3P4LA

Crystal structure of a hemojuvelin-binding fragment of neogenin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
201
structure length
198
Chain Sequence
LPMMPPVGVQASILSHDTIRITWADNSLPKHQKITDSRYYTVRWKTNITKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGTTFELVPTSPPKDVTVVSKEGKPKTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neogenin
publication title Crystal structure of a hemojuvelin-binding fragment of neogenin at 1.8A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 31
structure length 198
sequence length 201
ec nomenclature
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p4lA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p4lA02
1BAFH 2HT3D 4JFQA 4L8SC 4K8RC 3D0VA 2UY6A 3HUJA 3M1BB 4M00A 1CGXA 2YPLE 3IDUA 2HVJB 4S1DD 1RSFA 1RVFL 1QFWL 1RVFH 2VLRD 5JXEA 1QFWH 5IW3A 1I1YA 2R4RL 5I15L 4F58L 5I15H 2I27N 2XICA 4OZGF 4CDGC 2BVTA 3H9ZA 2VQTA 4GRMB 2AXFA 2NY5L 4O9HL 5ICYB 5C0DB 2NY5H 4O9HH 3DUUB 2B7DT 1WFNA 1E4XL 1IBGL 1T2JA 1YY9D 1E4XH 1BQLH 1IBGH 3A6BL 2YBRA 3A6BH 2CIKB 4JPVL 3EO9L 2X05A 3WIIL 4JPVH 4LLYA 2YPLA 3EO9H 3HNSH 3PG2A 4PBXA 1K5NA 1F3RB 2C1PB 5KSUB 5E8OB 3L3GB 1ZHKB 4HIHB 3KPMB 4LAJH 4O02L 5MEOB 2FX8L 4O02H 5IESL 5A40E 2FX8H 5IESH 5DJYB 4KDTC 2NW2A 4LLDA 2VZOA 4IIQC 3VXME 5DDHB 5F9WC 5J89A 5I6XB 1G7IB 4C56A 3CSBA 1ZOXA 3ULUD 3AY4C 5CBEB 5CINL 1CGVA 5CINH 3MUY1 5D7IF 1JHLL 4IOFD 4XBPA 1YN6A 4I4WB 1DUYA 5FKAB 3M17A 3MBEA 3U2SB 3VXMA 5FAAA 3TF7C 5HYJD 2FEEI 4PP1D 2ENSA 5LWYL 5LWYH 1RJLA 3EOYG 4EOWL 3QNXB 3CDGA 5FYLL 4P23D 4EOWH 1FE8H 2YUZA 5FYLH 1ODAA 1QA9B 4G6KL 4FXGB 4XH2B 4FABL 4G6KH 5F1KC 4FABH 2FR4A 4JFPB 1LE9B 2DBJA 1UEYA 2AKRA 4LCWE 3ZDYE 1T03L 3L9RB 1CLOH 1T03H 3Q3GB 5IB4A 4WFGD 4X6DE 4WNQB 4D0BA 5HHME 4ODXA 4TUKH 3GSQB 5C9JA 5HDLA 4CBPA 4EVNA 3MODL 2FO4A 3MODH 4KRNA 2C4FT 1A3LL 3V0VB 4Q74A 1NFDB 2A6KB 4PS4L 2Z92B 4LCWA 3LV3B 4JRYA 4PS4H 3MA7B 4Z0BL 5E56A 1AR2A 4Z0BH 4I13B 2I07A 5K93A 1YEDA 1WC7B 4BQBA 1JGDA 5CJXC 4JVPA 4P4KA 3DGGB 2H3NA 1ZEAH 1E6OL 1E6OH 1QLRB 1WK0A 4JFHE 3K3QA 2R2BB 5C0RL 3O3BA 5C0RH 1X7QA 1HHJA 1IC1A 1T3FB 1YA5A 3C8KA 5DK2A 1MVUA 4X5WA 4CVZB 1UVQB 4OAWB 4MCYA 1KPVB 4CAGA 4KJWD 3VE0B 1F3DJ 3TBTB 2ITDB 5CP3H 3O2DA 3GUTA 4HDIB 4AIOA 3ARZA 4LHQB 4KKCC 3FFCB 1HK6A 1M71B 4MB4A 5I8OL 4OZHB 1JWMA 1AKJB 3RWCB 5I8OH 1QNZL 3KPTA 3ARFB 3X14B 4A2MA 4DUWA 4N9GA 5I1AA 1QNZH 4P99A 1QPXA 4MNGB 2NY4B 1NBZA 1CDGA 4U6YA 3T4YA 1L0XA 4EXKA 3GJFK 1D5BB 4R9HA 1OM3L 4Y5VA 5K59E 3AXLA 2ADIB 5J1SC 4NRZB 4LSQL 3MV8D 3N85L 4P4KC 5EN2A 3RPIB 4AIXA 4LSQH 3N85H 4AT6A 4RMSA 1KJ2L 1RUAH 1PX3A 4KDWA 1WZKA 5GGUB 4QCIB 2OI9C 4J8RA 4RIRB 1J12A 3SE9H 4DW2L 1JZ6A 4MXWL 4WW2F 4DW2H 5JW5B 4MXWH 2BVYA 4HPYL 4LCCB 5DJ8A 1OB1A 2XIDA 4HPYH 1G6RA 5FYKL 3RKDC 4P9ML 1WFTA 5FYKH 2VLLA 4Z9KB 2FDBP 2Z93A 4RAUB 5BQ7B 5BRZB 1RUML 3K4ZA 2FGWL 2FGWH 1N2RA 5EUKB 1SJHB 3DMMA 2UWEB 3MZTA 4ELME 3J8F7 1Z2KA 3GMNB 4EIGB 4XPHL 3UBXG 4QXWA 4XPHH 2QQKH 3MGAA 5FK9B 5T3XH 2B1HL 4XI5D 3TBSA 4GMTL 2CLVB 5FO8A 1TCRB 2FH6A 4ZODA 2WUCL 4L3CB 2WUCH 2A38A 1RZ7H 3F12A 3VFMB 4LVNC 1P7KB 4MXQC 4NZUL 4NZUH 1ZWIA 3DV6B 3GSUB 4BFIA 1EFXB 2BNUB 3MOBL 1CL7I 3WHXB 4K71B 2HT4D 4BH8A 1JV5A 1BP3B 5EUOB 2ID5A 1MPAH 4RDQG 4GRWB 5GRVL 2R1XB 5GSVB 5FECA 4P3CL 4UZGA 3RAJL 3ZTNL 4P3CH 2DYPB 3ZTNH 4RNRA 1KPRB 5IK3B 2Z4QA 4R26H 4KFZC 2F8XC 4QHKJ 3NABH 5HHNB 1J10A 5KSAB 3ULVE 2IWGA 1JUFA 1JGEA 2E9BA 4F3FB 1B6DA 1GHFL 1JPTL 1GHFH 4APQC 1CDHA 1JPTH 4U6XA 3W39B 2C3XA 2KQMA 5IUSA 4LOUC 1CYGA 2K3TA 3DX7A 3BZ4A 4YHYB 2EYRB 3H3KA 3MJ6A 4MJ5A 4DFIA 5CLWA 3TJHD 4N0UB 4YDVA 5AAWA 1S7QA 5D2NB 1M4KA 5GIRB 3LQZA 2IALB 1NGQL 4RFNB 4KJPD 1WZLA 1NGQH 2E6JA 3LOWA 4GAYA 3EYQD 4L9LB 5E1AB 7CGTA 2IQ9L 1U8MB 3GNML 4JGMA 3H0TA 2IQ9H 4BM7A 3GNMH 2HFGL 3LEYL 2HFGH 1OSZB 4Z7VF 3C5ZB 3ILQD 2DMKA 5J11B 2DM7A 3EYUL 2IBGA 5DLMH 2ICWI 3KWWB 4LSDA 3DVIA 3S37L 3S37H 3C60C 1AE6L 4J3OC 1AE6H 1XIWA 1DL7H 5KSBF 5D7LD 3E6HB 3QCVL 4LSPL 4WDIA 1W0YT 5FF6A 3QCVH 5D6CA 4LSPH 5F7UA 3UDWA 4XGZA 3TEUA 2EIZA 5GQBA 4WFHD 3OGOE 4F80A 5J06A 2RHEA 4IRJD 4PR5A 1QFOA 2DLTA 2XQYK 3P4MA 4NNPL 5GRUL 1I9RH 1A5FL 3L7FB 4F15C 5GRUH 3VFTB 1A5FH 1RAMA 3KLAB 3AU1B 3TV3L 2M8XA 2I9TA 3TV3H 3MJ8A 2CXKA 3BPCB 4Y1AD 3W0WB 2CKBL 4HFWB 2ADFL 2CKBH 4CRPA 1K4CB 4PRPD 3WUZA 3K4DA 5E6YA 2ADFH 3F7VA 3IJSB 3D18A 4Q6IB 3OKMB 1RZ8B 3LDBB 4P2OD 4P2CG 5ESQB 2VERN 2Q7YB 4IOIA 1OWWA 2NTSP 3V6BR 4HGWA 1NC4D 1FZJA 1QBLL 4ODWA 2JB6B 1QBLH 2YD3A 4I2XB 4OCRH 5I1EH 1L9MA 1MFBH 2VRAA 2ADJA 4OZFB 1N59A 4G6AC 3QUKB 3MMEA 4PJXE 4GLRI 2VR5A 2AW2A 4R96A 3QZWA 1OP5K 2VKXA 2QEJA 5MI0C 1AO7D 2DM3A 1YNTA 5T5NF 4HIEA 1MAMH 1D5MA 4PGDB 4KAQL 5C2UB 4KAQH 3D3VE 5T3ZD 4NQXA 2VAAA 4PBWD 3SEPA 1MLBA 2BRQA 1KG0A 5AZ2L 2EDJA 5AZ2H 3IU3A 2YR3A 3X12A 4PJXA 1KTDA 1YQVL 1RUPL 1YQVH 1FNGB 1RUPH 3CU7A 1BOGB 2AK1L 4PRHE 4MD5A 1G9ML 3BRDA 3P73B 4G42A 1G9MH 4U1SB 3GM8A 1IQDA 4RAVA 4U1MA 5IWLA 2BFVL 3U1SL 3AVEA 1JK8A 2BFVH 3U1SH 1SBSL 1NCCL 1LGVA 1SBSH 1NCCH 5IBLC 3DVNA 4JB9L 3H3PL 4JB9H 2EDOA 3LB6C 5DS8B 4KKLD 2Q8AL 3FQWB 3RVWC 2BXZA 2Q8AH 2BCKB 2NY7L 1VEMA 2NY7H 3G5ZA 4PRHA 1H3GA 2GJ6E 4OIIH 3U0TA 4NKDB 1WBXB 3MLSL 1UQSA 5IFHL 3HFML 5IFHH 4XB7A 3HFMH 3MR9B 5IVXE 3L3OB 3SN6N 4MLIA 1B3JA 3RGHA 4ONFL 4NRYA 5FGSA 2NZ9C 4V2BA 5D96C 3ARWA 1UZ6E 4X6FA 1CN4A 4U1JB 4Y4KA 4MD0A 5DHYA 2ERJC 5GRJL 2YD6A 3SDXB 3VMPA 4XP9L 4JCLA 5GRJH 2IAMB 5C0NC 4S10A 1MJUH 4MJ6A 4XP9H 1RUQL 4YGVB 4DCQA 2VR4A 2PETA 4TVPE 4L4VD 2IADA 4GT7A 2GJ6A 4MQXC 4PGEA 1FSKC 1PFCA 3UZEA 1AHWB 1BBJB 5DXWA 1ZMYA 2BHUA 3DX6B 1KJ3H 1EBPA 5ACZB 3VFSA 5IVXA 1XZ0B 4Y19B 1F4XL 4NQUA 1U41A 1F4XH 2NY5C 2AERT 1B0GA 3G6AB 3QDMB 2H2PD 2VQ1A 1G0YR 3UYOD 4GXVL 4LKXA 1KLUB 4GXVH 5IWLC 2MHAB 5MEND 4JM4L 3DYPA 4JM4H 5ELIA 1XF4A 1A0QL 1KGCD 1A0QH 3ARGB 1FAIL 2RB8A 3GSVA 2ZSWA 4DZBB 3VXNB 3KLDA 3GHBL 1FO0L 3ARRA 3GHBH 3MRBA 1FO0H 3TWCL 1W0VB 4RGOL 3TWCH 3QXVA 4JPIB 2AK4E 5I1DA 1ZGLM 4O4YH 5BJTA 2WP3O 1U6AL 4JKWA 4NYLB 1U6AH 5BMFL 1V3KA 5ESAB 1LEKB 1TMCB 2F54D 5BMFH 5FDWA 4Y4KC 1ZLSL 1XMWA 2K7PA 4TTGA 4G6JL 3VXRA 1ZLSH 4G6JH 2XWTA 5EPMA 4KRPD 2X4QA 2FBJH 3FQTA 1W72B 4RFEA 2Q76A 3K74B 3OG4B 1DVFB 1T1YA 5D72L 5H35B 4FQJH 3NTCL 3IGAB 4NO0D 2X4TA 5D72H 3NTCH 5FM8A 3OAYK 4XNUL 2AQ3A 4D0DB 1JNLL 1QQDB 3B9DA 4MJID 1JNLH 2Y72A 4JY5H 4CVXA 4MDIB 5CKGA 4JFXA 3PUCA 4GMSL 3S4SG 4GMSH 3X11B 1B0RA 3C6SB 1N26A 4YC2B 4UDTB 5GSRB 4JZJC 3MRPB 1WV7T 1NFKA 3W0WD 4ZAKA 3E3QE 3DV4B 3SDDA 2NY3D 1RZGA 4L3EA 5SX4H 4MA7L 3W11C 4NGHL 3VGAB 3MRRA 2ZOKB 3C08H 4NGHH 3TBYB 5TGBB 2EZ0D 1D5XB 5GZND 4XNYL 1CR9L 1QEWB 4O51A 4GQ9L 1CR9H 4XNYH 4IMKA 4GQ9H 3T08A 2OX5A 4ACPA 4JO4H 4OFDA 3RWIA 3QQ4A 1HHHB 5C07D 4FQLL 1MFAL 4FQLH 1MFAH 1FV1B 2R9HD 1T2XA 5HGBA 2PO6B 3TN0B 1OQXA 3SGDH 2QBWA 4QXTA 4OUOA 5BXFB 2E7LC 4I0PD 1KJ2A 2QADC 4HGMA 1YJDL 4NDMB 1YJDH 4DEPB 1GOGA 1D6EB 3F7PC 1QP1A 4W6XB 3RNKA 2QJDA 5DO2D 2YD1A 2NXZD 2PCPA 3SDCD 3C2AL 1JYNA 4G8IB 3DETC 5JORB 2NLJB 3C2AH 2LE9A 1V7NL 4PY7B 4QOKD 4KK9D 1IGYB 2VDRH 2X1WL 4FNLH 5H37H 1RK1A 1UXSB 4AH2A 4YR6A 3TJEL 4OD3L 3TJEH 5C0FA 1S7RB 4OD3H 4JZNB 4PV9B 4XHJD 3SDDC 4Q2ZA 1JHTB 5HHVL 5EIIB 2HFTA 5HHVH 1NCTA 1A1OB 2BNQB 3HI5L 2OMNA 4LHUB 3FT2A 4NP4L 5JHLL 4NP4H 3PL6D 2EYSB 5JHLH 1TNMA 1TJHH 3D9AL 5SWQB 3D9AH 4MMXC 4AEEA 4LKCA 1ZGLB 4IMKC 4PTUA 1A6AB 1Z5LB 3FO2A 1I8LA 1KXQE 2WK2A 5IFAL 5IFAH 4U1GC 1KCVL 1P4LB 3VGGA 1KCVH 3I75B 3OXSA 1KYOJ 4HUWB 4Y4HC 1HHGA 1S7VB 4HUNB 4ZO6A 3QXAA 3B8YA 3BUYB 4JHBA 3QEHB 5F6IC 4P4RA 4PRDA 2IFFH 3T1FA 2IPTL 1TZGH 1GZPA 3QI9D 2IPTH 3UO1L 3BD3A 4HFUL 4JDVB 3UO1H 4HFUH 1A7RH 4ZNCD 5T1LA 3V5HA 3LKOB 4HJ0D 5J9PA 3SKJL 1HHIA 2DLEA 3SKJH 1WGOA 2P5WE 5LGJB 5CCKH 4Y19D 1QLEH 2GITB 3SKUD 4J3VA 3U7AA 1MF2L 2BDNL 3TVMD 1MF2H 2GJZB 2BDNH 2ZCKL 1F6LL 2GY7B 2GSIA 3L7EB 3MV9D 1A1MB 1RIUH 3VFOA 1BQSA 2QQQA 1A64A 1BFTA 1BZ7B 4ODBD 4FA8A 5DJ2A 1I8LC 4Q9QL 4F33A 4F7PB 4Q9QH 4XPTL 2P5WA 3CNKA 4QGYA 3QO1B 1G7JB 4GUPB 4ZFGL 4ZFGH 4R4NC 1WQVT 1TNNA 4MNQB 1CFQB 1R3LA 5C0BE 1IM3A 1MRFL 2V5SA 3LH2L 2JK5B 4XPAH 1MRFH 3LH2H 2H32H 4FMKA 5HXMA 4ISVA 5FM5M 4P2QE 1Q94B 3KYOA 3WMSA 3B5TA 1BLNA 3O41B 3QR2A 1Q9WA 3H9HB 1VEPA 5E7BA 5BS0D 2IGFL 2KZ1B 5ISZA 1MHHA 2IGFH 2ZSVA 2NQCA 3DURA 1HSBB 4L5FL 5AZEL 1PDKA 4L5FH 5AZEH 5C0BA 4NM8L 1G7PA 5B8CB 3C09B 4FFZL 4UQ2B 2R56L 5GPRA 5I19L 4FFZH 2R56H 5I19H 5F1NA 5F9DC 3Q2CA 4L8CA 1OTSC 5CEZD 4WI4A 3D85B 2P1YA 5I16B 1JRHL 1JPFB 3KDMB 1JRHH 3OWEA 4P5TA 1T04B 3MOQA 4I3SL 2WBJD 3V6FA 2CKBA 4JY4B 5C86A 4I3SH 1EHXA 1KIPA 3MQIA 1P5UA 3P40A 5TDOA 3UTSE 4CJ0A 5I8KH 5M95B 4HF5H 3TA3C 4EI5B 4WHYG 1SVZA 1U9KA 1YNKL 2L4OA 1KELL 1YNKH 4RGMB 1BIHA 3EGSA 4OLEA 5KSVA 1KELH 5TE4L 2HT2D 1AH1A 3WJJC 3FB7A 5TE4H 5JDJA 1ADQA 3PHQA 5J0BA 3BI9X 5HD8D 4XT1C 4GKNB 4ORZC 2Z31B 2NY0B 3O6FD 1A2YA 1FC2D 2OTWB 3BEWB 2G2RA 4BK5A 4PJEB 3UTSA 3L5WA 1FAKT 3Q0HA 2XA8L 3MLRL 1U58A 2ZOLA 2XA8H 1DFBL 3MLRH 1OTUD 5C0JB 5GS1A 4X9IA 1DFBH 1FLTX 1LK2B 1E28A 2AABL 4G9FD 2AABH 4LVHC 4WTXA 3QIUC 4Q97A 2HVKA 3UJJL 3UJJH 2F5BL 3ZMRA 2F5BH 3B9KA 1F4YH 5SV4A 1NMCC 4ZFZA 2QV2A 3IRZA 1NSNL 3V2AR 1NSNH 3NZ8A 4HUVA 5IFJA 3QDJD 5GGTA 4NSKA 4HKXB 5EC1A 2Q6WA 4NN7C 4ZQKB 4KJQC 4NQCB 1GRWA 1OD7A 5IVOA 3NFPB 4FFWC 4L29A 5FYJL 5ESVB 2VLKE 4Z7OF 3CDFA 5FYJH 1Y0LA 2YN5A 5JA8B 3S8WA 1RJZA 1T89A 2DL9A 3NACL 4OQTL 3D2UD 5JMOC 5C0EB 4X99A 3NACH 5ERWA 1CICD 1ZHLB 1CD0A 3U4EA 1AGEA 4P5KA 3TO4D 3GMQB 4B7IA 2H8PB 1KT2A 3H42L 1DUZB 5GS1C 2VLKA 3E2HC 3H42H 3B43A 1U3HB 5EU6E 2EDRA 3VFNB 5JO5A 3OZ9L 3ZE0E 1DQQB 3OZ9H 3SDAC 2O26U 5ANME 3KPSB 2VITB 3TCXA 3RHWK 3QNZA 1JVKA 5A1AA 1F8TL 3MGTB 3B9KC 2GY5A 3LKNA 3BP5A 1T5XB 5DRZA 1CGTA 2EXWC 1A4KA 2E9IA 4OGXL 1G9MC 3ARBA 4LLQA 4OGXH 1EDQA 3F7YA 2XA3A 3HUJF 2X4RA 1QSEA 4XX1G 5HI5C 5EU6A 4M9OA 3PGCB 5JW4Q 4LAQL 1JGVL 2WMPA 1JGVH 4X6EA 3BMWA 3HI1B 1E4KA 5ANMA 2PW2A 4AIZA 5JUEL 2Y6SC 4MVBD 5JUEH 1CWVA 3K1DA 4OFVA 2Y07L 4OBRA 2QR0B 1TDQA 4OV5B 1T89C 1TQBC 2Y07H 1P4IL 5AYUL 5EC2A 2JLLA 4WENB 2ZJSL 5CIPH 2ZJSH 2XZCL 4Y88A 4X5XA 3TH3T 4XZUB 1P84K 1A6PA 4Y4FD 3O8XD 3NCYP 3VFPB 3RDTB 3O9WC 1LWRA 3JXAA 5IMMB 3BPNC 4M4PA 1C12A 1MI5E 3L5JA 1OLZA 1A9BB 3DX8A 1F45A 3ESUF 2N1KA 5EWIL 2NR6C 5EWIH 5ICXA 3VD4A 4OIBA 5F88B 1FL5B 4HZAA 5D93B 4ZDHA 4QY8B 1CFVL 4IEFB 1CFVH 3DWTA 4V1DD 4J3SA 2Z91A 1OGAA 1U8JA 1G7MA 2NTFA 5HHOB 2R1WB 4YXHL 3ARBC 3FT3B 5DUBB 5EU3A 1MI5A 5JHDD 3UBXA 5CMAA 4KTDL 1TJIL 4OLYH 4X98B 4FQ1L 4KTDH 3WUWB 1TJIH 4FQ1H 3GBNH 1E4KC 5M94B 1PKQB 2BSSA 4HS8L 6FABH 3OAYH 4MSWA 5HGAB 4HKBB 1C1EL 1UJ3C 5F7YC 3B6SB 1BVKA 1G7QB 5GGRA 3AB0B 3BYTA 3KPRE 4P5MB 1QHOA 1F6AA 1INQA 4PJFE 1A9EB 5FDYA 5JW3L 3T4AA 4FQXC 5JW3H 1YDPA 4UDUB 5SWSA 4QRQB 3QUZD 5E8EB 3RFZC 4N90E 5DEFA 4QXUL 4QXUH 2IQAA 4XBGA 4WO4B 5D5ME 3VRJB 2HKHL 4H88L 2E7HA 2Z9TA 2HKHH 4H88H 3VRIB 4I9WD 2N7AA 5DFVC 4UT7L 1K2DA 4UT7H 4XP6L 3VFUA 5AG8A 2X4NB 4XP6H 4NQTA 1WFOA 3IKKA 3MRNA 3GBML 3KPRA 3GBMH 4DQOL 5EZJA 4DQOH 1HQ4A 4P46C 4PJFA 1HSAA 5F89A 2BP3A 2DOCA 3ZDYF 1MLCA 3TZVD 3PABB 1PYWA 2VN4A 3QWQB 1G7HA 5EBLB 4EDXA 5D1ZA 1VESA 4X6DF 2R2HB 5DQDL 5DQDH 2VDOH 1WAAE 4PJDA 2CMRL 5C0AD 2CMRH 2Q20A 3BW9A 2WM0A 4Z8FL 2FWOA 1VGKA 2VABB 4Z8FH 1T66C 5JZ7C 5CAYB 4O2FB 1U8KB 3IAQA 2W60A 5I8EB 4GXUM 1GYAA 4KTYA 3BDXA 3DLQR 1JTOA 1X5HA 1FFOA 3LN5A 1FJ1A 1BM3L 1BM3H 3ARXA 1ONQA 1YUHA 1WAAA 4JLRA 4PTTB 2C7UA 4GSDL 4MA3A 2VN7A 3MNWA 3DBXA 2BVPA 1R5IA 4D9QD 3S36X 5I71C 2OJEA 1BFSA 2NX5E 1SBBA 5E6IB 5EU4A 4UAOB 2GCYA 5IBUB 1IT9L 3OAZK 2HJLA 1IT9H 1YJDC 2XN9A 4LLMA 2J3SA 3VXSA 4RQQA 5DJDB 5FO7B 5HYSA 4M7JH 2V9TA 4QF1B 1YEIH 4MZ2A 5HYQB 1QRKA 1JF5A 1RZIA 3DARA 3TT3L 2IPKB 3FFDB 4KK8D 3CFKA 5CZXC 3TT3H 1CGUA 4ZSOB 5J6GB 3ZKMC 3WL9B 2NX5A 2NY1D 3O4LB 5KZCB 3HB3C 4OKVB 1QSFE 4HJJL 3TIDB 3MLYL 1QFHA 3HNTL 4FTVB 4HJJH 2WSKA 3MLYH 3HNTH 2IH3B 3EO1B 4JQXC 3FO1B 4LLWB 4G43A 1OF2A 2X4SA 3MLVL 4P48A 5GRXG 3MLVH 3CSYB 5C08D 1OCWL 1YNLL 2WWKO 4LRNH 1ORSB 1YNLH 2BJML 3LS4L 4JM2A 3QG6B 2F15A 2YKLL 5CSZA 2BJMH 3EDEA 3QO0A 2YKLH 5K59F 4H5SA 3GO1L 3CZFA 5HPMB 3GO1H 4KK5C 2XTJD 4HV8A 2EH8H 4LPYA 2HA1A 4MAYA 3PQYB 3QUXA 4AENB 3WEXA 4HSQA 1FC1A 1IGJB 5IGXL 1QSFA 5I74B 1FNSL 1KCLA 5IGXH 1FNSH 5DHVH 3QAZB 2DQJL 2F53B 3ULUE 2DQJH 2FHCA 5EO0B 3K4AA 4HJGA 5H2BA 1MFCL 4ONHA 1DBML 1DBMH 1QFPA 3H7BB 3P4OB 3RNQB 1SEBB 2H32A 5T1KD 2A6DB 4ELMF 1FL3A 2CR6A 4Q9RL 2FX7H 5HYJE 4PJBB 3BQUB 1PAMA 4Y16B 1NMAL 1RJYB 1NMAH 5DVLA 1NCDL 3E1F1 4CMMA 4KVNL 1NCDH 4PJGB 1X6NA 4KVNH 3NCMA 3HCVA 1JNHA 1VPOL 2ESVE 2XFXB 3I02A 4HH9B 4GRWH 3BXNA 4HUXA 5C70A 2GFBB 1EHLL 3ZYOA 1EHLH 3NVQA 2H6PA 5HHOD 3PGFL 4WV1A 4EKXA 4LVOB 2OL3A 3HMXA 4N0CD 5IW1B 1FYTD 5HYJA 3N0PB 1S7SB 5CUSL 1RU9L 2BY2A 1SJXA 4H1LH 5CUSH 3MFFA 5A3ID 4K7PL 1NBQA 4K7PH 3WXWL 3N50A 4MAYC 3QUXC 2ESVA 4OI7A 1MY7A 5FKPB 2DLFL 4HK0A 4IS6B 5TDNB 2DLFH 3OKKA 4KVCL 1YEEL 1EO7A 5IB5B 5C6WH 4KVCH 1YEEH 2JJTA 1CLCA 3ULVF 1UT9A 1VACB 4HWBL 2B1AH 1AGBA 2HFEA 2D7QA 3PHOB 4HWBH 2AXGA 1FQ9C 3IYLW 3ZKXC 4RSVA 3RVVD 3U9UA 3ZT6A 1BVLB 2DLHA 3M45A 5GRWA 3HA0A 5HVHB 5DMYA 3TBWB 3SPVA 3QIBD 1XCQB 2ICWB 3BO8A 3QIWD 3B5HA 3CC5A 5CKAA 4NOBA 4PLJC 1N0LA 2UZXB 1W8NA 5BV7B 3CLEL 5K33A 3CLEH 1XR9B 1U93A 3HZMA 4KU1A 3B8SA 4WV1C 3RA7L 3ETBF 1OPGL 5E5MB 3RA7H 4ORGA 3VI4E 1OPGH 5DURB 5DC4B 3RUGB 4NPYB 4PG2A 1K6QL 1MFDL 1K6QH 1XH3B 4R7DB 2BZDA 2NCMA 3FRUB 1EJOL 3V4PL 4LPTA 4LSSL 3V4PH 4U6HB 2JJUA 4JFFB 1J8HB 4JJ5A 1D9KC 2HYMA 3V7AG 4LLVA 2BNRA 1IAKB 1P1ZA 5E2UH 3GB7B 3PGDB 1MJ8L 3REWA 1MJ8H 5ETUB 4CMHC 1OTTC 4U0RC 4NNXA 3U48A 3MV8E 4X7SL 2Y7QB 4X7SH 2IANB 4OQTA 5IM7B 3C6LC 2J12B 2M26A 5IJVA 2DQDL 3REVB 5DJXB 2BRRL 2DQDH 3PE9A 3SCMB 4GAFB 2BRRH 1R5VB 3FTGA 3QEQD 1CK0L 3V8OA 5I66A 1HXMA 1CK0H 3OB8A 3LD8C 4NRXA 1PG7W 2PXYD 4CNIB 4J4PD 4ZS6D 4OZFH 4P3DB 3D25A 4ONGL 2FYYA 5TE6H 4PPTA 5ALCL 1PZ5B 4ONGH 1KCSL 5ALCH 4OLZL 1CTNA 2CLZA 1KCSH 4YQXH 4OLZH 1DQDL 3MV8A 1UENA 4MB3A 3IXAA 1DQDH 3WFBL 5F7KC 5IMKB 1OAKL 3EOTL 3ZYIA 1NGXB 3MV7A 4PG2C 1OAKH 3EBAA 5FOBA 1BD2A 2HJFA 4QRPA 2DJUA 5HYIA 2GAZB 5E8DH 4PJXF 4U7MA 3M1BA 2HVJA 4PGJA 4JRXD 1MCPL 5F9AC 2P42B 2EEDA 1MCPH 3MJ9A 1E4JA 4GRMA 1KNOB 2L7UA 5ICYA 5C0DA 2QSVA 3DUUA 1J0JA 3ZT7A 1IAIL 3I50H 3G04A 4RMQA 5HGHA 5IBTL 1IAIH 1NUFA 5IBTH 3QUYC 2VZUA 3GK8L 2CIKA 3GK8H 1G7LB 4NO5B 4F9PA 1NLDL 2C1PA 1NLDH 3OKDB 5E8OA 3ARDB 3L3GA 1ZHKA 4HIHA 3KPMA 5KSUA 5J3HD 1LEIB 2YA1A 2DQHL 2R69L 2DQHH 5MEOA 4F7EB 2R69H 2GTWB 1KN2L 5DJYA 2ZUQB 3ZE1E 1KN2H 2P46B 4PJAB 5HYEA 5DDHA 1IGIL 3HE7D 4FZEL 4FZEH 3QCTH 1B88A 1LO3L 1G7IA 4HULB 5L6YL 5L6YH 1JTPA 3HE6C 4L4TD 5CBEA 5B4MC 1Q0XL 1Q0XH 3E0GA 4I4WA 2P8LB 4Y0GA 4OF6A 5FKAA 1N5YL 4Z7UE 3PIQB 1N5YH 1OAYL 3U2SA 1OAYH 1Z9LA 4QRRD 5IVXF 1H3UA 2R23B 43C9B 1UZ6F 2IG2H 3QNXA 1AGDB 3INUL 2XZAL 2X1XR 3INUH 2XZAH 2N7BA 1QA9A 5DVNA 4FXGA 4XH2A 3BVNA 4NJAH 5I17B 3SE8L 3BKML 3SE8H 4JFPA 1A1NB 1LE9A 1VKXB 4GRLB 3TPKA 4F9PC 3KPQB 3L9RA 1G6VK 3IRPX 2XWBB 3P3YA 2O93L 3Q3GA 4PRBA 2Q3ZA 1IKFL 4WNQA 1MOEA 1IKFH 4WFHE 2JF1A 3GSQA 4WUUD 4JJHA 3F62A 5E00B 2XKUA 2AJYL 5I6XC 2AJYH 1NPUA 3WNLA 3V0VA 1NFDA 2A6KA 2VXQL 4NJ9H 4YHIB 4OCYL 1MNUL 2Z92A 4OCYH 3MA7A 1MNUH 4M1CD 2C9AA 4M62L 3WO3B 1WC7A 5GXBB 4M62H 1BZQK 2DIAA 4IRJA 3DGGA 4LSTL 4LSTH 4KROB 3VWJB 1J1OL 5IHZB 1YYLL 3FQUB 4LCYB 1QLRA 1J1OH 4D2NA 4N8VB 4PY8J 4TNWF 2R2BA 4OZHE 2P8MB 4W4NA 1X44A 4MNGE 1T3FA 2XZZA 3EJZC 3S7GA 3W9EB 4JQVC 4CVZA 1UVQA 4UT6L 1GJIA 4OAWA 3K8MA 4UT6H 5ALBH 3KPNB 1KPVA 3VE0A 3TBTA 1AO7E 1U8IB 2ITDA 4JFDD 4HDIA 4XP1L 1M71A 4JY6B 4E41B 4XP1H 1TVHB 4OZHA 4LSUL 1AKJA 1T6WA 1IL1B 3RWCA 3X14A 3ARFA 1NC4A 4LSUH 4ODVL 2FIRT 3C8HA 3L5IA 4ODVH 4MNGA 1M05B 3MFGB 4AM0B 1A6VH 1H5BC 5C0CD 2Y1VA 1T1ZB 3VCLB 1FG9C 2R2CA 1CFBA 1F3JB 1D5BA 1RPQA 4ZS7H 1PJ9A 3RGVD 5DUML 5DUMH 2ADIA 3T0EC 3O81A 4QRUB 4NRZA 3RPIA 5JIIA 1NQBA 2HG5B 5I1KL 5GGUA 4QCIA 5I1KH 4RIRA 5F3HB 2YEZB 3VFGL 5HI4D 3VFGH 5JW5A 4LCCA 5C0IA 4K8RD 4A6YL 5ADOL 3B9EA 5JTWA 4A6YH 5ACMA 5ADOH 2V5RA 5CGYC 3UP1A 2DWEB 1QBBA 4PJ5B 4RAUA 4WI7A 2OZ4L 5BRZA 5BQ7A 2OZ4H 1A4JB 3BPOC 5DFTA 5EUKA 1SJHA 2UWEA 3I6KB 5IV2B 3ARVA 1Q0YL 1GGYA 1P4BH 1Q0YH 3NBNA 2WWMC 5DRWB 2YXFA 4GW5B 3GMNA 3T0XA 3EO0B 5DK0B 2W9DL 1CZ8L 4JFEB 2W9DH 1CZ8H 5HDQL 5FK9A 4OB5L 5HDQH 2CLVA 1TCRA 4OB5H 4PJ7B 2W91A 3WUWG 3NPSC 4UBDC 4ZFFB 3L3IB 3IU4L 4LVNB 1RMFL 3VFMA 3IU4H 1P7KA 3MLUL 4L4VE 1RMFH 5HGGS 3MLUH 3G5VB 4EQ3A 2EE9A 3EFDL 5EZOL 1PD6A 4TOYH 3EFDH 1EX0A 4OGAC 5EZOH 4AYFA 3DV6A 3GSUA 2YS4A 1EFXA 2BNUA 4C83B 5L8JB 3MCKB 3OHXB 2CGRL 3P0VL 3WHXA 4UNVA 2JJSA 3P0VH 2CGRH 3BWUC 1Y6KR 1PY4A 3RHWF 2R1XA 5GSVA 2VDLL 5D2NE 1KPRA 4PLOB 5IK3A 4LCCC 1EFQA 4QYOB 5HHNA 5KSAA 2FRGP 3O6KH 4F3FA 4APQB 4Z77B 4X5LA 1MCRA 5DGRA 1DLHB 3AM8A 3W39A 4ZUWB 5JXED 5D7IB 2HAZA 4ETYA 4JFZL 5EBWB 4XXDB 1FFNB 4PG9B 2EYRA 4D9RD 5D2NA 2F54E 5GIRA 5MEPB 2IALA 1Q1JL 3UAJC 1Q1JH 4L9LA 5E1AA 3QUMH 1U8MA 2ATPB 2YPLD 4HWBA 1CD1B 4XX1E 1OSZA 3QRGL 3C5ZA 4YLQT 1BEYL 4R2GD 3VDCA 3P2TA 2A83B 4M9PA 3KWWA 4N0YL 2XNAB 4N0YH 1P6AB 3LZFL 3RZWA 1JTTA 3LZFH 2XZQL 4MQSB 4QT5B 4QTIH 1M7XA 5LG1A 2XZQH 3U30C 5KAQG 3C60B 2F54A 1R0AL 1R0AH 4C56D 1ORQB 3SGEI 3KLHC 4N0FB 3E6HA 3ARYA 2IH1A 3WS6A 4M6AA 1WJ3A 4B0MM 3V6ZB 5KSAC 1V7ML 4MJ4A 3W0WE 1V7MH 3WFDL 1OW0C 3MBED 3WFDH 3B9VA 3VXMD 5MERB 5GGSY 1I9JL 1I9JH 1U3JA 5IBUG 3LQAL 1QFWM 3EFFB 1I3RB 3LQAH 2VXUH 3VFTA 5D1XC 4FQPA 3KLAA 1CDBA 3AU1A 1BECA 1OWRM 2JELL 4HPOL 3SJVB 2JELH 4ODHL 1MHEB 4I2XE 3GMRB 4ODHH 5C2BL 5C2BH 2AJSL 4JKKA 3BN9D 3BX7C 2QSCL 3W0WA 3MRFB 2QSCH 3U4BL 2EIEA 1BBDL 3U4BH 4HFWA 2UUDH 1BBDH 2E9WA 3C5ZC 4AJ0A 1CXHA 1K4CA 5J11C 3IJSA 4P3WA 4Q6IA 3OKMA 1RZ8A 1M7DB 3NFSL 4KKCD 4UOW1 3TESA 3NFSH 5DWUL 3BEVB 5ESQA 4HC1L 2Q7YA 1BVZA 5DWUH 4H8WL 4GW4B 4HWZB 4KZDL 4H8WH 4KZDH 4S0SD 2JB6A 3HRZB 4I2XA 4O2CB 3LKQB 4OZFA 3QUKA 2CUMA 4WEMB 1RV6X 2A2QT 2V5TA 4LCWD 4NQDB 5DMKB 4JRYD 1NKOA 4GW1B 1TZIB 1SJEB 1T0PB 5DT1L 5MI0B 5DT1H 4QHKI 2QQNL 1MREL 3CDCA 2QQNH 1MREH 3ARTA 4XHQA 4PGDA 4P4KD 3MX0A 4XRCB 2DM4A 1TETH 1VFBB 1TTFA 1Y18B 3K2UH 3S9DB 1UB6B 1NAKH 1D5IH 5F6HJ 4NCC1 3MGOB 4OGZA 3RKDD 3QXDB 1WZ1L 4DVBB 25C8L 1WZ1H 3BZFB 25C8H 4RAHA 1FNGA 5LBSL 3MTRA 2ZUTA 5LBSH 1BOGA 4WW2B 1PY9A 2NY6B 1A6ZA 1U92B 3RL2B 3P77B 3P73A 3OKNB 4U1SA 3MROB 4Q6IC 1LO4L 1IGFL 3LDBC 3VMNA 1LO4H 4JFHD 1IGFH 3S35X 4KZEL 2B20A 4FQCL 1CE1L 4KZEH 4FQCH 1N3NB 1CE1H 2EH7L 5DS8A 3RPKA 3FQWA 3N1PC 5JNYB 2CQVA 2BCKA 3UC0L 3UC0H 4N1HB 4MXQD 3AUVA 4YXKL 4NKDA 3AGVA 4YXKH 4D0CB 1WBXA 5FFLA 1IE5A 1MCOH 5KVEH 2JCCF 3MR9A 3L3OA 1BJMA 4Y19E 4JREB 5D9SB 4AZ8A 3AREB 2QHLA 3K8LA 3QDME 4U1JA 1A22B 2GHWB 1JBJA 32C2B 3MV9E 1CVSC 3SDXA 5B38G 2DKSA 2IAMA 1DEEB 4YGVA 3UTQB 1MSPA 1FSKB 2BSED 4M7LT 2XKNB 4NZRL 1AHWA 1BBJA 4IDLA 4NZRH 3DX6A 5ACZA 3TGXA 4APQD 1FZOB 2D7TH 4PJCB 4JHZA 1XZ0A 4Y19A 5I1IL 4AEHL 3FHAA 5I1IH 4X6BB 4TQEL 4AEHH 4FQQB 1SMOA 3DMMD 4HK3N 4TQEH 3QDMA 3G6AA 3PP3K 3G9AB 4OSUL 1J0YA 4M7KL 4NUGL 1KLUA 4OSUH 4M7KH 2MHAA 4NUGH 3ZE0F 4J3XA 3KS0H 3ARGA 1FBIH 4LBEB 2ATKB 4DZBA 3HC0B 2W59A 3U0WL 4I0CC 3VXNA 1J8KA 4ZXBC 3U0WH 3NA4A 1C5DB 1W0VA 4JPIA 4JO1L 4ODTL 4ODTH 4M8QB 2YWYA 3RY6A 2P24B 4WI3A 5DJ6B 1VFAB 3PWPB 1CT8B 3PWJB 4NYLA 3ZT5A 1MCWM 4PRNB 5DJ0B 3IFOB 4ETQB 5ESAA 1LEKA 4K07A 5EULV 4YE4L 4OFPA 4Q6YA 4GBXC 4YE4H 1W72A 4MD4B 5C6TL 2K7QA 5C6TH 2WBKA 4F8QA 4OF7A 5E6ZA 1AHWC 1DVFA 4CADB 2FEDC 5KSBB 5H35A 3IGAA 2VR9A 4UOW0 1WISA 4D0DA 1QQDA 5CS7A 4EUPG 3U4AA 5M7QA 3UJIL 2HTLC 3C6SA 3GJEB 4UDTA 4JZJB 5GSRA 2A1WL 2DS4A 3MRPA 2A1WH 3SE3C 2FEEL 1BJ1J 2WUBL 3DV4A 2WUBH 3GIVB 5I1CL 2X70B 2V9RA 1T1WB 5I18H 5I1CH 2EDDA 3OPZL 4OF0A 4GS7C 2ZOKA 1Q38A 3TBYA 1NDGB 5ILTL 5TGBA 1D5XA 4AY0A 4NQEB 2P4AB 1QEWA 2YK1L 4XPBL 1S9YB 2YK1H 1FRGL 4RDQF 3VD5A 4XPBH 1FRGH 4LLUB 4LU5L 2CIIB 3HHRB 4LU5H 1HHHA 3ZTJH 1XIWD 3BIKB 3EHBC 4G6AD 5F7WC 1FV1A 4AEFA 2PO6A 3TN0A 1TITA 5BXFA 2NPLX 1TXKA 1DVFC 4PGZA 4PJFF 4PYGA 3GSXB 1UKQA 4NDMA 1J0KA 1NL0L 1S7XB 1NL0H 2ZCHL 4EBQL 1MCBA 1D6EA 2ZCHH 4MCZB 5HHPB 4EBQH 3RY5A 1YEGL 1MUJB 1KV3A 5DHXB 1YEGH 4IM8A 5D5MF 5DQ9B 4G8IA 2Y23A 3ZE2E 5JORA 2NLJA 5TQ2L 1HIMH 5JA9A 2A77L 5DD1L 4O00A 1IGYA 5TQ2H 2A77H 5DD1H 4PFEA 3OKOB 2HMIC 4FG6D 1UXSA 1LO5B 1FH5L 1FH5H 5F8QC 1S7RA 4KHXL 4UTBL 1KB5L 5MEQB 4KHXH 4PV9A 4HCRL 4UTBH 1KB5H 4HEME 4U05A 1JHTA 3HRPA 4HCRH 5EIIA 1X5IA 4ZFOB 1L6ZA 2V17L 4BA8A 1A1OA 2BNQA 2V17H 3SQOL 3SQOH 1FN4B 4WTZG 4D3CL 2EYSA 5EDXA 1OSPL 5SWQA 4D3CH 1OSPH 1WAAF 5IHUH 3AMLA 1ZGLA 2XXCB 1ETZB 1A6AA 1Z5LA 5BZWB 2LAAA 3QDGB 4U1GB 5EZIL 5EZIH 4X0KB 1P4LA 4HLZG 3V7AE 5BZDB 1VB9A 3I75A 4MZ3A 2YWZA 4Y4HB 3TN0C 4HUWA 3LS5L 3VG0L 1S7VA 2AJVL 3RVUD 3VG0H 2AJVH 3TBVB 1IGML 5FCSH 1CU4L 1RZJL 1IGMH 4XWOC 1CU4H 1RZJH 1CDIA 3QEHA 3O11B 2NZ9D 1U8QB 1ZLVK 5F6IB 1AD0B 1QBMH 4DEPC 5JR1L 3HR5B 5JR1H 3GMLB 5C0ND 4PREB 1BX2B 4OGYL 4JDVA 4OGYH 2X10A 3ILPB 3LKOA 5DA0B 3BKJL 1RHHA 4H25B 1V8HA 2WLYA 3EAKA 4BZ2L 3WN5B 4BZ2H 5LGJA 1R24B 2GITA 1A3RL 4I1NB 3BGMB 2GJZA 1A3RH 5C3TA 4JM2F 4G8EB 5F7MC 3L7EA 2DL2A 1A1MA 2A9NH 5J1TC 2AV7B 4O2EB 4MNQE 5C1MB 4YFDB 2YMXL 1BZ7A 2YMXH 2NZIA 2CK2A 3T0BA 3TNNB 4N8VG 4F7PA 4S2SB 1FNEB 4PRHD 3VGDA 5TJWK 3QO1A 4BJLA 2CDFB 4GUPA 3CUPB 4UIMB 5IKCB 3EOAB 2YD4A 3O8XA 3UTPD 5I30L 2ZUWA 1EPFA 4GAGL 1FZMB 1X3DA 1ACYL 3G6JE 4MNQA 5E9DB 1ACYH 1CFQA 5JHDE 3DI3B 4YX2L 2DQEL 4HMDA 4Y4KD 1L9NA 4ZPTB 4YX2H 1OVZA 1KIQB 1QBAA 2E6QA 4ZMAT 1Q94A 2X1OA 15C8H 1ZT1B 2VWEE 2WP3T 4HUKB 1MCHA 4HUUB 3ULUF 1K8DB 1R3IH 3O41A 3IDMB 3RWGB 2GJ6D 3H9HA 4CU6A 1CL7L 5DVMA 3GSNB 4KY1L 4LPCA 4KUCD 1HSBA 5DVOA 1UWEH 2APVA 1A6TB 4J3WA 4RMRA 5B8CA 4Q9CA 1J7VR 4UQ2A 3QH3B 2JTDA 4XC3L 4AQOA 1YPZE 5KANI 4XC3H 3QJHA 3D85A 5DD0L 3RVTD 4TVPD 5I16A 3MRMB 5DD0H 1JPFA 3JWDL 3KDMA 4HXAL 4F2MB 3FKUS 1T04A 3JWDH 4HXAH 4PJ8C 4I9WE 4JY4A 2PTUA 1MWAH 4WI9A 4PJEE 3B5GA 4GKOA 4E9LA 3TA3B 1GVIA 4EI5A 4HC1A 4NNYB 4NO2B 4YHLL 4X9HA 4YHLH 2F74B 5E2JA 1AFVL 2EDYA 4R0LB 3KGRA 3QNYB 3VXRD 4GKNA 2Z31A 3D39B 1J05B 2EDNA 3BEWA 2AJXH 2G75B 3HG1B 4MQ7B 5EOCH 4PJEA 1P2CB 3ZKND 5C0JA 2RGSA 2QADD 3ZSTA 1ED3B 1WIUA 1LK2A 5L7XL 1SY6L 1YMMD 2AAVA 1NMBH 3PDOB 5L7XH 1SY6H 4LASL 3LQAC 1CFTB 3QIUB 4LASH 1T7WA 5A43C 1FDLL 3N1FC 4ZO8A 1FDLH 5B8CC 3C09C 5JIHA 5BVPL 1NMCB 3QISA 2VWEC 5BVPH 5LGHL 4D9QE 4AEIL 3WLWD 1OAUL 5LGHH 4AEIH 1KJMB 1OAUH 3BRFA 4QHNB 2J5LB 4WEBL 1BIIB 4ZAKD 3W9DB 5JXAH 5DUPH 3SDDD 4HKXA 1REIA 4ZQKA 4NQCA 5T3ZH 4L3ED 3NFPA 3L5HA 2Y9RT 4EI5C 3VI4F 1KCUL 5ESVA 1VHPA 4H8WC 1KCUH 3K46A 3OSKA 1LMKA 1HYRC 4HHAB 4RGMC 2MKLC 4DK6A 1T22B 2YUWA 1JZ5A 3KPSE 5J12B 4HWEL 5C0EA 4Y4HD 2NY0C 1ZHLA 3GMQA 4LGPB 35C8L 2OTPA 1Z3GL 2H8PA 4OT1L 35C8H 1EEYA 1Z3GH 2E7CA 3IDYC 4OT1H 3WFCL 1DUZA 3WFCH 1NC2B 3LN4B 4MHHG 1U3HA 2DRUA 5KG9B 3OKEB 4KUZH 3VFNA 3T2QA 1RY7B 1X9QA 3SDAB 4GLRH 1JPGB 2BY1A 1DQQA 3KPSA 2VITA 5IQ7L 6CGTA 1R3HB 2NY2B 5IQ7H 3IDNB 5FYKD 3B2VH 2BHYA 3MGTA 1DQLL 1T5XA 1DQLH 2VISB 3CSPA 4IRSC 3EDDA 3ECBB 4M03A 1NCUA 4HWNA 1RULL 3R8BB 1IILE 3GRWL 3BD5A 4Y2DC 3GRWH 3PGCA 5J13B 1K9TA 2ZUUA 4XNXL 4BUGA 4ONOA 2HT3C 3HI1A 3QBTB 1A3QA 3BIBX 1KCRL 2ZPKL 3MRCB 3HN3A 2ZPKH 4S1DC 3T04D 2IF7A 3V52L 4YHKL 4U31A 2QR0A 5DEGB 3V52H 4OV5A 4TPRL 3PP3H 1QVOB 3TO2B 4BK4A 1DN0A 5KS9E 4X9FA 3JWNC 5FM4A 3V4UL 3CDYA 4XZUA 1N6QH 3V4UH 4R4ND 3VFPA 3HAEH 3RDTA 5HHOE 2ZG1A 3BKYL 3BPNB 5IMMA 3BESR 4OM0H 1U3HC 3V0WH 1G0DA 2AXHA 1A9BA 4OUUB 1F90L 3LVEA 5CD3B 1F90H 2VZVA 3GIZL 3WNMA 1FG2B 1FL5A 5F88A 3GIZH 4QY8A 4LDEB 5T1LD 1Z0MA 1QSVA 1YEFL 3P9MB 1YEFH 4C59B 4PLNC 1AXIB 2UV3A 2AJZB 3VD3A 4UB0L 1RIHH 2H2SC 2R1WA 4M7LL 5HHOA 3FT3A 4UB0H 3CZJA 4M7LH 5DUBA 3EYVB 3TH4T 2G5RA 4X98A 3EDFA 3FN0L 3WUWA 2DLGA 1MIML 1TLKA 1PKQA 2C1OB 2V2XB 5K9KB 3TYFB 2VXSL 2VLJB 2VXSH 1I85C 3QXUA 5IG7B 1FO0B 4BELD 5HGAA 4HKBA 3ZSSA 4IBLT 3B6SA 1G7QA 2P5WD 4TUOB 4PP1C 4P5MA 3G08B 4JDZB 4Z7UF 1A9EA 4R90L 4P23C 4FQXB 1DQTA 4R90H 3OTTA 4BQCA 3VH8B 3RTQB 4NCC2 1YZZA 2P5ED 3KLSA 4QRQA 5E8EA 1AI1L 2X5PA 2MCG1 1AI1H 5KVFL 4WO4A 5F71A 5KVFH 3VRJA 5JOFB 3IJYB 4GQPH 4LQFL 1EHAA 4LQFH 1NCAL 3VRIA 1B9ZA 3T1WA 2X4NA 1WVZA 4P46B 4BQ8A 3MLWL 3MLWH 5DTFB 5ISZD 1WCBB 2PYEB 3NGBC 3PABA 2HFFB 1UCTA 5EBLA 4R97C 3Q6GL 2R2HA 5C0BD 3Q6GH 2E9JA 5AD0B 2VABA 8FABB 3ORJA 1UZ8B 3LEXB 4O2FA 4V2CB 4X7TB 2EE2A 1U8KA 3BAEL 1T7ZA 3BAEH 2ZP0T 4HCRA 5I8EA 4AMKL 5DYOB 5MP6L 5MP6H 4FFWD 3PJSB 3QFJB 4R6UA 5IB1B 1DQJB 4PTTA 4U1KB 3ZO0A 3C9NB 2E27L 3NH7L 2E27H 2D7PA 2E7BA 3NH7H 5I71B 1XF3B 4NZTL 4YFEA 4OZHF 5CEYB 4TN9A 5CSBA 4ZSOE 4TSBL 3NIDF 1HXYB 3O4LE 4KJWC 4J1UB 4FTVE 2VDKH 5TDPB 1K3IA 5E6IA 3QG7L 5D1QC 4NCDA 1NC2D 5DJDA 1DDHB 5FO7A 3EKCA 4HS6B 4QF1A 1N0XL 5HYQA 3SDAD 1N0XH 2ORBL 2ORBH 2IPKA 3FFDA 4OZIF 4ZSOA 1KTRL 5J6GA 2W65B 3WL9A 3O4LA 3PQYE 4G7YL 3B9KD 4OKVA 4G7YH 3TIDA 4FTVA 1DBAL 4JQIH 2IH3A 3EO1A 1DBAH 2EXWD 2F53E 3FO1A 5FUCC 4NC1C 2D0GA 5A2IH 3CSYA 3VXTB 4YFLI 1J5OL 1ORSA 4CVWA 3BD4A 3QG6A 3PNWA 1H3PL 1I1AB 1H3PH 5HPMA 1XF2B 1XGRB 1WIPA 4XXCA 2Y6SD 3PQYA 3VMOA 4AENA 1IGJA 3T3PE 1JMZA 2F53A 5J4MA 2CDEB 4L4TE 5GGVL 4PJGE 5GGVH 3EW3B 1I8IB 5EO0A 4UT9L 4PJ9B 4UT9H 1RZJC 4POZD 1AD9A 4UAOC 3O9WD 4K3DL 3NZHL 4K3DH 4JO2L 2VLKD 3NZHH 3H7BA 3P4OA 4JO2H 3RNQA 1SEBA 3BUTA 2A6DA 1DANU 3I85A 2D7MA 4QRRE 3HE7A 2NR6D 4PJBA 3BQUA 4Y16A 1RJYA 2A73B 2PF6A 3PXJA 4YBLC 1RIVL 3P9WB 1RIVH 5D2LE 3CD4A 4MGXA 4PJGA 4NO3B 3D5OF 1JJUA 4OCXL 2XFXA 4HH9A 4OCXH 1FCGA 4NKIL 2GFBA 4IDJL 4NKIH 2FX9L 4IDJH 4JPWH 2BVEA 2FX9H 2VZ1A 3MUZ1 3ARBD 1QSED 3BSZL 1T0MB 2VLME 2ENYA 5I2IB 5IW1A 3AFLA 4DOHB 1S7SA 3H6JA 5C8JB 4M43L 4M43H 5DZOA 1AXSB 5JW4R 4L3AA 1I8MB 4EIZC 1MFNA 2XXMB 4H0HB 5FKPA 5TDNA 5T5NG 2VAJA 3QAZC 4I48B 3UXFA 5IB5A 4Z7WF 2BX5A 4LK4A 2XOTA 3GSWB 1PKOA 1VACA 1HYSD 2DQIL 2AEWA 3PHOA 3S98A 1HE7A 2VDMH 2HJKB 3ROOB 5EO9B 2Z8SA 5CEZL 5CEZH 1BVLA 1TVDA 1EGJA 3TBWA 3KNBB 5AEAA 1XCQA 12E8L 3BQUC 2H45A 2ICWA 4XBEL 2D2OA 3EYOA 4P46D 5C9JB 1HQRB 1OGAD 3S3JA 1T0NB 1XR9A 5BW7C 4RRPA 5E5MA 4W68A 3OF6A 2JJVA 3WFEL 3RUGA 4NPYA 1FZKB 4D8PB 1RD6A 5DQJB 1XH3A 4R7DA 4OLVL 1T66D 4OLVH 4X6DB 2EIBA 3FRUA 5C9KA 3Q5YA 3CFJB 3JWDC 5JZ7D 4PRIB 3VRLE 2IANE 1L7TL 5HHMB 2VO5A 1L7TH 4U6HA 1HCFX 4JFFA 1NLBL 1NLBH 5C0CE 4HWUA 3SBWA 1A6UH 1H0DB 1WT5A 1IAKA 5FGRA 3SY0B 3PGDA 3KXFB 1GIGL 2MQCA 2VE6B 5ETUA 4RMWA 4KI5E 1GIGH 4U0RB 5SWSD 4QLRA 4LFHD 5DI8B 1F58L 1NEZB 1F58H 2Y7QA 3C8DA 2AGJH 3MYJB 2IANA 3C6LB 5IM7A 3T0AA 3ZDZE 3DO3A 3REVA 5DJXA 3SCMA 1R5VA 5GS2H 2XG5A 4HAGA 4CNIA 3KPRD 2DKMA 1C16B 3T0DA 4P3DA 1OAQL 4I0KA 4JANB 5AWNH 1OAQH 1PZ5A 4OTXL 5CLTA 4OTXH 5D1ZD 1U8OB 1KXTB 5J1AB 5IMKA 1S5HB 3NA9H 3U9PL 2ICWJ 3HB3D 3U9PH 3NIFE 1I8KB 5L8KB 2WQ8A 4RWYL 3UCRA 4U3HA 4OLUL 2GAZA 4ZNEE 2HKFL 3GRWA 3JV6B 1GZQB 2HKFH 2OP4H 3RWEB 3QQ9C 2FHBA 4DUVA 4YGAB 3G5YB 1JNNH 3U6RB 5L88L 4WUKL 3PV7A 3DYOA 1VFMA 3MNZB 4KK5D 4WUKH 4KH2A 1AQKL 2RFXB 3VA6A 1AQKH 1KNOA 4PJAE 4FXKB 4EDWH 5BOZG 1U3ZA 4X4YB 3QUYB 2I9LA 1QR4A 2WWKT 3F6LA 5EOTB 2DAVA 4ZNEA 1G7LA 1T20B 4NO5A 5SX5H 3DROB 1PSKL 1G9NH 1PSKH 3OKDA 3ARDA 5TH2B 1LEIA 2LVEA 4POUB 4F7EA 1UCBL 2GTWA 4XMKL 1UCBH 2XN9D 4XMKH 1XAUA 3VXSD 2OMBA 2DQCL 4PJAA 4KKLC 3WIHL 2X41A 4ZPVB 2QTEA 4M5YL 3EOBB 4KPHL 1RZKL 3SDYL 4JAMB 2GIYA 4KPHH 5HDBF 1RZKH 3SDYH 3HE6B 3AY4A 4Z76B 5ADPL 2B39A 2NX5D 5ADPH 1KIRB 3MRDB 4ELMB 4WWKB 2JB5L 3JVGC 4M02A 2JB5H 1GL4B 3BZEB 2P8LA 3G6DL 1G0XA 4WTZA 3G6DH 3PIQA 4JM2D 5E4EC 2MFNA 3GBLA 1A7QL 4PV8B 3UTZB 5C92A 4BSWB 1A7QH 2R23A 2B5IC 2DQTL 1WCQA 3EIFA 43C9A 2DQTH 4LGSB 4NHUB 3DX9B 5B22A 1AGDA 2HWZL 4MAYD 3QUXD 1BQLL 2HWZH 3IFPB 1R5WB 1QSFD 3BWAB 4UNTA 5CIPB 4CL7A 5FYKU 5I17A 4C56E 1HKLL 3FB6B 1A1NA 3HNSL 1FNFA 1HKLH 1VKXA 2FLRT 4GRLA 3HZYB 3KPQA 1U8PB 3ARDC 2GUOB 2XWBA 4YDVB 1TCMA 3RWFB 3BP6B 2Z35B 3R0NA 3UPCA 5D6DA 4JGJA 2ZUQC 1CDUA 3GSRB 5E00A 2B4CL 3S3SA 1G84A 3B2UD 2B4CH 3FZUD 1K4DB 4YAQB 1N64L 1N64H 4YHIA 4Y2OA 2DIJA 2LU3A 1S9XB 5CJXA 5GRZA 3CVHL 1EHNA 3CVHH 4O58H 4QWWC 1OT1A 3CH1B 3DO7A 3VWJA 1EV2E 4LP4A 1RK0B 1FL6B 5IHZA 3FQUA 4LCYA 5ENWB 4N8VA 4U7SA 4E41E 1FE8L 3K80A 2R0LL 5E94B 4NQVB 2R0LH 2ESVD 2P8MA 4EQ2A 1IQWH 2H41A 3GMMB 4JHAL 1IJ9A 4JHAH 1S5IL 2W9LA 4HG4J 4HH8A 3W9EA 1JZ3A 1S5IH 4M48L 1D9KD 2P45B 4M48H 5IB2B 4GRLC 3FONB 4JRYE 1CLOL 3U36B 3KPNA 5JW4N 3KXFD 1U8IA 4UU9B 1JWSB 4TUKL 4JY6A 4E41A 2LQRA 5D6DC 1TVHA 2BHZA 1IL1A 1S7TB 4YHNB 3DECA 2MKWA 3N1MC 1UH2A 2OXGA 1M05A 1H5BB 4AM0A 4F7CB 1TQCB 2CDGB 1ZTXL 1T1ZA 3VCLA 1ZTXH 1GPOL 1IEHA 2EZ0C 1GPOH 4KXZH 1XEDA 1INEL 4Q58C 1NFIB 1INEH 4PJ5E 2I60L 2I60H 3T0EB 3QHZL 3QHZH 1WF5A 4QRUA 1ZEAL 3OBAA 5FXCH 1M7IB 3O6LL 2HG5A 1GGCL 3O6LH 4KROC 1GGCH 3DUSB 3VWJC 1LQSR 4YBHA 5F3HA 2YEZA 1XGTB 1YECL 3FQRB 1X5JA 1UM5L 1YECH 1X5FA 1D6VL 4I0PC 4JFEE 1UM5H 1D6VH 2DB8A 1J1XL 1ZVYA 4RWHA 1J1XH 3OKLB 4PJ7E 2DWEA 3U83A 4PJ5A 1H3XA 4NBZB 2VQUA 4ZD3H 3BPOB 5D7JB 1A4JA 3RX5A 3WD5H 7FABL 1V05A 2BNRD 7FABH 2NXZC 4RZCB 3SDCC 3UPRB 3Q6FB 4Q9BA 3I6KA 5IV2A 1EVTC 3LPFA 5DRWA 4ZFOL 3KG5A 3QB7C 1HH6B 4GW5A 5EH1A 3VWKB 3EO0A 3RIAK 5DK0A 2VJXA 3AROA 4JFEA 3ZE2F 2PNDA 2J6EL 4PJ7A 3D3VB 3NPSB 4U0QB 2J6EH 5FGCB 3QEGL 3G5XB 4ZFFA 1IQDB 1ND0B 1PG7X 3L3IA 3QEGH 3WSQH 2RQ8A 3G5VA 2YSSB 4PJHB 2C5DC 3TYGH 4MAUL 3QWRA 1O7SA 1OARL 4MAUH 3WO4B 1OARH 3VJ6B 4C83A 4CUCA 1QUNA 3OHXA 3MCKA 1RUAL 2DIBA 3R4DA 4OF8A 2FZ3B 2A9ML 3FO9B 2A9MH 4LEOB 1MJJB 3VH8G 3MV7D 2VIRB 5ICZB 5B4MD 4P2YA 3SE9L 1BD2D 2KZWA 3GGWB 4QRPD 4M8VA 1D7FA 5IT2L 4U6VL 4QYOA 1L6XA 5IT2H 4U6VH 3ZHKA 4APQA 4Z77A 4HG4K 1DLHA 1IEBB 2ZNWA 4ZUWA 5D7IA 4RA0C 3QI9C 4DKDC 4R4BB 5H8DA 3HZVB 5EBWA 4Q0XL 4XXDA 4PGEB 1FFNA 4HJ0C 4Q0XH 4PG9A 3QSKB 5DHVB 2YXMA 3VFSB 5E99L 4XP5L 5MEPA 2QQKL 3DVFA 5T3XL 1CBVL 5E99H 4XP5H 1ZT4B 4KV5E 1CBVH 4LLAA 2ATPA 1LVEA 1RZ7L 4N1CA 1ZXQA 3CFDB 1CXEA 2A83A 2XNAA 3VXPB 5IROA 5MHSE 1XF1A 4QT5A 3MPCA 3U30B 1I4FB 3U0PB 4TYUA 3C60A 2HLAB 2GSGB 4H26B 1MPAL 3SGKC 3QCUH 1ORQA 3FOLB 5F3BB 4N0FA 1B2WL 2EO9A 4LFHG 4BH7B 5F9OH 1B2WH 4R26L 3SJVE 2X09A 5TE7L 1AQDB 3NABL 5TE7H 2KKQA 3V6ZA 1CG9B 4G8FB 4J7RA 1CI5A 3GSNL 5MERA 4H1LB 3GSNH 4N8CL 1Q9OA 2NW3B 4N8CH 3G6JF 3U46B 1N8ZB 2AK4B 3EFFA 1I3RA 5D1XB 2EC9T 4HIXH 5BOPA 3EJZD 3SJVA 1I9IL 1MHEA 1I9IH 3GMRA 4UTAL 3FN3A 4UTAH 5H37G 1IAIM 3MRFA 1NH6A 4S0TD 4NQDE 5BVJB 3FOMB 1DBJL 1MCWW 1FIEA 1DBJH 2P47B 2OXHA 5DLML 4KKBC 4U49A 1G1CA 3BP7B 1AR1C 3O3UN 2X40A 3BEVA 2ILLA 1EO5A 2CRIA 4XVUC 2H9GB 2WBJC 5IROC 2OR9L 4GW4A 4HWZA 2RR3A 1QRNB 1YPZF 2OR9H 5HI3D 3HRZA 5DC0A 4Z7QE 4U7KA 4XCCL 2YD2A 1DL7L 3QEUB 5E70A 4O2CA 4XCCH 5CP7B 1OL0A 3LKQA 3BH9B 3DPBA 2Q86B 4JZOB 4NQDA 5DMKA 4GW1A 1TZIA 2EE6A 3ARSA 1LD9B 1SJEA 2DTML 4PP2B 2DTMH 3GSOB 4RISL 3T0ED 3BP4B 3DRTB 4RISH 5HD8C 4PB9L 1KC5H 4K94L 4XRCA 4PB9H 4K94H 1VFBA 3DNKA 1Y18A 1I9RL 2VOTA 4NT6B 1UB6A 2O5XL 2O5XH 1SM3L 2CRZA 4X80L 5HYSG 1S9VB 1SM3H 4X80H 3MGOA 3UMTA 2GK0B 3QXDA 3T8XB 4DVBA 5CGYD 4ZTPL 3BZFA 1KLFA 4XCNB 3LAFA 4ZTPH 1CF8L 1CF8H 2W0FB 3IDIB 3RL2A 2D3VA 2HP4A 3P77A 3QT2A 4QXGL 3LKPB 2VDNL 3OKNA 4QXGH 1Q9LB 2VDNH 3MROA 2WWMD 3OKYA 3OMZA 3FFCD 3Q48A 3ALXA 2X1PA 1AKJD 4OKDA 1UKSA 3ARFD 1M6OB 1N3NA 2YA2A 4OCRL 5FCUL 5I1EL 5JNYA 4UBDD 5FCUH 2NY4D 1OP3K 1MFBL 3F5WB 5SWZB 1ZANL 3H9SB 4YPGB 1ZANH 1Y6MR 2X7LB 1S7UB 4D0CA 2CSPA 3BISA 3WIHA 2G5BB 4PJCE 1MAML 5EZLB 2E8ZA 2AXJA 5D9SA 3NN8B 1UB5B 3AREA 5E0QA 5IW6B 4L4JA 3KYNB 1BFOB 1H15B 1T5WB 1CICC 32C2A 3STBA 4BQ9A 3P9LB 1KIUA 4GG6B 3TO4C 1DEEA 1IFHL 3UTQA 1HN1A 1IFHH 1PZUB 2XKNA 4LGRB 5HBBA 1AGCB 4DN4L 4KTEL 5BRZD 4X7EC 1FZOA 2V9QA 3IFNH 4KTEH 4DN4H 4PJCA 2VXVL 3LEVL 3S36L 2VXVH 3LEVH 4WW2C 3S36H 2NY6C 4X6BA 4FQQA 3ABZA 3A6CL 3UTPE 3OX8B 3A6CH 3L3HB 4OV6F 5TF0A 5IOPB 3E8UL 3VXUB 3E8UH 4CDHA 2DLIA 4G5ZL 3HR6A 3UAJD 1G9NC 4G5ZH 4LBEA 1VENA 2ATKA 2V7NB 4NKQB 3IF1B 1A02N 3HC0A 4ZXBB 1QR1B 4Y5XB 4WVRA 3RI5K 4OIIL 1C5DA 4EI6B 3A0OA 3IDJB 2FJGB 4M8QA 4MVBC 2UVFA 3ALPA 2F8VA 5KSBE 2P24A 5DJ6A 1NBYB 1VFAA 4TVSa 3PWPA 3OR7B 1CT8A 1RZKC 3PWJA 4XNZC 2IC2A 1EFXD 4PRNA 5DJ0A 3IFOA 4JREC 4IJ3C 3ZYJA 4ETQA 4DUXA 4JN1L 4KC3B 3AREC 1KXVC 5FYLE 4JN1H 3V7MA 4LCIL 3KLHD 1EXUB 5FB8B 1K85A 1MJUL 3LN9A 2Q3AA 4LCIH 4GBXB 3T2NH 3DXAB 4NWUL 2DYPD 1NEZG 4MD4A 4NWUH 4DJMA 1CD9B 5F70A 1ZS8B 2DQFB 4X7CC 1KJ3L 5KSAD 1P9MC 3I3BA 4CADA 5KS9F 3CMGA 5KSBA 3L3JA 5A16B 1BWWA 5SV3A 1FFPB 4LPXA 2FB4L 3ARUA 3PP4L 1QOKA 1YQ2A 2FB4H 2FBOJ 3PP4H 4KWUA 4NQEE 4NBXB 4G3YH 4P2RB 1P6FA 2OBGA 4HKJB 3GJEA 5EIVA 1CVRA 5FUOL 1NEUA 1B90A 4JZJA 5FUOH 4ZO9A 3V6OC 3VXRE 1HH9B 1G7PB 3GIVA 3C5ZD 2X70A 1T1WA 3RX7A 4MWFB 4P2QB 1V3LA 4G7VH 4GS7B 4O4YL 1YC8A 2R1YB 1NDGA 5TQ0L 4NQEA 4P5TB 5TQ0H 3C2SA 3MLZL 3V6FB 1AXTL 1QD0A 1S9YA 2B4CC 3MLZH 3PWVB 1IM9B 1AXTH 1EK3A 1YMME 2VL5B 5INCB 4LLUA 1URLA 2CIIA 2V7HB 2UVEA 1DANT 1IZJA 3BIKA 2FBJL 1J11A 3QUZC 3EGSB 2E7LA 4HW6A 1X5AA 2WIIA 2CUIA 1U8LB 4YHPB 4FQJL 3MRIB 2IPUG 3RVXC 3TIEB 2FECI 3GSXA 4L3EE 1UXWB 1S7XA 1YMMA 4JY5L 2X4OA 5HHPA 4MCZA 1MUJA 1KTKE 2D31B 2EECA 4UNUA 4GOSA 1GGBH 1U58B 1INDL 3TZVC 3KHOA 1INDH 3OKOA 2Q8BL 3VFRA 1LO5A 2Q8BH 3CX5J 1CFSB 5FV1L 1QKZL 1QKZH 5MEQA 3CXDL 2YPKB 5CP3A 4NUJB 3CXDH 4ZFOA 5F7EL 3C08L 3UEZA 1NGWB 3SKMB 5F7EH 3T0VA 1FN4A 1EBAA 2OTUB 3O2WL 2MSPA 3F65A 3O2WH 1ETZA 4K3EL 4PD4J 4JO4L 4K3EH 5BZWA 1XGQB 4FQ2L 5E2TL 3QDGA 4QHMB 4FQ2H 5E2TH 3S3PA 4MYWB 4X0KA 5FYKE 3OL2A 5BZDA 1I7ZB 3H9SD 3PDDA 4Y4HA 1T21B 4LPWA 2D9QB 4OCLC 1IVLA 2AP2A 3TBVA 2JJWA 4F37K 3O11A 1WUNT 1U8QA 1AD0A 2QQLH 4JKLA 2DQUL 3GJFH 3HR5A 3GMLA 2DQUH 4PREA 2JCCB 4Q7DA 1BX2A 5T3XE 2RIKA 4A6YB 3IVKB 1KT2B 1MCFA 3NIGE 3ILPA 2VDRL 1E4WH 4FNLL 5A2KH 4Y7MA 4H25A 1WTGT 2R2EB 3F8UB 2ARJB 3WN5A 8CGTA 1R24A 4YDJB 5DEZA 3CIQA 5INDB 1NAMH 2NY1C 3DSFH 3BGMA 1JF1B 4G8EA 3CXHJ 3CMOL 1WICA 1LP9F 2VZTA 3CMOH 3CFEB 4HGKC 1TJHL 2AV7A 2N56A 5JOPD 4O2EA 4YBQD 3GFUA 3ISWA 1RUKL 4I77L 4XCFL 5E9DE 5E8NB 3SOBH 4XCFH 3SKOB 1RUKH 4I77H 5GISL 2ADGB 5GISH 2OLDA 4N9OB 4X4MA 1MIEL 5EU6B 1MIEH 1WWCA 3MXWL 3TNNA 3MXWH 4ZXBD 4TULH 4OCSL 4S2SA 3FQXB 1FNEA 3O45B 4OCSH 1T83A 2PW2B 2XTJC 3CUPA 4FZ8H 4UIMA 5IKCA 3EOAA 1FZMA 5E9DA 1MHCB 4M61B 2IFFL 2J8HA 4ZPTA 3SGJA 3SO3C 2MPAL 1TZGL 2MPAH 2IAMD 4ODUB 3T3PF 1A7RL 3N1GC 3RJDA 3QXTA 1ZT1A 3VA2C 2PYFB 1OQOA 4HUUA 4BFBD 1K8DA 1E6JL 3IDMA 3RWGA 3S34H 3DYMA 4PJGF 1E6JH 2APTA 2FEDD 4OD1H 1VDGA 1EEZB 3I3EA 1H8SA 5AUMB 3GSNA 5CCKL 1MAKA 1QLEL 3V5DB 3KYAA 3WN5C 3CX5K 1MCSA 5ITFB 4X4ZA 3X13B 3QDMD 1A6TA 2FGZA 2OSLB 3QH3A 1RIUL 2P5EE 3NAAL 2HTLD 2VUOA 3NAAH 1X5XA 4WHTB 1KACB 3QUMB 3KPLB 5DD3H 2D0HA 2KH2B 3MRMA 5D2LF 3ARGD 4LNVA 5T5FL 4F2MA 5T5FH 4PJ8B 5E24E 2B2XH 2OJZL 2OJZH 4DK3A 1F2QA 1S78C 3HG1E 1T83C 1C5CL 3JV0A 3TA3A 1C5CH 2FL5B 2AJ3B 4NNYA 1MELA 5ISZE 1I7UB 4NO2A 5DMGC 1WLHA 4AG4L 3MRGA 2R15A 4MS8C 4AG4H 2P5EA 2F74A 1GC1L 4E5XB 3ULSB 3C5JB 4KGJA 1GC1H 5CJOL 2YRLA 5CJOH 3WJJA 2MTPA 1KJVB 4JR9L 3JTSB 4XPAL 4JR9H 3SGJC 4R0LA 3T77B 1INQB 3QNYA 5ITBL 4LIQL 5ITBH 2VB5A 4Y5YC 4LIQH 3D39A 1J05A 4X9BA 4MQ7A 2G75A 3HG1A 1KEGL 5EFIB 1KEGH 1DVFD 4M5ZH 1P5VA 4F7TB 1ED3A 2Y4SA 3QIBC 3SGEH 3PDOA 2W1NA 5GGSB 1KCKA 3VXQB 1CFTA 3QIUA 5DD6B 3QQNA 1EUUA 4NN6B 2V6HA 4TNWK 4FMFA 2FJFB 2HMID 1JCKA 1KJMA 4QHNA 3PXHA 4HD9A 5D5MB 3K2MC 1BIIA 3W9DA 5EB9A 4YDKH 4NOFA 1ZLUK 4U2ZA 5I8KL 4HF5L 3RZCB 1KYOK 4ZUSB 4BFEA 1DE4B 5LKNA 3E6FB 2QHRL 4HHAA 1QPPA 2QHRH 1NGZA 2G60L 2JIXB 1T22A 2G60H 3MUHL 1DBBL 1ULVA 4XP4H 3P30L 4R0LC 3VRLF 1DBBH 5CD5C 3P30H 3SE4C 1OGTB 2PO6D 3TN0D 3KHQA 2ZKHH 2X4PB 4Z95H 3O4OC 3O2DH 3IDYB 2VKWA 2M2DA 4XNMB 1NC2A 4PGBB 4K94C 1HOCB 3LN4A 3P0GB 2DMBA 4KI5F 3NCCB 3OKEA 4KKAD 5KG9A 3JTTB 2NXYB 1CS6A 5FO9B 3BT2L 4ZUUB 3LRHA 3SDAA 3BT2H 1JPGA 5B39B 1OP5H 2PXYC 2J88H 1R3HA 2F5AL 3IDNA 4J4PC 4ZS6C 2F5AH 3ZDZF 2FSEB 1F4YL 4IRSB 2VISA 3LQMA 2UZIL 3C5SB 2ZCLL 3DRQB 4X6CF 3ECBA 2UZIH 2ZCLH 2J5LC 3ZKQD 4Y2DB 4L8BB 1LDSA 2WLZA 2BNQD 2EICA 2NMSA 1RQ5A 4LHUD 3W81A 3IAGC 1IAOB 2I5YL 5TFSL 1NGYB 5I0ZA 2I5YH 5TFSH 2ZG2A 3RIAF 3S5LB 3MRCA 1G6RL 4OF5A 1G6RH 4P57B 4H1LG 5B21A 2VLRB 1IEAB 3NIFF 1BQUA 5DEGA 4PUBH 4WTWA 1QVOA 4QGTA 4FFVD 3TO2A 5I73B 5J12C 1U8NB 2ZUXA 3IS0X 4NM4L 4NM4H 4XCYB 1CDYA 4LQ1A 2ZNXA 2Z0BA 3O9WA 4HX1B 4D94A 2NYYC 3MBXL 4U1IB 3MBXH 1QSEE 2EKSB 1JI1A 4OUUA 5CD3A 2YPVH 3OB0K 5I76B 4YUEL 1FG2A 4YUEH 2NY2C 5GRVK 1VGEL 1MAJA 1VGEH 2VLJE 1KOAA 3HPLB 1CXIA 2BC4B 4EN3C 1WFUA 4BSVB 2BMKB 3FB5B 3EYVA 1S9KC 5J13C 4BKLB 4I3GA 4NN5C 1CGSL 4KK6D 1CGSH 2C1OA 2WINB 2V2XA 5K9KA 4XNQB 3TYFA 2VLJA 1O7VA 4URTB 5IG7A 1FO0A 4YNYB 1UJ3A 1ZT7B 5HYJB 3FCTB 1Z9MA 4TUOA 1P7QB 2E5EA 2CPCA 2MMXA 4ELKB 3G08A 4JDZA 5DSCB 4P23B 1NUDA 1OGAE 3MSPA 1E27B 2XKSA 4FQXA 2PYEE 3VH8A 3RTQA 2XY1A 4EXPX 1SYVB 4MNQD 4RGNC 4XVTL 5HPOA 4JKMA 4XVTH 4FQHB 3ULVL 4M1GL 5JOFA 3IJYA 3ULVH 4M1GH 2OQJB 5J56B 2E3VA 2W0KA 2OM5A 3T65B 1LE5B 4P46A 4DN3L 4DN3H 5DTFA 3HS0B 3NGBB 2Y5EA 1WCBA 2PYEA 1X5LA 2HFFA 4OZFG 3LIZL 2EDEA 2MNUA 1ACZA 4BZ1L 3LIZH 1J18A 4R97B 3JV4B 4BZ1H 3K1KC 2EDHA 3GZKA 3QFJE 3FQNB 4OLYL 5EU5B 1JYXA 4YO0B 5SWSE 3GBNL 2IFGA 5AD0A 5LXGL 3OJ2C 4ZO7A 5LXGH 5D8JL 8FABA 6FABL 1UZ8A 5D8JH 3D85D 3LEXA 5HTSA 4X7TA 1RI8A 1AJ7L 1AJ7H 1J0ZA 4QRTB 4WU5B 5AG9A 5ACLA 1VFOA 1H3WM 2XWJB 5DYOA 2DI7A 3O3DB 3ROLB 3PJSA 1PQZB 3QFJA 5IB1A 1QSZA 4EI5D 4NKMB 3VFWB 4K2UL 1I1RA 1JWUB 4U1KA 4K2UH 3C9NA 3RTQC 4KXZI 5I8CB 5GJTL 1X5ZA 2COQA 1XF3A 5GJTH 4EEEA 1JYWA 4PJDE 5EU7C 5CEYA 4UQ3B 4X4XB 4J23A 1HXYA 1I3GL 2J8UB 2Z31D 1I3GH 2NY0D 1X5YA 2J7LA 4J1UA 3L3DB 4HKZB 5TDPA 5D1QB 5KBNC 4HMEA 1Z6JT 1AIFB 5L2JB 1DDHA 4HS6A 2XYCA 43CAB 1S9WB 3G9VA 2VDOL 3BZDA 4LEXL 2EDWA 4LEXH 2W65A 3MCG1 3BN3B 3RGVC 1FIGL 4OIAA 1FIGH 4JQXA 3S4SB 4P0DA 1KB5B 1C7TA 4LRIA 1YEHL 3VXTA 1YEHH 4RMUA 2BY0A 3O3AB 1CXKA 4NQCD 3GM0A 3MYZA 2HRPL 5HI4C 2D03L 5DA4A 2HRPH 1XF2A 3BGAA 2D03H 3NCFB 4PGCB 1XGRA 5F44A 1WSST 2XN9E 5FV2A 3VXSE 4J3UA 3GMPB 4P49A 1I7TB 4YEEA 4G9DB 4ZUVB 2F58L 4DZ8B 5DJCB 2F58H 3IT8D 4OI9A 2R4RH 4F58H 2CDEA 4GG8B 1I8IA 4PJ7F 3B83A 2IBZY 3T3ME 3HZKB 4PJ9A 4CN6A 3N9GL 1BJ8A 3G04B 5HGHB 3N9GH 1V3JA 1TVBB 1L4IA 2UYLB 2DMCA 1U3HD 2D9CA 4M7JL 1AP2B 3WIIH 1YEIL 4DOHE 5E95B 1FVEB 2A73A 3A6OA 4YBLB 5I0DA 3KPSD 1FP5A 3TCLB 1ES0B 1HI6B 3FT4B 4NO3A 1L7IL 1L7IH 5DRNB 1IKNC 1A7BA 1UH3A 3S35L 3WFZA 2H2SD 3S35H 4LRNL 1N4XL 4LRIC 2PW1B 1N4XH 5B3JE 4B53A 3IETB 1T0MA 1PX4A 5I2IA 3KYMB 1I1AC 4UUJB 1QYGL 5C8JA 4WGWB 4WRLA 1JHLH 1H8NA 1QYGH 1T1XB 4RX4D 2EH8L 4S1QL 4S1QH 1AXSA 1I8MA 1FCCA 4LIQE 1HEZB 4E42B 5JXEC 4QNPE 4I48A 5K9JL 3RI5F 5A2LH 2YUXA 1P7QD 5K9JH 2BOBB 3GSWA 3MRLB 4HAFA 4PJ9C 1GGTA 1U95B 1KLGB 3WDJA 2A6IB 2HJKA 3ROOA 5EIQA 3BVNB 3RDTD 3V9FA 3A67L 5EO9A 1YY8B 4ZTOL 2EYTB 3A67H 1UWXK 1F2XK 1KUMA 3BGFB 4TVPL 4ZTOH 4PJIB 3MZGB 4TVPH 4N8PA 5LGKA 4Z7UB 2FX7L 4HMCA 1EEQA 3KNBA 4DKAA 5TPWL 3V95A 5TPWH 3PWLB 4R2GC 4PRBB 3L1OL 4KV5F 3O3EB 3L1OH 4PRIE 4FS0A 2IJ0C 1HQRA 3HC4L 3JSSA 1T0NA 3GI8L 3HC4H 3GI8H 3VI3E 1TPXB 3SKNB 2FJHB 1JF6A 1BF8A 1A3LH 2F8OA 3KXFE 5D7LB 5FGBA 1JNJA 1FZKA 3IKCB 1HNFA 4D8PA 4OF3A 5DQJA 4LL9A 1IGCL 1IGCH 2E8YA 4X6DA 3CFJA 4PRIA 2APBA 4JFOB 3MBEC 4IRJB 4MNHB 4JG0L 1MWAB 2DN7A 5IEKB 4JG0H 1D9KA 5F9JB 1H0DA 4LF3B 2EDBA 3AS3A 2BSTB 4Z7NE 2B1AL 3SY0A 1IC4L 3KXFA 2VE6A 1IC4H 3FO0L 3FO0H 1GC1C 5DI8A 4B41A 2BOCB 1NEZA 5A2FA 5F8RC 4WO4D 3BN9C 2LTQB 2V5YA 4Y1AB 3C6LA 3MYJA 1JE6A 1ZLUH 4DGYL 1SVCP 3M8OL 4LHUG 4DGYH 4PRPB 3M8OH 4GKZB 4I18B 2K9UA 1ZA6B 4P2OB 1A14L 1Q8MA 1T6VN 4W4OA 5D1QD 3WBDA 1A14H 1C16A 1CDCA 4JANA 1NC4B 3PWNB 2X9YA 4HEPG 5DC9B 3ZHDA 1U8OA 2BNRE 4W70A 5FYJE 1BZ9B 1MCQA 5FGBC 4YZFE 5J1AA 4N1EA 1S5HA 3MRHB 1NBVL 1AO7B 3HLAB 4ZG1A 1NBVH 1I8KA 4Z7QF 5E4IA 2XG4A 3BKCL 1OM3H 3BKCH 4OZIB 3JV6A 3WDIA 1GZQA 1KJ2H 1KN4L 1MCKA 3RWEA 1KN4H 3Q5OA 4U2YA 3G5YA 3U6RA 5E2UL 3V0AC 3EZJB 3MNZA 1YN7B 5C0IB 2RFXA 2GTZB 4N5EC 4P9MH 4FXKA 3BH8B 1RUMH 4X4YA 3QUYA 3EDJA 4CU8A 5EOTA 3MV7E 5TF1L 1T20A 1AC0A 4UILL 3DROA 1DTUA 5TF1H 1BHGA 4UILH 1BD2E 4QRPE 5TH2A 5E6ID 3L6FB 4W4OC 5TE6L 1PW3A 4F37F 4YQXL 2B1HH 4YDLB 4GMTH 1NKRA 4HLJA 5HHQB 4ZPVA 2H26B 3EOBA 1UGNA 1WBYB 4JAMA 4LCUB 2A6JB 3HE6A 5CGMA 4Z76A 3O4LD 1F6FB 5KZCD 1KIRA 3MRDA 4H0GA 4ELMA 1SQ2N 4Y5VC 4WWKA 1ZV5A 4FTVD 1DP0A 2DF3A 5F72S 5E8DL 1T4KB 3MOBH 2C4XA 3BZEA 3OB0H 1WWWX 3IXTB 4WCYL 5E03A 5E4EB 4WCYH 1WEJL 1XR8B 1WEJH 4PV8A 4PJCF 3UTZA 2B5IB 3IS1X 3RAJH 4BSWA 1HWHB 4L4VB 1HKFA 5HYFA 1CTOA 4NHUA 3DX9A 3PWUB 3D48R 3PQYD 3IFPA 3I50L 3H8NA 1R5WA 3BWAA 3WIFB 5CIPA 3GDBA 1EUTA 2F53D 3FB6A 2APFA 3DMMC 4KQ4L 1U2HA 3HZYA 4U1LB 4KQ4H 2YOCA 3HAEB 1TJGL 1U8PA 4TSAL 2GUOA 5MENB 3QP3A 1TJGH 1BMGA 4TSAH 3RWFA 3UTTB 1S8DB 4Z7WB 3BP6A 4H0IA 2Z35A 2Q1EA 2W38A 3GSRA 2HTKD 3LEYH 5HY9B 3QCTL 5HGDB 1ZHNB 3BQUD 4Y16D 1DJSA 5CFHA 3LRSB 1CQYA 1K4DA 4YAQA 3T2PA 4J2XA 3EYUH 3WCYA 2AEPL 2J2ZA 4WWKC 2AEPH 4A2LA 4LHJB 2F54B 1S9XA 5BCAA 4Y89A 1OY3B 5I1GL 1FVCB 4NFDA 5I1GH 4X7DC 4J6RL 4J6RH 1J0HA 2SEBB 3CH1A 4KRPB 4U1NB 2IH1B 4YJZL 4KUCF 1RK0A 1FL6A 3MV01 3OJMB 5ENWA 3H2WA 4ZOEA 2IG2L 4WGVB 4MXVE 5E94A 5F7FA 3ZYZA 4NQVA 4NO0B 2AV1B 4Y8DC 4NJAL 3GMMA 2JKXA 5B39G 3RU8L 4JQVA 4MJIB 3RU8H 1NFDE 5IB2A 4NNPH 4MX7B 2BK8A 3FONA 1L0QA 3U36A 2VLMD 1HNGA 2ITCB 4UU9A 3UROR 3QULB 1JWSA 3T0EE 1HDMB 3ULVC 2FHFA 1ZVSB 3B3IB 1S7TA 2NY3B 4YHNA 4UV7L 1RZFL 4F7CA 1H5BA 1UYWL 4UV7H 1RZFH 1UYWH 5GZOD 2O61B 2CDGA 5JIPA 3S5LG 4NJ9L 3OR6B 5J8OA 4H20L 3LV3A 4MDJB 4H20H 3EDKA 1QG3A 1NFIA 4JG1L 2ED9A 4DKFL 4F9LA 4JG1H 4DKFH