4OV6F

Crystal structure of pcsk9(53-451) with adnectin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
GVSDVPRDLEVVAATPTSLLISWPPPSHGYGYYRITYGETGGNSPVQEFTVPPGKGTATISGLKPGVDYTITVYAVEYPYKHSGYYHRPISINYRTEID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pharmacologic Profile of the Adnectin BMS-962476, a Small Protein Biologic Alternative to PCSK9 Antibodies for Low-Density Lipoprotein Lowering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
molecule keywords Proprotein convertase subtilisin/kexin type 9
total genus 17
structure length 99
sequence length 99
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ov6F00
3R06A 5DQJA 4L4TD 1MFBL 4YDKH 4RISL 5FHAL 3P9WB 4OTXL 3MRBA 5DRNB 3WNLA 4U1SB 1KTRL 1JF6A 5HJ3A 3VXRD 2EIDA 1I8KB 3BYYA 2QQNH 3DURA 1K5NA 2WWMC 4N90D 4MMXC 2F5AH 5SX4H 5ESVB 3HAEA 4JHBA 4XNYH 1RVFH 1LE9A 1MFAL 5IK3A 4IMKC 3T0EB 3QXUA 1AO7A 1LNUA 4NDMB 4PJAA 3PV6A 4LARL 4HV8B 2GAZA 4WWKB 4ZPTA 3A6BH 1CD8A 3BSZL 3L3JA 2YEZB 4C56B 3WS3A 4J8RB 4PTTB 3O6FD 4S1DD 5DUPL 2ESVB 2P5EA 4ERSL 3RWIA 3QEGH 5C0AA 3JWOC 1OWWA 3ARYA 3W0WD 1MCPL 1U6AH 1IRAY 4AEHH 1ORSA 1OGAA 1RMFL 4P2CG 1ACYL 3ZE1E 1FGVH 3PV7A 4J3XA 4NM4L 4PJ9B 2ZPKH 3VMPA 2BY2A 1BD2D 3VXSA 3N85H 5GGTL 1GIGL 1UB6A 3DGGB 4NM4H 2DLHA 2RCSH 2WM0A 3D69A 5DS8A 4YFEA 5E8NB 2H2SD 1CFVH 2I25N 3QCVH 4N0CD 4ZFZA 5IFHH 1JIBA 1EBPA 5I76A 4KK5C 5JIHA 4NZRL 5I75B 1RQ5A 5DJ0B 4E5XA 3HZMA 3C8DA 4K3JL 4MCYB 5DEGA 3RL1A 3T8XA 4DVBB 4JFFA 3TVMC 2VDKH 1GZPB 3MLPA 3KPSD 1OARL 4Z7WB 5EC1A 2QQLH 3L6FA 4XCCH 1IAOA 4XPTH 3LKOB 3B9KA 2B20A 2WWKT 3ZLQC 5DJYA 2CUHA 1IQWH 1UWEL 3DPBA 4KROC 3WL9B 1E27A 4JO1L 1JGDB 4UUJB 4ZTPL 4Z7NE 2J8UB 1RZKL 2H6PA 3BKJH 3WFEH 1XCQB 2DYPA 4E42A 1XGPA 2IAMA 4MHHI 3KPMA 4EBQL 1N5AB 1NGQH 2EDBA 3GSNL 3SQOL 2G2RB 4R26L 4RGMC 1F58L 1BQLH 1AH1A 3QFJA 4EKXA 4EUPB 3IAPA 4HJ0D 4WIQA 1IEBA 4LASL 4DTGH 5IEKB 1CICD 4BSWB 3MGTA 4R26H 3DETC 4TVPH 1MRCH 2PXYD 2NW3A 4LCUA 1KEMH 3ARFA 3HG1D 5IVZB 2Z93A 4RAUB 3IJSA 1QBBA 5JPNB 5C07B 4Q9QH 1NUFA 5CSBA 2UUDH 1KELH 2IAND 2W0LA 2HJLB 4WI8A 4Z7NF 1MRDH 4H1LA 4I48A 5C8JA 2CDEB 3WHXA 5I30H 3BHBA 1NMCB 3PL6B 3BPCB 5CCKH 1XF4A 2EXYC 1J5OL 2BNRD 1TETL 1OTUD 2E9JA 1S78D 4WFHD 4HS8L 1HQ4A 4G6JH 4I18A 4LHUA 2IPUG 4BSWA 5B39A 3MBED 2FX7L 4LLQA 5KG9B 4H25B 1PVHA 1U93A 3ULUE 5D1QC 1JF1A 2XZAL 5E8OA 3TPUB 3OB0K 5F93C 4AT6A 2JIXB 4S0SD 2NZ9C 2OMBA 3BPNB 4EN3D 5C86A 1MFEH 2DQGL 1CXHA 4IRSA 4I5BB 1I1AB 1F3JA 5KTEH 5FFLA 3DXAA 4HSQA 3RGVB 5EB9A 4LL9A 5F9WC 5FEBA 1A2YB 2IJ0C 4X8JA 2JK5A 5IFAH 5LAXA 3DVGB 3WCYA 2VIRA 3I6LE 5C8JB 4Z8FH 1FCGA 4S1RH 4FABL 4X7TA 1N3NA 2FJFB 1N6VA 4JPWH 4EOWL 4OCWL 1J1PL 1ULVA 4WCYL 3GRWH 3TJHC 3RBGA 1QSFD 3HUJF 2DQFA 3S5LB 2Z35A 4KAQH 3WUWG 5I19L 5BVJB 4G8GB 2I5YH 4TUKL 4UTBL 5F3HB 2NZIA 3LY6A 5CEYB 3ARGD 3QPQD 3WLBA 4TQEH 3NIFF 5CZVH 4KRPC 3IDGB 2W9EH 3SE8H 1RULH 3TYGH 4XXDA 2QKIA 1WFNA 2DQUL 5GZNC 3ARUA 2VJXA 4RMTA 2CSPA 1Q0YL 4LLMB 1EUTA 1Q38A 1YEDB 4KHTL 2XXMB 1QP1A 1T5WB 4XAKD 1MY5A 3CJJA 3D25B 1BOGA 5IB3A 2BX5A 4XPFH 5A16B 1DVFD 5TDPA 4XNUH 1B4JL 4OD2B 5ACZA 3SKNA 1UC6A 1LD9A 1R3HA 3V5DB 3T0XA 3W2DH 5D1QD 4CW1B 2YXMA 2V6HA 2IBBA 5SWSE 3MRKA 3MRHB 2J6EA 1K2DB 3S5LG 1F45A 1QSFE 1AO7E 4HC1A 1T1ZB 2VDLL 4U1HA 4NDMA 2V7NA 4I48B 4H1LB 3J8F7 4HLZH 4XVUD 2XOTA 3WLBB 2R0WH 4RDQF 4OZ4B 5LGHH 5TFSL 3MLRL 4W6XB 5FA3A 5E2TL 4POZC 2BVTA 4E5XB 4P4KB 2AEPH 5I71B 1RZIB 1KCLA 4LNRB 1EHAA 3GMRB 1DBJH 4BUHA 1NSNL 4M5ZL 3DETD 4U1JA 4KQ4L 4NQCA 3VRIA 1RHHA 4LEOA 4GMSL 2D9QB 3D69B 5F97E 5CMAA 3QIWA 1UZ8A 1X5ZA 4UT6H 1U42A 2ORBL 4D9LL 3D85B 1SJHA 1HSBB 4BH8B 5BMFH 3IVKB 1CWVA 3OWEA 3HE6B 4LLYA 5D1XA 1EHXA 2QSVA 3VXQA 2EICA 5ALBL 5GGUA 3JV5A 4JANA 4HZLA 1TETH 3R0NA 3TCLA 2FJGA 2JJSA 5KSBF 4JDZA 4MXQC 3C9NA 4MB4A 3V4UH 2HLAB 2Y6SC 5D4QA 3NCJH 3NZHH 3T0BA 2O5ZL 5EZLB 5CEZD 2GCYB 1R3LA 3CVIH 4P3CL 4ZQKA 1AO7B 1LNUB 1PZUB 1H9VA 3HPLB 4L9DA 4LQFL 2NYYD 3VFNB 3O4OB 2APFA 5F9OL 3R8BB 2XTJD 3T0ED 4HWZB 1FPTL 3NIFE 4YHIA 4OQ1A 4JB9L 4HFWB 2Y5TB 2HVJB 2LAGB 1ZLWH 1A6UH 1VFBB 1RIHH 3GSNB 3MNZA 4U1KA 4F15C 5GGRB 4GBXA 2ICWI 4YHOL 4PS4L 1LE5B 2UWEE 5DD1H 3AY4C 3C5JB 3VWKD 2NY4D 5I1KL 1R24A 5DT1H 4XWOD 4MA3B 1AGDA 1Q1JL 2AJVL 4JO3L 3SJVD 3VFWB 3X11A 3RAJL 5IW6B 3V0VB 3TBWB 5E08L 3QEUA 3MRQB 4P4RA 4OCLC 3RFZC 3NN8B 1MPAH 5I74C 1A14H 1X5KA 5E4EB 4XP5H 2FGWL 1BOYA 5C9JA 4TSAL 1HINL 3BKYL 3MUGA 4P2RA 5DJDB 4Y1AA 1X7QA 4UOJA 3SCMA 1U8NB 3BRFA 4H88L 1CLCA 2DQUH 1RZJC 3HE7A 1XZ0A 3KJ6L 4NHCH 3M17A 2G9HA 3U0TB 4XPGL 4YNYA 1QD0A 3C2AH 2IFGA 3B3IB 5I1IL 3RWEA 4LVEA 1J0HA 3QRGH 1NBYA 1ZGLP 2QQQA 2IBGA 1JGUH 1FNHA 4CN4A 5TE6H 4JKWA 1V3JA 1F3DJ 4YHNB 1PJ9A 3FT4B 3OTTA 4L9LC 2NW2B 4Z78A 7CGTA 2C4FU 2NNAB 2W07A 4NKDB 2X44D 2DI8A 5FYJU 2ZNXA 2EC9T 4X6CB 3RPIA 1T2JA 1I8IB 5IEHA 3UTSA 1T04A 3VW3H 2VXTL 1ETZB 1EFXA 1TJIL 1F4YL 4ODVH 2JB6B 3DTXA 1VFAA 5CWSB 2F8OA 5FO7A 3RVTD 1FH5H 2VXQH 1T3FB 3UPAA 4C57C 4NFCA 4XX1E 2APVA 4UINL 5IHZA 3L5XL 2JE8A 2KH2B 4MQ7B 5ANME 3M17B 3G5YA 3P9MB 5D8JH 1MH5B 4KJYB 5ADPH 4CU7A 3IU4H 5K33A 3RIFK 5AYUH 5EUOF 2EDDA 2BHZA 3HR6A 4EQ3A 4NQUA 5CLTA 1YEIH 5KJRL 5F1KC 2HT2C 1LEIB 5AWNH 1FZOB 1DBBL 3LPWA 1ED3B 3DX6B 2BVUA 2Z4QA 4ZUTB 3IDJB 5J8OA 5J89A 2B1AL 4H1LH 1N0XH 4RGOL 1MREH 4PGBA 4CJ0A 5C0RH 4JANB 1INQB 2CO7B 4GRWB 3RNKA 5ACLA 1CCZA 2JF1A 2VQ1A 3WHE0 1NLDH 4RQQB 1JJUA 3MNVA 4IHOB 4NKDA 5BJTA 2X42A 3GKWH 3MR9A 4CADB 4Y7MA 3GSXB 2R1YB 5DQDH 5D6CB 3GGWB 5KS9F 1LEKA 4KI5E 4Y4FC 2D4DA 3D85D 1JWUB 4GMTL 4DZ8B 5HSFA 4KHTH 4Z7UB 5AZ2L 4ELMA 1FZOA 3SJVA 2A77L 3HNSH 2PW1A 5HHVL 1Q8MA 4LHUG 5F1IB 4ZS6C 3ZTNL 1QHPA 4OGXL 4KDTA 5KSUA 1NGZA 2DDQL 4P9HH 4P46C 3KPRA 1FLRH 2CGRH 5ICYB 1B9ZA 1OF2A 4Q6IA 1GOGA 4PJIE 4NKQB 4AG4H 5KSBB 5J0BA 2VDPH 2YHGA 4PJFE 3KVQA 2C7UB 4F7PB 4LGPB 1F6AB 1FVCB 3ZDYF 2VLJD 3DV6B 3VD9A 3KXFB 4ZXBC 4XVTL 4NBXB 2GY7B 1WEJH 2PO6A 4JREB 3LDBC 4DN3L 2Z35B 3MA9H 4G8IA 5KVEL 2HAZA 1P4BH 4L8BB 4QHUB 4FG6D 3F7QA 3UC0H 5EO0B 3RTQA 4KKAD 1U8MA 4MNGB 5GSRA 1FVDA 2Q86A 4U4BA 1A3LL 4OLXL 5DMJB 2VDKL 4MJIE 4JKPH 3UTTE 3MV8E 3D87B 1P4BL 2K1MA 1CTNA 4R2GD 1P7QB 4U49A 1VPOH 4R4BB 2YN5A 3RVVD 2W60B 3DRQA 1WWAX 3Q0HA 4M6ML 3NVQA 1T03H 2ZUWA 3VJ6A 3MRRA 5ACZB 4HD9A 4KY1L 1GXEA 1NCNA 4WV1B 1K8DA 4OZHB 1A1MA 1ZE3C 1MCLA 4L29B 4S1QL 4YBLC 4F58H 3SDDB 1AQDA 1EAJA 5CGYC 3HAEH 4LCIL 1W72L 1XZ0B 1CFSB 1L0YA 1NC4A 1NBZB 1R5IA 3V7AE 2GEEA 1AIFB 4X5XB 1YEHH 1WZ1L 1SJHB 5EZIH 3PP4H 1AKJA 4QYOA 1KJ2L 1QFWL 4LPTA 4L1DA 2V7HB 3VGDA 2RBLA 2DQFB 3S5LA 2B0SH 3ZHLA 4N0UE 2NY6B 1TPXB 2W92A 2IQ9L 3QJFA 1Y18A 4JFOB 4J3SA 4XMKL 2WSKA 4YK4B 5DFVC 1WZLA 3KXFD 1T0NA 1D6EB 1JN6A 5F70A 2P49B 1M7IA 1T83C 3CC5A 1BJ1H 2VZ3A 1Z3GH 3Q3GB 4YEFA 1JFQL 5C09B 5DJ2B 3QDJE 3DVGA 2A6JA 1UACL 4D94A 3IXAA 5LBSL 5ICZA 1JNHA 4YDKL 3MA7B 1G9ML 3K1DA 3N50A 4EIZC 1JZ2A 4F7MB 1ZGLM 2WBJD 3UZEA 5T3ZD 3LSOA 4YBLB 1YNLH 5TF1L 5C6PB 5I1JH 3EO1B 1DN0A 4BZ2L 3P73B 1AKJB 3MRGA 1I8LA 4QYOB 3C5SB 5B3JE 3CXHK 5AD0B 4IIQC 5I0ZA 5DJ6B 2XG5A 3I84A 2Q6WB 5EFIB 3VXTA 1EO7A 1NC2B 3AXLB 1OOAA 2YA2A 1DZBA 3P77B 3P73A 4PREB 3DLQR 4PG9B 4JM4H 4JRXA 1JPGB 3A0OA 3PHOB 4H0IA 4TNVF 4MJ5B 4YHML 3EYFB 3RWFA 2XI9A 5CEXA 4YZFF 1UT9A 4C55A 4OCSH 5T1DH 4ZXBA 4G8FB 4FTVD 4Z8FL 1RMFH 2GJ6A 2X4UA 4YO0A 3RBSA 3T4AA 3NGBB 4D8PA 5GS3A 1BD2A 4MCYA 5DEGB 1K2DA 4MMZC 4U7KA 3VGFA 4YDLC 1RHHB 2Y07L 4WWID 1XF5A 3ARFB 4NC1E 3FFCD 4Y1AE 5E2WL 2AXFA 2C1PB 4O02L 2DM3A 3NCYS 5EO1A 4F7TB 3PHOA 4PJBF 3V95A 3QEQA 5D70H 3GHBH 4CN1A 1RUQL 5T3XE 5HYJB 2QEJA 3NFSH 5IKCA 1KCVL 5F9OH 1KB5A 3H9HA 4PYHA 4MAUH 1IAIL 2FD6L 4A2LA 5DZOA 4KTYA 1HHHA 5J3HC 1ZA6B 1C7SA 4AYFA 5F88B 1FYTA 2E6PA 2XZZA 4DKDC 3MYJA 4WHYH 3V5KA 5J6GA 3FFDB 3QH3B 2X4OB 3SDXE 3IRZA 4YFDB 2MJWA 1KLUB 4XZUB 4FFVD 3KDMB 2G75A 3M45A 2VTFA 4PP1D 3NFPB 2ATKB 5FF6A 1CD1B 1OAYL 4EI5C 4P23A 1RD6A 1H8OA 3G9VA 2NTFB 1MIML 2IQAA 3LPGA 1FDLL 2ESVD 4JO4L 3SGDH 1P4IH 2VXVL 2XG4A 3KYKH 1UB5B 2X4NA 1MQKH 5FUZL 3VCLB 3MJ9A 4L4TA 4NQSB 3NMEA 5ESAB 1Z2KA 2D0FA 2IQ9H 3DURB 4JRWA 3WFBL 1JTPA 3QIBA 1KNOB 1AXIB 4QHNB 1YEJL 2VL5B 1MSPA 2PO6B 3VFVA 2HKFH 5HYJE 1CGTA 4GO6B 5EC2B 4XP1L 1J1OH 2XTLA 3CFKA 5B3JF 4HUNB 1A6UL 1WZMA 4Q9QL 1FFNA 3HTLX 1XIWB 5FGSA 5DTFB 4JRYB 5FDYA 1XAUA 5E9DB 4OKDA 2H45A 4X0KA 5D7IF 3GMQB 1YNKL 3FRPG 3EO9L 4PRID 5D7LB 1G6VK 2P8PB 4TPRL 3OQ3B 2MCPL 5C0CD 3T3ME 1B90A 1U8LA 1QLFA 2E27L 1EEQA 1W0WB 2VC2H 3O2WL 2F5AL 3RGVD 2DI9A 1P84K 4I3RH 1P6FA 4HJJH 2XN9A 3U36B 4IRSB 4QT5B 4JJ5A 4G9DB 1UWGL 3W9EA 1FL5A 4UNUA 3SGDI 5FYKU 1J0YA 4GBXC 3VFPB 1FIEA 3GSWB 4XP5L 1EEYB 2I9TB 1HINH 3VWJB 1ZXQA 4MXWL 4UU9A 4XAWL 3W82A 2EDNA 4LDOB 4OLWL 1KPRA 4QOKA 3K2UL 5EU4B 1CFNB 1T7ZA 5DD0L 1NGWB 4XPAH 5ISZE 4P2QD 1A5FH 2EDFA 3AU1B 1JZ7A 4Z7UA 4ELMB 4KK6C 4YHYB 3CDCA 1JRHI 3O3DA 5E4IA 3BH8B 4DN4L 4AEEA 4MHHG 1OCWH 4HIXH 1TJHH 4X6CF 3T4YA 3EFFA 3PJSB 4ODXB 2R23A 3OXRB 4Z18A 4NM8H 1OAUH 3CK0L 1OGTB 2E9IA 1AIFA 1LO3H 3V4VH 2V2TB 3ZKMC 3W39A 1WIOA 1U8JB 3OKMA 2Y07H 1I4FA 2IH1B 5I8EB 5JW4Q 1I1YB 1TZIA 4OCXL 3BP7B 5D2LE 3U0TA 4IRZL 3NFSL 2IALB 4FFYL 3LMJL 3U6RB 1HKLL 1SBSL 5D7JA 3STZB 4E9LA 1HEZA 5KOMC 4HV8A 3ARBC 4EXPX 3HC4H 3ZE0E 3DGCR 3DIFA 5BV7B 1HWGB 4R7DA 1XGPB 2W9EL 2AVGA 5L2KA 3FZUC 2CIIB 3P2TA 5F89B 3MRQA 4P4RB 2OP4L 2BXYA 4PGJA 3WFEL 3H7LA 3MLSL 4NCC1 4DW2H 5DK2B 3F6IA 4FTVE 4WNQA 2XICA 3B9EA 1NLBL 1D5BB 3OHXB 1X5IA 4HK0A 3ARRA 3KPLA 2NXZC 4WGVB 4TVPD 3LEYL 1T5XA 3JV4A 4N0YH 3GSUB 3BE1H 3OB8A 1ROWA 3PWUB 4HX1B 3IDNA 4ONFL 4QO1A 2ZSWB 1NCBH 1T6VN 1YC8A 4MDIB 5ISZB 1MCPH 4JDZB 4KTEL 5EU3A 2G5BA 4Y4HC 1KCRH 1UFUA 3FTGA 4ONFH 3NGBC 3F7PC 4G9FE 1F90H 4PPTA 1OAXH 4UV7H 2VLRA 1TMCB 4LLDB 1FYTD 5E5UB 2CKNA 1FHGA 3VXOB 3HMWL 4RFOH 5BS0E 1BVZA 1BAFL 3FTGB 5GZND 4GQ9L 2GTWA 5IHZB 4NQDA 4NO3B 3ULVF 1F6FB 4G3YL 1YEGH 5DRZB 4L8CB 1NGXA 2PF6A 2IH3B 1HWHB 4TUJA 5L8KB 5KVDL 3QXAA 5F6IB 4G43B 4CGTA 2RFXA 4HF5L 1R0AL 3NZHL 1FQ9C 5EU7C 4PD4K 4Y16D 3ARFC 4G6FB 3OHXA 3G08A 4AMKH 4XPBH 1G84A 3MZTA 2DQIH 3OJVC 5KSVB 3UJIL 3RUGF 2AKRA 1NKOA 1XGRB 4KKCC 1C16B 1NQBA 3FZUD 2RFXB 2R39A 1KN2H 1UJ3C 3W11D 2LU7A 5AEAA 25C8L 1F4AA 1V7NH 4RGNE 4ZO8A 2X9WA 3W81A 4LSRH 2NY7H 4UTAL 2OZ4H 1RZKH 3CLEH 2FECI 2V2WB 3QHZL 4U0RC 3HNVH 3IDGA 2B0SL 1HDMB 3L3IA 3U79A 2MHAB 1KEGL 3MBEA 4P2RB 5DJDA 4BH7B 4QRPB 1U8OA 4QRTA 4JPKL 3R0MA 4JJ5B 1XGYH 3RA7L 1FJ1B 3B8YA 3S37H 4M1GL 4X5WA 3IJYA 2EECA 1KIPB 4ZUUA 4M7LH 1F2QA 4IRZH 1T1YB 1QG3A 3X11B 4PJ7E 5B3NA 2OQJA 4NUGH 4P3DA 1NCTA 5D2NE 3PWPE 2WWMD 3PDGA 2IADB 1Q0YH 3MUY1 1HXYB 3SDAD 3MNZB 4U1KB 5GS2H 1I1AD 4I0PC 3CMOL 3F58L 1LMKA 2ADFL 1ADQL 4N1CA 5E5RB 1I1AA 3QA3B 1MHEB 4OLXH 2K7QA 4L4TB 4NQSA 1FFPA 1G1CA 4YNYB 1QSVA 4ZFFB 3LD8B 1S9YB 1EERB 3TJEH 5F7MC 5FIEA 4HFUH 1FL6A 3SGJC 1ZT4B 1B0WA 2DQHH 4ZPVB 1CU4H 3ARWA 5J3HD 1QZ1A 4GKSA 4KJQC 3AMLA 2PR4H 3OR7A 1RZJL 1NCBL 3BQUD 3GI8L 5I8OL 2E9BA 4X9BA 4LBEA 1KENH 5I73C 4H0GA 2ED7A 5IQ9A 2XKNB 3RDTB 4OGZA 4UIKH 5C0CA 1C1EL 2J3SA 3P11H 3TCLB 1IKNA 2J8HA 1YEHL 4JFYA 1MAMH 2A6DB 1SEQH 5GQBA 3MODH 1OGTA 3MPCA 3BSZH 1J10A 1KCUL 3L7FA 4OF5A 3H7BB 2Y4SA 4DQOH 2QBWA 3QBTB 1EZVX 3FT2B 2L4OA 4GQ9H 2M26A 3V4VL 2AXGA 4CMMA 1N64H 4JHWL 1JGEA 5DI8A 2NX5A 5EUKB 5BO1H 4NO0A 1ORQB 2YD4A 2A83B 5GRVL 1AGBB 2O5XL 1JUFA 1OTSC 4O2FB 1MREL 4QTIL 1BECA 4DAGL 5IBUG 2FH8A 4FQ2H 3X12A 4FXKA 2VIRB 2NMSA 4X6DE 5JHLL 1HIML 4CW1A 4TSCH 1NJ9B 4PJFF 2VLME 3D3VE 3TT3H 4F9PC 2R29L 1IKNC 4XZUA 1FV1B 3RKDC 1D5MB 2XZQH 3G6JA 4NSKB 3ARDA 5TDPB 1P5VA 5DQDL 1SMOA 3GSVB 1MNUH 5DR5H 4R4FH 4G9FD 4YDIL 5DD1L 1OWRM 1AP2A 4JEGB 4WW1B 2ITCB 3DSFL 1I85A 5HHMB 3JWOL 3PUCA 3L3HA 4U7SA 3KYNA 5D1XB 5FCUH 4R4FL 4PRNB 4RIRB 1FGNL 1IAIH 3QDGA 5DWUL 5DI8B 4X98B 3IFNH 4XCYA 2BSSB 2OXGA 3QG7L 1ZT1B 3FOMB 5ESAA 5SWQA 4PJBE 1MCRA 3DGGA 1YMMA 4MVBC 1GGBH 4HH9B 4CDHA 3FN0H 3VXPB 4NZUH 1LP9E 5LVEA 4JG1L 1GZQB 1YMME 1UH2A 4OBRA 5E1HB 4Q6IC 4DKEL 2BNQA 4OLEA 4G7VH 2CJUL 1VADA 4C4KO 3SDYH 1A3RH 1NGYB 3WHE1 3FFCA 3QDGB 4I4WB 4BH7A 2GJZA 4K2UH 4OFDA 3VXUE 1F4HA 3FN9A 4MAUL 3DX9B 1J1OL 2X7LA 1EGJL 3EOBB 4IJ3B 4D3CH 4WEUD 3BP6B 4ZD3L 3CH8A 2PR4L 1AD0B 3O11A 3QDJB 1XT5A 3U1SH 5J11B 1DN0B 4U1NA 3ZT6A 4LHUB 3VA2C 2OJZH 1NBVL 1ZVHA 4KU1A 5CBAA 3D3VA 3Q6FB 3KJ4B 4LCWA 1ZANL 2AV1A 5BJTB 3DX8B 3DUUB 1F97A 2EKSA 3DO3A 5A1AA 1F00I 5LGKA 3K7UA 3WJLA 1T0PB 3C6LD 1G6RL 4Y4KD 3RNKB 5HHME 2M2DA 1H3PH 3AREC 5FDWB 1AKJD 3VFTA 5IM7A 2VISA 5C2UB 5E6ZA 4MNGA 4JHWH 1CICC 3DXAB 4G6AC 4NQDB 2BVEA 5F1NA 5F8QC 5TDNA 3HNTL 4OLYL 2GI7A 2EYSB 4PJGB 4A6YL 2DQJH 5KVGH 1OCWL 2V7HA 4OGAD 3RUGA 2RB8A 3FT2A 4CDGC 2EIZB 4OZGB 5ITFA 1Q9OA 4QTHB 2HN7B 4GW1A 2B7DT 4HUUB 4K71C 1KCSL 3QFDB 4YHZH 2D7OA 5JHLH 1CFSA 2R9HD 5F6IC 3DWTA 3DNKA 5D1XD 5LQBH 1BIIA 3BKCH 4K8RD 1PYWA 3QXDB 2NY1C 3CFCH 4QRRB 5I1IH 4M00A 1V7ML 3KJ4C 5HHVH 4OZIB 1ETZA 4YHKH 2C4FT 1AQKL 4WY7L 5C0AD 3ZTNH 1XF4B 4NZDA 1OAZH 4O5LL 2OJEB 2AK4A 3CFCL 1QKZL 1UA6L 4JFZL 1UJ3B 5CEZH 3O41A 3WUWA 4YC2B 4C83B 1HDMA 4MD4A 3OPZH 4JO2L 4LSSH 4O4YH 3RWDA 3CFJB 4LLVA 2WNGA 4Y16A 1PKQB 2P44B 3V6FA 4PD4J 5EO0A 2VLJB 4HJGA 1FBIH 5DEZA 4RMRA 1B4RA 1HE7A 3CSBA 2VDOH 3QZWA 2XPGA 2LFGA 4NC1C 1TZHB 3KAAA 2ZCLL 3S34L 15C8L 3C60A 4JAMB 1PEZA 2MNUA 3OAUH 5F7KC 2ADJA 1G7IB 2CKBL 4LEXH 4FNLH 2Q3AA 1ZOXA 1YDPB 1NCCH 4D9QD 1BVKA 4Y2OA 4ZNCD 1IGYA 1N5AA 3CZFB 4K9EL 1DFBH 3LKRB 5A43C 5E9DE 1T20A 2P46B 3ARGC 43CAB 4XCNA 5H37G 3LHPH 4V1DE 1S78C 1X5YA 4JFDE 1YN6B 2GTWB 4X7SH 3E1F1 5D6DC 1AHWA 1YEFH 2VZOA 3KPRB 4KWUA 5FYLL 2NLJA 1KCRL 4YHPB 1S5HA 2GTZA 3OAZK 3D39A 2ZSVB 4PY8J 3Q2CA 4PJCF 1G7IA 2V9TA 3LN4A 3OKLA 4JFFB 4N8CL 2NY7L 4JAMA 5D7JD 2R2BA 2OP4H 3OXSA 4RRPG 1KTDA 4PRAB 1HOCB 4X7DC 4QXUH 5HY9B 2O5YH 1H3XA 2VLJA 4DGVL 4QHLA 4PRDA 3KWWB 4Z5RB 2N4IA 2FIRT 2NR6D 3GJFB 3WJLC 1A0QL 3FQWB 3HS0A 3EYOB 2AKRB 4S2SA 2A77H 3HNSL 1F4WL 4HS3B 3QPXL 4ZQKB 3LKSB 2VLLA 2ZOKB 3JTTB 1YMHB 1NCUA 2X05A 5LGJA 1S7RB 4GXUN 2C7UA 1LO4H 4M4RA 2ZOLA 4K94L 5C08D 2NTSP 2MKLC 2BXZA 2ZCHH 3MRPB 4OLZH 1AE6H 5AAMA 3W9DA 1E4KA 4JZNA 4J3TA 4AIXA 3MREB 4AG4L 3IRPX 1AGFB 1MRCL 1QLFB 3SOBH 1JZ4A 1KT2B 1JZ8A 5BS0A 4AL8H 1LEIA 2EDJA 4Y2DC 4XP9L 3HB3C 4QNPF 4EDXB 5FGRA 5SWZA 2FB4L 4W4NA 1RFDL 2C1OB 4CVUA 1X44A 1HSBA 4K94C 5ALCH 1AXSA 5IB2A 4Z76B 1X7QB 4R8WL 3IAQA 4YDVB 1CL7L 5E8PB 2DB8A 2PN5A 3BZFA 1JRHH 5GRYA 3T1FB 2DBLH 1EH9A 1I8MA 4CVWA 3FCTB 1WQVT 5F72S 1S7VA 1IZKA 1WJ3A 3HZVB 1WV7T 1NFDE 1FO0A 1P7KB 4AIOA 3MA9L 3BEVB 3RWGA 3W9DB 4I2XB 3IGAA 3EDKA 5DJZA 3TA3C 2CJUH 1PY9A 2A9NH 3EDJA 1A7NL 1AY1L 8FABA 4F3FA 1UWGH 3MFFA 1UZ6E 2UZIH 4PJ5E 3B2UD 4XC1H 2VLLB 1RIVH 2ZOKA 32C2B 5GGRA 1A4KA 1KENL 3QHFH 1EO5A 4GLRH 1T1XB 1Y0LA 3Q6FA 4Z0BL 3SKNB 5IT2L 2EDRA 4BSVA 3MRMA 2ESVE 4ZOBA 4QXTB 2IPTL 2X89A 1HILA 3G5XA 4NWTL 4WI2A 5FO9A 4PJBB 1NBYB 1T5WA 5INDA 2OI9B 1U8LB 1CQYA 3K8KA 4HIIB 4JRYD 5TE6L 5L2KE 5HGAA 4BFIB 3FCTA 1IGTA 2GJJA 4JRYA 1ND0B 4XT1C 2C3XA 1H5BB 5EN2B 3MV7A 1EV2E 2ITDB 4LSTH 5A2FA 3SGKA 1JE6A 4KI5F 3RY6A 4XH2B 2PXYC 5IKCB 2VDML 3MRIB 1VESA 3VGAC 1UXSA 2VE6A 5D8JL 3V4PL 3ZDXE 3BRDA 1U58B 2PXYB 2UWEB 4OCNC 4BZYA 1FO0H 1NFDB 4K7PL 1KB5H 3QEUB 4OM1L 3ZTJH 5J13B 3BMWA 1J8HB 4XBEH 4DFHA 1R5VA 2EYTA 3IDNB 1I4FB 4UIKL 3HE6C 3U4EA 4WHYG 4LPYA 4PJ8B 3OF6D 3BGAA 4U6XB 3PP3H 1HH6B 4PB0H 4PRIB 4IMLA 1JFQH 5CJXA 2R69H 3SCMD 4Z78B 4FS0A 5GZOD 4P4KD 3MGAA 3O9WD 5GGSY 5CAYB 2CIKA 3HE7D 1S7SA 3OAZH 1VB9A 2FWOA 4Y8DC 2P8MB 2FCBA 4U1NB 3FB6B 1MVUB 3MACH 5E0QA 5EWIH 5F89A 5C07D 1GOFA 5C08A 3MLSH 4PRNA 3BZEB 2AJZA 4YHKL 2Y72A 4WUKL 4X4MA 3UYOD 3AMKA 1AP2B 1N7MH 5J9PB 4PRHE 3MRDB 3QJHA 5GS0D 5IVXB 4LLQB 5FV2A 2EYRA 1C5BL 2WQ8A 4OGXH 4YFLI 2QADC 4ORZC 2HLAA 3MZGB 1IQWL 1UWEH 4XCNB 1N8ZB 1NUDA 2Z91A 3TT1L 1RZGA 3MROB 4X4XB 3E6FA 4U1MB 4NCDA 1GC1L 4YGVB 1BD2B 5K9QG 5F96H 3C6LC 2MCPH 1B6DA 4TPRH 5L6YH 3K46A 4ZSOA 2AAVA 4W6YB 4M8VA 2APTA 2X5PA 5IW1B 1DQQB 2WBWB 5C0EA 1VHPA 3U9PL 1RZIA 2CLRB 4BUGA 1Q72L 1U95A 1IEBB 4MLSA 4PJEE 5C9KA 3HUJA 2GUOA 2PKDA 3EDEA 3T77A 2AXHA 3GSOA 3FB8B 5INCA 1H15B 3IDMB 2R0KL 5FOBB 3KPMB 4J4PA 5E8DL 4K23L 1BVLB 3LRHA 4GS7B 1KF9B 2ATKA 2PUQT 3PWLB 5FF6B 4BFEA 3H2WA 3C5SA 5C0BE 3MJ9H 3LKPA 3WD5L 2R4RL 5CSZA 5LJYH 4Y8AA 1YY8B 1NMAL 2YD2A 1FV1A 2A73B 3CSYB 3HA0A 3Q6GL 3I3EA 5DHVB 1XR9A 3PWLA 2FLRT 5GGUB 3I2CL 4P2OA 1ZT4A 4POZD 3ZSSA 3BIAX 1IBGL 5FYJH 4ODHL 2FDBP 1FZJA 3JWDC 4W68A 2BNRB 3HUJE 4L3AA 4LSPL 1X4XA 2BDNL 3BQUC 3QG7H 3FONA 5C0EB 5EULV 2DI7A 4Q58C 2EXYD 4M48L 1TENA 1W0VA 1SBSH 2E6JA 1YEJH 5EBGA 2FGWH 2HTKC 1DP0A 5IROC 5BW7C 3QIBC 2E7BA 1WAAE 2P24B 4X6BA 1J05A 4LDLB 3T0VA 4P2QB 5JHDE 3PDOA 4DJMA 1J8HD 1SYSB 4PGZA 3RKPA 3MRHA 2XRAH 1N6QH 1KJ2H 5MI0B 2Z0BA 1C12B 5ENWB 1RK1A 3LS4H 3FB5A 2FO1A 5DSCA 1NAMB 3VXMD 3ALXA 4K8RL 2XFXB 4R97C 1T2QL 3IT8D 4WCYH 4MNQB 1G9MH 4JZOB 2ICES 1B0GB 3D2UB 4V1DD 2F53E 2GAZB 5GSVA 5F9JB 3HPJB 4LAQL 3KHOA 5FM5M 1NBZA 1KJVB 3U7AA 2XQBH 2HRLA 3D18A 5E9DD 5CEYA 4Q74A 4M5ZH 1UVQA 4OT1H 2DQCL 4F80A 4MNQA 3RNQB 2WUBH 4K7FB 3GMMA 5JR1L 2GW5A 4FQ1L 1CDGA 5DD5L 4PB9L 4FQIH 2IPTH 4XRCA 5E6IC 2ADIA 4FFZL 3GJFK 1WFOA 4ZSOB 1BF8A 4L4JA 4NCC2 4J1UB 3VRLF 1MI5D 1CF8L 5IB4B 3R06B 5IMKB 5IROA 3VGGA 8FABB 3MGOB 4O4YL 5B38A 3MLZH 3JXAA 1UJTA 1LO5A 3RU8L 1JHKL 4RDQG 1JNLL 3ULUH 4KVCH 3KLAB 4R6UA 3LV3A 2BFVL 2RJMA 4WI6A 4AMKL 3BW9B 3BZFB 3VFGH 1OTUC 4ELKA 4F7CB 2X1XR 4GMSH 4MA7L 4EVNA 3LEVL 4H1LG 5T3XL 2ICWA 3V9FA 3HC4L 4JFYB 4Y19A 2IAMB 1F42A 4APQB 3QUML 5GGVH 1KG0A 1QNZH 1IGIL 5SWZD 4KJQD 1DSFL 1CE6B 3QQNA 1B0RB 1B4JH 2B4CC 3D9AH 3QHZH 2EYRB 5JNYA 2B2XH 4G7YH 4N0UB 4J8RA 3G6DL 1OARH 4G6KH 1X6LA 5H35B 2BVQA 5EWIL 1CI5A 2G60H 4ODHH 1DBKH 1J8KA 9CGTA 4AENB 2YMXL 1OAKH 3BN3B 5IW3A 1QSEA 1X5HA 4WW2A 1PKQE 4LCUB 1CD0A 4LKCB 4NWUL 1DQQA 4XP6L 2HLFD 2YSSA 4KRLB 2ORBH 1SJEB 1TVBB 2DQDL 2X89D 4XH2A 4P3WA 4CADA 3V6ZB 4D9LH 3QFJB 3O0RL 4Y5XA 4HAGA 2PTUA 5FGCE 4YWGH 4LVHC 3QWQB 3MUJA 2HWZL 1FZKA 4PJ8A 2DL9A 4LPWA 4EDXA 1S5HB 4LVHB 4OIBA 2IALA 5F7DB 4NQVA 2A9NL 1I7TA 3LS4L 4OQTH 1R3KB 4HCRH 4LOUD 4P49A 2DBJA 3A6OA 3G6AB 3UTZA 2XKNA 2HWZH 1S7UA 3VXUD 4PJ8C 4GRMB 4YR6B 2X70B 3ULVL 2XTJC 3L9RB 4XMLH 5CHNA 3P4NA 1RJLB 4LMQI 2E27H 1IGYB 3CZFA 4F9PA 4KUZL 2LVCA 5ABDE 1P7QA 2EDYA 4LMQE 3SJVE 4GXVL 4I3GA 1T03L 5E5MB 2ERJC 4RBPH 2EO1A 2FGZA 2QL1A 4HIIA 1AD9A 2AJ3A 5E99L 3EGSB 4D9QE 3FT3B 1AI1L 2VXUH 5JIIA 3SDAA 2VLJE 1ES0B 3I6LD 4M7ZC 3MODL 3PQYA 5DVKA 3NIDE 2I60H 3RP1A 3FO0L 5I1HL 4WWKC 4F33B 2OR8A 1ZLUK 1IT9H 4O58L 4JCMA 5IB1A 4F15B 2B5IC 3MUGB 3I02A 3FT4A 1Q0XH 1XCTB 5I1GL 3WXVL 3P4NB 2MPAL 1M71B 2H26A 5LXGL 3EDDA 4LLWB 3G5VB 4GG6F 1NLDL 4NN7C 1JK8A 2AGJL 5JPMB 2XV6B 4P59L 1ACYH 5E9DA 5I15L 3C5JA 1DE4A 1RK0A 1BQUA 1FFNB 3ES6B 3BKML 3TESA 3BJLA 4PJEF 1IAIM 5C0BD 4NHUB 3QO0B 5FCSH 5A2LH 1YEIL 5ANMA 1KIQB 4HKXB 2ADFH 5JTWA 1CN4A 1JHLL 4QXWA 1FNAA 4Y16B 3VFTB 4HPOH 5DMKB 3MMEA 3VFWA 4DUXA 1C16A 1T5XB 3UTSE 5TQ0H 3SE8L 4J12A 1R24B 4QRPD 3S8WA 2DTML 1L0QA 3OKLB 4HPYH 4NNXA 2GITB 1C5DB 1R3IL 2AK4E 3VFRB 3CZJA 4RWYH 4NFBA 4HS6B 4CJ1A 5DZLA 3EJYD 2AI0H 3L5XH 3MYJB 4NPYB 3WIIL 2FJGB 3ZKMD 1I1RA 3INUH 2G9HB 3GIZL 3GSRA 1GHFL 1NCWL 1NBQA 4KK9D 4IIQA 2BHUA 3O3AB 4F57H 2EEBA 4LLDA 5KAQF 5D7JB 3STZA 3D2UA 4ODUB 4N8VA 3VWKA 1A9BA 1FNGA 1BQLL 4GW4A 3QCVL 1HYRC 3T3PF 1M6OB 4MD5B 2JB5H 4QHNA 1WBYA 4QRUB 1LO5B 1J9CT 4JFEB 4KKBC 1CGVA 5C07E 4IM8A 5C0DB 4K3JH 4S10A 4YX2L 1EGJH 4L8DA 3JV0A 3H9ZA 4XNXH 4MD4B 3THML 4KV5F 1QBLH 4MSWB 2EKJA 4OF0A 2BVQB 4J1UA 5KVDH 2ADJB 2R15A 5I1EL 4KTDH 3ARBB 4H26A 2O5ZH 2XPGB 1YEGL 3QZWB 1GIGH 4Q6YA 3L3OA 2BC4A 1R5WA 2JTDA 4MWFA 5D9SB 1IBGH 3GMMB 1J1XH 2HJFB 3VMOA 5GIRB 2ARJB 3WNPA 5FA3B 1Q9LA 4NKIL 2EDLA 1U3ZA 2XY2A 3VXTB 3FRUA 4WENB 3KYNB 4R9HA 3MC0A 1J0JA 3F7YA 3PHSA 4PTUA 4W4OA 1EEYA 3C8KB 1FSKC 1G7LB 3L5JA 4M48H 2VL4A 1P7HL 5C9JB 1CIDA 1YNTA 3DJ9A 3J7HA 3L9RA 5FKAB 5JW5B 3G6JB 1KV3A 4N8PA 1ZS8B 4Z9KB 5E94A 4PJDF 1MF2H 1RUKH 3B4NA 2UYLB 1U8JA 3VA6A 4Y4HB 2XZCH 1A1OA 1YQ2A 1LP9A 3AREB 4CU6A 3H3PH 2AJSL 3DVNA 3BEWA 2X9XA 3QUYD 4P99A 1JUFB 4D0CA 4LHUD 1W0VB 3LEXB 4OFYD 2ED8A 4NRYA 1HZHH 1K4CA 1CLZL 3C6LA 1MI5B 1D9KB 2ZUUA 4HCRL 5JZ7C 2DMCA 5I1DB 1RZKC 1SJVA 5I8CB 2Z8SA 2VZUA 4Y4FD 4F7EA 4L8SC 3TH2T 5MP6L 4FQJL 3ISWA 5C0GA 3B8SA 4WW2F 1HHJA 2CDGB 1LEGB 4LF3B 4L8SB 4AQ1B 1J11A 5HVHC 4O9HL 3GBNH 5E7FA 4DEPB 2PTVA 4KJPD 1YYLH 2LV4A 3DHMA 2D31A 4EDWH 2V9RA 4QT5A 1QFUL 5A3ID 4HC1H 1TFHA 2J6EH 4EI6B 2Z31D 3QNXA 3BH9B 5BZWB 2QHRL 2ZUVA 1U41A 2A6JB 2APBA 2X7LB 3CC5B 3CVHB 2WMPA 4GSDL 4AEIL 2YN3A 1MHPH 1U8MB 1UH3A 5FO8B 1S9XA 1S7QA 4B50A 8CGTA 1K6QH 5FYLH 5BRZA 2I24N 4YJZL 5DVOA 4YHMH 3QO1B 4JPVL 1U3JA 3EW3B 4Y5VC 3GM8A 5HYFA 3BPCA 1QNZL 3FHQA 1BBDL 5KSAD 3FO1B 5BO1L 1T89A 4UB0L 4DFIA 5EZJB 4JDVA 5BQ7A 3PIQB 4P23B 5D2NB 1DUZB 5AZEH 5KW9L 4G7YL 1T1YA 1INEL 1OGAB 4QF1A 5C0RL 2X4PB 1PGRB 5GRWA 3RU8H 4FQXA 3DRTB 5E1AB 4C56A 4NKMA 3EAKA 3O11B 1YA5A 4ODUA 3VWKB 3WE6A 2J88H 2QSCH 2HVKA 2EDTA 4FXKB 4MA7H 3OZ9L 3QHTC 5GGSA 2HRPL 5GSVB 1Q9LB 3RL2A 4X6DB 1QLRB 2FSEA 4XXCA 1KYOJ 4CMMB 1T21B 4KTEH 2AQ2A 3QUYA 1ZLVH 2K7PA 1JGVH 4U1SA 4QF1B 5DS8B 4YH6A 2Z31C 3BISA 4MQXC 5E2VL 1UM5H 4APQD 3G6DH 4G6KL 3UJTL 1UQSB 3CVHH 3MNVB 4HXAL 4LSVL 1QLEL 3RHWF 4HK3N 3ULVH 4PJIF 1ZSDB 4TULL 3MLUH 4JG0H 5CEXB 5EUKA 4LK4A 3GFUA 1FJ1A 3REVB 1DL7L 5IHUL 2OZ4A 5H2BA 2OXHA 1QVOB 4NWUH 4PREA 2YEZA 3CH1B 5FYKE 3GBML 1BFOA 4WU7B 4N9GB 4BQ9A 2MHAA 4JLRB 4PJAB 2KDGA 3FRUB 1D9KD 3SKOA 1YY9D 5I8CA 2IFFH 1INDH 5JA8B 2R1WA 1E6JH 3BFOA 1RJZA 4U3CA 4ZG1A 2IANA 3D0VB 4HWUA 2BC4B 3U30B 1TVHB 3N9GH 3HMXH 3WXVH 2SEBB 3I02B 3L6FB 4LSTL 4ZUVB 5HPOA 5KSVA 3C08L 5HGDA 5DLML 1XR8B 4IMLB 2NNAA 5D7KD 1KEGH 3QPXH 4FXLA 5D1QB 3T8XB 3FB8A 1A6TB 5ESQB 3VRJB 5HGHA 2D9CA 3L5WB 3U1SL 5EBLA 4ISVB 3W0WA 4PP2B 5ITBL 3LH2L 3MLXH 2C3VA 3IAGC 3HC0B 5HY9A 2ENYA 3H9SE 4XP6H 1QTYT 2AABH 5E99H 3WXWH 4UT9H 3T3PE 4NRYB 3ZHKA 3LZFL 1YN7A 3VXMB 3CX2A 2JJTA 1S7XB 3O0RH 4JFQA 1S3KL 3RGVC 5T33H 2PO6C 3VXRB 1FRGL 1OY3B 2VLRE 1H3PL 3QWOB 3O3EB 1SQ2N 4XAKE 1KBGL 1IGTB 3OJDB 3NN8A 1A6WL 1ZHNA 2J8UE 2P8LA 3WFDH 5GXBB 3CSPA 3GIVA 3KPNA 5D7LD 4JGMA 3LKNB 3IJYB 3L3OB 1F4XH 2P5EE 5LCVL 4I3SL 1P9MA 4Y4KB 3QWOA 1SM3L 5HHQB 4JFFD 4N0YL 5BV7L 4K3HA 3GM0A 2EC9U 3DROB 2OTUB 32C2A 2BOBA 3JTTA 4JHZA 4PRPE 1NFKA 4YQXH 3U7YH 3QQ3B 4GXVH 1MPAL 5KSBE 3A6BL 3SJVB 4TOYH 1DUYA 2VH5L 4HFWA 4Z0BH 4DGYL 4EI5D 2VOTA 1QYGL 3BEVA 3RWGB 4RAVA 3QA3A 1JPST 2HKHL 1BHGA 3VWJD 2F8VA 3VFNA 1S7SB 4UDTB 5L6YL 3MRBB 3VWJA 1ZLWK 3S4SG 5ID1B 4Z76A 3KPQB 4BA8A 3WFHB 1KULA 1P69B 2R0WL 5LGHL 1OSZA 5GGQH 2OM5A 5ISZD 4Y4KA 1KXQE 2DM7A 3EHBC 5GHWH 2XN9B 4Q0XH 1I3UA 5D2LA 3SE4A 3KR3H 3LKNA 1L9MA 1PYWB 3CSGA 1I3GH 4M43L 1NEZA 2ZCLH 2H3NB 3S34H 4KQ3H 4LPVA 5JMOC 5EU6A 4GKNA 5JXAH 2D0GA 3ECBB 3FQXA 4RSVA 3SE4C 2GT9A 5DRXA 4ONGH 5ILTH 5K59E 3DBXB 3IFPB 5E2UH 1U8IB 4HUUA 4PJGE 5IIEA 3JWNC 4MZ3A 4K9EH 5EN2A 1D5BA 5HGBB 1JWSA 2ZWLT 3L3GA 5JXAL 1SJEA 4NZRH 4K71B 3T4YB 1QVOA 3QEHB 5JIKA 3VXRE 4Z7UF 1SVZA 2BZDA 2IPUK 2JJWA 4K8RC 3SO3B 4JFEE 5KZCB 2KKQA 3VMNA 4G8EA 1JWUA 2LAAA 4DW2L 2XA3A 4HKXA 1ZHBA 4OF6A 5EPMB 3T2PA 3G04A 5ESQA 5T1KA 3QXVA 2WP3T 1I3VA 1JZ5A 1P84J 3RVXC 4IDLA 4P5MA 2OK0L 3DBXA 3IFPA 1IM3A 3WEXB 3ABZA 4I8DA 3HAEG 5CBAB 4OAWB 3KPOA 4PJIB 1KIRA 3VE0A 5A3IC 5I18L 2FSEB 2ZUYA 2FX8H 2H32A 3H8NA 3INUL 1YEDA 1R3KA 3I75B 3GUTB 1JI1A 4OF3A 5L2KB 2ICWB 3CDGB 3ETBF 1XIWA 3VI4E 4IDJL 3OGCB 5DT1L 4KKLC 2JB5L 5IVXE 3GB7A 5HYSB 5HYJA 2HG5A 2CRMA 1TPXC 3P9MA 3C60B 5DO2C 3BAEL 4U1JB 1T80A 4X5LA 1DBAH 3NTCL 1QFWI 4WEBH 2KQMA 3S35X 2DS4A 4PJDA 1TTGA 3KPSE 3ARGB 1OAQL 1AD9B 2AJ3B 3RRQA 2XKUA 3EO0A 1K4DA 3GSUA 4LAQH 3ULUF 4MCZA 5BV7H 4MA3A 2NTFA 4Z7WE 3VXPA 2WBJC 3MJ8A 5E2JA 1YYMH 3KS0H 1T89C 4RZCB 1BLNB 4MS8D 4NO5A 3QP3A 4YZFE 1NDGB 5BW7A 5IF0A 1P7QD 3GKZA 5DA4A 1FL3B 3JWDL 1D5IH 5A2JH 3WD5H 1WISA 4ZDHA 1J1XL 1UADC 1WITA 1NC2D 1SBBA 1F8TH 2AJXH 43C9B 3P77A 4HG4J 1MWAH 1MFAH 3HNVL 1HQRA 1X5FA 1YJDC 3O3EA 4NWTH 4WO4B 4X9HA 4QOKB 5EU4A 3SBWA 2VZTA 4M7KH 3QFDA 4NUJB 3ROOB 3HRPA 3BW9A 5C2BH 4P2OC 4HEME 3GK8L 1MJJA 4NT6B 3QEQE 1IGJA 4UQ3B 5E70A 2VAAB 3MJ7A 3HNTH 4OLYH 2A6IB 4X4ZA 4KY1H 4R2GB 5I8KL 4OI7A 3PDOB 3Q3GA 4LP4A 4FHBD 2EKSB 1S9WA 4Y4HA 1CXIA 5IGXH 3O4LA 3ZSTA 3TA3D 5MHSE 5T33L 2BNRE 2XTJB 1GGIH 3T0EE 1PLGH 4LHQB 2AK4D 1S9VA 4KAQL 5MHSD 3LQAH 4I0PB 4LVNC 4TN9A 4PJ5D 3RGVA 1H3WM 4P9HC 2DWDA 2I9LB 2ICEB 4QRPE 1IGJB 3ARZA 3PWNB 5E2WH 1P53A 3O2VL 1K6QL 4OFYA 4XNUL 5EIIB 4JHAL 2ERJB 3JVGC 3UAJD 5C6TL 4YC2C 1QR1A 2KQNA 3TBYB 2YS4A 3HG1B 3NCYP 3WKMH 3KHQA 3ULSA 3QNXB 1D6VL 1QO3A 1VEOA 2Z91B 4KKCD 4FFWD 3QUXB 4KUCD 4PRIE 3LN9A 2BRRL 5FK9B 1T66D 4ZXBD 3VXSD 4QRRA 2NY2C 1QLEH 1NSNH 3H3BC 4OI9A 5T1MA 4L4VD 1EPFA 1QYGH 3GJEB 4PJ7F 4XXDB 1IFHH 4XVSH 1L7IL 3MRJB 2J88L 3OG6B 1EMTH 5D96C 3DSFH 3SDYL 4AM0B 5B38G 3B83A 4XCFH 1F3DH 2PYFB 4NGHL 5EC2A 4PBXA 4LEOB 3NTCH 2WP3O 4NRZA 1X4ZA 3O8XA 5BCAA 4M03A 5I76B 1PZ5B 3KYOB 4XBPB 1CE1H 2DWDB 2I9LA 5D1ZA 1KNOA 5IESH 4U6VL 5FXCH 1H8NA 1KPVA 1YEEL 2EC8A 2YKLH 2HG5B 2PYFA 2OX5A 4UB0H 3BEWB 5I1AA 4UT7L 1F6AA 4KZDL 4M6NH 4LSVH 4XWOC 3DX8A 2UYLA 1BFVH 5JQHC 2PTTA 1BF2A 2VKWA 4XMPL 5TDOA 1E27B 3NFNA 4A6YA 1R0AH 3Q48A 4KDTC 3O2WH 1G7MB 2X4OA 2NXZD 4B41A 1DL7H 1S7WB 1OP3K 5T3ZH 5D6DA 5E24E 5T3XD 3UZVB 1QSFB 1HNGA 1QRNA 4PJEB 3REWA 3MRCA 2YXFA 3TC9A 4UT9L 4XAWH 1TJGL 4AK1A 3QIBD 2DQJL 5DC9B 4KPHL 4NNYA 1FVDB 4TRPH 2Q86B 1ZGLB 1JPTH 1K5NB 4DZBA 3TBVA 1R5WB 1ZT7B 5D9SA 2VITA 5DC0A 3X14B 4ZYKA 2VLKD 3G5XB 3FONB 1MCOH 3MV9D 4OLUH 3MOBL 5CSGA 3MRNB 4HIHB 2W9DL 4U6YA 3GMPA 1TJHL 2CMRH 4JGJA 2NY6C 1T7YA 4XP9H 4YXKL 4Q9CA 2FJFA 1ONQA 3MOBH 4RQQA 4JY5L 4YWGL 1J05B 1BMGA 4NP4L 5EZIL 5MEPA 2ED9A 4HHAA 4M1GH 5IWLA 3BH9A 1EJ6A 2H3NA 3NA9H 2UZXB 3H42H 4K3DH 5L7XL 2H1PH 4D0BB 1MCKA 3P30L 3H9SB 3PXJA 2DJ4A 3L5HA 5FKAA 3ZKXC 5JW5A 3I3DA 2VR9A 5FKPA 3MLTA 3VGBA 5BZDB 5C7XH 4MA1C 3W11C 3C8KA 5CZVL 2JELH 1Z5LA 1EJOH 2JIXA 4GOSA 1H5BA 3IKKA 2QSQA 5FOBA 1FZMA 3NCFB 1RPQA 3O6FC 4U1GB 3U9UB 2I07A 3HRZB 1I7UA 5GS1B 2IPKA 2AK1L 3OG4B 4NQED 5ID0A 4LNVA 4DN4H 4KMTH 5DHVA 4ELME 3D2UD 4Y19E 1IL1A 1FH5L 4GKZB 3ARED 1OP5H 1HILB 1B2WH 2QADD 3C2SA 4MDJB 3VW3L 4EN3B 5HI5C 5JW3L 5ICZB 1E28B 3K81A 1AJ7H 3VFUB 1HH6A 5I1HH 3MFFB 4OV5A 4MXVE 4XCFL 1U8KA 4UINH 4WHDA 1SY6H 3KPPB 5T5NF 3RGHA 1XF2B 4PGBB 5AWNL 3QDGD 4AEIH 3SN6N 4LVOB 5C2BL 2AEIT 3SDAC 4L8BA 3SCMC 1VGEH 5FYLD 3TBTB 2FL5B 2BHYA 3TIDA 4X9FA 5F7DA 2AV7B 5I66B 1NANH 2F15A 2NY1D 3H7BA 1L0XA 1P4LA 1FE8H 4XNZC 5I8KH 4RGOH 5CHNB 1A21A 4PJ9A 4XNZB 3N1MC 1CXEA 4OZFB 1EDQA 1OB1A 4GUPB 1FN4B 1LO3L 5EOCL 4GAGL 3N0PB 2P48B 2YD8A 2R29H 1SM3H 4HS6A 1BZ7A 5DUML 3DO7A 1I3RA 1I8IA 5IEHB 2V5SA 4XWGH 5ELIA 2RAMA 1II4E 3G08B 2HFGH 2B2XL 2D7PA 3GSNA 3UBXB 1S7TB 4IMKA 4L8DB 4ZOCA 1YC7A 2AERT 5DK2A 1ZHBB 4XP4H 2BY0A 4QWWD 1X5LA 3C09B 5DA0B 2VWEE 1Y6KR 2X1WL 1PX3A 5C09E 1I9IL 2DYPD 4NNPH 1S7TA 1Q94A 3BPNC 1QQDA 4XNQB 4YHOH 3ILPA 3BAEH 2FBOJ 4PLOB 4G5ZL 5D2LF 2VZSA 2LABA 5F96L 1I75A 4XC3L 1TNMA 4F7CA 1XF3A 4OD3L 2BVYA 1NEZG 3PQYD 5AAWA 1I3RB 3RX5A 3FOLA 4P3DB 4HG4K 4ZTOH 4GW5B 3KLHD 5F7YC 1U3HA 1MCCA 4WFEE 3CU7A 1MLCB 4YAQB 1KIRB 3VE0B 1QA9B 1MRDL 5C7XL 4PRBB 5CINH 4FP8L 2W65A 3V6BR 3EIFA 1GRWA 4LCYB 3ROLA 2WUCL 5EU6D 1IVLA 4ODWA 3QWRA 5I2IB 4IDJH 4ETYA 5JW4N 1D5XA 1MFBH 3ARPA 4EXKA 1NAKL 4BELD 3FAWA 1FNFA 4H8WL 3QNYA 3GJFA 1T6WA 2F9BT 2VC2L 1LWRA 2AP2A 3UPRA 3QIWD 3FQRA 4QGYA 4PP2A 3V6OC 4IOFD 3MUZ1 2JB6A 3LD8C 1MY7A 3HZVA 1RHFA 3BIBX 1B88A 1W72B 1UYWH 3KYMB 3D18B 1QBAA 4P9ML 4GXUM 5MEOA 2WQRA 3CFEA 4U1HB 1QRNB 4PJEA 5T3ZL 2A9ML 1E4WH 3A6CL 4LCYA 4OM1H 4XB8A 4M62L 1FVEB 1I9RH 4F3FB 4P3CH 3SE3A 2HLFC 4YHPA 3MXWH 2ZCHL 4GG6A 5GGRY 1NKRA 4P2RD 3IGAB 1ZWIB 4ZFOB 1LQSR 3BUYA 4ERSH 4JM2C 2Q8BH 3KPNB 3GIVB 5DURB 3L3DB 3LKQA 4NUGL 3UPCA 1QSZA 1DQMH 3QQ4A 1TCMA 3P11L 3RZWA 3LQAL 1MHHB 3T1FA 3VFOB 5DURD 4HMDA 2AJUL 2EDWA 1BZ9B 1CFQB 5CJ8A 4PRHD 4L3EB 1OD9A 4X80H 4ZNEE 5FKPB 2YSSB 3MV7D 5BXFA 1MCWM 5JXEA 2P1YA 4UIMB 5KVGL 4P5TC 4E41B 3TYFB 2B1AH 3PL6D 1MEXL 1RK1B 3EGSA 3BKCL 1HOCA 4R96A 4EQ2A 1IARB 3HZKA 1SYSA 4HWEL 3BO8B 3BP4A 1RIVL 5HI4D 5LGJB 3BZ4A 4HIJB 4I3SH 1QSFA 4GRLC 2GJ6B 1K3IA 1MIEL 2X4UB 3REWB 5I1JL 5JDJA 3FB7B 5IT2H 5CJQH 3X13A 2YK1L 4GKOA 4RMVA 3P9LB 3TT3L 5A16A 2WANA 1Q9KA 4JM2B 1XGQB 4ONHA 4QWWC 3ARSA 4JFHE 5F9DC 3QUXA 2HT2D 4BQ6A 4KVNL 1T4KA 35C8L 3MV8B 3NH7L 5JOPE 3TPKA 2Q7YB 4KZEL 3JWOH 3TBYA 3RVWC 1IAII 4G8GA 3GSNH 3SQOH 1MFDL 3X3GL 2VR4A 4ZAKA 5J11C 4MXQD 2OL3L 5I66A 5D1ZC 3CSYA 4MD0B 1A4JA 3QEQB 4JGUA 3IS1X 5TDNB 4CUCA 3E8UL 1SY6L 5JQ6L 4HWBA 3H9SA 4W70A 4O02H 3B9VA 4NQCD 4NRZB 1ZMYA 2W1NA 4OLVL 4NQEA 4UT6L 2BNQB 2DM4A 4D0CB 1GAFL 1AHWC 1IC5H 4JRYE 3ZKSD 5FYKL 4HHAB 4PB0L 4JDVB 4C83A 1IFHL 2QQLL 2W91A 4XCCL 5D93C 3QI9C 4X4XA 5A2IH 1AC6A 2OS7A 3NABH 1RUQH 4NC0B 3UTQB 1IGIH 4YPGB 3UXFA 5IBTL 2DQEH 4KROD 2KZ1B 1PX4A 1PZ5A 4AY0A 2IANE 5GJSH 5C6TH 1U2CA 3VWJC 2OTPA 3AXLA 3HG1E 5F3BA 4PBVC 2NY4C 3IDXL 3EOBA 1NCDL 2G60L 5DJ6A 2O5XH 5JO5B 5HI3C 3QT2A 5BVJA 1KC5L 1EXUA 2HT3C 3CH1A 3DXAD 4ODSL 5EO9B 4FQ2L 2LTQC 5C3TA 5K9QI 4Z7QE 3VD7A 2X1PA 1OTTC 3CPLA 1C5CL 4NP4H 4YIQB 1C8PA 4GKSB 5HYJD 3Q5YA 1U0QA 4QRRD 4JFHD 5I1KH 1GGYA 4XCEB 4X0KB 5C0FB 1MWAB 4R2GC 1DQDH 4HIJA 3BZ4B 1NGPL 2ZUSA 5I30L 2XQYK 3SE9H 1IGFL 5GRJH 4YO0B 2R2EB 3WFDL 2X4TA 1I9JH 5AG9A 2Q1EA 3RPKA 3ZL4H 5CMAB 1AGBA 1G0XA 4G6JL 1QRNE 1AGCB 5FM4A 3EUUA 3HFML 5C92A 1PW3A 3QG6A 2DLEA 2NXYC 1FG9C 5CILL 1MF2L 1RUKL 1OW0C 2P43B 4K7FA 5EOCJ 2R1XA 3CXHJ 1A9BB 5TPWH 2YBRB 3D39D 1FFOB 4TTGA 1RJYB 3QI9D 1G9NC 4H0HB 4WO4A 2QV2A 5DMYA 1I7RB 5D7LE 1B2WL 3FQUB 3L3DA 3LRSB 1WC7A 1INDL 3KDMA 2H32B 5J1SC 2F54A 4ZUWB 5MEQA 5DHVH 3DI2B 3WBDA 1H0DB 4MGXA 3FB5B 3QFJD 4M7JL 4OFIA 1PSKL 3D39E 3VJ6B 5IJKC 1WAAF 3D6GA 2YPKA 2Z92B 3SDCD 2YZ1A 2W60A 1A4KB 4W4OC 3R1GL 1W8OA 3ULSB 1A3LH 3WJJA 5EIVA 1G6RH 4EUPG 4LF3A 3RDTC 2MMXA 4JFDA 3QUKB 1JNLH 3H9SD 3WDJA 4U0RB 2PW1B 5IOPB 4TRPL 1HI6B 1VPOL 4DVRL 4K55A 3PGFL 1MFCL 3B2VL 4DZ8A 4G8EB 2EH7H 1I9RL 3IU3A 2KPNA 4CVZB 4YHYC 1HQ4B 3TLRA 4OCXH 4X7EC 5DD5H 4YXKH 15C8H 4PJCA 3BT2L 1IC4L 3L7EA 3MJ8B 5KZCD 4PRIA 4HGWB 2CDEA 1CFVL 5JDSA 1VENA 2NZ9D 5SWQB 1QA9A 2LU3A 2H8PB 2DQEL 3IDJA 1BQHA 1AGEB 2AEQH 3UO1L 3MJGX 4NT6A 2CRZA 5BVPH 1MRFH 1EFQA 1BQHG 1EBAA 2DL2A 3OR7B 4QRPA 3UYRH 1IAOB 4QTIH 2OK0H 3AAZA 3PGCB 4IIQB 1JPFA 3CFEB 3T0EA 4JFXB 4P57B 5EOTA 1REIA 2WBKA 1QR1B 3GI9L 4FRWA 2G5BB 3HI1A 4GAJL 5L9DL 5HHMD 3RTQB 3PWNA 3QQ9C 5EBWB 2D2OA 1WTGT 5J6HB 5D6CA 3LQZA 3IDIB 4GAJH 1OAYH 2AXJA 4HBCH 3O4LB 1ADQA 3LKSA 1U8IA 3DROA 4MA8L 4AEFA 5F9WB 4WFGE 2VLKE 1M4KA 5L88H 4ZFGL 2GT9B 5DRXB 4RMUA 1FNSH 3Q5TA 4MNGE 1EMTL 4N0CC 4Y88A 3MMEB 4J3OC 4OZFG 4TUJB 4WDIA 1XFPA 1F90L 2GQHA 3HB3D 2J8UF 3ULVD 2Y06H 1D5ZA 1VGKA 5C0JA 1CDBA 4GW5A 2CIIA 4OZFA 5EUOE 4ELMF 2NXYD 3E8UH 5FA4B 3STLB 1BAFH 3MX0A 3A67L 5FGCB 3THMH 1AXSB 1X4YA 1EHNA 1CQKA 3VXSB 3JWDH 3IYLW 3L3IB 2WINB 5CP3A 1TVBA 2RIKA 3WNMA 5IK3B 1MH5A 3O6MH 2JJUA 5LG1A 5F7WC 2RGSA 4M3KB 2EDXA 3DV4B 4PJHA 3K80A 3OKEB 4BKLA 2P47B 4PJ9D 4YE4H 2PNDA 2YPLE 4HX1A 5CS7A 3WIHL 4GT7A 1DUYB 3KLSA 3VRJA 3MOQA 2R1YA 5DUBA 3VXUA 1CDIA 2FLBT 5LXGH 2NY0B 4WWKA 2Y7QB 4FP8H 4P5MB 3SE3C 4WFFE 2W0KA 6FABH 1N5YH 4Z7VF 3MV9A 3LS5L 2OTWA 4I0PD 3PNWA 4JY4A 1T7VA 1W72A 1J88A 2DQTL 2M1KA 4GJTB 1JNJA 1G7HB 1DLFH 4QHLB 1CFBA 3M1BB 1QUNA 3P4OA 4PJDB 4KKAC 1A14L 4XTRC 1KIQA 1YPZE 4TSAH 1U8OB 3SDDD 1UYWL 3K1KC 1JVKA 5I71C 4L4VE 3IFLL 4R3SB 3CIQA 5IB2B 1BFOB 3P4LA 4HAFA 2WIIB 3VFOA 4LLUA 4M62H 1AHWB 3QQ4B 4YR6A 2HA1A 2XT1B 4J7RA 5EIQA 3HC0A 1MQKL 1NH6A 4GG8A 1FO0L 4HDIB 2A74B 1H3UA 4QOKD 3PWUA 1JTOA 1OF2B 1AGDB 4LLUB 4WU5A 2EH8H 3VXRA 5EOQL 2Y9RT 1MJUL 3MNWB 4GBXB 5HGDB 1BJ1J 2AJUH 1EJOL 1YYML 1YY9C 1TJIH 2PW2B 4PJGA 1NUNB 2QLVB 2D4FA 4RCAA 2DQCH 1BZQK 3TJEL 2VWEC 1QFUH 3ZKQD 4TUOA 1QSEB 3AU1A 3OJMB 1YPZB 5FDWA 4I3RL 1A7QH 1IT9L 4O58H 1D5XB 3ZMRA 2GK0A 2LTQB 3A6CH 1RZ7L 1CGSH 1G9MC 4ZUSB 4Y1AB 3FJTA 5I16B 5JR1H 3V8OA 2EE3A 3FQXB 5BS0B 4U6VH 7FABL 1G7MA 3QI9A 4PUBH 3S96A 3UZQA 2X4PA 4Y5VB 5F7EL 3LRSA 3UBXG 4NO3A 2PTTB 2EH7L 4XPHL 3ULUL 4U6HA 2BCKA 3GIZH 1BBDH 5ALBH 1IKFL 2PO6D 5HPMB 5GS0H 5H37H 3VXME 1MJ7L 1MJ8L 4ZO7A 1A47A 3U7WL 3PXHA 4ODBD 3CMGA 5E4EC 2XA8H 3STLA 5C0IB 2F54E 3MOAH 4ZMAT 4FQLL 3U0WH 1CGWA 1QEWA 1FNEB 4DKFL 4GMTH 4DN3H 2CK2A 3SGJA 1RUPH 1IAMA 1XIWC 4M3JA 2EEAA 1T3FA 2RQ8A 3OKNA 1KC5H 1EFXB 1O5DT 2E7LA 4MVBD 3QR2A 2X1OA 3DIFB 2HFFB 2R0ZL 3KPLB 1DEEB 5IMKA 3O6KH 3PGCA 5TJWK 1HCVA 3RZCB 4QY8B 3C5ZC 3GJEA 4G9FB 1RURL 3LQZB 4LRNL 1E6OL 2Y5EA 1YY8A 4DGVH 5CLWA 5L2JA 1BOGB 2BOCA 4HMCA 4RAHA 2Z31B 5IMOA 4M93B 5K9KA 5B22A 1U2HA 4XPTL 4GUPA 1ZA6A 1M7XA 1KJ3H 5D2NA 4X7FC 5EA0H 3CFIC 2X4QB 3V6OA 3SY0B 3W0WE 4XVTH 3HI6H 1FZKB 2EEDA 3SCMB 4O2FA 3VH8G 4WHTB 4EBQH 3DRTA 4HXBL 4PR5A 5TE7H 1TZHA 3ZO0A 4JN1H 3ZE2E 2X10A 3QULA 4ZTOL 2IH1A 4MAYC 1BQHB 3OKDA 5HHPA 2C3VB 5CP7A 1AGCA 1PKQA 4OQTL 4ALAH 1FLRL 1EEZB 4UZGA 5FUOL 3P4MB 3WHXB 3UTSD 1F11A 3SKMA 4FZ8L 4Z95H 5AUMB 5I74B 2D3VA 1NMCC 3PL6C 1D3CA 5JUEH 3NABL 1UJ3A 3JSSA 5BZWA 4R7NB 4YDLB 5F7NC 3BGMB 4N0FA 4U6YB 1UKQA 3MYZA 2Y5TA 4K3EL 4MJ5A 1HXMA 3BXNA 2XACC 1G7JA 5CCKL 1E4XI 4Z77B 4M9PA 1QO3B 1A7QL 2P8PA 1HHHB 3E2HB 5A2KH 4CNIB 2E7HA 3CX5K 3QIUC 5T1KD 1JL8A 2I27N 1WZ1H 1I85C 3MRCB 1CG9A 3IXTB 3AM8C 4UU9B 3MSPA 2OI9C 4WU7A 4WW1A 4KXZH 4OCRL 4E42B 1XMWA 2WAHA 4G6ML 2FEEI 2XZAH 3BMVA 1E4WL 4AZ8A 7FABH 1BJMA 1NGYA 3WL9A 4MWFB 2JIXD 3QQ9D 3G9AB 3TZVC 3MXWL 3VD5A 5EO1B 1JPTL 3HCVA 2WUBL 4F7TA 4A6YB 1UWXH 3UTOA 1MCDA 1OAUL 4HKJB 1FORH 2AJYL 4M4PA 2VDRL 2GSIB 5KJRH 3VXQB 5D5MB 4HWNA 2QQKL 3AGVA 1DBBH 1KCSH 3PF2A 2YWYA 1J1PH 1TQCB 4YHZL 4BH8A 3UAJC 4DQOL 5LAXB 5IFJB 4P5KA 1Q1JH 3NPSB 3VI3E 4HKJA 3U82B 4YIQA 1JHTA 1N59B 5TF1H 2VAAA 4QHUA 4QRQA 2X2YA 4L1HA 5IEKA 3QIWC 1NFDF 4WI7A 4KKNA 4MS8C 4LSPH 3GB7B 5HYSA 1D9KC 2BFVH 3O8XC 2D03H 4FQJH 3TWCL 3P0YL 5JW4M 1KGCE 3KPSB 3T04D 5MENB 2C3HA 3I9GH 5IWLC 5D71L 3HPJA 2V5TA 3DYOA 4IRJA 4X4YB 4RA0C 5HGAB 4BFIA 4NHCL 4EI5A 1U8QA 4PB9H 4KMTL 5B39B 1UA6H 3CVHL 4JO1H 3VRLE 4JZJC 1VACB 4MJ2A 4M1DH 4PJAF 4QRTB 4P46B 1R3IH 1A6VH 1NDGA 5C6WH 4J3UA 1UGNA 2CD0A 4ZPVA 3BHBB 1I7RA 3MLUL 3MFGB 1FAIL 5HHXL 3FO1A 2YOCA 3HZKB 2V2WA 2VDOL 5CZXD 4G6AD 1RU9L 2J8OA 1FDLH 5FYJE 1CXKA 4PJXB 3O2DA 1ZT1A 3FOMA 1UM6H 2PYED 4X6FA 1FO0B 3FO9A 3TO2B 1QEWB 2HFEB 4JQVA 4NO2B 3UROR 1ZV5A 1RJCA 3IU4L 5ILTL 3OX8A 2X4TB 4X7TB 3CVHA 2Q7YA 1EAPB 4FQIL 3CLFL 3CDGA 3NIGF 1NC4B 1R5IB 3LIZH 4P2QE 1FE8L 5I1LB 1TTFA 5JHDB 4OGYH 1INEH 1QBLL 4HKBA 1RUAL 2HFTA 2F19H 2VXSL 3OKKA 5D2NC 4ZXBB 2EYTB 5DEFB 4HJ0C 2E6QA 4PIRF 4ZUUB 4UT7H 3N1PC 2Z4QB 4ZUTA 4GRLB 2QR0A 3QCUH 1EA9C 3OKOA 5JLZA 2L7UA 5DHYB 1DBKL 2WW8A 3R4DA 1FL6B 1GGCH 1DEEA 3IDMA 1CL7I 2KUTA 2YRZA 1KFAH 1Q94B 4J4PD 5DFTA 1SJXA 3GSRB 2W0FA 2F5BH 4F9LC 4Z7OE 4X8XA 2N7BA 3I6KA 2DN7A 2XZQL 3VFSB 2Y25A 2CRIA 5BXFB 1S8DB 2ZJSL 5HJ3B 3MV9E 2OTWB 2COQA 2WZPD 4HUWB 5MEND 1MCFA 4HT1H 1HEZB 1FYHB 2CDFB 3DVNB 1AE6L 5C09A 4U6XA 5HPMA 5I73B 2FIKB 4F7PA 2ZJSH 3ZZ1A 1CBVL 4MX7A 3BD4A 1Q0XL 1EEZA 3TN0D 3NCEB 5CBEB 1D6EA 2CH8A 4URTB 3G6AA 5SWSD 3UTZB 4V1DB 3PP3K 5ITBH 3U7YL 1PEWA 5CUSH 1BGXH 1W8NA 4KUZH 3KJ6H 1BBJB 3QJHB 1OSZB 2VH5H 3RI5F 3V79C 3TBSB 4OI8A 1S3KH 2G2RA 2W9LA 3IKCA 3K8MA 2YK1H 4X4ME 4KFZC 5FB8B 2VRAA 1JGUL 1E6JL 3NCMA 2YUXA 1JWMB 3GUTA 1KT2A 1RVFL 3JV6A 4XNMB 1DEDA 3U46B 1MHEA 1WF5A 3FT3A 4N68A 3AROA 3E2HC 1YYLL 2GJ6D 4EDWL 4HW6A 4ZDHB 4K3EH 3C5ZB 4OFPA 1WIPA 3GSQA 1T1XA 1Y0LB 1S7RA 2VZVA 4FQXC 3IFOA 2DQHL 6FABL 5EZOH 2CDFA 4JE4B 1QRND 5HTSA 5F44A 3ROLB 4CKVX 1RU9H 5FHAH 1I3GL 4M43H 1RJLA 1U91B 4HK3J 1IEAA 4YUEH 1A6AA 3E6HA 3ET9F 1QBMH 4YHIB 2XNAB 1C1EH 3SDAB 4DVRH 1U3YA 1W0WA 3JV6B 1BD2E 3ZYOA 2BK8A 3B5GA 4N5UA 4S1QH 4R7DB 1CTOA 1UXSB 4F37F 5E6IB 1FRGH 2AJYH 2VQTA 4QNPE 3WSQH 3BT2H 5FHBH 4WI4A 3RJQB 4Q97A 4JRXE 3PP4L 5SX4I 4IBLT 2DMKA 1JHLH 3T0DA 3MLZL 1NC4D 4LRIA 5C0JB 2EE6A 4MDIA 4AIZA 5FHBL 1F4XL 4X7SL 3V0VA 2C9AA 3L5WA 1T22A 5DGRA 1IEAB 3D1MC 3UO1H 2ESVA 2P5EB 4M5YH 3VFGL 1PBYA 4U05A 3MQIA 3MR9B 5C3LD 4FA8A 4JN2B 3KXFE 2MKWA 1E28A 3ESVF 2D03L 4L3EE 2P5WB 2UZYB 3DUSB 3N85L 2SEBA 3QIWB 1NUGA 2DRUA 2GSGA 2EXWC 1I7ZB 1RSFA 4TQEL 3BD5A 1BM3L 4PGEB 3RX8A 4GAFB 3S36L 2BVOA 3BH8A 5DJXB 4PJXA 3B3IA 1RUPL 1F58H 3QDJA 4U1LB 4IRJC 3ARQA 4LLVB 4HUVB 5E5MA 2IPKB 1WWWX 1OAXL 4Y19B 5FCUL 5CIPA 3HPLA 5IV2B 1FSKB 3U83A 1ZAGA 3KPRD 5K93A 4TVPL 1L7TL 1P4LB 3VFPA 5C71A 1WWBX 3BQUB 1OAQH 5CEZL 1HYSC 5TQ0L 1J86A 4NGHH 4M8QA 2FL5A 2Q87A 1FC2D 1YN6A 3PQYE 1D7FA 5DJAA 3NFNB 4O2CA 1ERNA 1NAMA 2HKFL 5E2TH 4KQ3L 5E2VH 1K3ZA 1T20B 4B0MM 3SKUD 3MV8D 3BKJL 1UXWB 5BQ7B 1PG7W 3RKDD 2HMID 2X41A 1YNKH 3T4AB 1XF3B 4ZAKC 3ZE2F 1N0LA 2CQVA 3LDBB 2CKBH 3UC0L 4QHKI 2Q76A 4DOHB 1CT8B 5IFHL 3EDFA 1FIGL 1TQBC 2FO4B 3RWHB 2EZ0C 5DK3A 1Y6NR 4M7JH 4R0LA 3GMRA 4Z5RA 5HYIA 4ZO6A 4LASH 1ZT7A 2AXFB 3KYOA 2IFFL 1GH7A 2V17H 3O3DB 4DTGL 4PGCB 2ZG1A 5L0QB 3CXDH 2XY1A 4KI1A 1JBJA 4C58B 2UV3A 1IMHC 3AM8A 5GS1A 3QDAA 2R4SH 4MJIA 4Y0GA 5FUOH 3I2CH 4IS6B 3F7VA 3AB0B 3O41B 3WUWB 5MP6H 4NN6B 1DDHA 3HN3A 3C08H 1E6OH 1RZ8A 2NY3B 2MSPA 3UJJH 2ADGA 3GMOA 3S37L 3MBXL 4R4NC 3ORJA 4OB5H 2AQ1A 3RWFB 5ICXA 3N9GL 2W59A 2K9UA 4NSKA 5TE4H 1YQVL 4ZS7L 4JRXB 1MUJB 3S97C 3VDCA 4WO4D 5DSCB 3OSKA 3S7GA 1MCOL 4OLUL 4QXUL 4P2YA 1C5CH 3BUTA 1AD0A 3FQUA 3TEUA 2AJXL 1GGIL 4U6TA 1I7TB 4APQA 4NJAH 1NC2A 3OKMB 1KN2L 1KXTB 2AJSH 1MCBA 5EBMA 1NMBH 1BVKB 5DZNA 3ULVE 4Q7DA 3MRFB 2VUYA 3T77B 2VLMD 3D3VD 2RR3A 5B4MD 2B5IB 3LRGA 1CDUA 3T2OA 4K7PX 4NYLB 5F1NB 4MB5A 3STBA 4ZAKD 3FN3A 4K94H 4D0BA 4WW2B 2R0LL 2V2XB 4NBZB 1ITCA 1KELL 4CMHC 1N4XL 5IFJA 4HCRA 3NZ8B 1LP9B 3O2DL 1TXKA 3UCRA 4PLJD 4XMKH 1MWAA 3KYAA 1IGMH 1M7IB 2VDNL 4S1RL 4YHLH 1OQOA 2D7QA 1G9EA 1XGTA 2V2XA 3BRGC 3T3MF 4WVRA 4K9EC 4XCYB 1CDCA 1F3JB 3WDHA 1OP3H 4NYLA 4FQ1H 3ZT7A 3C2AL 5HHXH 1U8QB 4WTWA 4N1EA 2PCPA 4G8GE 4HZLB 1UVQB 3OJ2C 1SYVA 2BERA 2MWCA 2XIDA 2I07B 3HRZA 4L8SA 3P0YH 4UDUA 5ERWA 4AH2A 4GSDH 4WO4C 5CKGA 1RJYA 2AQ3A 4ODTL 5F21B 4YBHA 1FFPB 2G5RA 3O3BB 1HHKB 3JBG7 3RUGE 3DECA 3PE9A 1NAML 1BFSA 1Q9KB 1RZFL 2VXTH 3GSVA 3QG6B 1CGUA 5ADOH 2FATL 5MERA 3K0WA 5ENWA 2H8PA 1U6AL 1XGTB 1ZSDA 1R6VA 1CFTB 1A7RL 1BFVL 4JVUA 3W2DL 2YRLA 1JZ6A 1T83A 5MI0C 3CUPA 4NZUL 2P24A 1X3DA 4F37K 4MCZB 3U4EB 3AY4A 3IDUA 3VXNB 5D70L 3HZMB 3EYQD 3ME0A 3DMMD 1SEQL 3OKDB 5HHPB 2AS5M 1A9EA 2O93L 1EFXD 4DZBB 4X9GA 5C0IA 1HK6A 2Q76B 3TWCH 5GRVK 4N8VB 4JVWA 5FECA 4NUJA 3ROOA 3TJHD 1OT1A 2HH0H 1FG2A 1ZTXH 3RIAF 4OF8A 5DVNA 3KPSA 3ZKND 4JPVH 4BM7A 4Z0XA 4NKMB 2NPLX 5IBTH 3BPOC 1AR1D 2F74A 4TNWK 4F7MA 4MXVF 4KV5E 4BSVB 3TIEA 3GGWA 4I18C 1I9IH 3K4DA 4JM2D 5EORH 1NJ9A 3T2QA 1OTSD 4HIEA 5KSAB 1VEPA 3GBLA 4L3CA 1NLBH 3CGTA 2BVPA 1HHJB 2CDGA 5DD6A 5CKAA 3WFBH 3SKMB 5I1AB 3BZEA 5L88L 2AEPL 3QUMB 1CLOL 1NFIA 3QO1A 4NQEB 3SEPA 1Y18B 4JO4H 1OL0A 2YKLL 3B5HA 3V0AC 2PXYA 2UWEA 3MLVL 4I0PA 4JQIH 2B1HL 4XBGA 5ALCL 4ZAKB 2W38A 4A6YH 3T65B 3K4AA 1MFNA 1CR9L 1Z3GL 1OPGH 3V52H 4OJFH 4AM0A 3E0GA 2VLRB 3H3PL 3S88L 5ERWB 2H2PD 4AH2B 4D2NA 2F19L 2VXSH 3FO2B 3D5OF 5CJBA 3QYCA 5F9AC 1U93B 5I1CL 4RGNC 4FMKA 2D7TH 3QUZA 4O51A 1A6WH 1WIUA 4Y5VA 2A73A 3WO3B 1PG7X 3QUXC 4XNYL 4LLWA 4I18B 2EDKA 5DJYB 1ZANH 5E00B 2HT3D 5CUSL 1DVFB 1LVEA 4Y2DD 4AQOA 4NQDD 1OD7A 1H3TA 3ARVA 2NY3D 2XWBB 4JFZH 1A6PA 2FECL 5T1KB 3G5YB 1I9EA 2DKMA 3EBAA 3SO3C 3PGDA 3BI9X 4HKZB 4PJFB 5CP7B 4YBQC 2E9WA 4XHJD 4Y4FA 2NX5B 1IQDA 4NZTH 4RGMB 3RWHA 2BSED 3T0EC 2PW2A 4BFGA 3GSXA 5AYQA 3BP5A 5GRZA 4JZJA 2APXA 3JTSA 2QJDA 3OGCA 4W81A 4R7NA 1H3VA 2VDQH 2Y1VA 3IFOB 4PRHA 3GK8H 5IFAL 2FRGP 2C3WA 1BBJA 2R9HC 5SWSB 3AFLA 4UBDD 3S4SB 2D7MA 1LK3H 2X70A 5GGTA 5HHOE 3LB6D 4U1IA 2Z31A 2YD6A 4OSUH 5KSBA 4Z7QF 1ZWIA 3RJDA 4ZFOA 5EUOB 3SGEH 5ICXB 1E4JA 2ZOLB 5BRZD 4LQ1A 5TGBB 1IC7H 5SWSA 5F6HI 2H9GB 4ESKA 2FIKA 2A0LC 4NFDA 1TQBB 5KSUB 2VKXA 1E0OB 4J3VA 3VGHA 3BWAA 3F7YB 3ILPB 3PQYB 4DVBA 3G04B 2VABB 2Q7NA 1ITBB 1MNUL 4G80B 3S3PA 5IMLB 1OSPH 4U7MA 2J8UA 2AEQL 3MREA 1YMMD 3FB6A 3TBWA 2BP3A 4NN6C 3RVXD 3E6HB 1KN4L 2C3GA 4GH7B 5LWYL 1I7ZA 5DRNA 5KS9B 4L4VB 2IWGA 2ZSVA 3T2NL 4HLJA 3RTQD 4XWGL 4KKBD 5JLZB 1SHMA 5DMGC 2BCKB 4BFBD 1GSMA 1LK2A 3VH8A 4KROB 4TVSa 1KEML 3GNMH 4PJ7A 3U36A 3I6KB 4DWHA 4Q9RL 2YPVH 1S9KC 4KRNA 4GG8B 1GPOL 3QXDA 2XWTA 1V3LA 1FAKT 4LCCC 5C0AB 1M05A 1YEKL 2R2BB 5ADOL 3MCG1 3HMWH 4RFOL 3QO0A 5D93B 1CICB 4WJ5B 1YEEH 4ZPTB 1IAKA 1CFQA 1U8NA 5IIEB 5JA9A 4MA1B 4N8CH 3H6JA 1J0KA 1RFDH 5E6IA 5BZDA 4HQQL 3IS0X 4XNQA 3U7WH 2NYYC 4QLRA 4WFHE 3RY5A 4PJ5A 4GKNB 2A0LD 4M6NL 3KLAA 4YXLL 4JG0L 1A3QA 1WSST 4KRPB 3NACH 4HQQH 3V6FB 2VISB 2XKSA 2LE9A 4KDVA 5GHWL 2A1WH 5D5MF 3WS3B 3WJJC 3UBXA 3AS2A 2V2TA 1JV5B 3DUUA 4R97B 1LDPL 3MRKB 4LIQH 3JUYA 2E8ZA 4JY6B 3CX5J 2ADIB 3TVMA 1WFTA 2NCMA 5JNYB 1WCBB 5SV3A 1ES0A 3X14A 5IB3B 1EVTC 3D0LB 3HZYA 4NKOA 4PJ8D 5FOJA 1GGUA 4XHJC 3QIUB 3C09C 2YUVA 2FB4H 3DI3B 1CLYL 1V7NL 3RWJB 2CLZA 4NQTA 4UOW1 2DDQH 2ZUQB 4GBXD 3QUZD 1JRHL 4U3XA 3WE6B 1A7PH 4HT1L 3TBSA 2BDNH 2MPAH 5E1AA 4IEFB 4UI2A 5D7IB 3MLXL 3V4PH 3TN0A 2YD1A 4HXBH 5IP4A 5JOPD 5EU3B 5I8EA 5MEQB