5AOMA

Structure of the p53 cancer mutant y220c with bound small molecule phikan883
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploiting Transient Protein States for the Design of Small-Molecule Stabilizers of Mutant P53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords CELLULAR TUMOR ANTIGEN P53
total genus 49
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5aomA00
2BIOA 1EAQA 3WTUA 5G4NA 1KZYA 3VD0A 2XWRA 1GZHA 4IBYA 3VD1A 4XR8C 2J20A 3IGKA 4A63A 3QYNA 1GZHC 2OCJA 2YBGA 3Q05A 2X0VA 5G4OA 2J1ZA 2IOMA 4IBSA 2P52A 3D08A 1HJCA 4IBUA 4L18A 3US1A 4AGNA 1T4WA 4LOEA 1HJBC 4G83A 5ECGA 2RMNA 4AGPA 4IBZA 3D06A 4IJTA 4MZIA 5LGYA 2BINA 5LAPA 4IBQA 3KMDA 2X0UA 3D09A 1TUPA 4QO1B 1EANA 4AGMA 2BIMA 4IBTA 3D0AA 5AOJA 1EAOA 2H1LM 3IGLA 2XWCA 2BIQA 2FEJA 2AHIA 4HJEA 3EXLA 2J6WA 3ZMEA 4GUQA 2J1XA 2IOIA 4AGOA 2BIPA 5KBDA 1YCSA 3WTYA 2MEJB 2WGXA 1TSRA 4L0YA 3WTVA 5A7BA 4AGQA 5AB9A 1CMOA 2AC0A 3VD2A 5ABAA 3WTWA 3WTSA 3WU1A 2IOOA 5AOMA 4LO9A 3TS8A 2GEQA 3D07A 4G82A 4KVPA 3EXJA 1IO4C 1CO1A 4AGLA 5BUAA 1E50A 4GUOA 3Q01A 5G4MA 1UOLA 3D05A 1HU8A 3QYMA 2ATAA 3Q06A 2X0WA 3US0A 1LJMA 3WTTA 1H9DA 4L0ZA 4IBVA 4IBWA 5AOLA 4LOFA 2ADYA 5AOIA 3KZ8A 5AOKA 2PCXA 2VUKA 2J1WA 4MZRA 2J21A 3WTXA 2J1YA
chains in the Genus database with same CATH superfamily
1WRFA 1Z3GL 4EBQH 3QIBA 3DYMA 4QT5B 5JIDA 4M62H 1D9KA 1MHEB 1KLUA 3LEVH 3V7MA 5MEND 1WD9A 1CE1H 4NENA 2APWA 4P04A 4P2RB 4A6YA 5BOPA 2PWHA 1K4DA 2QKSA 5FYJH 4FEIA 2ZYRA 2IBZY 1PNCA 2AEQL 2B3IA 5E6ZA 5SX4H 3BHBB 3DXAD 3IJEA 3VYOA 3P4MB 1C08B 1OOAA 3WDJA 3VD3A 5ILTH 4B97A 1Q9OB 3EJQA 3OJVC 1H3GA 4MNHA 1ITCA 3D39E 1FIGH 2PW1B 3PAZA 1TZIB 3D3VB 4NEHB 3F6LA 3QIWD 1UM6H 1YMMD 4JO5A 1LYQA 1WISA 4PJHE 3VWJB 2WD0A 1RZIB 4IJTA 3U6RA 1RVFH 4Q52A 4PJCF 4F2EA 3HBPA 1RHFA 2OX5A 1U8KA 3T77A 5IHWA 1A47A 1G94A 2J57A 2CDGA 1SRDA 2FECL 2L0DA 1A6VL 2ZWKA 3QZWG 3B2DC 4JREC 3LTVA 1Z3GH 1L3NA 4MAYC 5BS0B 1NMBL 4OFVA 3SKOB 2VDOH 3AUVA 1LL1A 5KYXA 4GY4A 2WTRB 1X7QB 2P3YA 3KPNB 4OZHF 3RL2A 1XL4A 1P9MC 4P9HC 3VFOA 1YAIA 3D25B 1LD9A 2VN4A 3KWVA 2UVEA 4B96A 4K5MA 1A8ZA 1AVAA 5I1CH 5EULV 2VSKB 1XB6A 5EF1A 2EDRA 4PP1D 3RB5A 3CQFA 3NABL 4KFZC 4P46D 4XH2A 5AVSB 1S9KC 2PMZA 1JXKA 5IUSA 1HWWA 5HGHB 4TNWK 4P46C 5IQ7L 1CS6A 2MQ0A 3AQZA 4JRXA 4URTB 5JNYA 3OR7B 4O02H 2W94A 4P59L 5D7LD 3U1QA 3L5WA 4M5TA 3MNVA 3K8KA 4K7PH 4CJ0A 1IC0A 2APFA 4QXUH 4WU7B 1P4BH 4GRWH 4PJCE 5AVYB 3HS9A 2R8SL 3DSNA 1IC5L 1JSYA 4ISVA 2Q7YB 3WLWC 4HMDA 1TTRA 3QRBA 4GUPB 4RAUB 5TDOB 3BKMH 1RZ7H 3PWNA 4Y5YB 3B9KA 4ODBD 1A3LL 1AE6H 3TNNB 3QAZB 2D7QA 3CLFL 1UXLA 5FB8A 3SKJL 1B90A 3AS3A 3QZBA 2DY2A 4OZHB 4LDOB 2G2PA 3IJSB 5AAMA 3QHZH 1I8UA 2QJDA 5F1OB 5E24E 1J1PL 2LFGA 3BZEA 4JPSA 5JPMB 1T2QH 2MQGA 3T3PF 3U0TB 3MX0B 4F2FA 3MLUH 2E8ZA 1DQTA 3UJTL 3BGMA 1HHGA 4AT6B 1MSPA 3CC1A 4Y4HA 4BWTA 3K4AA 4KTYA 3LDBB 2NYYD 3ARGA 2FBJL 3E3QC 5CIPB 1KB9K 3FAWA 4ZT1A 2J8UF 4AQZA 4EBQL 5C9JB 3ZHLA 1AHKA 1KBKA 4PWEA 4U4BA 1MY7A 3M07A 4N2AA 2VZUA 2BCKB 3TNNA 2BZ7A 3SE8H 4JFFD 5EU6D 2QLVB 4RFOL 1P2CA 5ERWA 3UZVB 3TTSA 1XF5B 3WFHB 5IY5B 4LOEA 2D03L 1FVCB 3CFBB 3KL0A 3HUJE 3ZY7A 2A5UA 4AUYA 5DXWA 2DLTA 2E27L 4KI5D 3FO0H 3LZFH 3B9KD 1FSKC 2NXYD 4Z78A 1ONQA 3GBMH 2DI7A 2FO1A 3RTQB 4K7FA 5IQMA 4FTVA 5B3JF 3NJHA 3G3LA 4JREB 2VE6B 3MDJA 1IGFL 4MZ2A 1PQZA 3BIKB 4P4KA 2YPLD 5GGQH 1UWEH 5ADPH 4HJTA 3H42H 1P1ZB 2NZ1A 3DECA 5DRZA 3IEAA 4TVSa 5IVXF 3A3YB 1AC6A 3FK3A 5CLXA 3VRIB 5IJCC 1SF3A 3RU8H 2YKLL 5I5MA 1BJ1J 4O58L 4W9CC 1MWOA 2RA1A 4DN3H 2GT9A 1BVKA 3TBCA 3BXNA 4HD5A 2WIMA 1ZLDA 2CK0L 4YDNA 4WFFD 2J8UB 1MUJA 2NQCA 1VFUA 1V7NL 2RACA 4LCIL 4LHJB 3O8XA 1I8LA 4ETYA 3EZ8A 4J8RA 1TZGL 2XKNB 1Z0MA 2R51A 2HN7A 1JDAA 2OW6A 4A55A 5EDXA 5TE7H 4X6CB 3WGVB 4NYLA 1FLTX 3ZMRA 3WY2A 2ZYSA 2XU9A 1OB1A 3LD8C 2GKIA 1ZLEA 2CKBL 1FP5A 4Z3IA 2CUHA 1DBML 4N2EA 3EBIA 3HG1B 3NPSC 1T1YA 4WHCA 4XMXA 2VUYA 2EQDA 4KJQD 2MOVA 3CVBA 4M61A 3IDGA 4RNRA 3F01A 4ODHL 4UM9B 1ZJBA 4L8BB 4EN3D 2NSXA 3OX8A 4PJGE 3VGGA 4KROD 2UUDH 1PYWA 4QRTB 4F7TA 4PRNA 2EADA 2XWBB 4XZUA 3V4PA 4H0HB 4YSPA 5C2UB 1KPRB 2NNCA 3OHXA 5CCJA 2V2WB 3UYPB 4MZRA 2LU5A 1N8ZA 3HN3A 2NXZB 5DK0A 1MXGA 4CADA 3U48A 1CDJA 2XTJC 5ERWB 4ZQKB 3ZDZF 4HGWA 4KKLC 5FA3A 2FT6A 3D85A 1ZHLA 2BFVH 4PJGB 3VACA 3B3BA 4OM0H 2WYTA 3B9EA 4TOYH 4N26A 1ZE3H 3U36A 3V4LA 2WWOA 5DZ9A 5FKAA 3VB9A 1XBRA 4DJMA 1FBIH 4RMUA 5EH1A 2VXUH 2EDFA 1EQWA 3IXTB 3GBLA 2MCAA 1TTGA 2RGSA 5EU4B 4W9KC 4ATTA 1WPCA 2DQFA 3OMIB 4PWFA 3J7HA 4X6CE 1R3LB 4ODVL 2BO0A 5GRJH 5IIEA 2YBRB 3OHXC 4Q9CA 3V4UL 4P06A 2H47C 1ETJA 1R3KB 5EMYA 4HWBA 2RAMA 1LK3H 4XRCA 4HK3N 3LCYA 3IM1A 4RMTA 1UM6L 3B2PA 1OAYH 3RTQC 4YBQD 3OMNB 1F58H 1QRNA 4HJGB 1D5ZB 2TRYA 1MUJB 3TYFA 3PV6A 5JW4Q 4FJYA 2DJMA 2ESVD 3L95A 3X11B 4WIQA 2HT3D 4MD5B 5K5YA 1E6OL 2QSQA 3FYIB 3DPBB 3ZUNC 3W5MA 4WWPA 2BHFA 5JOFA 1OAYL 2J6WA 3O4OC 3GSRB 1IM3D 3DHUA 5J0BA 1NCTA 2XFXA 4GUQA 2YPVH 3DTUB 3D0VA 3IXAB 3B8YA 1M56B 3X3GL 1WT5C 4NERA 4DHLA 2BWDA 1XCQB 2XVKA 3MRPB 1JF5A 4EF3A 1EIBA 2UZPA 1I4FA 3UDWC 4JM2B 2AITA 2A9DA 5AD0B 1TZ8A 5F0JB 2OCCB 4LSQL 5I6OA 2V5SA 2BS8A 1HWHB 2ZCHL 5DMYA 4X8JB 1CFBA 1PDKB 3AW5A 3BMVA 1T20B 3LPPA 4LVNC 5DD3L 3QHFL 4YXLH 3C12A 1QWNA 5AOMA 2FEDD 4C8XA 4Q6IC 4XXCC 4B9KC 1IAMA 3UGXA 2X4UA 3NPSB 2FGZA 1HEZB 5E2TH 4WNQA 3ZTCC 3CE1A 1UOLA 4GKSB 1HCFX 1LJMA 2AS5M 4BV1A 4J5VA 2F0CA 4H5SB 3S97C 4NN7C 3AB0B 3KPQA 3BYTA 3HI6L 1MFAL 4OIAA 5F1SA 4YXLL 4ZTPL 1DQJA 2AJXH 3ILQD 2VLJB 1FORL 4LRIA 3QQ4A 2N7SA 5IEHB 2A83A 3IBOA 5F3BA 2PWFA 2AAVA 3U4AA 1E3ZA 4TSAL 3CDFA 4G1MB 3WKYA 2I9TB 2HJKA 2V2XA 3M45A 1OEZW 4KZ0A 4OGYH 2ILLA 4Q9QH 4HK3J 4WFFE 1RZKH 2WZ6A 3KPSE 3VE0B 1G4MA 3PJSB 3CSYB 4FQQB 3DUUA 4EI5A 3Q2VA 1WFOA 3LPGA 2BH0A 5HDLA 1B3IA 2VB5A 3X1BA 4ONFL 1QSEB 5CINH 1WHOA 4GAFB 5JR1H 2VERA 1PSKL 4FQLL 5D93C 3ZDXB 4JQXC 5GISL 1I9EA 3L3KB 1QD0A 3G04A 4Z7AA 1T1XB 3HMXA 5CSZB 3CDCA 4IHOB 3O6FA 4WNJA 1UJ3B 4JO8A 3A67H 4KTEH 3TM6A 2Y4SA 4JM0A 1ZSHA 3WNMA 2AJXL 4ENED 2PUQT 5F3BB 1JZ2A 1A9VA 1TQUA 3NRPA 2D7PA 1OAKL 2VLKD 3CFDB 3K2MC 4NSKB 4ZDHB 4XCYB 2ZNWA 2XPYA 2Y1YA 1KT2B 4ODWA 1IFRA 4KXCA 1KSRA 4LMQI 4C57C 4U49A 5SX4I 4IKIA 4S1SL 1VENA 2D31B 3B56A 4YZFF 3TONA 2P8PA 1TEYA 2F7IA 4L37B 3PJLA 3NSYA 3KWXA 1KDJA 4R6UA 2WBJB 1MCJA 4YE4L 5F88A 4BHUA 5CLTA 3AT0A 3BDBA 3V5DA 2APVA 2LV4A 4H8HA 3QRFM 4ZOBA 4AW7A 2HJFA 4TLKA 4WWID 3RQ3A 4C4KT 1NIAA 2XX1A 4ENZA 1IQDB 2QVTA 4BFNA 4F15B 3LKQA 4Y0GA 4Y8AA 4L4VD 1MHPH 4PUBL 1QBAA 1FO0L 3LB6D 1HL5A 2FYYA 5T3ZH 1FFPA 1BOYA 1P7BA 1M1SA 3O4OB 5K1VA 2V3EA 1A5FL 4F2MB 3HE7D 5F1NB 2QGDA 4BKLA 2JXMA 2ZSVA 3HC2A 1B4JH 5ISZB 1I3RA 1CIDA 2ATKB 4TVPD 2ZPKH 3SDXF 2OMUA 4FMFA 1WWAX 4Q2ZB 4JY6A 3SE9L 2DIEA 3O3BB 1I53A 5HVHB 1XIWC 1JK8A 1I7ZB 4JM4L 2SEBA 4LZKA 1SJMA 3S36L 3HI1A 4JCLA 3HMWL 3VFWA 4P8QA 4K15A 3PV6B 5I82A 4HLJA 4LSRL 2NW3A 4UQ2B 3ZU8A 4LLWA 3MHZA 4UU9B 1PLGL 1OF0A 2HYMA 5JHLH 3ZT7A 5DK2A 4H8QA 4BIKA 3O0LA 4NKQB 3OKOB 3GBML 4Y7MA 6CGTA 2W9EL 1XCXA 5I28A 3J8F7 4JANB 2XYCA 4DW2H 3CLEH 3GI8H 4UDUA 3AREB 3PGFL 1AFVL 1YYMH 3GJFK 2VDPL 1Q0EA 1MDAA 4HDIA 4HPYL 4N2GA 4ZYKB 1NGZB 4ZFGH 43C9A 1KCBA 1OGAE 2IDSA 3S88L 3GZKA 2QV4A 2DIAA 4TOYL 4NQDD 5JDSB 5D1ZI 4L3CA 5KSAD 4K5OA 3GSUA 3ZRCC 3NABH 4R97B 5C0FB 4WGKA 1UXSA 2DH2A 1FORH 1P69B 4W81A 4MJIE 1M7IB 2KS0A 3VSUA 3X12A 5C71A 1QPXA 1ZA6B 3MRBB 3FOMA 2WXPA 4U3CA 3QPXH 1BFTA 1JZHA 5HGGS 1F4WH 4DESA 2BNQD 3PNWB 1N8ZB 3VJ6A 4MVBD 1YC8A 2WXHA 5G5DA 4A68A 3JTTB 1R3HA 1E4XL 4FXKC 2B4CC 1BF5A 5DVPA 5GGUB 4HUNB 3FTXA 3IPEA 4G1EB 2GJJA 4ZFGL 4JR9L 1UHVA 1KFAH 4HAGA 2ICWA 4G9FE 4WTWA 1K3IA 1VERA 4L1SA 4PJEB 5IW1B 3RDTA 3HZ3A 4Z0BL 5LAXB 4X6CA 1EAPB 3CFJB 4LRNL 3VWKB 4Q0XL 1K5NB 3GRWA 4U7MA 1H8LA 3F7YB 3AU0A 1NGPL 4PJ7B 2HB0A 1MELA 3L17A 2W60B 4KKCD 5LQBL 5HHNB 3LRHA 5C0BB 1J8HA 2QV2A 2E9BA 3P0VL 4OAWB 1XR9B 4KGJA 2Y2YA 4PJFE 3WY3A 1IAOB 4PJDA 1FH5L 1UASA 4YS4A 5ADOH 2AC0A 1NLDL 3FW6A 2XKNA 4X80L 3T4AB 1EUTA 1NWOA 2D2OA 4KMQA 4Z7VA 5IFJA 1MEXH 3KGRA 5AAPA 1ZPLA 1AYOA 2FX9H 4FQIL 3MGAA 4G82A 2BJML 3NTCH 3MV9E 2H3XC 3U7AA 2LAAA 1J11A 2IBBA 3ZSSA 3D1MC 4AQ1A 4J23A 4YDIH 3QIUC 3RA7L 4AYFB 4NHCH 5BV7C 2YKKA 3KJ4C 4X8GA 5DLLA 1RZJH 1G7LB 2FO8A 2YUXA 3H4FA 3KE0A 5GISH 4BHUI 2OCFD 2CJUL 4OM1H 1MLCA 1XH1A 1KIRB 2PXYA 3S5LB 4OM0L 2L7EA 1U91A 4JHVA 3B1UA 4OCXL 2XC8A 1GS7A 1OGPA 5FYKL 1LGVA 3PXJA 5CGBA 2D7TH 4MWFB 3W9DA 1DQDH 3L7FB 3AGVA 4HGWB 4OD3H 2B0SH 5DT1H 1OHQA 1KGJA 4UT7L 1XF5A 4ZUUA 3IDMA 2PCPB 2WJ7A 5MI0B 1P5VA 1GPOL 1B0GB 1SN5A 4NLAA 1GA2A 4POUB 4H2CA 2BCKA 5CZVH 3WKQA 4MRCA 3KR3H 2HVJA 2ZPKL 1OP5H 3BVVA 5E2JA 3SGEI 3L9YA 4Z7WF 4XZUB 1OWRM 4ZFFB 1CG9A 4RGNB 4KXZI 1JZ4A 2EVGA 5D6CB 2GJ6E 2G5RA 3SDAA 2G0KA 3QJTB 2HT4C 5JDSA 2Y25A 4R5TA 1OVZA 4MKMA 3KW8A 1U33A 2NY3C 1GGUA 3IU4H 3M7FB 1LMIA 5J6HB 5DI8B 2RQEA 1TYJA 3L4WA 5ID1B 1XCTB 4BQ8A 2DEWX 2XIIA 2C7UA 4V11A 3TBYA 3QHFH 4WUKL 5E56A 3COOA 1JV2B 3FUKA 1CFQB 5JW5A 1FCGA 5KANI 5H2BA 5AZEH 4NZFA 3TFKD 1OZUA 4P99A 4DQOL 3TYGL 4PREA 3WIAA 3BPNB 4CMMA 4F57L 1LMKA 2H1LM 3MRIA 3MRNA 4LLWB 4UU9A 1WVZA 3O8XB 4MCMA 5HHNA 1UGKA 1MCNA 2F7OA 4OCMC 1RH8A 5FW8A 3N55A 5DMIH 4P49A 4IOIB 3B8SA 5I9QB 3UG3A 3ZUCA 2VZ3A 4AGOA 4H88L 4DP0X 4FTVE 1JGLL 4JRYA 4KOCA 2Q8BH 1CXKA 7PAZA 3T3MF 1T6VN 3R0NA 1ACYH 3CDGB 2DJ4A 3DX2A 3L3GB 3WE6A 5CCGE 1K4CA 3UZQB 4XH2B 3C5JA 3F83A 4CN4A 2OZ4H 5ALCH 4AEEA 5BMFH 4JO4H 4KPHL 4JFOA 5AB1A 1W72L 2JWYA 5F7NC 1MFAH 1TQCC 1Z9NA 2RCSH 4QRSA 2HKHL 3D34A 5C7XH 1GYAA 4FG6D 3OLIA 1OP5K 2ZSWA 4R0LB 3F5WA 1XGQB 3ZKSD 2RFXB 2PTTA 1X5IA 1J8KA 3LRGA 1KXTA 4PS4L 2R0ZL 1YJDL 2G5UA 2JKWA 5TK2A 3QYMA 4A04A 4BSWA 1V27A 3RZCB 4HAKA 4N0YL 1BHGA 3W5NA 1J0JA 2DKSA 1YAZA 1W72H 2FUQA 3HJ0A 1QHOA 3EBGA 5GRWA 5JXEA 1G6RA 1R5IB 3OXRB 3QDGB 4R7VA 5GRVL 3NK3A 4GSUA 4UUJA 3TCLB 2X4NA 3P69A 4KX8A 1G1KA 3VQMA 3O6LL 3VH8B 2BVPB 4MYWB 4NKOB 1UATA 4F8OA 4ZNEE 3KPMB 2F53E 1ND0B 4EOWH 3BVNA 3P3YA 5B1KA 2OK0H 4OLWL 1A4KB 1SM3H 4WI5A 3B43A 5GGRB 5E1AB 3ATAA 3TURA 3X3FH 3MNWB 3QUKB 4HCRA 3LDBC 4J7RA 5ALBL 3ZT5A 4LLQA 1G0YR 2DJUA 5FWQA 2QMJA 2ZOWA 4CSZA 3L3KA 2ITDA 4ZFFA 4UTAL 2WBJD 3O2WL 2H9GA 4UILL 2CJSA 5DJYB 1F45A 3RX8A 5ACMA 4YVNA 5IOPB 1KTKE 1P6FA 1QPKA 4P4KC 5TDOA 1M9WA 4OQTL 1OHZA 3SQOL 4O02B 4Z7WE 4A6YB 3VFWB 2IBZX 2R2EB 1CE6A 1U3HB 3CU7A 1MHEA 4FTDA 4J4PA 3VXQB 3WN5B 2E9GA 3QUXB 4ODVH 5DZJA 5F0LB 1PFOA 4IBQA 4LSDA 3OVUB 5F89A 4MDIA 3H7BA 3SYPA 5IWLC 1KJ2L 1I7RA 3H53A 4R4BA 3MNVB 3GK8L 4PRBA 4J1UA 5FUOH 3EHBC 4UOZA 3CK0H 4PRPA 4UT9A 4UAOB 2EYSB 5IMLB 3NIGE 3C5ZC 4I0KA 1DJWA 3FFCE 3NCEB 4MXQC 4IOIA 4NO3A 4FKEA 3KWWB 3VXUA 4PRPE 5L0QB 2A74C 2NY7L 1SDYA 2J1XA 2WWKT 5F9JA 2XG5A 1HQ4B 4WFEE 4G80A 1L6PA 1WBXB 5L8JB 4S1DC 2VW4A 1OK0A 1SDDA 4OZIE 3P4LA 2XWXA 4WSGA 3VWKC 2VITA 3V0AC 3WTVA 4HAFA 3FB6A 5DJZA 3D30A 4XBPA 1KZQA 4P2OB 3FU7A 2OMYB 3SKOA 4IU2B 4MVBC 1AO7B 1QZ1A 4D0DB 1JHLH 3NFPA 5AVUB 2DYPD 1Z9MA 4K9EH 1WZKA 4N20A 2AEIT 4Z3JA 4DVRL 4LF3B 3V5HA 5J56B 3R06B 2FB4L 1KTRL 2DTMH 4M5ZL 3VM5A 5I0XA 3ZMNA 4PRHB 2GSGB 4ZPTB 3R1GH 5C2BL 1QNIA 4YSQA 4KRLB 4YUEL 3UOAB 5JOPD 4Y4KA 4YHNA 4ZMYA 3ZE1E 3EHBD 3Q6GH 3Q8BA 3OC5A 4NKDB 3DPBA 3CZNA 2BNRE 4JQIH 5BPPA 2EZ0D 3ABLB 1W80A 2MCPL 5C0RL 3MYZA 4IRSA 4NENB 3S7GA 2EH8H 2YLHA 1ZVSA 3ZE1B 4PTTB 5L9DH 1OAUH 3ATDA 3ISRA 1HE7A 3M17A 5CBAA 2WY3B 5DR5H 2Q1EA 2J2ZB 1RFDL 2EIZA 5CZXC 3AWGA 1S9YA 3HLAA 1R33A 3DGCR 2CGRH 2X2UA 2YBRA 3DIFB 3QJSB 2OM5A 3T2NL 1ZGLB 1M05B 1N6VA 3D18A 3UIYA 2XN1A 4EOWL 2AQQA 4NKIH 3ARGC 5D2LE 4POYA 2OCJA 5EU4A 5CGMA 4JB9H 4WO4C 3P1VA 2UWEB 4YL4A 3P3UA 5KVFE 4KHTH 5CEZD 2OJ1A 5FLVA 2EKJA 1NC4B 4FL4B 5JDJA 4AIXA 4XN2A 3UPAA 4PGBB 5SWZE 3GWJA 4Z3EA 2HX9A 2VWEC 1A6PA 3AMLA 4BRJA 1YPZE 5B1BB 3ASWA 1CVRA 3APNA 2ZXWB 4TVPL 4R0LC 1QHPA 3QR2A 4GNKB 4OCSL 4WWKA 1V55B 2C1OB 4JB9L 4IOSA 3D87B 4L4TB 4MD0B 4BH7B 5JHLA 3I9GH 5EZLA 1ZIAA 3MYJB 3HE7C 3MODL 4WW2F 4YGAB 2PO6B 2WN3A 2IWKA 2OXGA 5JIMA 1TJGL 2NSQA 1ZHBB 5LXGH 2AXGB 3I02A 1AGDA 4MHHG 1L9QA 1MF2L 1QKZH 2VLKA 4NRYB 1T7WA 3ECUA 3VUAA 1JWUB 1YLBB 5IVZA 4PJEA 3HN5A 1PJWA 5HVHC 4NZ8A 5CEYB 4I77H 1P4IH 5IB1A 3OPZH 2H0EA 1YCSA 1A7BA 4PRHA 4ZPTA 4XX1G 1T2QL 4TNVK 3FRUA 2EC9U 4XCNB 3KPTA 5C0JA 1W15A 4X4XB 2PCFA 4N2NA 1I8KB 4OF0A 4LFHG 5EBMA 2VRAA 2PO6A 3INOA 2WYHA 3L08A 1OAZL 5E5LA 3O3AB 4QJ3B 3NP3A 3SO3C 4CU6A 4MKTA 1V10A 3ZR6A 2BOBB 2VQ1B 4G6JH 5T1KA 2K3HA 1NPUA 2IPUK 4PB9L 3LOWA 4G5ZH 1YEKL 4UILH 3QXAA 3JWDL 1AIZA 4Q4EA 2DQCL 4QRUB 3CLFH 1R3LA 1PKQE 3NCMA 4BCZA 5DHMC 1J48A 4D7PA 1DR9A 3O3EA 3GJFB 3NESA 4LCWA 5K1JA 5I1IL 5I1KH 1XV8A 2VXQH 4L9DA 5EB9A 5T5NG 3RX5A 4Z7OE 1IGFH 4NQCD 4B3EA 5DJXB 3UTSA 5MEOA 4LPVA 5TDNA 1CD8A 1UCBH 4MSWB 3BSGA 2X4OB 3Q2NA 3ARWA 4RGMB 1AXSA 2A6DA 3CXHK 5BJTB 2ZUYA 2VR8A 3BKCL 4UQ3B 3WKPA 2UWEE 1JZDC 3BVXA 1TZOA 3MLSL 2H3KA 3FTUA 3V9CA 5K9OA 5FOJA 3RZWA 2F7QA 2J6EH 2VC2L 1WWWX 3KPRD 1UFGA 1INDH 3QC5X 3EDDA 4ODSH 4OR1A 5C0CB 3VQ1C 4UQ9A 1A4KA 2H0FA 2L8AA 2SEBB 2C3GA 1JZ6A 2R59A 3CDZA 3FO9B 4LPWA 12E8L 5KVEH 2EEFA 3LS4H 1IKNA 1XF3B 3OGCB 5ECGA 4HQQH 2VXTL 2AXHA 7FABL 2GG1A 4ZO8A 2VKXA 3GYRA 4OSUL 4MJ2A 4PJ9A 4AG4H 4OUUB 4P05A 1YECH 3CN1A 3TCLA 1FZOA 2HPOA 3CJJA 2ZG3A 1R5IA 1F11B 1EX0A 4L1DA 5AVQB 1RFDH 4WO4A 5IM7A 3ARZA 4PV1C 1IBBA 1JI2A 4LP4A 5CUSH 1T5XA 2ZE0A 3L2LA 4X5XA 1ACYL 5SWSA 2XKSA 5K59E 1CGTA 3WHE1 1HEZA 2RBLA 2JKJA 1TXKA 5E4EB 2AVFA 4MA8H 4QRRD 3V9FA 2C3XA 4GG6B 2P80D 1OT4A 3GUFA 3VNZA 4G6AC 4QRSB 5HY9A 4UT6A 2JB6A 3QG6A 1HHIA 1JV5A 1KB5A 2XVGA 1J8RA 4WK0B 3Q5OA 4WI7A 3HR5B 1SQMA 3MRGB 4NJAL 4KI5F 4PJFF 3C5JB 1SFHA 4AMKL 5KZCB 1E4KC 4CDGC 4UQAA 5C0EA 3DIDA 4Z0BH 2VQTA 3DARA 4JM2A 4Y1AE 4UTAA 4F24A 3JVGA 4EDWH 4JZNA 3P2BA 4Z7UE 5EO0B 4OZIB 4LLUB 4GRMA 2A2QT 3N40P 5B8CC 4GI6A 3TBBA 5INDB 3VFSA 5KYUB 1DBJL 3GSRA 1R1CA 3MRGA 4EUPG 4GKZB 3QUYA 3MGOA 5E9DD 1LP9F 3BD5A 3Q01A 2PR4L 5HY9B 4QXTA 1DQQB 2HJLB 3ZE0F 2I60L 3H3PH 4ABQA 9PCYA 1FVCA 1VAHA 3CFBA 4HIXH 4IBWA 2NX5A 1PKQA 3VA6A 5AG9A 1AZNA 2PO6C 1ZK5A 3B9VA 2AJVL 4MMZA 1GGIH 1GSKA 3VXMB 2ADYA 1E9QB 3KPNA 4N0UE 4NC1E 1K85A 4LDEB 1T0NB 1YEEH 3ARRA 4L1BA 5E9AA 4P3WA 2XQBH 1XH2A 3SB3A 1I1YB 2EE2A 3MU3A 2A0LD 4QHLB 4GRWE 3QC6X 3WBDA 5HI5C 4NUQA 5HYJB 4S10A 4UT6L 1D7FA 4ADGA 1KOAA 4KKLD 1O75A 2ZX9A 2NY6B 5DMIL 5FHBL 1AD0B 1NCWL 2Z7WA 4R90H 4FLHA 4XOEA 5KSBB 4RLDA 2ROYA 1NBVH 4JM2D 1VFMA 1A4AA 4RGND 3HFFA 3FPYA 5EWIL 3STLA 4K9EC 1WZAA 1J7VR 4BH8B 1W6WA 4OV5B 3MRQB 4YXKL 1EVUA 1KIQB 1U4FA 3EOTH 3GM0A 5T3ZE 3BAEH 4UOW0 1JE6A 4LEOB 1MAMH 2ZAHA 5AW4B 1SMDA 2K1MA 3EJYD 1G4RA 2UZXB 2Y6TE 4Q74A 1C5BL 1JOIA 3QBTB 3D06A 4JG5A 1S2EA 3BAIA 5KVFH 3G5YB 2FLRT 1FFNB 1FL5B 3VQ2C 4EI6B 3ESNA 4JFHD 4I3GA 5I6XB 1IKOP 1NDGB 3WE6B 4X9IA 2E6QA 2RQ8A 4ZO7A 3OJ2C 2ZWNA 4DZBA 4UOQA 2B7DT 2WVTA 1H5BA 1YEHL 3CPUA 3O45B 4NO2A 3OKDA 3K4ZA 3LKOB 3N44F 5KSUB 2PR9A 5FM4A 1IEAB 3HPLA 2PABA 1A2YA 4BZYA 4U1HA 2A1WH 3LKNB 1PEZA 1O9VA 2CBQA 1TZHB 4L2LA 1RIHL 5DRXB 3U46B 3EJPA 3T4AA 4Y1SA 2BPBA 1U8HA 2H6OA 3FU9A 4J12A 1IAOA 2P5EA 4PJDB 3UJIH 4EXKA 4Y2DA 4Y19A 5IQ9B 5L88L 3QXVA 4IKJA 4PIBA 4QJ4B 1PBYA 5EU3B 2IH1B 2CE6A 1UD8A 4B5ZA 4MMYB 4UT9L 5L7XL 4G70B 3PHAA 2E7CA 4Q14A 3SGDI 1TZHA 35C8L 3HR6A 3SQBA 4U6VL 2EDYA 1NEUA 1LE5A 4KI5C 5AW0B 1A2YB 1JV2A 4MCZA 4KO9A 3BPOC 4K8RH 3UTZA 5I15L 5LG6A 5KN5B 4Z8FL 1JHTA 4FQIH 3JTTA 4O4YH 1JGEB 3DXAA 4NZTL 5ABZA 3WUWG 1KC5H 2V9TA 3T2PA 1D6VL 2BSBA 1FFOA 2JK5A 2VE6A 5I1EL 1K9TA 4UAOC 4N2IA 5IVXB 5AG8A 1SXBA 4H4NA 5DUPH 1ZRUA 1CG9B 3HW7A 1E4WH 3OHMB 3NIDE 5AWNH 3QFDA 1SFDA 2K7QA 4UB0H 1JTTA 5I0WA 1MWAH 2PXYD 3MRBA 1B0GA 1IRAY 3EO0B 4FABL 3GXPA 3UTPD 4FLSA 3GZOA 2IVFC 1G7HB 2DF3A 4Z6AT 3G6DL 4FKHA 2C9RA 2PKDA 3T08A 1H6EA 4YFLF 1UA6H 3AZUA 3HUJF 5EEYA 3TCXA 4E9RA 1AGBA 1MHCA 3EYFB 3FQNB 2XWRA 4LBEB 1RU9L 2IQ9H 1AOHA 2Y5TA 5IVXA 4N2MA 1U93B 1DVFA 1DQVA 1P9MA 2X38A 2IFFL 3Q8AA 1XF1A 4LARH 4GRWF 5MERB 3SGKA 4M61B 5KOVC 3A24A 4GW5B 4NZTH 5DS8A 5LDSA 2K70A 3Q43A 4JFUA 2CM6A 2E56A 1BPVA 3BWZA 4GMTL 3DMMA 4WO0A 1IM9B 1KENH 3PGCB 2WLLA 2CDEA 2DLGA 2CG9X 4ICXA 1S9YB 4Y2OB 5EZJB 1YEIL 1XAKA 1IL1A 1OAQH 2BNUB 3VVWA 4DH2A 4ZSOA 2IPTL 2VMEA 4LLAA 4HKXB 2YIHA 4E2OA 1TMQA 1TTFA 4GAAA 4KJPC 4ZW6A 3VX1A 3MJGX 2ENJA 2VUOA 1GKOA 5IFJB 3GXFA 1NMBH 3O8XD 3WDHA 1BECA 2VERN 4GUPA 2VR6A 4UM9D 2GI7A 2VXVL 1WG3A 1NQBA 4KK8C 2ZKHL 3FUEA 1E42A 3O4LA 4OZGA 1D5MA 3PWUB 1A7QH 1HIMH 3CSPA 1Q94A 1X3DA 3IDXL 6TAAA 4PP1C 3SBQA 2WLZA 5C07D 3U82B 3EYSL 1PF3A 3UO8B 2IAMD 3UG5A 5FGSA 4IOFD 2NUTA 4ZFZA 3OJMB 1YUKB 3BRFA 1MIML 3LPWA 3RDTB 2FWSA 2VDQH 3E1F1 4Q2ZA 5E6IA 1AIFA 2H3NA 3BEVA 1JGLH 5K1NA 3UADA 2G60H 3VXUD 3MO1A 4L1HA 2Y7OA 2NY0D 3BWAA 3FT3A 1VZIA 4POZD 3ROOB 5EIVA 3WO4B 1WUNT 3TVMA 2ICWI 2VABA 3S88H 2HUEA 3DTXB 1YNKH 4PJ7E 2FYYB 1XTLA 3IFLL 3CSTA 2YMTA 5HHPA 5JLZB 4BQ6A 1EHNA 2ZWLT 4LCCC 1WZMA 1IO4C 1B2YA 3KXFA 4QJ5B 2YA0A 4LEOA 3QISA 4UV7L 2C26A 3JVFC 3OJDA 1IGTA 3SYCA 4CA4A 4YHOL 3MRQA 2Q76A 3QUHA 5D7JD 1Y18A 3VXUB 2H32B 2UY7A 1NC4A 5CF3A 3CCHA 4WGVB 4RAVB 2JJTA 5ACZA 3SDYH 2QQKL 5CO1A 3O0RL 4OCRL 2FSDA 1FCCA 1ZVYA 2WW8A 3CC5A 3ULUH 2GW5A 2OBGA 2Y9RT 4WFHE 5LBSH 2JCWA 2NY4D 2IIJA 4RIRA 3TA3B 3RRQA 4AUJA 2QQLH 4XN1A 2WJ5A 1QFWH 4XBEL 4PW4A 2VC2H 1EXGA 1INDL 3T0EA 4TSBH 1JN6B 4OCWH 2QHRH 4BZ2A 2F7RA 1Q9OA 4ZW7A 2J55A 4BDVA 1UT2A 4FTVD 4U4IA 1T0NA 4IRZL 4ZS6C 3V0WH 3B9AA 1H3UA 3KLLA 2JV6A 1JI1A 1YPZB 2CO7A 3WFBH 3TVMD 5C3TA 5AALA 5B3NA 5F8RC 3AVEA 3BE1L 3GHEH 3TT3L 1PY4A 4ALAL 4ZUWA 2YK1L 3PWPB 2OL3A 2D4DA 2AKRA 4WEUD 3QH3A 1KNOB 4GT7A 4UI2A 2KLTA 4G7VH 4LSPH 5F7LB 4KKAD 1HILB 3O0RH 4O2CA 2G9HB 3K0YA 1I3RB 3VE0A 5I8OL 3BZEB 3SCMA 1MFBL 4JRXB 1TETH 5EV7A 1U8OB 3J27A 1G0XA 2UV3A 3FTZA 3WFCL 2NCEA 3DX6B 4AQOA 3MCYA 2VDLH 3PFQA 2X4NB 4MNQA 1RULL 3LZLA 1XMWA 2F58H 2G9KA 3C87A 3QG7H 1J9TA 4NZUL 4IW4C 5D96C 2O6EA 4U0QB 4FNRA 4N24A 1J18A 3FQWB 3KS0H 2MOQA 2COQA 5D1ZA 2D0GA 5D7IA 4D8OA 1VF5C 3QR0A 1BZQK 4XPBL 4RGOL 2LT9A 5E51A 4PYHA 1LNUA 4M00A 1OL0A 1CL7H 3LIZA 4ODTL 2HFFA 3AJ7A 4CVXB 1GHFH 2ICES 2X09A 3UH8A 5I16B 4JY5L 3BUYB 3BAKA 2GBTA 3H3KA 5E8EB 3MV11 2VJ8A 4JO3H 4M8UA 1HC1A 4UF7C 3MV01 4NSKA 1IEHA 3H6JA 3BAJA 1OCWH 4PRHD 1OT1A 2GBUA 3ZT6A 3VWJA 2VLRD 3FHAA 3M1BA 4PBDA 1JCKA 2PP8A 4OFQA 2PWEA 5F6IB 4ZDHA 1X5FA 3CDZB 5BZZA 4F7PA 5LCVH 2X1OA 3OV6A 4EZJA 4GUOA 1AGDB 3RBSA 1QW9A 5T1DL 2F1BA 4CMHC 4GQZA 5D1ZC 3FT1A 3F58H 4XXWA 5LO7A 1J5OL 4XP9L 2EE9A 5IHUH 3D5OF 3UTQA 3IFNH 1BAWA 3HC4L 3EGSB 2XX0A 3Q0HA 4FA8A 4H0IA 3ARVA 4EI5B 43CAA 3L95B 2UZIL 4PWGA 1D5IH 2RHEA 5C08B 3LXBA 1DTUA 4UNIA 3FO2A 1JWSA 2K4AA 3K72A 4ZS6D 4AEIL 4DGYL 2H2SD 2ETWA 4NQEA 5K9KA 3TLRA 2NT1A 3IJ8A 4RIRB 5L4FA 4Z7VE 3C8DA 4J2QA 3MREB 3MRFB 1BAFL 2QMKA 3QGVA 3KPMA 2VXQL 5GGRY 1OCWL 3BEWB 1D3CA 5FC9A 4Q9RL 5IB2A 2ICEA 1DSFL 4G71B 2IQAA 5ITBL 1G7PB 2Y36L 5I73B 3QZWB 3NCCB 1QSEE 3QDGA 1DDTA 1BVNT 2ZWYA 3NZHH 3LZRA 5T1KB 1A7RL 1HEHC 1BFOA 3HNTH 5C09D 4BGDA 3GINA 2ZP9A 3H9HB 5D7JC 1GIGL 3AREC 4GP8B 4NDMA 1EHKB 2Q76B 3DROA 1V7ML 4LHUA 5GS1C 2E47A 1GVIA 3N42B 4GKSA 4QOKB 3JWDC 1RZPA 1QFUL 4PJXF 1KTLB 1JIBA 4HIIB 1UZ6E 3U7YL 2GY5A 1L3WA 2H26B 4IBLT 1TLKA 1HL4A 1FO0A 1TYEB 2FNBA 3JWOC 4K3DH 3V6OE 1I7TA 2YD7A 2VLJE 2HFEA 3BLKA 3CHPA 4K3JH 1VFAB 4JJ5B 4ONGL 2AV1A 4WWKD 4R4FH 3LMJH 3UERA 4YPJA 5JIHA 1AMXA 4P07A 4HUWB 1TETL 3L5IA 2GSGA 2VISA 3L2NA 4LB8A 4XPHH 5GS0D 2V9UA 3IAGC 2FK9A 4I18A 3ULUD 3ELAT 3NT0A 2LU7A 3BKJL 4IMKC 1BSIA 1GYUA 4XMZA 3U25A 3OMZA 1OB1B 4NFDA 1ROCA 1D5MB 3PWUA 4TUJA 2FQGA 2YHGA 2X1QA 3PUUA 5I74B 4F5CA 2E6PA 1U41A 3MNMA 4MAYB 4XP5L 5J1AB 4E0RA 5I9QC 5I5JA 1RUML 3N41F 1LO0H 2IH1A 5DJAB 1B88A 2EIJB 2UX6A 4YEEA 4X7FC 3MRDA 4LKCA 4ZUSB 2FQEA 3QUYC 4XMPH 4D0BB 4BZ1L 4OT1H 2BP5M 4JEGB 4NO3B 3WEXB 4P4RA 5E2WL 1K5NA 4KO7A 4HCIA 1OIOA 1PZSA 4FFYL 3TO2B 1BZDA 1R34A 4M6MH 5KWYC 2OZNA 4Y2NA 3FQ1A 4AVHA 4CC4C 1MHCB 5CBEB 1S46A 1P7HL 3SPJA 1A65A 1NFDF 3IJHB 3WEAA 2WCGA 3M1CA 2ZP0T 5JQIB 1SEQL 2W65B 3N0AA 1MG3C 4EI6A 1MCHA 4DK5A 2O5ZH 2RIKA 3L8QA 1EAQA 5C0NC 1O5PA 4G7RB 3RL1B 1OSYA 3EYOB 3TWYA 3FO1B 1IJ9A 1M7IA 4MJID 1LO4L 2FNWA 2GIYA 4HK0B 3L9BA 4L9LA 1LWRA 3NVQA 1OSZB 1GKEA 1GMEA 1FG9C 2NSMA 4R83A 4P5SA 2RH0A 1NCCL 4GB9A 2P52A 5DHXB 3MLTB 2MHAB 3VAEA 3FO0L 5DO2D 3LS5H 4CC4A 4RRPG 5J9PB 3HS0A 5BNXD 2GJ6B 1CFSB 5GQBA 2UZIH 5JPMA 2AEOA 3IDGB 2EIMB 1BQHG 3TZVC 2NX5E 4RZCB 4G43A 5D7KE 3WE1A 3VMPA 2YMOA 4MCZB 3AM8C 2AJ3B 3OD3A 4KY1H 2E9JA 2FJGB 3D09A 4APQC 2W0LA 4IK7A 1XEDA 5AVZB 2GTWA 1VACA 1U8HB 3HBGA 2XG4A 3L1FA 3MCLL 4XB3A 3T0EC 3TXAA 2R56L 3N43B 3S9DB 3P02A 1WE5A 1MNNA 1CGVA 3Q5YA 4GRLD 3EOYG 4LAQL 1VESA 5DRWB 5E6UB 5KSBF 3P30H 4NWUH 3N06B 5BZXA 3KJ6L 1HH6A 3GRGA 3RPBA 1ADQL 2R1XA 2YD4A 1S7SA 1JNNL 1ZCRA 4NLHA 3QQ9D 4L3FA 1CLOL 4TRPL 3NJJA 4XPBH 4AVKA 3SJVA 3BLPX 4DTGL 4E36A 5BV7L 5IMKA 4YHIB 4EI0A 3RWIB 4NB7A 1N9PA 3NJXA 3P2TA 4E5XA 5GRJL 1BPLB 4P2RE 3DUHA 1WC7A 2BY3A 4FNLL 3AQXA 3FQRA 1FGNH 4R2GB 4NNPH 3I2CL 4I1PA 1CDYA 1FL5A 3QAZC 2V0AA 4HCFA 4WTZA 2W0FB 3R1GL 3GSWA 3I9IA 4CSSA 1BX2A 4OLEA 5KYWB 4C83B 4HIPA 5B7MA 2H9GB 5JYMA 4JN2B 5BS0A 1UCTA 1Z6JT 2ZXAA 4XGZB 5J13C 4PJ8C 1P7KA 4JQIL 4KKNA 2RALA 2WMPA 4M6NL 3LVEA 1NCNA 4OF3A 3O41A 4X2UA 1GZPA 1IBGL 1PL3A 4AX3A 2CLRB 1W8EA 4PJDE 4RGNC 1AGFA 4H8WL 2J1WA 4G8IA 4L5FH 4LP5A 4O5LH 3U6RB 3V79C 5CIPA 3ME0B 4ELMB 4NXSA 5E2VH 3CXHJ 5C0DA 1BVZA 2BIOA 4JKKA 1RZ8A 3MLTA 4JCMA 4DGVH 2EXWC 4XNMB 3MX0A 2V17L 2YAPA 4MBRA 3O41B 2A6JA 4H1LH 2IPKA 5DD0H 1UACL 4WV1B 1LK2B 4KHXH 2J5WA 4XGZA 5DO8A 4JMNA 1GGBL 1XGPA 3LN5B 4Y5XA 5JHAA 5LUMA 1YO4A 5CEXB 2X9YA 3RDTC 4CC1A 5F7FA 3BKJH 1RVFL 3MLWH 4Q4IA 3S36X 1QASA 4HX1A 4N6RA 1E28A 3JTSB 4J3OG 1P5UC 1DQQA 5CJQH 3WIIH 3CHQA 4A37A 2CJUH 3WHXA 1YVLA 2A6KB 3MBXH 2OTUA 1CZ8H 3KYNA 3NRQA 5K69A 3L2MA 3OWEA 4XPGL 4PJHF 3JV5A 4BXSV 4ERSH 4LNRA 3RWCA 4JK0D 2ATKA 2Z1KA 4LLUA 1EEZB 3IMTA 3FRPB 1UM4L 1T3FB 2IFGA 4YXHH 3C09C 2DLFH 2XV3A 3O3DB 4WLCA 3QI9D 1UURA 4QHMB 4PGDB 1ZDSA 2XKUA 5TFSL 2ADIB 3C9NA 3GRWH 1UWXK 1ZLSH 1YYCA 1M2VA 1S7VB 1VZHA 4JLRB 1RZKL 3H9YA 2ZXDA 1OTUC 2FEEL 2QTVA 4WI4A 3U1SH 2Q7AA 3FB5A 4F9LA 3W38A 5FYLE 3PYCA 4JFEE 5EORH 4I48B 1PG7X 4CC0A 1AKPA 2PCFB 4RFEA 1VIWA 5C0BA 4DF9A 1E5YA 4N0UB 4IEFA 4HOMA 4IJ3C 4N5ED 1P4BL 4XI5C 4ACTA 4XP6L 3CFKA 4Z95L 3OG6B 3HVNA 4NAMA 3HFMH 3L3IB 3OGOE 2OP4H 1E7UA 5E1HB 1EHLH 2HTKD 4AE1A 3ZX1A 3VSQA 4X9GA 1XX9C 1GYVA 3EBAA 4WHTA 1EA9C 5MHSD 2QBWA 2IPTH 2ZXQA 1C08A 4X7TB 3GDBA 3GBNL 4PM1A 3MOQA 3T2OA 2Y5EA 5KUKA 1ILSA 2C9VA 3PXLA 4WJKB 5JZ7D 1WBYB 1K4DB 1D5BA 3KXFD 5JO5B 5BJTA 4MMXB 2PCXA 1FZKB 5HHME 4AJYV 1FC1A 2Y0SA 4M7LL 5EZLB 4I9WD 5D1QC 4YSAA 5DHDA 5KYYB 1XD0A 1QX1A 2DQJL 2XXFA 3SGKC 3DDGA 2W8CA 4B9PA 5EG6C 3DOSB 3BT2H 1OAXH 1JZGA 1TJHL 5F7EL 4ZODA 2Y7MA 2FL5A 5HHOD 5INCA 2F2HA 5D5MF 5EOQH 5CCHE 5MEOB 3SODB 4HPOL 4XP1H 4M1CD 4BFEA 2IQAB 5JIQA 1AG0A 2GSIA 3OWRA 2JKLA 2Z34A 2CK2A 2A83B 1UWXH 2YPVA 5CAYB 2AXWA 3HE7B 1NCAH 3HOGA 3MPCA 4PY7A 3VMNA 4JGNA 2ICWJ 3WXVH 5CGYD 4L18A 3DO7A 1TF4A 3QWQB 3OAZH 1WFMA 2CR3A 3MOBH 3S4SB 4Y4KC 1IZJA 4OIIL 3CUPA 1SJEB 1M4KA 1ZE3C 4OH2A 1JGVL 2EIZB 2NY1D 5AVTB 1FFQA 4LASL 1U8NA 4M29A 4N8UA 1F2QA 5DK2B 3U79A 3AQYA 4MJ4A 4WKXA 5BCAA 1OGSA 4PWKA 1CT8B 5C0CE 5H4ZA 3NBNA 4CN1A 3O3AA 3TYGH 1YEJH 1H3XA 4WZ9A 1UT1A 3AS1A 3TWCH 5I5IA 1JHKL 2XWTA 3TO4A 2WKOA 2VN7A 4PJAA 4MJJA 4M7KL 4PV9B 4JZJC 4BJLA 3TF7C 3L3IA 4I18B 4ZMXA 4Y9CA 1WYJA 4MX7A 3VD9A 2CA4A 1NBYB 3U1PA 4OGQC 5DWUH 4LVEA 4N5EC 1R24A 3FB6B 3L9RA 4XX5A 5DJZB 5I8KH 4CILA 1F3JB 1FJ1B 3IKKA 4J3OC 4W4OC 3V0JA 5HYIA 1AO7A 4UV4L 1T21A 3HS0C 1NINA 5GGTL 3QR1A 2PYFA 4X5LA 5T3XE 1JMZA 5FECB 4N0UA 2CMRL 2BNRD 4GYBA 4AI7A 1QLEB 3X12B 4BH7A 3NACH 5JPNB 4U0RB 3VRLE 4ABWA 2HCZX 1PZ2A 2X6CA 4NO0B 5EEVA 4UCFA 2X05A 2A9ML 1FGNL 3KEHA 1WFIA 3CTTA 3TV3H 5I1AB 2IXQB 1T3FA 5C3IA 4X5WA 4EVNA 4ZAKA 5D1XA 4P57A 5D8JL 3KPSA 3TBTA 3CH1B 1W9XA 4LIQH 2GSIB 5DS8B 1OCRB 3WN6A 1KELH 3BO8A 3HG2A 5TF1L 2RR3A 1LO5A 2VDKH 1U95A 3WXWH 1Y0LA 2JI3A 3ARDD 5A2JH 3OKNA 4NC0B 2BP0B 3JWNE 1J5CA 1L7IH 3DO4A 3CZKA 4AXWB 4OJYA 2AKRB 4ZXBD 4H8UA 5F9OL 4DERA 3PY9A 3NIFB 3ZK0A 5TQ0L 3OKEA 3FFOA 1G7HA 2N7BA 1HHHA 4OGAC 5DD5L 4KQ4L 3RAJL 5DUJA 3S2CA 1PZ5A 4JQVC 5DUBB 4ZZKA 1BCIA 1XB8A 4JFYB 2VAJA 3O6KH 4EN3A 3QUKA 2R0KH 2ZJSH 4Q9QL 3Q05A 5PCYA 2YPKA 1HJCA 4QI3A 1AHWA 1NMCC 4UAHA 3CBRA 2OA9A 5GS1A 1NGWA 2W81C 1T0OA 5FAAA 1M71B 1K8DB 1S7TA 2AXJA 2JLLA 3GLEA 3R06A 4AGNA 3BKYH 1EXHA 3QUZA 2CM5A 3IN2A 5ITBH 2A99A 3IDNB 3RWDA 4OVVA 3FFCA 3WJJC 2XI9A 3M8OH 5IWLA 2IWGA 3T0VA 3DURA 2O1AA 5AQ0A 5FLUA 5FYLD 3ARQA 3BZ5A 2P43B 5IW6A 2VLJA 1SLVA 4FA7B 3H3PL 5D9SB 1AS6A 3F58L 3AT9A 3MRCA 2BC4B 5CHNA 4FQ1L 3MRLA 3N50A 1IQWL 2HFFB 3GB7B 5FYJE 5C0AA 4KH2A 4OZHA 3D51A 4DN4L 1Q0YH 2OTPA 5EBGA 1IGYA 2A74A 2E5EA 4A7UA 2FX7H 3MR9A 3EGXB 3M8OL 5AL0A 1CR9L 4RZKA 1AC0A 2NX5B 3OC8A 4HPYH 4PAZA 2F8VA 3UTTE 4Z3TA 2FBOJ 1BZEA 4X6FA 5I6PA 5TDPB 3ZTJG 5FO8A 1OZTG 2EUZA 3LRSB 3B2VL 4E9VA 1LM8V 4HJUA 3BCFA 4JFOB 2PF6A 4FABH 1Y6KR 4K3EH 4PV8A 4V2CB 1NAMH 3PWVA 1AMYA 4KROB 5KVDH 3WSQL 4J3SA 3IMRA 1U92A 3F62A 1RSYA 4RQQB 1RLBA 3RLSA 3EH3B 1KB3A 3EADA 4XXWC 5E6IB 4AKQA 1I9IL 1Y7VA 2XZAH 3VDAA 5IR1A 3ZDYF 1NDMB 1H9VA 5F7DA 2P8LB 3Q1SH 1MLBB 5TGBB 2XFXB 2GAZA 4F8TA 3ZDXE 3H3BC 3RP1A 5IT2H 3EJTA 3G04B 1KB5B 3OR6A 4RISL 3LRSA 1JGDB 2IH8A 1W72B 3IKCB 3VW3L 3L1GA 1A6TA 1J9RA 2AK4E 3PIQA 4ODUB 4GUCA 1O7DE 2PETA 3LX9A 4S0HA 1B4JL 2EDBA 4OGZA 4AOFA 1FNEB 2ADFH 5A6MA 4NO0D 4EJ1C 1CXEA 4Q8BA 4PWJA 5GGRA 3KWUA 4NIKB 2X4SA 4GO9A 4BFKA 2DD8L 2CKBA 4I2XE 3VDBA 5FUZH 3ME0A 3S4SG 1UQSB 1NA8A 2QVKA 4G11A 1HHGB 4GW5A 3PFUA 5DO2C 5CILH 1B9ZA 1IC7H 1CFSA 5C0IB 2OMBA 1E6JH 1Q1PA 4RAVA 5ACZB 4G8IB 4NPKA 3HUJB 2D3JA 3T3ME 4PS7A 1I1CA 1BVLB 3QYNA 4BQ9A 2YBGA 3VTAA 3BN9D 4FXGC 3I6SA 5FCUL 1HZLA 4JX0A 4L1LA 4K5PA 4B9IA 1FNEA 3F6IA 3UAJA 3OB8A 4FQHA 1J0IA 4JPIB 4ZBJA 4I5BA 4DO6A 1F4XH 4TSCH 4BSWB 4OIBA 3AWEA 4OM1L 3AQDA 3IJHA 4J3UA 4FZEH 4QF1A 5GS2D 4E5XB 4WY7H 3LKSB 4OBSA 4HCGA 1AQHA 4U6HA 1TQBB 3PHOB 5DD6A 4AJWA 3BYYA 5D70L 3N1QC 1MREH 2C4FT 4GXUM 4NGHH 3RG1C 3BEVB 3UTOA 5BUGA 5CLWA 4KI5E 4I2XB 4IBTA 3MA9H 3L13A 3DI3B 1YNLL 3PU7A 4MB5A 2E7LA 1A1OA 4Q56A 5KN5A 4JCWA 5C0EB 3SJVB 3B6SB 4P2AA 5M94B 1TOXA 4N2DA 4X5WB 3JT2A 3O4LE 3V0DA 3GTTA 1J86A 1U3NA 4AYBA 3QJHA 3QUYD 1Z2KA 1TG8A 3BPLC 2FT8A 3VG9B 3P9WB 2YAOA 1F4YH 1TO4A 1WSST 2BERA 4MAYA 2FUTA 5FA4B 3D52A 2WGXA 5F0MB 1MRCH 1JGIA 3WEMA 5AENA 2WXIA 2W1NA 5GGVY 3MRNB 2AABL 3ARSA 4XWOD 1HOCB 3MLPA 4ZOEA 3SDCD 1R19A 4BK4A 1RHHB 2APSA 3DVFA 2VR7A 3TFKC 4EMZA 4JGUA 1X44A 2BNUA 4K4KA 1FSKB 3FQTA 4RWYH 4QRPE 5C08D 4GIAA 3T3MB 5B4MC 4XNQB 5I5RA 3WIHL 3U4BL 1H3VA 4H26B 3HG4A 1XDTT 3CX2A 3QEUA 4L0ZA 1M6UA 5FPIA 4NOFA 3H9SB 1OE3A 3D3VA 5D4IA 5F8QC 2E76C 2XWTB 5IFAH 2AJVH 1A0QL 1SJHA 4BUQA 2XQYK 4F7EA 5LGJB 2BIHA 2XPGB 3TJHD 3RL1A 3S8FB 2BK8A 4UIMA 1J8SA 2GI0A 4G8AC 2BMKA 1R3IL 3IRZA 2VCOA 4QHKI 3SEPA 2J1YA 4XAWH 1E30A 3VI4F 2CSPA 4MWFA 3W9DB 3WIHA 4XAKE 5JIPA 2R9HD 1RL1A 3QIBB 3IDMB 4OFPA 2YA2A 4R4NC 5GZNA 3S4SA 3UTSB 2NY2C 2EUXA 4NS0A 4EDWL 3STLB 4XN9A 2OYLA 3HZKA 1IKFH 3C6LC 3NA9L 3QA3B 4Z76A 4LEBA 4GAGL 2GK0A 4LU5L 1F41A 2XDHA 4RWHA 2WLIB 3VXRA 3WFEL 3BFQG 3X2QB 2F18A 5E08H 5D72H 1F58L 1NUDA 2F68X 1X5LA 2A73B 3UTTD 2OR9L 2R0KL 1ACZA 1J0KA 3SKJH 1M1XB 4Y4HC 3TEZA 5I8OH 1ZTXH 2H2SC 4K94H 4JL2A 5L0QC 3P11H 1N0LB 3LEYH 3BGFC 1DEDA 4JFFE 2AK1L 2VDNB 2VJXA 3FSZA 4LSVL 4YO0A 3OZ9L 5FCSH 3PGFH 4MMZB 3VXMA 5FA4A 1DVQA 1GMIA 3BP4B 4Q6IA 1EXUB 3UTTB 1UZGA 2W92A 3WEBA 3BXNB 3CV5A 1BVKB 1ESOA 3GBNH 4XPGH 3OR6B 5D4QA 5HSFA 1Y07A 3QWRD 3RHWF 1I7ZA 3BP7B 3CD4A 3DTDA 1A22B 1SY6H 4BFJA 4DP5X 3BH8B 3AY4C 4YHNB 5I2IB 3FU0A 4PJIF 2GIXA 4OZFG 1YY8A 3G08A 1ZV9A 2WZ5A 1M9SA 2C3WA 3O3BA 2HFEB 5D1QB 1QLRB 1DCLA 3JWNC 4HUWA 4JDVB 3S37X 4KHXL 5EU7C 3W0WD 4QMEA 1HHJB 1QLFB 3BUYA 1U6AH 4RA3A 5L7XH 4LO9A 5DSCB 4PSPA 2C1OA 1HINL 2W0KA 2ZUWA 3WNKA 2XV6B 3VFUA 3LQAL 3QULB 5G4MA 1KEMH 1HQ4A 1SLWA 1Z5YD 5T3XH 3I2CH 3ECBB 3HBZA 4Z7OF 1H9DA 2OYMA 3FB8B 4MNQB 4BK8A 4EO5A 4M03A 1I8MA 4N68A 4PGDA 4X0NA 5IB2B 2Z0BA 1UWYA 4IJ3B 3MV7E 5B1JC 5J8OA 1RD6A 1I75A 1CUOA 4NPYA 4GMSH 5BS0D 2MJWA 2NY4B 3QZWA 3KH3A 3UMNA 3IF1B 1YEGL 4WW2C 1GXEA 3DRQB 3RIKA 5DJ8A 2QFPA 1ETZB 3I6GA 4JE4B 4KNUA 3TWCL 1QUPA 3A47A 4NQEB 1PSKH 4FQLH 4QHLA 2RD0A 1RK1B 2BXYA 2MQ3A 3FO9A 3FO2B 3ULAB 2EO7A 2PW1A 1CE6B 1CXFA 1U3HA 1A3ZA 1CF8L 5D7IE 2O6FA 5FB8B 2DYRB 1AP2B 1UUSA 3M1OA 1S5HB 3TVMC 3A6OA 3B9KB 3H7LA 4AL8C 1SN0A 4LOUD 1NOAA 1B6DA 4HPHA 5CEXA 5E8NB 1TJHH 3D50A 1KGIA 2OMZB 2DM3A 3LN5A 3II3A 4YSEA 3QJFB 1UACH 1QFPA 3MRHA 1NAML 2HVBA 1QSEA 4OJAA 5F9WB 1F4WL 5DF0A 4F7PB 4P5TB 3ULSA 2XBTA 3T0EB 3EHBB 1WS8A 4FQXD 3NJLA 2OMTA 2WUBH 3ARBD 3JUZA 4QLRA 5DRNA 3UGUA 4Y2DC 3DVGA 3MUY1 2Z7YA 5F96L 3DI2B 2UXVA 4HJ1A 3I50H 1PZAA 3D9AH 4ANWA 4RVBA 3GXUB 2DQEH 4HUUB 1RZFL 4XMVA 3NFNB 2P8MA 1HX0A 2G30A 1BEYL 2PW2B 5L2KE 4ZAKB 2V5YA 4R96B 5D7JB 5EO1A 5A43C 2QADB 3D85D 1SXCA 1YEDB 1A7PL 3LB6C 4HC1H 5CMAA 4WNQB 1WA0X 5F96H 4CUCA 3REVB 4I48A 2C1PA 3T4AC 4H5SA 1FHNA 1KBBA 3FB5B 2B5IC 2H1PH 2G3ZA 3MBWA 1ZANH 2IBGA 2WBJA 5C3LD 1I9JH 4R8WL 5I6LA 3VFUB 3QNZA 3W11C 1JWMA 1PDKA 2H2PD 2W9LA 3R4DA 4GBXC 5C0AB 1G7QB 2CO4A 4R96A 2MEJB 1MCIA 3CN4A 2EVJA 3NIGF 1RIUH 4N8CH 3LEYL 4HUUA 5CMAB 3VXNB 4PJHB 2A9NL 1I9RL 1CTMA 3FHEA 4LCYA 3EIFA 5D4HA 4W9JC 4NN7B 2CQVA 3DJ9A 4JFVA 1JPEA 1HILA 3BDXA 1A6UL 4JFFB 3RWHB 5K9JH 3QYCA 2Y5QA 4LSQH 3QUXA 1KBGH 2R1XB 4NOBA 3SCMB 5I15H 2ADGA 1F8TH 32C2B 2F1AA 3KYNB 5I6XC 1KIPB 4ENEC 4PCSA 5BQDA 3TO4B 2YPKB 1KLGA 2EE6A 1C12A 2EE0A 1ITBB 4M7JH 4ZX5A 4NKMB 4U1IA 2X9ZA 3VMOA 4PYGA 4L4TD 5EZIL 1SBBA 4GO6B 4HF5L 2Z35B 5KG9A 2OR7A 2EYTB 2P45B 2WNKA 4W93A 4KOBA 2EVFA 5A2KH 1JP5A 5GZOD 4ZSOB 5BOJA 2VNCA 3MLRL 3NH7H 1KGCD 3LNGA 3PJSA 3UTSE 5BV7B 5IV2A 3KL5A 4KC3B 3X1FA 1M53A 3QCTL 5IJVB 1CD0A 3BMWA 1FG2B 3FN0H 3ECQA 3EH4B 4DNLA 4JVWA 3OLDA 2VDNH 2UWEA 3V6FA 2I26N 4G8GB 1BF2A 4PJIB 3VO0A 2Z0UA 4DGVL 2V17H 1I1AD 1FL6B 3UC2A 5H35A 1KV7A 1B6UA 4AITA 1RJLA 1VSCA 1AGFB 1LO3L 5EUKB 5GZOC 1WEJH 4M7ZC 3VD7A 1AGBB 3EYFA 3FQNA 4JFHE 3S35X 2EO1A 2YOCA 5ICXA 3VH8G 4L9LB 3ZTEA 5MP6L 1OTTD 4NHUA 2BP8B 3A6BH 4Y5XC 9CGTA 1LEIB 4RFNC 5EF2A 4KO6A 4RMVA 1FV1A 4FNQA 5DZPA 4HF5H 1FH5H 1U4EA 2VZTA 4PJBA 1FVDB 3SDYL 5CIPH 4IKLA 2Z31B 1ZMYA 4F27A 1L0QA 5HPMA 3TN0D 1NJ9B 3QDMA 2BVYA 4FQJL 4Q0XH 4M3KB 4XCNA 3FN0L 4ZUTB 4PJDF 1SVBA 1R24B 3WJMA 1Q9KB 2ENSA 1XGTA 5HPOA 1XF2A 2FWOA 2DWSA 2R29H 3HE6A 1DO6A 3K6NA 3ZE2E 3GJEA 3RFZA 1DN2A 4GBXD 4UM8A 4EI5D 5ADOL 3KLHD 5MHSE 3RNKB 5FF6A 3W11D 4N1EA 3SQBB 4UTBH 3MXWH 3O4LB 2LR4A 2QVFB 4Y4FA 3KWTA 4FFYA 3IXAA 3AMKA 3GI9L 3DOIA 4R97C 1WIPA 3KXFE 4A2DA 3DVNA 3B2UD 3FQUB 4OCLC 4DGIH 1WHPA 4H8WC 4XC1L 4BUGA 5J12B 3HC3H 3QDAA 4OZIF 1J9QA 2K6ZA 4GQQA 4PHXA 3P3RA 4G80B 4XVTL 4MB3A 2CHWA 2NCMA 3RFRA 3JVGC 2IDCA 3CWGA 4N1CA 2E7BA 4J3VA 2Z7ZA 4J3WA 1EJFA 3VFPA 4IRJB 3QWOB 1X5XA 4HMEA 3WNPA 2XQBL 3HHMA 1GC1C 3T4YB 3QQDB 1RJZA 4N0CD 4OLUH 2Y69B 4YIQA 4QRRB 3IFNL 1RZJC 4NO2B 3HC4H 3H56A 1O0VA 1MJ7L 2B39A 1U93A 4LLVA 1W91A 3KPSD 3MVSA 2GK0B 4NI6A 4F8PA 2R2EA 3KYKH 1V3KA 4E41B 1AGCB 2M26A 4QEGA 4JPIA 2P5EE 3OM3B 4NI3A 3T8XA 1C9SA 4U1GB 1MZZA 1EO8L 1NIEA 5IOPA 4NQXB 1TVBB 3CFNA 1Z5LA 3MJ9L 4ZMAT 4ZUUB 3UMTA 4AYEC 4NKDA 2XPZA 4G6KL 2BP3A 4U33A 5DD1L 4QOKE 3SY6A 5AFAA 2M83A 3EKCA 4Y1AB 1VGKA 1KJMA 2VDRB 1X7SA 3O9WB 4JFZL 4BE5A 4L29B 1G7PA 4QRTA 3EDKA 4P23C 3AXHA 1UWGL 4JPQA 5L2KA 1T1YB 4FNPA 2YAFA 3T09A 3F04A 2MCPH 5LGHH 3VH8A 1VDGA 1JHTB 2OTWA 1OPOA 2CLZA 3K2IA 4GINA 4D0DA 4YFEA 1O9ZA 1RHHA 4K9JA 5JPNC 3DX1A 5I1EH 4FMVA 1X9QA 2X89A 3Q8FA 1ZT7A 3FFCD 1F2XK 3MNDA 2A3TA 1MFDL 4KTGA 3UTSD 1XO8A 2X4SB 5FUCC 3LQAH 3EF7A 3DV4B 3F7RA 2HWZH 4OAWA 1BA9A 2PCYA 1YECL 3HKZA 1MW0A 4XNXL 5IESL 2YOAA 2VDRH 4NZDA 1HK6A 2CD0A 1TSHA 4HV8A 5INDA 1ZGLM 2P8LA 4RMBA 2E86A 4CBZA 4Y16B 1RURH 4Y4FB 4OZIA 1U42A 3CSGA 3QUYB 1QQDB 3SE4A 4HWNA 4H0LC 5KYUA 3FB7B 1P7QB 2G5BB 1PEWA 3E80A 4GI8A 3ZKXB 2ROXA 5F89B 2NNFA 3LKOA 4JO3L 5KSUA 3W1ZA 2X6AA 1IGCL 1UZ8A 3EFDL 4PGCB 2DLEA 1USQA 2PPAA 5SWQA 3ULVE 4P2QA 1NPNA 1ZGLP 3H9SE 4CDHA 2UX7A 2EILB 3V4VH 1WUZA 3P4OB 1KACB 3F64A 2LLNA 4PB9H 1T5KA 2IGFH 3WELA 1UA3A 2Z31A 1USZA 5DJDA 1N0XH 4I0CC 1DO5A 3VD5A 4N87A 2EXTA 4QRPB 3TBVB 1BD2D 3UC0L 1EHXA 3T6QC 3FDWA 3IETA 4KXBA 4XCCH 4Y5XB 3X17A 3L45A 4XN4A 4N90E 3UZVA 3MRLB 3REVA 2X9WA 5HJDA 4LSTH 5BZWB 3ZLQC 2CA3A 1SQ2N 1OALA 3TN0C 2YAQA 4MA1C 4N86A 4OCYL 1WGVA 5D1XC 5A2CA 4ZX3A 4PJGF 2J8UE 1YHPA 1LP9B 2XACC 5LQBH 4ODHH 2BY2A 3BI9X 2NY2D 3IVKA 4NKOA 3GK8H 3MRKA 1AJ7H 1I1YA 2VR9A 2FECI 1DJHA 5CKGA 2FT7A 1GZPB 1MCPH 1CE1L 1EEUA 4LESA 1DJXA 1XSIA 4ETQA 5CEZE 4NT6B 3PWNB 4Y5YA 2VSDA 3QJFA 3ZYZA 1DANU 5E7FA 1MJJB 4B3VA 2UYLA 2UWEF 3L3JB 2X0VA 1D2PA 1QWHA 2MH4A 1BBDH 4LXFA 4PVMA 2OSLB 1W0WB 3GTVA 3PWPE 1A6AA 4I4WA 4TUOB 3TX4A 3BPNC 2X4RB 4GRMB 2X4OA 2Q7YA 5F3HA 5B4MD 3A6BL 2F8IA 4FX5A 2XN9D 4GKLA 4K94C 1MF2H 2IAMB 1WZLA 4YVUA 3DHJA 3WJJA 2ZUTA 1LO2L 5IBTH 3EUDA 3S96A 2FD6L 5F7DB 1EJOH 4HUMB 3ULUL 3IS1X 4FQCH 1SJVA 3BPCB 3D39D 4Z3FA 3TASA 4JRYB 1KBWA 4PEEA 3VGAC 1G1OA 1KCSL 2VQ1A 3KPRA 3C08H 1F42A 2VOTA 4FFVD 2GCYA 2HFGH 1AHWC 3D7PA 5JPNA 2CUIA 2JKTM 2BSSA 1JWMB 2Z64C 3VFOB 2ZOKB 5FECA 3QULA 3G6AA 5BXFA 4JY5H 2CJTA 3UGEA 1L7IL 2ZZUT 1J9SA 4GXFA 4O00A 3GB7A 3SBWC 5IB4B 2BXZA 5IM7B 4ANVA 2QPDB 1V5JA 3CQPA 3GKWL 3PLYA 4S1RH 3X3GH 1UOVA 4H88H 4A7TA 4MAYD 4LLMB 5CWSB 2JTDA 3Q6GL 2B20A 4HEPG 1FJ1A 1CCZA 2K6YA 2R2BA 2XUWA 2OTWB 1HWGB 3STBA 1EFXD 2ZAGA 1N7MH 4WSKA 4JHBA 5FKPB 2AQTA 4JW3A 4XCYA 4ZPVA 5E2WH 4AV5A 1P6AB 5C6TL 2YQ3A 4LQ1A 4HUVA 1DJSA 2W9EH 2O5XL 1ETA1 3O9WA 5JQHC 1TR7A 2JVUA 5E94B 3S5ZA 3QIWC 3WJMB 1OARH 3UYRL 1KCRL 3QIUB 1KELL 3KG5A 4GLRI 5AW7B 4NUGL 2B15A 4WFHD 3DWTA 5I1GL 1BFVH 1M6OB 3SKNA 1TPXB 5IJBC 4P9HL 2X2HA 2OMZA 3GXNA 1SOKA 5KTEL 5TFSH 1FAKT 3H55A 2DIBA 4JRYD 2BVOB 5I71C 4Z8FH 4Y19D 4FXGB 4Y2DD 3PP3H 3KBHE 3ZTDC 2ID5A 3BQVA 5KSVA 5IEKB 3NCJH 4WW1B 4JRLA 4ESKA 2J6EL 2DI8A 3OKNB 2B08A 1CB4A 1GGCH 3L48A 5HI4C 4EDXA 1TTUA 1YEGH 1NBZA 3GSXA 4MJ5B 2JJUA 4PJ6A 2ZF9A 5DHEA 5E9DA 3L5XL 3ARGD 4IBYA 4XO3A 2BWQA 4FDWA 1B0RB 2NNRA 1ZGLA 4M1GH 4G7VL 2ZJSL 3OXSB 1INQA 3BSZA 2XSKA 3TEYA 2C9PA 2J1ZA 2Y3NA 5J13B 3N91A 5JPMC 1E7VA 1X9UA 2IALA 4F92B 3C6EA 4KRPC 3LNFA 3S6CA 3ULVD 1FE8L 3RGVC 2YD6A 5CFHA 5KSVB 4J8QA 5ANMA 5H94A 2IXQA 3RWEA 3UAJC 4ABUA 4LPCA 5DFAA 1OGAA 1YRKA 3LRMA 1BFVL 4OW6A 2JI1A 4MMXA 3LXUX 2PYED 3MROB 3GC3A 5ANME 3SOBH 1SBSH 4MA7H 2EZ0C 3EGSA 4R4FL 1B0WA 4H13C 2OI9B 1RCYA 2GUYA 1QFWL 1KPRA 3OHXB 5AKSA 3CVIL 4Z1PA 1ZV5A 4PJEF 5E03A 4P2CG 1QI5A 5LLIC 4M5YL 4JDEA 3H42L 2R1WB 3QXTA 4FFWC 1C7TA 5AW1B 2N3JA 2BRQA 1FFOB 3GS7A 4FCAA 1FH2A 5TE6H 4OF8A 3BD4A 4BZ2L 4PU2A 1YY8B 3QIBD 3RY6C 5GJSL 3KDMA 3EDFA 3GSNB 4B5EA 5KVDL 4XNYL 4IEFB 4PN6A 2NDFA 1UH3A 5HGAA 3Q13A 1ZJAA 3APCA 4CVXA 3MROA 1BBJB 1NGXA 2B3RA 3V0EA 4J3TA 3RKPA 4MMZC 3WTSA 3GSVB 3RPIA 5DQDL 3CHOA 3I75B 1ZA6A 1AY1L 3CUPB 5C6PB 1K6QH 2C3HA 1FYTD 4R2GD 3G5XB 4NZJA 3BOVA 4HWBL 4S1RL 5IQ9A 1HNYA 2AK4A 5J6SA 2YEVB 4XPTL 2IAND 1PG7L 1QBML 3CGTA 3KYKL 3V0HA 4K23H 2WAHA 3D69B 4Y2OA 3DETD 5EO1B 4UMGA 2EIBA 3I50L 4PRBB 4C54A 1GS6X 4QO1A 5JXED 4QHKJ 7TAAA 4GLRH 4GSRA 2OS7A 1IBZA 2IAMA 1NBZB 3GSXB 4MJ5A 5I8EA 5GHWL 3HNVH 2X9XA 3FRPA 5F3HB 4BQBA 5T33H 1J1PH 4F37F 2NZIA 2MPVA 3DIFA 4LFHD 1N59B 1VGEH 4P4KD 5INCB 1L0YA 2BVOA 1AACA 2YQ2A 3TESA 3L1EA 5I6KA 5DA4A 1QEWB 1A64A 1CFMA 1UD4A 2YEZA 5GZOA 3GRBA 2XXCB 1UENA 2DIJA 3HHRB 3PHQB 2B4CL 4WV1A 1CPUA 5C2BH 15C8L 3FC8A 1MJ8L 4UIMB 1RKRA 5T5FL 1ROWA 5I1DA 4GMTH 1SJHB 1X6NA 2CGYA 1KIPA 1ND0A 5D2LA 3TPUB 2GK2A 5B38A 3Q3GB 4AMXA 5IQNA 4FP8L 2FZ3A 3UO1H 1LDSA 3N2JA 5JXAH 2WPGA 4BKLB 3UPRB 4M6ML 3QRLA 1FFPB 4H0GA 1JS4A 1KJ3H 5FM5O 4OFYD 4PMFA 4UANA 2CR6A 4PRPD 3MGTA 4GRWB 3DX4A 1IC1A 5E99H 3QNZB 4CVZA 1SEQH 2GUOB 1PVHA 4J8RB 1O7SA 4AEHH 4IRJC 3B5TA 4TXVB 3MBWB 4IRZH 1MFUA 3RB7A 4MA3B 2BNRA 2J8UA 2XV2A 3VFMB 1M2VB 4IM8A 4XMLH 1QSFB 2VLKE 2ZSWB 1XGYL 4R0LA 5E70A 2WV3A 1SLXA 4Y19E 3VDCA 1UFUA 4A6YL 3B9DA 2OXHB 4MAUH 5JW3L 1NFDA 3LH8A 2RFXA 1OTSC 3NAAL 4UZSA 4HLZG 3S96B 1TSRA 1AYRA 2YZ8A 4HZAA 3I3BA 4NN6C 4FFZL 4PR5A 5D1QA 4CAGA 1A4BA 3HB3C 4QTHA 2E3VA 5ABAA 3SOBL 5B3JE 2XTSA 1KULA 2RB8A 3KM2A 1SLUA 1BP3B 5C97A 1RZGA 1OLZA 4F5CE 1P6WA 1BZ8A 2OMTB 4ODXA 2AQRA 2CDFB 3PWVB 4F20A 3PHOA 4C47A 2ZUSA 3LV3B 4HHWA 1ZD6A 4K3DL 3MJ8B 5AZ2H 1YEJL 4Y4KD 1U8PA 2XG4B 1UTDA 1UXMA 2BRRL 3KYMB 4U1LB 3F7LA 2BVQB 3FH8A 3FTGB 4FQHB 4JUTA 3OAZK 4X99B 4LLQB 5DMKA 3KAAA 3FSVA 2A6JB 4AMWA 3OZKA 1CICD 1ICTA 3UYRH 3EJZD 4EZMA 4P23B 1RZJL 1A7NL 3N04A 1AH1A 4R3SA 5E8OA 4MCYB 3S35L 4TTGA 1R5VB 1E65A 5CLZA 3U4EA 3O2WH 4P46B 2AJ3A 1PCSA 1RXLA 1P4LA 2A4EA 5K93A 3MV9B 4EQ3A 1JYWA 1Y1UA 3NG5A 1XL6A 3RIAK 5IVXE 1JERA 2DQFB 1DSYA 3VD0A 4RESB 1JPTL 3QUZB 1TKWA 3BN9C 5D4JA 2BY0A 4LL1A 5D1QD 5DZVA 4Z76B 3BISA 4LSUL 4P23A 4MXVF 4ELDA 1MRDH 2QKIB 2RTTA 2W95A 4X98A 5D6DA 4BQCA 4OT1L 4C4BA 4JFYA 3GSQB 5KYWA 4XMUA 1JGUH 4KXAA 4X99A 3Q8EA 4BWUA 1KXTB 3TL5A 4ELMF 2W0FA 4HT1H 2XZZA 1HXYA 4IGBA 2KI6A 4ADJA 5DJ6B 5IT2L 4WW2A 3IKCA 4UIKH 1G0DA 3L81A 4LLVB 3C08L 4H20L 1BV8A 5DJDB 3FCSA 3GDCA 4LCVA 2ZKHH 3A6CH 4IOSD 5IZ7A 5LDUA 2X2JA 1EANA 1P7QA 3GJFA 1Q72L 3FZUC 2V3DA 5ICUA 1BEYH 4MZ3A 1OD7A 4PRDB 3D0AA 2VQ4A 1WD8A 2EDQA 5E1QA 1E8YA 3QIUD 1KUMA 3QCVL 1QFHA 1H6UA 1NIDA 3CDGA 1QMUA 5KBKA 1UYWL 3FCBA 3ZE0E 1RMFL 2YXMA 5CJBA 4P4RB 3BAXA 1DLFH 2WYIA 3HI5L 1ZLUH 3UL4A 1F1GA 5F72S 1J10A 2UY6A 3ES6B 4TUJB 3FQUA 2IDUA 3RWJB 2YUVA 3PAYA 4HALA 4FF9A 3EO9L 4LMQE 3RWFB 1JTPA 5J4MA 4YDZA 4NZRH 2FH8A 4WF7A 4NQSA 2A77L 2GQHA 1DLFL 3CZJA 1BIIB 3ASOB 2VT0A 4I9WE 5DVKA 4PTUB 1E4JA 4FJ6A 1NGQL 2QGCA 1OAUL 2C9XA 1I31A 5LAXA 3IDNA 3RWDB 1LQSR 2QPEB 4YZWA 4P2QD 5E4OA 5SWSD 3GUTB 2BSTA 4WUKH 1M71A 1S7TB 2R1WA 2WB1A 4FNUA 2KHAA 4K8RD 4LVNB 4YFDB 2YWZA 1A3LH 3SD2A 2P7TB 5AOKA 4HQQL 2V5TA 1RZFH 1TCRA 3MLXH 4Y1AA 3LD8B 4G3YH 2BRRH 1HVXA 4DVBB 4JFDB 4W6XB 2XWZA 2KT6A 2Q87A 3P9LB 4YHYC 3JBG7 1B4LA 3VXME 2J44A 5HVWA 2JTYA 5ANMB 4AXWA 3QJVB 1BG1A 5C0AD 3HUJA 2GITA 4Z5RA 3KR3L 1TNMA 3QO0B 1MJUH 4PFEA 4OZGE 4HIHA 2SODB 2QFRA 3FCUB 5SWZB 1MHPL 4PUBH 5DUML 1INQB 2QSCH 1RZQA 3WFDH 5ICYA 1MXDA 3WEXA 2MOGA 5K9KB 2DQIL 5IJVA 4QRFA 2XQYG 5D2NA 1IV8A 2YSTA 3MREA 4AYFA 4BCYA 4DWHA 4ZUSA 2B9AA 2YXWA 1AD9A 4IYKA 1MAML 3BGAA 4P5MA 1X5MA 3EJUA 3FYEB 3QNFA 1HHKB 2ALAA 4ZJ9A 3GMLB 5KYYA 2VSMB 2UY6B 3ES6A 3K6IA 2YRPA 1OCZB 3K5RA 4TNGA 1O6SB 4GXVH 1IFHL 1JGDA 5A3ID 3UEZA 3KLQA 5BRQA 1R46A 1WICA 3HEIB 3BCDA 5C0JB 4ZG1A 1G9MH 3ZO0A 3L9RB 3ZMEA 4AKOA 1F90L 3A4FA 4OCRH 1UB6A 4NO5A 2IJ0C 3O81A 1K8IA 4LGSB 3VWKA 1X5GA 4RRPM 1ZOXA 5HDBF 3VFVA 3HBQA 3FT4B 1TFHA 3PWJA 2OMUB 1I7TB 1U58B 1U92B 2VISB 1NJ9A 5MI0C 3HE6B 3S5YA 5FYLH 1G7QA 4YR6A 2V8MA 4ZW8A 1XGTB 3RURA 4K71C 4G9FA 1SGKA 2CJ3A 4V33A 2WHVA 3G5YA 3WNNA 4YEFA 3FT9A 4APQD 3B7RL 2R23B 4Z9KB 1BAFH 1J5OH 4I5BB 5ENWB 1ERNA 3AACA 5HYSB 2F74A 5DQJA 3FF8A 4GAJL 3OZLA 4IS6B 3UROR 1JNHB 1REIA 5T8IA 1MI5B 4B95C 3WTTA 4TTDC 4M7LH 4BH8A 2CXGA 4HS8L 3DX6A 3WS6A 1OPGH 4TNEA 4TVPH 1AZRA 3DO7B 3U7WH 3IPFA 4OLUL 3BEWA 3KZ8A 3VXRD 3B7TA 4OY9A 5EOCH 2QR0A 2AQPA 4LIQE 3FFDB 1B0RA 4GP4B 4HC1L 2CCLA 2NY1C 2EIDA 4MDIB 5JHDE 1NZRA 1J88A 2DEXX 2FIKB 3ECVA 3FN9A 3HLAB 5JOPE 1IU1A 4IU3A 4M7LT 5GIRA 1X4YA 2XA8L 2CO1A 3TIEB 5AAWA 4KAQL 2PLTA 2GFBA 2QVIA 3QW9A 3DOSA 4KKBD 4TUOA 4PQXA 5LN4A 3CPLB 4HX1B 1A7RH 4N6RB 2HKFH 3ARUA 1FLRL 1A6AB 2LE9A 3EJZC 4GKNB 5DS2A 4HUCA 5B8CA 3ZGIA 4A63A 1OLLA 4WUUB 2FJFA 1D5BB 1F1AA 1A1NA 1KF9B 4LL4A 1CL7L 1JZIA 3O2DA 5I75B 1MI5E 4PJ9D 3TIEA 3PWLA 1KJ2B 5LNDA 1B3JA 4UOW1 1RIVL 1HJBC 3EFFB 2FIKA 3GO1H 5E2UL 1BM3L 2HRLA 1CGUA 2JF1A 3FFDA 3PAVA 2BS9A 3UJJH 4NN5B 2Y07L 3BVNB 1U95B 1H8NA 4AC4A 4IDJL 5IR1B 2XQYA 1WFJA 1MW3A 2I7OA 4YUEH 4LF3A 1MAKA 4NNYA 4OTXH 5KAQG 2WXMA 2KUTA 5A7EA 1E5AA 4JM2F 3Q44A 2GHWB 3HB3D 4O51A 5AVRB 1MCCA 1G7IB 1OGAD 3V0GA 1GZQB 1I3UA 3FSOA 1S7UB 4NM4H 5ESAB 2WMPB 3CU1A 2Q3AA 4XP9H 5BZDA 2AHIA 4RFEB 1CZ8L 1OY3B 1WQVT 3KS0J 3QORB 3MA7A 3K2UH 3A0OA 4XMTA 3FNKA 4R7DA 1IVTA 2BNRB 1KPUA 3JSSA 3UXFA 1CQKA 4ZOAA 2H8PB 5F70A 2VABB 2ICCA 5ECJE 2P1YA 1DQLH 1EMTL 3IRCA 4JFPA 4O51B 2DQDL 1F6AB 1OV8A 3EG9B 4JDVA 5C08E 5HHPB 1UOKA 3IK2A 4PRHE 1GOHA 5A7BA 1QLRA 4AGQA 1HHJA 3IB4A 1X5YA 1UJTA 1OD9A 1DE4A 1Z9PA 4XNYH 2R83A 3MV7D 2GTQA 1AO7E 1H3PL 1R47A 4PCYA 4W70A 3O6FB 4DKFL 4KX9A 3OF6D 1QQDA 5D2LB 4PLJD 3E2HB 6PCYA 5AW9B 5E9NA 4UINH 3D9AL 1SXAA 3WDIA 1YMHB 3ARED 3G6JA 2MQCA 4KQ0A 4EN3B 5HP5A 4QRQB 1JPSL 1B4RA 1E4XI 5DZLA 5FGCE 4YHPA 2OSLA 5CZKA 1EHAA 2YPLE 1AI1L 4QD2E 5F7KC 1EXUA 1E2VA 3UTTA 4M7KH 3D2TA 5CKAA 5GGTA 1KCRH 4BDVB 2O5YL 1YEKH 1VB9A 5FV2A 1NOLA 1DQIA 1F56A 3R19A 5K9QG 4MS8D 1MRDL 5JHMA 1CFQA 4B9JA 4YSCA 4AYGA 3RDTD 4JFDE 4F7CB 3MRKB 1XCTA 4MCNA 5GIRB 3U0PB 3INUL 4I3RL 4NNXA 1J05A 2F5AL