM5O 2C8NA 3KYOB 1USQA 1NFDB 5D1XC 2HRPH 3QUMH 1WV7T 2DOCA 5EO0B 3MBEC 4GH7B 1A9EB 4QO1B 4UV7L 5DJAA 1D9KD 1JF1B 4IS6A 4O2CA 2FBJL 4NZUL 2DI9A 4FKHA 3WUWB 5LGHH 5C07B 2NTSP 4N28A 1NUDA 4AVJA 2OMXB 5IJKA 4HWEL 5FR3A 3KNBA 2H1XA 1NMAH 3FZUD 5KSAA 1FZOA 1T0NA 2V7HA 5I1LB 5BV7L 4WK4B 4ZXBA 3LS4H 3S9DB 4IJ3B 1E42A 1WICA 1PEZA 3PUCA 4JRXD 5AYUL 3RAJL 1JN6A 1NUNB 2WNKA 3MI6A 4G7YH 3SZKC 1KELL 2ZCZA 1K4DB 3QR0A 5IT2L 4JREC 4WFGD 1OP5H 3V5KA 1FNGA 5DD6B 3D05A 2VTFA 5DZLA 3QHZL 1QVOB 1S9WA 3VXMB 4JFSA 3DYOA 2VISB 4KX9A 3QA3B 4IRZL 3E1F1 3NFSL 3PQYB 4OIAA 2DEXX 1M2OA 1L9RA 3ARGC 2DN7A 2XVGA 4HUNB 5FECB 1L9MA 4N2BA 4N1CA 1QI4A 3L9RA 4KI5E 1BOYA 3O8XC 3LNEA 2H32A 4BJLA 1HQ4B 3UJTH 1PYWB 1HE8A 4HWZA 3R19A 3KPRB 4KJWD 1KXVA 5CINL 4NP4H 5EUOE 3SE9H 3BUTA 3QRBA 1YEEH 3CVHL 5LBVA 1Z6JT 4MCZB 4U1NA 3ABGA 3EYQD 4L0ZA 1NEZA 4UF7C 4U4IA 4XNAA 3FSAA 5E23A 4L4VE 5DD1L 3ET9F 1A9BA 1EA9C 4P2QD 3WTYA 5LCVA 1GL4B 4FP8H 4JJOA 2BX5A 2KDGA 1EGJH 3LV3A 4E9WA 3BFOA 5A2FA 4XC3L 5IBLD 3TX4A 1QRKA 1WE5A 5T1LA 4RRPA 2N1KA 4Y1AA 5E5MA 4DPCX 5F9OH 4IMKC 1NFIB 4CU7A 2R2BA 4YNYA 2H1PH 2DQFA 1RVFL 2KC0A 5AAMC 3D30A 3RWEB 2X12A 3ATFA 3C87A 4DP2X 2UY6B 3GMNB 5DMGC 1MJ8H 3QIUD 3H2WA 4MD4B 3FOLB 1TVBA 1YNTB 2D0FA 4Y16C 1URIA 1VFBB 2LTQB 1FVEA 2FATL 3S7GA 4P3CH 1N4XH 4W93A 3KEHA 3TVMD 2IVFC 1RIHL 1G94A 5JW3L 2Y3NA 4HW6A 1KIRA 4WV1B 1XL4A 4PMEA 1CURA 4ONFL 1C5BH 2O5XL 1FC2D 1I3GL 1WDAA 3CN1A 5HVGB 3SGEI 1DN0A 5C86A 1V3MA 3U0TA 5F7YC 1P5UC 3HZKA 3HC3H 3TJPA 3I75B 3KJ4B 3KM1A 4NO3B 3VI4F 5CFAA 5DZVA 2KDYA 5IQOA 3CSYA 5CCGE 2EVFA 2YSSB 3ABMB 4OLEA 4MQXC 1HL5A 2XFXB 3OKKA 2PCXA 3BPLC 4XXCC 2D7OA 1DJGA 4OSUL 4AH2A 4W4OC 4N2HA 1EIBA 3A67H 1DFBL 3FTSA 3TZVD 5ID0B 1KT2B 1SMAA 1DO6A 3O4LA 4LP5A 2JKJA 1EZLA 1U2YA 1TT6A 3B7UX 2GCYB 2W65B 3OKNB 1MNUL 4CGTA 5H37A 4NRZA 3RY4A 4I48A 3SBQA 5I5RA 3T1WA 4MAYD 2OTWA 4OBSA 3FMGH 1H19A 1R3IH 2FYYA 4O4YH 2P5WA 4AZ8B 2EILB 1DE4A 3CJJA 3IJHB 3UZEA 3SPGA 4XNYH 4GRWF 4PJGB 3SO5A 2VE6A 4R7DB 1CDGA 3VGAB 2WLYA 1XIWB 2PW2A 2PYED 4WEBH 1GPOL 4HF5L 5FYLD 1WIUA 4KKAD 3S3BB 4B9KC 1OOAA 3P2TA 4N6RA 3RL2B 4UIMB 4X2UA 2QKIA 3RZCD 1QFPA 4XO3A 3NSCA 5AW8B 2VLJD 1U41A 4LLVA 4JPWH 4KKCD 4Q56A 1X5KA 1BF2A 1OM9A 4HIJB 2R29H 3H85A 3EJJX 5GRJH 3BO8A 4ZMYA 1GZPA 2X4OA 1DVFC 4F5CE 2UWEF 1RUQH 3GIVB 1LDPL 4GIAA 3KG5A 3UTSA 1ZTXE 4N20A 5FWRA 2AS5M 5IROD 4XCYA 5SWZE 3SQOL 4LU5L 1FYTE 5FUOH 2QQKH 3DGCR 1T0OA 4H26B 3DROA 1SM3H 5GJSL 3LKQB 5EU6A 2XWEA 4E2OA 3ULAB 1YN6B 8CGTA 4H88H 4TSBL 1PD1A 4OZGF 4UZUA 2HKHH 3FO1A 3FU0A 2OX5A 3GSWB 2CO1A 1HCFX 43C9B 4KJPC 5DZ9A 3ZO9A 1P7HL 4CVXB 4KMLB 1N5YL 2PWDA 5K9QI 3SDDA 3UBXB 2VAAB 2Z34A 1X9UA 3LNGA 3HI6L 3WJJA 3RFZA 5IFAL 4MMZA 3IBOA 1S9KC 4P5TA 4XNQA 1KYUA 2NUPB 2OSYA 1DLHB 3L6FA 3O6MH 3QRGH 4HIXH 4OLXL 4R3SB 4KHXH 4Y4KB 3CFIC 2ZXCA 1KTDA 5G4NA 5BZWA 3V4PB 4ZZFA 3PNWA 4M1CD 3QFJA 1A3ZA 3FRPB 5CGYD 4HH9A 2YPVL 1WAAE 4NQEA 1W72A 4GRMB 5F3HB 4UBDC 5ACZA 4FRWA 4HQQL 1FWXA 5FC9A 3MCKA 1SHWA 3BX7C 3IJEB 3NTCL 1HINH 3V0WH 5IQ7L 5MENE 3NIGE 4PMFA 4MJHA 2MTPA 1NGQL 3R4RA 4Q0XH 4FXGA 4B41A 3QCTL 3THMH 4PWIA 3TOPA 4LSTL 1GZHC 2GW5A 4JRYB 1F90H 3QUMA 4WY7H 4LOUC 1UD5A 1UB5B 2Z4QA 4BUHA 2BXYA 4L18A 3QWOB 4MNHA 3U9UA 5KN5A 2CLRA 1DJXA 1O5PA 2V37A 1BHGA 3DDFA 2XN9E 2AXGB 3MLTA 3MA7B 3US9A 1ACYH 3D0LB 4NQDB 2QLVB 4Z3EA 3D09A 3X1BA 1QNZH 2VSKB 2D7TL 3QNFA 2BHYA 4FTVB 1BG1A 3J07A 3ABLB 5KVDL 2F7PA 5C0FA 3QQ4B 2EXYC 1I1YA 1TU2B 3KBPA 3QZWB 1PZ2A 1ET5A 4ZD3H 4D7BA 3HCVA 4FL4C 4M1GL 4QLWA 3FF8A 4PJBE 4KKBD 4JAMB 4JO1L 3ARDD 3VWJD 2HT3C 1A7PL 5C7XH 5DEGB 1I3UA 5D71L 2YRZA 5J8OA 3MLSH 1E28A 1AO7B 2WN2A 1IJ9A 3MJGX 3U82B 3FH8A 2FO1A 1BG9A 2CE6A 2DQGL 3L3OC 2C1OB 3LKSA 4PUBH 2FO4B 2GBTA 1Q0XH 2F7QA 3VACA 5CCKH 1GZQB 1ZAGA 1TOXA 3SE3C 2I27N 3KCWA 2BDNL 2X40A 3VW3L 1JCKA 1UWXK 4JO3L 5FW8A 4DUWA 1WITA 2FX8L 2HJFA 1JZ8A 1WD9A 5E00B 4JFEB 1TSRA 1YEWA 3VXUD 2FO8A 5B7MA 5A6IA 3RIAF 5C71A 1NPNA 1RI8A 4HCFA 3KLQA 1ONQB 4Y9EA 2V7NB 2ERJB 5DTFB 1AYRA 4N9OB 5E0FA 1LEKB 2VDLL 3LDBC 5T3ZE 4ZTPL 4BSVA 4F33B 3G6JA 2VLKE 5B1JC 3MDJA 1ULVA 3WYRA 2F5AL 5EWIH 3X12A 5T5NF 4AL8L 4N9GA 3F7KA 2DBJA 2COQA 1AQKH 2HN7B 3QIUB 4KK9C 1BMWA 1JGEB 1U91A 2E4FA 4AGNA 1MRCH 5E94B 3SDCA 3WO4B 3GBML 4NIYE 1UA6H 4JKWA 5D7JA 4JL1A 3BP4B 3TEWA 5E6UB 4D9QD 2OR8A 2ATAA 1MXDA 1LWJA 2L7QA 2I7OA 4OY9A 4F2EA 3OKDB 4PCKA 4GRLB 3ES6B 3LEXA 5IGXH 1D5BA 1IZJA 1RAMA 3FN0L 3TYGH 4P49A 4R4BA 3TYFA 5DVPA 5DVLA 5HJ3B 1L9NA 2YD6A 5KEZA 3GHBL 2OCCB 4S1SH 1KF9B 5CEYA 3RU8L 1U92B 1R3LA 4AQEB 4AYSA 3T08A 2FBOJ 1RUAH 4J3OG 4U1GC 3TF4A 3I9AA 1BZ9A 5BRZA 3AMKA 5BOZG 2K8QA 3AWEA 4G6ML 4OLYL 3TN0A 4XP9L 1OQXA 3N0PB 5TQ0H 3SBPA 5A2LH 1RUML 4A6YB 5B39A 2F8IA 1XF3B 1XD1A 5AVZB 4F8TA 3O45B 2VUKA 2DMBA 1BMGA 2Y6SD 1MG2C 4PJEF 2P8LA 1TJGH 2Y2TA 2DM7A 2BVPB 1AGDA 2FQEA 2HCZX 1CICB 4NN6C 5L9DH 1E6JH 1XH3A 4WENB 2Y0SA 3S48A 2R1YB 4RBPH 1I8MB 4HIPA 3UYRL 4NZTL 4GKZA 4N2AA 1AGFA 3SPVB 1MCCA 4JANA 3CX2A 1N0XL 4IMLA 3O3UN 1OP9A 3G5XA 3MRNA 2H2PC 3CCHA 3QPKA 2IH3A 3VQ1C 1A21A 1BBJA 1M1XB 2MOVA 2X89A 5LXVA 2ICWJ 4ZO7A 4XMWA 2YRLA 4YHKL 3TWYA 2LLNA 3SE4C 1U3HD 4TYUA 3NIDE 2ZCLL 5FKPA 3RWIA 1RPUA 1MAMH 4RMSA 4DP8X 4L2LA 4M62L 2APSA 4R2GD 2R29A 2AJ3B 4DT2A 4U6XA 2V3FA 4XBEL 4NQSA 3ZE1F 3VD2A 4NXKA 3WKQA 1WFNA 2OYLA 5JHLL 1HSAB 4AKPA 1S7RA 1IGFL 4N2KA 1RU9H 4Z0XB 3TEZA 5EC2A 4TQHA 4LF3B 1CG9B 3OD3A 1AZUA 1L9QA 2DM4A 4WFED 1TQWA 3DETD 5CR8A 1LHZA 2Y5TA 4JO5A 4EKJA 2EADA 1PG7L 3WCYA 4LKXB 1SOQA 5IR1B 5HJBA 4JVPA 4F7TB 1CFTA 2X38A 4X6DB 1P9MC 5JQ6L 1K85A 2C3GA 3GZKA 2OK0L 4CC4C 2B9AA 4ZSOB 3DUSA 1OB1B 2XETA 4XGZB 3MRBA 1FAIH 4XCNA 4Z7VA 5CF3A 4ISVA 2EYTA 1O9VA 4PR5B 5SWSB 4KK5C 1MEXL 4YO0A 4CBZA 3A6CL 5HY9A 5D1QA 4OFYD 4ENZA 2GT9A 3AM8C 3CX5J 3ASWA 4X4KA 3LKPA 2W60A 4AIXA 3F05A 2DJMA 4P4KC 4YPGA 3EO1B 2WK2A 1KPRA 2YK1H 1SN0A 3QUYB 4OTXH 3ZXAC 4HU8A 2VW4A 3QO1B 5LLIC 1LO4H 1N64L 4Y1AE 4HGKC 1G7QB 1SOSA 3MV8A 1NMCB 2J5WA 3FCBA 2A3TA 3TNMA 4BZ2L 1ZLVH 1PZAA 4ATTA 4UQ3A 1BFSA 2XN2A 2R0LL 1A4JB 4J6RH 4GAGL 1BYPA 5EFIA 1FG9C 3GTNA 3QCVH 1XSOA 1J48A 2ORBL 2VO5A 1A1OA 4BGLA 4RH4A 3CZEA 4WWPA 2W88A 2HWZH 3RKPA 1NCIA 3V9CA 2VSMB 1E2ZA 1RK0A 4JY4A 2W80C 1W0WB 4POZC 3SKJH 2HUHA 5BQ7A 1HXYA 2MQ3A 2EEAA 3MXVL 1KCWA 2GSMB 1JE6A 2ALWA 2OMZA 4PTTA 3RX8A 4F9LA 5SWQB 3KLHC 1TCRA 2AK1H 5GGVL 4GBXB 4OCWL 4TSCH 1PCSA 1U8QA 1KEGH 4U7MA 2C7UA 3BFWA 1VFOA 2QEJA 3QEQE 4N0RA 1KJ2L 4PJFB 4EMZA 2QPUA 4HBCL 3F5WA 4NJ9L 2WWMD 3FSVA 2F68X 1XF5B 4I3SH 4YHZH 3LSOB 4AYGA 4HDIA 4J23A 4WO4D 5E6ID 4DOHE 4YSUA 4XMLL 1RUPH 3P69A 3F04A 1HIMH 3O4LE 1OGAB 4AJWA 2A9MH 3HPLB 4DCQB 1SHMA 4CVZB 3F7LA 2JB6A 1A4KB 2X2HA 2YSTA 1NDMA 2WUCH 1WS8A 1KIUB 3HBPA 1VRSA 7FABL 5H4YA 2A0LC 5KAQF 1VERA 4GJTB 1ZLDA 1ZA3B 3X17A 3OR6B 4R7NB 4NCC1 5DRNB 1FC1A 4YSQA 1MFUA 1ZVYA 4Y9BA 5ISZA 4B3VA 1AQ8A 1SEBA 2QSCH 5CM1A 3GB7B 3MNVA 1G6RL 1N8OE 4JR9L 1IEBA 1PIFA 4FNPA 5D6CA 5I66B 3PU7A 5LBSH 3HG1A 3TV3H 2VDMB 3MXWH 2NLJB 2WBJD 3PDOB 3REVB 1S8DA 2HG5A 5J6GA 1ZEAH 1B4JH 4YXHH 1LO3H 4KQ3L 3NQIA 3FFCA 2PP7A 3HZVB 3QXVA 5F7HA 4U3XA 3PAUA 1QBLL 2WZPD 3UTSE 3GXDA 1OTUD 1FRGL 2R4SL 2OSLB 2UYLB 2JJVA 1ND0A 1UM5L 5C08A 3NH7L 5J6HA 1RCYA 5G4OA 2VITB 2WD0A 4L23A 3DV4A 4OCYL 1VIWA 5I1DB 1LP9F 1CXEA 1WFJA 3KS0J 4UIKH 3CAFA 2GK0B 1MWAB 4NN7C 4Y8DC 1MQ8A 1U93A 3B56A 5JLZB 3QSKB 4GFXA 3DMMC 4LCWD 4K94L 4QHKI 3L17A 1HWWA 2HJLA 4AEHH 1T1WA 2BNQE 3U4BH 1DP0A 4OLVH 4P04A 4QY8B 3D69A 1CJYA 1Z3GL 5KVMC 1TLKA 2JE8A 1MFBH 1Z9OA 2XACC 3R7QA 3GWJA 3L5XL 2EDYA 3KL3A 5GGVY 5KYYB 1G0XA 2FL5B 2QKSA 3CFDB 5FW7A 3ZMEA 1HNFA 4WW1A 2YR3A 3TT3L 4OI8A 3KR3H 2ZZUT 2CUIA 3CK0H 4P05A 1TJHH 1UXMA 5TDNB 2DEWX 5DD0L 2VO8A 1MF2L 5K93A 1SUHA 4CSSA 5JPMA 1T2JA 5CSZB 1H15B 2BO0A 5FYKD 2HFFA 3IN2A 4HZLA 3T77A 1M7IB 1A6VH 2DQEH 2HAZA 1ZLWK 3GSNL 1MCKA 2FJSA 4NQEE 3BDYH 3L54A 3NJIA 4PM1A 5JIPA 1OSZB 2W91A 2Y7QB 4IU3B 1IGYB 3ATDA 2OSWA 4M7KL 3MRIA 4Y5YA 1UURA 1NCAH 1JPFB 3B2VH 3FU9A 3V0AC 4HJGA 1GOHA 4AEEA 4XBGB 3WNPA 3RTQC 1AGEA 2E56A 4B95C 3FHQA 4YPJA 4LSVH 4XTRD 4XPFH 2B1AH 4NC0B 1QPKA 4HA1A 1FO0L 2H5UA 1RP9A 4NM4H 4OD2B 1T6VN 1NCCH 4AV0A 1KJMB 4YDJB 4RGNB 3T2LA 1ZJBA 4RRPM 1KXHA 3HAEG 3H56A 4QF1B 5DC9B 4IKNA 3IFOA 1F58L 3QNXB 3ZHLA 3DPBA 3BISA 4L1DA 3P9MB 2CKNA 1FZKA 2DWDB 2OMUB 2MPAL 2RQEA 4G1MA 3KPNA 4MB1A 4M5TA 5EU4A 3SIKA 3CFTA 1TEYA 1I9RL 5DJ6A 5B38B 3QEUB 4RFOL 3BCFA 1H3TA 4WU7A 5IW1B 3T3PB 3ULUL 2DIBA 2YAMA 1P84J 4WWKC 2W38A 2P28B 2FEDC 4XZUB 5DZAA 3D18A 4JQIL 3R1GH 4OKDA 3SPIA 1GAFH 3FO0L 3I6LD 5J11C 4N0UB 5A3ID 1AS8A 1YYMH 5DQDH 3X3FH 3BC9A 3FUMA 4YDVA 3V6FA 4XB3A 2BFVH 3GGWB 3VSUA 4K5LA 4ANXA 5EEZA 5CD3B 3HUJE 1OSEA 4LLQA 1ZHBA 2XKSA 4P3DB 3EFOA 1KCVH 1BREA 4FJYA 2OXHB 5G5DB 4WFFD 1NWOA 4MD5B 1OP5K 1FAKT 4RGOH 3H9SB 1MCWM 2L7EA 1TYRA 1X5LA 2NZIA 2W92A 3ZZSA 3IDNB 4H8VA 3PY9A 3TL5A 2VXQL 3M7OA 1B90A 4FERA 1CZ8L 1JJUA 4K3JH 3KYMA 3V8OA 3O9WC 4TUJB 1WZAA 5L6YH 3G6JE 3E6HA 1UZ8B 1J0IA 3SDYH 1YMMD 4B6ZA 3UBGA 1RHHB 3HPJB 1IL1A 3FHEA 2O5YH 4AGQA 1DHKA 1J0ZA 2VXSL 4AQZA 4ELKA 2NY1D 3O3AA 1RFDH 2Z91B 2JQMA 3DX9A 4W6YB 5DA4A 3IFLH 2Z8RA 4PU2A 1RJLA 3D3VE 2X4TA 3MRPB 5CJ8A 1WC7A 2X4NA 4XCFL 3FAXA 3ILQD 4PG2C 5GS3A 4KXZH 5C92A 3WDHA 4JDEB 1S7SB 1J1OH 2XN0A 3GSVA 1NEZG 1NCOA 1QA9A 3KCPB 2B39A 4HIHA 4LDLB 3TBYB 3MREB 3GI8H 1F41A 3M07A 3MNZA 4Q9RL 2IV8A 4B9ZA 2Z7UA 4CVWA 4RRPG 4MD0A 5E4OA 5BRZE 2OV0A 3OX8B 2EUXA 1SEQH 2OS7A 2GHWB 4UINH 1INEL 1XCWA 4P9MH 2BK8A 3RUGF 1G7HB 1EEQA 2W0KA 1Q9LB 1UHVA 5DLML 5BVPL 1HEZA 3MRKA 1ZSDB 3N85L 1QSVA 2J6EH 4QWWC 2X05A 2X88A 2YKKA 5TK4A 1ZIBA 3OTTA 1NC2D 2VDOB 1YEIH 2IC2A 1FVCA 1KSRA 1I9JL 3TGXA 5IB5A 1XX9C 3DX6A 4LLUB 4QKXB 4WI6A 3QUXC 5DUBA 4FFZH 1RXLA 2X28A 5E2JA 4X50A 4U1LA 3QDHA 3VWKD 2KERA 3RWFA 2AQSA 1WFMA 1UADC 2BS8A 1CBVL 4UDTB 2DDQH 4XNXH 1RY7B 2DWXA 2ODIA 2WMPA 4DESA 5I1CL 3GHEH 5LBSA 4AY0A 2DV6A 1VLXA 3HTLX 5SX5H 2A77H 5F8RC 3VU2A 1DUYA 3BAEL 3SOBL 3TCLA 1L3WA 2JJSC 2NY0D 5DUPL 5HGBB 2E27H 3FJTA 3STLB 4QIRA 1UZ6F 3G5YB 5IBUG 3C60C 3QQDA 1OSPL 2XTJD 1OEZW 1Q1PA 5IB1A 5K5YA 5H37G 4MBOA 1XV8A 3UCRA 1QAWA 3WLWC 4A7GA 4NQVB 1L5GB 2UXTA 5TH2B 3V5HA 4LCWB 5KYXA 1NFDF 2E46A 5E5LA 1D2PA 3EOBA 4HS3B 3AITA 5DHYB 1FH2A 2HT4C 4NAJA 3G5VB 3OM3B 3ATEA 2HKFH 2KL6A 5EBMA 2FUQA 4ZFGH 1IM9D 4YBQC 2AF2A 4KDWA 4OCRL 3CE1A 1N5AB 1II4E 2NT1A 3KDPB 3HN5A 4NQUA 3UTPE 5IQMA 3GSQB 2P8MA 1Z0MA 3ZQWA 4FQQA 4KMQA 3DX4A 1FFOB 2GFBB 2LFEA 4X9YA 5HHOD 4IJ3C 4BSWA 4A7QA 1SBBA 5LNDA 1UWGH 3CXHJ 2EE3A 4CSZA 2AGJH 4MXQC 2KBGA 4RA0C 4HCRH 3MO1B 5ITBL 3MV8E 3D39A 4HS8L 3WL9B 1GC1L 1EJFA 1C8QA 1ORQA 4OD3L 4G9FD 4ETQA 2R0WH 2BOBA 1IKNA 2WXHA 1EAPB 3LS5L 3TC9A 1Q72H 4M02A 2QADB 4OAWB 4UT9A 4ZQKB 4K23L 1I8KB 3SY0B 4HT1L 1C5DA 3MSPA 4HPYL 4NB7A 1DQMH 5FIEA 4LSRH 3T8MA 3RB5A 5EZIL 1S9VB 4DK5A 1U42A 3E2HB 3JWDL 5ETUA 5K1JA 4Z8FL 2LLLA 4PGJA 1JWMB 3MGTB 3OMNB 1G84A 1Q94A 2F0CA 2WYIA 2YUWA 2VXVH 3U9UB 2YZ8A 4BA0A 2GEQA 1LK2A 4XMZA 1G43A 1FDLL 3QQ3A 3BSZL 1J1PL 2P24B 4PS4L 4YE4L 3FULA 3G6DH 3L13A 5EIQA 2YQ2A 3S37L 3ZKMD 4AV5A 3FU8A 5DQJB 1CLOH 4MXVE 3W1ZA 4GRWH 4PP1C 2W9LA 1KPUB 2ZNXA 5BUPA 3DIDA 3CFQA 3WNKA 5JDSA 5K1NA 3T2NL 4BFFA 1NCTA 3UGEA 1I1RA 3ECQA 5HP5A 3DXAD 5JUEL 4U1JB 1QFWI 2XRAL 2BOCB 3KXFD 3K2UH 4WO0A 4R8WH 4BQCA 2V17L 4NWTH 5E0QA 1B4RA 1QSED 5DJDB 2GSGB 4X8CA 1IFGA 1TTRA 2FWLB 2R51A 3TH2T 4B7IA 1YNTF 4M4RA 4YDMA 1DJYA 4PRIA 1HHGA 5IW3A 1BAGA 4UZGA 3LKOA 3ORJA 5ECGA 3MRDA 15C8H 1TTUA 2A4CA 3F64A 1KWGA 4QTHA 2IFFH 4PWGA 3F12B 3BUIA 5C0EA 3ARYA 3X14B 4M29A 4UNVA 3EG9A 3WXWL 5FYJH 5ISZE 3BUBA 4WV1C 2E76C 5GRVL 2K8MA 1N59A 1N19A 5E70A 1OV8A 3L1EA 4FZEH 4L1TA 5FX3A 2ZAHA 2GJZA 5A7EA 1RZPA 4U6HA 1E4XH 3HG1E 4ORGB 4EQ2A 35C8L 3CC5A 1PD0A 4YLCA 3HMXH 4NUJA 1QRNB 4R5TA 4UT7H 5TDOB 3NPZB 3PV6B 4EI5D 2N0MA 2EEDA 2CJ3A 3WNLA 2HLAB 3AU1A 2YPLE 3B43A 3FT3A 4KVNH 5I8OL 2BIOA 4JDVB 4OI9A 1JYNA 4KVCL 1TJXA 4H20L 2NY1B 1MH5B 2IMNA 5BS0D 4HJUA 3T3ME 2OMBA 5AL8A 3VI3B 4X98B 1JPTL 3GMQB 4RFNC 4B60A 2JCCA 4X7CC 2P7TB 3GBNH 4DAGH 3BP7B 4G6KH 2OULB 4PJGF 1G0DA 2N59A 4ODHH 4QRRA 3QH3B 4F80A 1KCSH 5J0BA 2KLRA 2Q7YB 5D1XA 3C2SA 4H8HA 3BPCB 2WKOF 3MBEA 4YFDB 1LVEA 1XIWC 4KTDH 1QLFA 5IB4B 2FT7A 1LO0L 4FXTA 4MNQA 1K4CA 3WD5L 3M1BB 1ZA6B 5DHVA 3H4HA 1NL0H 4BXVA 4F37K 4H7VA 4WUKH 3WJMB 3QUGA 2ADYA 2PETA 4HGWB 4XHJC 3C75A 4PRPA 1J7VR 4GAJH 4KROD 5FM4A 3VH8B 1AKJD 1VKXB 3UGUA 2NQ3A 2YEZB 3RE0A 5E9DB 4FTDA 3PXHA 2J6EA 3MCLH 3UTTD 3TH4T 1UD4A 4LHJB 4G59C 1OF2A 3T6VA 1QTSA 4XWOC 1P6AB 1S7WB 3W2DH 1WWBX 4IBWA 4MBRA 1Q9OB 2MNWA 2ZXDA 2XJKA 3DURA 1GMEA 4JE0A 3SEPA 2R0KL 1S3RA 1SJHA 5I8CA 4FYTA 4FFZA 3X3GL 4UQDA 3T0AA 5HI4C 4F58H 3F58H 4NYLB 1BFTA 1YPZA 3H3PH 3ARGA 2ZSVB 4EKXA 5CWSA 4FQ1H 2WINB 3FUHA 1MFCH 4LPYA 2XSKA 5A16B 2Z35A 3O8XA 4YHIB 3GJEA 2QDWA 3I02A 3QJVB 5C0RH 2GG1A 1AAJA 1VENA 2J2ZA 4LASH 2WXOA 4DPRA 3VRLF 1IGML 1R5IA 3FTGB 1UCBH 1HI6B 1A3LL 4Y4KC 1DANU 5B39G 2JKSA 3IJYA 5DK2B 4CN6A 3JWNC 3EFDL 3D0AA 3P11H 4GW1A 3ARBB 4PD4K 5H94B 4XNMA 4YEFA 4M7LL 1KYDA 5CEXB 4Y88A 4IMKA 1SLUA 1XR8B 1B6DA 3DX1A 3IRPX 1NCBL 3DSFH 3IDXL 3PWLA 3AGVA 2FD6H 4G5ZL 4JUTA 3BZEB 5AAMA 3T6XA 1YA5A 3B9KD 2WBWB 1E5ZA 5HGAA 3UEQA 2OMWB 3DX0A 5INCB 2X2JA 3TA3D 2A6DB 5DC2A 4RAVB 3CTTA 3OL2A 3G6AA 2FHFA 2Y06L 4TUUA 4Y16A 1YEKH 1QG3A 1Z5LB 5F9AC 1NKRA 3RVTC 2RFXB 2VN6A 4FNRA 1JGDA 2C9PA 2JNZA 2YPKB 3DUUA 4PRAA 4ZUWB 4WKZB 1FFQA 1IAIM 2XZQL 3LN5A 4V33A 1P5UA 2IQ9H 4G72B 4F9PC 3DJZA 5ANMA 2CKBA 1ZRUA 1AR1B 3VDCA 1A9VA 4Y19A 2FJGB 2WNXA 3FQRA 4NKMA 3US1A 3RB7A 4PY8I 5DI8A 3ECBA 1A7BA 3PAYA 3QARA 4YR6A 4BQ8A 3V6OC 5JHAA 1HL9A 2GTZA 3HEIB 1NCWL 4M5ZH 4M5SA 3GLDA 1PZCA 4HCRA 5DJCB 1AD9A 1SXAA 5JR1L 2DWEB 3A24A 4XXCA 5CU5A 3KLDA 4W4OA 4XX1E 3K71A 3L3JB 2DYPD 2WXFA 1K9TA 5C8JA 3T09A 4G9DA 3BP6A 3BW9A 4QHLA 2AJUL 3OC5A 5FK9A 2J8UF 3B5GA 4BQ9A 2CLVB 2IAMB 2X2UA 3P0YL 2E3VA 4K7FA 2A2QT 3FPYA 5JQHC 5DR5L 1F2XK 1SLXA 2FQDA 2VKXA 3A3YB 4RWYH 4QXTB 4JDZB 1PSKL 5AOZA 3QJRB 1KUMA 4L4TD 2VDQL 3PS6A 1GHFL 1V05A 3HI1B 3D48R 5D72L 5INDB 1MFMA 4F1SA 5GRWA 4DWHA 2RHEA 5IOKA 1DQTA 1FGVH 4CN1A 2CGZA 4DQOH 4R5VA 5C1MB 3P3RA 3RNKA 3NCMA 1BVKB 1BD2D 1LO5A 1T4WA 2GTWB 2D9QB 1VCAA 3LH9A 4ZS7L 3QDGA 5J1AA 3IGAB 3WKMH 2CDGB 2FX9H 3RJOA 1QWNA 5K69A 1KLUA 4DP9X 2ERJC 3PABB 2WAHA 4DFHA 4WSGA 3N42B 1DVFA 3I6KB 1LWRA 3MRQB 4LP4A 1NLDL 4EN2A 3WELA 4I3RL 5CUSH 2VDRB 2ED7A 2IANB 4X80L 1AMXA 4OFKA 1UGNA 5FA3B 3QIUC 2HMIC 3BH8B 1A6TA 5KSVA 1AQMA 1C08A 2X7LA 3WO4C 3TBSA 2ZJSL 1QKZL 1U0QA 3EOTL 1F3DJ 2JB5L 3KLAB 3BE1L 2Q86A 2MCMA 3L5WA 5E99L 2YD8A 4PJ5A 3B9AA 2V5TA 1LO2H 1E4WL 4GRLC 4Z7WB 3MJ8B 1R5WB 2PPEA 4OZGA 2QPEB 1QR4A 4HHWA 5DJ8B 4ZUSA 1RD6A 3MACH 4NNXB 1KIQB 3UTOA 4MA8L 1WBYA 1BQHA 4WI0B 5A1AA 4M6AA 3WHE0 4FZ8L 5KZCD 3F7YB 3JTSB 1DVTA 1EAOA 5KBNC 2C9RA 1DDHA 4QXUL 3HMXA 1MCJA 3FAWA 4NNYA 1UXWB 4CUCA 4F8OA 3JVGC 2Y24A 3Q6GL 1NZRA 4L5FL 1IC7L 5KBPA 4FLSA 4L3EE 4TOYL 1PKOA 3BZ4B 5A43C 2X6VA 1CK0L 4DN4H 3CLWA 5BS0B 3HJ0A 3KNBB 2EDWA 4ORZC 4N8CL 1T0NB 4DEWA 2AK4A 3OC8A 3P73A 5ESQA 2X2IA 4DN3H 1U8NA 3HMWH 1CICC 4JFDE 3C5SB 4D9LL 3IMSA 2YBRB 3P54A 4R96A 3GHPA 3CSTA 4G80A 1JN6B 1JZJA 1WUZA 5AZEL 4HK0A 3VMOA 5ABDE 3TTYA 1TG8A 4BWUA 4AYEC 1N2RB 1YSOA 2QZQA 4AT6B 4FI6A 4J1UB 3HC0A 1YY8B 4NRYA 1S9WB 3AJ7A 4K2UH 1F1GA 5A6MA 2OA9A 4LLMA 3IDIA 2WSKA 1ASPA 1TJIL 1I7UB 2YUZA 3SBWC 4APQB 1G1CA 1G9ML 3ISRA 5I6LA 4KKCC 1BOGA 2X3CA 2OYPA 4X9IA 3LRSB 4EQ3A 4AIEA 1PAMA 3A4AA 1WFOA 4EOWH 3GMLA 5JYMA 2JLPA 2XIDA 3L9RB 3NSYA 3NZHH 4TSAL 5F7FA 2PTUA 1QSFB 3VXPA 1FUNA 5CLTA 1E2WA 2CR0A 1TQBB 1KZQA 4AMXA 5IROC 4JHWH 5TFSL 3W38A 3K2MC 1NEZB 3EJUA 3GJFH 3GMRA 3L2LA 2MKLC 3I3BA 4GLRH 3K4ZA 5HVFB 3LV3B 4ZDHB 1A7QL 3EJYD 2YZ1A 4HUCA 3ZMNA 1T6BX 5T1LB 4D3CL 3VFPB 5E1AA 3S4SA 1FH5H 2OTUB 3SDAB 4YK4B 1IBFA 1EV2E 4R83A 2Z31B 1X9LA 4KTEL 4YNYB 4R90L 5E9AA 3L3OA 3W9DA 4G8FB 4M6MH 4P2YA 5HHXL 1GYWA 2GABA 3OB0K 3QJTB 3UZVB 2WXPA 2DD8L 2EDHA 5JXAL 2XA8L 3SE3A 2HVJA 5AB9A 3CZJA 5LUMA 3RWDB 2DH3A 3ZSSA 3IGLA 4L29A 5KTEH 1CD1A 1MFDH 2HFGH 5HYJB 4KJYA 3FQXA 4RMTA 3RDTB 4M1CC 4N2FA 1RMFL 5KYNA 2BCKA 5CGYC 4KJQD 5DMJB 5L0QB 1K3IA 3QUYC 2P46B 4K7PY 1JNHA 1KIRB 3EW3B 4WFHD 2EYSB 5KJRL 3MV7D 4OVVA 3OZ9H 3P9WB 3MLXH 1NMCC 3B1UA 1B3JA 4WSJA 5T1KD 5B1JA 2W0FA 2B0SL 2K7PA 3O2DL 5KS9B 2VYRE 3KS0H 3AT9A 3ZE2B 4KNUA 4DKTA 4MMYA 4WWOA 2A6KA 4PRIE 4LSSH 3OKKB 5AOLA 5H35B 3GZPA 4TVPL 2IPUK 2UY7B 4M8QA 4F20A 1NCNA 4LNRA 4B3EA 4E9QA 3V4VL 4Z7UA 4J4PD 1BJMA 3O3EB 3AG4B 1E65A 2IH1A 4ZPVA 4Z3GA 5IBUB 2H1LM 4WVRA 4IU2A 2AC0A 2C5DC 2ZYIA 4TRPL 43CAA 1PZUB 5B7EA 1QPPA 3FL7A 4NRZB 4NWUH 3VXNB 3HN8A 2H7WA 4XVUD 3HFMH 1KTKE 3ULVL 4C56B 4GBXC 4CKQA 3MBXH 2YQBA 4HXBH 3WJLA 1DE4B 1E5CA 4OB5H 4MGXA 1N6QL 5EU3A 2ZOLA 4W6XB 4X5RA 4G1EB 4P5KA 1GA2A 1HOCB 1UWEH 1GSMA 3FT1A 4HAGA 3GTTA 2V9UA 4X5WB 1LEGA 1MJUH 5JNYB 3F84A 1ROWA 4KKBC 2QKIB 4I2XE 3VWJC 2GPZA 1OIOA 2ITCA 4IDJH 4YGVB 5ESVA 2BSTB 1CF8H 4ZW7A 5MEOA 2E6JA 4R9HA 4FS0A 3BQUD 1VHPA 3VM5A 1OCWH 4UT6L 2JCCE 1G7PA 1OGTA 1GZPB 4LVNB 4ZAKB 2V6HA 3CMOL 3GM0A 3QI9D 4JN1H 4OJFL 2Y07H 1MCOL 5BZDA 1Q1JH 4DKFL 3CH1B 1PVHA 3ALWA 4QRRE 3RIFF 4JFYA 4K9EC 1LE5A 2WGXA 2COVD 4QNPF 3O3DA 2D7QA 2ZCHL 4KPHH 4Q7DA 2YAQA 3MRGA 5AKSA 1JPGB 4A7VA 4LHUD 1CTOA 5EU6B 2C4XA 4G2AA 4APXB 5EU7C 1I1AB 4XVJH 4MNQE 2WP3T 4BHUA 4OKVA 1TYJA 3SE4A 3QPXL 2MHAB 1OAYH 1DQJA 3JV4A 3SQRA 3GLAA 3VTTA 3F6JA 3NGBB 4I8DA 1NAKH 4XX1G 1DUZB 3VFWB 4PRPE 3ZUNC 4S1DC 4U6VL 1YEJL 3LJ3A 3B8SA 2NY4D 4YAQA 5D7EA 3DV6A 4XNQB 1E43A 5E95B 4ETYA 2IBBA 4DFIA 1YEGH 5HYIA 1YEFL 4ZFOA 3S8FB 4BYHA 2R56L 1X5JA 1JNLH 3HRZB 1KYAA 3QFJB 4Z77A 4O58L 2EABA 3MAWA 3DO7A 3EGDA 4LEBA 4YHLL 3HRPA 1BPVA 1CTNA 2D9CA 3HHSA 4LAQL 5TE4H 3EYFA 1SXSA 1YPZE 3LEVL 2CGYA 1P9MA 2FJFA 4PJHB 3MRJB 4NKOB 4YLBA 3VD5A 4CC4A 2XWJA 5DHEA 4ZMOA 2YGPA 3VSTA 4QRSA 2G75A 2JCWA 2CA4A 1VEPA 3U1SH 1U30A 1H0DB 2D3VA 1F4HA 2WQRA 2WQSA 1HESA 4JDTL 4PJCA 4LDEB 1XAKA 2YOCA 1GW0A 4F3FA 1U4EA 1UATA 2HVKA 3H9ZA 3DIFA 2I69A 1KN2H 3A22A 3QW9A 3DTXB 4P4KA 5TD4A 4OLWL 2PW1B 1B2YA 1XF4A 2CH8A 2VR9A 3KL5A 3MMEA 4WI9A 1P7KA 3C8DA 3ISWA 3LN4B 4DGUA 3PP3H 2VQTA 1GKEA 3NA4A 4EIUA 3TO2A 3QT2A 1QI5A 3WS3A 2Y7LA 4X5QA 5GRUL 3ROLA 3DBXA 4ADGA 4GMTL 4QUOA 5BV7C 4MA3A 3MA9H 4H8WL 1BLIA 3CUPA 1IC4H 4ONOA 1HCZA 4WLCA 3QG6A 1RPQA 2OR7A 5D1ZI 5IHWA 3HCVB 5DS8A 1A0QL 2HXAA 5SX5K 4DKEH 3VGBA 1QI3A 5E08L 3VXSA 4KVPA 1BQKA 1HKLL 2BNUA 1E6OH 2EVIA 4KY2A 4RGNC 1KNOA 5E9NA 1AJ7L 4R2GC 5LQBH 2PLTA 5ANME 2LR4A 4ODUB 2IJ0C 3LKSB 4Y19E 5DQ9B 4Y4HB 5JO5A 1SN2A 4R6UA 2H6PA 3VI4E 3ESPA 1FSKB 3FFDA 6FABH 1CTMA 5F6HI 3SGKC 1M6OB 3DETC 3GJFA 1WYJA 1J5OH 1C5CL 5EZPA 5JW5A 3HZYB 4DK3A 1KGCE 1SPDA 4Z1PA 3CFKA 2P5ED 3U2JA 4NXSA 3LAFA 4Q4IA 1PY0A 1UVQB 3FB8A 3D87B 4GG6A 4HPOH 2FEJA 4J8RA 3X12B 1MIMH 4TUOB 2IV9A 4XAKE 4H40A 1COBA 4FG4A 5ELIA 1A1NA 3ECUA 2E7CA 4WJKB 3SJVD 2X4UB 2Z93B 2QV4A 1F4YH 1MVUA 1TTBA 1A6WH 3FTVA 1CWVA 3GNMH 3HS0B 3KYKL 3N41B 3QEGH 1JHKL 3FPXA 1QWHA 3GPSA 4MNGE 4Q6IB 2ZUXA 1ZVSA 5F1NA 4GRWE 4OGYH 3Q05A 2UX7A 1ZE3C 1YECH 4JO4H 4KUZL 3EYSH 4ZW6A 3BWAA 5L4IA 2EDLA 2WQXA 4YSRA 3QDGE 2Q76A 3PWVA 8FABA 1SJEA 4NPJA 1UM4H 2X1WL 1BFOA 2DQHH 4LOFA 5LXGH 1EPFA 2WY3B 3IVKB 3ZL2A 1ZTXL 5C0AA 5GISH 1G7LB 5T8IA 3RVWD 3QP3A 2UWEE 1XCTB 5LN8A 2DQTL 4XX5A 2VM3A 3B7SA 1XFPA 1CVRA 4ENED 1W9XA 5B39B 4HLZG 4WSKA 1F2QA 3DMMA 5ADPL 1YQVH 4UTCA 2A9DA 4N85A 4YLQT 4G8GB 4PJ5E 4QMEA 2QPSA 3W5MA 1SN5A 1I7ZA 3HR5A 4OZGE 5CKGA 4UAHA 3BKCL 4ZX3A 5FYJE 5IJBC 1JHTA 1AGDB 2O5ZH 1AZNA 1XH3B 1OM3H 2O93L 3PHQA 1M9WA 1E9QB 2B16A 4GKZB 2SEBA 4S2SA 1J8HA 2VXTL 2AJYH 2KZKA 5BUGA 4MMXB 4BSJA 1E27A 2MMXA 3IAQA 3ZTJH 3SCMD 4YDLB 3IGKA 2WTRA 4YMPA 3CCHB 1DQQA 2IH3B 2AABH 4ZS6C 4ZPTA 2RQ8A 1R4XA 3N43B 5EN2B 1YUHA 2FZ3A 4O51B 1R9FA 1LK3L 5FKPB 4OW6A 2XV2A 1AIFA 2ZE0A 5BVJA 1ETZB 1P4LA 4JY5H 4U6XB 4NQSB 3DLQR 4HEMA 4LHQB 3OR7B 5FGCE 1O7SA 3BKYL 4HFUH 3NG5A 3RTQA 4ZTOL 1MFAL 2VDNL 3FSWA 3SKUD 4P23A 5JIQA 2F53A 2OI9B 4QOKD 2B3IA 1MLBB 5I1AB 4JB9L 1HEHC 5BW7C 1NFKA 2MOQA 2Y5TB 3LRHA 4V1DD 1X5FA 3RWGA 3IU3A 3L16A 4AI7A 2OYMA 3QUZD 3QEHB 2UUDK 1M3JA 3HZMB 3MRCB 4E41D 4EI0A 2WXJA 1U8PA 2X44D 5EULV 1VESA 5EPMA 3MRRB 5KBKA 1FE8L 1H3PH 2VR6A 2Q8BL 4XC1H 3PWNA 1MW0A 3PL6B 4Z7VB 4I77H 4Y4FD 1DLFH 2N01B 3MOAH 4MJ5A 3FT4A 4R84A 2XC8A 1DJSA 1QFUL 3BVDB 5HI5D 3U36A 5D1QB 1E3FA 2R7EA 5LNGA 2QPDB 3U46A 2PCFA 5A2CA 5C0IB 3UYOD 3CDCA 1TQCB 1FCGA 1L7IH 4J3VA 4WWKA 3WNMA 4OGQC 5F96L 2A1WL 1OLZA 3JTBA 5ACMA 5FHAH 1YNKH 3RKDD 1KY6A 2WVSA 5H2BB 2HLFD 1BLNA 2VSDA 1WZLA 4Q2ZA 3TNMB 4FQLH 3IETB 2H6UA 4LARH 3FQWA 4X6EA 3LNFA 3JBG7 4FQJL 3EF7A 1NICA 2E9WA 1BIIA 2B1HH 3CDZA 3VRIB 5AALA 1CGXA 5D4QA 5TJWK 4H13C 1OO2A 5C0BD 2PCYA 3K46A 2R69A 2XQYK 4JG0H 1TZGL 1X6LA 3BAYA 3D51A 5F7UA 1I1FA 4KXCA 3W0WE 1UC6A 4PLKD 3UFIA 2OMZB 4P2RA 1CQKA 2ZOKA 4PTTB 3WEXA 2GC4C 5EBWB 3O9WA 5K1VA 3EDDA 2D03H 5JHDA 1CFNA 5I5MA 2IWFA 2QADC 2EVJA 3F7QA 1B2WH 4BEIA 4HC1H 1UA7A 3F5WB 3ULVD 5A2JH 1KCRH 2NW2A 3GSRB 5I0YA 3GDBA 3E2HC 1XEUA 2PPDA 2ZCKL 3P1VA 3LOWA 1K8DA 1YC7A 1IGTA 4HKBA 4RX4A 3GXPA 4PG2A 4WUUB 2GJ6A 5CXPA 5H8DA 3VUAA 2BP0B 3LXAA 2OW6A 2EIDA 4PJ9B 1ZT4B 1CLYH 3TJEH 1EBPA 3CN2A 2NX5B 1AD0A 2NW3A 3WIHL 4LPTA 5HDQL 1FL5A 5M94B 1W80A 2ZNWA 3F6IA 3C12A 4DGIH 3TIEA 2KI6A 3RIAK 5C09A 1F8TH 3EGSB 4PJAB 3K91A 3LPFA 5TPWH 1JK8A 4NM8H 1X5AA 4ATWA 4KKPA 2BRRL 3S6CA 2VDQB 2ZXBA 3Q3GA 4IGBB 5EDXA 3UG3A 4AUYA 2XWDA 3MODL 4EDXA 2X53A 4K3EH 1QZ1A 1U8IB 2ADGB 5DVOA 1HH9A 2EECA 1S78D 3K5SA 2JLLA 2W07A 4MDIA 2XKNB 3KPMB 3NPSB 1QFWM 4X0KA 3RUGA 4P5MA 3ZQ9A 1P69B 1S8DB 4EDWL 2HG5B 5TQ2H 3FUIA 3WS6C 2QGBA 4AMKH 4G6AD 4PIBA 3FFCB 3QUXA 5JXEC 3LH2L 2OL3L 4R5XA 5DF0A 1Z0NA 4ELDA 4QD2E 3MROB 4K3GA 4HG4K 1X7QB 4Q97A 1ND0B 1S7XA 1P4IL 2A99A 1J05A 4L1HA 2BNRB 4AL8C 4WI5A 4AG4L 5CHNA 4M93B 1TETH 4CDGC 1N6UA 3U7WH 5KYUB 4EZJA 2BVOB 4JO2L 1CXLA 5EU5B 4RWHA 2HJLB 3OHXB 2YLHA 1JHLL 1SF3A 2BHZA 3MOBH 1WCBA 4LSQL 3PWPA 3VGDA 4B0MM 5I1IL 3VFMA 3D69B 3V4PH 3JWNH 2JJSA 2AMGA 3FTXA 5EZLA 4RMWA 5ID1A 1WTGT 1NBZB 3VI3F 2OMVB 3C60A 5IEHB 4KI5D 2F9BT 1E7UA 2OCFD 3ZE1E 4XMPH 2EE0A 2H2SD 2NY1C 2AXFB 3FT2B 4AQAB 5FDWA 2X09A 1V7ML 5D7LB 1CR9L 1ECZA 2PXYB 2YQ3A 4A38A 1RJZB 3IDUA 4K07A 4FA7B 5AD0A 7PAZA 2HFFB 5IWLC 2ZQKA 4L4VD 5DGQA 5F7MC 2GEEA 2XXGA 5CN2A 5B4MC 3LPPA 5C6TH 1HHKB 3O6KL 1AZCA 3JT0A 3KYOA 1NFDA 3PP4H 3FB5B 3QHTC 3RILA 4N2CA 3RIKA 5EO0A 1AGBB 1A9EA 3MRIB 3MV9E 4J3OD 4QO1A 4XMXA 3DVFA 4YL4A 4JM4L 3WUWA 5C07A 5E2UH 3DJ9A 3W11D 1IAOB 3SCMB 1NUGA 2JI1A 1SOXA 1BBDL 4EXPX 2MIZA 4ERSH 5E8DL 5I1LA 1AS6A 1EO7A 2DIAA 2NR6D 3FCUB 3IJ9A 4KKNA 4HVBA 5FAAA 1P1VA 2R4RL 3AXHA 5AVQB 1NC4D 3FBKA 4LEXL 5AAPA 1TNMA 4H25B 1FN4B 1K4DA 4FHJA 2WV3A 1BQLH 1A3RL 5LN4A 4DTGL 1NMBH 1QVOA 3BRDA 4DO6A 4QRUA 2VISA 3QA3A 4AWJC 4XN5A 1XTMA 3IJ7A 3SYPA 1ZPUA 3PQYA 4N0FB 5IQLA 3UOAB 4NAQA 5I8KH 1TCMA 3H9YA 4Z7OB 2YD9A 1K6QL 4IBSA 1BDYA 2F7IA 4MRBA 5FECA 1OTTC 3HNSH 5AVUB 2XG5B 5HDOA 1JXDA 4PVMA 1BQHG 1CLVA 3BMVA 1HQ4A 2IBGA 1PYWA 4GXVH 1FPTL 2BSSB 4S11A 3JWOC 3KPRA 5HDBE 4E41E 3KPSB 3WXVL 1D7CA 4GQRA 4M7JL 5E1QA 1CE1H 5GS1A 2X1OA 4MCZA 2Z8SA 4IRSB 2VLLB 4CA4A 2FT8A 2I5YL 2V3EA 3U1PA 4KZEL 3B2MA 2H41A 4YQXL 2RA1A 4GSDL 4F57H 2WKGA 3ARBC 1RZFL 2FCBA 4LLQB 5K39A 3L3IB 1HJCA 3KWTA 3AZUA 3BGMB 3E38A 4Z7NB 2IF7A 3NJLA 1NFIA 1F6LL 1FLRH 2KQNA 3EBHA 1HX0A 3W5NA 1X4YA 3WFBL 1X3DA 1NIDA 4D9RE 4XO9A 3ARVA 1XR9A 3RWEA 4MXWH 4PGDA 4KXZI 1UFGA 4PJBF 1F3DH 2UY6A 2WM0A 3GMNA 3SE8L 4ELMA 4ZMXA 1UH4A 4MD4A 3FOLA 3MRMB 1UA3A 3IWUA 4TKWA 3GS4A 1M2VB 2ISDA 5I1KL 1VFBA 3L8QA 5D96B 2HJKA 4P9HC 1KENH 3BXNB 4HMDA 3P4OB 4BK4A 4WV1A 3AQXA 2VQ4A 2P52A 5CMAB 3NJFA 5B3JF 4JE4B 5SWZD 3ARFD 1FYTD 2HYMA 3QC5X 4TUKL 4OQTH 4GQPH 2WZ5A 1A22B 4LCYB 1AR1C 4KBPA 4U0QB 4Z7QB 5J06A 3V4VB 4Q58C 3GSVB 2YSSA 2VDKB 2J71A 4FKEA 5FO7A 1U95A 3UPRB 4HIHB 1MLCA 4PW9A 4UI2A 4HKJB 4MLIA 4A6YH 1SVCP 5IJCC 1OCZB 3CPLA 4JVWA 2MQCA 4QAWA 1O9ZA 1BCIA 1KT2A 1XSKA 2XUWA 5ID0A 3T6QC 2HVBA 2Z64C 5CN3A 2CJSA 1T04B 5I75B 3IPEA 3S4SG 3OKNA 3L5JA 2W8CA 1M56B 2H6OA 3E8UL 1MY7A 4JZOB 2D73A 5IP4A 4UQ9A 4TQIA 4UM9D 1QHQA 4AZ8A 4NC2B 4TLKA 4GKNB 4M8VA 2OQJB 3IJHA 1NFAA 3ZKMC 3EJQA 1DANT 4PJGA 3VFTB 4R7DA 2KUTA 4NQXB 1XIWA 3T6WA 1SXNA 3ZDZB 1MHHB 3Q8FA 1NBQA 3SKMB 1RK7A 3RL2A 5IUCA 1PW3A 4UIMA 2WKOA 5GS2H 4KOBA 1J8HE 5J56B 3N42F 4GAAA 4S0SD 5MEND 5CLZA 1VGEH 4C83B 4HIJA 1UT2A 2ZPKH 1L0YA 2BY1A 2CK0L 3AQYA 3ZUCA 5CR1A 1VZHA 2VDPL 2CBMA 1ZK5A 3P0VL 5J12C 5I1JH 3GIVA 4HUKB 3NRQA 3ZTDC 5FO2A 4UV4L 2QFPA 3S37X 2I60H 5TGBB 3TWCH 3UO1H 1W72L 5HHMB 5T5NG 5ALCH 4H26A 1RZQA 4YUEL 1DZ0A 4I89A 2XN9D 3LKQA 1NLBL 5F44A 1CXFA 1YN6A 4U1HB 4HEME 4Z7WF 3IAGC 1YDPB 1BZ7B 2BIHA 2EUWA 5DRZB 5C0JB 1XH2A 3Q6FB 1UD2A 3GSWA 4FAAB 1FV1B 2MNUA 5IB1B 4FHBD 3S88H 2F53E 5CLXA 3D2UD 1PZDA 4CVXA 1ZWIB 3BPNB 1P7QD 2HRPL 3QUML 2IDSA 1JRHI 2QGDA 3SGDH 2VAAA 4GY4A 3UBXA 5KYXB 4DEUA 4N86A 3BUYB 2Q3XA 3EJCA 4YXLH 4U2YA 5JA9A 3OHMB 1O7DC 2NUPA 3LY6A 5LGHL 1DLHA 1CDYA 4K94C 3TS8A 3I9PA 3N1GC 4Y4KA 1BJ8A 4Z6AT 3K6SB 1NMAL 3DYMA 3NIDF 4NO0D 1CBJA 3V4PA 4OVUA 1C7SA 4KU1A 5KJ4A 1MDTA 2C3HA 3DVGB 3FRPA 4I0PB 3T65B 1U6AH 3LS4L 3MU3A 3V7MA 3P9LB 4YFEA 5F3HA 5EUOB 4G7YL 2A9AA 3RPBA 3WHE1 1G7IA 5ICXB 1BXXA 2P45B 2NY6D 4QHMB 1MREH 1IGCH 1T5KA 3IJEA 3A21A 3C6EA 2E9BA 4N8VB 5J9PB 4F2ME 2AXHA 3V0JA 3WIAA 2AZAA 3QXAB 4X5XB 4S0TD 3GQFA 3D39B 1PLGH 2DLHA 4CU8A 2EICA 3TF7C 2Z9TA 5DS1A 4ALAC 1W6WA 1WAPA 3VJ6B 1BYNA 2XYCA 1FVDA 1UT9A 2WGNB 2WQAA 3QWOA 2VZ3A 4ACTA 5T3ZD 1C5DB 3UJTL 4APQC 4YHPB 3N5AA 2VLKD 4NP4L 1GGIH 3SE9L 3VFRA 1R5VB 4X83A 5KWYC 1YEEL 2AXGA 4F9PA 2VB5A 1LK2B 5DFVC 1TEFA 4AE0A 1DVZA 2YC1B 4FTVA 3ZTNH 3V6OA 5FO9A 1AP2B 4FP8L 4Q4EA 1I8IB 2ED9A 1EGJL 2B8OT 3QQ4A 3RL1B 4X9GA 1I3VA 1XO8A 3QZWA 1E5AA 3MTRA 1RZJC 4K71B 3T8XA 2Y2WA 1AOZA 4YIQB 3NCJH 3II3A 4HJ0C 4WF7A 3T9WA 4JAMA 1FCCA 2JI2A 5JHDE 3T0VA 3RI5F 2H1PL 5DEGA 4QR7A 3GKWH 3L1GA 1AO7A 2YD3A 4DPAX 3MLWH 2D2CC 1S5IH 3SDAC 2YAFA 4YK4C 2Z31C 5CSGA 1ZDQA 3ZRFC 2C1OA 4K9EH 5L2KE 2Y7OA 2FO4A 3LB6D 4MTMA 5F9DC 4QPEA 4YZWA 4DK6A 1GZQA 4P3CL 1F42A 1N4XL 3ULUC 3HNTH 3HLAB 3QIWD 4MS6A 5FV1L 3UP6A 1F3JB 3ETBF 3LKOB 1C5BL 4NLHA 3MRDB 3EADA 1WTLA 5E00A 3RDTC 2YXWA 2VDMH 3HC3L 2X9XA 4OR1A 2WLJA 3ARED 5L0QC 3SKNB 3EG9B 2WSPA 3ARPA 4UILH 1E50A 1FORH 1ONQA 1X9QA 2V7NA 2BP3A 2Y1YA 2FSDA 4X7DC 5KS9F 2YMOA 5DTFA 1DCEA 4BWTA 4DHLA 3ZE2F 1YJDL 1CI5A 4F33A 3UCQA 1CGTA 1IAMA 1YEHH 1AZRA 1DR9A 3DOSB 3A67L 3LQAC 3RUGE 3VFOB 3VYNA 2HN7A 3QIUA 3V0VA 2DQMA 4UTAH 1JGEA 2CHDA 2DQ6A 5E94A 5GS0C 2IXQB 5L88H 1MWAH 4I18B 3CQQA 4J12A 2OMTA 2WUBH 4YDNA 3BP4A 5KSAD 3FU5A 5DA0B 3FMGL 1R3IL 5BOJA 1RULH 3OKDA 4GO6B 4ZXBD 4POYA 4GRLA 2GB2A 3ES6A 4O4YL 1VA9A 4WTZA 4XNYL 4HIIB 5HJ3A 3UMNA 1XXDC 4WEBL 3O81A 4PJ8B 1AQHA 1U92A 1IKFH 1FYHB 4OQTA 4AQEA 1VJSA 1RZIB 5HDWA 4FQCH 1WA0X 5D1XB 1LQSR 3PWPE 1UOVA 1RJYB 3IXAB 4HZAA 2NSXA 3JVGA 2R29L 4HWBL 3TZVA 5GRJL 4A6YA 5KSUB 1JGIA 3R8BB 1XF3A 2J6WA 5DHVB 1RUQL 3O45A 4LESA 3U7YH 2VXUH 1D7FA 1UZ6E 5FUOL 3T0ED 4PBVC 4R4FH 2BVPA 2QQKL 5LGJB 4XODA 1CICA 1CPUA 4ZAKC 4LVNC 4A2EA 2X1PA 2R1YA 1I8MA 4QHNA 1J0KA 3Q8CA 4H88L 5KAQG 4BKTC 3IMTA 1ID2A 1JUFB 3SPVA 5AYUH 2HKHL 3WENA 4KO7A 1NFDE 1KELH 2BMKB 4LIQH 2HFEA 3OGOE 4WK2B 1SMOA 2JIXB 2XV0A 1M1XA 2I32A 3DURB 3GBLA 4Y1AD 2LFGA 1SJHB 4TNEA 2ZICA 1I1AC 3BN9D 3KWUA 3HB3B 3T2QA 3ZLQC 4HD9A 4IM8A 2YKLH 4IRZH 5C07E 3NFSH 2AEQH 4MHHG 4PGCB 3O6ML 4K5NA 2DW5A 3QRGL 2FDBP 3NGBC 4KHXL 2AJ3A 5DT1H 4D2NA 1PAZA 4U1KB 3IB4A 3IMUA 2KHAA 2Q87A 1HSAA 1OZUA 1A4AA 5IROA 2IEPA 4Z0XA 3RVVD 3BAWA 3MRFB 1CG9A 3V4LA 1EZSA 3J2PA 1CL7H 4PQXA 1R5IB 2Q2EB 2EP6A 4XO5A 3IJYB 3DOIA 3CZGA 4FLQA 2H3XC 4WNQA 1UEMA 3HRZC 4N5UA 3VXME 3P77B 4PJHF 3GSUA 3V0WL 1HINL 2K4WA 3NEOA 4LKXA 3PQYE 5IR1A 1WWWX 4BV1A 2O6PA 4F7TA 5HVHC 4X6DA 1EDHA 5A2BA 1UKTA 3THML 3QEQD 4C54A 2C9SA 1A2YB 3D34A 4ZSOA 1OB1A 4RMVA 1BYOA 1F90L 2DKMA 3UADA 4WY7L 3BAJA 2CDEB 1RVFH 2YAEA 4PR5A 3PIQA 5SWSA 2CXKA 4L8SB 3O4LD 4UTBH 1UOKA 2RALA 1ZE3H 3PGFH 1RLWA 1ACYL 3EO1A 1LE9B 2IQAB 3QUYA 1QNZL 2B9BA 2PWGA 3ENEA 2KLTA 3QO1A 3DUUB 1AXIB 1G7QA 4B5EA 3P40A 3DRTB 4FNSA 1KZYA 4JHVA 2CKBB 3IJ8A 3WMPA 3MJ9A 4ZD3L 2IDUA 4NKMB 1A4JA 3BKJH 2F1EA 3ECBB 4YR6B 3MRLB 1OAKH 1QBMH 4I4WB 5C7XL 4EE2A 1XQ4A 1D5RA 4NCDA 3ZMRA 2EZ0C 3TLRA 5I2IA 3MLSL 9PCYA 2BHFA 2IFGA 3JVFC 2XHNA 3VXQA 3NYKA 3GO1H 1GC1C 3BP6B 4QHLB 4YH6A 4UM8B 3DSNB 4Z76B 3QORB 2DMHA 1Q0XL 2WZ0A 3II1A 3UTSD 4WNJA 5CCKL 1HCVA 4W9GC 1MNUH 4IIQB 4MJIB 4PPTA 1QO3B 2XQ0A 5FOJA 5SWQA 3DOHA 4MS8C 3JWDC 3ZL4H 3IF1B 1QHOA 3LIZH 3PJSA 4GBXA 3T6ZA 1UTDA 4MZRA 2QPFA 2XQBH 4Y4HC 5D4IA 4NUMA 4PJFA 2YD0A 2V5MA 3DX2A 3U4AA 4KITB 2EJ1A 1FSKC 1XF5A 5I17B 4ANKA 1T66D 5HBBA 1MAJA 3HG4A 3BUDA 3H9HB 1GPOH 2BNQD 2NZ9D 3OXSB 4GAYB 3VWJA 2VDOH 3EJYC 1OGAA 3SDDD 3Q8EA 5D93B 5EWIL 5IESH 3HPLA 2H8PB 3G6JF 2WXLA 1KLUB 3ZKND 4CVZA 4DCQA 3CQFA 1AQKL 1A4KA 5CFHA 3N1MC 1KIUA 4P5TD 1I1CA 2Z7ZA 3ZIYA 1RZ8B 3BVNB 4PSPA 1UOLA 2PO6D 1UA6L 3JUYA 3N41F 4UAOB 2ZT9C 2ED8A 3OR6A 4R7NA 3NJNA 5DRNA 3C2AH 4XRCB 1BFVH 1OW0C 5D2NB 3QIWB 1KPVB 3UH8A 5EF0A 4PJGE 3VG9B 3HS0C 5IGXL 3TYGL 4KO9A 4Q6IC 4NQED 4JGUA 5I19H 1JXGA 5I66A 2ZSWB 3HE6B 4R26H 1M1SA 4J2XA 4V2CB 3PDOA 4OF8A 2XI9A 1V7NH 3REVA 3TASA 3EH2A 4KMTH 1NQBA 1U21A 4PAZA 4DGVH 4ACPA 3T4YB 1SDDB 4ZODA 4HALA 1HL4A 4JGMA 3SYOA 3SGJC 1HNYA 5TQ0L 1WBYB 1BQHB 3REWB 3HI6H 3QISA 4MYPA 2OSLA 2UYLA 4N2NA 4OV5A 5C0CB 1XGYH 1H6TA 3F65A 4OLXH 4UB0H 5ABAA 2VITA 4IOSA 3STZB 3CIQA 1TJGL 1VFMA 2JKIS 5I1DA 4UTAA 5F89B 3RHWF 2GK0A 3U48A 2OAAA 1ID5I 1H9VA 5JLZA 5L9DL 1E6JL 4JRFA 1RKRA 2F19H 4NKIH 4Y7OC 1F4XH 4IRJB 2AK4B 1YC8A 3P73B 4RGMB 5GJTH 1A47A 1U8NB 1QQDA 3K4AA 5IIEB 5JOPE 2O30A 3I3DA 2Z1PA 1MY5A 2FL5A 5KYYA 3AUWB 3CFDA 3LZPA 4G80B 4X4XB 1MVYA 4UANA 5HSFA 1XB8A 4MMXC 5DHMC 1EZVX 4YDLC 4C4UA 3N43F 3HC0B 1MAML 3PUUA 1J18A 5CSZA 5DCCA 3JWNE 2HP4A 2QQNH 3TT1L 3VRLE 1M7IA 4DGYH 4GLRI 1RZGB 4G7RB 1EHAA 4JZJC 1RU9L 4OD1H 4M7ZB 3T0EB 4MVBC 3BQUC 2F08A 2Y7QA 1T1YB 2D4DA 2F1BA 2JVUA 3MLRH 4IU3A 4UOW0 4B9JA 4OU3A 3IMVA 3VU1A 1JPFA 4AIOA 1Z9PA 2D7TH 3GSOB 4JN2B 1PZSA 4XBGA 2B20A 1ZANH 5IW6B 3FQ2A 1L6XA 3POHA 4WJ5B 3WFEH 4JRYE 1TZOA 3I2CH 4PJ6A 5PCYA 2WTPA 5JYLA 1DQLL 1JVKA 4OD2A 5I1EL 3D0VB 3RURA 1FAIL 2XG4B 1NGYB 5D71H 3DVNA 5EBGA 1RK1B 4LDCA 1KJMA 4IRZA 4FXKB 4Z7VF 5A2AA 4YDJA 3S4SB 1JP5A 1RP8A 3INOA 4IEFB 1XGPB 3F7VB 1NIFA 2WWKO 4QF1A 1IB5A 4NQDE 3QDMB 3PL6C 4M03A 1WEJH 3VXOB 5K9JL 3QNXA 4N6QA 4GMSH 2NY4C 3D3VD 1NTDA 4FTVE 4NQTA 3SDCD 3P9MA 1AMYA 3V6OE 5D7JD 4AC4A 2DWDA 2HVJB 3VXRB 2OMUA 4OTXL 3EFFB 1FZJB 1CXIA 4PCYA 3SGKA 1LO4L 5B38A 3QEUA 1ACXA 1TQCC 3UAEA 5IW1A 2X9YA 1KTBA 4H5SB 3RFRA 3OAZK 1GOFA 5M95B 1WCQA 5AOIA 4XZUA 4J6RL 3TO4B 3BZDA 1YG9A 2YD1A 1ECYA 3QEQB 1AO7E 2BVYA 2ADIB 1PNDA 4N0UA 4XN9A 5BRZD 4RZCB 3FH5A 4OUOA 3TN0D 3WUWG 4TTGA 2NRDA 1RSFA 2HWZL 1GS8A 5KANI 1JYXA 4WGWB 3SKJL 5CD3A 4MMYB 3GUTB 1CYXA 4UYPA 4P3DA 2A6KB 1KB5B 4CGUB 2OXHA 4M8QB 2A38A 1OALA 4Z7UB 4JFEE 4MD5A 4R4NC 3KDMA 2C1PB 4Y8AA 4UWQB 3H9SA 4YX2H 4TSCL 3IDNA 3BMWA 1KEGL 4I7ZC 4J3UA 4FULA 4W1TA 2ENPA 2UV3A 1M05A 1YYLH 1NM9A 1ZHNA 2EXTA 2XJLA 2OSXA 4I3SL 4TUJA 4YHZL 4CILA 5C3LD 5I9QC 1UZ8A 5CJBA 2E5EA 1RUPL 1MCIA 3UJIH 1RHHA 2X89D 3HPJA 4B27A 2YD5A 1HIML 2E9GA 4TS6A 5EU3B 1AG6A 4ZI8A 2A9ML 2ADJB 3CG8A 4YSSA 1BA9A 5EEXA 3L3KA 2O4EA 2XNAB 3MRPA 3B34A 3D85B 1NAML 3CHOA 1EFXB 1AKPA 1BZOA 2PTTA 3FQUA 3HC4H 4W9FC 5I76B 5ESVB 4JDEA 1S7SA 3B2PA 3CU7A 4PJ9C 4PJAF 3MKGA 3TBYA 3KCPA 1KXQA 1N0LA 25C8H 4NN6B 3MREA 4BE6A 2F2HA 1P5VB 3D8MA 4Z23A 5BZDB 3Q06A 3LIZA 3NOIA 4PRHB 3FB7B 1GXEA 3NP3A 5LBSL 3TV3L 1KACB 4RAUA 3MXWL 2V2TA 2IOIA 3V5DA 4IGBC 1E7VA 4OUUB 2MFNA 1ZEAL 2BNQB 1A4BA 1CFVH 1Q9LA 1B4JL 4YXHL 1LO3L 3OAYK 1ZSDA 3MX0A 4XZ4A 3NPSC 4O9HH 1S9YB 5ECJE 3CMGA 5EN3A 1DQJB 1A7OL 4FE9A 2ZCLH 3JV4B 4UQIM 4LLUA 2X9ZA 2XIBA 3V2AR 2EIBA 2FLRT 3CHXA 4Y5XB 3UTPD 4EF3A 4RETB 1NCUA 1JV5B 5KBDA 1GS7A 3K4DA 4F2FA 1HQRB 5JIDA 1XB6A 4UIKL 3FRUA 3X1FA 4YAQB 5I82A 1UGKA 3DV6B 2GAZB 2OXGB 4ZMZA 2E4TA 4OFPA 2QMJA 4ZFOB 4AEHL 2CK2A 5BW7A 4KRPD 4UDTA 3EOAB 2CSPA 1NINA 1CFQB 4GKLA 2G60H 3U4BL 4OLVL 4FABH 3JWOH 1V5JA 3MV8D 3GS0A 3EXJA 1MFBL 2R9HC 2XFGB 4R7XA 2R59A 4DP0X 5MERB 2MKWA 5GPRA 3N06B 3OHXC 2FJFB 1MCQA 2NNCA 3SODB 2EAEA 1EHNA 4KNTA 3CK0L 2DQCH 1TJHL 4HSAC 1MHPH 2DJUA 4NQCB 5ACLA 2WZPA 1P6FA 2CJUH 3ZQXA 2DMKA 3STLA 1U8CA 1A6VL 5JTWA 2DQEL 3RBSA 5FLUA 4KI1A 4PJCB 1KXTB 4F3FB 2NTFB 1Q9WA 2HVKB 3BDYL 4BIKA 3U9PH 5J3HD 1P2CA 4NQVA 1L5GA 2PXYC 4HMCA 4OZHB 5TH2A 5D70H 3DK0A 4LCWA 4RVBA 4LLAA 2E7BA 1PQZB 4PWEA 1NCAL 3B2VL 4HS3A 5DHYA 8PAZA 4X6DE 1H3XA 1UWYA 2F5BH 2WKLA 2YPVA 3QPQD 1KB9J 3WS3B 3TBCA 4C4KT 4XPFL 2B1AL 3HN3A 4ZSOE 4P9HH 3JTTB 5L7XH 2QBWA 2WYHA 3CZSA 4BZ2H 1PPIA 4KKRA 4NX0A 4PV8B 4S1RH 4NM4L 1VGKB 1N5AA 3ZDYB 2R0LH 4EN3B 1T1XA 2CM6A 5SWSE 3CUPB 3BVTA 2APBA 4OGAD 5F7DB 1NCCL 1DJWA 3SCMC 3GSQA 3QG6B 3ZU8A 2NXYD 4LEOB 5GHWH 4PBWD 3UERA 1FFOA 2GFBA 1HH6B 1NANH 4XMKL 2XX0A 5FA4A 3VXSB 2C3XA 3OWRA 1DBMH 2BSRB 3Q9QA 3HZ3A 3MO1A 4XVSH 3SO3B 4D94A 5HGHB 1G9MC 3WL9A 3ZR6A 4P2AA 2ZKYA 2P42B 5CD5D 1EAPA 1DN2A 4Z7OF 5ISZD 1J0YA 2YO3A 4OAWA 1L0QA 4ZQKA 5JO5B 1I8KA 4LSPH 3FTZA 5EOQH 4GSUA 3T0WA 1S9VA 3PJNA 3HG1D 1T6WA 3K0YA 1JWMA 3MGTA 2GY5A 4FKKA 5C7ZA 3R1GL 3W56A 3UBXG 4CNIB 4P06A 5I30H 1GAFL 4ODTH 5D5MB 4AGOA 3QUZC 1YYML 5DQDL 3X3FL 1I85C 5JMRA 4Z78B 2BFVL 2P24A 4NZRH 3QE5A 4YWGH 1D5XB 4RDQF 2YPLD 3CN0A 3QJFB 2ITFA 3FQ4A 2CD0A 5TK2A 3D4GA 1CXKA 3BZ5A 4LXFA 1KPUA 2WANA 3JWNG 1KCVL 4IRSC 4PYHA 4GG6B 1ML0A 3U1QA 3FRPG 4IOIB 4J8RB 4Y4FC 2V2WB 2V5RA 3GRGA 4OIFA 4Y2DB 4JFZL 3LHPH 4QRFA 1MW1A 1U8OB 4Z7NF 1PLBA 3QDJB 4MFHA 1XF1A 4RGOL 4PJFE 5CZRA 1YQ2A 4U1JA 2BOCA 4JFXA 4HH8A 1CFMA 5F1NB 5I6MA 3ZRSA 1E30A 1NCJA 4K3JL 3KPOB 4N0CD 4NPYB 2VDRH 2GSGA 5DJDA 5L6YL 3RKDC 1HNGA 1OGAE 5J6SA 4OI7A 3SDYL 3K2IA 2X4RB 3OKEB 4V11A 1JPST 4JHAH 2CO6B 2Y7SA 3WS6A 2O5YL 4FFTA 4IBUA 5BMFH 1RFDL 3NK4A 4GSXA 3IFLL 3W9EB 3LEYH 3RRQA 1EXHA 1A7RH 2NXZD 3F12A 4PGEB 2CUMA 3LZNA 4WU5B 3BJ91 5C0AB 3S5ZA 3X14A 4OZIB 4J7RA 1S4IA 2A4ZA 4PRNB 2R4SH 2VR4A 3GRWH 1MI5B 3ZKSD 1H8SA 1J1OL 2J21A 4Z7QF 4K8RC 5EU7E 2WW8A 4R97B 3SD2A 4QNPE 3GI8L 2WJ5A 5I28A 3KVDD 4ORGA 4JGNA 2LHAA 3QXTA 3QZWG 4FA6A 3ABKB 5TDOA 1A25A 1Z2KA 3PV6A 1J8SA 1S2EA 1SEQL 3NAAH 4UINL 1HHJB 3WIIH 1Z3GH 1MVFA 4P9ML 4QT5B 2CGRH 2HLAA 4XMVA 1ZVNA 2WBXA 4OM0H 2KZBA 4OF0A 2SEBB 5IV2B 4JDVA 3LXCA 4OJDH 1EMTH 4A39A 3ULVC 4LCIH 3TT3H 2WO3B 1MH5A 3CZKA 1E27B 1PTZA 4HXAH 5I75C 1YEIL 1SBSL 4X98A 3GMQA 4IBYA 5DD0H 5IWLA 5F21B 4PJ7B 3BP7A 4I1RA 1WZMA 3BSGA 1FNEA 3QIBD 2Q3AA 1JL8A 2FZ3B 4FFZL 3TJHC 2X4SB 4P46D 4D7PA 3QH3A 3ZDZF 3H53A 3O6FB 3OMIB 5BVJB 4ALAH 5F6IC 3BPCA 1FNLA 3FHAA 3EXLA 2GTQA 1QEXA 3BIAX 5IB4A 4M7KH 4YHOH 2RJMA 3OXRB 5EO1B 2DDQL 4XNXL 2ZX5A 4GSRA 3M1BA 1ZA6A 1R0AH 4JK0D 4P23B 5HYEA 4IK6A 3GHEL 3WJMA 3AQZA 3EO9H 1K3ZA 4HGWA 2BM3A 3TFKD 2A77L 5CGBA 1SDYA 5T3XH 3RWGB 3VH8A 5CLWA 3QJHB 5JIMA 4U05A 1VKXA 2YEZA 1IBZA 2WO2B 3B7YA 5DHXB 5E9DA 2E27L 5IHUH 4GG8B 2ZXGA 4ZUVB 5AVWB 1RZJH 1S7WA 4QCIB 3NIFB 2YA0A 1MRFH 1OPOA 4JNXA 3PWNB 1L7TH 4ADIA 4IKLA 3IRZA 1WGOA 4TTDD 1GTFA 5DMIH 1HZHH 4MJ5B 2DKUA 1X5XA 3U4KA 3X11B 5C0GB 3UAFA 2D8KA 1ITBB 4NYLA 2EXWD 5JHLA 1EHLH 4WTZG 1SVZA 2J56A 2ZSVA 2WINA 4BZ1H 3BDXA 2A9BA 3BWSA 4WKXA 1MHEB 3T2PA 5CGTA 2VLRB 5IVNA 2HH0H 3RGVB 4GQZA 5A16A 4RFOH 5AW5B 3ML9A 3NQKA 4ZFGL 4YBLB 4YHIA 3GXFA 1Q0YH 3MUUA 1JNNH 2GJPA 2EIJB 2KQMA 1JI1A 2H0PA 4JQXC 1BLNB 4RGNE 1ITCA 3FTGA 3V0IA 1HI6A 3FO0H 5EF3A 2DI8A 4IBLT 3RGBA 4NBZB 3NSXA 4M61B 4ZMWA 4D0CA 4EUPB 5FFOA 4I0PC 3ARBA 2IGLA 5C6PB 3IDJB 5H94A 1G9NC 4EJ1C 4K4KA 1BIIB 1UWGL 3ZGIA 3N1QC 5CEXA 3AROA 2AGJL 3NJKA 2AJZA 3N44B 2KLSA 4W9KC 4X42A 1IEHA 5CP7B 3LQAH 4X5LA 1EAJA 4QRPE 2R0WL 4TM9A 5DD5L 5I23A 4HIEB 1J5IA 2OMWA 4PRDA 5INCA 1IMHC 2A6DA 4RAVA 5GS0H 4DVBA 1DQML 3OSKA 3WEXB 4WEMB 2E0PA 4JFFE 4EIZC 4NFBA 4N0UE 1IM9A 3EUDA 4AGLA 1I75A 1KGUA 2VXVL 4BZ2A 2RFXA 4BWWA 2NY2D 1JGVH 2YPKA 3CIAA 1HHIA 3BWUF 3G6DL 4ZUWA 2VXSH 1IGIH 4S10A 4X6FB 1CLOL 4H8WC 3U25A 3FO9B 1EVTC 2J1KA 2GBUA 3P4MB 4KUCD 2NR6C 4N2GA 3IWVA 3BN3B 5DJZB 5EUKB 3BWUC 1OCOB 3V4UH 5CBAB 2FJGA 2GJ6B 5HHNB 2FGWH 4XCFH 3ARTA 3H9SE 3DX7B 4JFOA 3FQYA 2VZOA 1AD0B 4DF9A 3NCXA 2DWEA 4K71C 1JGLH 2LGNA 3QS3A 3AT8A 3ARUA 3K2UL 3L3JA 3NRPA 4JM2B 3GC3A 4BKLB 4NWTL 5D1ZB 1JK8B 4KGLA 4YBHA 4YE0A 5EZOH 5AVSB 2CLVA 5JZ7D 5B7FA 4DETA 2CMRH 3APDA 3CLEH 4LSUH 4EDXB 5JPNA 1IIKA 2DTSA 4JQVC 2X6AA 1A14H 1IM3B 1J8KA 2D2OA 4QXTA 4MDIB 2W07B 1A65A 4JDZA 5BVPH 1U36A 15C8L 4KK6D 4TLSA 4JRLA 2IFFL 4WGVB 3HI1A 4LT7A 5INDA 3UAJC 4L3ED 4AK2A 1MRDL 3CBKB 4F92B 1GYAA 7TAAA 5FYJL 1KXQE 1ZLUH 2OMNA 3L95B 5E03A 5F71A 4BFIB 5B3SB 3S98A 4BFKA 5KBLA 4XI5D 5DEZA 4FZEL 4WJG3 2OCJA 2GTWA 3DVIA 3TA4D 5C97A 2E7HA 1MHCB 1S7XB 1E4XL 4RISL 5T33H 4JFDD 2CDGA 4OIBA 1J05B 2I07B 1QW9A 1BEYH 4EXKA 2PKDA 4EZLA 3HMXL 2DYRB 3PABA 4UT7L 4LK4A 2AI0H 4FQXB 1JWSB 3I6KA 1GGYA 1IC5H 3MRQA 4HAKA 1TZIB 4TN9A 1G6RA 2K78A 4KVNL 2IANA 3S36H 5I1CH 3CQPA 5FA3A 5DMYA 3BH8A 1AANA 3VFMB 1OGPA 1A5FH 5LKNA 4OFVA 2L3BA 4K3HA 3IKKA 3OMAB 4Q14A 4XPHH 3BAEH 4I18C 1AY1H 2Y25A 2J25A 3GBNL 3MUGB 5E1IA 5BRPA 2EEXA 3O3BB 3KLAA 4N1HB 4G6KL 3KL0A 2E6QA 1FFNB 4ODHL 4Z7WA 5D2LB 1R5WA 5I26A 5LG6A 3EHBD 1C9SA 1KCSL 3OB8A 3GRWA 1KBVA 5DJ8A 3EJPA 2FR4A 3QJSB 4PBDA 1IZKA 5JIKA 3O0LA 4NNXA 1KIQA 4KTDL 4PJ8C 5E2VH 1EX0A 4WI0A 5I16A 3T0DA 4NRXB 4ES9A 3F7YA 3JTSA 1W8OA 1WZKA 1MAKA 3ARXA 1NL0L 4WUKL 5IBTH 1S7VB 1UXWA 4U6TA 4PW3A 2F74B 4L9LB 3GI9H 1H8NA 4WW2C 1K5NB 4GAJL 5KG9B 3NCWA 3BZ4A 4AVKA 4O2EA 5BS0A 4OLUH 4XP5H 2Y5QA 3MCLL 3Q43A 1MCRA 4LOVA 1R3JB 3GTVA 4AJ0A 3GF8A 3W2DL 3LQMA 4HMEA 1ZVHA 3C5SA 5BXFB 5I1GH 1JXKA 2YBRA 4ODWB 5AWNL 4X4YA 4YVUA 4MDJB 4ZNEE 4JL2A 4O02L 4KXAA 3GSNA 3UTZA 3F58L 3OLGA 1OOWA 4XOBA 5ITBH 4FJ6A 1N2RA 2F54B 1G7MA 4ONGL 4PH8A 4AT6A 4J1UA 1YY8A 4FQ1L 1GC1H 1UM6H 1YPZF 3AB0B 1MFCL 2YN5A 4OIIH 4QRUB 4M9OA 4NUGH 3BCDA 2VH5H 1IBYA 3UZQB 3HB3C 4APQA 1I7UA 4K23H 1XGRB 2K9FB 5G2NA 3ZE0B 3ZT7A 3FU6A 4HT1H 4C57C 2UZIH 3KH3A 4BFNA 1NBVL 3LRSA 5C0RL 5EORH 2E7DA 4JFUA 3JWDH 4LASL 4FEIA 3FK3A 1HWGB 1AKJA 1CDUA 1QSFA 4PRID 1FO0A 1EEYB 2AEIT 4KFZC 1ADQL 2EH7H 5F1SA 2RD0A 4PS4H 5HYQB 3P11L 4YE4H 1A7NH 4G3YH 4Q74A 5GS1B 2CIKB 2AV1B 1AQDB 2WVVB 5HPOA 4E9RA 3AG3B 1JNJA 1REIA 3DSFL 1UUSA 4Z3JA 3VA2C 2FD6L 2K1MA 4ZDHA 1NDGA 5HHVH 3S34H 5K39B 3L81A 2O61A 1T5WB 2ODHA 3VFPA 3HIZA 4L8BB 3PG2A 3SDAA 1B4TA 1LJMA 2OTUA 4UDUA 1T2XA 2AAAA 4GPVA 2Z31A 4W9ZA 4L05A 4BZ1A 3VMNA 4PSRA 2H26A 2VSCA 4FQIH 4G8FA 4ANWA 1XR9B 3H7BB 3ZW3A 3UZVA 1X44A 1YEKL 1M57B 2XXCB 4HIQA 4PGDB