5AOMA

Structure of the p53 cancer mutant y220c with bound small molecule phikan883
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploiting Transient Protein States for the Design of Small-Molecule Stabilizers of Mutant P53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords CELLULAR TUMOR ANTIGEN P53
total genus 49
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5aomA00
3Q01A 3D0AA 1TUPA 2BIQA 4HJEA 4AGNA 1HU8A 3WTXA 2PCXA 4LOFA 1T4WA 2X0VA 4IJTA 4LO9A 3IGKA 4L0ZA 3VD1A 2IOIA 2J20A 5BUAA 3US1A 3Q06A 4GUOA 4AGOA 3WTTA 2AHIA 5AOMA 5G4OA 5AB9A 5AOJA 1GZHA 5A7BA 3Q05A 2OCJA 2YBGA 1LJMA 1EAQA 2GEQA 3WTSA 3US0A 3WTYA 2J1YA 5G4MA 4A63A 4MZIA 4IBYA 2IOMA 4AGMA 1IO4C 4LOEA 2IOOA 3D06A 2J1XA 2H1LM 5KBDA 4G82A 3QYMA 3WTWA 4AGQA 4G83A 5LAPA 4AGLA 1EAOA 4KVPA 3IGLA 3ZMEA 3EXJA 4QO1B 4IBTA 1HJBC 2AC0A 5AOLA 3D08A 2BINA 2FEJA 2XWCA 4MZRA 1H9DA 3D05A 5AOKA 4IBWA 2WGXA 2BIPA 3VD2A 2VUKA 5LGYA 3D07A 1CMOA 2J1WA 2J6WA 2ADYA 1GZHC 4IBZA 4IBVA 3WU1A 2ATAA 4L0YA 2RMNA 3KZ8A 2MEJB 3D09A 2J1ZA 3QYNA 5G4NA 1YCSA 2BIMA 4IBQA 4IBSA 2J21A 3WTUA 1HJCA 1TSRA 1KZYA 1EANA 5ECGA 1CO1A 3WTVA 4XR8C 2X0WA 5ABAA 4GUQA 3TS8A 3VD0A 3EXLA 2P52A 3KMDA 2X0UA 4AGPA 1E50A 4L18A 2XWRA 4IBUA 5AOIA 2BIOA 1UOLA
chains in the Genus database with same CATH superfamily
2Q6WB 4JVWA 4F9PA 5T3ZD 2I9LA 3SCMD 2UZYA 4M43H 1JGVH 1OB0A 2H26B 3D39D 1GGUA 4F57H 2XQYK 5TDPA 1G9ML 4HLJA 3VG9B 1CVRA 4DGIH 2QSCL 5E1GA 5E8EB 3VFNA 1YMMB 2VR7A 4OCWH 4PGDB 3CLEL 2QADB 1YHPA 2Z1PA 4Y2LA 4YSQA 2IDUA 5L7XL 2W88A 1GVIA 4TUKH 2GCYA 4TRPH 1MJ8H 2XRAL 3Q05A 1WWCA 1I8LC 3VFOA 3DUHA 4R7DB 5EFIA 5EZLB 2QBWA 3ZDZE 1OAUL 2FX7L 1BMGA 1S7RA 4A55A 5JHDA 2MNWA 2OQJA 4NOFA 1I4FA 2GI7A 4ODBD 4P5TC 3UAEA 4L4TB 4WKXA 2F15A 4EIBA 3FC8A 2SEBA 1UXWB 2VLRE 2YZ8A 3RNQA 5E1AB 3LNIA 3MCYA 2MRYA 3MFFA 5AAMA 1JHTA 2X05A 1CFVL 2BNRA 4KKQA 2C34A 3B2VL 1T21B 4NNXB 4RAVA 2FCBA 4NWUL 5E6IA 2X4TA 3GTNA 5JXEA 2WYHA 2XBZA 3FZUC 5AAWC 1Z5LA 1TZHA 4OM0H 4LHUD 3QDJD 4P5TD 2HA1A 3NGBB 5ICUA 1JERA 5IIEA 1SXCA 4R4FL 3MV7D 1G9EA 5GIRA 1B0RB 1AKJB 4F2ME 1HILA 2F7RA 2XWEA 3FFDA 7TAAA 1A6UH 3G6AA 4YJZL 3DOHA 3DOSA 4HIEA 1BECA 1R1CA 4KRNA 2P8PB 5IB4B 5IJKC 3NG5A 1AHMA 1KOAA 1MSPA 4QF1A 2G4EA 4RESB 5KSBB 5GS0H 2GT9B 1D9KC 1W0VB 2XN1A 1TQBC 2Y2YA 3VXUD 4MDIB 1JHTB 4Y4KD 2YARA 4N2EA 4UT9H 2ZOLB 1H5BC 5AEAA 2CWRA 3INUH 5EF0A 5CBAB 1MUJA 4Z78A 2AEPL 4NUMA 3E9TA 4WWNA 1LEKB 5HDWA 5IM7B 1DBML 2YO3A 2ZXWB 4HCIA 5E7FA 2ZUTA 3MLXL 2EUXA 2GIYA 3P69A 4XO5A 5D4IA 1A4JA 3BLKA 4NENA 1N4XL 3CFBB 5KBNC 2YAFA 2OXGA 3AQDA 2OR9H 3SDCB 3UEZA 4N20A 3CDCA 4N6RA 4EDWH 4N0FA 2I25N 3HZMB 4RMWA 4JFWA 4ZXBB 1A3RH 3RWJA 2QSQA 2UYLB 2DYPA 1AMYA 4OLZL 2JNZA 2CUAA 3T6XA 1BVOA 4GS7C 4X6DA 1QG3A 3DROA 2NT0A 4J3UA 4RA3A 4ACTA 1X3DA 1IKFH 4FFZH 4JFVA 3BCFA 5DD1L 4ZMPA 5BUAA 5I1HH 3UAJD 3QPKA 2ZONA 4GI8A 4U1KA 1BJ1H 3GSQB 3QWRD 5D6DA 3IBOA 4Y4FA 3ZDXE 1J0ZA 1KCLA 2CLZA 4LIQE 1I1AD 2QTVA 2AJSL 4UU9A 4FYSA 4PTTB 3WEOA 2Q8BL 5FFLA 1C12A 1FNSL 1RLBA 2BFGA 2HRLA 4P2RB 4YPGA 5KVDE 3TNMB 4KROD 3BDXA 4Z0XB 4Z95L 3UYRL 4N6RB 2VXUH 1HXYB 4NJAH 1AD9A 1T2XA 4NN7B 4ODVH 3X14B 3N42F 3ARBB 3GZPA 4R84A 3GXPA 2NPLX 5JXEC 4WFFE 5DUJA 4HOXA 3IKKA 1FRGH 4G83A 2WLLA 1I1AC 3L3OC 1KFAL 3TEXA 3GSNA 4A6YB 3B8YA 5IFHH 1NAKL 2KC0A 3MN8A 1F1DA 3ESPA 2EYSA 3OQRA 3KJ4C 1HXMB 1SLVA 2NX5A 4BZ1H 1P7KB 1E40A 4WCYH 4Q6YA 2EZ0C 4TSBH 3VCLA 1EAPB 35C8H 4UMGA 3S3BB 1DDHB 4UOW1 3QT2A 5I1LB 4Y4FB 4B50A 2JI2A 1F6AB 2K1MA 4NWUH 3UTTD 4OD2B 3QDJE 4RGND 2Q0ZX 2PF6A 4NHCL 5DVMA 1NA8A 2JKIS 2HG5B 4PTTA 2DMKA 2GSGB 2Y0SA 4ZSOB 3TYFB 3TWCL 3AROA 1Y1DA 3TYGH 1F13A 4PGBB 4OZFG 1WITA 3UC0H 4EN3D 4Z0XA 2KDGA 1CICD 4U1MB 4GUPA 4KTEH 4ODHH 2XUWA 5AFAA 4FULA 3QO0A 4ABVA 1M7IA 1FH2A 4G9DA 3ILEA 3CIAA 1AS8A 4X83A 4Z18A 2C9XA 1DJZA 3HMWL 3N0AA 4X6CF 2WW8A 3LNHA 1I7TB 1XIWB 3FT3A 3FQNA 2A6KB 5I6OA 3FT0A 1KPVB 3ENEA 3UTPE 3WFBH 2DN7A 4ZT1A 1SDDB 1MQKL 5F0JB 3L5WB 4EI0A 3EXLA 1DO5A 2X4SB 3BZDA 5KVFH 3UTQA 1HOEA 3POHA 4I77H 2Q2LA 3HRPA 1OSZA 4FI7A 5ESQB 1IEAB 4JL1A 4DNLA 3VVWA 1T4KA 1K3ZA 5ES4B 2ZOKB 1U3NA 4G6JL 3ULUD 3WTXA 1OTSD 3SIKA 4EUPB 5KSAA 5IVXE 4PRPD 1MFEL 1QVOB 2BH0A 3VD1A 1REIA 4WHYG 5GZOD 1IGIH 3OZLA 1YMMD 2PYEE 1NAML 3DO7A 2HLAB 3UIYA 4Y5YA 4NLHA 5DD1H 1M4KA 4BKLB 4BH8B 2VDNB 1Q38A 3HRZC 3WJLC 1JZ8A 4RISL 2FO4B 4U6YA 4QHUB 1TF4A 1VF5C 1FC2D 3QC6X 2B9BA 3B7YA 5J5EA 4PAZA 1IAIH 2EKSA 1NWOA 3ZIMA 4JPVH 1U3JA 2XY1A 4R4BA 3T09A 1ACCA 2ZCHH 2ZUYA 3WKYA 5ICYB 1KGUA 3AT0A 3LZQA 4K3EH 4R0LA 3MRMB 2BZDA 1NANH 3GMPA 1WWAX 4PCYA 4KX7A 4AM0A 2I07A 3C2AL 4OGAD 1YQVH 5E6RB 1SN0A 4BWTA 2Y72A 3VFSB 3H7BB 2G2PA 1NGQH 5JO5A 3KCPA 3V6BR 2CHNA 5F3BB 4O2FB 1DN2A 4URTB 3X1FA 3GMLB 5I1CL 3J8F7 4P3WA 1H0DA 1PD0A 2E86A 1XXFC 4ONFL 5SWSE 1G9MC 4JRWA 1S9KC 3LDBB 4GRMA 5BJTA 2ETWA 4Z7UE 1HHHB 3ZMRA 3HB3B 1QZNA 1F8TL 3DLQR 4WENB 4KU1A 2VMDA 4AE1A 1WS7A 4ERSH 2BWDA 2IWFA 1NLBL 2X3AA 4WTWA 3LRMA 1BFSA 2FLMA 4IKIA 1B6UA 4YSEA 1ZT7B 4TULH 5DDHA 1OP5K 4EN3B 3BXNB 4PRHB 4MNQA 2JIXD 3LVTA 1A6WL 3PPSA 2BNRE 4GXVH 4FQLL 4BQ8A 1TVHA 4L8SB 2GTZB 4LBAA 1QQDB 3DV4A 2Z92B 3CDZB 4APXB 3X3FL 4G8FB 4AQOA 3WFDH 4NFDA 5CP7B 1L3NA 4HSCX 1UEMA 3GXUB 5GHWL 4LCUB 3MKKA 4M6OL 2UY7B 4O9HH 4XNUL 3IDXL 1MW2A 4FQJH 5HI3C 3RI5K 5F6IB 1A7QL 3HI6H 4UNUA 3F7VB 4KKAC 3H54A 3D25B 4JE0A 2W60B 3FMGH 4C56A 1VCAA 2W9EH 2PXYC 4RISH 5AOZA 3ZDYB 3OPZH 5AOIA 1CCZA 3DV6B 4LK4A 2QGEA 4AH2B 3TT1L 1CK0L 7CGTA 1QLEB 4L1HA 3MLTB 4DAGH 5CUSL 3CCHB 4JHWH 1CDYA 4PRID 1J88A 1T4WA 4BKSC 3MRNB 5FECB 4Z23A 4MMXC 1YEFL 2PKDA 2PO6D 1HHJA 2ALWA 2XDHA 4YHYB 5JIIA 4WWKA 4I4WB 5JHLL 4DPBX 4TUOB 3L3HA 3BLPX 1QPKA 1XD1A 1NIDA 2N01B 3PUUA 2E7DA 3IFPA 1G0XA 1OAZL 3U2SA 4U1LA 2A38A 3UABA 1UGNA 2F53B 5I71B 2WY3B 1DVQA 2AQ1A 4XCFH 2QVMA 3D48R 3ZQWA 1DQJB 1G1CA 1QSFB 4H88H 2CMRH 4TQ8A 4BZ2L 4QYAA 4EIGB 2ESVE 4EOWL 3B9KD 2K6ZA 3NZHL 3CD4A 3D18A 2HJKA 5GSVA 3VYOA 3CMOH 1TQVA 1AS7A 2IWEA 1NKOA 3MO1B 2DQDH 5ELIA 4BFBD 3BGFB 5EU7E 4Z7VA 1EDHA 5DUBB 3AZUA 5DJCB 3GO1H 4FQLH 2JI3A 5EMYA 3ZYOA 2R23B 5F6IC 1MCOH 3FCSA 3IAGC 2OCCB 1IFHH 3GSRA 2WSKA 4CC4C 4NZUH 1NBZA 2VL4A 3S37X 5IVOA 2EDFA 3RWFB 2E74C 4OKVA 4QTHA 3NJFA 5DS8B 4RAUA 1PF3A 4OGZA 2X6VA 3BAJA 2P8LA 4TM9A 1KTCA 2L7JA 1CD1B 3DGGA 3MRQA 3V4PA 4I9WE 2XWJA 2AV7B 2XIIA 1G7QB 2QSVA 4N2AA 1KY6A 1BQHA 1J9QA 2EICA 1WIOA 1IAMA 2A83B 2NY0D 3ESUF 3BPCA 3RWCB 1OV8A 3FQNB 3TX4A 3TT1H 1V7NH 3SE9L 1KJVA 4DZ8B 4IOSA 1U8NA 3VFPB 4NJAL 3KPQA 4JHWL 4BSWA 4GINA 1MI5A 4RSYA 5KTEH 5H35A 5KEZA 4O58L 2QELA 3HZKA 3FFCE 3DTUB 4N9GA 3RPIB 3QZBA 3QEQB 4JRXB 4AXWA 1CVSC 2BHUA 1IAKA 1WO2A 4U1NB 1I9IH 1IEAA 3A24A 4W9CC 2WJ5A 4KKLC 3VI3F 4KZ0A 4NQCB 2BOBB 2UWEE 3NTCH 5MEND 2AQ2A 3OR7B 1HN1A 1O6VA 5D4JA 1S9VB 2NUTA 2CO2A 3RVXD 5B7FA 4Q9RL 3HNVL 3HE6C 4L8DA 4DERA 2EIDA 2P45B 3O2DA 5L4IA 4Y5YB 2L7UA 4J3BA 2VYRE 4ZODA 5F3HB 4BKLA 4NQVB 3TURA 4DEWA 3VQLA 4A7GA 2HMID 1AZUA 4AGOA 4N2FA 4N0YL 5DZLA 2ADIA 3RWDB 1QABA 5SWSD 1N64L 1R5IA 2H32A 3K46A 4XC1H 4Z7AA 5LGJA 2LR4A 1JDAA 1SXBA 1SJEB 1T89A 3FTGB 3G04B 3SE3C 1IAIM 1RUMH 3WE6A 2A73B 3LCYA 3FQRB 2ESVD 3BESR 1N9PA 2EP6A 3DMMB 2ZOWA 5E9NA 4AEIH 4L1DA 2O5YH 3KHQA 1OPGL 3RY6A 4GRWF 3VRJB 2ICWJ 5JO5B 1P1ZA 4LCVA 4FLHA 3RTQA 2OJEA 4UOZA 3D51A 3QI9A 1GZQA 2MWCA 3X2QB 1U8HB 3PXHA 5D7JB 1ET8A 3NZSA 3QZNA 4F7PB 4U1IB 1Q72H 1UD3A 1WTGT 2YD9A 4KO5A 1CC3A 1QBMH 1ZGLM 2H47C 2HKHH 2WCPA 3QO0B 3MV9D 3C5SB 3D12B 3RVWD 1T7VA 2R4RL 1G4RA 2R56H 3GBLA 1I7UA 2I9TB 2IC2A 1VPOL 3VG0H 1X44A 5C3LD 3ULVD 4P99A 1HK6A 2I60H 4ANKA 3HCVA 4JO2L 2NLJA 2X1XR 1DQQB 4P9HH 3BYYA 1RCYA 2WGXA 2HG5A 1T5KA 4HCGA 1R5VA 3ABKB 1J8HD 1M05A 1HSAA 3LKOB 4FG6D 4PJ9D 5AVZB 1KPUB 2ICCA 3N1PC 4MMZC 3PNWB 2WBJB 1LD9B 4MWFB 1UACL 3MLXH 3PU7A 5ICXB 1RIUH 2V7NA 3LYRA 4Y8DC 2NCEA 2VCOA 3CSBA 5FYJU 4B9PA 2D3NA 4Q9QH 1U8IB 4Y89A 3ETBJ 3QPQC 4NZRH 5KSVA 4BFKA 3G5YA 4NM4L 3P2BA 3UFIA 4NHUA 3RU8L 3LKSA 2H32H 4G8GD 3CFDB 2VM9A 5SWSA 2HTKD 3DPBA 3B9KA 1AQMA 3WOVA 1T7ZA 5CNHA 1G7LA 4MFHA 2VRQA 3TBYB 5ABAA 1T04A 1ZGLP 2ESVA 3MRFA 4MJ6B 1GMIA 4EXKA 2YLKA 3TEYA 1CLZL 1SXAA 4WHTB 2B4CC 1GC1L 2YMOA 3EBIA 4NQXA 2MPAL 5K39B 4YSRA 1NDGA 1KXHA 1U6AL 1G1KA 1ZD6A 2E9WA 2NXYD 1B0RA 2K8MA 1ZT1B 3QORA 3U0WL 4AJWA 3H0TA 1LP9F 3QDME 4H0IA 4I7ZC 4PUBH 2DKUA 4NIYE 4J3TA 5E6ZA 4AMKL 2BDNL 5BRZE 5DHDA 5AZ2L 4ZJ9A 3ILQD 1U93B 3VXMA 5IM7A 1AH1A 1S7VB 4A2DA 3IJ9A 5C09B 1AXSB 1MWAB 4F9PC 2XTJE 1WZMA 3V4LA 3FUDA 1BZ7A 2OXGB 3WKPA 4GW4B 4H8QA 3FOMB 3S8WA 3SKJH 4ZNEE 4ZFFA 4K8RH 2Z34A 3TYGL 1DJHA 3NCMA 5IJKA 2AJYL 2GBAA 3HPLA 4HDIA 5IHHA 3TO4B 4PY7A 5KG9A 1VFOA 4TVPL 3RL2B 3G5XA 3VMNA 4CW1B 5K9OB 1NANI 2FQFA 1N6QL 4GO9A 2EDLA 2BS8A 4G11A 4GP5B 3D1MC 3VG0L 4RFNB 4YHKL 5I9QB 4U3SA 5FK9A 2EE3A 4FQQA 1F1AA 4TSBL 3MRBB 3DK2A 3QUMA 3HI6L 4FI6A 2B9AA 3RAJH 1ZTXH 4ENED 5IHUL 1IUZA 5DUBA 3QR0A 5BS0D 5E00A 3GXNA 4A68A 2F19H 1OARH 3T2NH 3QJSB 5HHMB 3NIDB 3K72B 3MBED 1XGRA 1A3LH 3HFFA 4AQ1B 2VR3A 4WJKB 4AYID 1CWVA 3GMLA 3NQIA 4ZX6A 1AIZA 2OL3A 2JIXA 3T2PA 2DI9A 1JDCA 1WC7A 1KEGH 1I1CA 1QO3B 3EGXB 3F05A 1KJ2L 5JA9A 2NNAB 4PG9B 1AYOA 1M6OA 1TYEB 3RL2A 3C5ZA 4Y1AB 1OF2B 1QLRA 4LIQL 3PREA 4WO4D 5L88L 4OFYD 3CVHH 2K7PA 3QA3B 8FABB 5ECJE 3QH3A 5C0EB 5ISZD 2XIDA 4LSRL 2RMNA 2XZCH 4G6ML 3QSKB 2ILLA 2NX5B 4WO4C 3OKKB 4NC1E 4Z7VE 1SOKA 5GS1A 2F8VA 1WHPA 3JQOB 4NO0A 4QRPA 4F58H 3ZRCC 2VZOA 2ZXGA 3P9MA 2GUOA 3RY6C 2NXZD 3TH4T 3OXRA 4GKZB 1JNHB 4NEHB 4P2RD 1IAIL 1MJJA 4HK3N 1AC6A 4PJGF 5E8PA 3HHRB 2WQVA 5IOKA 1WCBA 1P7KA 2NXZC 3D7PA 1XBRA 2OZ4A 1EAPA 4Z0BL 2BK8A 4P23B 2IBZY 3ZSTA 5BXFB 5TQ2H 4WW2F 2PWEA 5I23A 2AK4A 4TYUA 3SKJL 1DEEA 3A6OA 2JK5A 2C9AA 2WLLB 2BOLA 1S9YA 4LE8A 2QVTA 3KJ6L 2OV0A 4HA1A 3SPCA 5I66A 1N19A 4JO4L 3ZZSA 1BG1A 1ZLEA 4M1GH 3GEWB 3PWVA 4DVBB 3NJIA 2Y5TB 1H8OA 3IJHA 4KROB 1JYWA 4PJDE 4ZD3L 3IGKA 4FADA 3GSUA 2VQ4A 1NPUA 1S9WB 1T83A 4LSQL 4OD2A 1KGXA 5F7AA 5SWZB 3TTYA 2R0WL 5I8OH 1KLUA 3WSQL 4WFHD 5DT1H 3BZ5A 2OZ4L 2GB2A 2B08A 2WXIA 2C3VA 1BF8A 1TPXB 2H3KA 1EWHA 5HI5C 3T0WA 4LHJB 2Q8AL 2F8OA 4DPRA 4OCXL 5HHOB 2DPKA 3CZKA 3HA0A 1RIVH 1CICA 5MEQB 2WZ0A 4K8RL 4X7FC 5CBEA 4PGEA 1T4KB 4EQ3A 2EVHA 5BXFA 5LNGA 4FFWC 2O5XL 2J43A 2NW3B 4HZLB 4XPTH 1PCSA 4F7PA 5GGVL 3K8LA 2WXFA 3AMKA 3GRBA 1E67A 5DSCB 1MI5D 5INDB 4IGBB 1WUNT 2X42A 1YY8B 2B4CL 5AW8B 1IGCH 5KYWB 3DJRA 3CXDH 1X5GA 2Y2WA 5LAPA 2XC8A 4TNVK 3UBGA 5I0DA 1UOVA 2YD6A 3MJ6A 4G42A 5F9JA 1G7MA 2CG9X 5CIPA 4H20L 3V7MA 1SJMA 2X1OA 4QHLA 1XZ0A 2F74B 1F90L 4G3YH 3OG4B 1QATA 4M29A 5F9WC 3VXME 1NBVH 4MB1A 3BDYL 5GGQH 3FSVA 3RGVC 3N1FC 4L1LA 4GNKB 1I7ZA 2E47A 2RCSL 1KNOB 4ZS6D 1ACXA 4FNPA 4J7RA 3CFDA 1RZQA 4BH8A 1Y7VA 5F7KC 5FEBA 4PRBA 4LZKA 1A7QH 3FUJA 1E9PA 35C8L 3LKNB 3LPOA 3U25A 4UM8B 3F00A 5EU6B 3INOA 4MCZA 3BUQA 2EAEA 2OMVB 1X4YA 1DN0B 1K4DA 3VFPA 3BEWA 1A6PA 3TO4D 1I8MB 4M43L 3T8VA 1DSYA 3UEQA 1T1WB 3IBEA 4K94C 5EU6E 1CK0H 3ARUA 3Q44A 4H88L 5ILTL 1CDJA 4GRLB 3Q6GL 1JPEA 1MIMH 1VGKB 2WLYA 3REVB 1K8DB 3L3JA 4U1GC 1FNLA 4NZRL 5EA0H 4LLWB 3P9WB 5E2UH 5AUMB 4DP7X 4HKBB 3HE6D 4R96B 4MB4A 3AG1B 3EJPA 4TS6A 3MRKB 5FOJA 3TGXA 4JB9H 4AEHL 5CD5D 3W37A 2A4ZA 1EZVX 2A7BA 2Y25A 3BKCH 3BIKA 5ADPH 1FJ1A 3U0TA 4XPGH 3D0LB 1HNGA 4LCWB 3HIZA 5C9JA 5F1NA 3GIVA 2DM2A 2Y6SD 3U0PB 3I9PA 5LBGA 5IFAL 3UG4A 4FRWA 3MJ7A 4JRFA 5D7JA 5HDQH 3T2OA 4X7TB 3LPFA 1K72A 3O2WL 2B4CH 4LSVL 4HUNB 1N6UA 2GKIA 1DP0A 1SHXA 1PZCA 1ZTMA 4MNQD 3VAEA 4A2LA 2VN3A 4ZFZB 4BSVB 2BFVL 2A0LD 3PABA 1SLXA 2XN0A 3CFCL 4NKOA 4B9JA 4JDZB 3QDMA 1ES0A 2XA3A 4G9FD 3VTTA 4RAHA 1S7XB 1J8SA 1IAOB 4F33B 5ANMA 4ORGB 1SM3L 1LILA 4G6KH 2BVOB 5ICZB 2JXMB 1ZSDB 2AK4D 4JZOB 5DRWB 5GGTA 5FKAA 3N0PB 4BFFA 5A1AA 3F83A 3NPSB 1KCSH 4OLVL 1I85A 5KSVB 1KYDA 4KMQA 2AK1L 2ZICA 4WWKB 1XCWA 1KXTB 3FTYA 4H25B 5EOQH 2ZCHL 1R34A 3JV4B 4PJHF 3WELA 3MUY1 5EDXA 1LO5B 4WF7A 3N1MC 3FRPB 5CJ8A 1O0VA 3QQ3B 3ASWA 4X8JA 2NW2A 3NDYE 4WU7B 43CAB 2EYRB 3KPPA 4HVBA 4XVUC 1N4XH 3M6DA 1LE9A 2WBJA 4J3OF 3SKMB 4GMSH 4Z77B 3PDOA 1JHLL 4Y2DB 5IW6A 1WFNA 3LPGA 2W07A 3NRQA 1A4CA 1MAMH 4J3OD 1ZHLA 1DBAL 1BX2A 5E9AA 2YEZA 1DLHB 1HJCA 1AKPA 1WRFA 5LO7A 1CXEA 2VSDA 1U8OB 4NRXA 3GBNH 2IGFH 1W72A 4KKZA 1WBZB 1FGNL 1A7NH 4BFNA 5J1AB 4KZCA 4F80A 1X5YA 4V1DE 3FFOA 2FVNA 2AV7A 5T1KA 1OCZB 4P4KB 1KCVH 4KXZH 4KI1A 3Q2VA 2CAKA 2CDEA 4L4TE 1EHLL 2IMMA 3TEZA 1EGJL 4JGNA 3L6FA 4V1DD 4FNLL 1S78D 1Z9PA 1LE9B 3U6RA 3FT4A 3FCSB 3O0LA 3T0ED 1EEYB 4H8HA 3H7LA 1HQ4B 2QPEB 1P1VA 4M8QB 2EDQA 1YDPB 5D72H 5CF3A 1NEPA 1U95A 2APVA 4L8BA 2VDLL 3KXFB 3VFVA 5I6XB 3IFLL 3AB0B 4POZD 4FTVD 3V0DA 4JM4L 1FRGL 4FZEH 5I8EA 1J8RA 4OI7A 2ATPA 4M9PA 4WNSA 3TIEA 1E9QB 5J56B 1XF5B 5FGBA 1PY0A 1MJUL 1G9NH 2NY5C 5F9WB 2JMRA 3T0EC 5F3HA 2VMCA 3RGVD 1DVYA 1OCCB 1YEJL 3S96A 4GS7B 3QDGE 4TRPL 1MI5B 3GKWL 4XWOD 3LHPL 3HZYB 4WTXA 1IKOP 3WG7B 4BM7A 1F3DJ 4GXVL 1PPIA 2VR5A 3QEGH 1AXTL 2Z9TA 4H4NA 1D2PA 2YPKB 4NFBA 1MHCB 5DZVA 4XPBH 3BD3A 3OWRA 2QGCA 3SDXA 1HQ4A 1QACA 3NIFF 1S7QB 4I3SL 2ZWKA 2N56A 2FHCA 4V33A 3LXBA 2Z6FA 4ZMWA 5AZEL 3WS3A 3WS6A 1MFUA 1KJ3H 2IJ0C 4JMXA 2Z8SA 1DBAH 1T0NA 3IDXH 1KELH 3IMVA 4I13B 3DRQB 4WCYL 5I8EB 4U1HB 3B7UX 3KYOB 5JQ6H 1DJWA 2R0WH 5I8OL 1FI8C 4LVOB 5GGTL 5FA3A 3LSOA 4M5ZH 4IMLA 4UANA 2AJZA 4UM8A 3EYFA 3QEUA 4W9IC 4IBVA 3I3DA 3O4LB 4YE4L 1NFDB 2R15A 4G8IA 3A21A 1ASPA 2C4FT 4M3JA 1E4WH 2HFGL 1GRWA 1HIMH 5EG6C 3VXOA 3W9EA 2O5XH 2CHZA 2FK9A 4QHMA 1XAUA 1KDJA 1AZBA 1R5WA 2NZIA 1C08A 1S2EA 2VISA 3CFKB 1KN4L 3HI5H 3B4NA 1PSKL 4OR1A 2QL1A 2Q20A 5CZXC 4JY5L 3W3BA 3KS0H 2PW1A 5L0QB 1KGYE 1HSAB 1RURH 1U3HB 1CL7L 1WK0A 4N1HB 1UG9A 1DSFH 5CGYD 5CFHA 1HXYA 3QUKA 2X4RB 3S3DB 3D0AA 1DBMH 2EIZB 1JYVA 4XPHH 2P28B 1JXGA 1ZANH 1JNLH 2RD0A 3OAYH 4HKJB 3VQMA 1U58A 2K9UA 4H5SB 4R4FH 1GY1A 2OSXA 2BC4B 43C9B 2I9TA 5I1AB 1E5AA 5CS7A 2VLME 3WXVL 5IHZA 2DQCL 1XH3B 1B88A 4K3EL 3VM7A 3PWUB 4MCYA 3S3CB 3NP3A 3F8UB 3LHPH 5AVQB 3WIIL 1E3FA 2BWQA 3VXRD 1HZKA 3EO0B 3IF1A 5GS0L 1MCOL 4PJCA 4HT1L 3O3AA 4IHBA 5F8RC 4CVZA 1HWHB 5G4MA 2VJXA 2QQLH 1HHKB 2FL5B 3BFOA 4G9FB 4R26H 4F7MA 4OCSH 5KSAD 3IJYB 4XN4A 2QQQA 1E6JH 5ERWB 4NT6A 2EZ0D 3FS9A 4ZUWA 2GC7C 4PCKA 4FFVD 4YDNA 4XMKL 1X7SA 3RURA 2CA4A 3F85A 1PDKB 4P4KD 4YL4A 3WFZA 2IDQA 4WQOA 3K1KC 2IAMD 3QJQB 3MBWB 3DSNB 2D7TL 1BVLB 2PTVA 3OJMB 1L5GA 4QPEA 4CGUB 4IM8A 4MQ7A 4WU5A 4P57A 4B0MM 3RFZA 2ENPA 4ODTL 5C0GA 2XG4A 1UKTA 2VDNH 2OMUA 3QUXC 4HAKA 3PV6A 1E4XL 1L0XA 1ZLVH 1MRDL 5GGSA 3VXSB 2X4SA 1D5RA 1I9JH 3KPPB 4UUJA 2OTUB 5CEZL 5DQDL 5JMOC 2FEDD 3ILPA 4OD3L 1UENA 4HLZG 1FO0B 1ECYA 1WZLA 4HU8A 2EXWD 3GRGA 5C0CA 4BHUA 3I3BA 5SX4H 4JRXD 3QNYA 2YEZB 1S6NA 4UAOB 4M6AA 3WXWH 2G60H 3MLWH 2EDHA 3F7QA 1TVBB 5GRUH 5M7QA 3FAXA 5MP6L 3AS0A 4IIQA 2XKNA 1ASQA 2XV2A 4NHCH 1GYCA 4NO2A 3HLAB 5F89A 1PBYA 2ALAA 4K5OA 1E5YA 3E2HB 4LLDA 3BEWB 1NTDA 5TF1H 3MJ7B 3QAQA 3IN2A 2WLKA 1TETH 4Q58C 3RUGA 4EI5C 1S7WA 1Z9SB 4POYA 4GXUM 2WXJA 5E1IA 1FAIL 4DO4A 4OF6A 1TJHL 1NFDE 3D39A 5IVNA 1UYWH 1L4IA 4CGTA 2R83A 3U30B 1D9KD 1MFBH 4GLRI 3ROLA 3BUYB 1K9TA 3SOBH 3UZVB 2Z7ZA 3NPZB 4R96A 2F1EA 4MDIA 4MASA 4P04A 4XVOA 2XTJB 2IPKB 4WI5A 4C4UA 1JOIA 4GUCA 2NNCA 2VAAA 3LNDA 2FUTA 3K0YA 2X6MA 2L4OA 3E7JA 2FWLB 1MCPH 2WLMA 5DFVC 1IAOA 2DWDB 4F33A 4E9QA 4EI5D 5FGCE 2Q3ZA 1IM3B 2EDRA 2WBXA 3AQZA 3KLDA 3CV5A 4JZOA 5DRWA 3GSWB 4PJFB 2R39A 3LKRB 5JXAH 1V7ML 4GRMB 4GMSL 5BJTB 3P77B 2XICA 5BVJB 2WQ8A 4UYPA 3LNEA 1HHIA 3P9MB 4WSGA 3U48A 5EEUA 1ZT4A 4J3OH 4MNQE 4XOEA 2VH5L 5DHVA 4IKKA 4ZFZA 4BSVA 5IBLD 4ZUTA 4JQVA 5I0XA 3F5WA 3EZJB 1OP9A 4YSAA 4CSSA 2XWXA 5D5MF 4MB5A 4WFED 5A2LH 4LOEA 1JPSL 2R1XB 1PG7W 1I82A 2HFEA 1KCRH 2FGWH 3MBXH 3ZTCC 2VXQH 5ESAA 3GSXB 4YPJA 4JE4B 3CAFA 4NBYB 2R59A 5H2BB 3HKZA 4BUQA 4Z77A 3PXJA 2YBRA 1J5CA 4KX8A 2ENYA 2P24A 4HUXB 5DHXB 4AQ8A 1OHZA 1IM9A 3HR5B 4JEGB 5DEZA 3O0RH 3L5HA 1NH6A 3ZMEA 6FABL 2VLRB 3SQBA 4HS6A 1ODUA 3ZY7A 4QRQA 4JQIH 5IB1B 5HTSA 4AQAB 3EYOB 2V3EA 1E28A 3ZTNL 1FUNA 4I5BB 2OPCA 3WE1A 3M45A 2WXKA 5J7CC 4N4YB 3IETB 2NW3A 4MZRA 2OYLA 4X5WA 1HCZA 3V95A 1UWEH 1CGXA 2C8NA 1PLCA 1R4XA 3CN2A 1G0YR 5DUML 5HYJB 3K6DA 5LCVH 4G7QB 4H2AA 4JHAL 2EYSB 5F44A 4Q2ZA 1EXGA 3RBSA 2DQFA 4RDBA 3QDAA 5KYWA 1AANA 1ADQA 1CXLA 2GY7B 3ECBB 5ACMA 4QY8B 1HX0A 4YXKH 3H3PL 4YFEA 5HI3D 2DTMH 3H9SB 5D1QD 2C3VB 1DQMH 5CIPB 4FFTA 5JQ6L 3QWQB 4EVNB 1DLFH 1LWJA 5CEYB 3M1BA 1MCCA 3K5SA 4K9EC 1OXYA 4AYBA 1RJCA 3S2CA 1VFBB 2VRKA 5GSRB 4BE6A 5EBWA 2BSED 2GC4C 2UZYB 3CHOA 1E28B 1TETL 4G6AC 2Z4QB 3EHBC 1F56A 2OX5A 3V6OA 3QPXL 2LU3A 4I9WD 2OZNA 4YLCA 4I3SH 3BW9A 4ZUUA 1DR9A 1YVLA 2QMKA 1HS6A 4U1MA 1UD4A 3BP4A 4S0TD 3ZRSA 2XPGB 4UMSA 4NRZB 4PB9L 5E24E 1MAKA 4G7YH 4ONGL 2PPFA 4XAKE 2CRMA 3MR9B 4NO5A 3RP1A 2WP3T 1KBBA 2WLHA 2DWEA 3GSVA 4NQDD 4GSUA 5FO9A 5C0AA 1ZAGA 3RDTC 1MRCH 4CVZB 2E6QA 4ODUA 2ARWA 2J73A 4DAGL 3EGSA 2HN7A 1QKZL 1UB6B 4X9YA 4ZS6C 1W8NA 3VQ2C 2EXSA 2BNQA 2Y7NA 3MRRB 4YDLC 1TTUA 1DUYA 2A6DA 2YMTA 4TNWF 4Z7OB 4MQTB 2WQSA 4QXTB 2OXHB 4UTBL 4PWHA 1LGVA 2XZAL 1KFAH 4NJ9L 4BSJA 5I1DB 5J11C 1FPTH 3R7RA 1CYXA 5JHLH 4GRLD 2A4EA 1AMXA 1CFTB 4OGXH 5E95B 2H0EA 4M8UA 1JNNL 3SQRA 4FQJL 1N3NA 1AKJD 3IPEA 2FO4A 4D3CH 1IARB 3SPVA 4XPAH 1KTRL 3GBNL 3I9IA 4QKXB 4JFYA 1NFDA 1J48A 3AITA 3D39E 4LP5A 4I48B 4LLUB 5EOTA 3MR9A 4NYLB 2QQLL 3VWKC 1ZK5A 5GGSB 2GG1A 4G72B 4KKLD 1OT1A 1GS6X 2P4AB 2UWEA 2YD2A 5AVYB 1AGEA 4ETQA 1VGEL 4GRLC 4OZHE 1JXDA 3KM1A 3PJLA 3CVHA 4QGYA 2DL9A 2ZKXA 4MVBC 3RU8H 1N5YH 1YJDL 1YLBB 4JM0A 2HFTA 4OFIA 5DO2C 3BHBA 2JCWA 2UUDH 2IALA 3TN0A 4Z78B 4PJ9B 3HE6A 3LN4B 1NIEA 1X5FA 1RUQH 3MLVL 5D7KE 2AAAA 1KYOK 5I1EL 2V37A 5D1ZC 4XN9A 4IOFD 3RYMA 4BH7B 3TJHD 4YXKL 4ZX4A 3TWYA 4PU2A 4ZFGL 4PJ8D 4K94L 4XNDA 3EOTL 5HHQB 3FQTB 2WPGA 1DQML 2OMWA 2QLYA 3EO1A 3ROLB 4OGAC 4FD0A 4Q97A 5DJ0A 4XT1C 2GJ6D 2WLJA 5INCB 4QLWA 2WTOA 5DU7A 3OZ9L 3ORJA 2BCMA 3EZ8A 1QRNA 2VIRA 3IMTA 1C5BL 2DD8L 2RH0A 1RIVL 4NQED 4ZO8A 5I73C 3TWCH 2ZTBA 1RZJL 4WWKD 4BV1A 5C0CE 2IAMA 3Q1SL 4W4OC 4X6FA 3V10A 4NKIH 1A6AA 3SCMB 5LDSA 5IHBA 1LO0H 2JKNA 5HXMA 4FERA 3GJFK 3AT8A 1FFQA 1KJ3L 4LEOA 5FHAL 3O4OB 3MRPA 4PWGA 5DHYB 5C09D 4YPGB 2GK2A 1BVLA 3MGTB 4JPVL 4OF5A 4XN8A 2Y6TE 2LABA 4CMHC 3PWLA 1X7QB 3QUZD 3T8XB 1GTNA 3FOLA 3SGDI 3SBRA 1DQQA 1AD9B 1PIGA 4NB7A 3IFNH 4DW2L 3F84A 1X5IA 3BKCL 3OKNA 2Y7LA 5HDRA 2CCLA 3UO1H 3VI4B 1FZOA 4QUOA 3SPIA 1HIML 3ILPB 2NY5L 4PG2A 2CALA 4QRTA 2XTSA 3TM6A 4K9JA 1W0WA 5D7LD 3KE0A 4HUXA 3X17A 1N6QH 2DLEA 4X9GA 3E8UL 3QIBB 3BP6B 3WXWL 5SWSB 3OJDA 2XKNB 4JAMB 1YMHA 1WBYB 3HG1D 4S1RH 1K8IB 5E03A 4LNRA 5T1KB 5AW3B 4QXGH 2GJ6E 1CFNB 4K71B 2BFVH 2EDEA 1X7TA 2E5EA 5ACLA 2KHAA 2G2RA 3DK0A 4G8GB 3OR6A 4BZ2A 3MV11 4HGKC 3QHTC 4OV6F 1NFIA 4HCRL 4JMNA 3K6FA 4QO1A 2QSTA 3K4ZA 1VGEH 1NGYB 3ZTJG 2XETA 1LNUA 4HWNA 3FCTB 4KGLA 3W5NA 1L9RA 5C7XH 5KSUB 2N7SA 3PP3K 4R5TA 1YQVL 2Q3AA 3SBWC 5L6YL 4POZC 4IEFA 4Z3FA 5CCKH 2DWDA 4JG0L 1F4XH 4WZ9A 3IYLW 4XCCL 5ADOH 2BO0A 3U1QA 3AT9A 3TF7C 5BW7A 1U8NB 2FEDC 4HX1A 3NA9H 4U1HA 1HDMA 2APXA 2GJ6B 2OK0L 1XGUB 1GCYA 5B3JF 4GQ9L 3D3VE 3QIWD 5IVXB 1KULA 5T5FH 4IDJL 5GGSY 2V7HB 2NQDA 5C3TA 3SDDD 4G7SB 4PP1D 5KS9F 4YHIA 4S0SD 1RZ7H 3BI9X 4DT2A 5FO7A 3L3OB 2BOBA 25C8L 3T77A 2VC2B 4I0PA 3LJ3A 3FN0L 3B2UD 5E2TH 3L4CA 3PWJB 3STBA 4JRXA 3L54A 4PV8B 5T3ZE 3GMMA 1JK9A 4UT7L 5GS2D 3VE0B 4LGSB 1E7VA 3KNBA 2J20A 3LRHA 3KPQB 5GGVH 4NQCA 3E3QE 3BO8B 3ESMA 3Q8BA 1IT9L 1P6FA 3KYOA 4X6CB 3G5WA 2X7LB 4M6OH 3ZT7A 2EC9U 2FSEA 5I76B 2C1OB 2JELL 5AB9A 1FNAA 3O6ML 1C08B 4G7YL 4YBLC 3AB0C 1NM4A 2R2EA 3QEUB 2IDFA 2NY3C 3QQ9C 4BBWA 1SQMA 2OSLA 2CGRH 2YK1H 4R3SA 4DN4H 3ZIYA 4X5XB 2VWEC 2Y07H 4N26A 3W9EB 2QFRA 2G5BA 5HY9A 5H8DA 1IO4C 5IW1A 1A6VL 1JDDA 2W94A 4J1UA 1QFPA 3J2PA 2KYIA 1QKZH 4BFEA 2VISB 3C09B 5DJYA 1U8HA 1SOXA 1F02I 5JNYB 5AKTA 4B7LA 1G6RL 2DL2A 5E8DL 2FNBA 3P4NB 4P4RA 2ZX7A 3NABL 1NCNA 4DK3A 1T6WA 1QBLH 2VDKL 4OIBA 1XF3B 3ESVF 2VDPB 2W0FA 3UZQB 1KLGA 2DB8A 3LZNA 2Y5EA 2HJLB 5EU4A 3QHFH 2X7LA 3C09C 1SPDA 3MYJA 4XBMA 3T0DA 3NACH 4YSSA 4M7LH 3RX5A 2HH0L 7FABL 2FIRT 4J4PD 5IQOA 3HG2A 2I69A 1YAIA 5B22A 3HZ3A 1TZOA 3HC0A 1G7JB 4PJDA 1UT9A 5AOKA 4Z8FH 3D50A 1BW8A 1HCVA 4O51B 4K5MA 4CAGA 4KK6C 4W9DC 5D2LE 4NX0A 2C3WA 3CZFA 3OAUH 4JO1H 4RNRB 1JYXA 4K3GA 3ABGA 5CAYB 1C1EL 1T22A 4ZUWB 1HI6B 3L1EA 3UOAB 3V5DA 2WAQA 4NRZA 5FGRA 2F6AA 3BWSA 4HMDA 2BOCA 1BOGB 2VLMD 4M5YH 1V5JA 4OZHA 4P2RE 4C58B 2D4FA 4NS0A 3OB0H 4ZQKA 2ZAIA 1ZHNA 5ID0B 4DTGL 1RUQL 5HHOE 1CLOH 5GRZA 3CCHA 5I5RA 4DKEH 1NIAA 2HN7B 2DQJH 5J57B 5E5MB 3BGFC 3CBRA 3SY6A 2XTJC 3UXFA 1PZSA 4ZMVA 3DVGB 4MNGB 1O6SA 2F53D 4EBQH 1AG0A 4HIHB 3ZKQD 2J8UA 4Y88A 4BKTC 1PFOA 1NCWH 3HC4L 4MXQD 4PP2B 5HGHB 2WNGA 1RZIA 5EUOB 5IV2A 3RVVC 3G08A 4N2CA 4Y2OA 4BHUI 1A14L 3HN3A 3CDGB 4O02A 5F2FA 3IK2A 2HXAA 5EZIL 1VCBC 1VEMA 2ZWZA 3Q8EA 1B4JH 1OGTB 4YHZL 3P4LA 4EKJA 3D9AH 4RMUA 3FB6A 4L5FH 4HALA 4LPYA 2ROXA 3VGHA 3WNNA 5IMLB 3UTTE 4IYKA 4C56D 3DI3B 4PCSA 1WAAF 4WEBL 1RUKL 1SXZA 4PJ5B 4W9EC 5J6HA 2N7BA 4CMHB 2D73A 2YPLD 2ENQA 5DZ9A 4JFZH 3H55A 4OT1H 4LPWA 3EJYD 1ID5I 3BE1L 4AQEB 1CDGA 2A1WH 3F58L 5T3XL 1MN4A 3S37L 2PO6A 3U7YL 3I6GB 4JM2C 4YE4H 3QIUB 4UILL 2VXUL 4LP8A 3ISYA 3KGTA 1VZGA 3QC5X 5IV2B 3O81A 4JK0D 1MH5B 2Z7UA 3EFOB 3R1GH 4PJGA 1JGVL 3FQTA 3QK0A 3L3JB 5K9JH 5EEZA 1BLNB 2VLKB 4IBLT 1QTYT 1WH0A 3FU7A 4TUJA 5GZOC 4FG4A 4BZ1L 3KLHC 5BO1L 3FULA 4PB9H 3L4ZA 5J0BA 3RY4A 4BCYA 2XX1A 2Y06H 3VFGH 2IAMB 4L8SC 4NCDA 1ID2A 3LKRA 4UT9A 1AIFB 2XJKA 4XCEB 1UJ3C 1JNLL 4FLQA 3BH8A 3GNML 4JFHD 2WCSA 1MUJB 4JJOA 2OTWA 4MS8D 1JHKL 4G59C 4MVBD 3VFMA 4X6CE 3O4OC 3HZVA 3IETA 4WEMB 1E9OA 1CDHA 3UADA 1PW3A 1MJ7L 4Y9EA 3KPOB 3CDYA 1DQLL 2VZ1A 4FQXC 4ONGH 4IMKC 3H9ZA 1CG9A 3F7KA 3WYRA 3VD0A 2KZWA 1DL7H 1T2JA 2B3IA 2QTEA 1ZVHA 4NO0B 3VWKB 3VI4A 1FYTA 5E6ID 3B7RL 4R26L 3PY9A 2AXGA 1G9MH 2Y22A 2UXVA 2X4OB 4O00A 4M4RA 1U8MB 4LSPL 5K9QG 4FKKA 4R83A 2BP0A 2WIMA 3HC4H 4NQDB 2HT2C 4B9FA 2UX6A 5KYXA 4JAMA 3N06B 2VQUA 2OX5B 3QBTB 1SF3A 4RCAA 3I3EA 4AW4A 1NGQL 2YD8A 4K7PH 2OMTA 3E0GA 3WN6A 1UCTA 4KJWC 2P5EA 5GSRA 2XQYG 2XQ0A 1YAZA 4PRPB 1ZLUK 5D2NE 5EV7A 4LCIL 4X98B 1G87A 1QW9A 5SX5H 2VN7A 4GB9A 3B5GA 4JRXE 5CEYA 4EUPG 5J6GA 1TJMA 1CF8L 3KD4A 2KI6A 4FFYA 4UI2A 1OT2A 4Y2DA 3BSZA 3ZHKA 3DIDA 4YLBA 5HHOA 1HXMA 3UACA 4F2FA 1MCLA 4M5ZL 3SDAB 3BISA 3NJGA 3S35L 1NCOA 3HE7C 4CBZA 3L9YA 5FUCC 5KVDH 2EIJB 1ETZA 4XWGH 1R5VB 5SWQA 2O93L 1AR1B 1XF4A 5LUMA 4IBTA 4Y0GA 2DWEB 1FG2B 3GSVB 2AJYH 1KYFA 3WNMA 2IG2H 3D08A 4G8GA 4ZMAT 2KZBA 2XWTB 1NCJA 4LSRH 3BZFB 3F6IA 4WGVB 1T7XA 3UJJH 5JDSB 4K3DL 3QZWB 1IT9H 4CU6A 5LG1A 1EAJA 5H37A 3W2DL 4F8NA 1OO2A 3Q9PA 1L9TA 4MQXD 2G2NA 2FRGP 1DQLH 4NQEE 5BRQA 1OP5H 2VDKB 3VM5A 3VWJB 2ZSVA 1B4RA 2V8MA 3FQ4A 2VC2H 3D4CA 4F5CE 4ODUB 1NGXA 2FJFA 1OARL 2KZKA 2YN3A 4OCRL 1RSFA 2Y07L 4F27A 4MJ6A 4IBQA 3FH5A 4L3CB 3OAZH 4JFYB 4ZS7L 5C0BB 4MMYB 1D5XB 1HQRA 4PS4H 2H6PA 3VD3A 1F42A 1CFTA 4AE0A 3I2CL 4WI7A 5DQJB 3ARTA 1K8DA 4AIZB 4PBWD 3GS7A 2XX0A 3O41B 2GTWB 1U93A 2ZNWA 1JS4A 4PJ9A 1OW0A 5BUGA 4FJZA 2MSPA 1YNTF 4KY1H 3P9LA 4OY9A 4X4ME 1ROCA 4GAYB 1JZ7A 2XQYA 4IBUA 1A1OB 4HH9A 1MFNA 5J13C 1DUZA 5IWLC 2AEQL 3MROB 2HH0H 4JFEB 4JJHA 1ZLSH 4U6HB 4PJGE 2VGLM 4RWYH 3VWJA 4U3XA 5F88B 3LKNA 4AV5A 5AW6B 1EHXA 4GG6A 2EVIA 2VDMH 3FT2A 3L3KB 4J2QA 3W39B 4ETQB 4TL4A 2XV6B 1AACA 6CGTA 1MCKA 4MQSB 3KL0A 1RIHH 3AS2A 3DIFB 1CQYA 2UZIL 2P80D 2FWOB 3UZEC 5BS0A 5C86A 2VZTA 4P07A 2WLNA 2LFGA 3NH7H 2NY3D 4Z7UB 5JYLA 1HQRB 4OI9A 1TJIL 2A9CA 5DJ0B 3GBML 3LQZA 2AFNA 3ML8A 4D7BA 1XDTT 2ZSWB 3VYPA 1JD9A 3SBQA 5IB3B 1J1XL 2ZOLA 3NJXA 2V9TA 1N7MH 2MQ3A 4OCLC 4Q6KA 1QSEA 2RHEA 2X6UA 3HC0B 2WSDA 1CBJA 4MJ2A 5IIEB 1PZ5A 4DKEL 2FJGB 5F7UA 2AMUA 2EEAA 2OL3B 4OF0A 4ZD3H 3ZJAA 5M94B 4YSDA 1WC7B 4LKCA 2B14A 3MSPA 4I9XA 1V3JA 2K3TA 2CO3A 4HIEB 3RA7L 3O2VL 1BMZA 3UGEA 3MMEA 3G6JA 2DJMA 4N22A 4ZFOB 3WCYA 4EBQL 2L3BA 3QQ9D 3L5JA 2IV8A 4B41A 4HAFA 5KVEL 1N26A 4E5XG 2P5ED 3ECVA 3O9WB 4W9KC 1A6AB 2YC1B 2QR0B 4W81A 1T0OA 1FLRL 3RTLA 2YAPA 5E2TL 3WY3A 2MMXA 3NFPA 5GRYA 1LO2L 1XBDA 4OQTL 4ZMZA 2IG2L 4XCEA 1LK2B 1MRDH 1NDGB 3RVWC 3NAAL 1UWXK 5EHFA 2PTUA 4ELKA 1U58B 4H5SA 2WBWB 1GGIH 1BPLB 5EO9B 1JNHA 3VWJD 5L2KE 4MA1B 2P5PA 2R7EB 4PV9A 4QRRB 3V9FA 5JW4M 4MRBA 4GLRH 4MMZB 1RP8A 5T5NF 2XA8H 5EULV 4FOMA 4PP2A 1AXSA 3VI3E 4OT1L 3SDXE 2P5EE 1RL1A 4J4PC 4X6DF 1OGSA 1DDTA 2FATL 4YZFF 1MPAH 3HLKA 5DCCA 3NSJA 3WJMA 5GRJH 4AKPA 5E9DB 2IGTA 1BIIA 2JJTA 3OGCB 1GCFA 2JJUA 3QO1A 1WAAE 4IRJC 3TV3H 1YPZB 3RIKA 2E8YA 4Y5VC 5F93C 1YYMH 4JY4B 5K9OA 3QISA 4BFRA 2VE6A 1Y18B 2X0UA 3B9AA 1NC4A 3KEHA 4M4PA 5GJTL 1ZVNA 4ADGA 3BDBA 4ENZA 4P5MB 1DJIA 4W9JC 5HHMD 1HHJB 3ETBF 4HJGA 4N0RA 4K73A 4N8VG 1IZKA 2IF7A 4PJEE 4XMVA 4FLRA 3IXTB 5ALBH 4BZYA 3ETTA 3GT6A 2ZG3A 3HS8A 4AK2A 4ERSL 3S6CA 5IHUH 4FQ1L 3GHEH 1ORSB 5L8LB 3E2HC 5CGMA 4QRFA 4TQHA 3FRUA 1B6DA 1N59A 5FKPA 3WTTA 2CDEB 3RFZC 1UZ8A 1T1YB 3PV6B 3LRSA 4Y7MA 1CGVA 2MKWA 1N6VA 2CBPA 3KLSA 4ES9A 2YGOA 4PJGB 4BEIA 3VRIB 5EA0L 4PJFF 1KEGL 1UKQA 1KIUB 2OR9L 1BFOB 4PJ7B 2YPLE 4Z7WA 3JWNH 2R2BB 3MRIB 2FQGA 5D4HA 3VXNA 4XX1G 3W81A 3VG9C 4KQ3L 4R7VA 2LHAA 2OYKA 5FYJD 3GZKA 3U6XA 1SMOA 3BWZA 2EEDA 1LO2H 1P2CB 3BJLA 4XXWC 3APFA 3RUGE 1ZJAA 4G82A 5I24A 1HL9A 3QDGD 3LIZH 3NFSH 3PYCA 3D2UB 2VXQL 2FWUA 3QYMA 1E9QA 4JM2F 1AAJA 4Z5RA 3U4BL 5I0WA 4RGNE 4XPFL 5GRVL 3QEHB 4N87A 2YIHA 1WCBB 2CJTA 1AP2B 1I8LA 3HNTH 2E75C 1WISA 3LX9A 1OY3B 2ZAGA 4R3SB 5GISH 5LBSH 1AGFB 5EZOH 5F7WC 3B9EA 2IH1A 1DJSA 1XCQB 2C1PA 3HUJA 4JBSA 2E8ZA 4Y19E 4XP6L 3WFCH 1J1OH 1FLRH 4LGRB 1A6TB 3ARDA 4P9HC 2ZCKL 4BFGA 5K1VA 1H3UA 4JO2H 3VXQA 4A7TA 3QXTA 1LO4H 1OZUA 4HZAA 5D1ZB 5HI4D 1D5MB 4QCIB 5FF6B 3D52A 5IHWA 1RJLA 1W2KT 3GI9H 3QWNA 2XKSA 1KBGL 2P7TA 4X5LA 1F11B 2R69H 5I5JA 2X89A 3HZKB 4B3EA 2ADGB 3UTPD 4AENA 2GHWB 3VFMB 4QHMB 3GK8L 5FA3B 1R5WB 2P46B 4OKDA 1PQZB 1T0NB 5ECGA 5BZDA 1GGBH 4HXAL 3S3SA 1BQLH 4J1UB 3TBBA 2OW7A 4FQHB 1L6PA 5DHEA 1QFWI 2ADJB 2TSBA 2XLLA 1UATA 5F3BA 3MOAH 1A14H 1WTLA 2CSPA 2P5EB 3N40P 4AUUA 1SY6H 4DWHA 2WUCL 2E7MA 4I3GA 2XCMC 2LFEA 3A0OA 2FZ3B 5HGDB 4OZHB 5I6KA 2APFA 2D7QA 3X12A 4LLAA 4TKWA 5CLZA 1MW0A 1ZV5A 3MRGA 5BO1H 3ZXAC 3OM3B 1CFSB 2HVKB 3KBHE 3CFMA 3MUGA 5HVFB 5DTFB 2Z91A 3TA4D 2X1WL 5B8CB 4YDMA 3MACH 3C8KB 1A7RH 2JB5H 2GITB 3L5WA 3B2DC 4IQHA 1GR7A 4XNQB 3DX9B 5AOJA 4L1BA 2OR8A 1BOYA 3GMNA 2WLZA 1NKRA 4DGUA 5C0IB 2Z92A 2UWEF 3ATAA 3L81A 4TF4A 4KRPB 4LL9A 4YZFE 4N8PA 4OZ4A 1MXGA 1HI6A 4DK6A 1JGLH 2R0KL 4QJ5B 3GFUA 4WFFD 1NCTA 2LLNA 4GKNA 1AS6A 3QXDA 5D8JL 3V0WH 3OJVC 2KQMA 4PRBB 4PJCB 1KENH 3T65B 1VJSA 3FQXA 3WN5C 4L9DA 4WUUD 2F08A 2E9GA 4XBPA 5BS0E 3DV6A 3EDKA 5MHSE 4ZG1A 3SPGA 4X4XB 4QHUA 5D7SH 1IU1A 3OQ3B 3L9RA 1NFAA 4GFXA 4H1LG 4TNWK 3N5AA 2WIIB 3D33A 4XP1L 3IMRA 1IIKA 3GRWA 1T89C 1VSCA 3WNIA 5F7EH 5JHBA 4J39A 3QXWA 5AYUL 1A25A 1H6UA 5LGKA 1GL4B 4AL8H 2V2WB 2VDRB 2JCCA 4MXQC 3RHWK 1QVOA 4D8OA 1ZHLB 5J6HB 3EFFB 3CSTA 3LXUX 4DVRH 5KVEH 3DUSB 3IFPB 4OVUA 1NEZG 1V7NL 2A9BA 3SE9H 4JKWA 5DJ8B 1KY7A 3GJEB 1VKXA 2BVQA 1UA7A 1IGYB 5ISZE 1MH5A 3EFOA 5J1AA 3CN0A 2BPBA 3GLZA 4OQTH 1YCSA 3MLVH 1A65A 2O5YL 3VSVA 5IFAH 3T4AA 3X1NA 2H9GA 2IH3A 3F12B 4MZ3A 5G5DB 3S2AA 5AZEH 4Z3JA 1LM8V 3UROR 4DEPC 2FUQA 1GYWA 2D0HA 2FSDA 4EDXA 1HEZB 4AYMC 1A5FL 3OJ2C 2LT9A 4NKMB 2HTKC 5KAQF 5FUOL 1Q1JL 1J9CT 3TO2B 3VFWA 5DMGC 3WEXB 3TN0D 4NQEB 3WEMA 2MQ0A 2YRBA 1C1EH 4BA8A 1QLEL 3P9LB 2VLJD 1I7RA 3PL6B 3U2SB 4KTDH 4HLZH 1TVHB 4L8SA 1UA6L 4Y5VB 3MOAL 3IGUA 2JTDA 1DCLA 4KK8C 5TK2A 2ED9A 5AKVA 4TVSa 1JZ2A 4AG4H 3C5ZD 5SV3A 1RHFA 5MHSD 1F6LL 4JZNA 3REWB 5C97A 1P5UC 5JQIB 2FR4A 4UTAL 1OAQH 2UY7A 2XYBA 5ITBH 1ECZA 3WDHA 4GQRA 1DBJH 4F1SA 3JWDH 2XWDA 1IC1A 3KDPB 2FHBA 4NQUA 5LDUA 3K6SB 3S5LB 4MNQB 3CHPA 4MAYB 2ZJSL 3JUYA 4MNGE 4TVUA 3O4LE 3LIZA 4MZ2A 4V2BA 4OCMC 5KYNA 4KC3B 3PWPA 4OU3A 4AKQA 2JVUA 5KN5B 4NDMB 4QRBA 1J0HA 1JF1A 3PAUA 1KV3A 5DI8A 1I8KA 2FLRT 3LEXB 1SXSA 4Y4HD 2EDOA 2FX7H 2K6WA 2OJZL 1HESA 1KC5H 4HW6A 1BPVA 3MV8B 3C6LA 1RZKL 5J1TC 3O6FA 4W70A 3GLDA 1A4BA 1CN4A 2ODIA 4KVPA 3L3IA 3HBPA 5F7MC 2I60L 3B1UA 1VRSA 1E5BA 1AI1L 3HFMH 4KDTC 1T7WA 2BDNH 3EYFB 1ZRUA 2QR0A 2VC2L 1NC2D 4AJYV 4Q89A 1UH4A 2H5UA 3Q1EA 1RV6X 2HUEA 2A6IA 2YRZA 3NJJA 3IAPA 1A7NL 4HHAA 4QXGL 4H20H 4WV1C 4OZGB 5D2LB 3TLRA 2L8AA 2YKKA 3OAWA 5DEFA 1U8KA 2O30A 2Y3AA 1IM9B 1LK2A 3HR5A 1TG8A 2R1YA 4XBEL 5EEVA 1HOCB 5DMIH 1GYAA 2MCPL 4CC1A 1KN2L 1TQTA 3K71A 2VR4A 1ADWA 4MAYC 2CDFB 4F24A 4JDTH 3L2LA 5CLYA 4JGMA 2AEWA 4CSTA 4I5BA 4BQBA 2DLFH 5KVGH 3BT0A 1RZ7L 3PF2A 2FHFA 4X0NA 1RD6A 1PEZA 2FYYB 1R3KB 4KZEL 3H4FA 4JG1H 4HSAC 4ZMLA 3JBG7 2ZUQB 3VDAA 4KY1L 2F18A 2ADJA 4QXUH 2JKTM 4KKNA 3NIFB 4XN1A 1IKNA 3BVTA 3NFSL 1XTLA 2L7EA 1QSVA 1TKWB 5LXGH 4ZPTA 4BK4A 4FQCL 1R3JA 4GG8A 3X13A 1XF5A 2V2XB 4O02L 5JDSA 1S9XB 2XQBH 4UZSA 5EN2A 5E8OB 4E9TA 5H4ZA 1SDDA 2E9IA 3QP3A 5SWQB 3PHOA 3IM1A 4HJ0D 1NFDF 4I2XB 1H3TA 4DEPB 2FWSA 4L4VE 1UA6H 3QXUA 4NAQA 3US9A 3DX4A 5FV1L 3TJPA 2J56A 4ZUUB 2EC8A 3KWXA 3G6DH 1I8UA 5I1HL 4DGVH 2QKIA 4EJ1C 1W72L 3MRHB 2XPGA 3UBXG 1XGTA 3CZJA 2UXTA 5E8DH 3VRIA 1UB6A 1RI8A 4IU3B 4YHKH 2H6PB 2ZIDA 3ZT5A 1QBAA 2CO6B 1I9EA 2OM5A 1P69B 1QASA 3ZZ1A 4MJIB 1IJ9A 3EJSA 3MGAA 4HQQL 1YY8A 2GTWA 3AABA 3EYSL 4X5PA 3TBYA 4A1RA 4E2OA 4ZDHB 3VXQB 4Y4HB 2V5TA 1KTLA 4XE5B 4A7GF 2D9CA 3HHSA 1DUZB 3LB6C 2OMBA 2YPVH 3ALWA 4JFEA 3GNMH 4EN2A 4FHKA 2MH4A 4UIMA 4XP5H 3TBTA 5JXAL 4WEEA 5TF0A 1MCWW 3BVDB 4DP6X 5L4MA 4NYLA 2GEEA 3FQ2A 4OBRA 2PMZA 1JGLL 2R0KH 3LB6D 3VU2A 3HE7B 1R3HB 5CLWA 1OOWA 3M1OA 2AVFA 3EGSB 3TBVB 3QIUC 3QQ4B 1PIFA 2VH5H 3JZ7A 3QNYB 2LV4A 4RDQF 3STLB 5C09A 4O2FA 5EOTB 4LXFA 1JWMB 2YMXH 4NM8L 2WXLA 1KPRB 4QHKI 1JMXA 1JV2A 3SKNA 1U3ZA 1S7UB 2WVVA 3EDFA 3H56A 1IL1B 3JWNG 4NN6B 4A38A 4NUGL 3F7PC 3O2DH 3QHZH 1GJWA 4FQCH 1T5XB 3QFDA 3EBAA 3LZPA 3QUYB 4ZDHA 3NEEA 3PE9A 1BVKB 4D0BA 3N43B 5JTWA 1X5AA 3BAWA 2DJUA 4PP1C 4ZQTA 4UIMB 4U3SB 3BKYH 3OLIA 3BPLC 1Q0EA 3NFPB 2J25A 4H8PA 4LDEB 4NUJA 4G8AC 3DX3A 3CVBA 3VQ1C 3SJVB 4TVPD 1DJYA 4IOFC 2XG5A 4Z1PA 3KWTA 3L9EA 5KYUA 3ZL2A 2H2SC 1UUSA 2WB1A 3KYNB 4L5FL 4CUCA 1ZKAA 2ZKMX 5J4MA 5EO1B 5JXED 4ZTPL 4GO8A 3U4BH 3LN9A 1TUPA 4LSUH 4DN3L 4E41B 5HHPB 1MG3C 3LH9A 1H8NA 3WIFB 3CLEH 2P8PA 1NEZA 5IB4A 5T5FL 5EEWA 2PN5A 3OBAA 4CADB 1UVQA 4JUSA 4LVNB 4W9LC 1QUPA 1QP1A 2D7TH 4QT5B 3CQQA 2AHIA 4HJTA 3DX0A 2AZUA 4XP6H 2FECL 3FN0H 4AKOA 5DEGA 2CGZA 4PCTA 1S4IA 1ES0B 1D7CA 4D3CL 5EO9A 4URKA 4YZWA 3WL9B 3EDEA 2F58L 1RZFL 2FDBP 2P24B 3MRCA 4DP2X 3MLRH 4E0RA 1QO3A 4OCYH 5TE4L 4HETA 5TGBA 3VXMB 3GXTA 5A7EA 1JGEB 1G6RB 2YMXL 2GCYB 3EYOA 4GKOA 1PFCA 3RJDA 2CIKA 4OIIH 1AO7E 3VFOB 1OCOB 3DJZA 4NQCE 1K5NB 2VKXA 1BZ7B 2I85A 4H8WH 2B1HL 3D2UD 4AQ1C 1OP3H 3HVNA 4IRSC 1J1OL 3NIGE 1MCFA 3RUGB 2H2PD 4ZS7H 4RRPA 2H7WA 3JTTA 4W93A 4KKPA 5D6DC 1AY1L 4R7NB 2E7LA 5DEFB 4K2UL 1MXDA 4JKPL 2EE0A 5C71A 1LDSA 4YHOL 1L7IL 3MLYH 2ZF8A 4PLOB 5E1AA 3TV8A 3HAEB 3FF7A 3RZCC 4ZO6A 4IKNA 2DYPD 3BUPA 5EIVA 5FM5M 3W11D 3NEXA 2Q3XA 4FP8L 3TCLB 3VI3B 3ECQA 5IFJA 3ULVL 1UC6A 1A9EA 1PSKH 3VFTB 1P4BL 4Y9BA 5B1BB 1HINH 1KCKA 3BD5A 4N2NA 5D5MB 1NBZB 1Y6MR 2NDFA 3N6YA 1QTPA 2BSSB 1MZZA 2VDOL 3BKMH 1YEEH 4QRAA 3MJ9A 2F8XC 4GSDL 4MA1C 1XGRB 4YX2L 3EYVB 4FG6C 1R3IH 3QJRB 1PG7L 1AZZC 4KI5D 1E8YA 2BZ7A 5EC2B 5AG9A 3LV3B 5ILTH 3HPLB 2AJUH 2VN5A 2ZOOA 2Z8VC 2YD3A 3QJHB 4IBSA 4XCNA 2WNWA 2XHNA 3UAAA 5I16A 4ZPTB 5IB2B 2HFGH 4WI3A 3RILA 1SN2A 3E6HB 3VXRE 3RDTA 1FVEB 3T71A 2HT3D 1J5OL 4C83A 2CBQA 3C2AH 2W0LA 1LO0L 3SZKC 1KLUB 1B9KA 1P84K 1QR4A 4U0QB 3WNJA 2JJTC 4N90D 3CHSA 4G80A 1WGVA 3L3OA 3VH8G 3ULUH 2HFEB 4MLSA 4L18A 5C08B 3FU9A 4ZMXA 4WI8A 2E6JA 4PBDA 3Q43A 2OBGA 5DK3A 3M7FB 4GKSA 1RU9L 3FQUA 3LS5H 1JF1B 1O6TA 2GJZB 4Z8FL 1SYVA 4L29A 2NYKA 4CMMB 4LSVH 2DS4A 3JV0A 3C6LB 1N18A 2XQBL 4LSPH 3RKDC 4YWGH 2WBJD 5C0RH 2ZCLL 5AOMA 2IVFC 2ZAHA 2FB4H 4N9OB 4AWJC 4IW4C 2C3XA 4B9CA 2AP2A 4UQ3B 2LVEA 4MJIE 1NMBH 1F3RB 5KVMC 2WBJC 1BM3H 5LN4A 1IEBB 3DETD 3QA3A 5CN3A 1EEQA 2ATKA 1AY1H 4BUHA 3FTXA 1MFAL 3PP3H 5GGRA 1JNJA 2R1WA 3N85L 5E0FA 2A9NL 2A73A 2FSEB 4ABQA 5I76A 3GSNL 1I8KB 3VXMD 1K3IA 3H9SE 2VO8A 3B6SA 3DO3A 5JHAA 4TSAH 4LB8A 2FD6L 1RUKH 5DJYB 1G1YA 2NY2D 4YSTA 2X9WA 2FX8H 2ZXQA 4KXDA 1A6ZB 4EVNA 3QVAA 4U6XA 5J13B 5K69A 2UVEA 5LLIC 3WTWA 2ZWYA 3VW3L 3CBKB 2FQEA 4NM4H 1FNGB 5DT1L 4WHCA 4C4KO 1GYUA 3Q2WA 3KWWA 3L1FA 4ZMNA 1VACB 4J23A 5D1XC 4GT0A 4DP4X 5BV7H 1CG9B 4X9BA 6TAAA 4PYHA 1MFMA 3MXVH 5EUKA 3MYJB 3BVNB 1ADQH 1JZ5A 3WAJA 3EOAB 1KUMA 3OHMB 4HF5L 3A3YB 2AXGB 3BAXA 4JG0H 4X9FA 1KJMB 4PS4L 2W8CA 4QJ3B 5E0QA 4F15C 3T0EA 1NMCB 3FSAA 4F8OA 4YOKA 3VXOB 2W38A 2BSDA 3JV6B 4R0LC 3UTSA 4DO5A 4XBPB 4CRPA 4DOHE 3KW7A 1J86A 2WVUA 3TFBA 2BWIA 5JPNC 2R0LL 4LL4A 1UWGL 1TZIA 4JFZL 4X99A 3RGVB 3CTTA 3ZBMA 2FLBT 4O51A 4OIAA 3EYSH 5JHDE 3FUFA 4OCRH 3W5MA 3U7YH 1Q9LB 4KFZC 3TCXA 2E7BA 5T1MA 5C7ZA 3OAYK 3EBHA 4ZUVA 2H0JA 5TF1L 3UGUA 2I26N 1IAII 1L7TH 2AEIT 1JV5B 3QXDB 3BCDA 4JFDD 4PJDB 5AW1B 3AU1A 3K6OA 5B39B 3FONA 4H26A 5D1XE 2VLJE 3LZOA 3NMEA 1ZLWH 3VFNB 4NPYB 1YPZE 2WZ5A 3DXAE 2QHRL 4HIHA 4QHNB 5MERA 1ZT7A 5DDHB 3TZVA 5LAXB 1FDLH 2QVIA 3G5VB 3OLEA 4LEBA 3QIWB 5E5MA 4QOKD 3V4VL 2YFOA 3GJEA 1J05B 5IF0B 4F2MA 3EO0A 3IF1B 3GUTB 3FB5B 2GFBA 4NUGH 1DQDH 2AQ3A 4P5SA 4NXKA 1PAMA 3SDAD 4Q0XL 4WUUB 3H2WA 3AS3A 4XAKD 3NCXA 4PLKD 4NQEA 2VZVA 3BWAB 4JGJA 5EU3B 3II2A 5GRVK 4A6YH 4ESKA 5HYSB 4UBDC 4N0YH 1WFIA 4FFYH 1UCBL 1FVDB 1ZTXE 1IBBA 5CGTA 3UTZA 1FYTE 4YL9A 3A4EA 1MDAA 3EKCA 4ELMB 3OL2A 3EH4B 4Z7UF 2CBMA 3NABH 2ZG2A 3JT2A 3I9GH 4TV3A 4Y1TA 3CZSA 4JG5A 1K8IA 2CHDA 4OLZH 1JZJA 3CVCA 2JI1A 3PGFL 4KXAA 1UWEL 2D2OA 2ZUUA 3T3PF 2PR9A 2A74A 4K0OA 3OR6B 2BXZA 1MELA 3IT8D 1A7PL 2J71A 4M7LL 5FUCE 2EUWA 3KPLB 2XNAB 1WF5A 4PBXA 5HDQL 1XSKA 2PETA 4X6EA 1RZFH 4YUEH 5DMGD 1NGYA 1G0DA 3HAEA 2DQTL 3H3PH 3K6SA 3FCTA 3REWA 4WIQA 2WANA 2DQUL 4PRIB 4I0PC 1F1GA 2NT1A 2E4FA 3U6RB 2FJHA 4RBPH 3PABB 4JM2D 3BIBX 5DZPA 2HT3C 2IBZX 5D2NA 1M6UA 3DURB 3OZ9H 3FBKA 4NRXB 3LNGA 4WW2B 4RETB 4HV8A 2D8KA 2DWYA 3FRPG 1OB1A 2EECA 1E7UA 1H3VA 2PO6B 3QIBD 1SY6L 4WO4B 5JIDA 3GSOA 1CLYH 1YYML 1C8QA 4Z7QE 5K9KA 5HJ3B 3F7YB 1ZHBB 3EDJA 3QUYA 3V5KB 5HHPA 5HD8C 4HU2A 5GJSH 4R4NC 2A74B 3QCTH 3HI5L 1BQKA 2WNXA 1NMCC 3MCKB 4P2YA 5DZOA 3RDTB 1Z9MA 3S5LA 1T83C 3WKQA 2Z8RA 4MXVF 4O2CA 3DVNB 1VLXA 2VR8A 4N0FB 4NKOB 3WY1A 4Q8BA 3DI2B 3HR6A 4GP8B 2FATH 2ZUXA 4K9EL 5EC1B 5AW7B 2XN9B 1EERB 1QFOA 1CGWA 4NENB 1JZHA 4GI6A 1A0QH 4KFMA 4X7DC 43CAA 3WUWA 5CILH 3TBCA 3IU4L 4JPKH 3UC0L 2EDYA 5C08D 1AQDA 2BHZA 3MFGB 4J8QA 3IS1X 2HRPH 3LXAA 4CMMA 1C16A 1E4XH 3GC3A 2W91A 4LLVB 1VFMA 4GW5B 4BINA 1T66D 1TTBA 2WKGA 4BRVA 5T1DH 2LU7A 2SODB 4H25A 2R2EB 2COQA 3OAZK 1P7BA 4JHBA 4PRNA 1QNIA 5D4QA 4JR9L 3FRPA 2APSA 3LIZL 4Y1SA 1FGNH 5DYOB 1PZDA 1D2OA 1QLEH 1ZHKB 3TA3C 3VFRB 3C60B 3ZGHA 1IVTA 1FP5A 3QJVB 4HK3J 2APBA 1F90H 1YEDA 4OCSL 3HRZB 1X6NA 2RFXB 4XN5A 2F1BA 5JIHA 1SQ2N 3ZTDC 3BZEB 1IGTA 1YEIL 4LCCA 3RHWF 3D85D 4XMKH 1DQKA 4KX9A 3VI3A 2VN6A 2DQ6A 5H94A 3AG3B 4U1SB 4YSOA 2IADA 2P47B 1CT8A 4XXCC 3FAWA 5EBGA 1FIEA 1PJ9A 1WWWX 2EXYD 5FYLD 2BSTB 5BOPA 4J3VA 3MV9E 3VRLE 4CA4A 3BSHA 1TQWA 4XVSL 2NNXA 4N2DA 4ZSOA 3V0EA 1T20A 4GQPH 1YPZA 4ZAKD 1M2VA 4UDUA 2OMTB 3F62A 4JM2B 1XHHA 2AXHA 4PUBL 2DQFB 4XMZA 4ZOEA 4CJ0A 3LKQB 4KO6A 2EACA 1EV2E 1JZDC 1LQSR 2DWSA 5IFJB 2GIXA 1SY6A 3DXAB 2ROYA 3VFTA 3ILQC 1V54B 1KCUL 1KDIA 1TZIB 2ZXEB 1A22B 4UQAA 5SV4A 4ANUA 5L2KD 3TTSA 3VD2A 1PZ2A 3GMMB 2H2PC 3GPEA 1ORSA 4OFVA 1GW6A 2CO1A 4N2KA 3IU4H 4LSDA 3V6ZA 1A4KB 3P0VL 3PHQA 1JVKA 5CD3A 3BO8A 3RFRA 2X1PA 5I28A 2O26U 1XQ4A 5F9OL 5LXVA 4YGVB 3CN3A 3A4AA 5C0BA 5B38G 3KPNA 1I9IL 1UHVA 3QDGA 2OI9C 1EZVY 4XMTA 2XWJB 3LEVH 1L6XA 2CLRA 3DPDA 4GSQA 4HEPG 5D7JD 5T1LB 5KZCD 3BAEL 1RHHB 4KUZL 4S1QH 3RGHA 4LP4A 3OD3A 4UQ3A 1YG9A 4A39A 1KTLB 5F72S 2AJSH 1G7IB 2DLFL 2UXFA 1OTUD 1YRKA 1E50A 4W9HC 3LKPB 1FWXA 4HISA 1P9MA 4TTDC 4NO5B 5MENE 1BVKA 3II1A 4HJEA 1RZJH 4XNZC 1YJDC 3UO1L 4ZMTA 2EUZA 3VXSE 1NCBH 1FC1A 1L0YA 2DYRB 2FIKA 3MRKA 4K7PL 2GJZA 4ODXA 3WENA 5A2FA 5IQMA 1XIWC 3E3QC 2PPDA 3HMXA 4ZTEA 5KBKA 4L0ZA 1XF2A 2KPNA 3VJ6B 1LTXA 1J0YA 4D0BB 2G0LA 4AC4A 4PJBA 1AGFA 5E8OA 2NY3B 1I3VA 4OZHF 4ABWA 2AK1H 1B2WL 1RAMA 1G6VK 4XOAA 3I6LD 4J6RH 3RDTD 5A2BA 2IXQA 1G84A 4GAYA 1ZS8A 4XGZA 4JLRB 2VL5A 1MW3A 1JWSB 3P2DA 4XMPH 2XG5B 4R4BB 3OKLA 2N0MA 1G7PB 2MCPH 3CN4A 1QA9B 4WO0A 1BD2D 2ITEA 1UFUA 2JCCF 2G9HB 1KG0B 2FJGA 5E5UB 4OUOA 2NYYD 2E6PA 3VXPB 3KYKL 2V5YA 4NP4H 4F7EA 2E0PA 4DGVL 5GRWA 4IHOA 4P9ML 5MEOA 4NNPH 3T4YB 2YAEA 3P3SA 2C9QA 3W1ZA 4U6TA 3HG1E 2JWYA 4KAQH 3IXAB 4WGKA 2QV4A 3QULB 3SE4C 2YPLA 1OAXL 5B38A 2IFFL 1J1PH 2ZSWA 3ZQXA 1KXQA 4FXLA 2W95A 1FSKC 3K81A 2VERN 4HEPA 2OI9B 4WNQA 2NYYC 5IROD 2ZP8A 1NCUA 4I1NB 4Z7NF 3NIGF 2VL5B 3JV4A 5EPMA 1V3MA 1KIQB 1EHLH 3CX5K 4BD4A 2PR4H 5CP7A 2WSPA 5LBSL 4OLXL 4E68A 5CZRA 5KBMA 3RIFK 2HX8A 4NI6A 4AQ8C 1G6RA 1HWGB 1NMAL 3SY0B 3RVTC 1JAEA 2JKLA 4Q7DA 3VXUB 2B15A 4IHOB 5FDWA 2Y24A 3UBHA 5EH1A 3V0JA 4TOYH 1OAUH 4HUWA 1SBSH 1TU2A 1KPUA 1C8PA 1ZA3B 2DKSA 3U1SH 1ETB1 5H2BA 4PJIB 2AEQH 5DD6B 5BCAA 2YXFA 1NPNA 2JIXB 3ESOA 2BCKA 4K71C 4Z7WF 4P3CH 4FMVA 5JHLA 5HP5A 2NX5D 4HS6B 2AQQA 4X4YB 3I75A 4L3ED 3BMVA 4PV9B 3B83A 3NH7L 4LPXA 5F89B 3NEOA 4JPSA 2XZQL 5C0GB 5D5MA 8FABA 4YK4C 4ZAKB 2VM4A 3N41B 3WFCL 5BV7L 3SEPA 4C47A 2WQUA 3O6FD 1LP9E 1QFUL 2PCFB 1H5BB 1JZGA 4NQXB 4HKXA 1QAWA 3DVFA 1C9SA 1KACB 4PGZA 1YZZA 3DC0A 4DZBA 5F7NC 4WUKH 4MX7B 1INDH 5BUPA 4ONFH 2ICES 4JANB 1FYTD 2RR3A 3FT3B 5DFWH 1OAKL 2NR6A 5CZVL 5DEJA 5ISZA 2FX8L 2EDJA 2PCYA 3NTCL 5IVZB 2JJSC 4ONHB 2J1YA 5DJAA 1QBBA 5JHMA 1PYWB 1NJ9A 4J28A 3FFCA 4RLDA 1QRND 5I0ZA 4N0UB 4Y5XB 5C9KA 4UT6H 4ADIA 4QRUB 1BCIA 1S7WB 3LMJL 4I1PA 5TDOB 3KGSA 2V9QA 4KK5D 1HE7A 3E80A 3RVUC 1KBWA 4EUPA 4HUUB 4JKKA 3UZVA 1S9WA 1NFKA 2WXMA 2WWOA 3X11A 1CI3M 4DK5A 1U92B 1NSNH 4GQZA 3KPOA 3TA3A 4ISVA 3FHEA 2EE9A 4U1JB 5CP3H 1EZLA 4FG2A 3P4MA 1EMTH 4CILA 1ETA1 3EGDA 1YEWA 4PR5A 5FO2A 4WI0A 3IMBA 2LLLA 3LOWA 5LVEA 3GDCA 3MBXL 1Z3GL 1MPAL 2VDOB 5LXGL 1FFTB 1RXLA 5IK3B 5D1ZD 3S8FB 1ZE3C 5D2LF 4ZFGH 4PJBE 3O2WH 5JPNB 5I15L 3QNXB 5L9DH 2ZOTA 4LLVA 3EGXA 4DHLA 2OXHA 4GEIA 1A1MB 2XVKA 4NSKB 2H8PA 1WT5A 1CE6A 5T1LA 4JKNA 4PRHE 3BQUB 2NQCA 1NUGA 3IDIB 4WFGE 2WXQA 4NO3B 5CSZB 3U79A 2V7HA 3PWPE 3DX6B 3I6LE 3FHQA 4Z7VF 1PS3A 3HB3C 3C6LD 1ZS2A 2Q76A 3D4YA 1QFUH 4HSQA 4QNPF 5BZDB 3OKMB 2WK2A 2W80C 5E70A 1FL6A 1HH9A 3AM8A 4I0PB 3PWPB 1SJEA 3PQYE 4C54A 2WJ7A 3N04A 5DD0L 3N1GC 4NC0B 3WD5L 4GSDH 4M7JL 1DQDL 4NGHL 4DJMA 1X9UA 3V0VA 1U3HA 4UM9D 5AYUH 3H1ZA 2O72A 3FUMA 5I6LA 1AQHA 2BJMH 2KMWA 5KJ4A 2CLVA 1YYCA 3LN5B 2X4RA 5AQ0A 1AQKL 5F1OB 2PW2A 2EIZA 1ETZB 3CE1A 3U46B 1IBYA 2B0SL 3N9GH 3MUUA 1Y0LB 3TU6A 2C9UA 4G5ZL 1BAGA 1MREL 5T3ZH 5KOVC 5J9PB 4N2MA 4PJ9C 3BSZH 4XPTL 4LAJH 5C8JB 2EUVA 4LCCB 4Y9CA 3VSTA 2NNFA 3B9DA 4K5PA 3WNOA 1BWMA 3DMMA 4FFVC 4QR7A 4GAJL 4JO3L 1YNTB 4DFIA 3QIWA 3BEVB 4F2MB 5FUOH 3VRJA 5FYLE 1NCCL 4M1CD 4N0UE 5D93B 2IGFL 5ENWB 1AD0A 4MJ5A 5C0IA 2FB4L 4JDEB 5GS0C 4F7MB 2IDTA 3FQ1A 1KLGB 2NLJB 4FNRA 1KGIA 4IIZA 1HKLL 4XMPL 1EAOA 3MTXA 1YN6B 3D87B 2FT8A 4PRDA 4UILH 1E8WA 1VAHA 1BIHA 1OPOA 1TKWA 2GFBB 1LO4L 3RWIB 4RQQB 1P5VB 4FQPA 4UT7H 2NZ9D 2D31B 2IDCA 4WVRA 2CLRB 5T3XE 3EH2A 3GI9L 4NP4L 4FFZL 1MHEB 3I2CH 5D5ME 3TZVB 5D7KD 5F97E 4A7QA 1VZIA 1SEQH 2EEFA 5I26A 2ARJQ 1OW0C 2WN2A 3ECWA 3EF4A 3RB5A 1ORQB 5IKCB 4KZDH 1ERNA 3FO1A 3L2MA 12E8L 4CN1A 1S8DB 2VUKA 1T0PB 2EEBA 3JWDL 4KAQL 2EO1A 1UD8A 2J1WA 3MX0B 2ICEB 2WXPA 3FJTA 2NQ3A 2BOCB 4F37F 5MENB 3Q8AA 4BCZA 4R5VA 3U1PA 1R24A 4JY6A 3ZE0E 2JJSA 4UIKL 2XVGA 3U4EB 1PLAA 4X4XA 1QI5A 1ZXKA 1Y18A 3BN3B 3KPLA 1YQ2A 4LAQL 1I85C 1EXUA 1P5UB 4RZCB 5D55A 1TSRA 3O3UN 4B9YA 1UXWA 3RNQB 3N43F 1Z0NA 5E4IA 4CNIA 2LE9A 5DJCA 1FZMA 1S7SA 2WWKO 4UBDD 2AQPA 1KN4H 3JVFC 3NFNB 1RUML 2CO7B 2B0SH 4FA8A 4JFEE 5LGHH 3RPKA 3ULUF 3DURA 4HDIB 1JWUB 4FA6A 2AJ3A 3PFUA 3NACL 1KTDB 3SDYH 4Z3EA 3ARGC 3FOMA 5JIKA 1H8LA 1CD1A 5TFSH 3UDWA 5I6NA 3ECUA 1TFHA 4M3HA 1SLUA 2F7QA 4YSCA 3G6JF 1KN2H 4JS7A 1S7VA 5B4MD 3ZDWA 3O11B 2R9HC 5C09E 1CF8H 5FHBH 1DCEA 3GTTA 1NLBH 2GBVA 4NO0D 2JB6B 4YBQD 3N40F 4EO5A 5TH2A 1FJ1B 4IK7A 3VFWB 4NN5C 1HXKA 3NT0A 3OZKA 2DD8H 4J8RB 3RPBA 1AQDB 1T7YA 4U4IA 2ZNXA 3QZWG 4P3DB 4ZXBD 2FR4B 2VITA 5ETUB 1K6QH 2K6YA 4HX1B 4IDLA 4M9OA 3DVIA 4XRCB 3LXCA 4AGMA 1CLOL 1CZ8H 2IIJA 1H3GA 3TZVC 4RH4A 4MAUL 3KLLA 5IVXA 4XP1H 1SFDA 1LP9A 4OLUL 4PW9A 3VACA 2VDKH 1C16B 1TEYA 1G43A 2PYEA 3JWOC 1IC7H 2IDSA 5KSUA 1IE5A 2XA8L 1BF5A 3HJEA 1II4E 2CKBB 1UCBH 5B21A 5PCYA 4AIOA 5I18H 4TUJB 1CB4A 1OANA 2AI0L 3OGCA 5A2AA 3PS6A 3MBEB 3MOBL 3L17A 2J7LA 2X89D 3T6VA 3QFJA 2YOCA 2VTFA 4MBOA 4G6JH 4JZJA 1ICTA 3C5ZC 4PS7A 2NY4C 2BINA 2JXMA 4QXWA 1CGYA 1HKFA 4LAQH 3U6XS 3RUGF 4PWEA 4MB3A 4N1EA 1M9WA 2NY4D 1EUUA 1TQBB 5I71C 1INDL 2AK4B 2MPAH 3BP6A 5B7EA 1CE6B 1SEQL 3ZQ9A 2NTFB 3OJDB 3C75A 2O4EA 1O9VA 4UAOC 2OMZB 3GRWL 1VADB