3P4LA

Crystal structure of a hemojuvelin-binding fragment of neogenin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
201
structure length
198
Chain Sequence
LPMMPPVGVQASILSHDTIRITWADNSLPKHQKITDSRYYTVRWKTNITKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGTTFELVPTSPPKDVTVVSKEGKPKTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Neogenin
publication title Crystal structure of a hemojuvelin-binding fragment of neogenin at 1.8A.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 198
sequence length 201
ec nomenclature
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p4lA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p4lA02
3HPLA 4OCRL 5EU6A 3X11B 4I0PC 3QI9B 4F57H 3U83A 1LNUA 3LQAH 5I1DB 2K1MA 4OCYH 4MNHB 1OAXL 3AREB 3ELAT 2NY0B 5F8QC 4M93B 1IM3B 2VN7A 3V52L 5DZNA 2R4RL 4TUOB 5EU4B 4HS3B 4F33A 3PDDA 5C0EB 3ULUL 4LCWB 4V1DD 3V6FA 1KEGH 4PJ8D 4IRSB 5KN5B 1RIHL 3PWPA 3ZL4H 5EPMB 4PP1C 4XMLL 1U92B 5JLZA 1EERB 1H15A 1JUFA 2CDFB 4G7VH 4NQCD 4TPRH 1FAIH 3H9ZA 3TN0A 3VH8G 3PQYE 5FYKU 3UBXI 1QA9A 3FQUB 2VDLL 2VXUH 4PGZA 2DQCH 1FZJA 1WLHA 3MGTB 2ZCLH 1A5FL 2YUXA 3MODH 3QXVA 5D93B 4QOKA 3ZKMD 2R0ZL 1KB5L 4GSDH 3WD5H 2FGWH 2AJ3B 3VGBA 3DX9B 1I7RA 5K59E 1T89A 3BIKB 2C1OB 1BQSA 3KPOB 4PTUA 5D7SH 4OGAD 3QQ3B 4KROC 5C0CD 5DD1H 4W70A 5F1OB 5JXED 3SCMB 4KKBC 4IMLA 5JOFB 5F44A 5FECB 4ZTPL 5GQBA 3D85B 4QF1A 2DKMA 5DWUH 5JA9A 3TNNB 2JCCA 4ODUB 3HB3C 4AT6B 5GGRA 3Q1SL 3WN5B 1UB6B 5GIRA 3NAAH 1V05A 3STLB 3UO1L 2ED7A 3LZFL 4P59H 5GS0D 5IB4B 4N1CA 3KPMB 5I66A 1RUMH 3HE6A 4WWKB 1NCBL 1YZZA 5I17B 2R29L 1FIEA 5I1GH 5B8CC 5IFJB 3D69A 2EE9A 3N85H 5K9OA 3LIZL 4M6OL 1ZTXH 4V2CB 3BI9X 4Y4KC 2ZOLB 1EXUB 1FYTB 2DWDB 4PJGA 2DM4A 2JKXA 1C1EH 1WUNT 3I6KA 2B0SL 1UXSB 5SV3A 4JY5L 1JVKA 1INDL 1A22B 3L3DB 3IJSA 4KK9D 5SWSA 3MLZL 2CH8A 4HCRA 4X6BA 4OI8A 4MSWA 3SJVD 4K94C 4WU7B 5AZEH 4F80A 4X6CF 2QQQA 4DGYH 1JHTA 4KH2A 4YO0A 4NQUA 3ARGC 3IXAB 1IFHH 4U6XA 4UI2A 4J3TA 4MDJA 4P2OC 2OZ4H 5DDHA 2IFFH 4ZSOA 5FYLE 5C0FB 3U1SL 4OT1L 3GSQB 3MFFB 4NZTH 2DYPB 1J12A 1F4YL 2GTWB 3SQOL 4M4PA 3HAEG 1KOAA 3CVIH 4POUB 1AJ7L 3U4AA 3FRPG 1UCBH 1IC7L 4R9HA 1MSPA 2BVOB 4OUOA 3SDCD 4UV4L 4LFHD 5E8OB 1EVTC 1J5OH 3O41B 1N0XH 4AM0B 1V5JA 3BDYL 1K8IA 4YXKH 5IESH 4U1NA 2O5XL 1DDHA 3MACL 4QRPD 5L7XL 4DJMA 4AEHH 1UA6H 3C6LB 3WNMA 1BBJB 3LKQA 3TVMA 3C6SA 1NBVH 1NJ9B 3IDXL 1YN7B 1ZA6A 3QNYA 1AE6L 1FVDA 2JF1A 1U3HA 2HLAA 3RTQA 4R0LA 5GSRB 3O8XB 3MA7A 5FGRA 4O00A 4N9GA 4YGAB 5DT1H 3GMRB 2XZCL 1MRDH 4NJ9H 4X5LA 1J18A 2CK0L 4DCQB 3GGWA 3SBWC 3KJ4B 1ITBB 4AQ1B 3QHZL 3B9KD 4FQQA 4CMMA 1A3QA 1RZKL 4PY7A 5HGHB 2FD6L 1GOFA 1X4YA 5EBLA 2WP3O 1GC1L 3KHQA 4KHXH 4TULL 5GZOD 3MLWH 3RZCC 4J3WA 4KI5F 1K4CA 3JVGC 5C6TH 4U1KA 5MP6H 1XAUA 1TTFA 1F8TL 5I75C 4ZAKC 3O3EB 2XWBA 2X4NA 4QHNB 4CADB 5CILH 5CEZD 1TTUA 2BP3A 4Z7QE 1W72B 3P73A 5FUCC 5T33H 3FRPA 1K4DB 1M6OA 3F5WA 1A64A 5I1KH 1NMBH 3W9DB 1E6JH 4UB0H 2E7CA 3CC5B 1VFBB 3G9VA 5T1KB 1IGFH 5MHSD 1U8JA 3F6IA 1KXVC 3BP4A 5EU5B 4I18B 3BVNA 1ZGLB 4OZHB 1JYWA 3DGGB 5EOTA 1KFAL 3GJFK 5BW7C 2VLJA 4J1UB 4FNLL 3WKML 4OLZH 3UPCA 4X9IA 4I48B 4LSPL 2HRLA 5CLTA 4HX1B 4UTAH 2VSDA 2VL5B 4YNYB 4Q97A 2DQEL 1MF2H 1OQOA 3DETD 3I02A 4AZ8A 4MD4A 3MV01 5EN2B 4XPGL 3U48A 3MRIB 4HXAH 1WK0A 5B3JF 3ARFD 3F62A 2AJXL 1NLBH 5I8CB 2CIKA 5KSBB 2P42B 3TO4D 4X6CA 4OIBA 1VPOH 1FO0L 1CR9L 3DSNA 3SKOA 4CNIA 2I9TA 4PJFB 1FNFA 4CMHC 1KYOJ 1N6QL 3OJDA 1INQA 1I85A 4MMXC 3TA3B 1NH6A 2V7NA 5BVPL 2X4QA 3BMWA 3JBG7 2KUTA 4M1GL 3REVB 5DSCA 4PR5B 5IMKA 4J4PC 1G9MC 4Z7VB 2OK0H 5D6CA 2AGJH 1QOKA 3QQ4B 1JPTL 2DQJH 2NNAA 1NEUA 5IB5A 2W9EL 2NY5H 3OXRA 4GAJL 4OZHE 3PWVA 1T4KB 2IANB 4QNPE 1XZ0B 1VENA 5ENWB 5B39G 1I3RB 3VXRD 3HHRB 1T1YA 3ZDXE 4ZO8A 2W60B 3H3BC 1BF2A 2YA1A 2B39A 4IEFB 4GW1A 1F6AB 4KRPD 4LLWB 5DRWA 1R3JA 1HHJB 1IAOB 2BDNL 2A6JA 3QFJB 5HHXL 1LO0L 1JHKH 2X9XA 3ARBA 2H3NA 3U0PB 3MRFB 3HI6H 5DRXB 5JXEC 2EKSA 1AQKL 1NLDL 3B43A 4YE4L 3EJYD 3RU8H 3L3GA 3OGOE 4L29B 1YUHB 4M4RA 5E2TH 3DO7B 5EO0A 3CDCA 2YA2A 4J2XA 2H9GB 3I75B 3G6AB 1XR8A 2OXHA 4PRBB 3NN8B 4PRAA 3RWHA 1AH1A 4AL8L 2QQKL 4NKQB 5GS0C 4Z7VE 5C86A 2DBLL 1YMMD 3FJTA 2NY2C 2ZSWA 3KXFB 4XVSH 4FTVE 3WLBB 2AJYH 3QCTL 4HJGB 2JIXD 3BIBX 2XXMB 4N8VB 5DUBB 1GIGL 2B1AH 1NCTA 4ETQA 2IQAB 5TDOA 5B39A 4U1JB 3LDBC 1N59A 4LP5A 4OM0L 4U2ZA 3CU7A 3ARUA 4KK9C 2RAMA 4PRIB 2OX5A 3G6JB 3QFJE 5TE6L 5D7LD 1FRGH 1A6UH 3EAKA 3VWKC 5I16B 2NW2A 4U1GC 3E0GA 3A6CL 4RFOL 3NCMA 1RZJH 4UQ2B 1GH7A 1IKNA 3T08A 3S3JA 2NY4B 5C09E 3MCLL 1S7SA 2VLRB 5H37G 4MA7H 1I1YA 3NA9L 3S96A 12E8H 1XEDA 3QIWC 4JLRB 3P77A 3FB6A 1UACL 2HJFB 1RIVH 1IQWH 1MCOL 1IC4L 5E99H 1HEZB 3GRWL 1T66D 4JDZA 1RZIB 3JV4A 2VNCA 3R8BB 1A7NH 5FUOL 4MXWH 3QXDA 1WQVT 1JCKA 1KJ2B 4ODWB 2EH8L 1FLRL 2YEZB 4JFXA 5F71A 1E4KC 4O4YL 4HKJA 3QDMD 4XP9H 1LK2A 1X5ZA 3KXFE 4WTXA 5DMYA 2MCPH 4PPTA 1UM4H 1NGPH 1RZ7H 2H2PC 4WFFE 2I27N 2FX9H 5F9AC 3B6SA 2NW3B 4I0PA 5I1EL 2MPAL 2XTJD 3WSQL 4HC1H 1HXYA 3DTXB 1IEBA 1JGEB 2C3VA 2J6EL 5BJTA 1V7NH 1CLZH 5CCKL 5FGSA 4WY7L 1Q9WB 3SQBA 3MRDB 5F9WB 3NCJH 1E4XH 4YBLB 3G6JE 1U36A 2HN7B 4OIAA 4P46D 3IFOB 1ZKAA 3OZ9H 1FP5A 3B9KC 3QCVL 2VLRE 1LHZA 3FFDB 5IROC 4R26L 2DM7A 5C0IA 3CMOL 1RURL 5GZOC 1MCFA 2F54A 4X7TA 4NJAH 3S6CA 4XMPH 4CDGC 5F6IC 3VRIA 3AGVA 4BSJA 3SGDH 5CKAA 2IMMA 1JGUL 1NBYB 4ZFFA 3EOBA 3ARTA 1JPSH 4JFDB 3S34H 3SOBL 1YEIH 1NDMA 4OLVH 1Q9OA 3CLEL 4JB9L 4F7MB 3CUPB 1NC2D 4H8WL 1UKTA 5DQJB 5FCUH 5INCA 4XPBL 4HUVA 5GGTL 5EZJA 5E2UH 3LPFA 4TSAL 4JREC 4NN7B 4HPYL 4ZNCD 1MQKL 1RPQA 1MWAA 3UYRL 1BQUA 2C26A 3LRGA 3PE9A 3UZQA 4JPKL 1YMHB 4KTDH 1BPVA 1VHPA 1SMAA 3CVHH 4CUCA 1MCWM 4KAQH 5E6ZA 5IJVB 1UH3A 4Y2DD 4XHJD 4U4BA 1NFDB 2ZUQC 5C0BA 1MFNA 2P5WA 3GSVA 4Y5YB 1FN4A 5FIEA 4L8SC 3I6GB 2F5AH 5B8CA 2R2BB 1DBAH 1VGEH 3TCLA 3C87A 3FQNB 5EC2B 5IHZA 3H9YA 1UJ3B 5EORL 3WHXB 4JFDE 5TE7L 3LAFA 5FDWB 5BRZB 1CGUA 5C8JA 1YEJL 4Y4KA 4JFPB 4DGVL 5E1AB 1CL7H 4D8PA 3B2VH 1MVUA 3B9EA 1KN4L 3T2OA 5KBNC 2Z8VC 1DQJB 1NFKA 1ZT1A 1QD0A 2DQTH 2EDHA 5ALBL 1U2CA 3DIFA 5C08D 1HN1A 4P2RB 3CSGA 5ALCL 3E6HB 2A1WL 2HMID 4FXGB 4WI5A 1EEUA 1UZ8A 3LRSB 3X14B 1I1FB 1VA9A 4BZYA 5HYSB 3ZE2F 1QLFB 3ARGA 4L9DA 3N9GL 1DJSA 5HI4C 4P2OA 1AQDB 1S9XB 4D0DB 3LQAL 5D70L 2ZOKB 1KJ3H 3QUMB 4B0MM 4QRTB 3SKNA 2C9AA 2P24B 1UB5A 4OD3L 4G6MH 3QUZB 1MJ8H 1NFDE 2AXJA 1KEGL 1T1ZB 4K07A 2YRLA 1G7QA 3VFWA 2ZCHL 4UILL 3ULVF 3PHSA 3LV3A 5F3HB 4G7VL 3HRZA 3N06B 3ROLB 3MV9A 4LQ1A 1KJMB 3TP4A 1YY8A 2VSCA 1QYGL 4L4VA 2P44B 4Z18A 5BRZE 2FNBA 4QEGA 2VXUL 1QNZL 4PD4K 2DQCL 3MGAA 5EIIA 4U1MB 5MI0B 2D03H 2Z35A 7FABH 2Q7NA 1CGTA 1K9TA 3MODL 1TVBB 1DEDA 1V7ML 4JRXA 5M94B 4NO0A 5KJRL 1AIFB 4P5TB 3NFPB 1D9KD 3BJ91 5SX5H 5DFVC 1NSNH 4GSDL 4MNQD 3H9SA 4P2RE 2FGWL 3CFKA 3DSFL 5F1KC 4R3SB 4YXLL 5JXAL 4YHZH 2BMKB 4PRHA 1CQYA 5F9OH 3SBWA 4DKFL 1F00I 2ZUTA 5I74C 4WDIA 1K6QH 1MFCH 1J1XL 4LVEA 3RWCA 5DD1L 2NX5A 3HI1A 2VDOH 2ZPKH 3RZCA 1CFNA 5DC9B 3JVGA 3BKYL 1CDGA 3MREB 3PXHA 4ZAKA 3OTTA 4M8QB 3EYSL 3VGHA 2NY7L 3M8OL 1BZQK 5KTEH 1OCWL 4P9MH 1R0AL 4P3DA 3QUMH 3PGFL 2NMSA 4IIQB 4Y89A 4YBQD 1ZHNB 5DD3H 5ESAB 5C92A 1LP9F 4JG1H 1SYVA 32C2B 3ES6A 3ARYA 4S2SA 2X10A 3BXNA 5BW7A 5H94B 1QRNB 3N85L 5GJSH 3P0VH 3L3KA 1ZTXL 1K8DA 2GJ6D 3VFTB 3P40A 5DMJB 1FDLH 3BWAA 5K9QI 2R8SH 2A6KB 1ZK9A 4E42A 2G75B 1OSZB 5AG8A 2VDKL 3MNZA 3GUTB 3WV0A 3U0WL 1BQLL 3P4NA 3MRRB 4P4KB 3BZ4A 5EU7E 3O4LD 4ALAH 2F58H 4Q9RH 3KPSB 2EECA 3JV6A 4U0QB 4P46C 2EC9T 4M5ZH 3EBAA 1NMAH 3ULUC 1BLNB 3UCRA 1I7ZB 4MB5A 2Y5EA 5IMOA 4NQCA 4NZTL 4P0DA 2C5DC 4J4PA 4C58B 2RJMA 3SKMB 1JF1B 3BEVA 3CVIL 2C4FT 1H5BB 2P8MB 2SEBA 4KDWA 5FYLL 5MENA 3C08L 3L1OH 2AAVA 3QDGD 5DVMA 1F45A 5C2BL 4LDOB 4PV9B 3T0VA 3QUKA 1U8PA 4ZS7L 4P23C 3PABB 4EUPB 3FB7A 1AGCA 1BOGB 1A2YA 2Q7YA 3RGVD 4YXKL 5IESL 4KMTH 5DVNA 3CX5K 2WBJB 4AEHL 3TFKD 4Y1AA 5D7JD 2EXWD 3LMJH 2FL5B 4PYHA 1ZT4A 1RIUL 4BSVB 3KAAA 1FC2D 1S78C 4UOW1 4N90E 1M7DB 5SWZD 3VXTA 2R0KL 3GKWH 2DF3A 2Z31D 3FO0H 3HRPA 3W5MA 5C70A 1IAKB 4NQVB 1XF3B 2ZUVA 5JR1H 5C0CA 1C5BH 1RJLB 1QG3A 5JXEA 4XTRC 1V3LA 3MRLB 4XVTL 4F8QA 1QSED 1N2RB 1RHFA 1YC7A 5DJ6A 4U1SA 3MRGA 2ZSVA 2A77H 1LEKB 2AXFB 1SM3H 2NZIA 2Y36H 1R5IA 4C56E 1FZOB 2QQLH 2BNRB 4CN4A 4Y2DC 4LFHG 3ULSA 2PTVA 3L3OB 4XHJC 2KDGA 5CJ8A 4KJYA 1CGSL 5F1SA 3OKDA 4G8EB 5ISZE 5GRJH 1F5WA 5T33L 1KIPA 4HIEA 4F7TA 2RHEA 5I1KL 1CICB 5IK3A 4XCFH 3PIQB 4JJ5B 1LP9A 5CEYA 2BERA 2X6MA 3BQUB 2FHFA 4KKAD 1EAJA 3U0TB 3WHE0 4YDIL 1N7ML 4BK5A 3O6FB 4PJAB 4XCEA 3HA0A 1XFPA 3VWKA 3PWNA 4KHTH 2WLYA 5IVZA 2VTFA 1DN0B 4K3HA 4J3VA 2DQIL 3K2MC 1JFQH 1FCGA 2AQ2A 4HXAL 2QQNL 5DHYB 1LO5A 1GGYA 3BGMB 4X4XA 4BFGA 3K46A 3QA3B 5E8EA 3QIWA 4QWWD 3OJVC 1MVFA 1X4XA 2B5IB 1B4JH 1OGAD 4JPIA 3O6LH 3EDFA 1VPOL 25C8H 2W92A 1OARH 3BPNB 3V5DA 1T1XA 2WIMA 2NPLX 1OAZH 1Y0LA 2BVPA 5AAWA 1G7JA 1X5IA 5DVOA 3BPOC 2GIYA 4Q2ZB 3BZEA 4NZRH 4M7ZC 2HJKA 2RR3A 2XWTB 2V2WB 4U1HB 3DV6A 5T1DH 4EBQH 3L3HA 4X6EB 4S1QL 3SE4C 2OK0L 1M1SA 1DQQA 1P7QB 1KCKA 4XPHL 2VLKD 4U6VL 1A1MB 5DRNB 3K80A 2PYEE 3S98A 4LU5L 2Q3ZA 2GITB 2IG2H 2WINA 5I73C 2BRRH 2K9UA 3VU2A 5KAQG 3K4AA 3Q5YA 5CP3A 4PJAE 1JRHH 3S88H 4FP8H 2YR3A 1IGJA 3F7YA 5KSAC 2E7LC 4RWYH 4GLRH 4ZQKA 2CRYA 4H20H 1QFWI 3MX0A 2MQCA 5IROA 1G7PA 4PJCB 4OCMC 1JHKL 1MFDL 2Z93A 3V95A 2X4UA 3HI6L 3MC0A 4XBGB 2DIBA 3S37X 4IRJD 5DYOA 4NDMA 4BH8B 4XMKL 1GC1C 2ZNWA 1LEGA 3G04A 5E2TL 4W4OC 4G8GE 4O2CB 3HZKB 5F89A 1LNUB 2VLME 1WIOA 4OCSL 5GXBB 1ROWA 4Q7DA 1NDGB 1TZIA 5F8RC 3RX8A 3SKJL 4U7MA 4YBQC 1EEQA 2F53E 4UT7L 5DD5L 3WLWC 2NY1B 2BHUA 3IDIB 3VXMA 1FFNB 3O81A 4MB4A 4XVSL 1WC7A 3EOAA 2ADIB 4H1LB 4OCXL 5DQDH 3REWA 2FIKB 5D96C 2VUOA 3G5ZA 3HE7D 3KR3H 1ZLVH 1DBJH 1EHLH 1KCUL 4ODXA 4LSDA 1VFMA 1IKFH 2DTMH 1JYVA 1U8KA 3B8YA 8CGTA 5ADOL 5F72S 1ZEAH 3R0MA 1HINL 3HS0A 5T5FH 5IOPA 5FYKE 4MCYA 4PTTB 4WHYH 3SDXB 4Y4HD 4M1CC 5D9SB 1BP3B 3NZ8A 3WEXB 1OD9A 4Z77B 4L8SA 3OGCA 3W39A 4I0KA 1WV7T 5E8NB 1VDGA 3OB0H 5FYKH 5INDA 5BS0E 5EU6E 12E8L 4J3UA 4YHOH 1NEZB 4NN5B 1N64H 3MOBL 2YSSB 4ZUUA 2UZIL 3NIDE 4LARH 4MAYC 3T09A 4CW1A 4WI3A 1NMCC 5IIEB 1IQWL 5E99L 5I9QB 3KPNA 4A2LA 5CSZA 5E2WH 5JHDB 4X0KB 1A7NL 5DQ9A 4GMSH 2IWGA 1IGYA 1T5WA 2IH3B 3S37L 3ZDZE 2R2HB 3J8F7 4XP9L 4WUUB 3DRQA 2MCPL 2D31B 5J6HA 3QB7C 1NGPL 4UT6L 3TFKC 5HHME 1H8OA 2FX9L 1YEHH 4F7EB 2EIEA 3VH8B 2GHWB 2FB4L 3OXSB 2K7QA 4LLVB 5HJ3A 3ULUF 4LPUA 4HZAA 1CLZL 4I5BB 3QJHB 3G5YA 2J8OA 1E4XL 4OLYL 4QOKE 3G9AB 1FNLA 3SDXE 1KPUA 4F2MA 4NKIH 4MNGA 3TT3L 5J6GA 2QR0A 3WXVH 2P5EA 2ADJA 3EYUH 5FHAH 4CU7A 4FQ1L 4FXKA 2GK0B 3WJLC 1HI6B 3UJIH 3D18B 3S36X 3GSRB 3RNQB 5CMAA 4XMPL 3QWQB 3RJQB 1UADC 2HFEB 2BY3A 3BPLC 1PSKL 5JHDE 3S34L 4GAYB 5EA0H 1YMMA 3QHTC 2JCCE 2AK4B 4YEEA 4OLVL 5CJQH 4LRNH 3TJEH 2GJJA 1KULA 4D2NA 3H6JA 4NO3B 4OV5B 4WW2F 3DNKA 4FFYL 1I1AC 4GXUM 4BYHA 1KJ2L 1MCBA 3OMZA 3VXOB 5E2UL 4Z6AT 3HTLX 1CD9B 4ZPVA 2FEEI 3RIAF 5AYUH 2APFA 2HVJA 3IS1X 3BO8A 3KPLB 5ITFB 4LCUB 5F7NC 2E7MA 1KC5H 4C59B 2YS4A 1L6XA 3TV3H 2VAAB 3ZLQC 1CQKA 5EZIL 4NM8H 3P4MA 1BJMA 2OTUB 3QHFL 3TPUA 4PJGE 3KYNB 3KS0J 5IM7B 1S9YA 1YEDB 1KLFA 5I8EA 3GKZA 2GFBA 2VZ1A 1HXMB 4XBEL 4LCWD 4NC0B 1KCSH 2UVEA 4IRSD 1G6VK 1OSPL 3H3KA 4NO5A 2E3VA 4YHMH 1VGEL 1GJIA 4HCRH 4FQQB 4CMMB 3OKKB 5CD3B 1BX2A 1NFIB 1CFQB 1NAMB 4PY7B 1BFOB 3L7FB 1RZFL 4H25A 3EOYG 4LNRB 4U1IA 1MELA 2AK4E 4ZSOE 3O9WC 4QHMA 4HDIB 3GO1L 4NBXB 5JPNA 5IMLA 1KENH 5IBLD 2EEDA 4PREB 1ORQB 1HHIA 3AUVA 4IOIA 3MRNB 1KELH 2XN9B 1KIRA 3HAEB 3MLSH 3VXSB 1DFBL 4LVHC 1VADA 2KKQA 1M6OB 3BJLA 1YYLH 5CBAA 5ICYA 3H0TA 1KV3A 5ESVB 1BD2D 3QDJD 3ZHDA 1FBIL 5EOCL 3VFSB 4JY4A 5C0AB 3PWUA 3PJSA 4P46A 4K3EL 3QIUB 5IWLC 1GCFA 1NGQH 2JELL 3QP3A 4G9FA 5FO9A 2DBJA 3QEQD 3WDHA 4OZGF 3EOTH 4PJEF 4M48L 1KJ3L 3U46B 1BBDH 2KH2B 2QBWA 1MJ8L 3EO0A 1U8MA 1XCTB 4LSQL 4J23A 1VFAA 5E9DB 1DLHB 4P23A 4MJIA 2DQFA 2H26B 3SKUD 2CDEB 1NCAL 5ICZB 1T1WA 4GUPB 2E7HA 5GS2D 3FQWA 4R2GD 4NRZA 2JE8A 3CZFB 3BHBA 4JN1H 4WWKD 2A74A 1KB5A 3C09C 1UM6H 2PYFA 3AU1A 1Y6NR 3ARDB 3Q2CA 4R97B 1VKXA 4HUWA 1ZHLA 4PJDB 2RGSA 2XN9E 1OHQA 1UYWH 4R4FH 4L5FL 5LVEA 3VXSE 2HVKB 3GSUA 2R1XB 5BO1H 1LDPH 1FYTD 5I19H 4DUWA 3GSWB 4HF5H 4D9LH 3HE7C 3GB7A 1WT5C 1K6QL 3EYFB 3VGFA 4RFEB 4XP4L 1HKLH 4EOWH 2VDOL 3B83A 2ZPKL 1WFTA 3B4NA 4Y2DA 4WFHE 1AGBA 5I1LB 5IQ7H 4OD2B 2R1YA 4QRUA 3L5WA 5FAAA 5EZOL 2E27H 1S7QB 4NQSA 3T3MF 3FTGA 4WO4D 4EEEA 1GXEA 3QUML 5B3NA 1NCNA 5E9DE 4FHBD 4XCNA 1CE6B 2O26U 1MCPH 5C0DB 4LF3B 3NBNA 1UXWB 2R0LH 1R5VA 4L3EB 3NFSH 4BKLA 4QYOA 1E0OB 1S9VA 3U36A 4YHNA 1X7QB 3GJFB 1WBYA 4NM4L 3DXAB 3FMGL 3KYOA 5ILTH 4MHHI 2UYLB 1K5NA 3TBYB 1OP9A 3O2DH 2ZJSH 5DS8A 1DUYA 1MHCA 2F8VA 3WYRA 3NTCH 2X9YA 3HLAB 3PHQB 2VIRB 4LP4A 2EDRA 1AC6A 5J57B 3W0WA 4QXGH 4QT5B 1WZ1H 3E1F1 1A3RH 3F58H 3MRCA 3TYFA 3AC0A 4LLQB 4W6YB 5JUEL 3NFNB 5IVNA 3O8XD 3QCUL 4GKNA 1IGCL 4ALAL 1H3XA 4NNPL 3CD4A 3QJFA 4XC3L 4JM4L 5BOPA 3LKSB 3L5XH 5D2LB 1VGKA 4E9LA 3IETA 3EFDL 4ETQB 4OZFG 2W65A 1NMAL 3KLHC 4OUUA 4UIKH 3WS3B 4OZGA 4XC1H 1NUDA 1OAUL 5ID1A 2OLDA 3SE4A 5F7YC 4MJ5B 5KSVB 3MV8A 4UOJA 1F11B 1S7RB 3EGSB 4L3EE 1F02I 4Z7WF 4X9HA 4HAGA 4LASL 5E24E 3I6LD 5DZLA 3T77B 2FCBA 1D6VH 1JGLH 2EXYD 3ZTJG 5L0QB 4WFEE 3DXAE 2MNUA 4MNQA 4QTIL 5T1KD 1G9NH 2FJHB 4QXUH 4JPVH 5KSAA 2E7LA 2UUDH 5EULV 2VRAA 3T04D 3FZUD 1N3NB 5CEXB 2EIBA 1PGRB 1TQBB 4XNXL 4C4KT 5JR1L 3HG1B 4JFXB 4PJ5B 1HSAA 4OBRA 3CFEB 1SY6A 1SJEA 3RY6C 5LGHH 2AERT 3T0EB 1UT9A 3ZE0E 5D2LE 4W4OA 3QI9C 3GMLA 4OFKA 1A6TA 2Y36L 3RHWF 2QQLL 4QXWA 3UTPD 3HR5B 3ZYIA 3AY4C 1QFWM 3GHEH 3AREC 2NTFA 4L4JA 1MUJA 2FH8A 2NY0C 4N0FA 4M93C 4EXKA 3MRMA 2NXZB 2VKWA 2YD2A 2ICWI 5IP4A 5GGVH 1OM3L 5IVXF 3VI4F 2CUMA 4IRSC 1UWEH 3TZVD 4XCCH 4U05A 4DFIA 35C8H 4LEOB 5C0ND 5HY9A 2OJEA 1QLRA 5ADPH 4OFYD 4XCFL 1CG9B 2XT1B 3WCYA 3BP5A 4LCYA 2Q76A 1IMHC 2IALB 4C83B 3GDBA 4Q0XL 4Q58C 1X5JA 1TJHH 3EZJB 4WI8A 4PLJD 4NP4L 1YPZB 2H2SD 2OR9L 3IJYB 3MGOB 4ZFFB 1W0YT 1G7IA 1X6NA 4JPWL 4XP1H 3SGEH 3HG1E 1L6ZA 4PJ5E 3GIZH 5HGAB 1QLEL 3BZDA 3OKLB 4OZIB 3DX8B 4WW1B 5I1CL 1YEEH 4HMDA 1HHKB 4ETYA 2DQUH 3QXWA 3VG0L 2H32A 1CWVA 1FO0A 1FGVH 4XAKD 3TYGH 4HLZH 4HUXA 3AVEA 3KDMA 3TBTB 1QKZH 4AG4L 4OAWA 4MAYA 1BHGA 2RQ8A 2JLLA 3SCMC 1OARL 5B38A 5DEGA 1LE9B 4JM2B 3PGDB 1OAZL 3MRPA 2R0WL 1T5XA 1CFVL 2P47B 1I8MA 3LKRA 2MWCA 1X5LA 4JFFB 1MREL 4RFNB 5ACZB 4PJBB 2EYSB 4JGMA 4ZUWA 1AHWB 5EU3B 4Z7WA 5SX4I 3TBSB 2PTTB 4AMKH 5MERA 2F54E 4WWKC 3SDDB 4QLRA 3ZTNH 3HMXL 1IC1A 5ITBL 5SWZA 4HD9A 1BIHA 5FV2A 4KQ3H 1YPZE 3P11L 1IARB 1LO3H 4JZOB 4KXZI 1A3LH 1Q0XL 1XH3A 2V5TA 5H37H 4PJHB 5CGYC 4JO4H 4M7JL 1RFDH 4TVPE 2BC4B 1E4JA 3TIDA 5D5MF 4D8PB 1PX4A 4RWYL 1JF5A 3LSOB 4GG6B 5A2JH 4H20L 4OCWH 3UTTD 4GS7B 4JVUA 4GW4B 3MXVH 4TVPH 2PW1A 5J13B 2XQBL 3GMQA 5BXFA 1U3YA 4PRID 3WJLA 1RUPH 1JZ8A 4KQ4H 3RL2A 4G80A 2YUVA 4L1HA 2VXQH 5DMKA 2BFVH 5HDLA 4QRRD 1U95B 4NC1C 3VD7A 4E5XA 1NC4B 3C8KA 4IMKC 1NBZB 1X5XA 4P2YA 1MWAH 4WHTB 2NLJB 4Z78B 4PJBE 1II4E 5IVXA 3WUWA 1UB5B 1I1AA 4L8BA 1N0LA 2YK1L 4FQJH 1OWWA 4I13B 4LPCA 4NUJA 2P5WE 1QFUH 5EUOF 2GTZB 1WAAF 1EPFA 5JIHA 5SV4A 3MOQA 2YOCA 2R23B 3MV9B 1WBZB 5GGRY 4QHLB 2OJZL 4JR9L 5LCVH 5KS9F 1YQ2A 2W0FB 4PGCB 4PJHE 4JAMB 2V2TA 5IQ9A 1MAMH 2Y5TB 3WIIL 1DBJL 3C6LC 5AEAA 5L9DL 1IKFL 4LBEB 1J0IA 1XGTA 5FA4A 3G5VB 4GRLD 3W5NA 5EO1A 1MLBA 1N6VA 4ZTOH 5IHUH 3T0BA 5HHQA 2DAVA 1TPXB 2GCYA 3O8XC 2OTPA 5F93C 3LD8B 3VMOA 3P2TA 2VXTH 1EFXA 1P69B 4F8TA 2QKIB 2BNUB 3TGXA 2X5PA 2CLVB 4JHAH 5FYKL 3KJ4C 1WZKA 1HCFX 5CJXC 1DUZB 1U93A 3GRWA 1N64L 1IILE 4K94H 1JTOA 2NX5B 5F9JB 3O9WA 1TZGL 4K71B 4JFOB 1MI5B 4I3RH 4YEFA 1A1NB 2KQNA 3V6ZA 4N0RA 3K81A 3IDJA 2VLKA 4QRSB 4ZUTB 5JA8B 4IDJH 1C12B 5FA3B 3FT2B 1S7WB 5ICXA 5IT2L 3VE0B 1M05B 2HH0L 4NKDB 2OP4H 1T7YA 4X7SH 3ZYJA 3MV9E 3D6GA 1M7XA 1T3FB 3AXLA 3T65B 2DJ4A 2J6EA 4Z7NE 3OSKA 3UTZB 5AUMA 3V6OC 3PP4H 1S5IH 4I18C 1JGVH 5TH2B 5IWLA 4Y2OA 1KSRA 1UEYA 5D4QA 3FZUC 2V5YA 2P43B 2HJLA 5DJDB 4DUVA 2JK5B 5D5MA 5CJ5A 2EDNA 3H9SE 4R4NC 4JANA 5I0ZA 4WJ5B 1VACA 5FKPA 3EYUL 1E28B 1H8NA 4M62L 2D7TL 5CWSB 1ZHKA 4KKCD 2BSTA 4XBPB 5HI5D 2C1PB 3T1FB 4RMTA 1WWWX 3KPRD 3S9DB 2NX5E 2VDPH 3IVKA 1VSCA 4RQQB 3HC0B 1NGXB 2Y07L 4V1DB 1URLA 4PJ8B 4K3JH 3CSYB 1TJGL 1DANT 4MD0B 1T0MA 2ZG2A 3TA3C 3OWEA 3IRPX 3TZVC 4LSSH 1B0GB 5CJQL 4PLKC 5FUCE 3QNXA 5GGTA 3V0AC 2APTA 4PBWD 1CD1B 2YUWA 5EUKA 3BEVB 4G9DA 1MJ7L 2ZP0T 5K59F 4WUKH 5BZDA 2CKNA 2HT3C 4WV1B 1JHLL 3HE7A 1HDMB 4FFWC 1X5GA 5EUOA 2X9WA 1WT5A 5ANMA 5DJ2B 3C60D 1WAAA 3ZE1E 2E6PA 3TBVA 4PLJC 2H2SC 1A6VL 4M9OA 1KC5L 5IW6B 5MEQA 1Z5LB 4R7NB 2GJZA 5C0JB 2VE6B 4HS6B 5T3ZE 3PV6B 2BNQD 2PTUA 1EEZB 1CTOA 3VXQB 3SPVB 3VXTB 2IQ9H 4BJLA 2HKHH 1FGNL 1J8HB 3V4VL 1ZWIA 3OR7B 2MCG1 4WGVB 1KCSL 3KNBA 3LKPA 3VW3L 4NSKA 4EQ2A 1C5DB 4QHKI 1CLOH 1U8HA 1IT9L 3U4EA 5T3XH 4V1DE 1GOGA 1U8NB 4D0BA 5LJYH 4XH2B 2P1YA 3ZKNC 1XGUB 5CP7B 4RMVA 4NQCE 2MTPA 2CD0A 4BSWB 2OCFD 1VEMA 2R9HD 4MXVE 4I4WB 1KCVH 1KELL 4HK0B 5FO7A 4X6DB 4P5TD 1G9MH 1OP3K 3OPZH 5HHVL 4OQTL 3M17A 2OQJB 3BKCH 4ZUVA 5EBMA 2XWJB 5HHOD 4RGND 4YDJB 3HZMB 3U9UA 4ERSH 2FYYB 3Q5OA 5D72L 1HH6B 2I5YH 4OIIL 4QXTA 2AJSL 1PKQB 3K2UH 1YQVH 4NHCL 4NRYB 3VD5A 4FFZH 4NHUA 4Z95L 3GMNB 3HCVB 4UINH 4QRQA 4LKXB 4RA3A 4G6KH 3P9MA 1E27B 4N0YH 1R3IL 5C0CE 1LQSR 2W07A 5D2NB 3P4OA 1DQML 1WFUA 2H1PH 3OR6B 3SJVB 2DDQH 3VCLA 2NY4C 3MUGA 3BE1H 1HZHH 5CUSH 3LKNB 3JTSB 3MRKA 5AD0B 4G3YH 4BQCA 4HK3J 1P7HL 1PKOA 2UZXB 3RWIB 3Q6FB 1JNHB 1EV2E 3O6MH 1J0HA 1KCRH 2YPKB 5MEPA 1UM6L 1NAML 5JOEA 2HRPH 2ID5A 4X98B 5GRZA 2NQCA 1QRND 2EE2A 2VC2L 3SDCB 2ESVB 3SY0B 1UYWL 4R4FL 3BZEB 4X6DE 2R69H 1P2CB 4X7CC 4YDKH 5GS0H 5HVHC 1OB1A 2Q8BH 5BO1L 2HTKD 3MRJB 3RY6A 4QRPB 4TNWK 5DUMH 4RX4D 4Q9CA 3STBA 4D9LL 1HILB 4LLUB 4PGBB 1VEPA 5TDNA 4HIHA 3GBNL 3X11A 3I85A 1AKJD 3QI9A 4QY8B 4DVRL 1I8IB 5I1DA 3PWLB 4NNXB 3AY4A 4MNHA 3AREA 2BOCB 1QR1B 1IM3A 5IQ7L 3O6KL 3KPSD 4TUOA 5EU4A 4HS3A 5F7EH 5F9WC 5C0EA 2W0KA 2AP2A 5M7QA 4K3DH 4LCWA 3VD3A 5IMMB 5D2NE 1Q38A 4IRSA 1UFUA 4JY6B 3SJVE 5JIIA 5KANG 5KN5A 1F4XH 3JXAA 3CXDL 5EPMA 1U92A 2P48B 5GGVY 3B9KB 1H0DB 4Z7QF 3TH3T 2CDFA 1AXTL 5FK9B 1MFEL 2R0LL 4D9RD 2APBA 2OMBA 4XZUB 2J88H 4Z8FH 3O0RH 3FQUA 3NABL 4JKLA 3MJ9L 5HI3C 2VDRL 4AH2B 3MGTA 4CDHA 2W9DH 2BSRB 5HGGS 3O2DL 3FONB 2ZJSL 3HFMH 4XPFL 1MCSA 3NTCL 2AJ3A 3VXPB 3DX9A 1FG9C 3BIKA 2YN5A 4QRPE 4TN9A 1A3RL 3F58L 2C1OA 3VFGH 4AYFA 3IFNL 1CDJA 3AMLA 3QUXD 4YPGB 2AEQL 3KPOA 4HG4J 1WICA 3QQ3A 5DD6B 4FA8A 4EI6B 3NACH 2QHRL 3SCMA 1BREA 5JOFA 1CE1H 4Q9QH 4Z7UB 1D5XB 5I76B 3L5XL 5FECA 5D7KD 1Z0NA 3D85A 1D3CA 1CZ8H 2VXVH 1U91A 3TNNA 2J5LB 3FAWA 4ODUA 5F7UA 4AT6A 5TPWH 4HV8B 2GAZB 1M7IB 4CVXB 1UB6A 5GPRA 3STLA 2BNRD 3ARFB 2Q3AA 3OF6D 3TJHC 5IB4A 5D1ZD 3KPMA 3TO4B 4YAQB 4WWKA 4Y5YC 4A6YB 1U3ZA 4ZS6C 5I17A 3H42H 3NZHH 4OZHF 5IFJA 4QNPF 4NBZB 3R06B 1UJ3C 1WWAX 1GPOL 5LXGL 1CICD 4K8RD 3S3SA 5CEZE 3ZDXF 3LQMA 2ZOLA 1EXUA 3ZSSA 4BELD 1FYTA 2DWDA 1U8LB 3RI5F 1KEMH 3QH3B 2M1KA 1G7LB 1UXSA 1JYNA 3L3DA 3KYKL 2XG4A 4ODVL 4JQXA 2AEPL 4KTYA 2DI9A 5FF6B 5LGHL 2XG5A 4WU7A 3VXRB 5J6HB 5KVEL 2PF6A 3KJ6H 4PRPB 4Z7UE 1RMFL 4IMKA 4GG8B 3IXAA 4PJFF 4KRPB 3VGEA 1L0QA 1FFOB 5C0FA 2XA8L 3UZVB 3GSQA 1Z3GH 4M1DL 3MFFA 4TRPH 2DYPA 2GTWA 4U1LB 2Y06H 3RZWA 3VGAB 4Z7VF 4YHYB 3QUZC 1GZQB 2BVEA 2BVOA 2MQ0A 3TCXA 5E8OA 3EUUA 3O41A 4JJHA 4TSBH 1F4HA 2ADJB 2ED8A 3ARWA 3WFEH 5GJTL 4AM0A 3N1PC 3VFRB 5DJXB 1YDPB 4KTEL 4X4YB 1TCMA 1WCBB 4XNMB 4NQTA 4NN6B 4P9HC 5CMAB 1MHEB 3BN9C 3C6LA 3QO1B 1ZLUK 3B5HA 5MI0C 5F70A 2R9HC 1NJ9A 1YN7A 5D71H 4V2BA 3EYQC 4LDEB 1DR9A 1GAFH 5GSRA 5KOVC 3UTOA 2A6DA 4P5TC 3O8XA 1ZLWH 1HHHB 2CKBB 5LWYL 3QZWB 1YEEL 3GMRA 2JIXB 2DQUL 4DCQA 3VXRE 1IGMH 1DANU 5BV7B 5IFAH 5CJXA 3TYGL 4AEIL 5HGHA 2EE6A 3UROR 4I8DA 3IKCB 2PW2B 3V0WH 2VOTA 1DQDH 5C0RH 3CK0L 4CL7A 5D7LB 5T5NF 1Q0YH 4P2CG 1T83C 3QPQD 3O3EA 1FFPB 5JQ6L 1T7XA 3TT1L 1F2QA 5LGJB 4OZ4B 5I1HH 4MNGE 4CADA 4OLUL 5CZXD 2X70B 4MQTB 1W72A 1EK3A 5C07D 1K4DA 2P5EE 3MSPA 4IIQC 3W9DA 2MHAB 2GFBB 3CC5A 3K8LA 5T1KA 2P46B 4KZEH 3V6OA 5EU5A 4I18A 1P9MC 1ZGLA 4OZHA 1B9ZA 3DGGA 3PDOB 4J1UA 1Z9MA 1LO3L 3MRHB 4DN3H 4H25B 3IDUA 4RDQF 1YMME 4I48A 3O3DB 3IDYC 1U6AH 3QDMB 4WHCA 5I8OH 3G6JF 1DTUA 1X6LA 2VH5H 2VLLB 4HX1A 5A1AA 2HTKC 5DR5L 5K9JL 2VL5A 3EJZC 5A2FA 4YNYA 4J8RB 3NIFE 5E08H 1YEGH 1E6OL 5EN2A 3IDNB 4JQIL 3TO2B 3S4SG 3HC4L 3MRIA 2XTJB 3IF1B 4POZD 5E4IA 5I6XB 2NXYD 1JPFB 4LSRH 3BAEL 1QEWB 4P4KC 4KQ4L 5I8CA 1ZSDB 1TVHB 4L1DA 4ISVB 5KSBA 3D0VA 5TFSH 2BFVL 5D7LE 4PJFA 2E8ZA 1MY7A 1FHGA 4R7DB 3TA3A 2L0DA 2VQUA 4NWTH 3REVA 4YR6B 4PR5A 1K3IA 1N5YL 1MCWW 3DX6B 1EUTA 3EYVB 4Z7VA 3DUHA 1H5BC 1QPXA 3QQ4A 5HPMB 1DCLA 1FL3B 2V5RA 3F6LA 4MQ7B 3BOVA 2PXYB 4RRPG 1T4KA 4N8VG 2IANA 4YUEL 1XZ0A 3ILQC 5LCVL 1B4RA 5ENWA 4S1RH 1I3RA 4DAGH 2WBJC 4NZUL 1J1PH 1D6EA 1MAML 1JGDB 3QDME 1IAIM 4RCAA 1NC2B 2W60A 4HULB 1NAKH 4H88H 1DBBH 3AU1B 2AEIT 1F6AA 1I3UA 4LLWA 5IHUL 4GBXD 3QUXC 2ITDB 2OTWB 1HHJA 1MCRA 1IAOA 5DHVB 3QUYB 2QSCH 2XTJE 3QFJA 4PJ7B 1HQRB 2F74B 3MRFA 4OF3A 5DRXA 1WTGT 1BM3H 4JGUA 1ED3B 4JHAL 5IBTH 3VWJD 4L29A 1YUHA 2MKWA 1T0PB 2H9GA 2FBJL 4MS8C 3I75A 3G6AA 4RNRB 4PRBA 4XXCC 2O5ZL 3NN8A 1MQ8A 1OAXH 4IDLA 2IEPA 4XP6L 3T0DA 3V52H 4KZDH 5D1ZC 4JRYB 3T3PE 3ULUH 1FVCB 2MOVA 3D2UB 1NGYB 1RIHH 4O58L 4XMLH 2CJUL 2OP4L 3DARA 3KXFA 3HUJB 5DK0B 3WLBA 4HQQL 2C3WA 1CICC 4HJGA 4N8VA 5DUBA 4K3GA 2Y7QB 1OAYL 1F90H 4KUCF 2IQAA 5GHWL 1OAQL 2X4TB 4U1JA 3BQUC 1A5FH 3BRDA 5EO9B 4JEGB 3O6FC 1CLYL 5DTFB 1CDBA 5C08B 3BRGC 4PRIA 3R1GH 3G6JA 2D0FA 1RHHB 2JJWA 3W11D 2R0ZH 3MROB 5KVGL 1KB5H 1MIEH 5I16A 3QIBB 1BJ8A 5JZ7D 3QG7H 5DEFB 1NFDF 4UQ2A 4AJ0A 1B6DA 4CJ1A 5CJBA 4XWOD 4Y0GA 5IEKB 3FOLB 4UDUB 2VLRA 4O51B 4OF5A 1HWHB 3SE8L 5HDOA 3RGHA 1A6ZA 2W0PA 4JLRA 2B5IC 3JWDC 4HS8L 3JZ7A 1OD7A 2HJFA 3T2PA 3BPNC 4ONFL 1H3WM 1HEZA 4ZTPH 2C7UA 4K3JL 1RZIA 2YD1A 4XGZB 1X3DA 3MJ8B 5TQ0L 2C3GA 1KJ2A 5CIPB 4ODWA 1Z9LA 2YEZA 3NH7H 2ICCA 4Y5VB 1JWUB 4URTB 2IBZY 4OKVB 3TLRA 3UO1H 3LZFH 3HUJE 3DYOA 4ZXBD 3NVQA 4IRZL 5IHBA 2EC8A 2NW3A 3UAJD 1NCBH 2JTDA 1PQZB 2R29H 3DTXA 1JGEA 5IFHL 5F1NB 1U8OB 2ARJQ 1KN2H 3QXTA 3LIZH 4F37F 1D9KB 4M6OH 1Q9WA 3MRDA 3T0WA 5C08E 3QPXH 3DVIA 2HN7A 5A3ID 3OKOB 5C0AD 4OLXL 4Z5RB 2EH7L 3AM8C 3IFOA 5HD8C 3F7VB 3C2AL 5T3ZL 3OAYK 5HVWA 2B0SH 4JY5H 3FFDA 1INDH 4ZUSB 1DSFL 5DO2C 3MLZH 1HSAB 2ADGB 1E4XI 1GGIL 2ATPB 1IEAB 2A38A 4F7PB 1CLOL 3RVUD 1Y18B 1HWGB 3MLRH 4NPYB 2OR8A 3JWOH 1NBYA 2ADFL 4JFDA 5EWIH 1NCUA 3CH1A 5L2KD 3A67L 3U1SH 4OT1H 1TQCB 4HJ0D 4OZFB 4F7MA 3CUPA 3S5LB 1F4YH 3SQOH 5J3HD 1XGRB 1UZ6E 4FFVD 4FQHB 2DKSA 1AJ7H 3SGDI 4LGSB 1IC7H 2NY1C 2A6IB 4UV4H 4TVSa 1B88A 3UTQB 4U6HB 3BDYH 1ZVSB 2GJ6B 5D7IB 1CK0L 2O5XH 1G7MB 3IT8D 3ILPB 4MNQE 1YMHA 1T2QL 1XGPB 2AXGB 1YQVL 1DQTA 4WENB 1I9IL 1JP5A 3P30L 3WFDL 3BGFB 3DWTA 3IDXH 4HUNB 4GH7B 1FVEB 4YFDB 1CXHA 1AE6H 4UINL 5IJVA 4POZC 4G6KL 2E9BA 3GI9H 4NC2B 5IB2B 4NQED 1NFDA 3O4LB 4DKDC 2DDQL 4Y5YA 2XZCH 2CK0H 3I6GA 1ZHBB 5FFLA 3A6OA 4H26B 1KJVB 4PGDB 4L3CB 1CLCA 3QHZH 2R2BA 3BE1L 1HZHL 2CMRL 3FQNA 5EC2A 3BSZL 1UJ3A 3WHXA 5FB8B 2LU7A 3KDMB 4NN5C 3ZSTA 5FDWA 5BRZA 1SY6H 2OSLB 1ITCA 1GC1H 5JNYB 3HNTH 3S3PA 4C54A 4TULH 4JFPA 5E1AA 3MR9B 2BY1A 1RD6A 4MJ6B 5I9QC 1H3PH 3QDGB 4K7PX 1DQJA 1EMTH 2OXGA 3K1DA 5E95B 4S0TD 3SGJC 3LN9A 5GS0L 4P2RA 4D3CL 3E6HA 2Q8BL 4LPXA 3RGVB 4FXGA 1EJOL 3LRSA 3X14A 5JHLL 2GJ6E 4KRMB 3ESVF 1I1FA 2GEEA 5D7IE 3V4PL 1AP2B 5D7JB 5HYSA 4I2XA 2EO1A 2D2OA 1QLFA 1G1YA 3LPGA 3SGKC 5DUPH 2G2RB 4X8JB 5I1JL 1AQDA 4PUBL 1S9XA 4D0DA 5DD0H 4FNLH 3WKMH 2QTEA 2Z31B 2ZOKA 3MV7D 2FDBP 2BK8A 3QUMA 1WEJH 4QRTA 2P24A 2Z4QB 4LSPH 3IS0X 3QUZA 1CT8B 3O4LE 1T1ZA 1S7VB 4CBPA 1QSEB 2DQEH 2VDQL 3ZDYE 5DEZA 5F3HA 3C5SB 4KJPC 4XPGH 4ZOAA 6CGTA 2C3HA 3ROLA 1KJMA 3ME0A 4HH9B 3O0RL 4RBPH 2ZKHL 4NZDA 4PB9L 4U1MA 4WCYH 2H32H 3ZMRA 1FO0H 1CR9H 1NL0L 1JE6A 3BT2L 4CN6A 3DBXB 4TTDD 2ILLA 5BMFL 3D9AH 1TVBA 3QDGE 3MLUH 3VI3E 1J0KA 1N6QH 1AIFA 4P5TA 3NFPA 4EDXB 1AO7D 5BVPH 5AAMA 2BXYA 4R3SA 3MLYL 4M1GH 2EDYA 2BMKA 2EKJA 5LAXB 1DVFB 1JPTH 2J3SA 1GGBL 2W9EH 3HZVB 4GAJH 4M7LT 1FSKB 4MWFA 3BISA 3DHMA 5SWZE 3MLVL 3NCEB 4UT9L 2D4FA 4K7PL 3B9VA 3AS3A 4LGRB 1G0XA 5DC0A 3T0ED 3MREA 1T83A 1T04B 1CZ8L 4GAGL 4M8QA 2DD8L 1OVZA 4RAUB 1JL8A 2ZUUA 5D1XD 5FA4B 1QSEE 1OTUD 3EO1B 4XWOC 4GKZB 5HHQB 2HWZH 4IIQA 1QUNA 1ZHNA 5HHXH 5HYQA 1OGAB 4JKMA 5ESAA 5K93A 1AQKH 1FORH 1NLDH 3RHWK 4YE4H 4U7SA 1P9MA 32C2A 3H42L 3IB4A 1QVOB 3NZHL 2GY7B 3G6DL 5H94A 1QRNA 3FAXA 2XTLA 1RSFA 1X5YA 3AS0A 2G9HB 1W0VB 2HT4D 3MJ6A 3VFTA 1KF9B 4PJAF 4MA3B 4OTXH 3N1FC 4MQXC 2A6KA 2QQKH 4NKMB 4AL8H 1HHGB 1YY9C 2G75A 1OSZA 5CEZL 1WZMA 5HDQL 2OMNA 4TNVK 1ZANL 2DBLH 3GUTA 5HPOA 4PJ9D 4LVHB 3MRRA 3FT4B 3DGCR 4P4KA 1WIUA 1SMOA 2ZNXA 3BKML 3RPIB 3KPSA 3QCTH 3KJ6L 1S7XB 2YKLL 2EYTB 3KYAA 2YRZA 3QIUC 1I3VA 2EDFA 1F3RB 1BLNA 1I7ZA 1IAMA 4OM0H 1A7BA 1F3DH 2ZG3A 4Z7OE 4S1DD 4YQXH 3SKMA 4JM2D 5TE6H 1JF1A 2ENYA 3ARPA 1H5BA 2P8MA 5I1IH 4IRJB 1OGAE 4RFOH 4CRPA 4PV9A 4BQ9A 3RVUC 4JFFD 4PJIB 4JE4B 2ORBL 3WFEL 3PABA 4EUPA 3MCLH 1BOGA 3BPCB 2DI8A 3NA9H 4HJJH 4IJ3B 1JPGB 2WBJA 4A6YL 5C2UB 3PGCA 2FL5A 5JW4Q 1MJUH 4B7IA 1UACH 4BSVA 5J3HC 3IDMB 2D0HA 1VB9A 4S1SL 1MCOH 4FFVC 1JZ3A 1M7DA 2NY6B 3GRWH 5D71L 4R97C 3ARDC 3ARQA 4GMTH 3QUXA 2VLKE 1F3DJ 1IAKA 4NQVA 4NRXB 1EA9C 1XF3A 3EDKA 2EH8H 1FLRH 4PJCF 3MLPA 5JORB 2IAMD 1RJLA 1NGWB 3H9HB 3MRLA 4X5WA 1XCQB 2KBGA 5JDSB 1IGML 3QG6B 1N2RA 3HE7B 1R3LB 3WL9B 1JMXA 2DOCA 2HFFB 2EZ0D 1R5WB 1LEKA 2AXFA 1BECA 3RVXD 4M3JA 3OKMB 4PG2C 1R24B 4XXCA 1FZOA 2J6EH 1DQDL 3NIDF 5LBSL 5CCKH 2BNRA 1J11A 4WY7H 3OF6A 3L3OA 4Y4HB 4APQD 1KBGL 1KG0A 3TNMB 4MMZC 2V9RA 1FL6B 4G8EA 1G7HB 1L7IL 3OG6B 1FFRA 4PJIE 4W6XB 3QCVH 3SN6N 3HMXA 5D6DC 4R26H 1CICA 3PIQA 1EBPA 1RURH 4KJWD 2CXGA 1U41A 2RB8A 5KSUB 2OL3A 1A7OL 4UQ3B 3BQUA 2NZ9C 3U0TA 1IGIL 2EDXA 3CDGB 4D0BB 1TJIL 3O6FA 3SOBH 3PUCA 3LPWA 4Y16D 4PJAA 2FX8H 4Y8DC 1QSFD 3P0YH 3CLEH 4JB9H 3SDXF 1DN0A 2E6JA 5A2KH 3GEWB 1BZ7B 2CXKA 2P4AB 2CKBL 4JFEB 5GGTH 5DHYA 3BGMA 4NFCA 3QA3A 4TSAH 1UWGH 2DLGA 3D39D 1GGCL 4Y5XB 4WI2A 2FWOB 3M17B 1MJJB 4WIQA 2R2EB 5BV7L 4P4RB 3QXAB 3RIFF 3UYRH 3WIHL 2L7UA 4JPKH 4PY8J 4XNZC 4BK4A 4PG9A 5FCSH 4Q2ZA 3RUGB 3KWWB 2JCCF 2NYYC 2XWTA 2V2WA 4NWTL 4U1HA 1MI5D 4X6EA 1IE5A 1N26A 1H8SA 3EHBC 5F7FA 3OHXB 1P7QA 4YHKH 1A1MA 5DRNA 4MAUL 4KC3B 2GITA 1XF5B 5L0QC 5B4MC 3MV11 5JW5B 4S1RL 5EORH 2WBWB 5TE7H 2WUBL 4DAGL 1WITA 2B1HL 4F9PC 3JWNC 1FYHB 3BRFA 1YEJH 4JO2L 4NYLB 3AM8A 1KN4H 4PJGF 1PG7W 4FZEH 5ALBH 4DTGL 1TQBC 4PJCA 3BUTA 5ALCH 4XBGA 1JRHI 1BM3L 2A1WH 4FXLA 4BH8A 3V7AG 4OF8A 5IBTL 1NEZG 3T0EC 2V9QA 5IB3B 4XI5C 4GLRI 4OGYL 2CUHA 3P9LB 5GGQH 1FNGB 4L8DB 1BZ9A 3PXJA 3N9GH 4O2CA 3HZKA 4HW6A 3RUGE 1CFTB 5D70H 1NDGA 3P9WB 1HCVA 1I8LC 2JJTC 5GISH 2NXZC 4KRNA 3L3IB 5TJWK 4KJQC 4KZDL 5A16B 1EGJL 4OD3H 2IBGA 3IDIA 2ZCHH 5CS7A 1FFNA 4U0RB 4UILH 5F7WC 1TNNA 4YBHA 5HYJD 4AEEA 3V4UL 3OL2A 4XNUL 2ADIA 1FJ1B 2IF7A 3MLTB 4H1LA 3RWEB 3VXUD 2HT4C 1QYGH 2FIKA 2EEBA 3QEUB 3DUSB 4D94A 1VESA 4IS6B 4WNQB 1QNZH 1F90L 4NQDB 4JN2B 1VFUA 1V7MH 3F7QA 5KJRH 3R1GL 1MIEL 4PTTA 1AI1L 3SDXA 1SEQH 5D9SA 3DSFH 5E00B 1ES0B 4ZDHB 1BD2B 3QDJB 3QG7L 4YXLH 3WEXA 5JXAH 4MX7B 4Z77A 5TF1H 3DYPA 5E8NA 2ZUSA 4DKFH 3SO3B 4RAHA 1S7TB 4GQ9L 1KIQB 3ALPA 2L4OA 1RQ5A 1NEZA 3BP7A 4HK3N 1J8HD 3QEQB 1J1XH 2YSSA 5E4EB 1L0YA 4WRLA 5JTWA 4ZO7A 5IIEA 4S1DC 4JM2C 4D9QD 3BKYH 4IOFD 5JHDA 4X0KA 4LCWE 1U91B 1N8ZB 2YD9A 2YPVH 3IJHB 1I1RA 1LO4L 2IH3A 3EYSH 2NY7H 3SGJA 3M8OH 2R2HA 3NH7L 1I75A 1OCWH 1R0AH 2HFGL 5AWNL 4GRWB 4RFNC 3PGFH 4WUUA 4P2QD 1HIML 2D31A 1AHWC 4G8FB 4LVNB 1HQ4A 1DP0A 4R2GB 1QP1A 4HZLB 4F7EA 3SGKA 3VH8A 3RWDB 3OXSA 4Z9KB 2YRPA 3SDDC 4LLVA 1AGDB 1V3KA 2XI9A 4PBVC 4ZMAT 1YEFL 3DMMD 2HFTA 3O4OB 2EIZB 1KN2L 4I5BA 3QJHA 3LKOB 3AS1A 1JZ5A 3QPXL 3UJJH 3BH8B 2Q87A 2I26N 4KK8D 1BD2E 3QDJE 2EDDA 3K3QA 3T4AB 3VG9B 4AENB 4GS7C 1KLUB 1KGCD 2VDKH 3CSPA 2EZ0C 5J13C 4NQXB 1KXQE 3U0WH 1BQLH 1UH4A 2GK0A 1P7KB 3MJ7B 5J11B 5HGDB 3QEQE 1HI6A 1JIBA 2IJ0C 4NGHH 3D18A 3HZYB 3GSRA 3RNQA 1CFSB 3MLRL 2X40A 5SWQB 4JFYB 2HFEA 3JWOL 4I9WD 2VR9A 4GAYA 5EWIL 4WO4B 5EBWB 4PJDF 1D5BB 2AK4A 3UZEA 5HHNB 4NOFA 1RK1B 4M61B 2VDNL 4GRWE 4NO3A 4OV5A 5K9KB 1KCLA 4KJWC 4OQTA 5FXCH 5FYLH 3VXOA 3C08H 1JZ4A 2ESVD 1M71B 1BGXL 5C2BH 4YDLB 1BVLB 4LQFH 2DLTA 2AQ1A 4ZS7H 3KPLA 4JFHD 3NPSB 5ITFA 1YJDH 3JV5A 1U8IB 4LCUA 4M43L 2GI7A 3IXTB 2XOTA 2N7AA 4DN4L 4P5KB 4LHQB 1N4XH 2VAAA 3LEYL 3LQZB 4CU8A 1RIUH 2OTUA 1FYTE 3DECA 3SDAD 3KYNA 5FO8B 3MFGB 2X1XR 5IM7A 1YEDA 2R0KH 3GI9L 4CKVX 2O61B 2A6DB 4X80H 5ISZD 1TPXC 1HXMA 3LD8C 4XNYH 4N8CH 1A4JB 3U7WL 4XVTH 2FEDD 2Z92B 4LHJB 2N7BA 4Z76B 5C3LD 3OKKA 4NC1E 5CD3A 1NFIA 3WS6C 1CFQA 4B41A 1NAMA 1BFOA 3L7FA 4LNRA 1QFHA 1SY6L 2WQ8A 3HNTL 4HDIA 4K71C 3V5HB 3CNKA 5GZND 4EN3D 1GHFL 2OBGA 3OJ2C 1LDSA 2NR6D 3IU3B 1H3PL 4PREA 1ORQA 4ZOEA 3W9EB 1TETL 1MCJA 1EMTL 3K8KA 1MY5A 3JUZA 3MRNA 1CGSH 2XN9A 1FL5A 2WWKT 3HAEA 3VXSA 4LNVA 5ESVA 4X9FA 5DMIL 3MPCA 3VFSA 5C0AA 5DUPL 3HI5L 2W91A 4RIRB 3QIUA 3ZE0F 5D2LF 4NUGH 3ROOB 4JQVC 2D7OA 2M2DA 3CXHJ 1ZS8B 3MBED 1A0QH 5DD0L 2OI9B 4YDIH 1N7MH 3SE9L 8FABB 3U46A 1T22B 1WEJL 3KPPB 1JPST 4U6YB 1QBBA 3RDTB 1KB9J 4X8XA 1DL7L 3QEHA 1XCTA 4N0UB 2DQIH 1UC6A 1DLHA 4LPVA 4GW5B 3MJ9A 5E9DA 2H26A 2QQNH 3QSKB 2IPKB 2CDEA 2PYED 1IJ9A 3O45B 5GS1B 5ICZA 4Q74A 4GUPA 3CFCL 4OBSA 1MHPL 4WCYL 4BZ2L 3CFIC 3CZFA 3D0VB 4L4TB 3O2DA 2YWYA 1QBAA 1CTNA 3ARDA 2XACC 3D9AL 5DVKA 3BX7C 1T2JA 4PJDA 4X99B 2RIKA 3MLUL 4PJ8C 2WNGA 2DM3A 3ETBF 3I6LE 3TZVB 5F6HJ 1C08B 2HVKA 3VFMB 2R1XA 5A40E 1SBSL 1MEXH 4S1QH 1Q9LB 4Z0BL 4LOUD 4WV1C 4X7FC 3GSWA 1JZ2A 4XPHH 4U6VH 3V6OE 1W72H 3EYFA 2GT9B 4RFEA 1OTTD 4PGJA 3VA2C 1A7RL 4PG2A 4XPTH 4LU5H 3MXWH 2FJFB 2UWEB 3HMWH 3I2CL 3ZKMC 5I1LA 1D6EB 4OD2A 2COQA 4PRPD 4J12A 1NANH 2DMKA 3UX9B 1S7QA 4F58L 5HYEA 3VJ6B 3C8HA 2WW8A 2HWZL 3SEPA 1CE6A 3RP1A 5FHBL 3MOAL 4HKXB 5FM5M 5C0DA 4KY1L 1ONQB 4OGAC 4LF3A 5D6DA 1UKQA 1UXWA 3MRQB 1MFDH 4L3EA 3UTPE 4QKXB 3S4SB 1FORL 1CYGA 4GQPH 1CXIA 5KSBE 3GBML 1FZKA 4XMKH 3OB8A 3PP3H 1X7QA 3GJFA 1O5DT 1RJYB 3DXAA 1YPZF 4PJFE 4RGOL 2UYLA 5A2IH 4K2UH 4OCSH 4B53A 5DI8B 3TBYA 5I30L 2YD7A 5JQHC 4OTXL 1INEL 3SKJH 3HLAA 3PHQA 2VIRA 3VFNB 4QT5A 4ZD3L 4UT7H 5IGXL 3L6FB 5DD5H 2MMXA 4LLQA 4LPWA 1ZV5A 1G6RB 3NFNA 3VDAA 4F9LC 2GUOB 3QWRD 4YJZL 4E41D 5BS0D 2IANE 5EU6D 1JJUA 2WLZA 5JO5A 4OCXH 1B2WL 2BZDA 1PVHA 2UWEE 1U58B 3LKSA 1KTDB 4JM2F 5D2LA 2X05A 2AEWA 4KK8C 4I3GA 4HUMB 1KCUH 5AZ2L 2DLFL 3WS3A 1ND0B 3MRBB 3UTTB 1C5CL 2PN5A 1E4WL 6FABL 5ADOH 4XAKE 4YQXL 3PWPD 1HINH 4PJBF 4ZFGL 4MJ5A 5KSVA 5I1IL 1F11A 3NGBB 1S7RA 3RL1B 3EGSA 5D2NC 3LN5B 4MDIB 2R56L 3TN0D 4OFPA 2AJUH 3T77A 4QRRB 4TUJB 3QNZB 5C9JB 4RGMC 4HJJL 4ZPTB 2AKRB 3RQ3A 3WHE1 2GW5A 5BQ7B 4K7FB 1PG7X 3RAJL 1CF8H 3MOBH 1A6ZB 1ACYL 4F9PA 2HLFD 4PJHF 2UZIH 2O93L 1MJUL 3WE6B 2FJHA 4XB8A 3FN3A 3M07A 4OKDA 2C7UB 4GMTL 5FUZH 3IDGB 4OFIA 1QO3B 4XXDB 1N3NA 3ISWA 3SDCC 2YD3A 3J7HA 1R3KB 5CEXA 1CDHA 2DB8A 3S37H 5HVHB 4NOBA 3HG1A 4PJ5A 2MKLC 3CFEA 4FQXB 2JB5L 3T0EA 4UT6H 1G6RH 4W81A 2LU3A 3PF2A 4LKCB 1QPPA 5JPMB 4X6FB 2FB4H 2ARJB 4QTHA 3T8XB 2YMXH 4GRLB 4O5LL 3HR5A 3UTTE 1UKSA 1I8LA 2JJTA 4PLOB 3BD3A 4NO2B 3S35X 4PRIE 4OLYH 4JFQB 5EFIB 4X4ZA 1NCDL 5MEOA 3TH4T 1QR4A 3TT3H 5ETUB 2HKFL 4QRRE 4LEOA 3T4YB 1H3VA 1CXLA 4FQ1H 3HE6D 3H2WA 2RCSL 1CG9A 3NA4A 1KTRL 4Z7NF 4EN3C 3VRLE 5CHNB 2FR4A 4N0CD 1OQXA 1I9EA 2IALA 3BDXA 4C83A 1TITA 1PYWB 3ALWA 3D3VB 4NCC1 2Y23A 2PXYD 5FOJA 1YPZA 2M26A 1PSKH 2Q6WB 3IJYA 3MGOA 2XIDA 4ENED 1SJVA 5LQBH 3CH1B 5F7MC 3MYJB 1I7UA 2FX8L 3G5XA 4WU5B 3P0YL 3BD5A 1CU4L 1MCLA 4M02A 5HGAA 2VUYA 3OKLA 4OZIA 3DX8A 4WW1A 5SWSD 1HHKA 4OI9A 4FFYH 5DJ8B 1GZPB 3U7YL 1KJ2H 1P84K 4G6AD 1PG7L 5L88L 2F8OA 3QUYD 1UWGL 3DVGA 3TBTA 3SGEI 5EDXA 5IF0B 3SDYL 1LE9A 3DVFA 4JM2A 3PGDA 1B0WA 1SJHB 2N56A 5EZIH 2VDML 1I9JL 2J5LC 4JFFA 3QHFH 5JOPD 3DETC 1QQDB 3ZT6A 1W0WB 4U7KA 5ACZA 4PJBA 2EYSA 3IAPA 1SVCP 5TE4H 3ARFC 1AHWA 3KPRB 2J8UB 5EU3A 4YHKL 4JRYD 2FATL 4XBEH 3TBSA 3TO4C 2EDOA 2PTTA 3D2UD 1OSPH 3SDDA 3ZE1F 2APWA 1HYRC 2B8OT 5IUSA 3L5JA 1NUGA 3S35L 2P8PB 4JZOA 3U2SB 1A6AB 4PJHA 1RZFH 2FX7H 5A43C 2C3XA 2ICWB 2BC4A 1UVQB 3GO1H 3L5HA 2X4OB 1UCTA 1U3HD 4KMLB 3RTQD 1MCNA 3MA9L 3FT3B 1KNOB 3GMMB 3LSOA 4GG6A 5DK2B 4GW4A 3C60B 4FZEL 3ZYOA 1YN6B 5AYQA 2DQGL 4MLIA 5IEHB 1DFBH 2HA1A 4MGXA 3QIBD 3CLFL 2X1OA 1FBIH 4PJEB 4KMQA 4LIQE 2O5YH 3KLSA 5EOCH 5GGQL 4I2XB 2VR4A 1U95A 2BNQB 1G84A 1YYML 2J7LA 4HKBB 4K3EH 1NC4A 5DJCB 5DGQA 1NBZA 2JELH 4KRPC 3TIEB 4WHTA 2NLJA 4Z78A 4M48H 5GISL 4FMKA 3KPRE 2J8UE 3VGAC 4MXVF 4YHYC 4YDVB 3EJYC 5JIPA 4LSQH 2GTZA 2EDKA 1JZ7A 5SX5K 2R23A 1WBZA 3L7EB 4QHLA 1NCAH 1MAKA 2W0FA 4PGCA 4CJ0A 4QCIB 2VLJD 4JAMA 5EOCJ 2A83B 4FQLH 2Y5TA 4NN6C 1FNSL 1WZLA 2IBZX 2JJSC 4YXHH 4LBEA 3HPJB 2KZWA 3G5VA 2X4RB 4JZJB 4IHOB 2NTSP 1F2XK 2PO6B 1X5FA 2WIIB 4QHUB 1B90A 4L5FH 1SEQL 2LABA 3A6BL 2LVCA 4XVJL 5I2IB 5HHOB 2OR7A 4RGNB 2QKIA 2BNUA 4RMSA 5TF1L 3MUY1 4NNYB 3OAYH 2CLVA 5H2BB 1RU9L 4X7EC 1C7TA 4I2XE 5BV7C 1DUZA 2BNQE 5CJOL 5DJAB 3WS6A 4JKPL 2FO4B 4GAFB 1MCCA 4J3XA 4MWFB 4XP4H 4PB0L 5F9JA 1LK3H 4JFOA 1P6FA 4PJXB 4BH7B 1ZAGA 1MI5A 1PFCA 1A1NA 1RUQH 2Y4SA 3LS5L 2GSGB 4UMGA 4BA8A 4QRSA 3D25A 3NPZB 4ZUTA 2YPVL 7CGTA 1C12A 5EZOH 5FA3A 4JO1L 3FT2A 4OQ1A 1S7WA 3OX8B 3FQRB 4X6DF 3VE0A 3ULVL 1M05A 1FPTH 4M7KL 4NKDA 2HG5B 4HH8A 3ZKXB 4M6NL 1T3FA 2FRGP 3T65A 5IBUG 5HYQB 2R2CA 2HLFC 4M6AA 3UTZA 2IPUK 1OAKL 1A7QL 3VXNB 5TH2A 3KGRA 4Y19B 4JQVA 5HHPB 1T66C 3RWGB 4NM4H 3FMGH 4YZFE 5DJDA 3AB0B 2W0LA 4P9HH 4L9LB 4DVBB 2JK5A 4JFZL 4FQIL 3FO9B 3IDYB 3UJJL 5BZWB 4WJ5A 5HHOE 4RGNE 4P3CL 3ARBD 3GSNA 1MLCB 3S97C 1E28A 4OLWL 5CWSA 1AKJB 2FSEB 4XBPA 2XTJC 2IPUG 2C1PA 3BW9B 3T1FA 5I6XC 5JUEH 3CZJA 5DXWA 2X4PB 1UENA 3FCTB 3QCUH 2W9LA 2EDLA 2P49B 5L6YH 1PY9A 4NGHL 4WFED 1IGCH 4PJXE 4NNPH 3PNWB 4XC3H 4JM4H 4RQQA 3HC0A 1NGXA 4V1DA 4KI5D 4PJ8A 1ETZB 2IH1B 3EFDH 3CSYA 2VMFA 2LVEA 4ONGL 4MD0A 5CBEB 3RVTD 3GSOB 1B0GA 3T0AA 4OM1H 1OAUH 4HPOH 2DWEB 1CD1A 2P7TB 1HNGA 1RULL 1HOCB 1QFWL 1WJ3A 3GM8A 4WV1A 5CSBA 1HDMA 1P4LB 5DJ2A 1FQ9C 5EBGA 4LASH 1XF4B 1A9EA 4LQFL 2PXYC 2XFXB 5HVFB 2D7PA 1FH5L 1YJDL 1QRNE 2EDEA 3K4DA 4ENEC 5IW6A 3QXUA 1Z5LA 4R7NA 3TH2T 5C0JA 1KPVB 2VE6A 1AGFB 2EIDA 1J9CT 1N4XL 2VZSA 1ZGLP 4HS6A 4QTIH 3PGCB 1IBGL 1IRAY 4R96B 3IAGC 3PV6A 1PD6A 4JCMA 4XB7A 5IB1B 4WHDA 1I4FB 2GSIB 1EEZA 1FV1B 2X1PA 3VXQA 3SPVA 4DQOL 3QUXB 2BSED 1T03L 1DEEB 2IADA 4G6AC 3QUYC 4X80L 4XNXH 3QAZB 1J8HA 4XNYL 3OR7A 4N8CL 4DKEL 1T2XA 1ADQL 5FGCB 4X5WB 3UDWC 1C5DA 3KPSE 4NCDA 1Z2KA 5EIVA 1FZMB 4YHLL 1U8NA 1CIDA 4MXQD 4ONHB 4S11A 4XH2A 1XGUA 3PG2A 5CP7A 4BSWA 2DQDL 2H8PB 1I3GL 4R8WL 4D9RE 5D1ZB 1KG0B 3CFBB 1OM3H 3UYPA 4I4WA 4HK0A 3FQXB 4X6DA 4ELMB 4F9LA 1BVZA 1FC1A 5JW4N 4POYA 3EYOB 5J1AB 1J7VR 4I0PD 1S8DA 2OQJA 3BZFB 2XWJA 4YDJA 4YHPB 3HZMA 2LAAA 2FYYA 1DVFD 3TWCH 5I0DA 3U6RB 4Z7UF 1HH6A 1OF2B 4NUGL 1PKQA 4EUPH 2OL3B 3EFFB 4Q0XH 4NRYA 3CSBA 3GMPB 1A0QL 3U30B 1TDQA 1U8QB 2MSPA 4NP4H 5KAQF 3GMNA 2OR9H 3HCVA 3BH9B 3CIQA 4LKXA 4JPWH 1E27A 3VFUB 1BAFL 4PP1D 5ERWB 2HMIC 3QIBC 5D2NA 5F88A 3SJVA 3OR6A 1HSBB 1QLEH 5B22A 5FGCE 3C5ZB 1JNNL 5I1CH 3LEXB 5D7KE 2V17L 5HGBB 3VG0H 1JI2A 1LEIB 4F3FB 5GRVK 3LKNA 2ICEB 3JTSA 1V8HA 5AD0A 3JWOC 4AG4H 3MMEB 3Q6FA 3RWIA 1JNHA 1SJXA 2BNRE 2YPKA 4X98A 2R0WH 3SDCA 4RA0C 2ESVA 1CFVH 4PG9B 3SY0A 5T1LD 4JZNB 1P2CA 4OCLC 4ELME 4ZG1A 1E4KA 3ORJA 1AXSB 1MREH 4Y5VC 3DHJA 3BYYA 4LSVL 2VITB 1MEXL 3U9PH 3GSXB 3UJTL 3MRJA 4QRPA 3C5JB 1PDKA 1HILA 4LLUA 4PGBA 1W72L 4KKBD 2UY6A 3RKPA 4QY8A 1I8IA 2FJGB 3HMXH 4MD5B 5ITBH 3PWLA 4XPTL 4NNXA 3MXWL 3P11H 3HMWL 5GS3A 2BOCA 1QR1A 1Q0XH 1D9KC 4M7JH 4LCIH 2OL3H 1V3JA 5GRUL 1GRWA 5J06A 3DRTB 5IMMA 3KLAB 3DPBA 4PV8B 1NCCL 4JY6A 4U33A 1OP5H 3RVVD 1MRFH 1QFPA 4FG6D 3B9KA 1H0DA 5C0BD 5FK9A 2P5WD 2XQBH 1CD8A 1KPRB 2IGFL 5E70A 4XZUA 1BIIB 1MH5B 1MNUL 4EN3A 1AD0B 2XRAL 2FEEL 4LMQE 4TQEL 4YFLF 1CDIA 1C16B 4AH2A 4LLYB 4LK4A 3RY5A 1BZ9B 4Y4KD 1VFOA 1V3MA 4K2UL 3JWDH 2BSRA 3FONA 5C07B 1TMCB 1RZ8B 1UJTA 4G8IB 1TQCC 1A8JH 3VXPA 4DZBB 3NIFF 2NY6D 1ZLVK 2QJDA 2EYRB 2YK1H 5KS9B 3UBXG 3TPKA 1T0NB 4YPGA 5HSFA 3P0GB 5DD6A 4EI6A 1TLKA 5KVDL 3ARGD 3FL7A 2E9JA 2OJZH 4JR9H 5CKGA 3X3GL 1UM5L 1CBVL 2XICA 4Z7UA 1D5XA 5I76A 1MHHB 2HYMA 3EO9L 4B50A 5LGKA 4MLSA 3WIIH 5L9DH 1CS6A 2ZCKL 2VERN 4DKAA 4HV8A 1P4IL 3BGFC 2WV3A 2GAZA 1M7IA 4CVXA 2NXYB 2H41A 2QLVB 4WI7A 3ARFA 3O3AB 4PJCE 5F7DB 3TO4A 3AAZA 4YAQA 1YECL 1LE5B 4WHYG 4A6YA 2AJUL 4L4VD 3FFCD 5DRZB 1QHOA 2Y72A 4J6RL 4KI5C 1Q8MA 1X4ZA 3I9GL 3R06A 5B21A 4DZ8B 3T0XA 3BP7B 3QISA 3D5OF 1CF8L 3RVTC 5IR1B 1MFBL 1Q1JL 1TZGH 3RNKB 3BUYA 5C07E 4JRXD 4NO0D 3WIFB 2XKNB 1GL4B 4FS0A 1U8LA 5FUZL 3DV4B 3QH3A 1G7LA 4AIZB 1Q72L 3QZWG 3CAFA 4PRHD 3CPLB 5IT2H 1D5IL 3W81A 2HH0H 3RGVC 1R3HB 5FF6A 3VXRA 1HQ4B 5GGSY 1G6RL 4PRPA 2EXWC 5D7JC 3F8UB 1EZVY 4JFED 4GG8A 4MCZA 2YMXL 5EC1B 4H1LH 4M03A 2PCPB 4GBXB 2K3TA 1FFOA 2Z31C 1H3TA 4U1LA 1JMZA 3S8WA 1MPAL 3T3PF 1D5MB 3PQYB 4NWUH 1GZQA 1SHMA 3U7AA 5CZKA 3VWJB 3MCKB 3OKEB 4M62H 2D7TH 2EDJA 3RBSA 3VFRA 2DRUA 4MXQC 1HH9B 3PWJA 5DJXA 1YDPA 3V7AE 4XNQB 4X4YA 4CVZB 3AFLA 1WCBA 4C57C 4XNMA 1YNLH 1MHEA 2JJSA 3QO1A 1J0ZA 5E6IB 1CVRA 1J87A 3CU1A 4XCYB 2Y07H 4QO1A 4DUXA 5L2JB 5LQBL 3X12B 2N1KA 4JDTL 3DX7B 1TJGH 3KS0H 3QWRA 1HHHA 2CKBA 3JSSA 4YLQT 2I9LB 5KZCD 3N1MC 4WUUE 3QZWA 2EC9U 2JIXA 1MJ7H 4HFWB 5T3XD 1DVFC 3GK8L 1JHLH 4EVNB 2Q1EA 4FABL 4I3SL 3WIHA 1FSKC 4KKAC 4UV7L 4WGWB 3X3FL 3ALXA 3IKCA 2PW2A 1EHAA 1A6VH 1F6LL 2C4FU 4P48A 3KYMB 2WM0A 3MLXH 3WFCL 1BEYH 3WMSA 3H8NA 5D7LA 3W2DL 4HFUL 3N50A 1FFPA 4U2YA 4J4PD 2J1KA 5LGJA 4N9OB 4OGXL 4OZ4A 5JDJA 1PZ5B 2X70A 5MEND 3OBAA 4HBCL 3ULVD 5TE4L 3MBXL 2MHAA 1FGNH 3ECBB 3L9RA 4QWWC 3ABZA 3HUJF 1RV6X 5GSVB 5FGBC 3V4VH 4LSTH 3FO1B 5ID0B 3VW3H 3DUUB 1DLFL 4LSUL 2J4WH 3PDOA 4EKXA 1IT9H 4Y1AD 4P49A 4S0SD 3MRHA 5JMRA 2Q8AL 2FX7L 3FO2B 3E6FB 4O02H 1T21A 3O3DA 4XWGL 2CLRB 3QDMA 4I0CC 3WXWL 4M6MH 2VLLA 4ZXBB 4J8RA 3GIVB 1FNEB 4NQDD 3IDNA 3TO2A 1FL5B 3IF1A 1JPFA 3IU4H 1UWXK 2A2QT 4YFLI 3S36L 5DFWH 1QEWA 1ZSDA 2B2XL 1TVHA 5HHVH 1P1ZB 1JBJA 4ISVA 4OQTH 5CGMA 3ZT5A 4YWGH 4YK4B 2O5YL 3LOWA 5D72H 3FOMB 4OIIH 1OGTB 2PETA 2AJSH 3VRJB 4R7DA 4NHCH 3RVVC 1EGJA 4K23L 4LIQL 2A9ML 4FG6C 2KZ1B 4Z95H 1GSMA 5E2VL 2VQTA 4YR6A 4MA8L 4XAWL 1P4BL 3DX6A 3EYVA 5F96L 3GJEB 2NY2D 1UZ6F 1R3IH 4IRJC 2R1WA 5HPMA 1DQMH 3QEHB 1FL3A 4LPTA 3MNVB 5JW4R 4MQ7A 4ODSH 2UY7A 5F97E 2VZ3A 2YD4A 2PXYA 4EIGB 3SE3C 4IJ3C 3IGAB 5L2KB 2G60L 4FQLL 1JGDA 2GKIA 1NC2A 4K55A 3HC3H 4YXHL 2YUZA 1J10A 2DKUA 1NAMH 2AI0H 2NY6C 1L0XA 4BFIB 3VWKD 1AD9B 3RA7L 2ITDA 2VC2H 4HIXL 2OTWA 4Q6IB 4AQOA 1QBLH 5DHVA 3QUYA 1F4WL 4PJ7A 1HQRA 2F74A 1XR9B 4M00A 3UDWA 1ED3A 2BJMH 3C8DA 3QIWD 1OLLA 3HAEH 5C0AE 3GBNH 1S9WB 4U3CA 4DVRH 3FRUB 1ERNA 2Q20A 5AG9A 1LK3L 1MFAL 1PAMA 4RNRA 4PRNB 3Q3GB 3QYCA 1T20B 3NCYS 4EQ3A 1RUQL 1NUFA 3A0OA 3O6KH 4Y4HC 4NQEB 3QRGL 4JRYA 3F12B 1FVCA 3D2UA 1NGYA 4UIMB 3CXDH 1FPTL 2H2PD 3V5KB 1OPGL 1AXTH 3HUJA 1MFEH 5DK0A 4KVNL 4DK3A 3GZKA 5L2KE 2E7BA 5D7IF 3I3BA 3RX5A 1BF8A 2Y7QA 2XNAB 3NABH 3VDBA 3MJ9H 1ZA3A 1FZKB 1M4KA 1Q9KB 2VDRH 1CCZA 1SYSB 3ARSA 2QSVA 2X4TA 3L3JB 4KV5E 3CX2A 4PJDE 5EO9A 5JW3L 4LDLB 1D7FA 4P9HL 5DTFA 5C08A 1A7PH 3UXFA 1RHHA 3MROA 2X1QA 15C8H 2ITCB 2BSSB 3QIBA 4XPFH 2Q86B 5J9PB 5DEFA 1CDUA 5DURD 3Q48A 3UC0L 3UMTA 3ZDYF 5IEKA 3FOLA 3IFNH 4UDUA 4O51A 3GM0A 5HDBE 2AEQH 3VFOB 2ED9A 2BXZA 1DE4B 4NT6B 1J86A 4U3XA 5L6YL 5I8KL 4Y5XC 2QHRH 5JO5B 3MV7B 3FB5B 2I25N 2XZQL 3LH2L 4XP5H 4XNZB 4NQEE 1L9MA 3JUYA 4GKSA 4XGZA 2F15A 3MJ8A 3S5LG 3VI3F 3QO0B 5CIPA 3MCG1 4OM1L 4Y5VA 2A9NL 1JWUA 4HPOL 2Z8RA 4OKVA 1XF2B 3VXMD 4YX2L 2DLEA 2UUDK 5E5RB 1CI5A 2WMPA 4KUZL 1BQHG 1KT2B 5I1AB 4BFEA 1PQZA 4HWZB 3WNOA 3O11B 5F1NA 1A6PA 1U8OA 5KVFL 1J1OL 4NKOB 5CINH 1Y6KR 1D9KA 1GPOH 2YA0A 2R4SL 1AO7B 5LXGH 5DHXB 3OKOA 3GJFH 4DEPB 2FECL 4Z5RA 3F7VA 1QSZA 2D7NA 4YIQB 5J1TC 5GRYA 43CAB 4ZUSA 3KYKH 1S5HB 4OB5L 3RWJB 2ADGA 4ODVH 1LMKA 2ATPA 3RDTD 1IEAA 3FQTB 2AEPH 2X7LB 4F7PA 3MV7E 5KVEH 1Y18A 5FOBA 1FE8L 4NPYA 2AJZA 1RMFH 2V5SA 5D1XB 4QTHB 1I8KB 4UTBL 4GFTB 1ODAA 2XA8H 3IFPB 2B4CL 4OZFA 4M1DH 3ULVC 3S5LA 4L4TD 4HSQA 1XGRA 4FQHA 4GRMB 4FTVB 1U3JA 5MEOB 2A6IA 2AJVL 4Y4FB 3WO4B 4U0RC 2RBLA 1NQBA 5C6WH 4PBXA 1W8OA 3UTQA 2YPLD 5GJTH 2HT2D 3PL6B 4U6HA 1ZVSA 5HI4D 2GJ6A 1BQHA 5D7IA 1MCEA 4KTEH 1G7MA 1AO7E 3TWCL 3ILPA 3H7LA 3FN0L 5LKNA 2FR4B 5IBLC 1XGPA 2AXGA 3B5GA 4G43B 3OAUL 4L8CB 4AIXA 1FVEA 3CFJB 2F5BH 1QSVA 4DFHA 1CXEA 4PJ9B 3U4BH 5IB2A 2YBRB 1I7UB 4HXBH 3MZTA 3BD4A 4O9HH 4YHIB 5C09B 4LEXL 3BEWA 3G5XB 4Z7OF 5C0GB 4NBYB 4G6JH 2P5ED 5LWYH 2VXSH 3O4LA 3DROB 1IZJA 4XVUD 1TXKA 1ZHBA 4H26A 3L95B 1D5ZB 1KJVA 3SO3C 4PGDA 4L3CA 4WEMB 3T0EE 2AV1B 1PLGL 2D9QB 3NCFB 4AEIH 5FB8A 1EEYB 3DVGB 3QR2A 4LCCB 3QEGL 2OSLA 5JNYA 1QFOA 5E4EC 4HLZG 1ZT7B 3MR9A 4LL9A 3CK0H 4MJ6A 2DQHH 1TENA 3X17A 2F8XC 5DFVD 3QDGA 4OSUL 5I18L 5JQ6H 3TT1H 2R39A 4OLUH 4ACPA 3RGVA 3U9PL 4PS4H 1JYXA 1AFVL 5TDPB 1J8KA 4LVNC 4X9GA 1YJDC 5EG6C 3VGDA 1UGNA 1AP2A 5D7JA 4R2GC 1F42A 5DJYB 4OD1L 3I50L 2G2RA 4X8JA 4H0HB 1RAMA 3E2HB 4K8RL 1IM9B 1QBML 1EO7A 1YEKH 3O4OC 2Z31A 4JO3L 2PR4H 4LCIL 3KPQB 2WUCL 2YHGA 2OL3L 5T1MB