4OV6F

Crystal structure of pcsk9(53-451) with adnectin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
GVSDVPRDLEVVAATPTSLLISWPPPSHGYGYYRITYGETGGNSPVQEFTVPPGKGTATISGLKPGVDYTITVYAVEYPYKHSGYYHRPISINYRTEID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/protein binding
molecule keywords Proprotein convertase subtilisin/kexin type 9
publication title Pharmacologic Profile of the Adnectin BMS-962476, a Small Protein Biologic Alternative to PCSK9 Antibodies for Low-Density Lipoprotein Lowering.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 99
sequence length 99
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ov6F00
3GMLB 4LAJH 2EEAA 1FVCA 4PJ7E 4R4NC 1P7QB 4HJJL 2BJMH 2G2RB 3MUHL 4N5ED 4QHUB 4QRTB 3K2UH 2HFGL 3WN5A 1W2KT 4ELMF 4DJMA 3CVIH 1DDHA 3WJLA 2B0SH 3SJVA 3CPLB 3HPJA 3S36L 4LVNB 4HLZH 5F3HB 4ODHL 2A73A 5FYLH 2EH8L 4K7FB 4MAUL 4V1DD 4XHQA 2EDEA 1ND0B 4N0RA 3BI9X 1RU9H 4JQIH 3O6FC 5D7JB 2AEQL 5HVFB 1CLZH 4YUEH 3C5JB 3VGAC 4F58L 5CCKL 4PP2B 1OCWL 4MNGA 1H8NA 1DQJA 4PGCB 3NIDF 2B1AL 2MOVA 4MZ2A 4OZHA 5I1JL 4KUZL 4DGVL 4YBQC 4EI5B 3QDJA 1MCBA 1S7WB 5FK9A 4HWBA 1C5CL 1WQVT 4BZ1L 3F62A 4R26H 1A5FL 5I75B 2V9QA 2VDKH 1W0VA 3GB7A 3DRTB 3MNWA 4HUKB 3QDME 4Z8FL 1RJYB 3VXSD 4NRXB 5I1AA 5C0JA 1ETZB 1KFAH 3C09C 1IGMH 3IXAA 5JW5B 3OPZL 4K71B 3CLEH 2AJUL 4PS4H 2NW2A 4MA7H 5D7LE 1PYWB 4NHUB 3PUCA 2UZXB 2Z4QA 1CXLA 1EEZB 3Q0HA 1TXKA 4TN9A 5M7QA 4PRID 4YQXH 2Q6WB 5IMLA 3MRRB 2AEPL 5IB4A 3T3MF 5C92A 5BS0D 1MLBA 4V1DA 3FFCD 1N7MH 4S1SL 5HHVH 3HR6A 5D6DC 4TRPL 2P8PB 5SWZB 5HYSA 3PGFH 3T3PF 3DMMC 4HUXB 2VL4A 2IADB 43C9A 2NY2D 5GGVY 4FMKA 4RMRA 1KB5L 5J12C 5DUMH 2ZG3A 4GAJH 1RJZB 4XVUC 4AEEA 5TQ2H 4C55A 5K93A 2Y7QA 1DL7H 4HWEH 5FO8B 2Q87A 5TFSL 4JRYD 4Q74A 2VDML 4KGLA 1ORQB 1F3DJ 3IF1B 3P4NB 4DZ8B 4N9GB 1X5HA 5AEAA 2OL3L 5IK3B 4QXGL 3RI5F 3SDXE 5BJTB 3PHOB 5C08E 3MYJA 5CJ5A 1MIML 3R0MA 2OTWB 1XGYL 3O3DB 1I9JH 2XICA 3JUZA 2WBWB 5BOPA 1RK1B 3HUJB 3TM6A 4PRIA 4M1CC 5IFAH 3NIFF 4JFED 3SQBA 1OAUH 5F7HA 3QWRD 1XCTB 3RAJH 3MR9B 4EXKA 5DRXB 3E6HB 1OAXL 5BS0A 3V4PH 3FFCA 1NEZB 4QEGA 1FBIH 1T1ZA 4ISVA 2E7MA 1LGVA 5FCSH 1TPXC 3CSYA 4Z7NF 5K9OB 4HLZG 1AIFA 2L4OA 4P3CL 5TDOB 5FM5O 4U1HA 1CFTB 1BX2B 4OB5L 4OQTL 5DVKA 5L8KB 5EFIB 4FZEL 3AS2A 3CIQA 5JA9A 1HDMA 3MGOA 3QNYB 4YHML 2E7LA 4QCIB 5GGQH 2XTJC 4BFIA 1T6VN 5B8CC 3U2SA 4LNRA 4JRYA 2W9EL 4A6YL 1JWSB 3VXRB 5HI4C 3MV8B 5FUCC 1A7RH 1W72B 3C5ZC 1ZV5A 5IQ7L 2RCSL 5J3HC 5IESL 1XR9A 1IAIH 4FTVB 1J0IA 4ZPTB 3RU8L 3QUYC 2YD1A 2QV2A 2X42A 2P5EB 4ETQB 4LLWB 1QD0A 2MSPA 4O5LH 3MRMA 4KWUA 3DHMA 3DX8A 2DL2A 3QI9D 2OL3A 4JFEA 1C5DB 4HAFA 4K23H 1IGCH 2A6JB 4ODWB 4I0PB 4Q9BA 5BV7C 5I2IB 5F96L 3P30H 3MREA 1YJDC 5FOJA 5D72H 1K5NB 4NQUA 5IR1A 5E56A 3UYOD 2NY3B 5IHZA 4PJ9C 5T3XH 4F15B 3O2VL 3LN4B 1HHHA 4PUBL 2FR4B 3D6GA 3VGGA 5DUPL 4QHMA 4M1GH 3TO2B 2NY6D 4Y4FC 4PJXE 4HIIA 1FZMA 1MFAL 4HUVA 2Q8BL 1I4FB 1MCRA 2EIZA 1TCRA 3T2NH 1G9MC 3UBXA 1A4KA 2HRLA 3ARFB 1RHFA 4NT6A 5LCVH 3AU1B 4QRQA 1WT5C 4OI8A 2OTUB 3EFDL 3QYCA 4LPTA 4DKFH 2NX5B 1J8KA 3H9HA 4DKEL 5T5NG 1T5WB 1X44A 1BIIA 1CZ8L 4KUCF 3GJEA 4N0YH 3ZKXC 3D9AL 5C2BL 3VXNB 1KXVC 3LPWA 1OF2B 1FO0B 4CRPA 7CGTA 3MNVA 5B4MD 3MGTA 4LVOB 2VDLL 2WP3T 1WZ1H 2D9QB 4M7KL 3ZE2F 2ZKHH 2VH5H 3LB6D 1JMXA 2RBLA 3B5TA 5I1KH 3O6FB 1MHEA 5B39A 3ILPB 5FUZL 2VLLA 5FDWB 5I73C 1IBGH 3LPGA 3VGAB 2BNRE 2CKBA 4M9OA 1FZKB 4LU5H 1G7HA 2R0KL 4NM4H 3RWHB 1QPPA 1AFVH 1A6WH 1GSMA 3MFFB 3NCYS 1R0AH 2WIMA 1T21A 3ARGD 1NGYA 2YSSA 2BVPB 5GS3A 4GKZB 1BJ1J 2D03L 2EC9U 1RUMH 1R3JB 5CILL 2BVOA 3QCUH 1OGAA 4M7LT 4X6DF 4HD9A 4IRZH 3FT4A 5LQBH 1UFUA 2XACC 1N59A 1JGUL 3QDGB 3K8KA 2ESVD 5KJRL 1IKNA 2C7UB 4HK3N 1DBAH 1JBJA 5I8KH 3CDGB 1CFQB 4LAQH 4MNQD 4IM8A 4OIBA 1S9XB 3SE4C 4LCWD 2ARWA 4M62H 1KTDA 5F9JA 4OZ4A 3MACL 3BH9A 1ACYH 4W81A 2E9WA 5CFHA 4XZUB 4TUOB 2VQ1B 3I2CL 2EH7H 4WU5A 2COQA 1FFOA 2YWYA 1JGLH 4QHLB 2PXYB 4FZ8L 3QJFB 4JQVA 4EI6A 4X5WA 4LDLB 1AP2B 4J1UB 1RIUH 3FQRB 5SWQB 4JKPL 4GQ9L 1Q0YL 2WUBL 4BKLA 4GAFB 3ULUL 4RA0C 3LS5H 1S8DA 2OK0L 5EC2B 2NR6D 4ZODA 1JPTL 1W72H 3KPPB 5DGQA 5DR5L 5TQ0H 1OTUD 1NFDA 4J3UA 2X1QA 5DLMH 4L5FL 2FJGA 5AD0B 2DD8H 3ULUD 3NA4A 2R29L 1C12A 2DLEA 2ESVA 4U1GB 5FB8A 1UM6H 2RJMA 5DJZA 4UB0L 4MNQA 5CJXA 5C0CD 1HHKA 1HQRA 3OXSA 2JE8A 4B5EA 2ZP0T 2QSTA 4DOHB 2VAAA 2DI8A 2VABA 3S37L 5E8OB 3LMJL 1WFOA 4MD0A 2A77H 2XZAL 5I71B 2BCKA 5I66A 2W9LA 1MH5B 2D3VA 1TPXB 4P5MB 4LQ1A 4FFVD 1DBKH 5LKNA 5LWYL 1UADC 4QF1A 3WNNA 3FJTA 3FQUB 4JO1L 2LVEA 4HS3A 5ESQA 1U8HA 4KK9D 1S9KC 2X09A 2R2BB 4GAGL 4RAVA 5C07E 4M1DL 5K9KA 5LGJA 1YYLL 2XZQH 1NLDL 4J6RH 4UQ2B 1AKJD 4CVZA 3VE0B 3CGTA 1HINH 3F5WA 4Q6IA 1HHGA 5D71H 5B8CB 1KCSH 3DIFA 4PJCB 3WFDH 1QSFE 3ZKMD 3EJYC 5E9DE 5IKCB 5EU3A 2W9DH 4JFFB 4BA8A 3C5ZB 4LLQA 1L4IA 4LSRH 4NCC2 5SWSE 1IM9B 4PRHB 2AJVH 5MI0B 4M61A 1CF8H 3ARTA 3QUYB 4ZO6A 5DQ9A 4KHTH 2ZPKH 3WEXA 1QLEH 1T3FA 4ODTH 3SJVE 5C0CA 5EUKA 4Y16A 1FCGA 1WGOA 1NBZA 3MV9B 4OLVH 1QO3B 3MMEB 5TDNA 3VWKD 3KYMA 4L8DB 1T03H 1FO0H 2CDFB 4LGPB 4X4XB 4UV4H 1FP5A 3FT2A 1NEZG 1NAKL 3WDJA 4MNGE 4HWZB 2HRPH 2GSIA 4PJ9B 5FO7B 1NUNB 1KCRH 2GTZB 3ECBB 1DR9A 3QDJE 1TVBA 3H6JA 4OCMC 1F58L 4PJBF 5MEND 4R2GB 3SE9L 3RIFK 3SKOA 2DJUA 1AKJA 3TPUB 1NSNH 4Y4FB 3UTQB 4QLRA 4OF0A 3SDCC 2WINA 3BKML 5JDJA 4P2QD 2NXZC 3S5LA 4WNQB 3BPOC 1UZ6F 2I07B 3G04A 1J1PL 2R1YA 1IAII 1NL0L 1E4WL 2V2WA 1SYVB 5F1OB 1DBJH 4OZGE 2AKRA 3M8OL 3ARBC 3ZKXB 5BRZD 3VWKA 2CUMA 3DNKA 3QQ4B 1WBYB 5F89B 4PJHB 2VN4A 3LV3B 3MUGA 3WUZA 4N90D 1IC4L 4GRWB 4H25A 3MJ8B 5D7SH 1NAMA 4RMWA 2EIBA 5CBAB 5I73B 3QO0B 1FH5L 3DV6A 4XNMA 1PG7H 4ZOAA 5MENA 2I24N 5E0QA 1CFBA 3WXWL 3T2OA 4S1DD 3S3PA 4KU1A 1Z3GL 2C26A 3CX5J 4GG6B 5J6HB 1CDJA 3S4SB 4MAYD 3VXSE 5FIEA 4U33A 5F71A 4ZUTA 4P2QA 4YGVB 4NQSB 4EQ3A 2AJXH 1LDPH 2Y5EA 5INDA 1OLLA 2ATKA 4KFZC 4MDJB 3VJ6B 2VUOA 2E7BA 1DCLA 5KVDH 2K7PA 4I3SH 5IFHH 1ORSB 1KEML 3TFKC 1I1YA 5AYUL 2JKXA 3LY6A 5BRZA 4L29A 3FFCE 5JA8B 3K80A 4KQ3H 5ACZA 7FABH 4DW2H 2HVJA 3RA7H 4YC2C 5DJ0A 3GSRB 4XPFL 4AK1A 5JR1H 3QIWC 5DRWA 4PGZA 2WIIB 1T89A 2VLMD 4E42B 3K2UL 4JQXA 4XCNA 5SV4A 3MBED 4NM8L 4HEME 3FTGA 4XAKD 4MWFB 4OF5A 3CXHK 3MBXL 5HY9B 2EDFA 1OGTA 3GGWB 3QXTA 3EYQD 4BH8A 4OGAD 3VGHA 3LKNA 3T0XA 4JQIL 1RU9L 2DYPD 5GGTH 4QTIL 3ZE1F 4C58B 1CLZL 4MAYA 4YUEL 5HGGS 1U8PB 4BQBA 3O41A 3K4ZA 5FYLD 4U1SA 4DFHA 4R96B 1VGKB 1UWGL 3DROB 1D6EA 2GK0B 3NIGF 5F7DA 3QPQC 3FONA 1KEGH 4PR5A 3RVWD 1QRKA 2AXHA 5F9OH 5I1HL 4LLUA 2AXJA 4R26L 4JFEE 2VDKL 4OT1H 1VB9A 3DVNB 3IXTA 3EUUA 4HV8B 4NO5A 3DX7B 4JN2A 2VQTA 2G5BA 3OV6A 5IVXF 1S7QB 1KFAL 5BMFL 3TBYA 4X6BA 4XWGH 3PWNA 2UUDK 2XN9E 5KSBF 1J9CT 2PO6D 1V5JA 4OF3A 5GGSA 4PS4L 1YJDH 4MA7L 4F37F 1MAKA 1KB9K 1MWAB 1I8KA 3MBEA 1N6QH 5DEFB 5JIIA 5ICZB 2DQCL 2NY5L 2H3NB 2DS4A 4P23C 3I6KB 4NRYA 2IAND 3NPZB 4F9LA 1YNTB 3C08L 1ZHBB 5E99H 5AZ2H 5I15H 1E27A 3VG9C 2ICWB 5DJYA 2DYPA 4XP9L 5DZLA 5EWIH 3RUGF 2QQNH 1HILB 5D70L 1G9MH 1CICC 4YDVB 4JFQB 1LNUA 4YE4H 3M07A 1SY6H 3VXOB 2J6EH 1PJ9A 1ZVYA 4M48L 4P46B 3AS0A 4X7CC 1KLGB 4GAJL 4K55A 1RFDL 1OTSC 3IFPA 1YEGH 1QR1A 5IBLC 3LKPB 4YGAB 2WBJD 3QQ9D 3IYLW 4QTHA 1QVOB 4YHKL 1FDLL 5KTEH 4KHXH 2XZCH 4Y1AB 2HWZL 4PRBB 4HIEA 4I2XA 1T20B 2PO6A 1NCNA 2BVTA 2FB4H 1Q1JH 1NANH 3BJLA 5CGTA 4GRWH 1I9JL 4KJPC 1RURH 5K9QG 2W0LA 1GZPB 2A74A 3WS3A 1G6VK 1EBAA 1OAUL 2YPVH 3ES6A 3F58H 4U6XA 1VADB 1I7ZA 4U2ZA 2J1KA 1JYVA 3X3FH 2IANA 5IG7B 3C6LB 3V4PL 5IHLB 5A3ID 1FBIL 2LTQC 4JFYA 5IQ9B 1A47A 4FN0A 1U8OB 5L0QC 3M17A 4D0DB 1OAKH 3MLRH 3PWVB 3U0TA 2CLRB 4LHQB 2R4RH 4HS6B 2NXZB 3PJSA 3UJJH 1LO0H 1F3JA 5BO1L 2V7HA 1KPUA 4M6NH 4I3RH 1YN6A 3BZ4B 2MNUA 2WBJA 3B8SA 1AGDB 3PGCA 3OKYA 5E4IA 1Y0LA 1QFWM 4X80H 2D7MA 4DEPC 1JF6A 4K2UH 5E8PA 1A7RL 1F4XH 4HGWA 3VFVB 4IIQC 3WFCL 3V7AG 5CEYA 1IAIL 3VFUB 2Q7NA 3RVVC 1U8QA 5EO0B 3KS0H 3X12A 4N0UA 2DL9A 3V9FA 3BPNC 3QCVL 3NIDE 2FZ3A 3VFTB 3P0YH 5DJ2A 5JDSA 4ODSH 1RJCA 4LHJB 5CJBA 3O9WC 3O6MH 4NO3A 3VMOA 4OLYH 4I1NB 5HSFA 4GXUM 1IL1A 3L3GB 4V2CB 4P4KB 1OB1A 2PCPA 3SKUD 3KDMB 5E5UB 4DGIH 4LEOB 5GS2H 1U58A 3MCKA 2DWEB 5KSVA 2YUZA 1YY9D 1UWEH 4EDWL 2I27N 4J4PA 5CGMA 3MV01 2GHWB 2GCYB 4WHTA 1GVIA 1UVQA 3OKEB 3LN9A 3VXME 4X6CA 5D7JD 4M1GL 2R4SH 4YNYA 5EBWA 4E41E 5KS9B 5T3XD 3GMOA 3ZDZF 2V5TA 5HYJE 4LCWE 1D3CA 3T3ME 3QO1B 3A0OA 1HXYB 3DXAB 4MCYB 4RIRA 2AABH 1FNGA 1T0PB 4EI5D 4M5ZL 1IGFL 4Z7WB 1K8DB 2RHEA 4X99A 3DV4B 2DQUH 5LCVL 3AC0A 2R39A 4Z7UB 4OFVA 4YC2B 3T3PE 1FL3A 3CH1A 1PKOA 2UZIH 2YC1B 2MKLC 3T0AA 1TVDA 3OR7B 3UMTA 1NBVL 4LPWA 3DX9B 3ROLB 3NCYP 1NCAH 4PJDB 3V5DA 1LO5B 1PDKA 2EEDA 1NMBH 3GMLA 2H2SC 4L9LC 4PB9L 4U31A 1ES0B 1JRHH 4XMPL 3LD8C 1P7QA 4JRXB 5ETUB 2G2RA 4QHUA 4QRTA 4OCLC 3AS1A 3GKZA 5TDPB 4RDQF 1SYSB 3CPLA 1V3KA 4GH7B 5F3HA 4K7FA 3GBNL 3OTTA 1QSZA 5C86A 4L3EB 2GJJA 3KNBB 1UH2A 1ND0A 1W8OA 5SWZD 4HS8L 5D7JA 1ZMYA 2C3GA 4P9HH 1TDQA 3C5JA 3NIFE 4Z95L 1U8MB 4PP2A 1GGTA 4PLKC 4PGCA 1TTGA 5CWSB 4EI5A 3QCUL 1Z9SA 1S7WA 1CGWA 4B0MM 3HTLX 4Z7NE 5ALCL 3ESVF 4IRZL 5D2LF 5LQBL 3QH3B 4HUUB 3FN0H 1CN4A 3DRTA 3UYRL 1YDPB 2OTPA 3ZL4L 4UIKH 5C8JB 4HH8A 3ESUF 5K9QI 1RJYA 4NRXA 1CLCA 1GGIH 1ETZA 3OKOB 5JW5A 4FNLH 1YC7A 4M7JH 5CBEB 4ELKB 1SVZA 4P23B 3E8UH 3ISWA 2UUDH 1PYWA 2VLRB 4NHUA 2VR5A 5ELIA 5KANI 4TUKL 1EEZA 3VG9B 1ZEAH 2UWEB 5EU7E 4PG2A 1WF5A 2Q6WA 2F19H 4B41A 4PLOB 2ZUQC 3MRRA 4QHKI 1GZQB 2FGWH 3RNKB 3G6DH 2Y07H 2RR3A 1KLUB 5F7EH 2R0WH 2GI7A 5SWZA 2P8PA 5CEZE 1UM4L 1EXUB 5HHXL 1A9EB 4HUXA 5F6IB 1FE8H 3WCYA 2IADA 2P48B 4NNYB 5CUSH 1I75A 2CMRH 1W72L 1RJZA 4KRLB 4WUKH 5DLML 5D1XC 3IDJB 1I3VA 1QLRB 2DD8L 5FO8A 1QHOA 3VG0H 5TGBB 1CQYA 3I3DA 1UM6L 3NVQA 1ORQA 3IF1A 4WFFE 3P4NA 3VXRD 4DZ8A 3QEHB 4N9GA 5DD3L 4WWKC 4ZTOH 1JV5B 5HDOA 5IK3A 1X5KA 2PN5A 5BJTA 3PHOA 2B1HH 2OTWA 2P5ED 3O3DA 1IAKB 1TJIL 4KJYB 1RK1A 3HUJA 1B6DA 2GTWB 2X1PA 4PRNB 3G5VA 2EC8A 3KPTA 5TE6H 2X7LB 1XCTA 4GMTL 3MR9A 2FIRT 4I0PD 5DRXA 3E6HA 1R5WB 2OJZH 1A6AB 3IU4H 4RGMC 1NEZA 1H15B 2JK5B 2VDOH 4L4TE 5EOQH 3D85B 5FKPB 2YD4A 3JTTB 1HWHB 5K9OA 5TDOA 4OLZH 1CFTA 1BX2A 1CTNA 4J6RL 3P11H 2DBLH 2P7TB 2B2XL 1D5XB 3CSPA 3OAYK 3JV4B 3D25B 3HB3C 3H9ZA 5D71L 5EFIA 5BZWB 1MHHB 1KCSL 1MJ7L 1VKXB 1BQLH 2CDGB 2XIDA 1P6FA 4HCRA 3ZE2E 1S7TB 2F74B 4I9WD 2GEEA 2DLHA 3QNYA 4GS7C 4U6HB 4QCIA 5CP7B 4N90E 2AJSL 2SEBB 4JG1L 5IMOB 4ONGH 4KHTL 2ZPKL 1IZKA 1JWSA 3BPNB 3CK0L 3VXRA 3MV8A 1W72A 3ARFD 1NCTA 3FB5B 1URLA 4URTB 3ILQC 4FTVA 4OLVL 5IB1B 3I50H 1JZ4A 4ZPTA 3O9WB 4XNYH 5E5RB 1T03L 1LWRA 5FO9B 2P5EA 4ETQA 3FHQA 4R4ND 1JZ8A 4LLWA 4PRPB 1I7UB 3WSQL 4KTDL 2BFVL 1C5DA 4X6DE 1F2XK 2A6JA 4ODWA 4I0PA 4C56B 5I2IA 3UYPA 3AMKA 4KDVA 1B4JH 1QBBA 1HKLH 5ALBL 1K5NA 1SBBA 2QHRH 3C60C 4PGEB 1OAQH 3O6FD 3I85A 4GW1B 5L8LB 5IT2L 4NZTH 4EKXA 4WI6A 2HN7B 5FAAA 3VRLF 1J87A 3JTSB 3LN4A 3AY4C 3THMH 3TF7C 3O3AB 4CN1A 2FR4A 4ZUVB 4YBQD 3TO2A 2E6JA 2F54E 2C4FU 1V7NH 2FBOJ 4M03A 3CC5B 5C70A 1I4FA 3A6BL 1PKQB 4EUPB 1T4KB 4PREB 1F4AA 1DBJL 3ARFA 2KQNA 2C5DC 4XAKE 3AU1A 2IEPA 3PIQB 2OTUA 1EJOH 4JVUA 2NX5A 4F7CB 3QDGD 4L9LB 1DTUA 3V4UH 1T5WA 3LD8B 5I8CB 3KJ4C 1E4KC 2XG4A 4P0DA 2A6IB 1FGNH 5FYLE 3RP1A 3QFJB 3VXNA 4XPTL 4YXLL 1OF2A 1FO0A 1C08B 2IPUK 1ZLSH 5EDXA 3KPSE 3BH8B 1P7KB 1N2RB 43CAB 3ULVF 3O6FA 3ILPA 2HTKC 4LSVL 5FDWA 1F00I 3DMMD 4AJ0A 3SGDH 3WNPA 3V52L 2AAVA 5C0GB 1H3PH 2W59A 4XP6L 3QUXB 2YPLE 5AUMB 2BERA 1FZKA 5ITBH 3RWHA 3MFFA 3ARZA 1A2YB 4XVUD 2BVPA 5JORB 4HSQA 3CFJB 4GKZA 2ZOKB 4NKIH 2JB6B 4Y0GA 1R3JA 4JN1L 4S1RH 3VD5A 4YHZH 3FOLB 5IFHL 1MUJB 3MA7B 4LCYB 3STLB 2IWGA 3QDGA 3B3IB 1EEUA 5LG1A 4KQ3L 5KSAC 1JRHI 4AG4H 2C7UA 5JR1L 1K3IA 1CFNB 3FHAA 5I8OH 3CDGA 2GJ6E 1CFQA 4M1CD 1S9XA 1UCBH 2GY5A 2ICWI 4DVRH 1Q0XH 5TE4H 1UB6B 2VKXA 4KAQH 1F4YL 4ORGB 4JGMA 5D6DA 3QA3B 4XZUA 4TUOA 2GITB 2VQ1A 5I9QC 1PG7W 3KR3H 4QRRB 3O81A 3EOYG 5GGTL 1F3RB 3U0WH 4QHLA 2XT1B 1T7YA 2PXYA 3QJFA 2ZUSA 1TZGH 3UJIH 1AP2A 2R69H 4J1UA 4O58H 1EZVX 3FQRA 5SWQA 4LLVB 2H32B 2GFBB 5D1XB 4APQC 5F9OL 2W0FB 1FFQA 4LSSH 3L5WB 3PDDA 2ZJSH 5EC2A 5IBTH 5F88B 3QXWA 3KPPA 5HI4D 5B38B 3C5ZD 5AD0A 5J3HD 4O51B 2CUIA 1V7MH 3VDCA 2EXWC 3QUYD 4XWGL 5AAMA 3QULB 1HQ4B 5IW3A 2HJFB 4BM7A 5GGUB 1WC7B 3MV9D 4XP1L 1G9NC 1UZ6E 2EDKA 2AS5M 5E8OA 4RGMB 5ICXB 2I5YH 1MH5A 4M00A 4P5MA 2CRYA 1C7SA 3PXJA 5E99L 2C3VB 3FQUA 2E7HA 1CL7L 4PJ9D 5EN2B 1I85C 2QQNL 2R2BA 3G6AB 4U3CA 4JB9L 1JTTA 1MF2H 2EDDA 3E3QC 3T0WA 4B7IA 5LXGL 5L6YH 3JV5A 4UQ2A 2BDNH 3VE0A 4Y4FD 4GS7B 5GGTA 5B8CA 3OF6D 4K7PH 4EUPH 2NW3B 4PJCA 4K3DL 1EH9A 5IKCA 4JFFA 4H88H 3HPLB 3C5ZA 4XC3H 2JB5H 1IM9A 2UZYB 4PRHA 9CGTA 1PG7X 2ITDB 3QUYA 4KHXL 3PQYB 1Y6KR 4K9EC 1WTLA 1A1OB 2FB4L 1AI1H 3MV9A 4M8QB 1QO3A 3MMEA 2DI9A 4CL7A 3INUH 3VFOB 3D39D 4L8DA 5HHMB 2CDFA 4X4XA 5HYIA 4GQPH 2YPVL 3CXDH 4HBCH 3E2HC 1QTYT 1QEWB 1F42A 2Z0BA 3C60B 1U3HC 4QWWC 2AXGB 2JELL 5T3XE 1MVUB 4HWZA 1EVUA 4X9BA 4PJ9A 5FO7A 2MCG1 1VERA 2GTZA 2EC9T 3P9MB 3ECBA 1RZ8B 5EUOF 1WEJH 3TV3H 2QQKL 1OAKL 3MLRL 3A6CL 5J1AB 3W39B 4PBWD 2R4RL 4LGSB 1FAIL 4BQ9A 3TN0C 5FYJH 3TPUA 2IBBA 4Y4FA 4CUCA 3UTQA 4HT1H 1CD0A 3OF6A 3CD4A 3BESR 4I3RL 3P2TA 5IFJB 1SY6A 2J6EA 1KIPB 4WNQA 3ZMRA 2I07A 5D2NE 4GLRH 1WT5A 4YBLB 2BOCB 1KIUA 1U2HA 1YY8B 3ZE1E 1SYVA 5F7WC 1JE6A 3WO3B 1YPZF 4JGUA 3U6RB 3KJ4B 5E2TL 1MLCB 5IB3B 4MQXC 3MRIB 3KYNB 4FQJH 3P0YL 1WBYA 3QQ4A 4MJ4A 1YMMB 4PJHA 5F89A 2FDBP 1FFNB 3LV3A 5SWZE 1YC8A 2DQJH 4UDTB 4LLDB 4OLYL 3D2UD 1AR1C 5DJ8B 3P77B 3MJ8A 5CSBA 4NO2B 5EIIB 2YBRB 2IFFH 5CBAA 3QO0A 2PW1B 5GSRB 5IVXE 3RZWA 3VGEA 4JM4H 4HC1L 3QHZH 3ETBF 5F8RC 5KSBE 1WVZA 1CTOA 4UNTA 2H32H 3L7FB 2VXTL 4OIIH 5GS2D 4GG6A 5J6HA 5CSGA 3S4SA 4CJ0A 2BVUA 4D9LL 1LO2H 3K2MC 3P4OB 1RUQH 3GSVB 5DD6B 2MTPA 4YGVA 4EUPG 1D9KC 2JLLA 1P1ZB 4NQSA 5T5FL 4WY7L 1ZVHA 3PP4L 4MDJA 3VJ6A 3PWPB 3UPCA 3RUGE 5EO9B 5KSAB 1RZJC 1T2XA 4JFXB 2AJ3B 4BFEA 5CHNB 4PD4K 4NGHL 1ORSA 4OV6F 3P9LB 5KAQF 4XPHH 3SE4A 4TUJB 4AYFA 1M6OB 2F9BT 3GSRA 4PP1C 3OJ2C 1JRHL 2FH6A 4LKCB 2WIIA 4F7EB 1J12A 1X5JA 5HDBF 5I9QB 4TVPD 2C3HA 3PL6C 4E42A 1TNNA 3OX8B 1U8LB 3NTCH 4U1JB 1A7NH 3L5XH 5DJXB 3JXAA 4MWFA 2VTFA 5HY9A 3GGWA 5EA0H 4ZG1A 4Y5YC 2D7OA 4APQB 4HZAA 4P9HL 1JNLL 1U8PA 3OB0K 2OR9H 2YEZB 3EJYD 4R96A 2LABA 4PBXA 1VGKA 3DROA 2GK0A 2J8HA 2CXKA 1UEYA 1RUKH 3U46B 4J3OC 2IBZX 3W0WB 1RZFH 2EDLA 1VEPA 1FVDB 4FQ2L 2P8LB 3DVNA 4HV8A 4XXDB 3DX7A 3RQ3A 1T2JA 5EIVA 2DTMH 3IDYB 4PJEB 1Z9LA 1S7QA 3V6OC 2J12B 2EDXA 4Y1AD 4FNLL 1YEDB 5SV3A 1XGRB 3KVQA 4MD4B 1DSFL 3K8MA 3S96B 3E8UL 5BVJB 2OR8A 3T0EC 1MWAA 2FX9H 4A2MA 5CEZL 4NQCE 2CD0A 5DEFA 5ICZA 5T33H 1OL0A 4NQEB 2H3NA 5K9JL 1CE1L 3I6KA 3RX5A 4JFHD 3VMPA 4XAWH 2Y07L 3N9GH 1YNTA 2QHLA 1ZHBA 2UY6A 4WV1C 5F7EL 5HVWA 1L7TL 3WNLA 2ICWA 2IPUG 1ZT1B 3DVFA 4IOFC 1HILA 2BHUA 3SDCD 4YDVA 2O5YL 4JFQA 6CGTA 2FLBT 5B3JF 1BHGA 3VXOA 1IC7H 3TIDB 3BDXA 2NXZD 2LE9A 4OGXH 3RZCC 1CDIA 4P46A 2CMRL 4XHJD 1KLGA 3I02B 5B38G 5J6GB 1B3JA 2NPLX 3GJFK 2XKUA 3LKPA 3VG0L 3T4YB 3LOWA 1QBMH 2BY3A 1QVOA 1HIMH 3EYUL 3ARBD 1QBLH 3QZWB 4XCFH 3U4BH 4Y1AA 3GMNB 4PRBA 4Y5XB 1T20A 3E2HB 3QUMB 4ZAKC 4L3AA 3K1KC 4KDTC 2B1HL 4U6VH 1U3HB 1ZT7B 3UC0H 4JHAL 2OX5A 2PYEB 1RIVH 3NACL 5GGVH 1LK3H 4HKJB 1GZPA 1QR4A 1F90L 1VADA 1KIQB 2ZOLB 4P2RE 2OJZL 5IG7A 3IU4L 3C6LA 1PX4A 1ZANL 3ALWA 4Y4KB 3TN0B 5IQ9A 2IG2L 4M4RA 4W4OA 3W9DB 1SQ2N 3UTOA 1KUMA 1U8OA 4OLZL 2NNAB 4WFGD 4D0DA 3HC3L 2W91A 3L9RB 3PWVA 2CLRA 5ILTH 4HS6A 3QDGE 1XT5A 2P8MB 2HT4C 3TEUA 1FZOB 2Z91B 1AE6H 5ECJE 3JZ7A 4PJAB 3UX9B 3MLPA 3BZ4A 4A2LA 3JWOL 1AGDA 5JMRA 4ONGL 1IEBB 3WHXB 3TFKD 3QCTH 4DQOH 3DXAD 2W60B 4HIJB 1P2CB 4G8GE 4WHCA 3VFVA 3NMEA 4GRMB 1KCUH 3VFUA 1NCDH 2V5SA 2VLJD 3GJFB 5EO0A 5T1DL 1NLBH 4XNYL 3E1F1 3MXWL 1A7OL 3HFMH 4LNVA 1NGQL 1RZKH 1ZHKB 2F5AH 4V2BA 3VFTA 3PDGA 1IARB 5D2LE 4HPOH 1XGPB 5C6PB 2CH8A 3MCLH 1KELH 4N68A 3L3GA 1A7PL 5JW3H 1KJ2B 4F3FB 3A67H 1B4JL 4P4KA 1NEUA 4JRXD 1S5IH 3KDMA 3WN5C 4LEOA 3RX8A 1NBYB 2FIKB 2DWEA 1DBMH 3WJLC 5I8EB 3BVNB 4NZTL 5E8NB 3HZVB 1U8JB 1NMAH 4G7YH 4UMGA 3THML 2F8XC 1MI5B 3PV6B 1D9KB 4L3ED 2GCYA 3QPQD 5I30L 1GC1L 3OKEA 3RVTD 4WFED 1GJIA 5KS9A 5GISL 5DT1H 1DVFB 3E0GA 4OKVB 4HXBH 4BSWB 5CJOH 3QO1A 3DTXB 2C1PB 1HXYA 3DXAA 4MCYA 1IGIH 1J8HB 4XMLH 4AENB 4Z7WA 1K8DA 5JZ7C 1G9NH 3DV4A 4HXAH 5GJTH 3BPLC 4YWGL 4Z7UA 3MJ9H 4HH9B 1EHXA 3P4MB 2DQIH 1WBXB 2YC1A 3FB7B 3V4UL 2AJYL 4I77L 4KI1A 3OR7A 4Z6AT 2NZIA 4BUGA 3PL6B 3DX9A 3ROLA 2DQGH 2C3WA 4LQFH 4PJDA 1LO5A 3MC0A 5F7KC 3V8CA 1ES0A 4KROB 4P23D 2VLRD 1RUAL 5CP3H 1ZLSL 2XTJE 4PJIB 4JRXA 2X5PA 4IDLA 4ZS7H 5ETUA 4LRIC 4OFKA 1E4XL 3Q5OA 5TDPA 1SYSA 5FUCE 2IGFH 1CICD 5HHNB 1BGXL 4L3EA 4GKSB 3KNBA 3HE6B 3ZKSD 5ITBL 1KENH 3KPRB 4YHNB 5IHUH 4ZFGL 4EIGB 4HKXB 1CWVA 2ERJC 1QFUH 1JNHB 1OTSD 1U8MA 5IBLD 4NWTH 1KGCE 4J3SA 1F6FB 3MV9E 3OB0H 4NKIL 3KPLB 5CWSA 5HHOD 1XF3B 3S98A 4S1RL 5HHQB 5DFVC 3RL2B 3QR2A 3QH3A 4HUUA 1UWXH 2V17L 3QUMH 1YDPA 4KZDL 4LDOB 5C8JA 1A21A 2GQHA 5I8OL 4OKDA 1IGTB 2YRLA 4KJPD 2O5ZH 3OKOA 4PJGF 4DVRL 1Q0XL 5CBEA 4ELKA 4LSUH 1LEGB 4P23A 3RKPA 4HQQH 2VLRA 5J1TC 3SCMC 4WV1B 3EYSH 4NWUH 2UWEA 3CLFH 3HNSL 1ADQH 1O7VA 1U8KB 2DQEH 1KN4H 4OCYL 3KR3L 3RNKA 1BFTA 4M93C 3E6FB 1AJ7H 3SGKC 3U0WL 4U6YB 1KLUA 4JFZH 2ZUXA 3D85D 4O02H 1TZGL 3RZCB 2R69L 3P3YA 4O58L 1EXUA 1OAZH 5DJAB 5CEXB 1A9EA 5E7FA 4Y89A 1UJ3C 4TNVK 4XC1L 3CU1A 1N64H 2E9IA 2BZDA 5KVGL 4NOFA 4ALAL 4OF8A 1H3VA 5C6TL 2MMXA 4LSSL 3D39E 4NNYA 5IBTL 5CLTA 5DZOA 4LSQH 1FIGH 1GIGL 1AQDB 5JQ6L 1G7JB 3IDJA 2E7LC 1QLRA 1RIHL 3IAQA 4GRWE 3GJFH 1MQKL 5TGBA 3RVVD 4ZAKB 1V7ML 3VRLE 2CRIA 4BSVB 3CSBA 4H5SB 5E08H 5JXAL 4RA3A 1NBQA 3QEHA 4XP4H 1XH3B 2J4WH 3LEXB 1JV5A 4UINH 4AQ1B 3BZDA 1MJ8H 1FC1A 3LS4H 3O9WD 4MXWH 3K74B 1IAKA 1KJ2H 4KJYA 3CVHB 2BSRB 4PRPD 4YXKH 4QHNB 4GG6E 1BBJB 2EYRB 2GTWA 2J8UB 4PRNA 1IKFH 1ZAGA 2X7LA 5HPMB 2KL6A 3GDBA 1R5WA 1LD9B 4C56D 1A6AA 4RISH 1H15A 2JK5A 3NZHH 3U1SH 3D85A 4LVHC 5FKPA 3JTTA 1MF2L 3P40A 5E1HB 3W5NA 4YLQT 5L6YL 4MB4A 2P7TA 1D5XA 4G7VH 3JV4A 3D25A 4HIXH 5BZWA 1MHHA 1VKXA 1DQDL 2CDGA 3DI3B 2DN7A 3KPMB 5E2UL 1SHMA 4H88L 4X8XA 4DGYH 3IS1X 4OF7A 1S7TA 2F74A 5DHVB 2JB5L 4U6HA 4P99A 3FAXA 4HZLB 4JM2B 5CP7A 4PY7B 1GRWA 2SEBA 5IMOA 3QZWG 1A6ZB 2DLIA 4X7EC 3ZKQD 1B2WH 5IGXH 4X0KB 3IAGC 4KGJA 4ZFFB 4LKXB 4KVNH 1A6VL 3FB5A 1MCPH 3FB8B 5IB1A 1BVKB 4EBQH 3INUL 4X7FC 3O9WA 2XY2A 5DC4B 1MCLA 1JN6B 2E6PA 2H2SD 5FO9A 3CXDL 4PRPA 4RGNC 1I7UA 2YHGA 4RBPK 4M6AA 4KK6C 3BRGC 5AG9A 5ADPH 1BFVH 3BP4B 3QFJD 1T2QL 4C56A 1EEYB 1R5VB 2ORBH 1Q8MA 3CX2A 4PGEA 4WEBH 2CK0H 3SDYL 4GW1A 5FYJL 5IVNA 2HN7A 4HT1L 3PWLB 4ODVH 3RWGB 3RY6A 3HC4H 2A1WH 3EKCA 3JTSA 4K07A 4PLKD 3O3AA 4GJTB 3QUXD 4ZUVA 1F6AB 3OR6B 5ISZB 1AO7E 4UDUB 2D7TH 3ALXA 4W68A 4M43H 1R3IH 4Y4HC 4R7NB 3BPLB 3CC5A 1QYGL 1PKQA 3X14B 4EUPA 1AXTH 4FABL 2FEDC 1T4KA 4UT9H 4TVPE 2ED7A 4PREA 5CGYC 3RRQA 1QRND 2J7LA 5DJCB 4DK3A 1J1XL 4UT7H 3ARQA 3PIQA 4I18C 1EVTC 3S3JA 1JZ5A 1QKZL 8CGTA 1JGVL 4F7CA 4L9LA 1MEXH 3NFNB 1G7LB 3JVGC 5I8CA 1QG3A 2A6IA 1EUTA 1NFIB 3K46A 5IMMB 3QFJA 4YXHL 3S35H 5FYKH 3U82B 4JPKH 2QJDA 3Q5YA 3WFBH 1M1SA 4F2MB 1C08A 2B4CH 5B4MC 3BH8A 1P7KA 1N2RA 3UO1H 43CAA 1U92B 5DK2B 5J9PB 4FQIH 3QHZL 4XNQB 2ERJB 3HA0A 1NH6A 5C0GA 2H6PB 2O61B 2JJSC 5C0RL 3QUXA 3RBSA 2D31B 2DDQL 5AUMA 1RUQL 5LAXB 3HNTH 4JQVC 2F53B 1JCKA 2VXUH 3WNKA 3Q3GB 1A2YA 2PTVA 5D1XD 3AROA 5JORA 3CFJA 5E1AB 2ZOKA 2JB6A 2HYMA 3WIIL 4F80A 1CDCA 5DJDB 4D3CL 4JFDE 5DMIL 2QSCL 1MCOL 4JZNB 3BMVA 1MUJA 3MA7A 4LCYA 3STLA 5EZOH 3O2DH 3RIAK 4JY5H 1BVZA 3B3IA 1CGUA 2W07A 3SCMB 5D93C 1CFNA 5EOCH 3CVHH 1F4HA 1QHPA 5CJXC 4NP4L 3WNMA 1DFBH 4LCIH 2DKUA 4U7KA 1UB6A 1KIRA 1JHLH 2GT9B 4ORGA 3X13B 4TSCH 2MJWA 3ZT6A 2VZTA 3QA3A 1PVHA 1OT2A 2GITA 2RGSA 1CT8B 4JGJA 3MLTB 2LAAA 1UJ3B 2K3TA 3BP6B 4I0KA 4QRPB 1MCNA 4QRRA 3RWFB 1HYRC 3T0BA 1FL5B 3HB3D 3WD5H 1AXIB 3H3PL 2OR9L 1CFSB 3VH8B 5C0AB 1A4JB 4LLVA 2H32A 3QNXB 2GFBA 2ICEB 5DHVH 3NOIA 5D1XA 3P0GB 3ET9F 4Q6IC 5EU6B 2W0FA 5IV2B 1IE5A 5AZEL 4NJAL 1DQLH 3L5WA 3WFZA 4JO4L 1KB5B 3TT1L 5F88A 4QOKD 2HKFL 5EUOE 3QHTC 1RMFH 5B38A 3G6JB 4GKOA 2XRAH 3GHBL 4Z7QF 3BWUC 4KI5F 4O51A 2DTML 3HLAB 3ILQD 3ULUC 1ZXQA 3KPOB 3Q1SL 1CXHA 4LCUB 4Z77B 3PQYD 5CJQH 2VXVL 1P69B 1I9IH 3QULA 3FB6B 1HQ4A 1QSEB 1TIUA 3CFCH 5ESAB 2HJFA 1YEEL 5GGUA 4EDXB 1WC7A 4Y16C 3B9EA 3R8BB 3HG1D 2YR3A 1AGEB 5C0IB 5ICXA 4P9MH 1AD0B 2BC4B 1J0ZA 3EHBC 1B90A 4LVHB 4DZBB 3U0PB 5L2JB 1RVFL 2ZUTA 4Y5VC 3EO0B 3BUTA 1YPZE 3C60D 3RY4A 3MROB 2C3VA 4RCAA 2KUTA 1G7QB 1CXFA 1E6OH 5EN2A 1FNEB 4KK9C 1JZ6A 3G6AA 3VRJB 2AGJL 3C8KB 4MJIB 2NMSA 1RQ5A 2Y36H 2R15A 1IC7L 1JPFB 2VLJE 3N1QC 5HDQH 3TBTB 3RJQB 3RGVC 5T1MB 1DQTA 3B9VA 4JZOB 1EGJH 3KYAA 5FEBA 4LL9A 4PJFB 2NW3A 3VFWB 3GK8L 5JHDB 2EYSB 4WTWA 3HPLA 1LE5B 1VA9A 5E95B 5IM7B 3T4AB 8FABB 3N1PC 4M7ZC 4TULH 1SEQL 4U1KB 4GSDL 3RTQC 2OJEB 1QBLL 3VFSB 2ITDA 4JRXE 3PQYA 4PJ5B 4S11A 4A6YB 3NPSC 2EEBA 1UYWH 4RGNB 1A1OA 1MHPH 4XBEH 4U6VL 2IMNA 1FRGL 1IT9H 3UC0L 4M8QA 3STBA 25C8H 5DDHB 1INEH 3VFOA 5JXEC 3VWKC 1MCSA 3O11B 4X6EB 5GIRB 4HULB 2HJLB 2ATPB 4HJJH 4WFEE 1QEWA 3C60A 2EKJA 2AXGA 3A6OA 1Q9LB 1MVUA 2MQ3A 3GSOB 4RBPH 2HTKD 1XFPA 4ZS6C 1IEAB 1UB5B 3P9MA 1FYTB 1RZ8A 1WITA 4MAUH 2FX7H 5LBSH 5J1AA 3W39A 5DHXB 4U1MB 5ILTL 4BK4A 4Y4HB 5JMOC 2AEQH 1MRCH 2EZ0C 2FATL 4NBYB 1RV6X 1MFEL 3VXUD 2NTSP 2WM0A 5DVOA 2B1AH 5I1JH 5IFJA 4DGVH 1KIPA 2HLAB 1BVLB 1YQVL 3QCTL 4I18B 4BZ1H 4DQOL 3UTSB 4OZFB 1LEIB 2VLRE 2BOCA 1KCUL 3PWPD 1YY8A 5ID0B 4QGYA 2XA8H 5KSAD 1N3NB 4Z8FH 2W38A 1NLBL 3U6RA 1HK6A 2F8VA 2XA3A 3HFML 1MLCA 1RZKL 2F5AL 3K1DA 5IB3A 3MRIA 3FO0L 4YK4C 3KYNA 3OPZH 4JG0H 2IBGA 2AJUH 2OBGA 1YMMA 1FFNA 5J11B 1MJUH 4UDTA 4LLDA 5DJ8A 3P77A 3IKCB 5FOBB 4NO2A 2R23B 4G9FB 2YBRA 5EIIA 5GRVL 1S5IL 2AEPH 4NZJA 2PW1A 5HHOE 4H0HB 5GSRA 5I74C 3SKNB 2PUQT 1DBML 3VFMB 4S1SH 1H3UA 2DJ4A 1TZIB 2V2TB 2WQ8A 4TRPH 1WCQA 3L7FA 3C5SB 4APQD 3P4OA 1KB5H 5DT1L 3SY0B 1QFWI 3GSVA 4P3DB 5DD6A 1WCBB 5C6WH 5TH2B 1P1ZA 3TT3L 4XMLL 3B4NA 4MCZB 4LMQE 1KJ3L 1VACB 3PWPA 2EXWD 5GJTL 5EO9A 4OTXL 3MJ9L 5TFSH 5KSAA 2ZCLH 3EOAB 5DQJB 15C8L 4JFXA 2AJ3A 4ACPA 2VDMH 3MO1B 5CHNA 2Y72A 3QJHB 5KZCB 3O4LB 3P9LA 2PTTB 4TUJA 4QXGH 3ARUA 1CVSC 2OYPA 1M6OA 3MTRA 3MLXL 1TFHA 1XGYH 4W6XB 1A3RL 4LKCA 1NMCC 4F7EA 3BN9C 1MRFL 3X11B 1XIWB 1H3WM 4FQQB 3OX8A 3MBEC 1U8LA 1C16B 3GI9H 4U1JA 5DJXA 4IJ3B 4NQED 2E9JA 4F9LC 3G08B 4OB5H 5DHYB 1KENL 4OQTH 4APQA 1M7DB 5IHUL 1DE4B 1H3XA 1QFUL 3B2UC 4RFNB 2YEZA 1TTFA 4FZEH 1O5DT 4IDJL 3VI4F 3RFZC 3ZTJH 3NN8B 1NKRA 3KWWB 5AAWA 1MCJA 4YHMH 4CU6A 3MLSH 4OCNC 3U46A 4OGZA 4R3SB 5LVEA 5ESVB 3W0WA 3ZHKA 2W9EH 4A6YH 1FVDA 3QUML 2P8LA 4XX1G 5DK0B 4XXDA 5FYJU 5IQ7H 3K7UA 3TNMB 4PJEA 3QDHA 3UTTB 5IJKA 3RU8H 5DD5H 3MJ9A 1YEDA 1XGRA 5F8QC 5IVZB 4MD4A 5MHSD 2CQVA 3D69B 4HQQL 4Y5VB 3S96A 5BVJA 4POUB 3AREC 2BRRH 1U3HD 1I8IB 4CU7A 3EOTH 2PYED 4NBXB 1OP5H 3CLFL 3SBWC 5MP6H 2X1OA 2DQEL 1I85A 4NQEA 1CGYA 5CP3A 5TE7L 4FG6C 4JFZL 5C0BB 3TN0D 3RGVB 2FH8A 3VH8G 1ZT1A 4NKMB 3NFPB 2HA1A 1OAZL 3IFOB 5H35B 4P3WA 3QHFL 3O2VH 5JHLL 5CZXC 2NY5C 3ARDC 5F7YC 4PUBH 3TA3B 3IVKB 4XNXL 3AVEA 3TIDA 4BUHA 4QHKJ 3V0AC 1QBAA 3BD5A 4BH7B 1MFAH 4M7ZB 3RTQB 4OZFH 4Y2DC 1AHWC 1Q9OB 2Z8RA 3I02A 2Q8BH 5J6GA 4OBSA 4TSAH 2CR3A 3T4YA 4K94L 4YDLB 3QFJE 2XV6B 4DUWA 1JPGB 2ZNXA 4G5ZL 1KTRL 4MQXD 3QZWA 1NCCH 3GMNA 2R56H 3BSZH 4UINL 4Y5XA 3SPVB 3MFGB 3QUMA 3LS4L 1P84K 3QWOB 1CDHA 4TNVF 1U3HA 1ZT7A 1AR1D 4M5YL 2PYEA 1V05A 2XXCB 5C2BH 4HKJA 3VD7A 5DO2C 2M26A 5F9AC 5GQBA 1KIQA 2ZOLA 2VDLH 2J5LC 4LIQL 1M7IB 2CRMA 1U3JA 4M7KH 4RISL 3H3BC 3NZHL 3U1SL 1OW0A 3QEQB 4YHPB 5HGBB 4Y4KA 3TN0A 4W4NA 1I8MB 2J8OA 5GGRY 5CSZA 3W9DA 1MFNA 4LSTH 1ADQA 3ULVL 1QRNE 2NNAA 5FF6B 3L9RA 3BIKB 4HIXL 1VGEL 1UT9A 4O2EB 2R0KH 4J4PC 1D9KD 2P8MA 4H1LB 4OUOA 3ZTJG 1JYXA 1FZOA 2Z91A 1BLNB 4PJAA 5JW4Q 4OAWB 4ZSOE 2X89D 3NZ8A 2H45A 5CILH 3MOBH 3FRUB 1IEBA 3WHXA 1T83A 4HIJA 2W60A 5H94B 1MFDL 4F7PB 3VW3L 1P2CA 4YK4B 1JGUH 4OZHF 1MCPL 4GRMA 1PEWA 1FVEB 3GJFA 3C87A 3MX0A 2WWMC 4PP1D 4JY4B 4S0TD 1ZHKA 2QL1A 3ZYOA 4EVNB 2FJFB 5DQDH 4DK6A 4Q2ZB 4OD3L 3PL6D 5ADPL 1CK0L 1XGPA 3MRCB 3MACH 3C8HA 3MV7D 5L9DH 4KROD 4LPUA 3BXNB 1KJ2A 4F3FA 3I2CH 3JUYA 2PR4L 3EZ8A 2ORBL 1NBYA 2FIKA 2CK0L 2KPNA 2AW2A 5I8EA 3BVNA 4NOBA 3LQMA 5E8NA 3HZVA 1U8JA 4PJGE 4OZIB 2VDQL 4NNPL 4FFZL 1MI5A 3PV6A 1D9KA 2WZPD 4JO3H 5C2UB 3HE6D 4GQ9H 1Q0YH 1LDSA 2D7TL 3KPRD 3MSPA 4M43L 2B8OT 3TBSB 2EE6A 4YHYC 2CO6B 2OK0H 3GSNB 4OKVA 5DWUH 4Z7OF 3EO9H 4OZFG 1AXTL 4BSWA 2EKSB 1RZIB 1JPTH 1QFWL 4WRLA 3DTXA 2C1PA 5I1EH 1J8HA 2DLGA 4AENA 2AV1B 4L5FH 1CIUA 5IVOA 3VD3A 3SQOL 1J05B 4UT7L 4HH9A 3P4MA 4UU9B 1WBXA 4DAGL 4RGOH 2A6KB 1X5LA 4UB0H 4PJ7B 3FB7A 4GBXC 3IETB 1ODAA 1NMCB 3T0ED 3PL6A 1VESA 3SOBH 1HH9B 3S37H 3LMJH 1IAMA 3KS0J 1MPAL 4K71C 3S35L 4AIXA 4L4VB 1FJ1B 3DYOA 3VMNA 4PJIA 3RDTB 3UO1L 4RX4A 4JO1H 1XZ0B 4GG8B 5D1QC 4QOKE 4IOFD 4MJ6B 4OIAA 4CN6A 3PNWB 3MODL 2JIXB 5FYKD 5EB9A 1IGYB 5L2KB 4IEFB 5HHNA 1YYLH 5JIPA 4QXUH 1NLDH 4GKSA 2BSED 3B5GA 3HE6A 5SX5K 4XMKH 3GI8L 5ADOH 5E03A 3PQYE 3KPRA 5EC1B 4YHNA 3RZCD 3ZZ1A 2VXUL 4HKXA 1JNHA 4I8DA 4R4BB 3OAZH 4WEMB 4X5XB 4NDMB 4NN6B 3BP5B 3KPLA 3HG1E 3QDMB 1KNOB 5IF0B 5J89A 1OSPH 4CW1B 1XF3A 3SN6N 1TCMA 4NCDA 2R2CA 5HHQA 3RL2A 4YHOL 5TF0A 1H3GA 1UEMA 1HCFX 4JY5L 3D18B 4ZAKD 1MVFA 5D7LB 2DQTH 3AREB 4NYLB 3CVHL 1IGTA 3WDHA 4CDHA 2D0GA 3BEVB 5BW7A 2Z8WC 1RUPH 1DFBL 4LCIL 4ZO8A 1T1YB 1LEGA 1JHLL 2JJWA 1D7FA 4OD2B 2PNDA 3G5YB 1X5ZA 4WV1A 1HOCB 4UTAL 1PEZA 2BY1A 1U8KA 4YZFF 4WHDA 3ARDB 4O2FB 1KF9B 3E6FA 1F58H 3QB7C 4AMKH 4MQ7B 4JANB 4U6YA 4YFEA 3RIAF 2ICWJ 4LPXA 1U8NB 1SVCP 2R0LL 5CKGA 3RZCA 1CG9B 4H1LH 5DJAA 5CEXA 1NCBL 2P24B 4IS6B 2DMCA 2HT4D 4X6FB 1AHWB 5JTWA 2OP4H 4HMEA 1U6AH 1DQLL 1MNUL 3VFNB 3HR5B 3T65B 4Q9RL 5DC9B 1RMFL 1YNKL 1AQDA 1DQML 1G7JA 1T0NB 3SDXB 3FQNB 4ZAKA 4BSVA 1WV7T 4KDTA 4RMUA 3V0WL 2Q8AH 3F7QA 4H5SA 5EU5B 3M8OH 4LVEA 3CFCL 1XH3A 2HJKB 4IRJC 3LEXA 3O2DA 1A3QA 4W6WB 3TYGL 1FPTH 4ZNEA 3WHE1 3BAEL 3QPXL 2ADGB 4TPRL 4PLNC 2RIKA 5E2WH 3CVHA 2BSRA 3S7GA 3VXUE 4QHNA 4BQ6A 1BBJA 2EYRA 5B22A 2J8UA 3OQ3B 1UXWB 3N1GC 5GS1B 1FH5H 5D7KD 5HPMA 2JJTA 2VZVA 1LD9A 4NRZB 3AMLA 5E6ZA 1E6OL 1KB9J 4PRAB 3WXWH 3Q6GL 5F72S 1WBZB 1KN2H 1Z3GH 2NY3C 2AK1H 3GSNH 2XQYK 4RAUB 4N0FB 4X7TB 4G6FB 1FGVH 3KPMA 1Z5LB 5DGRA 3BIAX 5ISZD 4RMSA 5JZ7D 5DHVA 4HZLA 4JM2A 4PY7A 1CI5A 2P49B 4XPGL 1ITCA 5D8JH 1A6ZA 4X0KA 4ZFFA 5AYUH 1UYWL 1FNSL 1WIOA 4LKXA 2Q3ZA 5CZVH 2YXFA 3FB8A 1IT9L 25C8L 5FHAH 1INEL 1BVKA 2N7BA 2YUWA 3ULSB 4XPFH 5ERWB 1JN6A 2Y6SC 3V5KB 2A38A 4NM8H 5FHBL 3BP4A 5E24E 5A40E 1EEYA 3SKJL 3MBXH 1DQQB 3F6LA 4LVOC 1R5VA 2FX7L 5LBSL 3ZT7A 3ZSTA 3RVXC 3MXVL 4PJXB 1MRCL 4QTIH 4YHYB 3V0VB 3RWGA 3PWLA 5FV2A 4H1LG 1INDH 3GHEH 3LSOB 1UWGH 1BIHA 1F6AA 3OR6A 1CS6A 5ISZA 2Y5TB 4UDUA 4FS0A 3L1OL 4R7NA 3UAJC 1JWUB 5DFVD 5I1HH 5H37H 2E7CA 1EGJA 4JRWA 2CKNA 3X14A 2WLYA 1S9YB 4GBXB 3OJDB 2XA8L 5HVHC 5DJCA 4NQEE 1QOKA 3W11C 3P0VH 2DKSA 3E3QE 4ZUSB 1I9RL 5BMFH 2ILLA 4JG0L 1NFDF 5F3BB 1UKQA 4Z7VB 1XEDA 3NFNA 4XP5L 3FOMB 1MJUL 1G7LA 3G9AB 4JFPB 1KOAA 3SCMD 2XKSA 4HK3J 1AD9B 4LRIA 3IDNB 1NFIA 5D1QB 5IMMA 1INQB 3HCVB 4Z7QE 2DQCH 2LV4A 4KI5E 2NY5H 2BNRB 3GSUB 4F2MA 5E6YA 3UZEA 3V79C 5FGBA 3S6CA 2CDEB 1WK0A 4J2XA 3C08H 1CD1B 1U92A 5DK2A 2JCCB 6FABH 5J9PA 2FX8L 1IAIM 4XP9H 2AK4E 4XNQA 4AZ8A 5D70H 3OKNB 2QBWA 2EICA 4NHCL 1EMTL 4QRPD 2H6PA 3HC0B 3ZDYF 2O61A 2D31A 1IQWL 2PXYC 4P2CG 5LAXA 4D0CB 1CGSH 2F53A 1FG2B 5C0AD 4M48H 5SX5H 3GM8A 3Q3GA 1RFDH 2YA2A 1MRDH 4U0RB 5KVEH 1CDUA 4UT6H 5EU6D 5E1AA 2KDGA 3Q5TA 3ZHDA 1BMGA 4D0BB 2Y9RT 2R1WB 2ZCLL 5DJDA 5CINH 4YHKH 4JZNA 3BEWB 1FDLH 1LQSR 1HSBB 2HWZH 1OAYH 1I7TB 1JYWA 4FP8L 5IEKB 3ULUF 4G9DB 4U1GC 4LDEB 3SCMA 2AVGA 5C0FB 1QSED 3ZT5A 5DUBB 1P4IL 3LKSB 4WVRA 2GIYA 1MCCA 2FEEI 5DFWH 4OBRA 1NGWB 1N26A 3PWUB 3SGKA 2GT9A 4FHBD 3OXRB 3X13A 2D4FA 4AIZB 3GI9L 3IJYB 5I71C 4G6MH 2VL5B 3GRWL 1N4XH 1T5XA 3MUZ1 1CT8A 1BZ7B 3MLTA 1UJ3A 4QRPA 3BP6A 4FRWA 5TF1H 3RWFA 1RZGB 1FL5A 1G6RH 1CFSA 3VH8A 4Y2OA 3BHBB 4YDIL 2J2ZA 4LARH 5C0AA 5D96C 3EZJB 1A4JA 5BO1H 3QNXA 2ICEA 4NNXB 1QP1A 3OZ9L 1RJLB 3O4OC 2IFGA 2Q76B 3MLSL 5IV2A 5EU6A 2L0DA 4YDKL 3DJ9A 3MJGX 3WDIA 1KB5A 5H37G 3Q2CA 5JHDD 3QEGH 3HRZB 3G6JA 5IMKB 3RWDB 4IRJB 3S36X 3EFFB 3WFCH 3HLAA 5FV1L 4R97B 3KPOA 4LCUA 5MI0C 4Z77A 5DD5L 3OSKA 1Y6NR 3EDFA 3OJMB 4PJ5D 4XNZB 2Y06H 3SE3C 4RGND 1B9ZA 3FB6A 4ODXB 1QSEA 1ZWIB 3QCVH 4OCRL 5ESAA 5A2JH 4CU8A 2FD6H 2BRRL 4EDXA 4KK6D 2YUVA 3EOTL 2Z92B 5EPMB 4R0LC 4EZMA 5MP6L 1AGEA 1ZS8B 5C0IA 1AD0A 2BC4A 2XZZA 5C07B 4DZBA 4KKNA 5L2JA 2FSEB 3U0PA 1ZTXL 3EO0A 1YECL 1TJGL 5HGDB 2AJZB 3MROA 1A6UL 1KLFA 1QLFB 1G7QA 4EDWH 1FNEA 1FYTD 3VRJA 3C8KA 1PAMA 1QSFB 1HSAB 4MJIA 5E9DB 4UBDC 4R2GC 1H8OA 1JPFA 3FQWB 3TBTA 4Y4HD 4K3JH 5FYKU 5SWSB 5T1MA 4OQTA 4JZOA 4CBPA 1EK3A 4PJFA 4F9PA 2FEDD 4PJ8B 3VFWA 5CGYD 5JHDA 4TSAL 5C0EB 3NA9L 4AQOA 2EYSA 1PD6A 5GRJL 1LE5A 4M5ZH 1IGFH 1OGAD 3T4AA 1MCEA 1B88A 3MV7E 5IM7A 3FCTB 5DF0A 2MQ0A 4U1KA 2X41A 3UTSD 2OJEA 1PFCA 3VFSA 1D5MB 3CCHB 1NCCL 1FCCA 2R56L 4PJ5A 3BSZL 4A6YA 1ZA3B 5ICYB 4UI2A 3EYOB 2A9MH 5DRZB 1NBVH 4YEFA 5DDHA 5HYFA 3O11A 4PB9H 4X6EA 5GIRA 4EN3C 2HJLA 4XMPH 2ATPA 1N0XL 2IC2A 2C4XA 2NYYC 4Y19E 1Q9LA 1O0VA 4WIQA 3GSOA 3MNWB 4UIMB 1GGUA 3NBNA 4LSTL 4TNWF 1IEAA 1UB5A 1FYTA 5T3ZE 3GBNH 3V6OE 2VLKB 4LRNH 3LHPH 4U1MA 2KKQA 2VC2L 4HS8H 4Y4HA 1B4RA 4JO2H 1GXEA 2NW2B 4Z95H 5I0DA 3T0EE 1T0MB 1MFBL 1OPGL 1A0QH 3TZVC 1BJMA 4OZGB 5HVHB 2HLAA 1BVLA 3MOBL 3SEPA 4O4YL 3FO1B 3EBAA 5ALCH 4XXCC 4I18A 1CVRA 3UTSA 2HKHL 3QXAB 4OZFA 1LEIA 3BQUC 4K3EL 3UYRH 3ZL4H 2C1OB 5ID0A 1N3NA 3JVGA 1ZKAA 4CVWA 4AL8L 3VI4E 3O4LD 2BOBB 5MEPB 3T08A 5DQDL 2MPAH 1Q9KB 4OCWL 1LHZA 1QFOA 4TUKH 5L9DL 3ARRA 4XH2B 3IKCA 3RHWF 2R23A 4G9FA 4NZUH 1BD2E 4WI8A 1UKTA 3SKNA 3VFMA 3VXSB 2JJSA 4KV5F 1TZIA 1UJTA 5T1KB 2XPGB 2V2TA 1KBGH 1UM4H 5HHXH 4JO3L 3C5SA 3KLDA 3I6GB 5F7NC 1FSKC 4I48B 3P4LA 5DD1L 3SY0A 4P3DA 5DWUL 3EO9L 1WCBA 2DRUA 1HNFA 4I5BB 4KDWA 1S3KL 4MA1C 5TH2A 2H41A 5I1EL 2XQYG 4TTDC 3ELAT 4JDTL 1CBVH 1TNMA 1LMKA 1EUUA 4MCZA 5HJ3B 4KTEL 1VACA 1GGBL 3EOAA 5DQJA 2FCBA 3MO1A 4RGOL 5C0DB 3QJHA 3O4LA 5D6CB 5DD3H 4ZTPL 2PTTA 4Y16D 2NY2B 5M94B 1IC1A 2X4PB 1F45A 4WFHE 3SOBL 5DA0B 3TIEB 1JUFB 1TJIH 3EHBD 1NFKA 1FNHA 4OJFL 1J0JA 3FO9B 4NQDB 1H0DB 3L7EB 1D6VH 5FGCB 2I60L 3X11A 3K81A 1XIWA 1GAFH 4FQQA 4GMTH 3AFLA 2FEEL 1C16A 1U0QA 1WUNT 4S0SD 4OLEA 2ZZUT 4NUGH 5D96B 2D7PA 3OJVC 4QXUL 2OZ4H 3G08A 1OLZA 5DHYA 5C0BD 4XMKL 5GXBB 5ADOL 3U7YH 2B2XH 3O4OB 3RGVD 1M7DA 3EJZC 4ZOCA 3BRFA 3N85H 4P5KB 1DE4A 4NQXB 3LN5B 4XNUH 5HI3C 5HGHB 1MJ7H 3TA3D 3NN8A 2X2YA 3QUKB 1XMWA 3KWWA 4M3JA 1OSPL 1EPFA 1OHQA 4P46C 3RTQD 2AJSH 4P9HC 4R3SA 5GS0L 3RVUC 4JG1H 4LLYB 5ESVA 3PWJB 2XN9B 4M6OL 2DLFL 2XQBL 3CK0H 4KKBC 3BISA 5DK0A 2DQTL 2VJXA 5IW1B 3TNMA 2O5XL 3UTTA 4BZYA 1JF5A 5JXED 1HYSC 4R0LB 3K4DA 5TPWL 1RUPL 3WL9B 5IVZA 2EE2A 1FV1B 3D69A 4Y5VA 3WSQH 5SX4I 1XF2B 1T1XB 4KTDH 2VDRH 2BFVH 1I8IA 3PXHA 1MIEL 1E4JA 2UVFA 1Q38A 3UBXB 2MFNA 4ZS6D 3HMXL 4MXQC 4OZHE 5ISZE 1BOGB 1ZLWK 4J8RB 5T5NF 3OBAA 5ALBH 4AMKL 3C6LC 3QEQD 5C0BA 5JW4M 2VNCA 2EZ0D 1GOGA 1H5BC 2EE3A 4NFCA 4W4OC 3RGVA 5IT2H 4NKMA 3NFPA 5J56B 3O0RL 4DKDC 3IFOA 1Q94B 5H35A 3KYKL 3OHXB 3QI9B 2OP4L 3WXVH 3TA3A 1KXQE 3IVKA 1U6AL 4K8RL 1XGUB 4MZ3A 3U7WL 1G0DA 3O45B 5GRUL 4BH7A 1HCVA 3LRHA 3RTQA 5EULV 4XHJC 4XBGB 3CU7A 1Q9OA 3A6BH 4N8CH 3MPCA 4X6CF 2PTUA 1GYAA 4POZC 2Q8AL 1JPGA 3I6LD 5JXEA 4R90H 4V1DE 4EN3B 3SPVA 1FPTL 2CO7B 4K3HA 3QWOA 4X9GA 4BYHA 4U05A 4Z7OE 3MCG1 5E2WL 1C8PA 1FC2D 5DD0H 3VFPB 4UTBL 4XPTH 4YXLH 1FZJB 1SM3H 4QRUB 5HYQB 2YMXH 1S7RB 5D7IB 1M7IA 2KBGA 3QEQA 4Y7MA 4YHPA 1KV3A 5FUOH 5HVGB 5HGBA 1I8MA 4P4KC 4NC1C 3O3BB 1NPUA 4LSVH 1MCWM 5FF6A 1AC0A 4ZXBC 1KN2L 2OI9C 4HGMA 4ELMB 3V52H 1GHFH 3VU2A 4XP6H 3TZVB 2AK1L 2ED8A 3BIKA 3GSNL 2C9AA 3K3QA 4KY1H 4O2EA 1HN1A 3N1MC 1FGVL 1CR9L 4RZCB 4H1LA 1LILA 1V8HA 1BLNA 3BQUB 1ZHNB 1UQSB 5DMKB 2X40A 4OAWA 1SJXA 3BGFC 4PRIE 4JN1H 3FRUA 5D8JL 5H94A 4F7PA 1B6UA 5IEHB 2CGRH 5BS0E 5J1SC 3D0VB 3TNNB 5CZVL 5F1KC 5FHAL 1FVEA 3IFLH 3RI5K 3JWOC 3EJJX 3ME0A 4JY4A 3ARGB 4QRPE 4IRSC 4EVNA 2FJFA 1X4YA 3BN9D 4Q2ZA 3QQ3B 1OM3L 5EZIL 3MRCA 1F4YH 1XR8B 1BM3L 1BBDL 4L4VD 1FIEA 3BXNA 4HFUL 4Z7VF 1BWWA 2GK2A 4OCSH 1AH1A 3UPRB 3KAAA 3VXMB 4JRYE 3K8LA 4IMKA 4E41B 1FSKB 3B2UD 5L2KD 2HTLC 4OZIA 5HYJB 1INDL 4LCWB 4MA1B 4LPCA 3GHEL 4X4MA 2DF3A 3SGEI 3GIVB 5EOTB 3TBSA 1SMAA 3U79A 3RVTC 1JHKL 3CFEB 3GSNA 4R6UA 4YZFE 1A7BA 1X9QA 4WHYH 2EKSA 1RZIA 3GIZL 3QDMD 1F8TH 2AV1A 5HYSG 1GC1C 1J05A 4AIOA 5I1CH 4ZUWB 3P0VL 5IBUB 4MLSA 3OAUL 4JHWH 4UU9A 2A6KA 3IJSB 1O7SA 4PJ7A 2R0ZL 3IETA 5D7LD 3ARED 2OSLB 4MQSB 4UOW1 5CD3B 2BHZA 3LQAH 2CUHA 4XP1H 5E2VL 1HH9A 1A1MB 3KG5A 2UYLB 3D48R 2ID5A 4KRPC 2MKWA 5I1LB 4L4VA 1FJ1A 4PYGA 4FG6D 4ZFZB 6FABL 3T2QA 1TZHB 1XZ0A 1CL7H 4GG8A 2H1PL 5J57B 1JNNH 4MJ6A 3HUJF 4GXVL 3PNWA 1X4XA 2JIXA 1IGYA 5L2KA 5CZXD 3ARDD 4JB9H 3PG2A 5DMGC 5LXGH 2EDBA 3V6FB 3BZEB 1MCKA 1IVLA 1CGSL 5EC1A 3BDBA 4NC0B 4PJ5E 5E6IC 4Y2DD 4RGNE 3GNMH 4R4BA 2B5IC 4X5XA 4NDMA 5KSUB 5F6IC 3H0TB 1MRDL 3IDIB 4K3DH 5KVEL 4UT6L 3BP5A 1OQOA 2VE6B 3T77B 3QDMA 5FCUH 1KNOA 4ODUB 2D4DA 5IF0A 4CW1A 1L6ZA 5CINL 5I16B 4U6TA 1ACZA 2E8YA 5IROC 1OAYL 3D18A 5D7LA 1OY3B 3AREA 4NYLA 5L7XL 1P9MA 4X98B 1FYTE 3SBWA 5C7XL 5F7UA 3BEVA 1EDQA 5DO2D 1OP9A 3W81A 3QBTB 1T1YA 1DLHB 1F97A 1OWRM 4PD4J 4OD2A 3G5YA 2E5EA 2JELH 1HOCA 4LSPL 4G6ML 4JZJC 5INCB 5ITFB 4WCYL 5E70A 1H5BB 5IUSA 2VZUA 1N4XL 5DXWA 5KANG 1HHJB 2P5WD 1OGAE 2QQLH 2QQKH 3ARDA 4O2FA 5TF1L 3A6CH 3L95B 4MQ7A 3TVMC 4JANA 1ZLWH 1G6RL 4YHIB 1U8NA 1FAIH 4OFIA 1OOAA 4J4PD 4GRLC 4LARL 3SKMB 1ONQB 2P24A 4IS6A 3SDAC 4LEXH 3I3EA 4Y2DA 4X6FA 1AHWA 2L7JA 3DURB 2NY4C 2GW5A 3DVGB 3PGDB 3VFNA 4G6FD 3HR5A 3T65A 3QEGL 4WHYG 1PGRB 1VFAB 4NQVB 3MLWL 3IS0X 1T0NA 3SDXA 3FQNA 3TJEL 1YZZA 3BUYB 3HHRB 3J7HA 3TBVB 2RB8A 2WWMD 4WI7A 5EU5A 5MEOB 2Y06L 5E2TH 2X4SB 3MLYH 4JKKA 3AAZB 2HJKA 3PHQB 5BQ7B 2FD6L 2NY7H 4WTZG 1W8NA 5JOFB 1CXIA 1MCDA 1MY5A 4KMTL 4WW1B 2ADGA 2CK2A 4XCCL 2BVEA 1HI6B 4L4TB 3UBXG 3C2AL 1P7QD 5LGHH 2Z35B 5GHWL 1U95B 1UXWA 1YNLL 2P5WA 4QRSB 4ZXBB 2OI9B 5GS1A 4JKLA 4HC1H 1ZOXA 4NRZA 3N50A 3KPQB 1NFDE 2FHCA 1WZLA 2R2HB 4PRAA 5ENWB 2K9UA 4NSKB 1H9VA 1WBZA 2ESVE 3F7PC 2VXTH 1DN2A 4K3JL 1YYML 4KZEL 1Z6JT 4D9LH 4NKDB 3RY6C 2YN5A 4MNQE 4N0FA 4RAUA 3O4LE 3BGFB 4X7TA 2QADC 1PX3A 3CZJA 4JVPA 5T5FH 3DUUB 4WY7H 1Z5LA 3PP4H 3HS0B 1KG0B 1KJVB 5I18H 4Y88A 4BSJA 2VZ1A 3SO3C 1LVEA 5CMAB 1TENA 3C9NB 1ZGLB 4NGHH 4GBXD 4IRSB 1IRAY 3ZDYE 3W82A 4F7TB 2A9ML 1XAUA 3BT2H 4X6DB 1V3JA 3ULSA 5ERWA 4YFLF 3V5KA 2HVKB 4KRMB 4LASH 5T3ZL 4KJQC 2N56A 5DVNA 2YD7A 2EDTA 3JWDL 5GPRA 1PY9A 1FNLA 2DOCA 2VITB 3MRPB 5D1QD 2W1NA 4ENEC 4X7DC 4C4KO 4P2OC 3QFDB 3X3GL 4FXLA 3PDOB 5B21A 3BKJL 2BNRD 4DWHA 3L5HA 1KTLB 2NY1C 1DQQA 2D9CA 1HH6B 3VGDA 3ULUE 1QA9B 4LRNL 3LHPL 2PW2B 2F54B 4PJXA 1T7WA 4JO2L 3GSWB 3V0VA 3HI1B 1JNLH 4N8VB 5C0CE 5A43C 4I0CC 4Q9QH 1A0QL 3LSOA 3QUXC 4IMLB 4UNUA 2Y5TA 5CLWA 1JWUA 5D2NC 4F33B 4ZO9A 1NCWL 4XRCB 5JUEH 2IPKB 1D5BB 1S9YA 4FQ2H 4GBXA 3OJDA 4KQ4L 2AEIT 1EHLL 3GKWH 1JJUA 3CDCA 4ZUSA 4X7SH 4KRPB 4F57L 3ROOB 5F3BA 2MPAL 1DSFH 3BFOA 4KVCH 4Z7VA 1Y6MR 4JFPA 1FN4B 3KPSB 4HHAB 3QP3A 1AD9A 3IDNA 4JPWL 5FFLA 5CEZH 5D1QA 3NH7L 2DTSA 1INQA 3HCVA 1S7SB 3GMMB 4PLJC 4HMCA 4NZUL 1S78C 4KTYA 3B5HA 5K9JH 1ZGLM 2BNRA 4JR9H 3GSUA 1CE1H 3SE8H 2CDEA 4P59L 2YPLB 1KC5L 1NUDA 1CD1A 1L7TH 2JCCA 2QQQA 4RSVA 2XKNB 4LHUB 1KBGL 5E6IB 3LH2H 5J06A 4UUJB 3TWCL 2B5IB 3OKNA 3QT2A 3V4VL 2O5YH 1UZ8B 3HC0A 2BSTB 1WFUA 2VR9A 4D0CA 1FG2A 4WO4C 4TSBL 1I7ZB 2APVA 3BKCL 1CBVL 5BZDB 3F12B 4E0RB 4D0BA 2R1WA 3MV11 1MCQA 5IBUG 5EZJB 2AI0L 3EYUH 2GJ6B 3BEWA 4PJCF 3MV8D 1A64A 1A8JH 4IRJD 3IB4A 1HSBA 3UBXI 5MENE 1I7TA 4FTVD 5IB2B 5KG9B 5IEKA 4G9DA 5GGRB 3GM0A 2WW8A 4ZOEA 4JHAH 5C0FA 4NJ9L 4HDIB 4JZJB 2YK1H 5DUBA 5ANMB 3NACH 4OM1H 1RZ7L 3LKSA 1D6VL 1CL7I 1F90H 1GAFL 1NGWA 3PWUA 3JSSA 4P2QE 2ADIB 1OARL 3TVMB 1R6VA 3OXRA 4R4FH 4AIZA 3IJYA 1NDMB 1ZANH 2VL5A 2VZSA 5C07D 2IG2H 4GRLB 2J88H 4NUGL 4WENB 3SDAB 1LP9B 2OZ4L 1BZ7A 3B2VH 4HJGB 3WYRA 4JEGB 3HC3H 5I1GH 1X5IA 3U7YL 1JL8A 2NY3D 1RZGA 3N85L 2FGZA 4M6ML 2NY4B 3I6LE 4XNUL 5BRZE 1QSFD 5F70A 3BHBA 1I9EA 3IFNH 4PJBB 2JF1A 4NNXA 1RJLA 1OP3K 4LP4A 5SWSD 2Q76A 3JWOH 1VFMA 3R1GH 1ZSDB 3HRZA 5JNYB 1P53A 5IMKA 3RWDA 4IRJA 2EE9A 3EFFA 2NY0C 1IM3B 5T1DH 2NX5D 5FKAB 4WDIB 2Y6SD 3MXWH 1A7OH 2EDWA 4NO0B 1RK0B 4OCXL 1NGQH 4ODXA 4HWBL 1ZWIA 4Y8DC 4RWYH 1NC4B 1VPOL 2VDRL 4GO6B 3MUJA 4OZIE 2Z92A 5EPMA 1ZS8A 5EOCJ 1UACH 4UV7L 4TTGA 4UOW0 1A7PH 5C07A 2FSEA 4PJHF 3IGAB 5HGDA 5C09B 2AJZA 3RVXD 2JTDA 3KLAB 1QLFA 4JDVB 4GRWF 3GMQB 2OQJB 2QADB 2BP3A 3WXVL 1QSFA 1HSAA 5E9DA 5KVFL 1R3LB 1IGJB 2VLKD 1N5YH 5I30H 2OZ4A 1GC1H 3FQWA 3UAJD 4MNHB 5SWSA 1XF4B 1KCVH 3L3IB 5GISH 3SO3B 1A14L 5D1ZC 1BEYH 4PJ8A 2VLME 2EYTB 4N8CL 3U36B 1MFCH 1QZ1A 4HF5L 5C0EA 4GG6F 3UJTL 2ADFL 4KV5E 1MAJA 3BWAB 5HI5C 3FCTA 3W11D 4L4VE 2WV3A 4YWGH 3RIFF 1D5MA 3CCHA 4R90L 4YBLC 3U30B 2VRAA 4NFDA 2AJYH 2DI7A 1ZA3A 4I77H 5ICYA 3BKYL 3EYOA 1AC6A 5DRZA 4F37K 2E27H 5L2KE 4P5TC 1FLTX 3H7BB 2YKLL 4WJ5B 5ABDE 4P2OB 5DD0L 1HKFA 4HKZB 4QGTA 3M45A 4KKLC 1SM3L 2NY1B 4ZYKB 4BZ2L 2DQHL 2YMXL 1RUAH 3BIBX 2UVEA 5DS8B 1X5FA 4RFOL 4BQ8A 1E4XH 5FUOL 4UIMA 1TQBC 1OT1A 2H26B 4G3YL 2YD8A 1GHFL 1BGXH 2IH3B 1UM5H 2VLKA 3REWB 2PXYD 5T1KD 4KY1L 4YHLL 5GRZA 1LO3L 4ZFGH 5JOEA 4I2XE 5D2NB 3VWJC 1T0MA 1X7QB 4DUVA 4XPAH 2Y4SA 3OL2A 3T1WA 4OZGA 2Z93B 2N7AA 3QISA 2EDOA 3FO1A 4OV5B 3QXAA 2OS7A 4GT7A 2CGRL 2P42B 4ZPVB 3QG6B 2IANE 2V17H 4U1IB 4KZDH 3V95A 2C1OA 2DQFB 3H8NA 3IFLL 1BQSA 2Z8VC 3C6SB 2BOBA 5MEPA 4X9IA 2BMKB 2FBJL 3L3JB 1U3YA 1Q9KA 5IVXB 1JI1A 1UKSA 2AEWA 4ONFH 4XH2A 5KSBB 4NQDD 3MRLB 3HNSH 1RZKC 4G6AC 3V6BR 4LK4A 4OCSL 4OCYH 3VXSA 1KPVB 1MREL 4XWOC 5T1KA 2XPGA 3I75B 3QAZC 1NKOA 4N8VG 4WO4B 1NUFA 5JLZB 5EH1A 4O2CB 4C57C 3I6GA 4XC1H 4N0UE 5KVGH 4ALAH 1ZLVK 5C6TH 3RUGB 4I48A 1BWMA 5FDYA 4ZD3L 4MVBC 1FNFA 3G5VB 4R9HA 4I5BA 3RPIB 3BX7C 1BPVA 4HWNA 4JFFD 1GIGH 4RNRB 1F8TL 4FFYL 5JQ6H 1RIHH 5HJ3A 1IM9D 4PRHD 2V5YA 1MQKH 5I1CL 1J7VR 4JHWL 2XN9D 2P5WE 2W65B 5JXAH 3FN3A 5C0DA 4H8WL 1KYOJ 5D6CA 1JZ3A 3LQAL 3IDYC 2X4PA 5IJKC 1YQ2A 4X83A 3TIEA 4YPJA 1JUFA 4NQDA 3FO9A 4X6CE 2ZWLT 4QKXB 1H0DA 3L7EA 4GXUN 3TESA 5JIHA 1JNNL 4LHUG 4WU7B 4KXZH 4ERSH 1QNZH 1JTOA 4UBDD 4R2GD 4TQEL 4LBEB 2BK8A 4NFBA 4POYA 1JPSH 3F7VB 4P5KA 1AGCB 1NDGB 4LPYA 4NQXA 3LN5A 1CD8A 3GNML 1ZE3C 5HGHA 3ZYJA 1DQDH 3QUKA 5E2UH 3QWRA 5FCUL 5EIQA 4LLMB 5JO5B 2NY0B 4JCMA 1OP3H 4LLYA 2CKBL 5ID1B 3PWJA 2ZCKL 5F44A 2XN9A 2XWTB 3L3HB 3SE3A 4PGJA 1A6VH 4CMHC 2N4IA 5IW1A 1MCWW 3RNQB 3S34H 5GJSH 2EDNA 4IHOB 4H26B 4R0LA 5IW6B 4NQCB 5EBMB 4EN3D 3QRGL 3WL9A 4Y5XC 1FV1A 4W6YB 1J10A 1SMOA 2NYYD 4WTZA 1XF2A 5E8EB 1T1XA 3GFUA 4G8FB 1T2QH 3OKMB 1MJJB 1BOGA 5DK3A 4J8RA 2QQLL 1AY1H 4HG4K 1OW0C 1U8IB 3SDYH 4Y4KC 2G60L 4M4PA 2X44D 4K3GA 4LEXL 1Q94A 5D1ZB 3OHXA 3QI9A 3FQTB 1IC5L 3TZVD 4CKVX 1XGUA 1FYHB 1K4CB 4MA8L 3O45A 5BCAA 4Z7VE 1B0GB 1QYGH 4XBGA 5DFTA 3BQUD 3CJJA 4FABH 4BK5A 5E8DL 2FL5B 5KS9F 1BP3B 1J1XH 3P9WB 4P5TB 2A2QT 1T83C 3MLYL 4XVJH 1K9TA 2DBJA 1QKZH 2YD6A 4J3TA 1JGVH 1HZHH 2NY7L 4EN3A 4Z7WF 3MRKB 2JCCE 2HH0L 4P2RB 4K94C 1REIA 4NKOB 2ENYA 4Z7UF 5GRVK 3O8XC 3VFPA 5LGHL 4YXHH 1TQBB 4J23A 5KBNC 1FZJA 2VB5A 4QRUA 5HYQA 2VQUA 1S7RA 5D7IA 5H2BB 4S2SB 3LAFA 3EDDA 3C09B 4PJDF 4DVBB 4GUPB 3DRQB 4FQ1H 2APBA 5KOMC 3VI3E 3O3BA 4JAMB 2O93L 3VWJB 4Z78B 3VXMD 4ELMA 4E41D 4PRDB 5L88L 3TJHC 1J1OH 2VUYA 3QUZC 3TZVA 1RULL 3X17A 5C0RH 2DDQH 5HYJD 4JE4B 4KK5C 4CDGC 5GRXG 3UCRA 3D3VB 4XXCA 3UROR 4RZCA 4TTDD 3ULVC 4G8GB 4OM0H 3BQUA 1ZHNA 5I18L 1UQSA 5DMKA 2WP3O 3HNVH 3HUJE 3WIIH 1DVFC 4N9OB 4D3CH 4P48A 5DMIH 2QSCH 3DMMB 1MCOH 1NCUA 2A6DB 3QDAA 4I4WB 3VFGL 5IEHA 4PPTA 5GZNC 4G6KH 1ROWA 3RWJB 5HYEA 4PGDB 1AGBB 5I1IL 2P47B 3BT2L 4HUWB 3D0VA 3TNNA 1WLHA 3G9VA 5J12B 5D2LB 4U49A 1RHHB 4KPHH 4HCRH 3VCLB 4LASL 4HUMB 3ARGA 2FJHB 2OXHA 4NP4H 1E4XI 3QQ3A 4R8WH 5MEQB 2HLFD 2VDNL 2QKIB 4NN7C 5FM8A 4BELD 1C1EL 3EGSB 1XR8A 4Z76B 1AQKL 3LZFH 2ZNWA 4KROC 3QAZB 1UC6A 1JIBA 3MRQB 3UPRA 3VXMA 3EJZD 4E41A 1I3UA 5J7CC 2UWEF 1G7MB 4HC1A 3VXRE 5HI3D 3MV8E 3H3PH 5E94B 5HYJA 4OLUL 3WJJC 4LCWA 4Q9QL 4FTVE 1U93B 3KJ6L 2ZUVA 3HE6C 3GIVA 5EOTA 4OQ1A 4P46D 2P5EE 5AZEH 1E0OB 3CFEA 1UWXK 4NJAH 3RVUD 4JO4H 5DI8B 5JUEL 3TT1H 1ZLVH 1CYGA 2HKFH 1JVKA 4AM0B 4KKBD 4LLAA 4O9HH 3GHBH 2D2OA 3QEUB 1OWWA 4ZUWA 3GKWL 4YJZL 3Q1SH 1HYSD 3V2AR 2HMIC 3LEVL 4X7SL 2VXVH 1IAOB 4HX1B 3AM8A 3IJSA 1D5IH 1EEQA 3FKUS 4KVCL 2D7QA 2OSLA 1YEEH 1R3KB 2XTJB 5CD3A 1FFPB 3RWCB 1A1MA 3B9AA 3DO7B 2LFGA 2UYLA 4H20L 3RJDA 5BW7C 4OI7A 4MXQD 5I1LA 3WNOA 5F1IB 1G84A 1RVFH 4JR9L 4I9WE 3SE8L 1IFHL 2IPTH 3C6LD 4ZFZA 4Z9KB 1TZHA 5CEZD 2GYSA 1N6UA 3HI6L 4FXGB 4BFBD 3LH2L 3FZUC 4FQHB 2X05A 2AGJH 4XBPB 2NLJB 3H2WA 2B4CC 3V6FA 2ZUUA 1NAML 3MJ6A 4D94A 3BZEA 2NX5E 5BV7B 3IDMB 1MAML 5KSUA 1LP9F 1U91B 3H0TA 5F21B 3IDIA 3GK8H 3MRGB 5F93C 2VE6A 3T77A 4POZD 1RI8A 3DECA 4NBZB 4ODUA 4CMHB 4XVTL 1VCAA 1YN7B 3GBML 5I16A 4WFFD 5DURB 1QFHA 1SEQH 2PKDA 3LIZH 4GSDH 2FWOB 1AXSB 1R5IB