4OV6F

Crystal structure of pcsk9(53-451) with adnectin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
GVSDVPRDLEVVAATPTSLLISWPPPSHGYGYYRITYGETGGNSPVQEFTVPPGKGTATISGLKPGVDYTITVYAVEYPYKHSGYYHRPISINYRTEID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proprotein convertase subtilisin/kexin type 9
publication title Pharmacologic Profile of the Adnectin BMS-962476, a Small Protein Biologic Alternative to PCSK9 Antibodies for Low-Density Lipoprotein Lowering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
total genus 17
structure length 99
sequence length 99
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ov6F00
3V4PH 4YHIA 3HB3C 1AKJA 2XIDA 4KUZH 4MDJB 1ZVSB 4XZUB 3QCVH 3O4LE 4ODWB 2CLZB 3MLWL 5ID1B 1CLZL 1LHZA 2CRZA 4X9BA 4M8VA 4QY8A 4JVUA 4XB8A 5HI3C 2UZYB 1P4IL 4CKVX 3PV6B 1EXUA 1ZTXL 4QHLB 4ZPVB 5DEZA 2Y5TB 5HHOD 2C3WA 1JPGB 1AR1D 3P4OB 3KJ6H 5F44A 5M95B 2BNQB 2NY6C 3V8CA 5GJSL 2JKXA 4JFPA 2FIRT 1PLGH 1G7QA 1LMKA 4YDKL 1OLLA 4BKLA 3U7AA 4OLXH 3GI8H 3T0EB 2C3XA 3RUGE 5I66B 2UVEA 4I2XB 1JNNH 5I9QC 4KTEL 2GK0B 4Z7WF 1KGCD 2DKUA 2LTQC 3EO1A 4XBPA 3WNNA 5KANI 2AEQH 4TSCL 3K8MA 5D1XA 2ICWB 5HHNB 3TWCL 3GI9H 3UC0H 2MQ3A 1ND0A 4UOW0 1XF5A 2FNBA 2F74B 5I8EB 2X41A 2YPLB 1OTSC 4NM4H 2IALA 5IB4A 2DBLH 4OZGE 1KELL 5AZEH 1IGYB 5K59F 4Q9QL 4KUCF 5A2FA 2IBGA 1FZKB 1G7MB 2WBKA 4Z5RA 2Q7NA 4MCZA 1FNSH 1S9YA 4R8WL 4TVPH 4JEGB 4OCWH 3BD3A 5DD0L 2E7LC 3L5WA 1B0GA 2VDKH 1SEQH 1XF3B 4P2QD 4P23C 3BPOB 4Y5VC 5DJ0B 1U3HA 4OIIH 1KCVH 4JGMA 1JGEB 3UTPE 1HILB 4OF0A 5TDNB 1RZGB 5I30H 4O02H 1CU4H 4J6RH 3V5KA 2AQ2A 3IFLL 1RIUH 1YMHA 2FL5B 2R0WL 1TCMA 5AAWA 1GGYA 3X14A 2D31A 4WTZA 4TQEL 3ET9F 1T2QL 3HZYB 5BS0E 4WUKH 2X7LB 3QQ4A 1MPAH 2VAJA 4WJ5B 4Y19B 3FB6B 3WDJA 3QQ3A 4KZDL 2X4NA 3GM0A 4K71C 2IQ9H 5IIEA 1CL7L 3VGBA 5J9PB 4M5ZH 3FAXA 3C08L 3SE9H 3ZDYE 4PG2A 4O4YH 2WZPD 3TBSB 3TBWB 1FNGB 2JK5B 2V17H 4NUJA 2FGZA 1BX2B 4F57H 1DBAH 2C5DC 4OT1L 1CLOH 1CWVA 1P9MC 5EZIH 5GGQH 1HINH 4HXBL 1OCWL 4WHTA 4KKNA 1X3DA 4QHUA 3SDYH 1MFBL 4YHZL 5GS0D 2M2DA 4BH7B 4HG4K 4WGVB 5JHDA 3JWNC 4OFYD 3ARFD 1JRHH 1M71B 3KYOB 3KLHC 1BEYH 3UDWA 3VGFA 5CBAA 3KPQB 5IMKB 3PGFL 1TTGA 3GKZA 4TN9A 3W9EB 4D0BA 5J8OA 1Z9LA 1GZPA 3S37X 1T5XA 4ZUVA 1JF5A 4IJ3C 1W72B 4I0PC 5HDQL 3QFJD 4CVXB 5IFJA 1T21A 3VWJD 2ADJA 2NY5C 2QQLH 2P4AB 1AFVH 2UWEF 1OQXA 4XNZB 3A6BH 3RFZC 2FBJH 3WFCH 2Z31D 2OZ4A 2IFGA 3RWDB 3H7BA 3CSPA 3PQYE 1KJMB 5EU3B 4V2CB 4PJ9C 1N7ML 5DTFA 2XY2A 4DK6A 1NLDL 1BFOB 1XGPA 1AGDB 2NTFB 2OL3H 2IBZY 3MRRB 1U91A 3L7FB 2VISA 4M93B 3KLSA 5FXCH 2DN7A 2NX5E 1A1NA 1H3TA 2FYYA 3FQXA 3MRJA 4LKXA 5EFIA 1C5DB 5KANG 3ULUE 2WV3A 2JIXD 5E24E 5E0QA 1KBGL 4J23A 2BNRE 5JW4M 4D3CH 5J12C 1NC4A 4MA7H 4AIZA 2D7NA 2GITB 4DK3A 5JR1L 1BZ9A 1MH5B 2IQAB 5JOPE 3PXHA 1E6OL 3L5XL 3IJSB 4UQ2B 3O4LB 3F5WA 1NGYA 5F70A 4Q9CA 4JFEA 5J4MA 4JANA 3CX2A 3HR5B 3BDXA 4S2SA 2Z31B 1H3UA 4LNRA 2Q3ZA 4I0CC 4WFGD 1KC5H 2ZJSH 1QBMH 4X4ME 3H9SD 4MD4B 4YXKH 4YGVA 2Y6SC 3U7YL 1X5XA 3E1F1 4CGTA 4NRYA 2NPLX 5DDHB 3V95A 5DD6B 3QUXD 3ABZA 3I75A 4NWTL 3Q48A 3RUGB 5T1MB 1YEFH 3MNVB 3LEXA 4X9GA 1FNHA 2VH5L 4KK9D 4OQTA 4HUUA 3D39D 2O5ZL 3V0WL 2F54A 3D48R 5GRJH 2F53E 4OGXH 1YY8A 3SDDA 3BN9C 4CN4A 4JDZA 1MWAA 4KKAC 1NQBA 1RZKH 5TE7L 2JELL 2Z4QA 1FG2A 3FRPA 4XP5L 1I4FA 5EA0L 4OZGB 4A6YB 4ZTOL 4NJ9L 2XN9D 1BLNA 1FV1B 5SWZE 2BFVL 5ANME 3AAZA 4ZD3H 4JQXC 1ZLVK 1AIFB 1U6AL 4AM0A 2BRQA 5IQ9A 4TULL 1WFOA 3LN5A 5CKAA 4FQHA 1RQ5A 4G8IA 5T3XD 1MFDL 1TXKA 4OCXL 5C2BL 5DVMA 3OG4B 3W39B 3BDBA 3DVNB 4GKOA 1BBJB 4PP2B 3L3JB 4X6FB 4WFHE 2H3NB 5EUKB 4M7ZB 4U49A 4FQJH 3MMEB 5KOMC 1NGZA 1FPTH 4O51A 3WUWA 1HQ4B 5HGDA 5EC2B 5BS0B 4PLJD 3VI3E 4GAYA 1BZ7A 2R23B 4H25A 5F72S 5HHMD 2FEDC 4X6CF 3PHQB 2YKLL 1AR2A 1WIOA 3ROLB 2DF3A 4XNYH 2DTSA 2R2BB 1G6RL 4UILL 3DUSA 5EH1A 5C0BD 1WIPA 4QCIB 3BMVA 4U6HB 3OXRB 1HEZA 1NAMH 5DJDB 1IGIL 1TVHB 4QGYA 1OD7A 4ZAKA 4MWFB 4RAVB 2E9WA 1HQRB 3QPXL 1A6TA 3QT2A 5J3HC 2QLVB 1FL6B 1JGDB 2P44B 1UC6A 5HPMA 5LGJB 2PTUA 4MA8H 5C6WH 4FNLL 2D3VA 2EIDA 2VLRE 5KSAB 1K2DA 5FYKL 4FABL 4CN1A 4EBQH 4FQCH 3KPPA 2AK1L 4ENEC 3PQYB 5CHNA 4JM2B 1T6VN 1QQDA 3RY4A 1T0NB 3MLSH 1MLCB 2DD8H 3NBNA 3U0WH 1EHAA 3RNKA 3ARWA 4U6YA 1MFEH 5B38B 5CFHA 4NKMB 1XH3B 5JNYA 3BZFB 3S4SA 5F9JB 1RFDH 4Z8FL 5L2KD 4ONGH 4M61B 3UJIL 1KIPB 3VD4A 3BPLB 3PWUB 4X7FC 3NIFE 1R3HB 2NX5B 4MAUH 1D6EA 1KTDA 1U8LA 1CF8L 1CQYA 2RBLA 1YNTA 1FL5B 4K2UH 3JTSA 5E8PB 3W81A 5SX5K 3KPNB 4IMKC 4FRWA 5F6HI 1WZLA 4DAGH 3SDXE 4M1DH 2NY5L 4P5MA 5EOCH 4ZAKC 4DZ8A 1TDQA 1LEGA 4KY1H 4QXGL 1DJSA 3VXRA 5JXAL 4PJ8A 3ZL4L 3SCMA 3NACH 3OMZA 3QNYA 3MC0A 3MFGB 2J8UA 4FFVC 4OCNC 4KTYA 2JJUA 1H0DA 4OZFH 2Q8AL 4AMKH 2BK8A 1VSCA 5JDSA 4KHTL 1QFHA 5TDPA 4XVUD 1J8HA 1JYXA 4HUXA 1V3LA 4LCCB 4K3EH 1A7BA 2WBJB 3P9LA 1OP5K 4Z7NF 5MI0C 4URTB 4ZFOB 3BUYA 2QTEA 2QADD 5FYJH 2UV3A 1FRGL 3IU4L 5T1DL 5FYLE 2GSGB 3VRLE 5FECA 5E2VL 3WNPA 1X4ZA 1VACB 1DBMH 3A6CH 5LAXB 4Y4FA 5CBEA 4PB0L 5ACMA 1B2WL 1HYSC 4YK4B 3GSRA 1GRWA 5I73C 1G84A 4IRSA 3HE7B 5LKNA 3NABH 2O5YH 4NPYA 1U8HB 3C5ZD 4M7JH 1T1YA 3UJTL 1RUKH 4BM7A 3TBYB 3VXTB 2F53B 3TA3D 5L8LB 1A4KB 3DVGB 4L9LC 4V2BA 3O2WL 1DZBA 4PJ8C 5F7LB 4PS4L 1ZLUH 1IAMA 3SCMC 1UB6B 4XVJH 2R56L 3GIVB 5I1AB 1QVOB 1DVFB 4LHUA 3U82B 1CXKA 1RIVL 3F7VB 3EYVB 5DFVC 4K7PH 2AJZB 2C3GA 5ANMB 4CNIB 5GRVL 4KUCD 4PTUA 4U1HB 3CZFA 4ZFFA 3PDOB 4OM1L 5J13C 2GIYA 1XZ0B 4MD0B 4ODVL 3RIFF 3X11A 2HVKA 1UM4L 4JO2L 1I7ZB 4KAQL 5IEKA 2VITA 5I17A 4PJCA 2AV7A 4X80L 1C12A 2UYLA 5HGAB 1IKFH 4BYHA 1TJHH 3L3KB 4H20H 5T1LB 3G5YB 4HK3N 3GMRB 4KFZC 1ZSDA 4Z7QE 3QH3B 1TCRA 4LLQA 5I8CA 3KXFA 4H1LA 5D7LE 3TM6A 3BT2L 1MHCB 1X5IA 3QCTH 5TQ2H 1RU9L 1ZE3C 2QQKL 5C92A 4PJ5E 2B4CC 3LAFA 4L29B 5D1ZD 1P4LB 3EYOB 1ITCA 2NY1D 1CI5A 3JUYA 4HUWA 1HHJB 1KF9B 2BOCB 4MX7B 5EWIH 2GCYB 4RBPH 4NQCD 5FYJD 4DUWA 4E5XB 4EDWL 3CFBB 5L8KB 1O5DT 4K7PY 4JJ5B 5JMRA 2BSTA 5C0RL 4KKBD 3GSWB 3RWHB 4IEFB 1D3CA 3CLEL 3D85D 1CD8A 1XIWA 2DLTA 3B6SB 3MRDB 3O6FA 4JDTH 4ZSOA 4B7LA 2APXA 2FX8H 3DSFH 3LKQB 1CDYA 4U1NA 2A6IA 1BVKA 2NY0B 1UJTA 1BJ1H 4Z7OF 1C1EL 2B5IB 1UEYA 2VLRB 5H35A 3L95B 1S7VA 5GPRA 3V4UL 3S3PA 4Q58C 5E5UB 1DQJA 1CD9B 3MBXH 1R5IB 3BDYH 1V8HA 2R4RH 4OKVB 3R0NA 2A6DB 3MLVH 2XWBB 4PJIF 3WN5B 5A43C 3BQUD 4EN3A 2BVOA 1XCQA 3IDUA 2Y4SA 2KZWA 5FUZL 5SX4I 1MQKH 1DDHB 3GMQB 2D0HA 3CX5J 4WCYH 1PD6A 1LEIA 1JPST 2VB5A 1MELA 4GS7C 3NZ8B 2R1WB 2PUQT 4X0KA 4KRNA 2EH8H 2D7TL 3K4AA 4F2MA 2PO6D 1DL7H 5ITFB 1A14H 4KK5D 4LLDB 4XC3H 3VGGA 5B8CB 2DQIH 3HE6D 3LY6A 3NZHL 3SDXB 3MV01 1XR8A 3WFBH 1JIBA 4G7YH 3LHPH 4P2OD 3VWJC 43CAA 1E4KA 4KJWD 4XRCB 4NGHL 3VU2A 3RBSA 3TBVA 4HWBL 5IT2L 3EKCA 1H3GA 1CGXA 1HWGB 4KV5E 3BIBX 4LLUA 2GHWB 1Q9KA 5DQ9A 1BIIB 3PWJB 4IOFC 3EYFB 3FTGA 4PJXF 3VH8B 5H37H 3C6SA 1PG7W 1RHHA 5KSBA 2X9YA 2A2QT 4Y4KA 3V5HB 5ADOH 4Z18A 3ZO0A 2NY4B 3GHEH 2CRMA 4OCLC 3P73B 5GS1A 5IEHA 2YXMA 5F7YC 1RULL 3OGCA 1A3LL 1ZWIB 1MJ7L 1T83C 5GRUH 1KLGA 2Y07L 3QEUB 1YUHA 1BOGB 1PVHA 5C07A 35C8H 4J1UB 1PG7X 3D39A 1M4KA 1JMXA 1I1AD 1YMMA 4MSWB 4OLUL 2L0DA 1QLRA 2O93L 1RK0A 3U9UB 3O0RL 3HZVA 1PKOA 3TN0B 5JHDE 2V2TA 1X5HA 5MEOA 2G75B 3B2VH 3HE6B 1GGIL 3U7WH 1L0XA 5F96H 25C8H 4YQXL 3WKMH 3RA7H 3HMWH 2AW2A 3RL2B 3O3AA 2AXGB 4XP9L 2OL3A 4XBGB 2FO4A 5TJWK 1KTLB 2DQFA 2W65B 3S6CA 4ZUUA 3I6KB 2HFGL 5HBBA 3HAEG 1J87A 4L8CB 5BQ7A 1SM3L 4FZ8H 1FAIH 3QUXC 5EU6D 2QSTA 3UO1H 3F65A 5GGTA 2A6JA 1JTPA 4CMHB 2BY1A 4HLJA 4PLOB 1HKFA 5CZKA 1ZLSL 4KK9C 4L3ED 5DMIL 4TOYH 4HX1B 3OR7B 4FQXA 2FWOB 3I02B 5KAQF 3ARXA 3EOAA 4GW5B 1RK1A 2LAGB 4LPWA 4QHMA 5D7LB 2WINB 1EVTC 1JRHI 2VXUH 1SJEB 4FFZH 4Z7UA 5BVJB 3MRCA 1KENH 3IXAB 4PJ5B 3MLTB 5ABDE 2DIBA 1NCDH 2GW5A 4YHIB 4RGOH 5KS9F 3SE8L 5DURB 1OGAD 2R4SL 3DHMA 3EYUL 4G80A 1FNLA 4QY8B 4Y1AD 4JFEE 1T89C 1EXUB 3QIUD 3SKOA 2Y9RT 3NIDE 3CFKA 5TH2A 3VFRA 4AL8H 1OSZB 2FECL 5E6IA 3TP4A 3T09A 5E9DA 4MNQA 2VXSH 2X44D 4UOW1 4JFPB 5IR1A 3ZDXE 1F3DH 4M6OH 4TUJA 4Z7VF 3F12A 1F90H 1LK3L 1R5WB 1U95A 3GDBA 4DVRL 2N7AA 5HDLA 1TZGH 4CRPA 2OS7A 1OHQA 3L3GA 4QXTA 3CIQA 2DLFL 3AVEA 5IKCA 4XBPB 5DRZB 4ETYA 4JFFD 5D1XB 5E2WL 1MIEL 1YQVL 4MD5A 5CGTA 2F54E 2ENYA 4PLKD 1ND0B 1XF5B 2VZTA 1P4BL 1YEIL 1G9EA 2FO1A 3PL6A 4U6XA 3OB0K 2VLMD 3L7EA 2XXMB 4UT6L 3GHBL 2V2WA 4K3DH 4R7DA 1A7OL 4XCFH 4Z5RB 3CFJA 1F8TL 1S9YB 1U3YA 1OAZH 3E3QE 3WSQL 4YXHL 3K4DA 1EHXA 15C8H 2VDNH 3ZE1E 3MODL 5C0EA 3L5WB 3QHFH 1B0GB 5E6IC 5C0ND 1CTNA 3L5HA 2RGSA 1U3HB 4F37K 4I5BA 4JKLA 1BFSA 4G3YH 5GRYA 5IB3A 5F7UA 3F7RA 4HPOH 4ZPTA 5C3TA 2ORBH 4O5LH 3V5KB 1K8DA 1RZKC 4N0CD 4A2LA 1IAKA 1YMHB 2D31B 2BNUA 3HC3H 3OBAA 1JZ8A 2CKBH 5GS0L 4LSQL 1BQUA 3QQ4B 5E8DH 3DJ9A 3BISA 4XI5D 4APQD 4KRPD 1PLGL 3WJLC 3QQ3B 2X4NB 1PYWA 4LSPL 3RGHA 5J11B 4TUKL 2D9CA 2WSKA 4OLXL 5HHQA 4PP1D 3B43A 3QEGH 3C5JA 3O45A 3WDIA 3FQWA 2V6HA 3KDMA 4NUJB 3QP3A 2H6PA 4JO3H 1SJHA 4QHKI 4X7SH 3PL6C 2YS4A 4WHTB 2JJWA 5CSZB 2DQUH 3T3MF 3P0YH 1RJZA 4QHUB 2XG5A 2OTUA 3GI9L 1EO8H 3UC0L 2I07A 1M05A 5JHDB 3NMEA 3PNWA 1HNGA 1HSBA 3KPSA 4C4KT 5CBAB 1EA9C 3BP4A 3EYSH 3LS4H 3TYGH 5T3ZH 4CDGC 5DRXA 2DBLL 2E9BA 4KRMB 4D0BB 4Y0GA 1P7QA 4MXWH 5AZEL 1GSMA 2KPNA 1GZPB 4LGSB 5DC4B 1T5XB 5EO9A 4ZUVB 2PCPA 5FO9A 3OAYK 3QXAA 5INCA 1FNSL 3HUJF 4XVUC 4JFYA 1A3QA 4Y4HA 5IFJB 1T21B 4TVPL 1EPFA 3LKNA 2ZCHL 4Z9KB 4OCWL 3FFCD 2ADJB 3ZHDA 4O9HL 1UENA 5FM5M 3S97C 2VDKL 2QADC 4PJ7F 1SEQL 2IMMA 1JWMA 5HDBE 5J1AA 1QFUH 1ES0B 1KCVL 5CJ8A 4U1GC 3H7BB 4LK4A 1ORQA 3RDTA 4J6RL 5DTFB 1RIUL 3RI5F 1XGPB 3CFEA 5GJTH 1B0WA 1OM3H 4WI5A 2GAZA 4WUKL 1U91B 2VISB 4RQQB 2YD3A 4XHJC 1JWSA 2IQ9L 3BRFA 3C5ZC 1A1NB 4OZFA 3ARZA 1MFCH 3G6AA 3SE9L 1VFMA 2FYYB 3FQXB 3MRJB 3TA3C 4LKXB 4X5WA 5EFIB 5D1ZA 2V17L 5I71C 2WW8A 1K3IA 1CLOL 5GGQL 5EZIL 1NC4B 3F7QA 1N0XH 2YHGA 2ZG1A 1BD2A 2P45B 4WI7A 1BZ9B 3VXRE 4G6MH 3OJVC 5EBLA 2P5ED 3SDYL 1QEWA 4K9EH 4K7FA 2J8UE 3SGKC 3SE3A 3F5WB 1JRHL 1U92A 3NAAL 4JAMA 5E4EB 4Y4HC 1NGYB 3RZCA 1BEYL 3DIFA 4BSJA 2NMSA 1TVBA 1NLBH 4TSBH 4JFEB 4PV9A 1QG3A 4JANB 4G43A 4S2SB 3QQ9D 4LNRB 1C7TA 1J8HE 5B38G 1N8ZA 2JJTC 4ONOA 5F71A 3AFLA 4Q74A 2X09A 1G7PA 4JRYA 2MOVA 5JA8B 4ODSL 3O2DA 3S7GA 3WFZA 4NRYB 2UWEA 1EEZA 2FBJL 2IPUK 3I75B 4JZNA 3SBWC 1EAPA 2H8PA 1U36A 3BJLA 5IVOA 4N0YH 3C09B 5T3ZD 5FGSA 4Z78A 2V9TA 3D18B 3RWEA 2VLJD 3LEXB 3B9EA 1VPOL 3WHXB 5D1ZC 4UDUA 2NY1C 2X1QA 2OR9H 2F54B 3LZFH 1TQBC 5T3XL 4C56A 3C5SA 2NW3A 1YY8B 3SDDB 4TUOA 4OF8A 4JDZB 1MWAB 4R6UA 4NUGL 4OFVA 3OPZH 2CMRL 4XTRD 3GO1L 1H8OA 2UZXB 1MRFL 4CBPA 1I4FB 1FVDA 3SE3C 3BSZL 1BLNB 4V1DD 3RZCC 4MJID 4POUB 2CUMA 4MA7L 3RVXD 3DI2B 3AAZB 3SQOH 5HGGS 4FQIH 4BELD 4QOKA 1RVFL 1MCLA 5IQ9B 3LN5B 4FQHB 4G8IB 4RMWA 5MERA 4UMGA 1F2XK 2W59A 4NNPH 5JW5B 4PB9H 5DA4A 5I74C 1H3PH 1YEEL 4JHBA 1KC5L 1NGZB 2ZJSL 1W0YT 3FOLA 4O51B 3WUWB 3BQUC 4YXKL 2EXWD 1X5AA 1UG9A 3R06A 4NN5C 3WL9A 1M7IA 1NSNH 4HXAL 1DFBH 4GAYB 4BH8A 1BZ7B 3QUZD 3BKJH 4LSRL 4KI5F 1AI1L 1PEWA 4LVEA 3KXFE 3WO3B 4PGBA 3VGHA 2UVFA 1YEFL 2PO6C 2VO5A 2CLVA 2ADIA 4DOHE 3ARVA 1EDQA 2GTZA 2NXYB 4LDLB 4V1DB 1OVZA 4M7LH 3V2AR 2SEBA 3AY4A 1ODAA 2HJFA 1HEZB 4P2OC 5GRJL 4OGXL 4KJWC 2B1HH 5I1JH 5JW4Q 1U42A 3GSNA 1RZKL 4ZAKB 4GFTB 1MY5A 2Y23A 1A6TB 1JNHA 3QDHA 3UBXI 2IF7A 4ZSOE 5AYUH 2ESVA 3GSVB 5HPMB 3UZQA 1CR9H 4ZD3L 3WS3A 5L88H 1HXYA 3MNWA 1IAII 3OKLA 4O00A 3SKNA 4RGMC 1K2DB 2F5BH 4Q9RH 3U46A 4HHAA 1U9KA 1IEBA 2OP4H 3KPPB 5CHNB 4YFLF 1LK2A 1QQDB 1UZ8B 3LV3A 1YN6A 5EU5A 1TJIL 1EVUA 4FQJL 4TVPE 4IM8A 1G0DA 3RNKB 1FPTL 5ADPH 2I5YH 2X70A 4U6YB 2EDKA 3AB0C 1CDHA 2HT2D 1CD1A 3HMXH 1I1AC 2EE6A 5TE6L 5JNYB 3S4SB 3WIHH 1AD9A 2LVCA 5IVXF 5FM8A 1C5CH 4ZUWA 4JHAH 5KZCD 1R5VA 3QUMH 4GBXA 3T4YA 1KTDB 4X6CA 1U8LB 4RX4A 4XB7A 1FIGL 5ILTH 3IGAA 1YNTB 2ZUQC 3JTSB 4JREB 3H0TB 3AY4C 4XNYL 4XAKD 5I6XC 2YZ1A 1LGVA 2EDDA 4P5MB 5E8NA 2E7CA 1NGPH 1LEGB 5E2TH 5BV7H 1KN2H 3VXRB 4IS6A 4PJ8B 2UY7A 3SCMB 3WFEH 3QNYB 1OSPH 3H6JA 3QIUA 1CVSC 1NAML 2J8UB 3I50L 2VSDA 1H0DB 3NCJH 1DLFH 3E8UL 2I24N 1MCRA 2A38A 4ZFGH 4KC3B 1HIMH 4XMPH 1J8HB 5D2LE 4HUXB 3LKSA 4NZRH 3SDCD 3IFPA 3P9LB 5ETUA 4I3RH 4MA8L 1FZMB 3BUYB 4AK1A 3FO0L 4K3JL 2Y7QA 5EOQH 5J56B 1CICA 4FTVA 4N9GA 4PUBL 4XVTH 2EO1A 3RVTD 1PEZA 4MNHA 4GAJL 5DT1H 5FECB 3VFOA 4FQCL 2N1KA 3HNTL 3LOWA 1V7ML 5DJCA 4JZOB 5C07E 4LCWD 4Y4FB 1IT9L 3T8XA 4TYUA 2DD8L 1F6FB 2XZZA 5EOTA 1YMME 1UADC 4OFKA 3U0WL 4GBXC 3GSRB 4MS8D 1Q72H 4C55A 3OKNA 4IRSB 2XKUA 2MPAL 4ONGL 2YD8A 4LSUH 4NPYB 2WNGA 3P0GB 5B3JE 2EYRA 4YPJA 3JBG7 2CJUH 3MGAA 4G5ZH 5D7SH 4OD3H 3B4NA 3QIUC 2AERT 2CGRL 5E8EA 4OI9A 1V7NL 5EG6C 4DAGL 1NKOA 4LHUB 4M1DL 5EOCL 4NBYB 4KY1L 3WHE0 5D9SA 4G9FD 1F4YH 3CZFB 4ZFFB 2EDFA 2Z8VC 3NACL 3PWLB 1P5VA 3BEWA 4U0RC 5CWSA 2ARWA 4IOIA 3X11B 3RIAK 1DUYB 2HVKB 3UBXG 3UEZA 5IEKB 4P3CH 4J8RA 5I17B 3ZDZE 1C12B 4BUHA 4YBLC 2UYLB 1RZJL 2ATKA 5FYJL 1YY9C 1D9KD 1H8SA 3REVA 1ZVYA 1MI5D 3CFIC 1SJVA 5IBLC 4XMKL 1C08A 1TCRB 1T3FA 4LLQB 4NFBA 3KXFB 4H1LB 1YJDH 4PR5A 3OJ2C 4Z7UE 3A6CL 4YBHA 1DLHB 3KPTA 4WTWA 1VEMA 5DVKA 3L5IA 2E3VA 1FORH 1KPUA 2MCPH 2P8LB 4DOHB 1KFAH 3MV9A 4HUWB 3NABL 4XXCC 4ZTPH 1X5KA 3QDGD 2O5YL 4M7JL 4BFBD 3N85H 1RUKL 5C0NC 1A6WL 2RFXB 4OFIA 3O3DA 1NFIA 2BSTB 2VERN 5MP6L 4B7IA 2A9MH 1OP3K 2IGFL 1MCPL 3EOTH 1XIWB 3O6FB 4N0CC 2PYED 3D6GA 1MY7A 5E9DE 4MNQE 4ZSOB 1UWEH 3OKEB 4U1NB 2DQJL 1E0OB 2A6IB 3TBTA 3OF6A 2Q3AA 1BVKB 2D7OA 3IYLW 1Z3GH 4PBWD 3FOMA 1YNKH 5H35B 4XI5C 4APQC 4KRPC 1AGCA 2BJML 1S7VB 1Z5LA 1JZ3A 1KPRA 4S1QL 3EUUA 4GO6B 4PP1C 4UTBH 3FB5A 5BMFH 3BYTA 4EN3B 2BVOB 4IMLA 1XCQB 3WFHA 5CZVH 3GJFK 2X5PA 1QHPA 4LSVH 1D7FA 1IKFL 1XAUA 1LEIB 1IBGH 3ARTA 4ODUA 5IGXH 3WKNA 1WFUA 2Q76A 4H20L 1U8PA 4Q6IA 4X0KB 2B0SH 3PF2A 3BESR 3N1QC 1KLFA 2EYSA 2C4FT 3ARYA 1YEHL 4L8SA 1IAOB 3QCTL 2CKBA 4OF6A 1QKZH 1XR8B 4OZ4A 5C08A 3DO7A 4KQ4L 3RAJH 2D0FA 3TBVB 2OSLA 3LRHA 2OR8A 1NGWA 5CUSH 4NZTH 1EEUA 2FX7H 1Q9KB 1EMTH 2CDGA 3FTGB 4JDTL 5DJ6A 5D2LB 3C6SB 2FX8L 1RHHB 2W91A 3DSFL 4Y4KB 4OLEA 2DS4A 5H37G 4RFEA 2H9GA 5GS1B 5IEHB 1ZGLM 3HZMA 3OGCB 2MMXA 3TO2A 3PWPA 4RA0C 5JPNA 2EC9U 3TF7C 1KLGB 5E1AA 2R4RL 1XR9A 4W68A 4U1KA 3MLVL 4Y16D 5C07B 3O4OB 1RSFA 4Q6IC 4BZ1H 4PJIA 4NNXA 2PTTB 3WNLA 4N8VA 1YMMB 1QLRB 1RK0B 4GG6F 5EO0A 3HA0A 4L8SC 3HZVB 3BGFB 5BRZD 3TV3H 4RMVA 2V2TB 5MEOB 4N5EC 1OWRM 1CN4A 3KPSE 5KSUA 1H9VA 4QLRA 4M43H 1B6UA 2EH8L 2HAZA 1KB5H 5JHLH 3QISA 1FGVH 3O3AB 4XC3L 3QQ9C 1EUTA 3RWJA 2OL3B 4X9HA 2FO4B 4XPGH 1MHHA 5AAMA 3G5ZA 4YR6A 3X3GH 5MEND 2DQFB 3S35L 3WFBL 4ZUUB 4HWEH 4G7YL 4P9MH 3NOIA 1E28B 1Y6MR 2EO9A 4PRHD 5BQ7B 4JFZH 3QG7L 4OZIB 2NXZD 3ESUF 4JN1H 2WK2A 4UNUA 3V6OA 5A16A 1F5WA 1FNFA 3SPVA 4XVSH 4YE4H 5ADOL 4U6TA 3DX8A 1U3ZA 2YXFA 3GHEL 4OIBA 3OKMA 4FQXB 4YDVA 2AK4A 1KACB 4P2RA 3QEQA 4HGWB 4Z95H 3S5LG 4YHLL 5GRUL 2BVTA 4QHMB 4XTRC 1RUPH 2RHEA 1FSKB 4Z7UB 35C8L 5GSRA 2Q8BH 1PX4A 2ATPB 2DJ4A 1BD2E 1FCGA 3N50A 5I75B 1WJ3A 4HPYL 3X13A 4QGTA 3RVXC 3CNKA 5HPOA 4DKDC 3TESA 5DD5H 3D2UD 3KPRA 4G80B 5F96L 5MENB 5J06A 5GQBA 2DL2A 3RJQB 5KBNC 3WKML 3RA7L 4G6KL 3HMWL 3CFKB 5TH2B 3VFRB 1CE1H 3IKCA 4DCQA 2NXZB 4U1LA 2GFBB 5E9DB 4MNQB 1KCSH 3QHTC 1NUGA 4HK0A 4FP8H 1G9MH 4JRYE 2EXWC 4TUJB 4DTGH 3F12B 2UWEE 2J88H 1U95B 4GKNA 4HIJA 3QUZC 1MCDA 2GT9A 1M1SA 5IV2A 3E0GA 1GC1C 3B3IA 4WFFD 3CU7A 4K9EC 5D7IF 5IJKC 1EFXD 2W9LA 3L3GB 4QXTB 2YC1B 3UXFA 4KGLA 1MFAH 3HNVH 2Z93B 5D5MF 2P1YA 3HI5H 1ONQB 4MD5B 5IVZA 4C56E 4TOYL 4MXVE 3V8OA 2UZIH 3MLPA 4MZ3A 4AEHL 1JL8A 3S3JA 4JKPH 3PL6B 4U6XB 1ZGLA 1JFQH 1NCTA 1AE6H 1QLEH 4OBSA 5HI5D 5CP3H 3BEVA 4FFZL 4R7DB 4LRIA 4R0LC 5JTWA 1KENL 1AGEA 1INDH 3CFJB 4WGWB 4LIQH 1NCDL 4I9WE 3QWRD 1UCBH 1WT5C 5C0EB 4QOKE 4CVUA 1J1OH 3MRFA 1QSFD 4HK3J 4I5BB 5F1SA 5IB3B 2P24A 4PJBF 2AEWA 4MJ2A 1H5BA 2X4PB 4UV4H 4ZPTB 4YDJB 4UIMA 1K8DB 3VCLA 4AL8L 1IAKB 3SKMA 2P8PA 2WM0A 5ICXA 2BNUB 4DKAA 4OV5A 1KT2A 1DANU 1A02N 2HT2C 3MV8A 4M6OL 2WIMA 4KJQD 5KG9A 3T0WA 2XYCA 1F90L 4Z7VA 1PYWB 1TETH 1TZGL 4L9DA 3U1SH 3C5JB 3SGJA 3W2DH 3KDMB 2H6PB 3SJVD 3EDJA 3W5MA 1SJHB 1SVCP 3BP5B 4ZDHB 1RJZB 2DQTH 4J12A 4K23H 4NM8H 3QIWA 1M05B 3PNWB 3GBNL 1OAYH 1HSBB 3MUJA 3KPSB 5I71B 1GZQA 1F45A 3J8F7 1JGVH 5C0CD 2BX5A 2QKIA 3BP4B 1YPZA 1KOAA 1FHGA 4GRLA 4QRRD 5DRXB 4YHYB 1FYTA 1P7QB 1QSFB 3OWEA 4LU5H 5JIIA 2W07A 1AY1L 3LKRA 4K3DL 1B9ZA 5EO9B 2ESVE 2Y36H 2PCPB 3HMXA 5FO9B 3QXAB 5INCB 1KB9K 2BOBB 5DEGA 2DIAA 1OAZL 4YHML 3SDCC 3LKNB 15C8L 2VDNL 3V7MA 3QNZA 2DMBA 1JZ2A 5IROC 5IJVB 1E4JA 3V0AC 3QUMA 1X7QA 3MLRH 2FSEA 3GIZH 2DYPA 1ORQB 4ELMA 3RDTB 3S9DB 2IG2H 4O5LL 3IETA 4OCMC 2NZ9D 3JV0A 4XC1H 3CFEB 2YR3A 3SGJC 2X1XR 4J7RA 5EBMA 2GAZB 3VD7A 1ZLVH 4MS8C 1IJ9A 5E8DL 4U0QB 1JHTA 1UACL 5C0IB 4DVBA 1WBXA 1JWSB 1VGEL 3QI9A 1UJ3C 4WEMB 1ACZA 4LMQE 3G6AB 2HYMA 1UWXK 3QEGL 4X5WB 4ODXA 3MUHL 4JO3L 1UKTA 3ZE2F 4YAQA 1NMAL 1JTTA 1BD2B 2DQUL 1T7VA 3UTTA 2X89A 2D7PA 1EO8L 1P84J 1QEWB 4B41A 4NKQB 3ZT7A 4K7FB 1KLUA 1P7HL 2FD6H 2VN4A 1U92B 1BOYA 4TTGA 4JAMB 1LNUA 1JV5A 3DIFB 2R8SH 2D03H 1EO5A 4XMLH 3TYGL 5T3ZL 4G43B 2DQGH 4MA1C 2Z92B 4KHXH 4UINH 1CXIA 1N8ZB 3OAZK 1J5OH 4MJ5B 4XX1G 3HUJA 3TZVA 4NCDA 2K7QA 4FTVE 4JRYB 4HC1L 3K0WA 5F7HA 1RMFH 1D9KC 5BV7C 1EEZB 1R24A 1QFUL 5B22A 1EAPB 2H8PB 4RWHA 3ZKXC 1FFOA 4Z0BL 4CADA 3DUHA 1W0WA 4Z78B 3T0DA 4F8TA 4RISH 5E5MA 5JA9A 1LE9A 4NN7B 3CLFH 4OLWH 5MEQA 3PE9A 1OM3L 4UDUB 4LDOB 3GMLA 5L2JB 2Z8RA 3C5SB 4P59H 2NW3B 2BVPA 2GI7A 3MRGA 4G6FD 4TUOB 2XY1A 3EGSA 3WO4C 5L7XH 1T2JA 4FG6C 2RQ8A 2IPTH 1KCRH 2EKJA 4QTHA 1FVDB 3MJGX 5D4QA 4QXUL 1A3RH 5EU7C 3ZTJH 4F7EA 3VXUD 3VFTA 2X4QA 3WDHA 1VHPA 3U0TB 1GC1L 4QOKB 3VMNA 5DK0A 5MERB 1VDGA 3QIBA 5T33H 1I1YA 4XNUH 1NLBL 5E08H 1I9IL 8FABA 4I1NB 5SX5H 2WMPA 3I6GA 5KAQG 2ADFH 5A3ID 5D93B 1E4WH 5DJAA 3FB8A 3FOLB 3IDYB 4NYLA 1JMZA 4Z7NE 3WL9B 1M7IB 2OCFD 1C5BH 4P4KD 4BH8B 5JOEA 4KVCH 1FN4A 5D7JA 3LKPA 3C60D 5DQDH 5DJXA 4L8DA 4HSQA 3ARPA 4RIRA 4QRTB 5A2IH 5B4MD 4PGBB 3S96A 5KVEH 2ZUVA 4PRIA 4J4PA 3V5DA 4F7MA 4IOSD 4EIZC 2CLVB 4MA3A 2ITCB 2ADIB 1OP5H 3BW9A 3MV9E 3HR6A 2GTZB 4I13B 3ZKSD 3HFMH 2OR9L 2FJHB 1BREA 2EYTA 2SEBB 4Z6AT 2HJFB 2ZPKH 5F8RC 1CDBA 3GSNB 3B9KA 1K9TA 3OPZL 2VZ3A 4YDLC 4C54A 3CXHJ 5KJRH 1QRND 2EEDA 3IDGA 1AQKH 3MXWH 5EIVA 3ARGB 2P5WD 1JNHB 4NQDA 1AXIB 2BVEA 1YJDC 5D72H 2ESVB 2Z9TA 3C6LD 3FMGH 4GH7B 5JW4N 3WS3B 4NC2B 3MNWB 4FQIL 3OKLB 4N9OB 3SKNB 1I8LC 3U46B 3VXMA 4HHAB 4H88H 3Q2CA 5C7XH 2IBBA 3Q1SL 2F8XC 4PB9L 4OF5A 1YN6B 1H3PL 5EU5B 1IGCH 3C60B 5DYOA 4LHJB 4H5SA 2X70B 1CD1B 3EO9H 4UB0H 1NSNL 4TRPL 3QO1A 1WTLA 2VIRB 4QNPF 3DGGA 3QJHA 4HBQA 3TYFA 4JY6A 8CGTA 4PIRF 4ZUWB 1A2YA 1QFWH 4KVNL 1R5VB 1OPGH 3T4YB 1MCCA 3IGAB 1IZJA 1NMBL 2IBZX 1RURL 3T4AB 1DBJL 2WUBH 5I8KH 1TQCC 4GMSH 3B9KC 4JJHA 5DSCA 5E8NB 3GBLA 3QWQB 5C08E 4F37F 2GJZA 4IS6B 1W8OA 5FGCB 4G6AD 1NCNA 4M7LL 3K80A 3CGTA 3BPCB 3TJEL 2YD2A 2W9DL 5I1JL 5C0GA 1K6QH 2COQA 3LN4A 4PV8A 3DURA 4NHCH 4LVHB 1GOHA 1J86A 4LAQH 3LKSB 5AYUL 2GQHA 5GZNC 4X9FA 3IFPB 4U0RB 5ETUB 1CR9L 5L88L 3MRBA 2HRLA 2Y7QB 4Z7OE 1CICB 4NO0A 2CR6A 4FTVB 4N9GB 4YWGH 2F5BL 3PWPE 4MNHB 3CVHH 4UTAH 2OP4L 3RU8H 3VFOB 5JDJA 4GG8A 4QXWA 5DJCB 4JFHD 4OB5H 1OT2A 4PJIE 3IB4A 5EOTB 4KI5C 4GRWF 2CO6B 3MLWH 1CLZH 5ADPL 1FE8L 2I5YL 3WHE1 4RNRA 1G7IA 3JUZA 4PRPD 3KJ4C 1IARB 5DC0A 3WIHL 3AXLA 3EAKA 3X12A 1NFDA 3CAFA 1S9WA 3BE1L 2A73A 2EYRB 5D96C 3QUML 4QRPA 1OL0A 1ED3A 2ZCKL 3OQ3B 4JPVH 1WTGT 2AJVH 2ZKHH 5E8EB 4GKSB 2VKWA 3VI4F 2HTKC 1B6DA 3A6OA 2CRIA 4WTXA 1CCZA 5E2TL 1KN2L 3P0VH 5BV7L 5D9SB 4OZHF 5DJ8A 2IWGA 4KTEH 5ISZD 5K9KA 1OSPL 4CU6A 3BEWB 3MREA 5CWSB 3KHOA 5DUBA 3IS0X 1UT9A 4RAUA 3NCJL 4IOIB 1HNFA 1DLFL 2FX9L 3QHZH 2HJKA 3TWCH 3V6OE 4YBQD 4XMPL 5CIPB 5CZXD 4J8RB 5F88A 1J05A 4IIQA 4P4RA 4YXLH 4JO1H 4WI2A 4UI2A 2ATKB 3U9PH 1I7UA 1Z9OA 1X5YA 3REVB 4XVTL 2AK4E 1U0QA 4P2RE 4P0DA 3QEQE 4LPYA 1INEL 5DT1L 1T3FB 2JJSC 5CD5D 5F1KC 3HG1A 5DD0H 5BW7A 4NDMA 2Y1VA 4I4WB 5GZOD 3WLBA 5HI5C 5D7KD 4HS8L 1KPUB 3LD8C 4L4VD 3EDDA 3MV9B 1O7VA 4ACPA 4ERSL 1JNJA 5DC9B 2H2SD 3ULVE 3KPRE 4LSUL 1YECH 4MB4A 2XTJD 1YYLL 4JVWA 3RGVA 1T2QH 1W0VA 5GXBB 3O3DB 5ISZB 1S9XA 5IMLA 3LKOB 2ZSWA 3VD3A 3STZA 4YC2C 3NIGF 5ELIA 2GJ6D 3TBTB 2KH2B 1GXEA 3H9ZA 5I18L 5FOJA 1QACA 5DJYA 1F4YL 3FOMB 2VNCA 1EERB 2VZSA 4KJQC 1AGCB 2VZVA 1Z5LB 5F6IC 1KPRB 1LO0H 1E4XH 5HJ3A 3FB5B 1A6VH 2BHYA 4JO4H 4P5TA 4P3CL 3DUUA 4IMLB 3WFHB 1J1XH 4O2FA 5FIEA 1CZ8L 4CVZA 1I7TA 1EHNA 2VDPH 3FT3A 5L9DL 4KU1A 3FFDA 4ODUB 1S7UA 2Q76B 1G9MC 2CXGA 4OV6F 1U8PB 1WAAF 1NMCC 1IQWL 1Z0MA 4Y8DC 2DQCH 3SGDH 2EYSB 3UPCA 5GHWH 1YJDL 4X4ZA 1SEBA 3DXAD 3MUY1 5ESVA 2CKBB 1OAUH 3C9NA 3RGVC 3GFUA 4MB3A 3DV4A 2MCPL 3TIDA 1ACYH 4OZ4B 4KI1A 5C08B 5MHSE 2Z0BA 3H7LA 1B4RA 2HJLA 1N7MH 1NANH 3CD4A 3WS6A 2DRUA 2W92A 1NLDH 3QCUL 2OSLB 4Y2DA 2DI8A 2E8YA 1NGWB 5B3NA 1PY4A 4JN2A 4GRMA 2A9ML 2CDGB 2PXYA 3EOTL 1JBJA 5DJ6B 2NZ9C 2YSSA 5CJ5A 3AS1A 3QXUA 3QA3A 3C2AL 3MV8E 5FV1L 1Z3GL 4RFEB 2LU4A 3EYQD 2H9GB 4Z7VE 3HZMB 1YNKL 3SGEI 3PWPB 1I9EA 4NFCA 3JVGA 5HHPB 3QZWG 4MQ7A 2J6EH 1CFTA 4PRNA 3ALPA 5E1AB 1XR9B 4UTBL 2AAVA 3L5XH 4MAYA 4U1KB 3PG2A 4W6WB 3DYPA 4PJIB 3LEYH 4NNXB 5IF0A 4N8VB 2NY3D 4P46D 3W0WD 5EO0B 5CZVL 3DHJA 5GIRA 3GMNA 4LSVL 3DXAB 3BGMB 5EIIB 1IBGL 1SY6A 5KSUB 4ZUTB 2DBJA 4F9LC 5LXGH 1YPZE 1FYTE 1JNLH 1ADQH 1HZHH 3I6LE 2QHRH 3U7YH 1JVKA 3MJ9H 3Q5TA 3RWJB 4M62H 1GL4B 1MHHB 5T1KD 3G5ZB 3T0AA 1FYHB 1QKZL 1ZA6A 3K4ZA 3LRSA 2W0PA 3B5TA 4LPVA 3LDBC 4AEEA 3B2UC 5AD0A 3SDAA 1AO7A 1KTKE 4MVBD 5F7KC 1HXMA 1Y6NR 3OB0H 1T1XA 2R1YA 4ELME 5CUSL 5HYJD 5CILL 1G1CA 3REWA 32C2A 2O5ZH 3RVVC 1EMTL 5A16B 2AV1B 3I3EA 4JY4A 4DGIH 5JO5A 5DRNA 4U33A 3QNXA 3DX8B 2JELH 3OKMB 4XP5H 4NJ9H 2AK4B 4P2RB 3QDMA 3V79C 3QEQB 2IADA 3KG5A 2YD1A 1UYWH 4W4NA 2KKQA 3ZKQD 1T1ZA 1KB9J 4N90D 1WBZA 5GSRB 4TULH 4BZ1L 1MFDH 3UTTE 3CU1A 5FKAB 1L6XA 3X13B 4GG6A 3BZEA 3QXWA 3TV3L 2NY2D 5HTSA 5T1KB 3KPRB 3DVIA 3N1FC 3OXSA 2VR4A 1KXVC 1KB5L 1DE4A 3RWCA 1FGVL 5EU4B 3IKCB 4DCQB 1EGJL 3MRHA 4U1LB 3MRKA 4XPGL 3HUJE 5A3IC 3X3GL 4HK0B 2YKLH 4K7PX 2XXCB 3FN0H 1CBVH 4GRWH 4P9HH 4HWEL 2CDFA 4P4KC 4P9ML 4HIJB 4GKNB 1JUFB 2HKHH 5ICZA 1NUNB 5C6PB 2GT9B 5IV2B 1G6RH 1TJGL 3B3IB 1OTUC 3BGAA 4PJFF 4WVRA 1QA9A 1YQ2A 2QEJA 4MB5A 3VXSD 1NGQL 1PZUB 5I16A 4D0CA 5B4MC 3OAYH 3O6ML 1CDUA 3O8XA 4Y5XA 1IGIH 4YE4L 1QHOA 1X5ZA 1OAXH 4MQTB 5ITBH 2OI9B 3O6LL 4JHZA 4XWOC 4DN3H 3QPXH 4LPTA 1FO0B 1FFPA 1NCBH 1ZGLB 2XQYK 3IFOA 5C0DA 2VDQL 1GOGA 1AC0A 5E56A 5DRWA 1RUPL 3O81A 3ARDD 4WWKD 3CCHA 3BEVB 1MHEA 3BHBA 1N5AA 4JLRB 4OTXL 5I8OH 1S7QB 4YLQT 4FABH 1L7IL 4JPKH 2AK1H 4NQEA 1OWWA 5DJZA 4HQQH 4QHNA 5I0DA 3MRFB 1EHLL 3RIAF 5FOBA 2P24B 2A1WH 3MV7D 1H5BB 3QDJD 4M6NL 1PGRB 2AABH 4AZ8A 4UIMB 3BFOA 3P30H 3VCLB 4Z8FH 3UJIH 3SKMB 2P8PB 1CE1L 1CG9A 4UU9A 4JFQA 1KCSL 4OV5B 1U2HA 1KT2B 1G9ML 1QBLL 3MV8B 1AHWA 4DTGL 5KG9B 3V7AE 4Z7VB 4KMTL 5ALCH 1PSKH 4Y5XC 4RRPA 5J0BA 1A0QL 1VFAA 2EDNA 4QXGH 9CGTA 4PRIE 5JXAH 4YO0A 4ZO7A 2H26A 4XT1C 4PRPA 3OJMB 5D5MA 2CLRB 2VXVH 4NO3A 3QIWB 4QO1A 3VG0H 4HFWA 2GYSA 3F7PC 2Q8AH 3UTSA 2UZIL 4KHTH 5BOPA 1OAKL 1U8OA 1GZQB 4JKPL 4XHQA 2BY2A 2QKIB 3DECA 1YPZB 4GRLB 2CSPA 1FYTB 1AE6L 1QLEL 4EI5D 3TO4D 4GQ9H 3LKRB 1FRGH 4NQDE 2NR6D 1F4HA 2I27N 3D5OF 1A1MA 1YZZA 3DMMD 1EO7A 3IU4H 3MV7B 5T1DH 1INDL 4EOWL 3F62A 1EJOL 1IGTA 5DEGB 1V05A 1MCHA 1UCBL 1NC2D 2G2RA 4WW2A 3VXME 1I1FA 4JRXA 1X7QB 4PJGA 1B2WH 2H2PD 2EIZA 2P49B 3T04D 2FSEB 2AI0L 4BJLA 2DYPB 1I8KA 3ARBD 3BVNA 4HIEA 4JG1L 4UV4L 4ELMB 2C1PA 2VQ1A 3PXJA 3UJTH 3UJJL 1BVZA 2DQHH 3DPBA 4DEPB 1DQLL 5EBMB 3MUGA 5C9JA 3ZKXB 5ACZA 3QG6A 3EJYC 1JHTB 2IH1A 4DVBB 1JGUH 1JPTH 1WBXB 3MRPA 2NLJA 2YK1H 3QI9B 5LGHL 4KI5E 3ECBA 1KN4H 5C0AA 3U1SL 1RIVH 1ZHNA 3MNZA 5IHBA 3W2DL 4ODXB 4W6XB 4OAWA 3MXVL 4WUUA 1XF4A 4YAQB 5BZWA 4OM1H 1IM9D 3UTTB 2DQTL 4NM8L 4ZG1A 5HVHC 1MVUA 1WUNT 43C9A 1KLUB 1OAYL 4AG4L 5D1QD 1LNUB 1JV5B 1JGVL 3NFNA 3AS2A 3WBDA 3MLXH 5DMGD 2VAAA 4LLMA 4ODTL 4LU5L 5KVGH 3VXQA 1KEMH 1JZ6A 2VQUA 4YBQC 3ARBB 5IBUB 4EUPA 2F5AH 4LSSL 3HUJB 2NW2B 4J3OC 3TZVB 1I3GH 5DK2A 5DQJB 5F7NC 3BT2H 1H8NA 1R24B 3R4DA 4HUVA 5DHVH 2Q86A 4PJHA 5HYSA 12E8H 4L8BA 1FFOB 3GIZL 1B0RA 1M6OA 1QFWI 4F15B 5E5MB 2R0LH 2I9TA 5AZ2L 2FDBP 1LE9B 5IESL 5MEQB 2WP3T 2IPKA 4NKOA 1DQQA 3GMLB 4X6EA 1NFDE 1A1OA 7CGTA 4UAOB 2BVPB 3MRGB 4JY5H 4QRPE 5D8JL 2XTJC 3EGSB 4RGND 1JF1A 2IAND 4M9PA 2LU7A 3EO0A 4L4TE 1C1EH 4HLZG 4W81A 3QUYD 4F7EB 5IQ7H 1F4WL 3VFTB 4P2CG 3B5HA 2X4QB 3ZTJG 3PP3H 5HGHA 2BSSA 1F4XH 2FJGA 5DK0B 3RWGA 5FA3A 1F3RB 1RZIA 4R9HA 4F80A 3QIBB 3D9AH 3RUGF 1I1YB 1CK0H 3JV4A 2R8SL 4IDLA 1XGRA 3K74B 2CRYA 4K07A 5TGBB 3VDAA 4XMLL 2DI7A 4LVNC 3RY6A 3KS0H 4ELKA 4ZS6C 2XQBL 1OAQH 5HGBA 5DJAB 3FB8B 3ARSA 4FS0A 4WI9A 4NYLB 2G5RA 4RMTA 2D7TH 3QYCA 4LRNH 5TFSL 3CDGA 2IAMA 4IRJD 4XXDB 1I85A 5D7JB 1CXFA 3GJEA 5DI8A 1YYML 3X3FH 2XZCH 3V6FA 5DJXB 2VLKD 5F1OB 3NZHH 4L8DB 4OZGF 3ZMRA 4JQIH 3HG1E 4RIRB 3OKKA 2RB8A 3S96B 4RISL 3V5DB 4F7MB 4NOFA 4MA3B 5C71A 4HCRH 3FQUB 4HWBH 4AEIH 5IT2H 2Q1EA 3KHQA 2EYTB 4DKFH 1KXQE 3M17B 4P59L 5KSVA 5FM4A 3HCVA 5EPMA 4M00A 4HIIA 5L7XL 2ZOKA 4PJEA 1MCIA 3IDGB 3JZ7A 5BXFA 2DDQH 4YNYA 1WC7A 1N6QH 4NQDB 1FP5A 3BI9X 1MRDL 3UP1A 3RY6C 1SHMA 4JZJA 1CFVL 4WO4A 3VXMB 1IEAA 3EYQC 1B3JA 1TIUA 2E8ZA 3OL2A 3FCTA 1NCCL 4OLUH 4ZXBD 5C09D 5E08L 4M3KB 2IAMC 3NH7H 3O0RH 4IRJB 1JYWA 2FR4A 1I85C 2GTWA 4LIQE 3IDXL 5DYOB 4MQXD 4NSKA 2ADFL 2APVA 3KVQA 4JG0H 1E4WL 2NY3C 4P46C 3VXOA 4KTDL 1C5BL 3QO1B 1MSPA 3PP4L 4KVCL 3DGGB 3TYFB 2Z35A 1BFTA 1A2YB 3T3PE 5DQDL 5GSVA 1X5FA 2QSVA 1J7VR 2K1MA 4KROB 5CINH 2BHZA 2HFGH 5FGBC 3BPNB 3AM8C 1SM3H 4L5FL 3K2UH 2GJZB 1HDMB 2GY7B 3VG9B 3HFML 3KYMA 3NGBB 3FT4A 2J6EA 5JZ7C 4JM2F 4JZJC 4MVBC 5C0GB 3UPAA 3BAEH 4JVPA 1ZLSH 3LN4B 4GQPH 4PV8B 3DURB 1AQKL 3MXWL 4CU7A 5DMIH 3ORJA 5FUCC 5LWYH 5J7CC 5D72L 4NOBA 5DR5H 3FMGL 2UUDK 2X4TB 4ZOAA 4WFEE 4Q0XH 3MRBB 3VFWA 2E9IA 4NO0B 5ACLA 4KPHH 4ZFZA 3O9WA 4H88L 3WIIL 3ILPA 1F6LL 5C7XL 3LIZH 3MJ9A 3D87B 4GG8B 2RR3A 5C6TH 1OP3H 4NQVA 4XBEL 3UROR 4KXZI 1VEOA 2DM3A 2C1OA 2DTMH 5H2BA 4RNRB 5F93C 3Q6FA 3EO9L 1AP2A 2J3SA 4UB0L 1U2CA 3VFMA 4OUUA 3AXLB 3X12B 1NFDB 3VMPA 1S9WB 2A73B 3FT2A 1X4YA 1QFWL 2NY2C 4AEFA 4GAGL 4ZO8A 4QRPB 2V2XB 1NANI 3NCYP 1V5JA 3IAQA 3NA9H 4L4TB 1LK3H 3QFDA 5I8KL 4F9PC 4KJYB 4P57A 1EFQA 4OCSL 3GJFH 3RKDD 2MQ0A 1SMOA 5DJ8B 5KVMC 2BNQD 2AJYL 1AO7E 5K9KB 2E27L 1T5WA 2OJEA 1E27A 1A6UL 3MREB 5DUBB 3T77A 1ZGLP 5J57B 5E2WH 1MIEH 4RAUB 1S8DB 1OOAA 2HJKB 4HUMB 4NHCL 1KG0B 3OHXA 4LAQL 5F88B 1YEIH 3VWKA 3ZKMD 1J05B 2WWMD 4IIQB 1W72H 4P4RB 1MCOL 5FEBA 1I7UB 3FZUC 4UT6H 3GHBH 4YWGL 3V6ZA 3RTQA 4LVOC 3DBXA 1A7OH 3QDME 4QT5A 3CVHL 1MRCH 4UTAL 3RU8L 4F7PA 3WSQH 1CLCA 4YXHH 3RPIA 4M9OA 3HG1B 2YPLD 4OB5L 3MODH 4NDMB 2H41A 5BZDA 3ARDC 4OD1H 2ZUSA 4WWKC 3CX5K 5L0QB 4GG6E 3P4NA 2B1AH 3OV6A 4NZDA 2BVQA 1G6RA 4I18A 5B39B 5CEXA 5CEZE 2E7LA 4JPWH 4EI5A 5EBWA 2XZQH 3TO4A 1MCFA 3RGVB 1ZS8A 4HJGA 4P23A 4AH2A 4Y5VA 1W0VB 4WI4A 5GS0H 1S9XB 4LSQH 5IMLB 2ZSWB 4D0DA 5IFHL 5E7FA 4JPVL 5I1CH 3STZB 2AJVL 2ZKHL 4HH8A 4LSPH 1TZIA 4TUKH 5CEYB 4NN6B 1FC1A 4HKXA 4NCC1 3P0VL 4GMTL 3N0PB 5DJYB 1PDKA 3VWKC 4Y19D 2DM4A 2BC4A 5HJ3B 5IBTH 3QHZL 3RTQC 6FABL 1S9KC 4P5TB 3F58H 3D3VA 2FBOJ 1J11A 3DUUB 2MKLC 4O2FB 3E6HA 4CVZB 1P9MA 1I7TB 4YXLL 4JO1L 4P3DA 3U9PL 4XCYA 5LJYH 1VESA 3TNNA 2VR5A 3FFDB 1S7UB 2VDRL 1LP9A 2CIIA 1U8MA 4P9HC 1KJ2L 3BH9A 4NT6A 1LO5B 2BSRA 4I18C 1S7TA 2JE8A 2QQQA 2ZCHH 4R2GD 1SEBB 3C8KB 4O9HH 3MRIA 4PGEA 5EZLB 5ESVB 4EI5C 3TO4C 5IHUL 3ISWA 4NQSA 3DMMC 4EQ2A 3DV4B 3HI6H 5FF6A 3U30B 3CFCH 4LQFL 7FABH 3TIDB 4I0PA 4LF3B 4NQEE 1HH6A 5BJTA 4JHWH 5DUMH 3WYRA 2HJLB 1Y6KR 1YECL 5A2KH 1TZHB 4G7VL 1RUAL 4Y2DB 1S9VA 2B20A 2H2PC 3CSYA 4S0TD 4JN2B 4GRMB 5K93A 3BP7A 1K85A 1A4JA 2PXYB 4A6YH 4Y5YA 4UOJA 1FLRH 2YSSB 4PJ9A 5GRWA 3ZHKA 1ZXQA 3QA3B 2FGWH 1UQSA 2DQEH 3UPRA 3VDBA 3NIFF 4U3CA 2J1KA 2R2HA 3SO3C 1LO0L 1PW3A 4PRNB 4R97C 3UX9B 2V5SA 1E4XL 1UB5B 1NCWL 5EO1A 1A6VL 4JO4L 4MAYB 3TPUA 3SDXF 5IF0B 3D0LA 4NKDA 5D5ME 3NAAH 3L3HA 1J1XL 3NCCB 5SWSE 4FQ2L 2V5RA 4R2GB 2BCKA 1QD0A 5GIRB 2VDPL 1A5FH 5ESQA 4LPUA 3UTSE 2QJDA 5D1QC 1G7JA 4LEOA 3O4LD 4XPBH 5CKGA 4MNGA 3STLA 2AKRA 2DQCL 3O11A 5SWQA 5GHWL 3LEVL 3RPKA 2R69H 2R1XA 4GXUM 5DMGC 1NH6A 4ODSH 1OAUL 3M45A 1FJ1A 2XWJB 1IM3B 4G8GA 1ZA6B 4WNQA 3LRSB 1ACYL 5FFLA 3NCBB 5ECJE 4Y5YC 2G9HA 3NCEB 5DS8A 4JRXE 5AD0B 1T04A 3SDAB 4PJGE 3SO5A 1AO7B 1HXMB 4HFUH 5DO2D 5JW3L 1T1XB 2R1YB 4X99A 3EDKA 2HH0H 1VPOH 3ZTNH 3REWB 32C2B 3TVMD 1FL3A 5DUPH 1QPXA 5T3XH 4QWWD 1S7XA 3CVIL 4U3XA 4JY4B 4NUGH 1ZVHA 5JO5B 5DRNB 2CMRH 3GO1H 3QNXB 4M7KL 1MRFH 1Q9LA 2VLKA 4M02A 4DZBB 1SYVA 3BSZH 4E41A 3NPZB 1JI1A 1WV7T 3QDMB 5C0AE 2DLHA 2J6EL 3QPQC 3LQAH 2LE9A 2EKSA 2EICA 1LO3H 1T6WA 1T1ZB 2HVJA 4WUUE 4PTTA 1RVFH 1WBZB 2HT3D 2PYFA 5FO8A 3T1FA 3LEYL 4AQ1B 1Q1JH 1D5XA 5BVPH 1Z6JT 1BVLA 1P2CA 4GG6B 3LSOA 2R0ZH 1JHLH 1DQDH 3BZEB 1CDCA 4RAHA 4JQXA 1YEEH 4X5XA 4OJFH 5LXGL 4PLNC 3G5XA 3HTLX 3MBED 5EORH 3S8WA 4XAWH 1JNLL 1ADQL 3OXSB 1HZHL 4HXAH 3UTPD 2QHRL 3MJ9L 1DE4B 3H9HB 1D5BA 3RWCB 3MRHB 1NKRA 4LSRH 3MRKB 2OJZH 2VUYA 4M62L 4W6YB 1AI1H 4ZS7H 3TVMB 3FQRA 2EIEA 2A6KA 5IG7A 2CDFB 5BS0D 4LGRB 3VJ6A 4PJHE 2I9LA 4Z7QF 1N26A 4JKKA 4WW1A 1OF2A 2ZG2A 4D8PB 3AUVA 1QA9B 3G08A 3Q3GA 1OTTD 4D0CB 1AD0A 3O8XB 4Y5XB 3WEXB 4DGIL 4I0KA 3IJYA 1FH5H 5D2NC 4PY8J 1FFPB 3IFOB 1UKSA 1MOEA 1UYWL 5E2JA 3H3BC 5DRWB 5SWSD 2RCSL 3HS0A 3CCHB 3IT8D 1MHEB 3BHBB 1N5AB 3CPLA 3MBEB 3ZE2E 4FQLH 1Q0YL 1MVFA 4MZ2A 1N6VA 4NQEB 2ICEA 5DJZB 1A6AB 2AP2A 4QHNB 1CFNA 1TJIH 3EZJB 5FOBB 5KSAD 1F02I 3KPLA 5H8DA 5TE6H 4ZXBC 1YA5A 2ITDB 4JDVA 5F21B 3PQYD 4UUJA 4YH6A 4JM2D 3MCKA 1CG9B 4HWBA 4UU9B 4JFQB 5GGVH 5AWNH 1BQHG 4RFNB 3FN0L 1CBVL 1AHWB 1FIGH 4P9HL 2FHFA 3DROA 4XNMA 4UZGA 2XACC 2HKHL 5F9AC 3CXDH 3DETD 4U1JA 5C9KA 1XFPA 1VFAB 4PJFA 3I2CL 2NX5D 4YO0B 2H26B 4OD2A 2FB4H 1T0PB 3OAZH 4JM4H 3QAZB 2EDRA 4IMKA 3I50H 3OJDA 3ULUD 2QR0A 5SWSB 4NO3B 1HOCA 1OAXL 4MDJA 5JXED 1UXWB 2BNRD 3MO1A 5ITBL 3E8UH 3PJSA 4OLZL 4DN3L 3UTSB 1U8OB 5JOPD 1NCBL 4X7TA 4XP4L 2IPUG 4PJEE 3U4AA 1I3UA 3FO0H 2W0FA 4K3JH 4HJ0D 3CK0L 4BK4A 1A1MB 4PUBH 2VLLA 4JFDA 3MX0A 4GT7A 5I8OL 1YNLH 1NCUA 4OF3A 1FCCA 2HFTA 4GAJH 1EX0A 4HDIA 1KCLA 5FKPA 2M26A 4JPKL 3HNTH 1A9BB 2G2RB 2WBJD 4WWID 1V7MH 4WW2B 4OBRA 1I1FB 4HQQL 1IT9H 1QPPA 4R96B 1TFHA 4JRXB 3T0EA 4PJGB 5GGVY 3PIQA 4PJDF 4IHOA 2A1WL 4E42A 1BWMA 3BVNB 1V3KA 2AABL 2C1PB 3J7HA 4NCC2 2MPAH 1NPUA 1TITA 3P30L 5BO1H 1BJ8A 2OTWA 3MSPA 4RMSA 1CVRA 5E99H 3MUGB 5ACZB 2JLLA 4KDWA 1T4KA 2IH1B 3VRIA 3MRPB 2F74A 3QXVA 3DO3A 3HE7D 5EC1A 2NLJB 5ALCL 1PSKL 2CGRH 3ECBB 4PBVC 1V7NH 4NZUH 4HBCH 2BNRB 5C0AB 1ZHNB 3MNZB 3VGEA 4L3CA 2F53D 4L9LA 4OAWB 4HMCA 1WCBA 3ARUA 1XF4B 4WUUB 3KYAA 4YEEA 2VXVL 1IGJA 5HHOA 5SWZD 1DVFD 1MVUB 3RKDC 4TPRH 43C9B 4NJAH 4EI6A 2DLGA 3VG0L 1X5GA 4UT9H 1ZOXA 3NFNB 1PZ5A 1FGNH 1RZJH 4LLMB 5HDOA 1A7PL 3BO8A 4GQ9L 2VWEE 3T0EC 1KTRL 2FL5A 1KYOK 4WFHD 4EUPB 3HPLA 3O41B 4XMKH 3ZKMC 1BGXL 2WWMC 5CJBA 5DK2B 5F9WC 4RZCA 4HUVB 1MUJB 1IL1A 4H8WH 4QRQA 4L3AA 3VFNA 5T5NF 4PJHB 2Q86B 5HYSB 4L8BB 5T1LD 3HAEA 3TBSA 2JK5A 1B0RB 3B9AA 3EDFA 3DX6A 4GW1A 2NZIA 1A7QH 2I9TB 4UNTA 3GJFA 1KIRA 2ID5A 2DQHL 1A6WH 3BXNB 4XPHL 4NKOB 1DQQB 1S7WA 1Q9OB 4X6EB 3VXNA 5MP6H 1J8KA 1JGUL 1S78D 1JPTL 4QNPE 2GKIA 1MCPH 2IGFH 4I3SL 4PJAE 2YK1L 3E2HC 4LLWB 5SWZB 2BZDA 2ICWI 1KN4L 1JF1B 3W9EA 4P2QA 2DQJH 3NIDF 1AR1C 3CC5A 1IC5H 4CVWA 2WWKO 3DTXA 1IKNC 4HV8A 2BJMH 3TFKD 4CVXA 4S1QH 1MJ8L 3VFSA 5HGHB 2BSSB 2DMKA 4Y7MA 2FJGB 3RWGB 3PWNB 1FQ9C 5E5RB 5FA3B 2NY0D 1PJ9A 1WEJH 2GSIA 1RZIB 3ARED 1IAIH 1XF1A 1XGRB 2VLRD 5CD3A 5EU3A 3MLXL 4ELKB 3VFPA 2MKWA 5KVGL 1OP9A 5HGBB 1KEML 1AGDA 4Y8AA 1YEDA 1QSEE 2IMNA 2F5AL 5TPWL 3MR9B 1I3GL 4GW4A 4WI8A 1WISA 1BFVL 3CDGB 4D9RE 2IAMB 1YEHH 4G42A 4NO2B 3RBGA 3GJEB 3RJDA 2ICCA 12E8L 4OFYA 2A74B 3ARFA 3OKKB 4PGZA 1MAJA 3WJJC 4EKXA 2R0LL 4P49A 1LEKA 2XRAH 5ESAA 4KQ4H 4GRWE 2XICA 3ZE1F 1DN2A 3FN9A 1NEZG 3TEUA 1PBYA 4QHKJ 3IJSA 3G6JF 3VGAC 3GKWL 3QFJA 4X4XA 4JGJA 5KSVB 3HCVB 3VWJA 4JY5L 5EPMB 2YBRB 1GIGL 1MCJA 4LASH 5TQ0L 2ZOKB 4S1DD 5E03A 4XNZC 4MLSA 4PJEB 2NQCA 3ROOA 5BXFB 2Z31A 1JZ4A 3MJ7A 3AREB 1WC7B 2Y06H 4P3WA 1K3ZA 5IQ7L 3VI4E 2D7QA 3Q5YA 4JZJB 1A64A 4HGMA 1F4XL 1UZ6F 4WO4B 5DD6A 2NY4D 1KEGH 3FCTB 3D9AL 4CUCA 1CK0L 3C2SA 4N1EA 4M93C 4OSUH 5FYLD 5FYKE 2FR4B 2GTWB 1T83A 3D3VE 3UTQA 2MQCA 1I9JH 1C8PA 4KGJA 2HKFH 1OAQL 2PF6A 5GS0C 5LG1A 3LQZB 2VYRE 4KWUA 3ARFC 5B39G 2JIXA 2J4WL 1S3KH 3B8SA 3O3EB 5FHBH 3VXOB 4LRNL 1MCWM 5D6CB 5EUOF 3MJ6A 1LP9E 2EDJA 2Z35B 3TN0D 1ROWA 3GBMH 3V52H 3N1PC 3X3FL 1T7WA 5GSVB 2XZCL 3MLZH 4JQIL 3CUPA 3S35H 1DANT 3RZWA 1WFTA 2YD5A 4HT1L 5IB1B 4HCRL 3QG7H 2Z31C 4AEIL 3KYMB 3H9SA 5HI3D 4DKFL 2OLDA 3THML 4HKJA 3FO1B 3MOQA 1RI8A 1IC7L 5FCUH 1C16A 3DVNA 4RMQA 5DO2C 1XGUA 1KPVA 1DUZB 2YUWA 3QUXA 2OQJA 2DDQL 1WQVT 5DD3H 1N6QL 2NY6D 4QWWC 5I1GL 4YHLH 3U48A 1OGTA 3W9DA 4AIXA 3VFWB 1DSFH 1O0VA 3O9WB 1OB1A 1TTUA 4RCAA 5DEFA 5F9OL 3GSUB 3KLAA 3L3IA 2P46B 3BWUC 3NH7L 4HPYH 4X7EC 3TPKA 4NQVB 4C83A 2X6MA 1Q94A 1BECA 2DQDL 5FB8A 5D7LD 2C1OB 3VRJB 5H2BB 5HSFA 4JG0L 2HT3C 5CP7A 3Q6FB 2XN9A 5F9DC 5TF0A 4PJ5D 2VZ1A 4I3GA 2YPKA 4U7KA 3VFMB 1XGYH 4OUUB 4G6KH 1AKJD 1HHKA 1KJ3H 5DJDA 5DURD 4PJAB 4MNGE 4FMFA 4U3HA 2JB5H 3HC0A 4Y88A 2CXKA 5IP4A 5EOCJ 1T89A 1JGDA 5CINL 3N06B 3QFDB 4G8GE 4P57B 3K2UL 4M7ZC 4HIXH 2NY6B 4R90H 1T5WB 2OJEB 1E27B 5FUOL 5F7MC 3MA7A 3G9AB 1F97A 3WCYA 3T77B 1I75A 5JLZA 5H94A 3BAEL 5IHZA 5I19H 2DOCA 3MLYH 3ILQD 1OTTC 3OHXB 5LWYL 5I9QB 3ZKND 3VWKB 4AEHH 2LTQB 4LSTH 5DR5L 3JV6B 4HWUA 3EOBA 5B38A 1QSEB 4Q0XL 5D1XD 1CIDA 4KPHL 5C0BA 4E41E 3RTQB 3DBXB 3PWUA 3UYRL 2FHBA 1FG9C 4F7PB 1ERNA 5SV3A 3RPIB 1FL5A 3LIZL 5F1IA 1AKJB 4PG9A 2X42A 4KJPD 5C6TL 1QYGH 3FKUS 4ZO9A 2DTML 4GRWB 4HUNB 3P4NB 3V0VA 1TMCB 1N5YH 4D94A 3WXWL 2BVQB 1G6RB 4I18B 1IC1A 5CEXB 5EBWB 1ZS8B 4P23B 1R3IL 4Y5VB 1IFHL 1U3HD 4S0SD 5KSAC 5HXMA 1I1CA 3P40A 1Z9SA 4D0DB 3L5JA 4YPGA 4PLJC 3LQAC 1Z9MA 3NA9L 4XGZA 1G7QB 3NTCH 4JM2C 4BKLB 4HKXB 4LLYA 3PHSA 3C8DA 4U7SA 3EO1B 5E00A 4WENB 4KKCD 3WJLA 3L9RA 3DYMA 4FA8A 2EDEA 2BC4B 5L2KA 4K71B 1UFUA 3DETC 3BPLC 1PG7L 2V7HA 3D3VB 4DN4L 5KW9H 3GBNH 1ZT1A 5I15H 1W72L 3E6HB 2IALB 5IB4B 4P3DB 3VE0A 2F9BT 3TNNB 2MHAA 1BZQK 1D5ZA 1AY1H 1SVZA 1LP9B 1N64H 1U8MB 2OX5A 1MRCL 5JHDD 4MCZB 1AXSA 3BH9B 5HVFB 3TT1L 4NT6B 4YHMH 2AEIT 2BSRB 1S7TB 3QEHA 5J6HA 2VOTA 3GIVA 4PGEB 2R29L 4LL9A 1Q38A 1NGXA 4OD1L 4HJ0C 4NQSB 4PYGA 3JXAA 5FF6B 1IEHA 4IJ3B 4I0PB 5IFAL 1HH6B 2B1AL 1UM5L 3ULSA 5BJTB 3BRDA 1KJVA 2FIKA 4LCCC 2WBJC 2ZNWA 2R15A 4JPWL 2XZQL 4Z77A 3X14B 1MWAH 1S9VB 3CSYB 1J1PL 2VXQL 3BP7B 1I7ZA 4NP4H 1UACH 1A4JB 1NAMA 1NBVH 5I1CL 5DZOA 1AGFA 4PJ9B 1VGEH 5IIEB 1IAIM 4LNVA 3AGVA 3EJZD 1I9RH 1ZANH 1UQSB 4F58H 3UPRB 4YK4C 1T03H 1DBBH 4Z7WA 1NMAH 2R2HB 3HE7C 4PJFE 1UEMA 4JFOA 3C5ZA 4IBLT 5IBTL 5KVDH 1P7KA 5EO1B 4D9QE 3TA3A 3F58L 4HWZA 3TPUB 3VW3H 3D0LB 4NKDB 1P4LA 4DFIA 1LQSR 3L3HB 1LDSA 5CGYD 5F7EH 5J12B 5LCVH 1J0JA 1NC4D 5ESQB 1YC7A 1DVFC 4QKXB 1WWCA 1Y0LA 2CUHA 3NPSC 5F97E 4ORZC 1G7JB 4LEOB 3SGKA 3STLB 4MNGB 5ICYA 3AROA 2OXHA 1XEDA 5SWQB 4MMXC 2R1XB 4HC1H 1DEEA 1CDIA 5D2LF 4JFED 4JFDE 3B6SA 1ZHBA 1R3LA 1FJ1B 1VEPA 3LKQA 4G8GB 4OLVH 3HI6L 2JJTA 4LEXH 3CFCL 7FABL 4Z0BH 3MCLH 4J3SA 1RJLA 2G9HB 5DS8B 4JHWL 5DUML 1T04B 3T0EE 1XMWA 1K4DA 2J12B 4X99B 1FNEA 2A77H 5ENWA 2APTA 2V9QA 3SBWA 4M7LT 4N68A 3WN5A 4BQBA 5EZOH 1YDPA 4A6YL 5TE4H 1FLRL 1S7XB 4H0GA 1WFNA 3KYKL 3OTTA 1Q9LB 5HYIA 3GSXA 2FGWL 2DQEL 2FEDD 4QXUH 2MSPA 3EHBD 4E41B 5J1SC 1S78C 2F54D 3BUTA 4AIZB 3SQBA 3I85A 3PUCA 2EKSB 4NQCA 3SDDD 2YMXH 3VFUA 2HVJB 4YFEA 1GC1H 2KQNA 1IGML 5B8CA 5FO8B 2PYFB 3T1FB 3P4MA 1N4XH 1D5XB 4M4PA 5HHOE 2HWZH 1M7DA 5KOVC 1BVLB 1P2CB 3TFKC 3LSOB 3MJ8A 1A5FL 1GPOH 3D85A 1I9IH 5AUMA 2D7MA 3HHRB 4W4OC 4OZIF 4X5XB 2DWEA 2NY0C 3G5XB 4XPBL 5J3HD 4YGVB 1CL7I 3Q6GH 3MTRA 2R69L 1BIIA 4XP1H 3SN6N 3UZEA 4IDJL 1D5BB 3EYFA 3ZDZF 2XG4A 2HA1A 1J10A 1N3NA 1WVZA 1KGCE 3U2SA 2YEZA 3FQRB 3WN5C 1Q0XH 1N6UA 3BQUA 3BOVA 3T1WA 4Q6YA 3B9DA 3VJ6B 2OBGA 5IHLB 2I9LB 4HFUL 4WW1B 5E2UH 1EJ6A 2HH0L 3G08B 3ZTNL 3Q3GB 3QEUA 4HUUB 1BOGA 3KAAA 5DUPL 4F3FA 4RFOL 3UBXA 1B4JL 1AD0B 4MSWA 1RZJC 2PO6A 1I8IA 2NTSP 1UH3A 5I1EH 3IJYB 2Z4QB 1FG2B 5B8CC 3HE6A 2X4SA 2YRPA 4KQ3L 2ZUUA 2NXYD 4KKBC 2IFFH 4P2OA 1DQMH 4P2QE 4ZMAT 3LQAL 2EECA 4TTDD 1KYOJ 1LO3L 4H8WC 3RL2A 5IWLC 4S1DC 5C70A 3HS0B 4MGXA 3O6KH 3CPLB 4TVSa 4ZAKD 4AM0B 1U8IA 3O3UN 1Q1JL 5BVPL 4FFWD 2R0ZL 1J0KA 1DQDL 1JHLL 3K46A 3Q1SH 4QTIH 1R3JA 3AU1A 3GMPA 4PFEA 4DQOH 1CFNB 4PJCE 4OJFL 4QEGA 4BFIA 5LGKA 5EORL 4YZFE 5HGDB 4XAWL 1U8JA 2AJXH 4JDVB 2ICES 2ZNXA 4TRPH 4H25B 4UUJB 3ULUL 3MCKB 1F3DJ 1BF2A 2OJZL 5I2IA 4OCYH 4KVNH 3UAJD 4ZS7L 3MPCA 4O58H 1NMBH 1I1AA 3V9FA 3DROB 4XNMB 5E6YA 4GKZA 1RURH 4O2CA 1DBJH 4GW5A 3DUSB 4KK5C 4U1JB 4PJFB 3HE6C 1WBYA 3BN3B 4OD2B 4M1GH 5BVJA 1RIHH 1NFKA 4BQ9A 1V3JA 3TJEH 3OJDB 2QR0B 2W9DH 1HOCB 2AGJH 4WEUD 3MO1B 4ZFOL 3PJSB 1FH5L 3FN3A 3QFJE 4U05A 3VXRD 2DM7A 4PJ8D 3ZE0E 1MFNA 3D69A 4X7TB 3SCMD 5I1LA 4H1LH 2W0FB 5M94B 1ZLWK 1OSZA 3DRTA 1M7XA 1VADA 3LH2L 2VLLB 1NL0L 4JFDB 5DFVD 5EU6A 4D2NA 4KMQA 3ETBF 4FQLL 4OLYH 1P84K 1J8HD 4HEME 4YJZL 4HDIB 5FKPB 4CMHC 5JORA 2E6JA 5MI0B 2F15A 1R5WA 2EDYA 3DV6A 3I84A 5JQHC 4FFYH 3PIQB 4L3EA 4IHOB 4E42B 2VJXA 1FE8H 2KDGA 3T2NH 3BIKA 5DRZA 3NFSL 1P6AB 2E7MA 3BE1H 5F9WB 2OTWB 4M6ML 4X7DC 4Y4FD 2G60L 1JZ7A 5GGVL 4TSAH 5AWNL 1D6EB 4X6DF 4NBZB 5I73B 1T4KB 4J3XA 2ZCKH 1CGYA 2M8XA 5DFWH 3VRIB 1RUML 4IRSD 5EC1B 1XF2A 1HWHB 1H3VA 3CXDL 1OGAA 1YEJH 3IDMA 4MDIA 4DZ8B 4L3CB 4L9LB 1VCAA 4Y1AA 1JN6A 3NA4A 2FB4L 1WCBB 2W60A 4JM4L 4AT6A 4WFGE 3E2HB 1IGJB 5HHOB 1HHIA 4LHUD 3PGCA 4EI6B 3H9SE 1L9NA 2FX9H 3KPOA 5JDSB 2F19L 2PW1A 5TDPB 4D9LL 3RP1A 1BM3H 3KNBA 4CAGA 5KSBE 1PZ5B 2H1PH 1BPVA 5J13B 4YUEH 1JHKH 1FAKT 3Q5OA 2QHLA 2PTVA 1GGBL 3BO8B 3GM8A 3ILQC 1XGQA 1DTUA 1YNLL 3WNMA 3HPLB 3ZKNC 3STBA 1INEH 2BXZA 5D71H 1RZ8A 5GGRY 1KXTB 4JFFA 4YHKH 5D1XC 4RZCB 3D39E 5CBEB 3ALXA 1IL1B 4QRQB 3VFNB 3MRLA 4HS8H 1H15A 4JE4B 4PJDA 3HAEB 4HKZA 3DX6B 4GW1B 5JPMA 1BF8A 1JPFA 2LV4A 3LMJL 4ERSH 3KXFD 2E5EA 4KJPC 1TNNA 3GJFB 2M1KA 1KIRB 1SMAA 5CSZA 5BO1L 1T1YB 1MREH 1YYLH 2XN9E 4RDQG 5E99L 1S7WB 1I8MA 3VH8G 3VXNB 5TF1H 1TNMA 4GXVH 2X4UA 1SBBA 4XXCA 3CSGA 4I77L 4NZUL 4HBCL 4LPXA 4P2QB 5T3XE 4CW1A 2ZUYA 3CC5B 3W11D 1U3HC 5I18H 3DSNA 1F58H 4PTUB 1CS6A 3S5LA 2CIKA 1WITA 3DTXB 4HV8B 3VGAB 1AH1A 2HLAA 2MNUA 1XIWD 3O6FD 3VFSB 3RWIA 4N8PA 4TPRL 2X4RA 4NJAL 5GRXG 2ZWLT 4AIOA 1ES0A 2O26U 2GSIB 4UT9L 3CXHK 2VITB 4PJCB 1R0AL 5HHME 2AV7B 2YA1A 4APQA 4KKCC 5CD3B 2ED9A 1CZ8H 2O5XH 1FGNL 4XH2A 4IOFD 3VFPB 5J11C 5L9DH 2FEEI 4HZLA 1HH9A 4XNQA 4PG2C 4NFDA 3HC4H 4PLKC 1YEDB 4LLAA 1IQWH 1ZSDB 3K1KC 4TNVK 4GW4B 4TVPD 4EN3D 5I8CB 2JTDA 4MXVF 1MCKA 5C0BE 4RQQA 3EFFA 4G42B 3IFNH 3INUL 2RAMA 1CLYH 4H8WL 3IU3A 4GS7B 1QNZH 2BVUA 3ARFB 3EBAA 4KK8D 5GGTH 3UDWC 1A7QL 1LEKB 5ESAB 3B83A 4S10A 2BERA 2UUDH 3QCUH 3QFJB 4X4XB 3I3BA 3VWJB 3FFCA 2DI9A 3QXDA 2DJSA 4YHOH 1JWUA 5FYLL 4JPIA 2F8VA 3F7YA 4R7NA 3ROOB 3C2AH 4WDIA 3MJ7B 1IC5L 4WIQA 1OW0A 3D25A 3WXVL 3H8NA 1VB9A 1MQ8A 4EXKA 5LQBH 1DQJB 3GRWL 3QQNA 4ORGA 4Y4KD 5FM5O 3EJZC 4M48H 1R3KA 1WEJL 3CFDA 3M07A 1IAIL 5L2KE 3SKUD 4HD9A 4XCCH 3LQMA 3HPJA 4X5LA 1I3RA 4GSDH 3UTQB 3D18A 4X8JA 4G9DA 4LCIL 3H3KA 1IZKA 3PWVA 5C07D 5DVOA 3WHXA 2JIXB 3OSKA 1F2QA 5CGYC 1YMMD 3KLDA 1QLFA 3SEPA 4F2MB 1QZ1A 2P5EA 1WCQA 2WLZA 3DOSA 1T22A 3CUPB 1UM6L 4ETQA 5E4EC 2X9WA 2AXJA 43CAB 1A21A 1F3JA 3JSSA 1MCEA 4YFDB 2XRAL 4HF5H 5DVNA 5KVFL 1OW0C 5CILH 3JTTA 1HYRC 3H9SB 4LLUB 4R4FL 3G6JA 3FQTA 5DQ9B 4HKJB 3EFDH 4K3HA 1C16B 5JW5A 4LASL 5KSBB 1XGUB 1KPVB 3QUXB 2OQJB 3IDJA 2Y06L 2FH8A 2QQNH 3C09C 5DWUL 1OGTB 3W9DB 2VLJA 2J7LA 1YUHB 4Z7WE 1OB1B 2VKXA 3D39B 1KEGL 3EHBC 2W9EH 5DEFB 4FQXD 3KLAB 3L3IB 4HC1A 1X5JA 4OSUL 4BZYA 1KNOA 3RNQA 3SDDC 1EIBA 4C83B 1Q94B 1I9JL 2HKFL 5FB8B 4HMEA 4J3WA 5CP7B 4HULB 2XN9B 1S3KL 2XT1B 3QSKB 4V1DA 5FHBL 2YPKB 4MJIA 4H0HB 1NJ9A 1NCAL 1W8NA 4WTZG 5EUOA 3TCLA 1HHKB 5K59E 1QTYT 3E3QC 5IMOA 3GBML 3V52L 1EGJH 3S88L 3MLZL 1IRAY 3HC0B 2D0GA 3UTOA 2QL1A 3RX7A 2OM5A 5INDA 1IC4L 4JFXA 3GSVA 4K8RH 2D9QB 1P69B 4GLRI 1OARH 3MGTA 1TJGH 5E6ID 1QUNA 5F7FA 1YEGH 4UT7H 5FYKU 5E9DD 4MNQD 2A6JB 1NGQH 2F58H 3MA7B 3O6MH 5JLZB 5FCUL 3QUZA 5H94B 4ODBD 1AJ7H 4PJXA 5HHMB 5IHZB 1UZ8A 4MLIA 5MEPA 5IJKA 4EJ1C 3O6LH 4U6VL 5DD3L 2VDMH 3A67L 1N59A 1RZ7L 1CGSH 3MOAH 2P7TA 2ZP0T 3EOAB 3EOBB 1MCQA 2EXYD 1RK1B 2VDQH 1DSFL 1RHFA 2VSCA 5C0BB 3BZDA 1HKLH 2FEEL 3MRCB 2EDTA 4OTXH 2NY7H 2NXYC 4NQCE 1AQDA 4ODHH 5FYJE 1L7IH 5F1IB 1VFOA 3H0TA 3PL6D 4PG9B 3BKYL 4TTDC 4ZNEA 3SKJH 1WZMA 1EHLH 2VL5A 1LE5A 4XPTL 2HRPH 4R0LA 2YA0A 1BMGA 5EDXA 3V0VB 4M6NH 4FFWC 1XGYL 3SKOB 1WT5A 2P48B 1UVQA 1G7LA 1KJ3L 1LDPL 3HNSL 3L3OA 5E6IB 4XP6H 2JB5L 1EUUA 3LRGA 5IR1B 3N9GH 1QBLH 4HAFA 4YPGB 4XGZB 2YZ8A 3PABA 4KMTH 2OK0L 5T5NG 1JF6A 1FZMA 1A0QH 2W0LA 3UAJC 4LLYB 5CJQL 4HIXL 4R90L 3TLRA 5IKCB 5E00B 3L9RB 2I26N 4K55A 4HZAA 5L2KB 3SGEH 2BSED 5F1NA 4JZOA 5I19L 2EE9A 3MLYL 2V7HB 3PHOA 1D5IL 1ZT1B 4X98A 1OAKH 4LSTL 4K8RD 4JREC 3VE0B 4XHJD 3L7EB 4ESKA 1P1ZA 4FQPA 4NHUA 2MHAB