5AOMA

Structure of the p53 cancer mutant y220c with bound small molecule phikan883
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Exploiting Transient Protein States for the Design of Small-Molecule Stabilizers of Mutant P53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 49
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5aomA00
2AHIA 3WTYA 1UOLA 1EANA 2IOMA 1EAOA 4A63A 3WTUA 3D05A 3VD2A 4AGNA 2J1YA 3KZ8A 4AGOA 2FEJA 3KMDA 2BIOA 3Q06A 3US0A 4IBSA 3EXJA 2X0UA 1CO1A 2WGXA 2BIMA 4G82A 4QO1B 1E50A 1GZHA 1T4WA 2H1LM 5ABAA 2X0WA 3D07A 3WU1A 3D0AA 3Q01A 3US1A 1CMOA 5AOLA 3IGLA 2BIQA 1LJMA 2J1XA 4LOFA 2YBGA 2XWCA 5ECGA 5BUAA 2J20A 4LOEA 4G83A 2IOIA 3TS8A 2J1WA 4LO9A 4MZIA 3VD1A 4IJTA 2X0VA 4KVPA 2J1ZA 3Q05A 2ADYA 5AB9A 4AGMA 3D06A 1YCSA 4L0YA 3WTWA 1H9DA 3IGKA 4AGQA 5LGYA 4AGLA 5G4NA 5G4MA 1IO4C 4IBWA 2ATAA 2GEQA 1KZYA 2BIPA 5KBDA 3WTVA 2OCJA 5G4OA 5LAPA 1EAQA 4IBQA 3WTXA 5A7BA 4GUOA 1TSRA 4IBYA 4IBTA 5AOKA 3QYMA 2J21A 1HU8A 4HJEA 4IBZA 2J6WA 4IBUA 2PCXA 2VUKA 1GZHC 5AOJA 1TUPA 2BINA 4XR8C 4AGPA 3VD0A 2MEJB 3QYNA 2P52A 4MZRA 3WTTA 4GUQA 2IOOA 2RMNA 1HJBC 5AOMA 1HJCA 3ZMEA 2XWRA 2AC0A 4L0ZA 4IBVA 3D09A 3D08A 5AOIA 4L18A 3EXLA 3WTSA
chains in the Genus database with same CATH superfamily
1AZRA 2WXPA 2YPVA 3IAGC 3NIGF 1NAMH 3DV6A 5F71A 4HJ1A 1A7OL 1NDMA 5C1MB 5F3BA 1S8DA 3ETTA 5HPMB 5BMFH 3MXVH 2O30A 2FWSA 5T1LB 1UM4L 3N1QC 3N0PB 2GJ6A 1CS6A 5FXCH 1HK6A 2AXHA 1SMDA 2PMZA 3HNVL 4HF5H 4ONGL 4NM4L 1NOLA 3F58H 4M6MH 3MRIB 2K9UA 3TC9A 3Q2NA 2YQ2A 4RAUA 4OTXL 3FT0A 3D4GA 1ZTXL 2QGDA 4DN4L 4LCWB 4AITA 3MLSH 3QJOA 1MFAL 1MJUL 2IADA 1AY1L 5F1NB 2EVIA 2ENJA 1IM9A 1P5UA 2CD0A 1AZUA 1VFUA 3IDMA 4FFWD 4Z7NF 1JGUH 1I7UB 3PHOB 3LZLA 1XF4B 2HB0A 5JOPE 4GRLC 2Y07H 4NN6C 3L3JA 4D9RE 4WO4A 3B5TA 4LPTA 1D6VL 2J8OA 5DHVA 1XVSA 3P0GB 3TS8A 1JF5A 3EHBD 4MCYB 4F9PC 5L2KB 2R2BB 2VLJA 2HN7A 4K8RC 1NICA 4CU8A 2ESVD 4M4RA 5EHFA 3TH2T 1OV8A 5F72S 3SDXF 4L0YA 1JOIA 2Q2LA 4A7UA 5F89B 3HE6B 1F3JB 4XWOC 2C7UB 5DI8B 4PPTA 4PBXA 2AXWA 4P2RE 3EGSA 2A73B 3KGRA 3L3KB 1HESA 4FTVB 1PD0A 5IBUB 2DKUA 1T5KA 3BPNC 1R3IL 2MIZA 3ARDC 3VI4B 5ICYA 4M7KL 1J87A 2A83A 3FH8A 1CXLA 2BCKB 1E9OB 2QR0B 3MN8A 1J48A 3LS4H 2FZ3B 3PWLA 4ZZFA 2R69L 4L5FH 3H55A 3FU7A 5MERB 1A0QH 2HH0H 5FW7A 2DB8A 1JNNH 2R1XA 2YXFA 3VXNB 4HUWA 3B34A 3KPOA 3HHRB 1LEGB 1SBBA 1GHFL 4GI6A 1G6RL 4XP1L 3TYFB 3FQUB 4DKTA 2HJKB 2AQTA 1EAPB 4J1UB 4L0PB 3D34A 1LLAA 2ZUQC 1F3DJ 4ENZA 4NRYB 3KPMA 4G7YH 4F8QA 4AVIA 3TIEA 2QFRA 4UIMB 2DYRB 4IIZA 1KGYE 4XNQA 5GISH 3SDCC 5E4IA 2VLKD 1XGPA 2GQHA 4PB0L 5IWLA 3W37A 3IGAB 4WK0B 1E8XA 3IKCA 4R0LA 3FFDB 5HJ3B 2AHIA 5DJCA 4PJ9B 3O81A 1BFVH 3QFJB 4I18A 4WU5A 3CJJA 2J88H 4YDZA 3DGGB 4Y2DD 3MUY1 4PJ7E 4ZTOH 4KVCH 1A6WL 4R5VA 3THMH 2OMYA 3RI5K 3O2DL 3GT6A 4A68A 2Y22A 4ZBJA 2BIIA 2ZX9A 1AVAA 2JH2A 2APBA 3BPOC 4H0GA 4C56D 4I9WD 2LTQC 4KJYA 3ZHFA 4HJ0D 4LSUH 4B7LA 1NLBL 1G4MA 1I1AC 7PCYA 3LXUX 2PTTA 2GJJA 1YNLH 4YDNA 1CT8B 1GS7A 4OCWH 1AS8A 2XWZA 1N0LA 4TF4A 4CVZA 4X6DF 1IGCH 4RWYL 3QRGL 4H20H 3N55A 4D0CB 5DWUH 1WIUA 2BDNH 3ZY7A 1UT2A 1UJ3A 2VLRA 1F86A 4GS7B 4PJ6A 3LKSA 1DBAH 1NL0H 3LMJL 4E36A 1SJHA 1EZVX 2W9DH 2X5PA 3HN5A 3JV5A 5FUOL 1J88A 2IV9A 3QJVB 4U1LA 1X5YA 1ZV9A 3NABL 2TRYA 1VACB 3DJRA 1ODAA 3GSUA 5IW1A 4YIQA 3R4RA 3BW9B 5D7HA 3UJTL 2QVFB 5JW3H 3MOBL 3OKDA 4N24A 4XWGH 5D1ZI 1B0RB 1M2VB 3Q8BA 1F4WH 3TWCH 4DVBB 2IMNA 1A1NA 5J4MA 1MJ7L 5CN1A 4IRSB 4ZT1A 4BSWB 3EJZD 4RCAA 4X7TB 4MMYA 2VDKH 5KVDL 4LHUD 2ICES 12E8L 2YAQA 1TCRA 3ZQ9A 5EEVA 1QO3A 3T2OA 4W4OA 5DUBB 5B39A 3FO1A 3QYCA 4AV0A 5L88H 1V7NL 1U2YA 1RIUL 5EO1A 2ZX8A 1N7MH 3CC5A 3ZKXB 3QDGD 3NTCL 3VJ6A 1ORQB 3NCYS 1U8JB 4JG0H 4P59H 1OM9A 3MSPA 3DUSB 3OC5A 4JGUA 3UTPD 1BVNP 1HKLH 3OJMB 4BSJA 4YHZL 2XTJB 4L3EB 4PB9H 3ZE1F 2WLHA 2X2JA 1A6ZB 2FHCA 2BIHA 3RWIA 2BZDA 3HPJA 3PPSA 4XPGH 5FYJL 3T4AB 1JGEA 3ZE0F 3GUTA 3FQRA 3O6LH 3X14B 3REWA 2V9TA 1UZGA 2R15A 4JFTA 4WI3A 2YPKB 2G30A 3MV7A 4WI8A 4MA1C 2E9BA 2XPGA 1BZEA 3RGVD 4N2GA 4GW4A 1A6AA 1J1XL 1JRHH 2YUWA 4Q58C 4KHTH 1YN6B 1B9ZA 2J72A 3PJSA 2PPFA 1PZAA 1TITA 2KYIA 2EE9A 4X4XA 4YSCA 4Z7WF 4XP4H 3RWHB 4D0DA 2JJVA 3ZL1A 2W1NA 4HX1A 2YPLD 2Y2YA 4TVUA 1KEML 4PFEA 3WNLA 3CN2A 3SQBA 4O51A 3O8XC 1A7RH 2GCYB 2VQ1B 4ZW5A 3VB8A 2A2QT 3RTQB 3Q06A 4ADIA 1OE3A 4S0TD 4AQ1B 2ZJSL 3QDAA 2Y5QA 3ARFB 4XT1C 5FYKU 1HNFA 4E9XA 5ADPL 3CHSA 2XVGA 2ADJA 1N2RA 4EI5C 1GZHA 4I3SL 1NCGA 3UXFA 4UQBA 4LFHG 2KT6A 4S0HA 1CFVL 5I5IA 1A14H 5MENB 2QTVA 4FYQA 4UT9A 4XCFL 3O6MH 1ZIAA 3WMSA 5L8KB 1Y18B 3KPTA 4P5MA 1WZLA 4JDZB 2JI3A 4Q6KA 2PYEE 2LV4A 1LQSR 1GOFA 2X87A 5C0AD 4AEIL 1RUMH 5GGRA 2BJMH 1E30A 5D96B 2WWMC 3P3TA 5EUKB 5HGHA 4OV5B 2RAMA 1HZHH 3ZZLA 3UPRA 1KIQA 3IK2A 2F61A 4F8TA 1FNEA 3GIVA 3X1BA 3ARBB 2A9BA 1E4JA 5DJAA 4WNQA 4TUKH 1GJUA 5C6TL 1UADC 3QARA 3CE1A 4AT6A 5IBTH 2RBLA 1XB8A 5DK2A 1TQBB 1AO7D 1X6LA 4JRWA 5H37G 3S8GB 1IBGH 4OF3A 2GTQA 3CHRA 1K4DB 3GMQA 4K7PH 3VH8A 4PGCB 1BZ7B 4WKXA 3B3IA 2QADD 2R2EA 5TE7H 3SGEI 1JNJA 4XNYH 4FLQA 2BMKB 2DQTL 4WY7H 2DIJA 4LSPH 4N1HB 5J12B 3R7RA 2VW4A 1C16B 3QA3B 2AVGA 3F7KA 3QCTL 4D3CH 4FFTA 3RA7L 5E1HB 1DBJH 4JRXA 4X8CA 3NACL 1ZT7B 3PUUA 4JM2C 1AQ8A 4I7ZC 4TN9A 2LLNA 4UM9A 5DFTA 3DUUA 3RX7A 3UG5A 3CFUA 3U7WH 1Y6NR 3P4MA 4MZRA 1W16A 3O0LA 3RPKA 5HYJB 1D9KA 4JHWH 4E41D 4N0UB 1YUKB 4KRNA 2FEDC 3NCWA 43C9B 5J7CC 5CIPH 4ABVA 4AQAA 4UWQB 3GMNA 3F5WB 4GIPD 2Y6TE 1AFVH 3HG1A 1CFNB 2GUOA 1IM3A 4MXQD 4WW2B 2FYYB 1ADQL 1UACL 3B9KA 3HAEA 4UQDA 2DQUH 4W9DC 3OR6B 3NJKA 1N5YL 1B6UA 4RGOH 4YWGH 3NESA 1VESA 4NUGH 2KLSA 4YZFF 4BH7B 2AQSA 2HLEB 4Y1TA 4OJDH 1F42A 2G60H 3CDFA 3KMDA 2VMFA 1JZ7A 4DN3H 5LQBH 4FXKA 1IZKA 4GQRA 4G70B 1YMMA 2JKXA 3INOA 3DSNB 5KSAA 2QMJA 3OL2A 4DP0X 4UB0L 3BD3A 4QRAA 1YPZB 1WC7A 5ELIA 1QPPA 1PG7X 4ISVB 4AZUA 3FN0H 4RRPG 2B0SH 4BFFA 3ZDZE 4NBXB 4UIKL 4FKKA 5HSFA 4YLCA 3K7UA 1QNIA 3T3PF 1JZHA 5GGTA 2EXSA 5EIQA 1E40A 2XV2A 2YJQA 4HD9A 5HPMA 2C3GA 2FCBA 4P0DA 5T1LA 1M6OB 3QNZA 1AE6L 1AQHA 4B9YA 5CEXB 2YMOA 3LS5H 3U7YH 1QSEB 1M7DB 3ZZ1A 4UTCA 4CU6A 3DVIA 1L0XA 3MRIA 5LBSA 2WLIB 4GRLB 5C7XH 2H3KA 3FPYA 4HIEB 5ACLA 3K6NA 5I74C 1EO8H 4LCWA 4Q7DA 5B4MC 4OJFH 5F1NA 3DO7B 2X38A 1K6QL 2BRRL 2WMPB 4TSBL 5CKGA 4DT2A 3PHOA 1I7UA 2UWEB 4NAJA 1XF4A 4NZRL 4ORGB 1KZYA 1G9MH 4HU2A 2D9CA 1ZLVH 4KNQA 2I60L 4QWWD 4Y2LA 1IAKB 2VM3A 2Z8VC 4L37B 4BH8B 2IGLA 4N2KA 3N42B 2VO8A 3FTXA 3WTXA 4LIQL 2XA3A 1PY0A 2AK1H 4FL4C 3D85B 2EDWA 4OLWH 1CI3M 2YN5A 5L2KA 3BPNB 4HCRA 3T9WA 2EUVA 3ARDB 1BQSA 2HX7A 3KPRA 4AJ0A 3SKUD 4I13B 3D8MA 3K72B 2DJ4A 1P4LB 3VXTB 2WNGA 1RUAL 4FI7A 5CD5D 3QG7H 5F89A 4PP1D 1F3JA 1RZPA 1WAAE 3TP4A 2C7UA 1MF2H 3EF4A 4KUZL 4OD1H 5DI8A 4RZCB 2NY5C 2ZAIA 3DETC 4RA0C 1EGJL 5D1QE 4L4VB 2ZX7A 3FKUS 3L3KA 4FTVA 2NLJB 2JE8A 2MOVA 2FWOB 3QPQC 1CCZA 4FZEL 3GS0A 3CBKB 2BCKA 1E9OA 4PJCB 3R7QA 3RUGB 2QR0A 3RY5A 2FZ3A 4LRNL 5ANMB 2DD8L 2ZUQB 5MERA 2VDPB 1Z3GL 4MS8D 4NO0D 1NBZB 2OXHB 2VR8A 1IC4L 2APWA 1A64A 3PXJA 4JJHA 3VXNA 3UTQB 1IBZA 2Q2EB 3QIWD 1LEGA 5D4QA 3C6EA 1VGKA 2C4XA 5FUCE 1RZ7H 3DDFA 3JYCA 5I9QB 3SDCB 3QFGA 3TYFA 3FQUA 3CH8A 3MCLH 3QNXA 3UJJH 1EAPA 3W3BA 3LRKA 1QSZA 3I6SA 4AZ8B 1ZJAA 2BZCA 1B90A 4GP5B 5LXGH 5EDXA 4NRYA 3IFNL 3ARGD 4LCIH 1LHZA 3MGAA 2EP6A 4IMKA 3RU8H 2YKKA 2WLYA 1FVCB 1TCMA 5B7FA 1ZA3B 3TIDB 4MAUH 2VZUA 5L9DH 5DCCA 1RPQA 3IGAA 3BPOB 4QMEA 1Q9KA 2LTQB 4JPVH 5DJDB 3FFDA 1HL5A 2Y6SD 5AVRB 5HJ3A 4KJWD 4PJ9A 1I1AB 3FN9A 1W0YT 3DGGA 4DJMA 2VDQL 1CE1L 4KHXH 4P05A 4LU5L 5M94B 1ULVA 3JVGC 3FULA 2CAKA 2WLZA 5CP3A 1KZQA 4GLRH 3X13B 4M62L 4U33A 3TCLB 3RZCD 4JE0A 4PJHE 1QNZL 1JI1A 3QRLA 4HPYL 3RWDA 1HKFA 1PKQB 3QZWB 4YDMA 4ADJA 5HYSG 1CT8A 4JFDB 3BWSA 1NLDH 1QD0A 2MTAA 2VDOB 3MNZB 3DHUA 2R8SL 4PG2A 3A24A 2Z1PA 2IG2L 1DUYA 5CZKA 4D0CA 1BZQK 5A6LA 5AVXB 2G2PA 3GSNL 3GUFA 1BVZA 2W88A 3QCVH 3Q7JA 5K69A 1OPGL 5I19L 5BZXA 3SBWA 2GIYA 4ZO6A 4OGQC 3ZKQD 1GXEA 2XN9B 4AIEA 4OLVL 3F12B 2A1WL 2OR7A 5DK3A 3EO1B 4WWKD 5CCKH 3IRZA 3UROR 5E00B 5LDSA 1UD2A 5CJOH 2ADIB 3WKNA 1RK7A 2WP3T 3IETB 3ECBB 3GM0A 5ESQB 3EJPA 2IWKA 1F3DH 5GS0L 3RVVD 5EC2A 4JFFD 4LAQH 4QHLB 1CUOA 4XVUD 1LILA 5I6PA 1FNSL 4TSCL 1B0RA 1M2VA 4UQIM 4DVBA 4I1PA 1CURA 2TSBA 4BSWA 2GBVA 1W8NA 2VYRE 2BNQB 4A2FA 3WSQH 4X7TA 2NY1C 2GHZA 4UV7H 1ZSDB 3N40F 4B53A 2CHWA 4R5TA 2GHWB 2V9RA 3O6FD 4FADA 1E4KC 2LLLA 2XQBL 3D48R 5KVGE 5BRPA 4YHLH 3S4SB 3PYCA 3WIHH 4F3FB 3WTSA 1B4JH 4ZAKC 4AQ8C 2IXQB 1MLCB 4W6WB 4YHIA 5JXEC 5HPOA 2YQBA 4KNUA 4ERSL 4ETYA 4FKHA 3BFOA 4GO8A 5DJ0B 1U8JA 3STZB 4PS4L 3DUSA 1L7IL 4MA1B 5C0IA 1YJDC 1C7TA 4JM4H 2YEVB 1A6ZA 3EZJB 3T4AA 2D03H 5GS0D 2NZ1A 4HH9B 3JWDL 4KY1L 1MSPA 1ES0B 4OD3H 1FIGL 4LVNC 3CXHK 2JQAA 1X9RA 3BQUA 5IVNA 1E4WL 5DVMA 4UQ9A 2EDYA 4JLRB 5LB1A 2YPKA 5TDOB 3V95A 3ZKNC 4ATTA 1UD3A 3HW7A 4N68A 1ZGLP 3MLXL 3O8XB 1YN6A 3N1FC 3MRQB 5I8KH 4XTRD 3VXUE 1DVSA 5JIIA 3JBG7 2EADA 2YEZB 5FA4B 5ESAB 4AG4L 3HEIB 4U1SB 3T1FB 3CN3A 2P26A 3QPXH 3RGHA 3T6ZA 2EIZB 1U4EA 4NT6B 3NAAL 3QK0A 3IPFA 4FP8H 2GCYA 2ALWA 2VQ1A 3G6DL 3GBML 4L4TE 3RTQA 1BDYA 4DH2A 5K9KB 2ADYA 4YFLI 2WP3O 3NGBC 4N2DA 4A6YA 1NCWH 2N0KA 1OCZB 2WCPA 3GXTA 4AQ1A 3ARFA 4F7EB 3H3PL 3L5WB 4KAQL 1PF3A 2KQMA 2QGBA 5FHBH 1KXHA 1N8OE 4UT6A 3RL2B 3LNDA 2E76C 2ICWB 1NUDA 3WEBA 4F1ZA 3UC0H 1URZA 1SLUA 1GY2A 5MENA 1KTDB 1MEXH 4HIQA 1F1AA 1EIBA 1Y18A 3L9RB 4ZSOE 4ZUTB 5B3JF 4JDZA 4XMTA 2PWHA 2FTAA 1EO7A 1HEHC 3SDAA 1MI5D 2AF2A 4WFGD 4G9FD 1OZTG 5DC9B 1R24B 2APVA 5MP6L 4OV5A 1JHTB 1VZIA 1F8TH 1UFGA 3H8NA 2IWFA 2K0RA 1LMIA 3ARBA 2ZKHH 4LASH 4G9DB 5SWZD 2RFXB 3NJFA 4NQDD 4Y9FA 4LKCB 1U95B 5AQ0A 3WY2A 1X5JA 2WO3B 3TFKD 4XN7A 2BSBA 1HJCA 4R9HA 2B7DT 2WVSA 3P30L 1JNLL 2IDCA 5LJYH 4U1HB 4Y16C 1P9MC 4Z0XB 1DVYA 3E9UA 2FEEI 1K4DA 1E4XI 1BZ7A 1KCRH 3QDME 4AKOA 4JM2B 2EILB 1AANA 5KZCD 5IGXL 4IS6B 2ATPB 1AG6A 3CGTA 1C16A 4XXDB 5BNXD 1J1PH 3QA3A 3TWYA 5K39B 2ZF9A 3FUKA 5HY9B 1MVFA 4F91B 3TNNB 4CDGC 2EDFA 2WYIA 5E2TH 1NCBL 1AMYA 3NDZE 4JKMA 1OHQA 1QBAA 2HT2C 1MUJB 1MIEH 1VADB 4MNGB 3L7FB 5I1CH 1V55B 3EUDA 5CN3A 4KQ0A 5HYJA 4PRPB 4QKTA 2EABA 4N0UA 3BC9A 2PPAA 4K7PX 43C9A 4GAGL 4YSAA 4NQCD 1FL5B 4N2IA 3EO9L 5AAMA 3NQKA 2JCCE 4CRPA 1OCWL 4Y5YC 4DW2L 1SBSH 1CFNA 1ZKAA 2PWGA 2NY6B 4WW2A 1UWXH 5D2NC 3HR6A 2FYYA 4OZGF 2DAVA 3OR6A 4R90H 1K8IB 3ZOAA 3FB7B 3LQAC 2WZ5A 3FYEB 1N19A 1GR7A 4KVNH 4C4UA 1IT9L 3D50A 4BH7A 5LCVH 4G6AC 4ABQA 1BZDA 1RMFH 2DMCA 3NH7H 4X6CB 1T7YA 3BSZH 3MLYL 1I8UA 2Q0ZX 2VM4A 5AYUL 3V7AE 1E5ZA 3N44B 3IFLH 3LXAA 3FO0L 1TJGH 3ZL2A 2F8IA 1EVUA 4JO4H 1JK8B 3RI5F 4AQOA 1LYQA 1YPZA 1T03L 1RHFA 3UAFA 1S7VA 2XFGB 3HMXA 3TONA 4EUPG 4ISVA 3L2MA 5L7XH 1H3PH 1YYCA 3D6GA 4W9LC 3NSYA 1TYEB 4QAMB 4WDIA 5I74B 3VG0L 3T71A 2FO8A 4M56A 3TJHD 5LAPA 5KVFH 5CSZA 3C12A 4I88A 4NX0A 5CEXA 5CKAA 3BI9X 1IU1A 4HPOL 2IPTH 4JHBA 4KXDA 1QSEA 4L3CA 3UTTD 1M7DA 5K9JH 1A9VA 4OGYL 2Z9TA 3JWOL 4GRLA 4DTGL 3H53A 4HIEA 3VFRB 4HYTB 2EIDA 4KQ3H 1OAYH 3H42H 4Z7VE 2WIIB 1SDAB 2V5RA 4FL4B 1T0OA 4EI0A 2Z93B 3L4CA 2WBJB 2WMPA 1CJYA 3N9GH 4RA3A 2VDRB 3L17A 2UWEA 1NSNH 4ORGA 2FBJH 4UTBL 3X1FA 5IB2A 5IQMA 1FQ9C 5KJRH 4WU7B 3CBJB 1N5AB 3L7EB 1IAKA 4BH8A 4WW2F 4L37A 3MV9A 2J7LA 3ECUA 4MJIB 2YZ8A 3CX5K 3D85A 1FPTL 4U3SB 1ORSA 4O00A 3HE7D 5D7SH 5LNEA 4Z95L 5DVNA 4JRYD 1DSYA 3L6FB 1IE5A 3K72A 2P4AB 5LHDA 1P4LA 1X4XA 1Z5YD 2GSIB 5KBMA 4M1GH 5DJ8B 25C8L 4X6FB 2XQYK 3D5OF 3F65A 2FX8L 3WIIL 2A5UA 1FCGA 4RZCA 1EZSA 3KWUA 2YBRB 4LF3B 4L4VA 2BFVL 4E2OA 2NLJA 2X4RB 1EXGA 3EFOB 4RX4D 2MKWA 1BZ8A 4PV9B 4PJCA 4FCAA 3DX3A 3RUGA 3KR3H 4LEOB 2HFEB 5ANMA 1MNUH 5J9PB 5I18L 2VDMH 3SD5A 2CR3A 5DZPA 1NBZA 4X6EA 1N18A 1YMHA 3SPGA 4QYOB 3C6LD 1A3LH 1XGYL 4JO2L 2Q8BL 3O9WB 5HHPB 2Y1YA 4E0RB 3UTQA 1NAMA 3AG4B 3I50H 2ZQKA 4F2FA 3SDCA 1HCVA 3HBPA 2Q87A 1S46A 4G83A 1SOXA 1KPVB 4BIKA 1MCJA 4AZ8A 3RWFB 3PJLA 2PYEB 4PMEA 3B5HA 3QR0A 3DHPA 4GQ9L 3D06A 4XOCA 2IH1B 1JNHB 1E5BA 4X5QA 4NZTH 1PQZB 1RV6X 4PRHD 1P2CB 1FVCA 2AK4D 2X4NB 4R7VA 3FQYA 4LPYA 5CEYB 5E4AA 5I1HL 4XVJH 4P23D 2UWEF 1J0KA 5DJDA 2YQ3A 2FLBT 4PVLA 3BUYB 3B2VL 3REVB 4XAKE 2F5BL 4WENB 3U82B 1I1AA 4TQEL 5JQ6H 1V3JA 2ZUWA 4YSSA 2XETA 3MYJB 3GLDA 4IEFB 6FABL 2DRUA 3U1PA 4L1LA 4ZFGH 1F2XK 1NUNB 5SWSE 3TCLA 1TTCA 3N6YA 3IF1B 4Z7AA 4GXVL 1XH3B 5LWYL 1PKQA 3D69B 3QZWA 4AKPA 1KXTB 4JFDA 5CJBA 1H3WM 3MNZA 3OTTA 3VXMD 1I85C 3MUZ1 1ZLDA 4JEGB 3GSOB 4OLYH 2DWXA 2DF3A 3SDDC 3PP4L 1NEPA 1RLBA 3S34H 4PJCF 3RUGF 1BEXA 1IZJA 2XRAL 4KV5F 4NFCA 1TQTA 1XCWA 3B7TA 1JZGA 1A5FH 1J5IA 2WXNA 1BQUA 2XN9A 3GSVB 3F12A 4X6BB 1MAKA 2ZXCA 3L95B 2NY1B 5E00A 2QQNH 4IKKA 5DZJA 4OJAA 2IBZY 1YYLL 1ZANL 3ECBA 3O4LE 3EDDA 5ESQA 1NGQL 3O11B 4QHLA 4RAVA 4ZOAA 2HPOA 4JQVC 4ZAKB 3V0WH 3UJIH 1XXFC 3U4EA 2BWDA 1J5OL 3CHPA 4N2LA 1HI6B 3CHQA 3ASOB 3ZDWA 5B8CC 2BNQA 1Z9PA 4W9ZA 5KVEE 4Q9BA 5I8OH 1ZSDA 4ZOBA 4FTDA 1NPNA 3C87A 2UZXB 3MTXA 4F2ME 1DVTA 5F7EL 3S4SA 1KB3A 4DKAA 2J8HA 1WUNT 2YHGA 3G3LA 4JCWA 2IXQA 1MLCA 4I1NB 3MLRL 4NERA 4LVNB 2EDDA 3CSBA 1WWWX 3UYPB 3V4PB 4BFEA 5CM1A 3STZA 4YXLL 1IGMH 3MFFB 5EOQH 2OYLA 4J3WA 2DTSA 5L8LB 2D7NA 1JXKA 1T5XB 2FT8A 4YE4L 1OCOB 3MRGA 4LGRB 1IM9D 4HH9A 4ACTA 5CGTA 4M7JH 3ABLB 3QS2A 1RZKH 4FNQA 3U2SB 4JLRA 1H9DA 1A4JA 2F54D 1U8KB 3K1KC 5TDOA 5DURB 2O6EA 3LYRA 2I7OA 3VSQA 3O8XA 5CJQH 1FRGL 3MRQA 2OZ4A 4YMPA 1UB5B 4U6HB 4DAGH 5K1NA 2YEZA 2AGJL 4FOMA 5IHHA 3LPGA 5FA4A 2VDLH 2VLJD 4K3DH 3GXFA 3NGBB 1QTYT 2XWDA 4I2XE 3ZRFC 4U1SA 3CVHB 1DLFL 1M7XA 1IAOB 3ZTCC 5DQ9B 3ZGHA 4K3JL 3IBOA 1BEYL 1YN7B 5A7BA 5KUMA 3QUMH 3ZKMD 1EUUA 4ADGA 5JPNC 3C5JB 5CINH 1J18A 2I85A 5DA0B 4QRPE 1DTUA 3HA0A 2YGVA 5K9KA 4JG1H 5KUKA 3DJSA 4PJ5D 1QWHA 3ZYOA 1P7HL 3FO2A 3NA9L 2WLKA 2N4IA 2KH2B 1SXZA 2KZ1B 3MRDB 4N1EA 4FQPA 3CSTA 4P2RA 3GZOA 4TXVB 2ICWA 5DMIH 3IPEA 4DK3A 1RU9L 3UIYA 5LLIC 1MCWM 5AOIA 1S78C 2WVTA 3WYRA 2HZHA 1KTDA 1IKFH 3KJ6H 2ITCB 3WDHA 3L9RA 1MCPH 4RMUA 4ZUTA 1CXKA 3ISRA 5EU6D 2JXMB 3AADB 1H3XA 4DGVH 4OZIE 2EE2A 4Z8FL 1YAIA 4WO0A 1UWYA 1R24A 4Y16B 3H2PA 3PDOB 2R1YB 5FGRA 2CJ3A 2P43B 3WNJA 5C2UB 3QUXC 4HJJL 1S5HB 3OPUA 4G9DA 4WW1A 1EUTA 4U1MA 2RFXA 4JDTH 4LKCA 4NUJB 1U95A 3EBIA 1NMBL 3FF8A 3KPSE 1MG3C 1ANUA 3G5ZB 2ZNXA 4QHMB 4J5VA 4S10A 4U1HA 4Z0XA 4YHOL 2VKXA 5TE4H 4OLZL 1BQLH 1OM3L 2X0WA 1GC1L 5DD6B 4AC2A 5C0EA 3LEXB 3RJQB 1A1MB 3P3SA 5BS0D 3B2XA 1CR9L 2YXVA 5ALBH 2ATPA 2X3CA 4TOYL 4U6VL 3BD5A 2FUQA 2YMTA 4UAHA 5HY9A 3TNNA 3KGUA 4PJ7A 5HHVL 1HH6B 3EYSL 2Y24A 2ITFA 3AXLA 3WY3A 1MUJA 2A6IA 1Q0YH 1VADA 4FA7B 4MNGA 3L7FA 4HISA 3IU4L 1A9BB 3VNYA 4N6RA 3U4AA 2R0WH 4MYPA 1E67A 4MAYC 5AW8B 1FL5A 3IFOB 4OF5A 3VFSA 4HQQH 4GBXC 3QEHB 5EEWA 4NKOB 5C9JA 3N50A 1WH0A 2TRHA 5JPMC 4TLTA 3ME0B 2VH5H 3L48A 1UA7A 3T2LA 1K8IA 4J4PA 1T0MB 5T1DL 3FB7A 4K9EL 4RGND 2VRKA 3HS8A 5LN4A 3B7YA 4LEXL 4POZD 5EEXA 5FDYA 2NY0D 1RIHH 1CICC 2DTMH 2FJSA 4YBLC 3MNVA 1GGCH 4X6CA 5AW9B 5TF1L 1F4XH 4ZODA 2RTTA 4JR9L 2YZ1A 1ILSA 1RD6A 1KELL 4IGBD 1UXMA 5IUSA 1JK8A 1HCFX 1AHWC 4Q0XL 4FLRA 1UZ6E 2B39A 4K7FB 5EIIB 1U8LB 4JO5A 1SUJA 1KCVL 4ZDHB 4WK2B 5J1AA 2C3HA 1D5ZB 4NWTL 4YXHL 3QQ3B 1UZ8B 1YEKH 4OM0L 5IMOB 2NQCA 3D3VB 1GVIA 4LB8A 2P44B 4ZS6D 5HVWA 2ZKWA 4HS3B 1NEZA 3D05A 3H7BB 5EZIH 4PJ7F 4WHTA 2WO2B 4N90E 3VFRA 2ZOLB 4ESKA 5A3IC 1XSJA 3PNRB 4OF0A 1GGBL 2WIIA 4UV4L 3SGKA 4MBRA 2R56H 2IQ9L 1BXVA 4UT9L 2B4CC 3QQ9D 2Z93A 1EHLL 4JREC 2WBJA 2E46A 4WSJA 5GJSL 5B1CA 2EDJA 5IFHL 2DJSA 4Q56A 3GTTA 1W0WB 4IRZH 1TZAA 4XC1L 1KLFA 2VMDA 4WU7A 3S37L 1XEUA 2BSTB 5CIPA 1OTUD 4MJIA 2XA8H 3QEQE 3WFDL 4V1DD 2NQ3A 2WQWA 4U3SA 4X7CC 1R3LB 1GRWA 4IIQC 3HG4A 2Y72A 3L6FA 3J8F7 4JFZH 2FK9A 4ODXB 2GSIA 5CWSA 4U0RC 2FHFA 5DJ8A 4X6FA 4PJBB 4LOVA 1LK2A 3RGBA 4ZW6A 5D7LE 1C1EH 5C92A 1EJOH 1U0QA 2YBRA 4LF3A 2VW7A 4MBOA 2WZPA 3P9LB 2XJLA 3X11B 4CN6A 1RZFL 4PMFA 2GB2A 3EFOA 3W38A 5LVEA 2OJZL 4TPRL 2XV3A 4PV9A 4F5CE 4LEOA 4H25B 5FYLH 5J9PA 1J9TA 1X3DA 2DDQH 4LPWA 1KGCD 4F20A 2DL9A 4QYOA 3O9WA 2H2PC 3PDDA 4M8QA 5F21B 3T8MA 1OAQH 5HHPA 4E0RA 3UFIA 3MOQA 1ZHNB 1NWPA 3L5IA 3OWEA 3U25A 4DF9A 1ZV2A 4WHDA 1KPVA 4ZSOB 5F7BA 3RWFA 1NCTA 2PYEA 5TQ2L 5EBWB 1ZTXE 2ZKYA 4Z76B 4FI8A 4PY7B 4F7CB 1M4KA 3HZKB 2FX7L 1MPAH 2TSAA 4OFDA 2ARJQ 5T1KB 4HHAA 3UBXI 1PQZA 4XR8C 1SY6H 4AV5A 5IJVB 3JVGA 4JZOB 2X4NA 1NIEA 3MLWH 2D4FA 1RKRA 1ZEAH 5CEYA 1QBLL 1T2QH 4UF7C 3L1FA 3TT3H 2J43A 4GRMA 3BUYA 1CL7H 3A6BL 3KD4A 3REVA 2CBTA 3BVNA 4WWOA 1Y07A 2NPLX 4BJLA 5DR5L 3P11H 1KBGH 1RP8A 2GK0B 1EA9C 5DO2D 4CMMA 2IBGA 1T2JA 4JRXD 3MYJA 3HCVA 1KG0B 1UA6L 4IEFA 4UM9D 3QDMB 2VDOH 2WUCH 5DJ6B 5LO7A 3SDDB 3VWKC 4DP9X 5J13C 3HN8A 2EUWA 3F8UB 3W56A 4NWUH 1D9KD 2ZUUA 5IG7B 3PAVA 1ZS8B 3IF1A 3ZYZA 3Q1EA 1FA4A 5H37H 4XXCA 1KTRL 1XH3A 4PU2A 4OT1H 3STLB 3D69A 5E24E 4G42B 1KXTA 3B8YA 1IM3D 4XMZA 3PWJB 1GL4B 5GGTL 3GSOA 4OZFB 4ICXA 3B9KD 1OP4A 1AC0A 5FYKH 5JHDE 1MHCB 3P54A 2CK2A 2WSDA 4BHUA 5K59E 2EDOA 4H13C 1T4WA 2X05A 2DQGL 2I5YH 3D2UB 4PLKC 5F96L 4TNVF 1P4BH 5LBSL 1EPFA 3GSVA 3BN9C 4XB8A 3SJVB 2I9TB 1HFUA 4X6BA 4JQXA 4L1TA 4JCLA 4Z9KB 4L8DA 4MJHA 3ZX1A 4OU3A 1IGIH 5JHLA 4C56E 4I9WE 1UKQA 1E4KA 2WVVB 3O11A 1NCHA 1PLCA 2EO9A 4I4WB 3QZNA 1QW9A 4P5TB 5CHNB 1QSFB 5D70L 1BFSA 4ZAKA 1M56B 4AQ8A 3KWVA 4N5EC 1DQVA 2J55A 5JXEA 3IMRA 5E2WH 4EKXA 4DEUA 1HI6A 5HD8D 4BCXA 3FU8A 2YGQA 1KJ2L 4P9HL 3CPLB 5DJZB 3SGDH 3AS2A 3WY1A 1KXVC 3L2LA 1RAMA 4S1DD 2UZXA 3DIVA 1G87A 4HCRL 1ACYH 4ENED 2ED7A 2ZX6A 4HWZB 3FH7A 4FF9A 4A7GA 3NFNA 2OTUA 5DSCB 3V5DB 4XMUA 4PRNB 4MDJB 2Z7WA 3UYPA 3V4PA 4UMSA 3GB7B 3L3OC 5D7IB 4PS7A 3M1BA 1F56A 1RH8A 1Q1JL 3GGWB 1T5XA 5IF0A 1YC7A 4LCWD 1HOCB 1OGSA 1FZOA 1INQB 2XTLA 4IRJC 5E99L 3TJEL 5FIEA 3KYAA 3LNHA 4PM1A 3S36L 1UQSB 1F4YL 4K15A 1KGXA 5F2FA 4GH7B 3U2SA 3WEMA 5KAQF 4FJ6A 1SVBA 5JIDA 1U8KA 1OAKL 4QPEA 3N85H 1XGTB 2X10A 1IGFH 5E6ID 2MNJB 1UB5A 4OJEH 1SHXA 4U6HA 5L2KD 1RY7B 4DUVA 1WCQA 5IREA 3KPRD 2OX5B 4OIIH 2X28A 1PZBA 5CN2A 2XT1B 3K4DA 3ZJAA 3UTPE 3VA6A 4LEBA 1IAOA 3SKJL 3EH2A 3NSFA 5E2VH 5DQ9A 1YEDB 2G0KA 1YN7A 2D0FA 5JW4Q 2ZP8A 3AWEA 2ILLA 2AMGA 3QGVA 4TTDD 1SEQH 3IAPA 1C5DB 4TLSA 3C5JA 1OAXH 1OAUL 2FATH 3TURA 2AANA 1CTMA 2XBTA 2JKTM 4GXUM 1Z7JA 1DQLL 1DQKA 4FFYL 3RWJA 5DFVD 4DPAX 3IWUA 4HXBL 5J89A 3NZHL 5IOPA 3BZ4B 1LDPL 4XO8A 1WAAA 3MRDA 4XNXL 5D1QA 4F37F 6CGTA 4QO1B 2NT1A 3NOIA 5DRZB 1F18A 2DLFH 2JNZA 4KZDL 4ACPA 4A7GF 5DRWB 4BUQA 5DDHB 1P7QB 2XNAB 3QUXB 5GHWL 4GLRI 4EXKA 3A67H 2X1PA 2Y2TA 1K5WA 2ITCA 4XCYA 4HU8A 2BVQB 1H15B 2JXMA 5FW8A 1FUNA 3ZDZF 4DNLA 1WTGT 1SMAA 1OK8A 4TULH 5BW7C 3QH3B 3K5SA 1C5BH 2CBMA 4Y16A 1P9MA 3PDOA 2VITB 3WEAA 2R1YA 1PEWA 4FFWC 5C0CB 2MCAA 3AY4C 1WDAA 3B2PA 1EEUA 1HNGA 1S5HA 2WXMA 5F7FA 3AABA 4FLOA 4NUJA 2UVFA 4FQLL 4TNEA 3G5ZA 2E9GA 1SLVA 4QHMA 3RWGB 4NB7A 3UG4A 2PTVA 3V4VH 4ORZC 3EHBC 1E2ZA 1YEEL 3WUWB 2P80D 2DI9A 1I53A 1MLBB 4DKEH 3DIDA 5EZOH 1HXMA 4WJ5B 5FKPB 5KSBB 3LH2L 1RSYA 1YEJL 3ETSA 5DD6A 3LEXA 4FYTA 1A1MA 3E9TA 4R2GB 1PD6A 4HSAC 1PW3A 4UBDD 3V52H 1FF5A 3WTVA 1NFIA 3QAQA 4MAYB 4XMPL 5BOZG 2VL5B 4GBXB 4QJ5B 3CFTA 1HH6A 1YSOA 4V2BA 5JPMB 5DS1A 4KTEH 1HE8A 3FS9A 4FRWA 3B9AA 4NN7B 4QNPE 5IROD 5K33A 1A9BA 3EJTA 5L6YH 2DLHA 3ZR5A 2WAHA 4OFQA 5EU7E 1WEJL 5LAXA 5SWSB 4ODHH 4PWEA 3SDYH 1R5WB 2VLLB 4PJHA 5LGHL 1AO7E 1JGDB 4RMBA 3VD0A 3IFOA 3D4ZA 3T08A 1WAAF 3HB3D 1CICB 3CQQA 1MIML 3IAQA 4YBLB 4DQOH 4GW5A 3QEHA 1H8NA 1JTOA 2FNWA 3SCMD 2MQ3A 5MEPA 4BA0A 3ME0A 4EIZC 4ZMWA 2CCLA 5DZNA 3V6OE 3K71A 1T0MA 3SE3A 1ONQB 1MXDA 3IEAA 4YDKL 4ELME 1AHWB 4PWGA 2KZKA 2NSXA 3HJEA 4LCYB 4NGHH 5SWQA 4TL5A 4JX0A 1KBPA 2FX9H 3BDXA 1BF5A 3PIQB 2OL3H 1CDJA 5T5NG 3TT1L 3MLUL 3W9EB 3GRWH 1Z32X 1XSOA 1F6AB 3VU2A 1DL7L 2JKJA 3OKMB 4NKIH 4C47A 5BVPL 4K7FA 4Y2DC 4CMHC 5EIIA 1F13A 1U8LA 4YR6B 2H1XA 1DE4B 3WEXB 2AXFB 1L5GA 3CXDL 4I5BB 4ZDHA 2EEDA 3HOGA 5AOZA 1GAFH 2CLZB 1L0QA 4OF6A 1D5ZA 3DX8B 2YR3A 3QQ3A 3WFEL 4KPHH 2EDQA 1BAFL 1UZ8A 2PR4H 4D9LH 4HJ0C 3NP3A 3L45A 2A4ZA 5DHYA 4F2MB 4LSVL 1ET8A 1EFXD 3A5VA 3D3VA 4A6YL 3RAJL 4JREB 4DWHA 2WNKA 1N0XH 3HI6L 3L4YA 3BQUD 4K2UL 4MXVF 3B7RL 1Z9NA 4HS3A 4JDVB 3IDNB 4OM1H 2ZOLA 3K8MA 4UT6L 4F57L 4HG4K 3P0YH 1WZ1H 5HTSA 2SEBB 1JCVA 4YC2C 5HGAA 1K3ZA 5FS5A 3CDZB 1VEPA 1J5DA 1VFAB 4IIQB 5F7HA 4PJHF 3RJDA 2UY7B 2YA0A 1W0WA 4OIAA 3NCJH 3ZYJA 4Q6IC 4U0RB 1GPOH 1QUPA 5IESH 3KPQB 4GRWH 3BGMB 4OLXL 4Y19B 1S9WB 2IAMB 4O58L 2BSTA 2VR9A 2BOCB 4Y89A 3U4KA 4YO0B 3VW3L 4GAAA 4QXTB 3VFWB 4UNIA 2RR3A 3VXUA 2Q3ZA 4ODTL 1CQYA 4BWTA 1R3LA 1MAJA 3MX0B 2YK1L 2W0FB 1J5HA 4I2XB 1MKFA 3U9PH 3EJZC 3WS3A 1L9RA 1J1OH 2D7MA 2NUTB 4PJBA 4EPSA 2BOBA 2C26A 1UH4A 4NP4H 4O2FB 3Q5TA 1Z9SB 3ILPA 4YDLC 1T21B 2YGPA 4QRPB 3P9LA 3X11A 5DD1L 1NCNA 4JFXA 1IFGA 1I7ZA 3QAZC 3HLAB 1QKZH 1FYTD 3M88A 3C2AL 4H25A 1HJBC 3SDAD 4FE9A 4Y2OB 4PJ8C 3QPKA 3CPUA 1D7BA 1TYRA 5TTRA 1ZHNA 4J6RL 4CVXA 5HDBF 5KVMC 3FMGH 5AUMA 4ZSOA 1AGDB 1VGEH 4KXBA 4JY5L 4XP9L 3RGVC 3VD2A 1C8QA 5EBWA 4Z76A 4PJEB 4OZIB 4F7CA 1FAKT 3HZKA 5HHNB 5T1KA 5AVUB 1I1YB 5IJVA 4JZOA 2KMWA 1G6VK 3RVTD 1KYDA 1WK0A 4E9RA 3L8QA 1PAZA 3RWCB 3LD8C 1Z5HA 4Y7OC 1OAZL 5IMMB 3KPSB 4EZLA 1L0YA 4KQ4L 2QT6A 3WFCH 2B5IC 4PVMA 2FSEB 2GK0A 4Z7OE 2BY3A 3E38A 3U6RB 3WG7B 1TETH 3QDMA 5DJ6A 4G3YL 1RXLA 3SDDA 1UKSA 4WHYG 3C5ZD 4EBQL 2AXGB 5ICXB 5IG7A 3C08H 3L4XA 4K94L 1ZS8A 3HMXL 5IMLB 4XZ4A 5GZND 1K85A 2AAVA 5ISZD 1DBKL 4DHLA 1OGAE 2I25N 4G42A 4HH8A 3QQNA 1UXLA 3VVWA 1YEGH 2XN2A 3HFMH 3O41B 2AJUL 4P48A 2VR5A 4P4KD 3U6XS 3WHE0 4OZFA 2RCSL 4WWID 3BUQA 1MFBL 5BCAA 3LCYA 3EDEA 1MHCA 2ZNWA 4B7IA 1RVFH 2CIIB 3F04A 1VA9A 2YWYA 5J06A 5C07D 5CUSL 3BGFC 3P1VA 3D2UA 4JQVA 2VNCA 3WAJA 4KDVA 2P1YA 3BXNB 3PREA 2XOTA 3SJVA 2I9TA 2JCCA 3DYMA 2M8XA 4S1SH 3HIZA 4Z3GA 1FAIH 2DQDH 4NHCH 2IBBA 1F5WA 4WIQA 4JPKL 5D6CA 3LEYH 4I4WA 1WQVT 5CHNA 1L9MA 4P5TA 1AP2B 3OHXC 4WVRA 3U4BH 2M1KA 1TZHB 3K2UL 5DC0A 1FSKB 4FNPA 2HWZH 1KFGA 3IS1X 3QWOB 4EAEA 5AVVB 5BV7H 2X3BA 3BKJH 3CPLA 3GS4A 3L3OB 5DJZA 2QADC 4J3OG 3V6OC 4IRJB 3R8BB 4HWZA 1IAIL 3ZZSA 2FECL 1X5AA 4KKAD 4L9LC 5DSCA 3V5DA 3MMEB 3LZRA 3NCFB 4PRNA 4MDJA 5FYJU 5EEZA 2IAND 1S7UA 1P6FA 3EYFB 3GB7A 4TVPE 2XXCB 4MB3A 3GGWA 1QBBA 4S1RL 4Y1AD 4TTGA 5I5MA 1O6SB 1DQQB 5IZ7A 3QBTB 1HOCA 1XIWD 3LN5A 1L7TL 3GNMH 1INQA 4DK5A 2O6FA 3Q48A 3WNMA 3ARED 4EUPH 2WZ6A 4QR7A 2F7OA 4IMLA 5EIVA 1FNGB 2VR4A 2YD5A 1LDSA 2VDPL 4MXQC 3NEEA 1Q72L 3BKMH 2F8OA 1OIOA 2F7IA 5DMJB 3V0GA 3K5RA 2HMID 1XGTA 4TNWF 4JFOB 3MV9D 5IHUH 2YMXH 5CP7A 1NAML 1ZMYA 3VFGL 4Z7VA 5EOCL 3SKOA 4BGDA 4JDEB 2PW2B 1MFCH 3SZ6A 4IHOB 3BKYH 5BMFL 1AKJA 2OX5A 4L8SA 4YSTA 2WCSA 1RZIA 2JCCF 1YEDA 2FLMA 2IPUG 1AGFB 1MCOL 3DOSB 5JYMA 1WA1X 4HC1A 2VZOA 1S7RB 3V0IA 1QHOA 3T6WA 4CW1A 1A6VH 3QEQB 3L08A 1KDJA 4A7QA 1HH9B 3VFVB 5IEHB 2IAAC 2BWQA 4IHBA 1RJLB 4A7TA 4HKZB 2AS5M 4OZHE 2A9MH 2O5ZH 3BZ4A 4MMXC 1F11B 2YD9A 3CFIC 1D5IH 4GP4B 5D7LB 3VFTB 5I76B 5G2NA 4WGWB 1NMAH 3FTYA 4QO1A 2YLKA 2R0KH 5DRZA 4UOW0 3IDGA 4ZUUB 4AGLA 5DRWA 5DDHA 2XNAA 3QUXA 4L29B 4QTIL 1M6UA 3OB0H 3P2TA 4N8VG 2BVQA 1TO5A 2I07A 1H15A 4BZ2H 3BIAX 3CAFA 3FRPB 5I0ZA 4G43A 3LSOA 3MYZA 3QH3A 5FM4A 4ZFQA 4U3XA 3EHBB 4QI3A 4Z7QB 2CA3A 2VITA 3EKCA 5C0CA 1FE8H 2ZCLH 2EUZA 4QAWA 1BM3H 1E9QB 2D2CC 1Z0MA 2ZCHH 1WWAX 5D7EA 4BQ6A 4QWWC 2ATKB 1E5YA 5CEZL 2AJYH 1NCDL 3UX9B 1RFDL 3SKMA 3RWGA 5DS2A 3LS4L 4L5FL 1TXKA 4Z7VF 3TX4A 3QORC 4MYWB 3ULVE 2CCWA 1ID5I 3T2NL 5I17A 1E3FA 5GSRA 4HOMA 5FKPA 5E1AB 4PIBA 4WJ5A 2DQ6A 4HUNB 3OF6D 1E6JL 4PRDB 5CD5C 4G6MH 1LXMA 1WBYB 4TVPH 1BJ8A 1MI5E 2XKSA 4PP1C 4WFGE 4X9BA 3X17A 4ZMYA 3VVVA 2C3XA 4MAYA 3LQAH 3EUUA 1D7DA 2O61A 2VL5A 1DZ0A 3CLEH 4GBXA 1UOLA 4JFDD 4R8WH 3CVBA 4NIYE 3NZ8B 3EJYD 1FVEA 3CN4A 3KLDA 4IOSD 2ODHA 3B2UC 1UOVA 4N3TA 1KJ3H 2GTWB 4NQDE 5E8DH 4QJ4B 1WBXB 2CHNA 2O5NA 1YYML 4YHMH 1XHHA 5SWSA 5EA0H 4MS8C 1JZEA 3AQYA 1R5WA 2VLLA 4GSQA 4WWPA 1E9PB 2Z8RA 1WAPA 2B15A 3QIWC 4P8QA 4KX7A 2H9GB 2K7QA 2Z4TA 4NAMA 4U49A 2VLKB 3OVUB 3QUKB 1F58H 3ZRCC 5HJGA 3THML 4KROB 4NZDA 5J5EA 4XCCH 1FNAA 3QG6B 1ONQA 5AZ2L 1AHWA 3ARGC 3H0TB 4Y2DB 3MGOB 4CMHB 1JGVL 1KWKA 2D3VA 2J4WH 3M17A 5E9AA 4ODSH 3BT2L 32C2B 3PIQA 4E9QA 2C7FA 1JHKL 2OZ4L 4C56B 1WCBB 4X4KA 4ILDA 4IDJL 3Q44A 3O4LA 2ROXA 2Y6SC 1ZLEA 4XHJD 4HBCH 4KJWC 4OB5H 1F6AA 1EHAA 3OKMA 1HWGB 3TBSB 4E5XG 1MHHA 4F2EA 4BWUA 2LLGA 4OFKA 4RESB 2AXFA 5ADOH 1G9EA 4I5BA 2NY7H 5AZEH 3X1NA 4MVBD 1SZNA 2ZYHA 4HGWB 2JWYA 3SKNA 3ZGIA 2CLZA 4KTDH 4P04A 3UDWC 3EH4B 1TTAA 3DX8A 4OVUA 4UILH 3RZCC 4XH2B 4YC2B 4F2MA 3BX7C 1IC0A 3D39D 4PLJD 2EUXA 3EJUA 4NKMA 2YD0A 1HHKB 4QKXB 5JW3L 2OCJA 1M71B 3DWTA 4JFWA 1LO5B 5H4YA 3GJFB 3RE0A 2Y25A 3TWCL 4JDVA 3GHEH 3K2IA 4W70A 2QQLL 4GMTH 4X5XB 2VRAA 1KYOJ 2SEBA 4GMSL 4XNUL 5IBLD 3MV01 4B27A 1B0IA 2DBLL 1VFAA 4IIQA 4BXSV 5MEQB 4LMQE 4OCRH 3VD5A 3BCDA 2VXQA 4JVPA 4C57C 5A2BA 1BBDL 2UY7A 2BM3A 5KYYB 2XZQL 4WI0B 4WWKC 5AD0B 5JOPD 4X99A 3MRMB 4LHUB 3ULVH 4MHHI 5E6YA 1RL1A 1U3HC 4Y19A 1S9WA 2IAMA 1QASA 3G5VB 4JG0L 2BOCA 5TPWH 1FFPB 1OSEA 3LJ3A 2P5WE 3RVVC 3WKML 4YO0A 3B56A 5DUMH 5EDSA 4QXTA 4XVUC 5IKCB 2QPEB 4YDLB 1LNUB 3QDGB 2MRYA 4LLWB 4PB9L 4WKZA 5CJXC 2W0FA 4PQXA 4I2XA 5DD3H 2R4SH 1BZ9B 5KJ4A 3QAZB 2AQ3A 3APMA 5E1GA 3O6LL 3BZEB 4FN0A 2NUTA 3FBQA 3O6FC 5DXWA 4P2RD 4O2FA 4OGAD 1T0PB 1Z9SA 2A74C 3TCXA 1T21A 1R46A 1PDKB 4QRPA 1JRHL 1PZSA 3MAWA 4OGXL 3PWNA 1U4FA 3AMKA 3HLAA 2J2ZB 1HILB 1NGPH 5DRNB 4M7LL 2CLVB 3ABMB 3BH4A 1H3UA 3RGVB 2VOTA 3Q5YA 2JELL 2V17H 1YNKL 3PQYE 4Y2OA 3MRJB 3DBSA 1QP1A 2NSMA 2SODB 3AG2B 3GKWL 2IBZX 5GS0C 4P3DB 1BGXH 1U91B 8PAZA 1BVOA 5F7NC 5FK9B 1F4HA 1ZHLB 1M05B 3NP4A 3NCBB 1R19A 2YPLB 4AEHH 5SX4I 1T3FB 2XJKA 3LD8B 1AGDA 2Z91A 4JG9A 3V2AR 2DS4A 4UDUB 4EZKA 4XTRC 4OZIA 1XGQB 2B5IB 3SY0A 2BHZA 5HHNA 5K1VA 2R0LL 4L1DA 1I1YA 1N68A 1WZMA 1BYPA 3AS1A 4X50A 4PLNC 1BVKA 1JN6A 2A4CA 2GK2A 3KE0A 4U0QB 3FQTB 4DEPC 4GAJL 2VZ1A 4R4BB 4Z0BH 2XX0A 2VSKB 3RWCA 2X4OB 2FO4B 2XBDA 1W8OA 5IMMA 2CR6A 3KPSA 2J12B 3B9VA 1R5VB 2FSEA 4B9KC 3U6RA 2NRDA 3UGXA 4TRPL 2ZOKB 1RUML 3HHSB 2BJML 1IEHA 3H56A 4MQXD 4PD4K 2AXGA 5IJKA 1D5RA 3LPFA 3FCTB 3UCQA 2OK0H 4G72B 4I1RA 3UL4A 5IMLA 4FQIL 2KKQA 5C0AB 1N64H 4K71C 1PKOA 3NIGE 3UZQB 4GNKB 3TOPA 2EE3A 4PRHE 2W38A 4ZW3A 4ZYKB 2NNAB 1NCAL 2XXMB 3O41A 4H2CA 2FYVA 4W6XB 4WEBL 4IBUA 1WD8A 2LU7A 3I75B 1J8KA 1KC5L 3VMNA 3P73B 4H88H 1GGYA 2EACA 4J4PD 2CIIA 1S9YB 5TE7L 3OHXB 1CLCA 5A2IH 2CDEB 2H32H 2AEIT 3SB3A 1YDPB 5KYXB 1MVUB 1AO7B 2AEQL 2NYZA 3QJHA 2BHYA 3VQ2C 3BXNA 4AV4A 1XTMA 1F4AA 1EZLA 2CM6A 1G9HA 3QHFL 2OTPA 4JPIB 1NA8A 5HI4D 4D3CL 3WDIA 1ROCA 2ZF8A 2GC7C 3OPZH 5EORL 4HS8L 1CLZH 2DWTA 3BAEL 3TFKC 2NW2B 2VDRL 2QLVB 4PRAB 1DJYA 1QFUH 2Y06L 4L9LB 1KDIA 2UXVA 3QWOA 4OZIF 3GBNL 1AZCA 3QJSB 4KITB 1J8HE 4IJ3C 5H4ZA 2ZG2A 2WB1A 5DFWH 1AFVL 3C9NB 3GIZH 1F6LL 4E41B 4NQQA 3QCUL 1XSKA 1ND0B 2JSFA 3OB0K 4GQZA 8CGTA 5EU3A 2DQUL 5EFIB 1WRFA 1MOEA 2VXTL 2BIMA 3SGJC 3BMVA 3SQRA 5DMKB 3A0OA 2X6VA 3EYFA 5E7FA 3BAIA 3CCHB 5E8EB 4MCZB 2BXYA 1CK0L 2FUTA 1HHGB 2ZP0T 5E0FA 3NFSH 3F83A 4FQHB 2F5AH 4Y9EA 5DTFB 2PPCA 1O6SA 3GXPA 3DRTB 1RURH 4KKRA 3SE9H 2J1XA 4KRMB 1J9CT 2WBJD 3WMQA 2IGTA 1VZGA 5F6HJ 4O02H 1JWSB 1FNGA 3IPBA 4ODWB 4KTGA 3RNQA 2I9LB 4JAMB 4PG9B 3WNKA 5BUPA 5GRUL 2OYPA 5E2UH 2E7LC 1JVOA 3WO3B 4JFOA 2VC2H 3WGUB 3GBLA 1ZS2A 4M6OL 3TEXA 4JDEA 1GGUA 2PW2A 2E8ZA 1F6FB 1C12B 2K6YA 1UM5L 1GW0A 2BX5A 1PZ3A 4DCQB 2CK0H 3FOMA 3QC6X 3WXWH 4UTAH 4BE5A 1IKOP 1AGFA 3DOSA 4M3JA 4OQTA 5CBEB 1S7RA 2B20A 1LWRA 2EEBA 4MMXB 4O5LH 1PGRB 3LEVH 1TQCC 4UDTB 4J3TA 1SM3L 3TA4D 3QEQA 5IVOA 2X1XR 2X53A 3LHPH 4JGJA 3GK8H 5I5RA 1P5VA 1HH9A 3LNIA 3VFVA 5IEHA 2H26B 2WYTA 5CMAB 4OJFL 1O7SA 2F54E 3D52A 4HKZA 4MJ6B 2J21A 1HU8A 5DUPH 1NZRA 2HFTA 1CL7I 1F11A 3TJHC 5BW7A 5JQHC 4HKBB 3O9WD 5D7LA 3VFTA 2UZIH 1YECL 3TN0C 5K9QI 2GFBB 4NO3B 4ZUUA 4G8IB 5BZDA 4HLZG 1UZ6F 3T8XB 4OLWL 5TJWK 3MA9L 1KTLA 1BG1A 1HTYA 3EO0B 2W5PA 5E5MB 2YOAA 2VMJA 2NSQA 3FRPA 4X9IA 1PLBA 2B59A 4HJSA 1CI5A 4X6DE 3EOYG 3VB9A 1R3HB 2APXA 2JI1A 3DK2A 4X4ZA 5A2CA 5FLVA 2GJRA 4OD1L 2DIBA 4NOFA 3AM8C 4CJ0A 3CG8A 3NSJA 2CJTA 2ATKA 2HKFL 4GUPB 4KXZH 1TZOA 3V0HA 5JO5A 2FD6H 1JHLL 3VD3A 3W2DH 1KCWA 5E23A 2Q5BA 1QFWH 3F6JA 1FHGA 1U3JA 3HE7C 1S7SB 3RVUD 5JHLL 2YAPA 4CUCA 1YA5A 5M7QA 1BFOA 4ZTPL 2VE6B 5E1AA 2QVMA 1EWHA 1GYWA 2ZICA 2Q8AL 5I1GL 4R4FH 4YLQT 4PRDA 4JKLA 3JWOC 1U8CB 1TDQA 4B3EA 1WBYA 4BWWA 5GGQL 1W72H 5ALCH 3WJJA 4PSPA 3EG9B 2MSPA 6PCYA 4Z7OB 4HWNA 1CBVH 1YJDL 3FT4B 3NZ8A 4K23H 1A4KB 5F3HA 2QQKH 4LCIL 2AEWA 2GTWA 1WBXA 1UM6H 4K3EL 2HRHA 4XPTH 1Q90A 2XWEA 2X6BA 3ARGB 1AR1D 5CILL 3V4PL 3C6LC 4EOWH 1E9PA 1BP3B 1YNTB 3FUEA 1OGAB 3GZPA 2YO3A 4JFYB 2Z92B 2H9GA 3LKRB 4WFFE 5DZVA 2VLKA 4TUJA 5BS0E 4QLWA 1VERA 3ZE0E 1ETZB 5JHDA 5KS9E 3COOA 2CRZA 3IBEA 3QG6A 4KX9A 3R1GH 3S5LB 1WD9A 4Y2DA 4FHBD 1NCOA 1REIA 3QUYD 1C08A 4YDIH 1D5XB 3DX2A 3CZNA 32C2A 1B4RA 1S7XA 4NLHA 5D7JC 1BXXA 4C56A 1WCBA 3QQ4A 4P23C 4WI2A 3KEHA 4Z7WE 4XMKH 3RZCB 3RFZC 1PNCA 5HHXL 1U41A 1OALA 3TBSA 1HYSD 2DQHL 5CGMA 4XO5A 2Z35B 2PWDA 3SSGA 4EZMA 2HKAA 4MD0B 4HGWA 1A47A 3RDJA 1ID2A 5CZXD 4EN3D 4K9JA 1I9RH 2HFFB 4QXGL 4QRRD 1C8PA 4LLUB 1YLBB 4XH2A 3O2WL 2O5XH 5E6UB 3KYNB 2GY7B 3VFUB 4X4ME 4HEPA 3SPVB 1U8QB 1IBDA 1FH2A 2Q3AA 1DBBH 2ICWI 4P2OD 3KLAB 4LAQL 1M71A 4WWKB 2CO1A 1LO5A 3GJFA 3DPBB 3CSPA 4UT7L 4ALAH 1MWAB 3SHSA 5DHXB 5DS8B 4F7MB 3C6SB 4X5XA 5E9DD 2E9WA 5E95B 2P28B 4JFFB 4E42B 5I73C 4HXAH 2IALB 4G8GD 1CB4A 5MEQA 3A6CH 1BAWA 5I15H 1S7WB 4YHLL 3WIHL 2OI9B 5KYYA 4WI0A 2JKRM 4FFZH 4FDWA 3MRMA 4LHUA 4O2EB 4AX3A 5EWIH 2OYKA 5L2JB 3G5VA 3O6FB 4S1QL 1O5DT 1FFPA 2D7TH 5IKCA 2A74B 4G6FB 1MCHA 3MODH 4FX5A 3GSQB 1LNUA 4JM4L 3MLVL 4LLWA 2VISB 1EDQA 2F7QA 2I69A 3FZUD 3MJWA 4OD3L 3BZEA 3MACL 2APSA 4YUEL 3MV11 1D5BB 5D1QD 1JG9A 4D9QD 1EO5A 1G7LB 1JTPA 4FCHA 3NIFE 4FQ1H 1RUPH 1PDKA 1NINA 1Z6JT 2WKOF 4GFXA 3S98A 5I0WA 1OTSD 1DQMH 2CJUH 3DSFL 4XPFL 1LE5B 3MLPA 3TF4A 2J2ZA 4WTQA 3LIUA 1HILA 2DEYX 5DRNA 4YX2H 2CLVA 2C8NA 3RGVA 2X70B 2B3RA 4N22A 5ERWB 3MRJA 4V1DE 2X6UA 1U91A 4P3DA 3FT2A 4QUOA 1VCBC 5FK9A 3CK0H 1ZHLA 3FONB 4DEPB 2VRQA 1H6EA 1WHOA 2YPLA 3G9VA 3N41F 3OAUL 3IU3B 5CU5A 2Y4SA 3MCKB 3KVDD 3NN8B 2H1PL 1XGQA 3BO8B 3D0LB 5EH1A 2A4EA 4F58H 1I1FA 4G1EB 1QYGH 5FHBL 3C60D 4Q4EA 4GT7A 3UAJD 5GS1B 2PN5A 2W59A 3Q1SH 3VE0B 4PI2A 1XCXA 2CNZA 3MRCB 1CZ8H 1SNRA 2M26A 2BINA 3LZPA 1C9SA 2RGSA 3IJYB 4IU2B 3F05A 2WYHA 3ZKMC 2ZZUT 5SV4A 1J8RA 1R5VA 2CQVA 3KVPA 4NENB 3TPKA 1HL9A 1T66D 5JR1H 4I77L 1RUQH 2CGYA 1JWUB 4U1IB 2ZOKA 3HHSA 1TF4A 1WSST 3EH1A 3BWUF 5GS2H 1D2PA 4HPHA 2NOYA 4KTYA 5E8PB 3NSXA 3HC4L 3FCTA 3N1PC 4QHUB 3HMWH 2H4EA 3GBDA 1MI5B 1VFOA 5C0AA 5ACZB 1T04B 2Y2WA 3SN6N 3F7YA 3UZQA 1PD1A 3BISA 1L9NA 1QLFB 2EVHA 4ZYKA 3ZK0A 2G75A 2NNAA 1KBBA 3DMMA 4TLKA 5CCHE 1S6NA 3I75A 3ESPA 1MCDA 4E9WA 3P73A 5SWZB 4IOIB 5KVGL 4NQDB 2WZAA 1S9YA 3O6KH 1QEXA 3MROA 3OHXA 3KVQA 3SIKA 1P4IL 2B08A 2DJMA 1DJXA 2CDEA 3NDYE 2E0PA 3NJXA 1YDPA 3Q9PA 1MVUA 5CXPA 1AO7A 4WZ9A 5TE6L 5B1AB 5J11C 4Z1PA 3UBXG 1C7SA 3BVTA 1CVSC 2OMXA 4IJ3B 2QSTA 1CFBA 5C08E 4JPIA 2R27A 3NUKA 4XN1A 5KZCB 2VO5A 1NBYB 3QO1A 1J0JA 2R2HB 3V6OA 1UXSB 3BD4A 4I18C 3SE8L 1J9RA 3T2PA 2NW2A 4ELMA 2V7HB 4PRAA 4OCSL 3CZGA 6PAZA 4PEEA 1ASPA 1WZKA 5BUAA 3FH5A 5T3XE 3H2QA 4LSSH 2Q6WA 4ZS7H 1KCBA 4XNMB 4H0IA 3C9NA 2QMKA 1SBSL 1NBVL 2XWBB 5JW4M 5CFHA 1S3KH 4PWHA 3ULUH 2EVFA 4PW3A 3X3GL 3UTOA 5EFIA 2AQ1A 1CFQB 1NCIA 5DMKA 4HS6B 3LHAA 4P57B 3CCHA 5E8EA 4MCZA 2BNUB 5A1AA 1HHGA 1S5IH 1G0XA 2WN3A 4N85A 4GRWF 4CSTA 5GGSB 1AI1L 1UJ3C 3DRTA 2A9AA 1FNLA 3IFPA 4OCYH 5F88A 3OXRB 3AT0A 2YAOA 1TJGL 1JWSA 3VAEA 1TMCB 2ZXBA 4LPCA 5FOBA 1LO3L 4JAMA 4PG9A 5E1QA 1FV1A 1INDH 3H4HA 4N0FB 4UZSA 2WC7A 2W80C 5C86A 1GC1C 2B1AH 4N0YH 1PFOA 2I24N 1QW8A 4JQIA 1TQCB 2EDBA 2XV0A 4OR1A 1FJ1A 3VXUD 4B9ZA 4MA3A 4IKJA 4RGNC 5DC2A 1XF5B 4POZC 3FSWA 1TFPA 3OLDA 3ZDYB 2NY0C 5A6IA 4DCQA 2R1WA 4XODA 2MKLC 1X9LA 2Y5EA 4GKOA 5K9JL 1A7NH 4AEEA 5CBEA 3RVWD 4UDTA 3GSRA 4L4TD 1EXUB 5F7LB 2ADFH 2OQJB 2A9DA 3OAWA 3UTTB 3LKOA 3LKQB 4ELMF 3O0RH 2FQDA 4G8EB 1NJ9B 2H26A 3VMOA 2UXGA 4CSZA 1XDTT 3HUJE 1HL8A 4Q9CA 1DJZA 4MJ6A 1UT1A 1T7ZA 2L7JA 2L7QA 3ESMA 3E80A 1E28B 1NM4A 1WUZA 2NQDA 1NSNL 3ESOA 2FBJL 1UT9A 5AL0A 1FGNL 1A7OH 5KJRL 4E9TA 4N86A 4CC1A 2H6UA 2GFBA 3B4NA 1IARB 4ZS6C 4NO3A 3QZLA 1UM4H 4DOHB 3T8XA 3BDBA 3FT1A 2OMWB 3EXJA 3K6FA 1TIUA 2BRQA 3HNVH 4FG0A 4ONGH 4NM4H 4P9ML 4AYFB 3EO0A 2EO1A 1CBJA 3RRQA 1FHNA 2QVIA 4A2HA 3BQVA 1ODUA 4S2SB 1A7PL 1I9IL 4BHUI 1GJIA 3LZFL 3KWWB 3Q01A 3ROOA 4AOFA 3QQ9C 3HE7B 3UZVB 1R3HA 2CKBB 2O6DA 3C8KB 4M7LT 4DN4H 4JRYB 3VGAB 2NY3D 3Q0HA 1MFAH 1MJUH 4AENB 1AY1H 4DGIL 2EXYD 1NUFA 2QV4A 4FQCL 3FUHA 4KY2A 5LNGA 4P2QE 2VWEE 4GUPA 5A43C 2VAAB 2WXJA 2B9BA 4NUMA 3U9UB 1OTUC 3F84A 3AACA 1ZJBA 2R59A 1BWMA 1S7SA 1D6VH 2BCMA 4Z3TA 1KTBA 2VE6A 3PV6B 4LPXA 2WYZA 2JIXD 3I50L 2HLAB 2V2TB 2BVOB 2BSSA 4PVBA 4BZ1H 1MAML 3C6LB 1EEZB 1LO0L 3GRGA 2NDGA 3EG9A 2LFEA 1RERA 4NC2B 1GS8A 5BO1L 1JZ5A 4UQCA 4IK7A 1A4KA 3ARRA 1TOXA 2GVYA 3HVDA 1P6AB 1C5CL 5FWQA 1R3IH 4URTB 5HDWA 5B3NA 1KPRB 4Z7UE 4M7KH 4NLAA 4WGKA 4MMZC 3TO2B 4HK3J 2RQ8A 3ARGA 3P9MB 5CS7A 3K3QA 1A3QA 1KIPB 2R69H 2X3AA 3NIGB 1YNTA 3JV6B 1OGAA 1MXGA 1NDTA 3DBXB 1EGJA 1DCLA 4JFYA 4KDWA 4PRHB 2AK4B 2MHAB 2Z92A 1PYWB 3LKRA 5HHME 3M7FB 2XQYG 1MCFA 4WHYH 1V7ML 1SPDA 3KNBB 4UQEA 3T0BA 3FQ1A 5INCB 2VUYA 1ETZA 1GHFH 1G6RH 1HYRC 1QEWB 1X9UA 3LZNA 4XP1H 4FQXD 5DVOA 3RFZB 3OKOB 4B95C 2L0DA 4LSQH 2IC2A 3S5LA 1SYSA 2LU4A 4GKSB 4ZFGL 2OM5A 1QQDB 1SFDA 4G6JL 4UQ2A 5CFAA 4YOKA 1MRFL 2GITB 2HG5B 2Y7MA 2H0JA 1GZQB 2XG4B 1GKEA 2WQSA 3W5MA 2KLRA 3UDWA 5E70A 4GPVA 4WTXA 4MNHB 3RZCA 3FTGB 3E3QE 3M46A 4OLUH 4OLYL 3LDBC 4PB0H 4Z7NB 4ZD3L 2V8MA 2VXVL 5B39G 3SE6A 4F24A 2VTFA 5DO2C 3B3BA 4KRPB 3VXMB 2Z35A 4ZUSB 1ZVNA 4MD0A 1A5FL 3FBKA 3WCYA 1YAZA 4NQED 2X6MA 2HFFA 2FJHB 1D9KC 3O2DH 4I0CC 4LLUA 3R19A 2QQNL 5I73B 3UIZA 3KYNA 3VFUA 5CZVL 4PJFE 3SPVA 1U8QA 3RILA 5CCGE 5ABAA 3V0FA 1SOSA 4X4YB 2EYRB 3KLAA 1NLBH 4NNXB 4WWKA 2CO6B 3ZHDA 1DDTA 1QABA 3B9KC 4XB7A 4J3OH 1MWAA 5DS8A 3C6SA 2DKSA 5IQOA 5A2JH 2P8PB 4E42A 3QRGH 5I8OL 5C0RH 1XD0A 2IALA 5D5ME 1AKJD 4ANUA 4M93C 3QULA 4N8CL 3S9DB 4FG6D 5B3JE 2WCGA 1S7WA 3F7VB 3FU9A 5BQDA 2FJUB 4QXUH 3RBGA 1I3GL 2Q7NA 2YD1A 4FXKC 5DGQA 2F53E 1QACA 1X4ZA 3LMJH 1CU4L 1NDMB 2P7TB 4O2EA 5FUOH 1S8DB 5TE4L 4A66A 4ONFL 1PTZA 5BQ7B 5CBAB 3O6FA 4FERA 5L2JA 1HHJB 3DTUB 1IGML 1J05A 3NABH 4LOUD 5EOQL 5CLXA 3GSQA 3UJTH 2VISA 2QFPA 5HD8C 3IT8D 3VWJD 4D7PA 5J56B 5GRZA 3EFDH 5L4JA 1MJ7H 5F70A 3T0ED 4WEMB 4JUSA 3X12B 3E2HB 1RZKL 2ICEB 4S1DC 4WQOA 2EDEA 5FA3B 1TVHB 4A67A 5KVDH 2IADB 12E8H 4ENEC 1D7CA 1G7LA 3ZU8A 3IDMB 1NOFA 3MO1B 1YY8B 1NANH 2NNRA 1V7NH 2Z7UA 4J39A 1Q38A 1RIUH 2UZPA 3DTXB 2XZCL 4Q52A 2YA1A 2F54B 2VDLL 3NTCH 3TBWB 4NC1E 3G6JE 1FG9C 2X70A 5DHVB 5ERWA 4YGVB 5GSVB 4Z78B 1ZRUA 3FXIC 4YHZH 3H6JA 5KBKA 4XP5H 2X2IA 1EJ8A 2VLJB 3FONA 1OP3H 4IK6A 4M4RB 5FYJH 2A9NL 3GMMB 1ACCA 3D09A 3R18A 3QXUA 5GRJH 4P9HC 3IU3A 5FO9B 3TCTA 3G08B 3I84A 5E6IC 4DEWA 2XWJB 3MCKA 3NN8A 1FH5L 1EANA 1LP9F 3BO8A 3D0LA 3D25B 4X6DB 1GYAA 1J1XH 2AEPH 4OZGE 5TF0A 4X9YA 2A83B 4HCIA 4PJ5B 3IXAA 3VH8G 5DMIL 5GS1A 1FYTE 3NK3A 4R2GD 5T3ZE 3MRCA 2XN1A 2E86A 5D8JL 3IJYA 2HJFB 4IU2A 4XAKD 4PCTA 4J3SA 4TTDC 3MBWA 1KEMH 4NENA 1MCPL 1N10A 5BRZE 3KAAA 2GAZB 4AVJA 4U4IA 4QRSB 4M5TA 2OMUB 4U1IA 1HHHB 4YHYC 5DFVC 4ZO7A 5I6XC 5E2JA 2ZJSH 5SWSD 1JMZA 5EU6B 3VFNB 2E4TA 2AJVH 4QHUA 4Y7MA 1S2EA 4MFHA 5E03A 3KPMB 1MI5A 3T3MF 3TIEB 5ACZA 1T04A 4XX5A 4I3SH 5J11B 5KVEL 1U6AH 3RIAF 4BFNA 4F9LA 1YEIL 1FORL 5ECGA 3H54A 1CFVH 4Z3EA 4EIBA 4HJIA 4EVNB 1TSHA 3UTSD 2FE0A 4IOIA 1SLWA 2YAHA 1FZKB 1SF5A 4NQDA 4WEUD 5TFSL 3L1OL 1RZJL 1OE1A 3WAKA 2X1QA 4I18B 2OAAA 4OZHF 3MUHL 4F8PA 2OMYB 2PR9A 1U8HB 2CO7A 2DL2A 3RHWF 4AEIH 1G7MB 3ZE1B 3AXHA 3V9EA 3AWGA 5BS0B 4K0OA 3O4LD 1HXYB 3P0VL 5FR3A 1NBYA 2HAZA 3ZE0B 2R2HA 5JIPA 2P5EE 1UXSA 5HHOE 2F1AA 4X80L 1Q0YL 2VXQL 2W60B 5FECB 4XXWA 2V7HA 3NBNA 4AIXA 4R26L 5D2LE 5DJXA 4ELKB 1CLOL 4PW4A 4XNMA 4KKCD 2VXUL 1U30A 3P4OB 5IT2L 1E42A 1UJ3B 3Q8AA 4UBDC 2XWBA 4Z7WB 2UUDK 2AERT 3K4ZA 2X7LB 2GBTA 1O7DE 4QGYA 5I71C 2DQTH 1Q8MA 1CFQA 2NNFA 3NJGA 5JLZB 4FEMA 4P57A 3BYTA 1BLNB 2BNUA 2R7EB 3ULVF 3C5XA 5IROC 2K7PA 5GGSA 3NACH 4ZXBB 3E3QC 1NQBA 4RGNB 2UXTA 3SBWC 2EIJB 5AB2A 3CVCA 3UBHA 3OXRA 3D51A 1N4XL 2EINB 2DW5A 5EZPA 5B1JC 3GSXB 2NY4D 2NY0B 3HB3C 3DECA 1XFPA 5AW7B 3Q2LA 2V37A 2ITDB 2W65B 4DSYA 3V6ZB 5EPMA 2IAMD 3U0WL 1LL1A 2FT6A 3FT3A 1RZ8A 4IGBB 4OUOA 1NCUA 3FUFA 1NFKA 4JKPL 3OC8A 1ADQH 1UACH 1LO2L 4AK1A 3PHQB 3L3HB 3AITA 2IANE 5D1XD 1U8MB 2IMMA 2HJLB 3BIBX 1Y0LB 1S9VB 4Q9RH 4X83A 3O3DA 1UCBH 1H8LA 4Y1AE 3OM3B 5CLTA 5FDWA 2X2YA 2OP4H 3DJZA 3W39A 3H4FA 1JYWA 1VCAA 1EXUA 2P5WA 3GUTB 3STBA 2OQJA 2Y23A 1R0AL 1JPFB 2E6JA 1JF1A 3LKQA 4G8EA 5AOLA 1NJ9A 2R56L 3EJSA 4UB0H 5IBUG 4ZMVA 2BIQA 1LJMA 2ZTBA 2XTJC 3QI9D 1A6AB 4GW4B 1CWVA 1U93B 2ZOUA 4MSWB 3SY6A 3TBVA 4WAFA 1E28A 3PJSB 4IRZL 3T4AC 4XBEH 2WBKA 1LE9B 5JIKA 2Y1AA 3DNKA 4I8DA 3NIFB 1GGTA 1ESOA 2O4EA 2R29A 4XBGB 1R1CA 1UOKA 3BQUC 2FGWL 4OAWA 1Z0NA 2OMWA 1AE6H 3AM8A 4XNBA 3NCMA 4AYFA 3HKZA 4JNXA 2OULB 3IGKA 3MRKA 5DMGD 3SQBB 4DZBB 4O51B 1TKWA 4L2LA 4KKZA 4S2SA 4JFZL 2ENYA 3C5SB 3VDBA 3KWWA 4V1DB 4F93B 1PZ5B 4LAJH 3HE7A 1BMGA 2CKBA 4ABUA 4JRYA 1EJOL 2XX1A 5E8OB 3HBGA 4J12A 4KV5E 4TSBH 2BRRH 4OCXH 1KWGA 3V6BR 3S96B 4FNRA 4WJKB 4TYUA 1R34A 1MCKA 2EYSB 4NZRH 2B1OA 4PJDE 3D33A 8FABB 1JPSL 2OLDA 1E27A 3TO4A 5I26A 5I66B 1XGZA 2GSMB 4AQ1C 2NTFB 5E9NA 2L3BA 3PV6A 4R7LA 2N7SA 4R3SA 4ZTEA 4AGPA 3KHOA 4ODVL 4UTBA 4LVHC 1B9KA 2AABL 4HUXB 1UUSA 4MMZB 3IJHB 4PV1C 2V2TA 2IOOA 3QIBB 3C6LA 1EEZA 1RUAH 3WV0A 3UPRB 3N1MC 1KIQB 1CF8L 1SVCP 4JFHD 3GJEB 4YVUA 4KUZH 5HDOA 1Q4NX 2KZWA 4KKLD 4HZ1A 2F15A 4JPSA 5FCSH 2KL6A 2A77H 1ZVSA 1QG3A 2C3WA 3I3EA 1KPRA 4AT6B 2W81C 4M43H 4FZEH 1NCCL 4OSUL 1IQWH 3SDAC 3TO2A 5DK2B 3CZJA 1JZIA 3UBFA 3A6OA 3P9MA 3TT3L 4LRNH 2DD8H 2DH3A 3VH8B 3GMQB 3N5AA 3DBXA 4KO6A 2OKMA 4PRHA 2AK4A 1IC4H 2MHAA 1PYWA 4HFUL 4MWFB 3BGAA 1T80A 5FYLD 3T3PB 5C0FB 2IV8A 3P11L 3KNBA 2LHAA 3NMEA 2JTYA 2WTRB 2N01B 4KKNA 5INCA 2YARA 1QEWA 3HNTL 5B7MA 3VQMA 3M7OA 4OZ4A 4KH2A 3LDBB 3OKOA 3ZT5A 5FGBC 1CD9B 4NWUL 1QQDA 2B3IA 4BGLA 3DVGB 5I1EL 3IFNH 4JRXB 1FN4B 1HIMH 4LFHD 4UM9B 2GITA 4OT1L 2XG4A 1GZQA 3RVTC 2J8UE 4TL4A 4Z5RB 3EW3B 5GIRB 4MNHA 2ZAHA 4QTHB 3FTGA 4XVTH 2IPUK 2VJ8A 3BZ5A 4KFZC 5EBMB 5C97A 3A47A 3BAKA 3AFLA 1IM3B 4ZUSA 2I5YL 3D87B 3M1CA 3B9KB 2VDQH 1CE1H 3HAEB 4KVPA 5AVQB 3C5ZC 1J8HA 1OP3K 4GB9A 2EKSB 5F9OH 4OCLC 5GZNC 4M62H 1TTBA 3T4YA 4KI1A 4FD0A 4M93B 1QX1A 5AAMC 3ZE2E 4JPWL 1QNZH 2E9JA 2EYRA 3VFPB 1JGLL 4HPYH 4NNXA 4FXKB 4LL4A 4P4KC 4DESA 4WW2C 2CO6A 3WFBL 4L4JA 4JHAL 1KXQE 4N90D 5E2WL 5I6NA 2BIPA 1WITA 1MELA 2LU3A 4RMRA 3RKDD 4AWJC 2R8SH 3F85A 4BK5C 2IG2H 4JY4B 5HI3D 2E27L 2RD0A 4HCFA 2F58L 1WC7B 4PRBB 1O7DC 2CRMA 2COQA 3GSNH 1TPXC 5FYKD 5GGRY 3F7VA 1OPGH 4XI5D 5I1JH 3M45A 3JWNC 3UPCA 5JOEA 2P7TA 1GMEA 5FB8B 2A1WH 2HTLD 5BQ7A 5CBAA 1HHJA 3HRZA 3FUNA 3DXAE 3D39E 3QNZB 3QNYB 3QEQD 5IQNA 1M9WA 4H1LB 1EK3A 1I3UA 2VM9A 4K94C 3LB6D 4Y4HD 1FO0B 5FO2A 4BXVA 2NZ9D 1FFNB 1FNSH 1SEBB 2DLEA 4PJXF 3V5HB 5T33L 3OKLB 2AJZB 3X12A 1WICA 2ICEA 3QZMA 2X4PB 2YXMA 2DQFB 2RHEA 4KXZI 1TVHA 5FA3A 5D7LD 2HVJA 3V0EA 4A2GA 1EBPA 3CU7A 5CJ8A 1INEL 3CFJB 2C9SA 1QFWI 3MO1A 2AZUA 4KKAC 1YY8A 3IMUA 3VRLE 1F90H 3DTXA 2VAJA 5CZRA 2F54A 4POUB 4QRTB 1KJ2B 3TBWA 4O9HL 4A37A 1CYXA 4ERSH 5HDQL 1SLXA 4UUJA 4YGVA 5GSVA 4Z78A 1QTPA 5E6IB 4PS4H 3VDCA 1XIWC 2CMRL 5FM5M 1L7IH 1MCWW 2X6AA 4QHKJ 4QRQB 4BKLB 1KLGB 2Y7QB 5EUOF 1DVZA 3AREC 3T8VA 3KPRB 1SEQL 3KBEA 4LARL 1BZOA 1CDGA 3FQ4A 5GXBB 2GIXA 2L8AA 3JWDH 4KY1H 2GI7A 3GMMA 4MHHG 1FIGH 2HG0A 3CX5J 3DHMA 2XKNA 1X5KA 2HMIC 2Y7OA 5FO9A 4A04A 3G08A 4H8VA 1E4WH 2NXZB 2W07A 1OGTB 5C09E 2XWJA 3ML9A 4PGBB 2NX5E 5CGYD 2FR4B 3D25A 4X6DA 3MLXH 4HLZH 3F7PC 2F19L 4EI5D 4Y5VB 4PJ5A 4NI3A 4P4RA 2DQJL 3LZQA 3ZTDC 4YHYB 5I6XB 1OF2A 1G7IA 1B0GB 2DQEL 2DEWX 1E5CA 4AG4H 1HC1A 3IRPX 1S9XB 3CUPB 2BP3A 2QGEA 1OHZA 2DPKA 2HJFA 1BA9A 2WXOA 2PUQT 3A67L 1GCFA 3BRDA 9PCYA 3OLGA 1XV8A 2GAZA 3NAAH 3AGWA 1VGKB 4QRSA 1NFAA 1V8HA 2OMUA 3GBMH 3NCEB 1HHHA 3QNXB 1FC2D 4N28A 5TDPA 4QOKD 3H9HB 4RRPM 4JZNB 2EZ0D 5JHAA 5EU6A 3VFNA 1RLWA 2J71A 4N2FA 3PAYA 3H3PH 4KAQH 3I9AA 5I9QC 3LTVA 4PJGE 2ZOWA 1JZ8A 1E7VA 4KROD 3DRQA 3KPNB 4EVNA 1CFTA 1Q9KB 5IIEB 5JHDD 1FZKA 4B60A 2F0CA 5D1ZA 3MREB 4KK6D 5EZOL 3L4WA 2FVNA 4X5LA 5SX5K 4KK8C 2MNWA 4ZRGA 1U8HA 15C8L 1DJGA 1G7MA 1N3NB 5MP6H 3KL3A 4BSVB 2H2SD 2P52A 1U2CA 1AOHA 5BS0A 1HXYA 1T7VA 3IWVA 3RDTA 3RTLA 2V0AA 2CDGB 2E9IA 5KS9A 2Q7YA 4G59C 2VZSA 2W60A 3RWDB 5FECA 4GXFA 4WHCA 4WCYL 4YBQD 5I71B 2E75C 5L6YL 3F2LA 5BVJB 2E3VA 1B2WH 3SDYL 4NZJA 5F1SA 1DUYB 1MQ8A 4TSAL 4ELKA 4FFVD 2MH4A 2CSPA 3P30H 5JXAL 1IC5L 1KPUB 1OQOA 3P4OA 2EH8L 2ERJC 2EIBA 4JFVA 2Q3XA 3GSWB 1D6EB 1RK1B 4Z7WA 4ZUWB 4B41A 2X7LA 4FULA 4X42A 4UQ3A 4W9CC 5IGXH 5JUEL