5AOMA

Structure of the p53 cancer mutant y220c with bound small molecule phikan883
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Exploiting Transient Protein States for the Design of Small-Molecule Stabilizers of Mutant P53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 49
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5aomA00
4L18A 2IOMA 1TSRA 1IO4C 4L0YA 1EAOA 2BIMA 4GUQA 3QYMA 4A63A 4QO1B 5ABAA 3VD2A 2J6WA 2IOOA 3ZMEA 4AGNA 2XWRA 3D09A 2GEQA 2J21A 3Q05A 4IJTA 1GZHA 4IBSA 3WTXA 1T4WA 5A7BA 3D06A 2H1LM 3KMDA 5AB9A 5LGYA 2XWCA 1HJCA 3D0AA 4MZRA 3IGLA 4IBWA 1E50A 4AGOA 3Q06A 4HJEA 2X0UA 1TUPA 5AOJA 4G83A 2WGXA 2BINA 3EXLA 2BIQA 5AOKA 5AOIA 2OCJA 4AGLA 2MEJB 4LOFA 2J1YA 3KZ8A 4IBTA 1UOLA 5G4OA 3QYNA 5AOMA 4G82A 1EANA 2J1WA 4AGQA 4IBVA 2J1ZA 2BIPA 3Q01A 2BIOA 5LAPA 4IBYA 4IBUA 3TS8A 3WU1A 1EAQA 1H9DA 4KVPA 5G4MA 3VD0A 2X0VA 1YCSA 1CO1A 1HJBC 3US1A 3WTYA 3WTSA 2J20A 3WTTA 5BUAA 2X0WA 2P52A 3WTVA 5AOLA 5KBDA 2PCXA 3VD1A 2YBGA 1GZHC 2IOIA 1HU8A 2ATAA 1KZYA 2J1XA 5ECGA 4IBQA 3IGKA 4L0ZA 4AGPA 4MZIA 1CMOA 4LOEA 2RMNA 3WTUA 2FEJA 2ADYA 1LJMA 3D07A 4IBZA 4XR8C 3WTWA 4GUOA 3D05A 3D08A 5G4NA 2AC0A 3US0A 2AHIA 2VUKA 4AGMA 4LO9A 3EXJA
chains in the Genus database with same CATH superfamily
2Y1YA 5C09E 2ZP0T 1BEYL 3PCYA 4JZOB 4JMXA 1R3KB 2UXGA 3BDXA 3IMSA 4HJ0D 2WM0A 1KACB 1KPUA 5F7KC 4N0RA 3T2PA 2XNAB 3T3PE 4MHHG 3RVXC 1ITBB 3NJNA 1ND0B 1S7VA 4WKXA 3W9EA 3S8FB 3TO4C 1CE6B 1C5DA 1WBYB 2F08A 4NC2B 4OSUL 5C08A 4PJ5A 3PDOA 3GBEA 1I8LC 4I2XB 3W11C 1JHLH 4ELME 2PF6A 2VQTA 2UUDK 1IB5A 1IGTA 2OJZL 2UZYB 4MMXB 3LKRB 3EJQA 5D7JC 2F1BA 5AUMA 4HS8L 3AGWA 3D2UB 3VGBA 5EC1B 4JN2B 4HJEA 1S4IA 3SE8L 3Q3GA 1T03L 1I7RB 2NPLX 1HKLH 3O6LL 4TSAL 4W9EC 5IOPA 4P3WA 4B9JA 1YQVH 3O3AA 3WE6A 3EAKA 5HI3C 2VL4A 5ITFB 2EDWA 4P9HC 4U05A 2MKLC 3DHJA 4HXBL 3BIKA 3QDGA 3N85L 4IRSA 4O00A 4HOXA 4F2EA 4HX1A 2BNRB 3IDNB 3IRPX 5HHQB 1KGJA 2YAPA 3O4OC 3VD7A 3CU1A 5KVGE 1J8KA 3DO4A 4X5WA 5HHNA 1CLYH 5KVEE 3KCWA 1RPKA 4CBPA 5B4MD 1ETB1 3S3CB 2X2HA 3UPCA 4L29B 5FDWB 1CD9B 1R3HA 3Q0HA 3HC0B 3RL2A 2NZ9C 1QR1B 4IHOA 2DQGL 3LKSB 4N3UA 5J9PA 2AGJL 3BP5B 1PKQA 1PBYA 2EC9T 2LOEA 4HYTB 3KH4A 2IOIA 5IVXF 4OGXL 5F7YC 3I9GH 4KGLA 3MV9B 2YD3A 4BFFA 3ZZQA 5AB2A 1DBMH 3NSCA 3CZFA 1ZLVK 4M8VA 5DURD 4GAJL 5TF1L 1OY3B 3NABH 4I0PB 1ACYL 3LXBA 3KLHC 4M6MH 4JAMB 1XR9A 4D8PB 2IAMD 1Y18B 2WMPA 2VDNB 2VZUA 3E7JA 2X70A 4LP8A 1FNAA 5I0XA 5TDOB 4GQQA 4LPUA 1UB5B 4WAFA 4HGWA 2Q3XA 5IJBC 2Z0UA 5F72S 4AYDC 5CSZB 5C07D 1YN6A 5DMKB 4QAWA 3NSYA 4L4TE 4OM1L 1SVBA 2P5WE 1X5YA 4AENB 2UZXB 3V79C 4JRXB 1ZT1A 2AK4D 3P77A 4QHNB 3K2KA 3V6OA 1FVEA 1MCRA 4XB3A 3W9DA 3D2TA 3DHMA 4NSKB 1U95B 3FHQA 3CD4A 1WZ1H 5HHXL 4ZMVA 3QEQA 2G0LA 1IKNC 3PV6B 1KCVL 3CZNA 2VH5L 2HFTA 2KMWA 2N01B 3HVNA 3PWVB 2QKIA 4WEEA 5J6GB 2O6FA 4C4KT 4HJTA 5E9AA 1NCWL 2JSFA 2R0ZL 3CDCA 4PRPB 3VMNA 2LFGA 4OZFB 2XG4B 3OR6B 1T4WA 2ZOLA 3FQWA 1DQMH 3OAUL 3V4UH 5CCKL 4JFFE 4AG4L 1S8DA 3CFCH 3VXQB 5A6LA 3RPBA 2DWTA 3NYKA 1Z5LA 1YSOA 4KK8D 1W8OA 4YN3A 1MY5A 1IGCL 3QDMB 2Z7YA 2XY1A 4BZYA 1MJ7L 1OE1A 3D39B 2Z35A 1DSWA 2O93L 5C0DA 2CCVA 3H7BB 2WB1A 4Z3IA 1LD9B 4UM9A 3DX7B 4ZUTA 3KWXA 5DWUH 5DS1A 3TA3D 5C9KA 4QLWA 4U2ZA 3PABB 1OLZA 4GXVL 4IMLA 3F6JA 1NCOA 1SY6A 3SE3C 4FXGA 4BZ2H 2ADFH 4ZPTA 3GMMA 4P9ML 4PJFB 1IFHH 1IL1A 1L3WA 2AK1L 3CFKB 4LRIA 4UT9L 4N2BA 2XN9E 4S2SB 1LNUB 1GZPA 3WNNA 2OL3H 1WZLA 2EP6A 3WTSA 3ALXA 4P57A 1CF1A 1K5NB 3DECA 3VGFA 2YPLA 5AKVA 3LRSB 3DYMA 3OHMB 2WINA 1WCBB 4R26H 3RI5K 2B3IA 5I74C 1S78D 4IKJA 1CXEA 1DL7L 1QPXA 3TEYA 3CLFH 3PRZA 3UYPB 1NFIB 3GXUB 4G6JH 4TMPA 4JY4A 3PWNA 3B5GA 3Q8BA 3QO0B 3SGEI 1SJMA 2DWSA 3DETC 4F9LA 1V3LA 1I1CA 2R1WB 2G60L 3LEYL 1NICA 4NO2A 1WV7T 4FNUA 1MVYA 5I1CH 4WSKA 3ZU8A 2NY6B 3PFUA 3MLXL 1TMQA 1SF5A 2R56L 3KPMB 1DUYB 1E4JA 1T66D 2B39A 3L7EA 1V10A 1KJVA 2GSMB 4HIQA 5DVPA 4ATWA 1P7BA 4LCCB 3K81A 1MF2L 1OT1A 4NENB 5K9KB 5G4NA 3RVTC 5BQ7B 1YUKB 5CJBA 3MV8D 4L1HA 3QIWB 1QW8A 1UQSB 4EI0A 1HDMA 4G8GB 1A4JB 1E5BA 2VISA 5BZWA 3CLEL 5ITBH 1GGIL 2CRZA 4MFHA 5F1IB 1F3DJ 1RZ8B 1SF3A 1P5UC 5JOFB 4JDVA 3V5HA 1FYTE 4XXWC 4GW1B 4JB9H 5C0CE 4LEOA 3N1MC 3VB8A 3MRGB 1RUPH 1ZXQA 2YEVB 1EERB 4JREC 5JUEH 3NQKA 4LLYA 4PB0L 4JFVA 4X4XA 1F00I 4LFHG 1JZJA 1A21A 4P9HH 4U0QB 1JNLL 3ULUD 4X4ZA 3IE9A 2NX5B 4WEUD 1XH0A 4QOKD 3HE6B 5EORL 2Q86B 3SCMD 3WEXA 5BO0D 5IGXL 4OV5B 2FCBA 3D9AH 4KK5C 1OVZA 3V8OA 4FFYH 5EV7A 3V4PH 3WNIA 1AG6A 3UERA 2IFFL 2HKFH 3D4ZA 3X3FL 1BIIA 5KSVA 3T0EA 3T4AC 3P3YA 1LE5A 5GZOC 4S1DD 3TT1L 4YDIH 2MNWA 3GBMH 4ABVA 3UEZA 1U30A 1NCBH 1KBBA 2XU9A 2COVD 3NCEB 3DA0A 3U30C 4GKOA 2CAKA 4ZX3A 4MJ2A 3V4LA 2WN2A 1HQ4B 5GGTL 3LS4H 3T0BA 4XPFL 2WWNA 4HU2A 4JANA 3NIFB 5EU6E 4HIHB 4HH9A 1LGVA 3OLIA 3P0YL 1SXAA 4ECNA 4C54A 4X7SH 5BV7B 4ENZA 1XGRB 3R4RA 4R4NC 4Z9KB 1WYJA 4PTUB 5C1MB 3WTTA 1BVNT 4ELKA 4PY7B 3WJLC 1VJSA 1BX2A 5TE4H 5E1GA 4EDXB 4QRFA 4JQIH 2EE6A 4YHLH 3PWPD 2ZUYA 4MDJA 3S4SA 5BMFL 1M6OA 1JVLA 3QQDB 2CHNA 1AXSA 5J3HD 2DD8H 2QVKA 1XV8A 3ELAT 2ZD0A 5JPNC 3NA9H 1NMCB 2FJSA 4ZTOL 2E47A 3DPDA 5PAZA 2JELH 4KKBD 4PB9H 2VB5A 4WTQA 3MBEC 4FTVE 2JB5H 3B3IA 1XGYH 3GLZA 2R7EA 3P4NB 4UINL 4LPTA 3LDBB 4JW3A 3B6SA 4NO5A 5AYTA 3JWOL 3QGVA 4OZIF 3P4MA 4JVPA 1EV2E 3PWJA 1FG2B 3JT0A 4HJGA 2A0LC 4AGMA 2OYKA 3MRNB 2PKDA 1OPGH 1D5RA 3O9WA 5AW2B 4MDIB 5DUBA 1A7QL 1G4MA 3QJRB 3TNNA 3TPKA 2WTRB 3SKMB 4KK6C 1NC4D 3MA9H 4GG8A 1A7OH 2WZPA 1TJMA 4K7PY 5DJAB 3BKYL 4ONGL 1IM3D 2HVBA 3DSNA 3L7FA 4P5MA 4R7NA 5F8RC 2X89A 2EDOA 4IJTA 5GXBB 4AQZA 5D7IB 1Z0MA 3MCG1 3IK2A 4WFEE 2FJHB 1F58H 2HT3D 3LKQB 3OG4B 4YZFF 5DU7A 5FFGA 1NAKH 1NMAL 4R5XA 5FM5M 1K3IA 3D1MC 4MJ4A 3ARYA 3AU1B 5CWSA 3VWJB 5J6HA 5E5UB 5F0MB 1UGKA 4M1DH 4XP4L 2P9RA 5F6IC 3IJSB 2FGWH 3MC0A 4J4PA 3O6KL 2PUQT 4LRNL 4PJDE 3KPOB 5CIPB 3IMBA 1NBVL 3U82B 1T2JA 4FQ1L 2OMYB 4J3VA 1MHCA 3F00A 3AM8C 3VD5A 1NCAH 1U8QB 2V7HA 3UTQB 1UASA 4TLUA 4NGHL 4XMKL 1MCNA 3UJTL 5G4MA 2WXPA 4BKLB 3ZIYA 1GHFH 4MCZA 3OKDB 5L0QB 2Q7AA 4I85A 3WENA 4RWYL 3RIFF 4JY6B 2CXGA 1KTLB 2LE9A 2AP2A 4X5RA 6FABH 3IFOB 4XO4A 3QB7C 3GSOA 5H94A 3WJJA 5A3ID 5J7CC 2J20A 3ARGD 3VFNA 5KYYB 3MRHB 3T3PF 1PSKL 1TVHA 2FO4B 4KTDH 4DSYA 4ODSH 1UZ8A 2AXFB 4NHCH 4OF6A 1CVSC 3FT4B 4OQTH 1ZVNA 4FXKB 2H3KA 4KKAD 1T4KA 4G9DB 4J23A 4JHVA 5AL0A 5T1DH 4FLSA 4BFJA 2FYYB 4TQPA 4ELMF 5T3XE 4ZMYA 5DEFA 4R3SB 3MJ9A 4IEFB 3FYIB 4OZ4A 1VFAB 4TSCL 4MYPA 3KWUA 3FOLA 3LIZH 3BVUA 4HH8A 3C8KB 4MCYA 3DJZA 1HCVA 1JYXA 3V0WH 2C34A 3BP6B 4GRWB 4QCIB 1M2VB 3L3IA 1UC6A 3AWFA 1MFEL 2VDNL 1RP8A 2WBJA 3DURB 3KXFE 4OZGB 4OKDA 4YDVA 1ZDQA 3ARDD 5AZEL 4KK9C 3DXAE 5IHLB 1A6VH 1IAOA 2J43A 4ZOBA 1UOWA 1JGEB 2P44B 4Z95H 2G2RB 4P0DA 1N70A 1DEDA 2W9DH 4KI5D 4KQ4H 2Q6WA 3S97C 2VWEE 1B9KA 4YHPB 1DJHA 1MRCL 2EZ0C 4MJJA 5C0BA 2HRPL 3EOAB 4OW6A 3NJFA 4TTDC 3KNBB 2H2SD 3H56A 2O61A 4PH8A 1KGCD 3MLTA 3VD4A 3UZEA 4MTMA 2WUBL 3EJUA 4ORGA 5E8DL 5HYQA 2C3XA 2N7BA 1OCWH 1IC1A 2AITA 1PLGH 5AAMC 2AXWA 4XMLH 2ZUSA 3DHPA 2Y6SD 2YN5A 1VZGA 2GIMA 3WIFA 3AACA 2CGYA 5KOMC 4P2QA 5GJTL 1QSVA 2F19L 3QRGL 1S46A 1SYVB 4HSCX 5IQLA 2XTJC 2H0FA 3UH8A 3OAYK 1MFAL 4ISVB 2BY3A 1B4JL 3OTTA 4NPYA 2Q7YB 5ISZD 4NWTL 4AITA 1YJDC 2WLIB 2W65B 1ZHLA 3TASA 2YPKA 2VRAA 2F7IA 2XKSA 4GAGH 5I8EA 1FDLL 3SDAB 3GI9H 4YNYA 3DYPA 3PHQB 3I3DA 4AVJA 1NEUA 1ORSB 5E4OA 3L4CA 1LK2B 5D1QD 3UP1A 2FX7L 2YPVA 1AR1D 2XPGA 3PIQA 3QXWA 1MHHA 2CH8A 4QXTB 1LEKA 1CGSL 4XXCA 1RJZA 2F5BH 3GB7B 3VRIA 3W0WD 1T1XA 1SXSA 4OUOA 1GYAA 3KZ8A 3BWUF 3DJSA 3OZKA 4Y19E 5E9NA 2VDOB 2R4SL 2GBVA 3Q01A 1EHNA 2FE0A 1LXMA 4X9BA 4OZFG 2K6ZA 4LPCA 3I6GB 1RUAH 2ZE0A 2G5BB 2E8ZA 1T1WA 5IWLA 3GTVA 4F24A 3TF7C 4DK6A 4EEEA 2ZWSA 3FO9B 1FFNB 4HPHA 3FFDA 4BSVA 2ZOKB 4JFDD 5AVVB 2HG0A 4Y9CA 4Q8BA 5KBNC 4DVBB 1LP9F 4FQQB 1U8PB 3BEVB 3O3BA 4FI7A 1G7IA 3DVGA 3L81A 1J1OH 1F02I 3QJVB 4N1CA 1AE6H 1FIGL 2VZ1A 1O5PA 2C3WA 1FGVH 3PU7A 4UT7H 3L95A 1E30A 4PD4J 4DW2H 3GRWH 4G5ZH 4FG2A 3IFNH 5TQ0H 5AG8A 1KIPA 1YEFL 1MI5B 3O6MH 1Q94B 5FPIA 4GKSB 1I7ZB 3IGKA 1GAFL 2DEWX 5BXFB 4K8RH 5IBTH 4LU5L 1IAIH 3OWEA 4MZIA 4NO0A 1BZQK 2AFNA 1K85A 3V0AC 4PYHA 2Y9RT 1XCQB 4APQB 1DP0A 1MLBA 1SLXA 5B7MA 4GMTH 1CI3M 1ZE3C 3CSPA 3LPGA 4E42B 5B8CC 4X8JB 3IJHB 3TNMB 5GRWA 1AP2B 1YEEH 5DK0A 2Y2YA 4CDGC 1XB3A 4UWQB 2X3CA 3EZ8A 1KLFB 2JKLA 1FNEB 4N6RB 1YNTF 1BVKB 1TLKA 2E9JA 3ULVL 1DSYA 2B2XH 1MAMH 1TQBB 1GZQB 2NY0C 2VR9A 3M45A 1GY1A 3LNEA 1TXKA 3PGCB 2AJXH 4JFOA 1D9KC 2YA1A 4JO1L 4F3FA 1FNSH 3AB0B 2ED8A 1RZKL 1DEEA 1D3CA 1OP3K 4YBLC 1VGKB 3WUWB 5IVZA 1W6LA 4Z77A 4XN1A 4POYA 1W72H 2RHEA 1C08A 4OZHA 2APFA 4M7ZB 2DLTA 4X4ME 1LK3L 3OKLB 4LIQH 5EU5B 3EOBA 1L0PA 5A7BA 1GS7A 2IAMA 3N43B 4GW5A 4I5BA 3WV0A 1PFCA 2I9LB 3BSZH 4L8SA 4OJFH 5TPWL 1DBJL 3UAAA 2NXYB 1GYUA 2DLFH 1PIFA 5T33H 1F56A 3BISA 2WO3B 1BQHA 2XX0A 4DN3H 4NQDE 5HPMB 5BS0D 5DZAA 3AREC 4R96A 5C07A 4W9GC 3L5XH 4XCFL 2J8HA 4Y5VA 3S9DB 1XH1A 2I07B 2ZP8A 5C0GA 5C0IB 1SVCP 1X9LA 4MNQD 5ILTL 3HCVA 1Y7VA 3LXAA 1WWWX 2HVJA 1P84K 1U3NA 4M8QA 4MAYC 1HCYA 3ME0B 1HNFA 3E8UH 3L3JB 4ES9A 4TTGA 4HWEL 3GSNB 2X1WL 2JJSC 4CU6A 2B7DT 5E99H 5G5DA 3ECQA 4FMVA 5F9JB 5AYQA 1J5IA 1BOGB 3NN8A 1ZOXA 4D7BA 3JZYA 2QSTA 3OAWA 3HR6A 3LEXA 4WSGA 5IB3B 3GXFA 1DDTA 2FECI 2QGBA 4GBXD 5F9OL 1Z9MA 2P8MB 4HK3J 3UXFA 3UABA 4J3XA 3O0LA 3ARBA 5AVZB 4AQ1A 1RHHA 2AEQL 5GIRB 5KYWA 1KZYA 3KL0A 4F8LA 3KLDA 1L4IA 1SXNA 4KJWD 5HGAA 1LVEA 1LTXA 4JQXA 3VI4A 1AO7D 2AEPH 1XH3B 4BFKA 1KZQA 3VYOA 4A37A 4AIOA 1C12B 1RK1B 1N64H 3NRPA 3WO3B 4U6VH 2DBLH 4YMPA 1QPKA 1Z3RA 4ZYKB 1VADA 4N0CD 1NFKA 1BFVL 3SB3A 2G3XA 4I4WA 5GJSL 5I28A 4XNZB 3V6BR 4Q9RL 3NDYE 3BGMB 3Q2WA 3TA3A 4Z23A 4XVJH 4PLOB 2GVYA 2V9UA 4J8RB 5KSAC 4UTBL 3QPQD 3V8CA 4GO9A 1ERNA 2VABA 1KJMA 1EPFA 2J6EL 4OLXL 4HIEB 3OKMB 1I1YB 3GI8H 3RWGA 4GUCA 1CF8L 1M1SA 1XT5A 2R15A 3UC0H 3QUXB 3WFBH 1I4FA 3SO3B 2NSMA 3AW5A 5DA0B 2JFCA 4XMXA 3P3UA 1E5CA 2ITFA 3UBXA 3D2UD 2AJZA 5DO2D 3JBG7 4YQXL 1MFBL 3PHOA 2HA1A 1L0XA 1DVFB 4XO3A 3N9GH 3U4AA 5L88H 3AQZA 3SDDB 3HI5H 4OVUA 3DMMB 3X1FA 1NTDA 1XTMA 2R1YA 3U6XS 32C2A 4K7PX 5TFSH 1I3RB 1KBGL 3ZRFC 1C1EL 4ODXB 3EFOB 4EI6B 5C6WH 1S7RB 2E4FA 3G7TA 2QQKL 4X6CE 5D7LD 4UQ3B 3DX6A 5D2LA 5E2VH 3X11A 3AQXA 1VGEL 1CDGA 3RJOA 1UZGA 4XNMB 2O5ZL 1RH8A 3MV8A 2GBUA 5FO7A 1JHKH 3X17A 4YBHA 4ENED 3L1EA 2J1YA 2CO3A 3OXSB 5I19H 1CE1L 1GCYA 3OD3A 4Z78B 2UYLA 4U1JB 2AEWA 2GKIA 2HRGA 3MZGB 5CNHA 1P5VA 2E7DA 5JHBA 2YRLA 4I1RA 1JYWA 3MV9D 3LRLA 2FWOA 4FABH 4ICXA 1BHGA 2JKRM 2R0WL 3UO1H 5IJKC 3GSQA 1IGYA 1F6LL 3QUYB 1GGBH 4XP5H 5EPMA 3W81A 3AT8A 3G6JB 3RIAF 5HDBB 5IW1A 3TTSA 1AGFB 4CJ1A 1UWFA 4YC2B 2NW3B 4QOKA 3UTPD 4JPIB 3PG2A 4HULB 1SBBA 4ZXBB 1HZLA 1ZPUA 4EQ2A 4JJHA 4LQFL 3KM1A 4A6YA 2PNDA 2LT9A 4LEBA 3LIZA 1A2YB 4FYTA 1JI2A 4JFYA 3V6OC 5LAXB 2UWEE 4JRXD 3BLKA 2FSEA 1QI4A 2B8OT 1GJWA 1J1PH 3LD8C 4G1MB 1A3QA 1I82A 2F5AL 5GGQL 4J39A 5DFAA 4A7GA 4WI8A 4X6BB 1KELH 1X9UA 2QKIC 3MJ6A 3OPUA 4TUKH 2AXJA 3NIDB 4ZD3L 3T04D 5CEXA 3UPRA 3P1VA 3F7QA 4GEIA 2YOAA 2XDHA 3VB9A 4AEHL 4ETQB 3BUPA 2CLVB 5F3BB 2YD2A 1TZGL 1YNKH 2MIZA 3P9LB 3MXVH 3G6AB 4PJDF 4XMZA 1FORL 4P3CL 5F7DB 2HX7A 2IGLA 5D6DA 1TVDA 4DGVH 1PX3A 4NO3A 3AUWB 4LESA 4C56E 1Q38A 5I16B 4RMVA 4WHTA 3ZMEA 3MKGA 1OL0A 3TJEL 2JJVA 3PWPA 3K7UA 1RJLB 4UNTA 5F89A 2VN7A 4KO9A 3QDMD 1IBBA 4PV8A 3D39D 1PZ5B 4W6WB 3P30L 4LLVA 4IDLA 3ETBF 3DDFA 1FLRL 4G1EA 4OGQC 5IQ9A 5IFAL 4FXGC 1BQUA 1MFCH 2E75C 4KVCL 3TCLA 1G7LB 2ERJC 2XRAL 1MCJA 5IZ7A 2DTML 1GYWA 4H1LB 1HILA 3NH7L 3WY2A 3U9UB 4NJAH 3WNOA 5C9JA 4QXGH 2CNYA 3OB0K 4RBPH 4WFFE 5SWZE 2V2WA 2YLHA 4A7TA 4D9RE 2CKBH 2EYSB 2ZX9A 4P4KC 4M3JA 1JD9A 4O9HH 1UXMA 5KANI 2BSTB 2AJSL 1HWWA 5J1AA 2UZIH 3QULB 2NNRA 2AQSA 2HLAB 3OAZK 2RJMA 2WTPA 1TZAA 2VAAB 3KW8A 5EWIH 3O8XB 2O5XH 3HJ0A 1A0QH 3FFCD 4J2QA 3WIIL 1XF4A 1YRKA 5KVFH 2QPEB 2DMBA 3D25B 3HVDA 2V3FA 1W8NA 4FP8L 1NC4A 4F9LC 5L9DH 4UAOC 1N18A 1HHHB 4GS7B 4KKCC 5CD5D 1JGDB 1OZUA 2Z8RA 5I1DB 1IM3A 3SKOA 3KVPA 4QY8B 1A3ZA 2OSYA 1CL7L 1O7DC 3QQ3A 2RD0A 3H9HB 4LKXB 3U46B 3HZ3A 1P2CA 4BQ8A 1OSEA 2D7TH 3BCFA 4WUUB 1U3HB 2NY6D 3S3JA 3FF7A 3X1EA 1OM9A 3AS3A 3NFPA 1ACCA 2BVTA 3CIQA 1RIUL 2IANB 3O2VL 3IU3A 4RFNB 1YLBB 3MREA 4TOYH 1BGXL 3QIWD 4JFUA 4MHHI 1KCUH 3F84A 2VZVA 3HUJE 1T83A 3BSHA 4G8GD 4LPWA 4O4YH 3S36X 2CO1A 5D7SL 1BECA 3W57A 2ICEA 2OFQA 4K0OA 3ULVD 5HVHC 4NJ9L 3V6FB 1J0YA 5HDQH 5IEHB 3O3DA 4K4KA 5F7EH 3X13A 1MEXL 1XGQA 3Q5TA 1LDSA 4QTHA 5GGSA 2WY3B 1MJ8H 1NCTA 3VVWA 4BSWA 3C5ZB 1QBML 3K3QA 1AC6A 1RZJL 4DP0X 1LO2L 2CMRL 1MH5A 4FQCH 3II3A 1TTAA 1CYGA 1H9VA 4KJYB 4LASH 4UV7L 2NX5D 2VXTL 4M6NL 2V5TA 1EEZB 3M1BB 4LSQH 3VE0B 1YEIH 3NCMA 1URIA 5AW8B 3VD2A 1DDHB 3HMWH 4OIBA 2NW2B 1IE4A 1YG9A 3S96B 5JLZB 5CZXC 3T0EC 3K5SA 1DQDL 2A74B 3CTTA 2VLKE 3LQAL 1VEMA 4KFMA 4RRPM 1WD8A 3H3KA 4ATTA 1U91A 3HRZB 1K2DA 4PI2A 3LQMA 5EO0A 4ODVH 3PXHA 2W07A 3AUVA 1N12A 5LXVA 4IBWA 3ARDA 1E2VA 4GT0A 4X99A 5DUML 4MA3B 2PCFB 4XAKE 3DUSB 4W9ZA 3NZ8A 3QNZA 2D3NA 3ECVA 3X1NA 3MUHL 5DJCA 5HXMA 2A73A 1XCTA 1CFVH 1ZSDB 3Q6GL 3WUWG 1IAII 4AH2B 3DUUA 1EZVY 1BYOA 1Z3GL 3ML9A 4MWFB 4AI7A 4CSTA 3GSNL 2JJUA 1QSFB 3N1PC 4X9HA 4OGYH 4OLUL 3VG9C 5ADPH 4U6HA 1UJ3C 3DV6B 2XVLA 3C5XA 2JIXD 1OF0A 2Y7QB 3UJJH 3A4EA 5JQ6H 4I77L 4PJBE 1RZFL 5ISZA 3MUGB 5I1LB 4F7EA 1KPVA 3FPXA 3WFDH 4TPRH 3EYSH 4J6RL 2Z4QA 3VFPA 4JR9H 2BS71 3UDWA 1MQKH 2E7LA 3BSGA 3R19A 4YSOA 4XP6L 1HQRB 1SJHB 2NY3C 3KBEA 4PG2A 3WTUA 4UT9A 3W0WA 3KPSB 3TWYA 2J8UB 4LXFA 5KS9B 3GZQA 3HTLX 4C55A 2XG5B 4R2GC 1AFVL 3EADA 1YQ2A 4Y5YC 2JCCA 1S9WA 1PD6A 1H6FA 1QOKA 3II2A 4PGZA 2VUOA 3VCLB 2YAEA 1X9QA 2X4OB 5IP4A 5FGRA 4JFDA 2BRRH 4GXFA 4ZUVB 1LL1A 5JA8B 1EAOA 2DLGA 3S5YA 5IB4A 1SOKA 2O30A 5CLZA 1NFDA 2FTAA 4K7PH 5E6IB 5I8KL 5BO1L 4J5VA 4PR5B 2CR0A 2DWDA 4AUYA 2P8PB 3T2NH 5E70A 2HX9A 3CBRA 3SDXA 2D7OA 2RCSH 5DTFB 1ZHKB 2CO4A 1IQWL 1MCBA 2ZXBA 3NT0A 4W68A 1JV5B 4XAWL 4YWGH 1JGUH 1F97A 2J56A 3HBQA 4G5AA 1WA2X 5KZCB 5CEZE 2Z93B 3L9EA 3PWLA 4J4PC 3U9PH 5I1JH 1JZ8A 2KL6A 1M3JA 4OF7A 3RURA 5LJYH 3LKPB 4PHZA 3ES6A 4GI9A 2CALA 3QQ9C 4LSPL 3EO9H 1ID2A 5E00A 5FGSA 1AYOA 4F8NA 1WAEA 5JXED 2P5ED 1A6ZB 4J3OG 1I3GL 3RVWD 4EJ1C 1RZ7H 2E56A 2WCGA 3WJJC 1PD1A 4JZJC 4NAMA 1A1NA 3FCUB 3FQRA 3ECWA 3GMLB 5DQJA 3S6CA 1PZUB 5C8JB 2AEIT 3QORC 4ONFL 3QO1A 5C0EB 2N7SA 1MCDA 2AAVA 1DQJA 4D94A 1OTTC 2FIKA 1MWAH 3FCTA 4WWKB 4PRAB 2QHRH 2AI0H 4IBLT 2PXYA 3I75B 3MLUL 3AGVA 1YN7B 3DRTA 3K0YA 1M7DA 3QA3A 3GTTA 4KHXH 1U8NB 4OFVA 5FYKE 1LMKA 1KWGA 5EUKB 5BVJA 4Z8FL 2EH7H 1CT8B 4O58L 5MI0B 2ADJB 3H6AA 3BDBA 1ZVYA 3US1A 2WBJC 3BHBA 2LV4A 4XHJD 1I1FA 1XD0A 4NC0B 1QSEB 3J2PA 1B3IA 1F90L 5KUKA 2VLRB 4B41A 1U8MA 1YY8B 3IXTB 2VO8A 1IAKA 1OCRB 4OV6F 2VIRB 4N2EA 2DJMA 3ZR6A 5GGTA 4WZ9A 1JFQH 4L0ZA 1PY0A 5BS0A 4HUWA 5ACMA 4YAQB 3Q6FA 3UZEC 1I3UA 1HAWA 3ARWA 3QC5X 3CK0H 2GSGA 3IKCA 4MNQA 3CMGA 2ADGA 3QZMA 4G9FE 4X6CF 3HBGA 2J4WH 4QXUH 1A22B 5FKAB 2YGOA 1OO2A 3CZJA 2EILB 3M7FB 4HWNA 3HBZA 4JM0A 4JO4H 3VXNB 1OTSC 4E41D 5BV7H 4PJGF 4NKMB 1SXBA 2W94A 4D0DB 2EIDA 1N59B 4OD2B 3S35X 1LO5B 1W6WA 4KDWA 4WV1C 3CFQA 1YMHA 2ENJA 4MS8D 2HAZA 3CC1A 2EXYC 2TSAA 2YBRA 4ZPVB 3UTTA 4LO9A 2D73A 4PRBA 4XOAA 3HHSB 5C7XL 1WGOA 4QGYA 3OC8A 3VMOA 5GHWH 4E68A 4H8WL 2DQCH 4FJ6A 4GBXA 4XNBA 3MCLL 3GMOB 4I0KA 3SE4A 5LQBL 3H4HA 4PJEE 3SDAD 4WQOA 3B8SA 3P4OA 4JRYD 2P28B 2DWYA 4B27A 6PAZA 3B5HA 3X1BA 1T1YB 1F4WH 4XXCC 3PDDA 2GEQA 5E8PA 1KFGA 4MB5A 3ARFB 2IXQA 4XPAH 2A6IA 1AO7A 2CLRA 1CU4H 2V33A 3PQYB 1I9RL 4E36A 2XBDA 3IWVA 4HJ0C 5D9SB 4JHWL 2E27H 4E9LA 1YDPA 2WAHA 3IXAB 4JZOA 1R3KA 3CVHB 5LBSL 5D71L 2KZKA 5IWLC 3VXOB 1H8SA 4HHWA 4IS6B 3RB7A 1YEGL 2UWEF 4U4BA 4MBOA 4P2RE 3B2XA 1RVFH 1MRFL 6CGTA 3OLEA 1CE6A 1NA8A 1A1MB 3GIZL 1WBYA 4ZAKB 5IMMB 2ARJB 2OXHB 3W37A 4IBTA 1TPXC 1KDIA 4I2XA 5HY9B 3IAGC 2AJ3B 3VWKB 3W1ZA 2FH8A 2UZYA 3LKRA 4PD4K 1PYWB 3UTZB 4WF7A 3KEHA 1NLBL 1TJIL 2Y7OA 4X6EB 3UYRH 3D2UA 3ASWA 2ZXCA 5EC1A 4JN2A 4W81A 1GR7A 3IE4A 2VDRL 4HBCL 5BCAA 1I7RA 4NUGH 1JK9A 1V3JA 4H1LG 1UM5L 3GSRB 3EFDL 4PY8J 3HN8A 4BZ1H 2ENQA 2J57A 4Q9QL 4O51B 1N2RA 1FZMB 2FT7A 5C0FB 4HCIA 3O6FD 3S36H 5ITFA 5KTEH 1TJGL 4U1HA 4APQD 1YMME 5DC0A 4HMDA 1FN4B 3FTUA 3HIZA 1V5JA 3V9CA 4R90L 4XMPL 2P80D 3O11A 3FJTA 4X0KB 4U1IB 5D7LA 1Q4NX 3DARA 5HHQA 2BNRA 3IDNA 5I71B 1D7FA 5CIPH 1DLHB 3NSXA 4FYQA 2MFNA 5B4MC 3NAAL 3ILPB 4ZFQA 4PGCB 1EGJH 4X42A 5DT1H 2AERT 2LHAA 5IHUH 1KENL 1X5AA 4U7SA 3ISWA 2E7CA 12E8L 1XQ4A 2NZIA 3HC0A 5IVXB 4M8RA 1QR1A 4YZWA 5JW4M 3BP5A 4DUWA 1JZIA 3I84A 1HZHL 1Q72L 3MV9A 6PCYA 3X12A 1NKRA 3NRFA 2EDTA 4F92B 1WO2A 5MHSD 2IAMC 2VJ0A 4I89A 4L8SC 4C47A 2R0KL 2NUTA 4I0PA 3TBVB 1JHTB 4D8PA 4JAMA 2YMXH 2HKHL 1OAUH 4JVUA 4F80A 3U36B 4GT7A 3MNWA 1Y18A 1FH5H 2NXYD 4GRWH 1HXYB 5TDOA 1UB5A 1OT2A 3VFWB 4E9SA 4AV4A 1ET5A 3GF8A 4S1RH 4WU5A 1ODAA 2NTFB 4GIOA 2YGNA 4OJEH 4LBEA 5DMKA 2Q8AH 4NZFA 4OF8A 4YGVB 4K5LA 2Y1VA 5JXAL 4AENA 2UZXA 2QADB 2JKXA 4JRXA 3WSQL 4N3TA 1OP5K 1XZ0B 2ZYSA 3PHSA 4NEHB 1USZA 3G5ZB 2R2EB 3LB6D 1JGVL 4KQ3H 5IMKA 4X4YA 3OLDA 3WKMH 3VXSB 2HJLB 4NSKA 1T22B 2WVTA 3APCA 3NACH 5E5MB 5I18L 3HUJF 3ZGIA 4DP4X 2FIRT 1G6VK 5A16B 3PV6A 5C3IA 5E1QA 1GS6X 3ZJAA 3PWVA 5J6GA 1Z9SB 4Y4HD 4AQ1C 4PRPA 4PUBH 1V55B 1GMIA 3QEHB 5GRVK 4NZUH 1OHZA 2XG4A 3OR6A 4OZFA 2M83A 5DD5H 2VDPH 4W9LC 1KYDA 4KK8C 5CJOL 3R8QA 4JQXC 3VXQA 3RG1C 2ZKWA 4I3SL 4UDTA 3TJPA 3LRHA 3FQNB 4AL8H 5T3ZH 2ENYA 2MQ0A 3H42H 3CPLB 3BPLC 2IJ0C 3QDMA 2AMUA 3RHWK 4EOWL 1QYGH 2IPUK 1EX0A 3CVIH 2TRHA 3MBWB 3D39A 1ZLSL 1S9VB 3TA3C 4EN3D 3TWCH 3H7BA 1T80A 1LD9A 1HEZA 5K9JH 3DX7A 4HOMA 3W3BA 1E9OB 1EHLL 2XTJE 3UMNA 2HPOA 4FNPA 4XBEL 3PABA 3B2VL 4CU8A 4L3CB 4E9TA 4PWJA 3PGFH 4JG1L 3JV6B 1ZAGA 1EUUA 4L3EB 1S7TA 1EJ8A 4FZEL 4UIKH 5BZZA 4PJFA 3K4DA 4X7TB 4DK5A 1SDDB 4XWOD 3CFKA 3QDAA 1UURA 3QUXD 3VXMB 1KIRB 3QCTL 4MS6A 4S2SA 3TLRA 5LBVA 1LNUA 5AB1A 1NWPA 3ZL2A 4KUZL 1ZY9A 5E4EB 5A43C 4Q14A 3D05A 1K5NA 3BT0A 4J3OD 4N2LA 4RMTA 1N5YL 3LRSA 4CAGA 1S7WB 1WCBA 3P3SA 3RDTB 5HHPB 3FFCA 1ONQB 2HWZL 1OSZB 5IESL 4WW1B 3IFLH 1J0JA 1NFIA 1N8OE 5H4ZA 1J7VR 5FUZL 3SDDD 3DMMD 1V3MA 3ARUA 3EJJX 2JKNA 4KUCF 3QO0A 3VUAA 5KYNA 4MCNA 2R1WA 1T66C 5CSGA 2EIEA 3QIUB 1E65A 3V95A 3NCFB 4OJYA 1SOSA 3FSWA 1YYLH 2BHYA 1DUYA 1S9XB 3HAEB 3KPMA 1MAJA 5I1KH 5AZ2H 3QJHB 4QKTA 1MAKA 4LCCA 1KOAA 4P59H 5K9KA 2D7NA 2K8QA 5HGBB 3K2UL 2J21A 2QTEA 1WAAE 1OGTB 4M6OH 4OLZL 3QIWA 4PJBF 3MJ7B 1UQSA 4WGVB 3SBWA 3D8MA 4G8GA 1A4JA 1FO0B 3WTXA 1R24B 3H8NA 1MIMH 3KG5A 4OCWH 1DJZA 4KKZA 2ZF8A 2EDFA 1RZ8A 4R5TA 4NYLB 5JOFA 3F8UB 2ZOOA 3D6GA 5DD0H 1QFUH 1MCOL 3G04B 4JHZA 4BA0A 5E2TL 1NIBA 1W91A 4NN7C 1UB6B 3VTAA 4NQQA 4LT7A 2Z7UA 2CLZB 4MA1C 3NCCB 1YEJL 3KPTA 3QUYD 5IJVB 3VMPA 4DIXA 5B3NA 1I8UA 4ZO9A 1MHEB 1UH2A 3SCMC 5FYJH 2ZCKL 25C8H 2KLSA 4DAGL 4G82A 2NX5A 2XXGA 4JO8A 2Q86A 1JPGB 3AADB 1NOAA 5K39B 3RWJA 1CUOA 1TJXA 1X5MA 4OV5A 5KBLA 1YCSA 4S1DC 3VYPA 5A2LH 3PS6A 4GOSA 5LO7A 3STLB 5I6KA 1A9BB 1HCZA 2OW7A 3CDGB 2VR7A 1NINA 1VB9A 2H9GB 2B1AH 1ORQB 4B6ZA 5JW4N 5HYJB 1FFRA 1FCGA 1BM3H 1GYCA 1QTPA 2GBTA 4X80H 3BH9B 2OR9L 3B7TA 4WNQB 1IC4L 1G1YA 1JZ3A 1AZBA 1AD9A 3EJYD 3I50L 1JPEA 4D9QE 3S35H 2MNJB 2QZ5A 4TULH 1AHKA 3EZJB 5D6DC 1EFXD 3QDJE 4K94H 1XH2A 2XC8A 4FQ2H 3WDIA 2BVEA 2LAAA 4WTZG 1HTYA 3WXWL 3NGBC 3LZFL 1XGRA 1KXQE 2BS9A 3QR0A 3KBPA 2BS8A 3CIAA 4PTUA 4EXPX 3N44F 4ZS7H 3OMAB 1CICC 4HWBH 1ZGLM 4W93A 1INDL 1MELA 3KJ6H 4EDXA 4ZMNA 4TSBH 3OPZH 2Z9TA 5C70A 4OIFA 1N26A 2ITEA 5C97A 1ADQL 3QQDA 4K07A 2H26B 3FHEA 2PW1B 3K0WA 5JA9A 4KKBC 3AQDA 4XH2B 3ATDA 3I74A 5DHYB 3U1QA 3PWUA 3VGAC 3FT9A 3THML 5FV1L 5DFVD 4WI4A 2EXSA 3AG4B 3MFGB 4IOSD 1P7QB 4UTBA 3P4NA 4N90D 1A6UH 4OZIB 3WXVH 1OAQL 1GH7A 2J6EA 1RQ5A 2W8CA 1II4E 3AG3B 3OKYA 4YUEH 1FG2A 5KVFE 2GK2A 1JDAA 5EBMB 1CGTA 3MRNA 3SE6A 4EAEA 1XF3B 3WO4B 2EADA 3ERXA 4RAVB 3BUBA 4UT6H 5GRJH 2OSXA 3O8XD 3DO3A 1BEXA 3DIDA 1RFDL 1P7KB 4UNIA 4Z7AA 1CFNB 3NFNA 3SKMA 2MSPA 3GZOA 4QDGA 3ZLQC 5EF3A 2Y3AA 1I1AD 2B16A 3FONB 1UD4A 3FUFA 3QUKB 4UYQA 5D1XC 2DQFB 3CZSA 1M53A 3BVDB 4HISA 1IJ9A 3WI9A 3INOA 5FEBA 2X6VA 3MLYH 5EN2B 2YD8A 1BSIA 2OMUB 1A5FH 5D7IA 5G4OA 3L2NA 2X40A 3DGGB 2QVFB 3Q48A 4WUUD 2HT3C 1U3HD 2IO5A 4GI8A 3SKNB 5F7UA 5IQ7H 2GT9B 4KZDH 4BV1A 4B9ZA 2FJHA 2IAND 4KH9A 3LKQA 2CJUL 1T83C 2VLMD 4OF0A 5FUOH 2MCPL 3VFGH 2ICEC 4ZX4A 2E4TA 4ZFGL 4JPVL 1RAMA 1HT6A 3MLRL 5D93B 3GMPA 3S34L 1BMGA 4XCNB 2O6DA 4PJEF 3VWJA 3VQMA 2HFGL 1BVLB 3EDJA 3MRJB 1RUQL 4K73A 3IJSA 4N8VB 5EN3A 3ABMB 2J1XA 5L2KE 2OMYA 2NY1B 1TEYA 1FYHB 5JXEA 1ETA1 4YHKL 1U8QA 5C09B 3UTQA 4KVNL 3NG5A 2EQDA 5A3IC 2J55A 3OKDA 2DIJA 3ARGC 1S5IH 4JY6A 3EJRA 1KTLA 1MFDL 1QVOB 1TOXA 1ZT7A 2NYKA 3I3BA 1GKEA 4YR6B 2ZUQB 2XBZA 3QJFB 3T3PB 43C9B 3C9NB 4KKAC 4Y1AE 5KYYA 4KBPA 3MRHA 2EDBA 3C5JB 2OI9C 4F33B 2FO4A 2AXFA 3FT4A 4FXKA 2WZ5A 3D85B 3M8OH 4ELMB 4G9DA 4MQSB 2QSCH 4B9YA 2LLLA 4RAHA 1A3LL 2DYPB 5J6SA 1FJ1A 4IEFA 2DQIL 1VFAA 5DC4B 3COOA 5CKGA 4O2CB 3C8KA 2A77L 3ARDC 4G59C 4QCIA 2X3AA 4Z7WE 5C2BH 4OZGA 4K3HA 3OJDB 4Q6IB 5EG6C 4MXWH 4DP9X 4C58B 4P46B 2XWRA 5DQDH 1JGEA 1S3RA 3T6VA 2G2RA 1EH9A 1OCZB 3SDYL 2X42A 1GZHA 2DIEA 4UILL 4YHPA 2H2SC 4K3GA 1NCUA 3FMGL 2X10A 3EOAA 1E3FA 5DI8B 3HS8A 3MRCB 3KNBA 1NL0H 4XB7A 1QI3A 2B77A 3CQFA 1QEWB 1MIEL 3V6OE 2Q8BH 3EIFA 1IVLA 1QSFD 2Y6TE 4GAAA 4WIQA 2L7QA 5L8KB 5EA0H 5EO9A 1ZCRA 4YX2H 4N0YH 1FNHA 2BVOB 4PS4H 1VFUA 3W2DL 3ZSSA 1RURL 4A1RA 1QKZL 2CM6A 3FB5A 4D3CH 4WI5A 4ISVA 5DUPH 2NY2B 5EZJB 2APSA 4NLHA 1ZLUH 5EIIB 2Q7YA 3HZMA 1HHIB 1YO4A 2WLIA 2W65A 3F6LA 3UDWC 2E7LC 4QF1B 2DMHA 5D1QC 1AR1C 1V05A 3SDAA 2FB4L 4PG2C 4YHNB 4H1LH 3PHQA 1E6OL 1XGZA 1ORSA 1TTGA 1LK2A 2FHBA 3QI9B 4RGMB 4WW2C 3WS6A 1THCA 4QXTA 4DUVA 2XVBA 2WWKT 1KIQB 3GB7A 3HLAB 4FHJA 3KPSD 2Y3NA 1NGQH 2Z6FA 1VA9A 5DJDB 1E4WL 4XCYB 4L4TB 3GTNA 4MJID 2P5WB 4CVXA 2A1WL 4B9IA 1WC7B 1OIOA 4M4PA 4H8UA 5FS5A 5HP5A 1G5GA 3MLZH 4G11A 3I6GA 4K3EL 2G5BA 1KWKA 2DDQH 2YLKA 3FO2A 3LTVA 3GJFK 3KJ4C 4JGUA 4XXDB 3FO9A 3N04A 2HT2D 1J5CA 3BWAB 4YDMA 1X4YA 1LP9B 2ZOKA 2WB7A 2Y07H 4BH8B 3DI2B 2RQ8A 4BFIB 1XGPB 4DVBA 1NBYB 4FQQA 1U8PA 3BEVA 4DTGL 3NZHH 3WNLA 5E6ID 2I5YL 2YPLE 1E5ZA 3ZTEA 3RFZC 3BAKA 4ALAL 3V0DA 5ALCH 1N68A 4LMQE 4RISH 4KMQA 5DYOB 3F7YA 1AQKH 2OMTB 1Q94A 4GKSA 1I7ZA 1E2WA 2DQUH 4ONHB 2LU4A 3WD5H 3B9AA 3N1FC 5BXFA 5KZCD 3SO5A 1E42A 3HI6L 3QRBA 5DJZB 3UBGA 2CGRH 1KN4L 1FP5A 2ATPB 4P23B 4APQA 1XCQA 2WNKA 4KROD 1ES0B 5ABAA 4LOVA 5DDHB 2D31B 3R06B 3IEAA 1AC0A 3LOWA 1O7DE 2P80A 3FQ2A 4V1DD 4E42A 4X8JA 2DLEA 2DH2A 3L3HB 2PPDA 3IJHA 4TNEA 3TNMA 1ZS2A 1C5CH 4H44C 1AP2A 4QXVA 3FN0L 3Q05A 4JPWL 3M86A 4S1QH 4UQIM 5I15H 2WLHA 1FO0L 1EZUA 4AWJC 3AC0A 5K5YA 3LPOA 5B7FA 1YNTB 1U2CA 2FR4B 1KLFA 1M71A 1FNEA 2BHUA 3FU6A 3GEFA 4N6RA 1BVKA 1CK0L 3N85H 5FO2A 5J13B 3KMDA 2VZSA 4JM2C 1GZQA 3K2IA 3PGCA 2IQ9L 4NHUB 1BBJA 1JPSH 2XWJB 1EFQA 5LB1A 3CMOH 4L4VD 1D5IL 4M7JH 2XN9B 1GPOL 2EO1A 2YFOA 3G08B 3HMXH 3WUWA 3HAEG 4EVNB 1X5FA 1TQSA 3I6LE 4S0HA 2YQ2A 3SYOA 2ZX7A 4XCCL 1MJUL 1PCXA 1QSED 5EU5A 3RILA 4NP9A 4BWTA 3SY0B 2I9LA 1QP1A 5I17A 3J27A 1H9DA 4XZ4A 5B7EA 3AT0A 3VA2C 1J9RA 5HPMA 3WFEH 3JVGC 2HTLD 5KBKA 1BFOB 3K4AA 1G9NL 2I07A 4XO5A 5C0IA 3H2PA 4BYHA 1I9JH 2BY1A 1SLWA 5DGQA 4AMXA 2B15A 4NUPA 2UY7B 2F54D 4PBWD 3P0GB 3PYCA 1DHKA 1HL5A 3LZQA 2R83A 3ME0A 4YXKH 3L3JA 4I3GA 3VJ6B 1WAAF 3GSNA 1G6RL 2WBXA 3P2TA 2OJEB 3BCDA 3TT3L 3HR5B 5F9JA 4Q74A 3EGXB 1WPCA 5E8EB 1N6QL 3D4YA 2P3YA 3D07A 1FYTB 4GBXC 4N9GB 3IVKA 2V3EA 3I6KB 4I18A 4V2CB 5CP3H 3LKOA 2VITB 4Y4HA 3SE4C 3LNDA 2FD6H 4J3SA 4HWBA 5KYXB 2P8MA 3DSFH 2GG1A 4DQAA 1JMXA 4XPBH 1F3RB 4KJWC 3T2QA 1UYWL 4JFZH 1CXLA 1SJXA 5GIRA 4JY5H 5CUSL 3CVDA 4F57H 3I9PA 4KTEH 5BW7A 2GTWB 1IAIM 4Z18A 4GSUA 2CBMA 2Z1KA 2K3HA 3IAPA 2MCMA 1J88A 1XEUA 3P3TA 4F9PC 4N0CC 2EVFA 4CVZB 2X4UB 3PQYD 1WIUA 4YSEA 5EOQL 3RUGE 1C12A 1RK1A 2PN5A 4KITB 1GJIA 1IZJA 4Q2ZA 4L9LA 4OCXH 3L3GA 1KXHA 3P73B 3QPQC 4O02H 3BGMA 5E5LA 3NK3A 4FMFA 1GSKA 4J8RA 4AYBA 1IGIH 2BVYA 2IIJA 2ZXWB 2QVTA 3BAIA 2FDBP 3KLKA 5AW7B 1DYZA 1H3PL 4HIEA 3GSVB 4XB8A 2K4WA 2ZWYA 1FPTH 4ZAKD 1TNNA 2KT6A 3QUXA 2H1LM 4DQOH 1QBBA 5JW4R 1ZKAA 5C2UB 1PW3A 2R1XB 4GXVH 1IFRA 3VWKD 4DP2X 3MBXH 4H88H 5DO2C 4P5SA 4LDLB 5DHXB 5EU6B 3QPXL 2NCEA 2YJLA 1EIBA 4WFHE 1KCRL 1WGVA 5DJYB 5I23A 2JI2A 4JFPB 3ZL4L 2CHDA 4BK8A 4QRPD 4F5CA 3V7MA 4OM0H 2GJRA 2DQHL 4GI6A 1MUJB 2XSKA 3SDDA 3PREA 3DMMA 3TX4A 3KYKL 1TVBA 1GVIA 3ZE1E 4LKCB 1BZ9B 5HYFA 5KSBF 1I3RA 2VC2B 2FYVA 3WUZA 3B1TA 3GUTB 4ODXA 1RIHL 3EFOA 4B95C 4EI6A 1J87A 1S7RA 1JI1A 4UQ3A 5FKPB 1RK0B 1MLCB 1OAKH 4XNMA 5IMOA 4ENEC 2A9CA 3GBNH 1OE3A 3BAWA 1L7TH 4FTVB 3QH3A 5ALBL 3FL7A 4IYKA 5FYLL 4FEMA 3HRPA 1JCVA 2GJ6E 4WJ5B 5B39B 3QXDB 4U1JA 2WIIA 2FL5B 1UWYA 2VGLM 1IKFL 3UTSD 2A4EA 5IQOA 1S6NA 4HETA 1TQCB 1D5ZA 1OOWA 4H25B 2MCAA 2P24A 4HJIA 1G94A 4N5UA 3ABGA 1UZ6E 4X9IA 1UOKA 3QJQB 3QUYA 2HLEB 3CFIC 4N2DA 5IFHL 3G6JA 3HC4H 3QEUB 4ADJA 1AGFA 4FA6A 4KRMB 2NW3A 3AFLA 3EOTL 4XX1G 4Z76B 4JPIA 4KPHH 1ET8A 3BQUB 4G7VH 5DRXB 3STBA 4NQED 5AYUL 4N8VG 4QWWC 2X7LB 1TKWB 1NUFA 3B9VA 1J1XL 3HNTL 4KX8A 3SPVB 3ALPA 1A2YA 1HYRC 3A6OA 3BE1L 3GRGA 2VO5A 5I8OL 5H35B 2QADD 1QUNB 4G70B 3TV3H 3ILEA 1MCKA 2UUDH 1KJ3L 4G1MA 3BDYH 4LP5A 4JJOA 2XJLA 2P43B 5DJ2B 5SV3A 2A9NL 2A6KB 4F1ZA 3Q13A 2O6EA 5LGJB 4X6BA 3P9MA 1ADWA 2R29H 3SY6A 4K15A 2X1XR 1RJCA 5ICXB 4FTDA 4ETQA 3DYOA 5K9QG 2CLVA 5F3BA 4PJDB 1EFXA 1FC2D 1SDYA 1F4YH 2AMGA 4DWHA 3G6AA 1R3IL 4LLUB 5T3ZE 5F7DA 4GSDH 3RZWA 1S7XB 4WO4B 2WUCL 5AVXB 1RZGB 2VRKA 2CO2A 2PO6D 2NY4D 1EBAA 1IBGL 1HXMA 3ZMNA 5KVEL 4ACTA 3LQZB 5I16A 1QLEB 2QDVA 4K5MA 5GRUL 3MACH 2MQGA 1BZ8A 3QQXA 1PY4A 2OCJA 4C4BA 1MFMA 2JH2A 3VTMA 2CK2A 4PJHA 2HFFB 3QIBB 1JFHA 5JIMA 2J1ZA 4TVPE 1RU9L 1G7LA 1MQ8A 3C6LC 5F9WB 5LUMA 4UUJB 1I3VA 2FQDA 5LBSA 4JL2A 1I8KB 3RB5A 4UNVA 1NPJA 2B4CH 3U9UA 1YC8A 3H54A 4JKPL 4IOSA 3GK8L 5TD4A 5DF0A 4ZG1A 2EYSA 1MPAH 1G9MH 3JT2A 2BSTA 3VXMD 4Z7WF 3DXAB 4ODHL 3QULA 1MSPA 5FGBA 2ED6A 2HLAA 3P9WB 2APVA 1LE9B 4PJXE 1GL4B 1DQIA 3VXUE 2VAAA 3U0WH 3O8XA 1JG9A 3BKCH 3KDPB 1N0LB 5FB8A 1HS6A 5EIIG 2R9HD 3LNGA 3PXLA 4BUHA 2D0GA 3D25A 4AIXA 4MMZC 2W9EL 3MV7D 1LEIB 4R7VA 4IU2A 3VSUA 1HHHA 4FHBD 2QGDA 4IJ3C 4L3FA 1JGDA 3UTOA 1J0IA 4XNYH 3BIAX 4WI3A 5I1DA 2YFNA 4QY8A 2HB0A 2NY6C 3EUDA 3V52H 1D6VH 3H9HA 3K1KC 4LKXA 4HKBB 3QIUD 3QUZD 3U46A 2WQAA 4NM8L 4WUUA 1U3HA 4LCCC 4D2NA 3B9KB 3EYFB 4QTIH 2CO6B 5IB5B 4HPYL 3GYRA 2IANA 3QIWC 3SBWC 4ONGH 5F9AC 1S7QB 2GFBB 2V2TA 3UYOD 4HKJA 3FC8A 2K8MA 2CDEB 5CD3B 5ES4B 3ULVC 2ZIDA 5EDXA 3IM1A 2DQTH 1NOFA 3IDUA 4JG0L 2BIMA 2X1QA 4M9OA 3QCUL 4U1KA 4PQXA 3V6FA 2DQJL 4Y4FC 1RZKC 1SJVA 3R8BB 4HIXH 1WZKA 1HL4A 2ZPKH 1LDPH 5I5RA 2F7RA 2P1YA 4HT1H 1G7MB 5FYJE 4N2MA 4JCMA 1PLBA 1XSIA 3KYOB 4FKEA 4X9YA 3CXDH 1AI1H 4Y19B 4M7LL 1FGNH 4BH7A 3A47A 4A2GA 2FJUB 5E08L 3UGUA 3GM0A 4ZFOB 4KJYA 3O6KH 4LRNH 3WY1A 4Y4KC 2ORBL 2WOYA 1EEZA 1URLA 3L4XA 1BVZA 1I8IB 3VE0A 4LARH 5ICYB 1A7NL 3MRKA 3RAJH 1FSKB 1MHPL 3ZTDC 5ACZB 1DDHA 5F6HJ 3S96A 1NCDH 2NW2A 3VXRE 5JLZA 2D03L 1JPST 1FLTX 2WZ6A 2CXKA 1T89A 3TEWA 4IDJL 2A74A 1NAMB 3F58L 4NCC2 4DPBX 2FX8L 1JZHA 2BDNL 2Z34A 3UZQB 5K1VA 4TLKA 4TNWF 1JTPA 4Y1TA 2WLYA 3V6ZB 5ESAB 4PJIB 5SX5K 2CJSA 4LK4A 2G75A 3ROLB 2JMRA 2IF7A 1QSZA 4WEBH 2C26A 2PABA 5IMLB 1VKXB 3AWEA 5EEZA 1E4XH 2WN3A 3WN5B 1QWHA 2VMFA 2B1OA 3VD0A 4MA3A 3WLBB 2PCFA 3CAFA 3BFOA 3DUSA 5C07E 4FNSA 1CDBA 3O45B 4DGIH 2QGCA 3TYGH 3VSQA 1ZSDA 5D5ME 1T7VA 3FUHA 4ANKA 4AH2A 4U6TA 2AK4E 2ROYA 3NZUA 2QBWA 1UKTA 3CH1B 3CGTA 4MWFA 2YAOA 2D0HA 4GEJA 5I66A 4ZTPH 1INEH 2QMKA 4DO6A 1MCWM 1QSFA 5DJ0B 4NN6C 4WCYH 4TRPH 1UVQB 1TLMA 4M00A 3DV6A 4IGBC 4XR8C 2Y7QA 1DLFL 1N7MH 1CFMA 3WCYA 3KGSA 2E5EA 4DP6X 3HC3L 2RFXB 3MUGA 5I1LA 4Z0XB 4QRAA 2W1NA 2XIIA 4CRPA 2WLJA 1K6QL 4G7YH 2VL5B 4MZ3A 3QSKB 1J8HE 4MQTB 1CFQB 4XVSL 1BPLB 4UOQA 1M7IB 4E9VA 3GO1L 3U7WL 1IAMA 5FDYA 5L6YH 2VZ3A 1HQRA 1SJHA 3RWFB 3V2AR 1D5XB 2Y5TB 5INDB 4FEIA 5EOCH 1GRWA 4NQDB 3KPSA 1OGSA 2EACA 2J8UA 4HXAL 1FDLH 4QI3A 2GJJA 2XG5A 3OM3B 1QFPA 4MJIA 2VTFA 4MNHB 4LSRH 4AE1A 2ZJSL 4A2EA 5KVMC 2DF3A 1PZBA 3VCLA 1TZOA 2X4OA 4G7RB 3F85A 1NPNA 1XXFC 2W0FB 3A4AA 3VDBA 4V33A 1XTLA 3SN6N 4ZUVA 3V0VB 4B7LA 4Y16B 4K7FB 5E6IA 3SIKA 3W39B 4JRWA 4PR5A 3BAXA 2NY7L 4P2YA 2P8PA 1E4HA 1JPTL 5D4HA 2ZX6A 5I0DA 2A7BA 5F1SA 2XCMC 4KRPD 1ZHKA 5DTFA 3MXWH 3ESUF 1JV5A 5FF6B 1XWVA 2LTQC 3PL6B 2WXLA 3WIHL 5I24A 2BCKB 2DEYX 5JPMB 2Q5BA 2XZCL 1AQDB 4IBVA 3DX0A 5FYLD 2ZWZA 2VC2L 4J7RA 3RBSA 3WNKA 2DQEL 5JXEC 1RHFA 2ATKB 3FB7B 3DO7B 1RULL 2A9BA 3RVWC 2AQQA 4V1DA 2BP0B 5D2LE 2PTVA 5L0QC 3LIUA 2PMZA 3FTXA 3RUGF 1MKFA 3GNML 1YYML 1MCPL 1P4LB 3NBNA 3ZW3A 2AABL 3GMLA 5LCVH 1WTGT 5C8JA 2Z64C 5C0EA 1P1ZB 4BHUI 3RGHA 1BZ7B 3H3PL 2X2IA 3KE0A 4FXKC 1OP4A 4PRAA 4YOKA 3ROOB 4LSUH 3QNXA 4WI9A 3WFCH 3I75A 1YN7A 4RRPG 5I1IH 1U8NA 1NGXB 1XIWB 3D85D 4EI5D 1TFHA 1IE5A 5EBGA 2DYPD 5EUKA 5FW7A 4WTZA 4HEMA 2VE6B 4XHJC 1CT8A 3INUL 4BFGA 2NRDA 1GJUA 2ADJA 4K9EL 2OP4H 1DJGA 1BXXA 3RU8H 3GSWB 1NCCL 3MUJA 4JO3L 2H0PA 1QSEA 4URTB 4DO4A 1NCJA 4LLMB 2VLRA 3G5VB 1YY8A 1AHWB 5IIEB 4NAQA 4OLWL 3IXTA 2AQNA 4P46D 2X05A 1RP9A 2AHIA 3S3SA 1ECYA 4U6YA 1N3NB 3RTQB 3W82A 2G4EA 3W38A 5DD1L 3HKZA 4KZEH 5LG1A 1ZK9A 3K74B 4OD3L 1CD8A 2GSIB 4X6CB 3WOVA 3PAVA 1M9SA 3N41F 5FKAA 2GUYA 2J6WA 4PJGB 5E9DE 3QWQB 5TGBB 4U31A 4DKFL 2F54A 5DLML 4NKMA 4D0DA 5I73B 1BJ1J 1UM6H 1VZHA 5J4MA 1N59A 4MS8C 4ZUSB 2VXQL 1EHXA 1RIVH 4DESA 2Y7LA 3MI6A 5T5FH 3HG3A 1G84A 4RAUB 2XKNB 4NKIH 1ADQA 1WLHA 3SGDH 5EEUA 1ACZA 1FA4A 1IBDA 3ASNB 1SOQA 4EZMA 2RGSA 4FQJH 2NY2D 4G7QB 4HSAC 1AIFB 1JWMB 4XOEA 2X38A 3F5WA 1E8YA 1ZA3B 3SDAC 5BOPA 1LQSR 2IALB 3GMOA 3MJGX 1QLEL 2DMKA 4LGSB 1FRGL 3CSBA 1B2WH 1UZ6F 4JO2L 3WFHA 2YRPA 1QBLL 1T1YA 5C0AB 5TE6L 3VDCA 3G6DL 4QRBA 3UBFA 3ARFA 5KVDE 4IHBA 5F9OH 1H3GA 3M46A 3PQYA 1U2HA 2F74B 4NRZB 5CR8A 5E5RB 4R7DA 4MAUL 3BH8A 5D9SA 3T0DA 1KC5L 1Q0YL 5T3XL 2KQMA 5CJQH 2P5WD 3CVHA 3CX2A 3Q7JA 2J5LC 1BM7A 4M7KL 3VXOA 2UWEB 4IS6A 4GP5B 3VQLA 1T0MB 4N0UE 4PJCE 1NMBH 3FRPB 4XZUB 4N86A 4NZRL 4ZW3A 5LBGA 4Q89A 5E6UB 1A1MA 2PYED 4ZAKA 5F96H 5IMMA 2ARJA 2OXHA 4F58H 1JXDA 5FK9B 2VDLH 2AJ3A 4ANVA 3LV3B 4FKHA 4JPKH 3VWKA 2VR3A 4FC3E 4HLZH 1PYWA 3UTZA 1BLNB 4X6EA 3CSFA 3PP3K 5CP7B 1HH6A 4JDTL 2Z8VC 4NNYA 4M4RB 5HHMD 3GSRA 3N06B 2E9IA 3O6FC 4QRPA 4PJ6A 4APQC 4O51A 4C56B 1FZMA 5C0FA 2GAZA 5D1XE 4GMSL 3ESOA 4P23D 3WNPA 1K3ZA 1FN4A 3A22A 4QRSB 4TNGA 4ZW5A 3KPRB 1QWNA 2D3VA 5IQMA 1LYQA 3EH2A 3TTYA 4X0KA 3BUIA 4PCTA 3BKJH 4U1IA 4A39A 1JNHA 4BGDA 3H0TB 5EC2B 3D5OF 3MQIA 5E2WH 1DLHA 3LVTA 4NI6A 1RZJC 3R7RA 2X6AA 4XP9H 1IC0A 5D6CB 4URKA 3HB3D 3E6FB 3ILPA 3X3GL 2B1HL 1BZDA 1NGPH 3K8MA 3LMJH 3OAYH 5IY5B 3VNYA 1IJNA 2OL3B 4XMTA 4G6KH 2YD0A 5SWZB 1AD0B 2QVIA 2XVKA 2EAEA 3F7VB 2X6MA 1KMGA 2H5UA 3HNSH 4S0SD 5IVXA 3ZL1A 5LNGA 5T1KD 4CC4C 4H20H 2HPTA 2XN9D 1NEZB 3FS9A 5E2UL 5AW3B 1DUZA 5F7HA 1ZGLB 5T8IA 5KBPA 4M7ZC 3JWNC 3TM6A 5LGHL 4Y9FA 4I13B 3T8XB 1MNUL 3FTSA 4PJXF 2WQXA 1EO7A 1RV6X 2AJUL 3FU8A 4L5FL 5IROD 3TBVA 3T77B 1J5OH 2NXYC 1JHTA 4CC0A 4UF7C 3SPGA 1BP3B 2DYRB 3EO1B 4JN1L 1MWOA 2W59A 2Y7MA 3B4NA 3BP4B 3U36A 1HXYA 3D0LB 4OI7A 2RIKA 1OHQA 1J0KA 1X44A 3MLWL 4B3VA 3IU4L 3C8HA 2NOYA 2D7QA 2NTFA 1NAML 1GC1L 1OGAE 4LP4A 4GQ9H 3EHBD 3LB6C 4XGZB 1FUNA 5EH1A 1XZ0A 1PF3A 3NFSL 5HGHB 3G5ZA 4MDRA 2R2EA 2NQ3A 5JORB 5A2JH 5FW8A 3HUJB 2HJLA 1T22A 5KVGH 2CBOA 5E5MA 3QUGA 3VX1A 2BX5A 3L45A 2FUTA 4I18C 4DGYH 2YC1A 4W70A 3HG1E 4KKQA 5A16A 3RWEB 4Y4HC 2WCPA 3OF6D 4YL4A 1FYTD 2B9AA 1QRKA 1TJHL 4KO5A 1U33A 4GQRA 4FRWA 1BBDH 1Z9SA 2ZNWA 1JBJA 4HAGA 4ODWB 3RGVB 3QEHA 5DHVH 5I9QB 5J8OA 5IG7B 2P7TB 2ZX5A 1KGCE 3MODL 5BW7C 2BM3A 5FOBB 4R5VA 1FAIL 3O4OB 1L6XA 4AGPA 3FQNA 1UD3A 3QNFA 4MD5B 5TH2A 1AKPA 4EN3C 4RFOL 2BP8B 2FH6A 4L9LC 5JIHA 3IDXL 3I85A 3L2LA 3L2MA 2CDFA 1S9VA 4FI8A 5EZOH 3E1ZA 1YA5A 1X5HA 1V8HA 2OPCA 4G6FB 1E9OA 1KGXA 4OVVA 2MOQA 2CPCA 2F8IA 3J7HA 4L3CA 1R5WA 3P2DA 3C2AH 4HAFA 3JV6A 4U1GC 4XWOC 1OP3H 4HK0B 1JGLH 3QUXC 3L4ZA 1ZANL 3DX9B 4XPTL 4MVBD 5IB1B 3EUUA 3SO3C 5D1QE 5IFAH 1FLRH 1RMFH 4X7TA 1SDDA 4ADIA 2ZKHL 3VXMA 2BSCA 5D55A 3BD4A 2BVUA 2AKRB 2QVMA 5J1SC 4XRCB 5HYSB 1YAZA 5EU6D 4M62L 1P4BH 3CBKB 3L1OH 5ICUA 3TL5A 1S7WA 3VX0A 1B0IA 3QK0A 4R97C 2XZAH 3RDTA 5HHPA 4WENB 2JCCE 3QJSB 4L2YA 2XN0A 1OSZA 4WW1A 5D5MF 5IW3A 1KBWA 2Y2WA 2AJVH 1JZ4A 2CK0H 3UAEA 2A9AA 5C86A 2R23B 2HJKB 2I60L 4JFDE 1OAZL 3D7PA 3QIUA 3QUZA 2BNUB 5DVMA 4LL4A 3QHFH 4OCRL 4D9LH 1BG9A 1JL8A 3IJ9A 3HAEA 1S9XA 3IGUA 2WXIA 1JJUA 3QJHA 1E90A 4JL1A 2MCG1 1V7NL 3B7YA 4BXSV 4PJBB 4M48H 5HGBA 2GEEA 1OGTA 1UTDA 3MJ7A 4FTVD 4CKQA 1FO0A 2ESVB 4EUPA 1R24A 3QFDB 5T1MA 2H8PB 3UAJD 2BSDA 2ISDA 2GC7C 5TTRA 4FLQA 4OTXH 4NYLA 4MBRA 1NKOA 2WIMA 3G04A 3NCJH 4NIKB 4W4OC 4WY7H 2HN7B 5GGRY 5C3TA 5F93C 2X4PA 1UB6A 1RSYA 4JDZB 4B5EA 3OMIB 4A2HA 2VNCA 4AT6A 1ECZA 4TUJA 4AM0B 2HJFB 5IJVA 1JHLL 3SKUD 1OKEA 5KBDA 2Y24A 1MHEA 3FQ1A 1JV2B 3SQOH 1ASQA 1E27B 3QHTC 3RVUD 4XNUL 4I7ZC 4Q56A 1JPGA 5ECGA 3QDGD 3WKQA 5CCJA 3IPFA 1PDKA 4CADB 3UP6A 3BQUD 4JKNA 7CGTA 1LO2H 2WAQA 2H1XA 1YQVL 2GHWB 4WFED 5D70H 5TDPB 1IC5H 1GOFA 3S3PA 3STLA 4ZI8A 2J1KA 2R51A 3CDGA 1TYJA 3NPSB 2H9GA 3A6CH 4ETYA 1ORQA 2CWRA 4YHYC 5D72H 2EXWD 1JERA 1KULA 3EJYC 1UWEL 4FG6D 3BH9A 5GS0H 4WNQA 2AQRA 3U1SH 1G7JA 4OUUB 4PBVC 2AQPA 3FKUS 4CN1A 1L0YA 1UXWB 1CLYL 1JP5A 3Q1SH 5BS0E 4H8WC 5FCUH 2G4GA 4WUKH 4QO1B 4WWID 3S5ZA 4WO4D 3N44B 1C8PA 5D2LF 1KV3A 3IAQA 2IADB 3RZCD 4EIUA 4DPCX 4MLIA 3I9GL 1A3RH 1UEYA 1DBML 1KJ2H 1NCHA 4I9WD 4JS7A 2VQ1A 3F12B 2H26A 1S7SA 2E6PA 2PW1A 3NABL 1KGUA 1MDAA 2XWCA 4M6ML 5EFIA 4W9HC 4ELDA 1SBSH 4NT6B 4XH2A 1PQZB 4Y9GA 5DD6B 4W9JC 3T0AA 3V55A 5DHYA 1E5UI 5DFVC 3HKFA 5T3XD 3MOQA 4YL9A 3BN9D 1NSNH 2ZXDA 3KPQB 3NOIA 4X5LA 1Y6MR 4OZIA 4JREB 4OLVH 3VD3A 3QEQD 4IRJC 3VG0H 4N6QA 1UEMA 4NWUH 3BVWA 2APBA 2NY5H 1AZUA 3DXAD 1W2KT 5EBMA 1V3KA 2DKUA 1XF3A 2XY2A 4FNLH 2Q76B 3EJZC 2WXNA 3GDBA 4AQ8A 3VQ2C 1DFBH 2YS4A 1I1AC 3VFTB 1P7KA 3TURA 4K3DH 3ECUA 5F71A 1CFNA 4KTGA 3TFKD 1A7RH 2I24N 4KZCA 2QL1A 3EGDB 3QUKA 4G9FB 5IM7B 2JJWA 2DQFA 3IMWA 3STZA 4UTAH 3QUMH 3T4AB 4X98B 3TV8A 1D2OA 2KDYA 1VESA 2OMUA 3OGCA 4TQ8A 1KT2B 1VLXA 1AFVH 3DGGA 1DQML 3V4UL 3VXTA 3ELQA 4UM9D 4RFNC 1EDYA 3B9KD 3M17B 4POUB 3LPWA 1F1AA 2GT9A 4NM4H 3ZR5A 3WMQA 4F7PB 5LGKA 3GJEB 2C7UA 1CXIA 1G7QB 1WA1X 1M05B 5I6LA 3FTYA 4NDMA 3BFQG 4WTWA 3SGDI 4Z7UA 4JLRB 4XCNA 4DZ8B 3MGOB 3FRPG 5DWUL 1BVLA 2IH1B 3MRJA 1KPRB 4N8VA 4BZ2L 1YEKH 2ADFL 3D69B 5D7LE 2V5SA 4DN4H 1IFHL 2VERN 4WSJA 4AUJA 3Q8FA 3NCYP 2DY2A 3TP4A 4HKZB 3LN5B 1ETJA 2C9VA 2OL3L 5JPNB 4EQ3A 2ZTBA 3HG4A 1QVOA 4AQOA 4YR6A 4N2CA 5L4JA 4N2NA 4PRID 3QJFA 43C9A 4R26L 4PJCF 4HKXB 3CZEA 3CLFL 3OB0H 1ETZB 2BSRB 2IDUA 3D85A 4ELMA 1JWUB 4LL1A 4G6JL 2EVHA 2DYPA 4FNRA 1CLCA 2W38A 3E8VA 5EB9A 4OCSH 4WGKA 5FA3A 5H37H 1GGCH 3OAZH 3WE1A 2B08A 3PPSA 4O2CA 5I1CL 2CJ3A 1N6UA 1AGCB 3OJDA 4Q6IA 4UMGA 1HX0A 2ZOTA 5DZPA 2QELA 3T8VA 4FDWA 2OA9A 4P46A 2WVSA 1YMMB 2PPEA 2KH2B 2IGFH 2YD9A 4JK0D 1G87A 1NEZG 2FECL 1JOIA 5ITBL 5CS7A 4RSYA 4ZDHB 1K8DB 2EEDA 4JRXE 5DI8A 3MRCA 1U93B 3MNVB 2F53E 2V9TA 4KZ0A 4JB9L 1F4XH 5A6IA 2B14A 3ZN6A 4A7QA 1EAJA 1K4DB 1RUPL 4XMUA 2EO7A 3OKNA 4UQEA 3KDMB 5JUEL 7PCYA 3H9ZA 2BVOA 1E8WA 1W72B 1YHPA 2FRGP 3RX5A 4LF3B 4L2LA 1CDHA 4U3SB 3IDGB 1F3DH 4P9HL 4YIQB 1C16B 2EH8H 3UJIH 1XSKA 5EZJA 2GJPA 1KB5B 2HRHA 1HU8A 5EIIA 4LHJB 3E9TA 3C60C 1HHIA 3CZGA 1X4XA 4QF1A 3D9AL 4B9FA 1CC3A 4FFYL 4YHNA 3KPLA 3V4PL 2X9WA 1QLRA 5LXGH 5KJRH 4HS3B 3S5LB 3L6FB 3QI9A 5L7XH 4ZUWB 4DKEH 3K6DA 3GBML 4YDIL 2P26A 3AWGA 2WXFA 2EXTA 1KIQA 3HLAA 3HFMH 3O2DH 1NCBL 2C1PB 4R7XA 4Y9BA 5I82A 5JIKA 3TBBA 1QZNA 2D4FA 4TVUA 4XN2A 4XCYA 1KCSH 4L4TA 2Z91B 4FKKA 4ZQKB 2DM3A 2P5WA 1BJ8A 2G9HB 3LS4L 2EEXA 1WC7A 4WK4B 2XPYA 3WLWD 4MMYB 1J05B 1EXUB 2HFEB 2JB6B 2BHZA 2HT2C 3AAZB 5E1IA 1I9RH 4YDLB 2WLLB 4JHAH 4XXDA 3ARTA 3ILQD 3A4FA 1B9ZA 2W5PA 1SZNA 3BWAA 1MXGA 1LP9A 5F8QC 1HINH 4BH8A 4BFIA 1XGPA 1NBYA 2IOOA 4AGNA 1SPDA 4Y16D 5TE4L 2BPBA 4JQIL 4YHLL 5CLXA 1QFWM 3FN3A 5FOJA 3FFCE 5D2NC 1NGZB 3LJ3A 3U2SB 1NC2B 4R0LA 2OMTA 3BI9X 4GY4A 2DD8L 4RFEB 3N1GC 5IF0B 3PL6D 4ONHA 4QNPE 1ED3A 1IT9H 5DMGD 4KROC 1AXIB 3NA9L 1R5IB 4YHOH 5FHAH 2ATPA 3WYRA 1TR7A 2JELL 4PB9L 4KOCA 4P23A 4FCHA 1ES0A 4P49A 5DDHA 5DA4A 2D31A 2JB5L 3O9WD 3R06A 1XGYL 5CEYB 1T6BX 4N0FB 3HA0A 5HYSG 3L3HA 4BA8A 3MNDA 1PZAA 3SHSA 3LZRA 1M1XB 2K9FB 2G0KA 2QHLA 5E23A 4FOMA 2XTJB 4LDOB 1YNTA 2FR4A 1FFQA 1OPGL 4TM9A 3BUYA 3ULVE 2N59A 4F37F 3MLVH 2XXCB 4NHUA 5AVYB 3P2BA 2XWJA 5GISH 4F8TA 2EYTB 3EGSA 1T21B 5T1KA 3L4YA 4DNLA 3MA9L 2WKOF 3O3EB 1A7OL 2XN9A 3FYEB 4FFZH 5HVWA 1BQ5A 3G08A 1WTLA 1M56B 3MN8A 3RJQB 1E9PB 2L7JA 1LO3H 4EVNA 4WW2F 5J06A 2EDHA 1EZSA 5JOPD 3RFRA 2KPNA 4KMTL 5IROA 4OIIH 4AOFA 2NX5E 4UOW0 1F58L 4YBQC 4GKNB 3SY0A 2H7WA 4HA1A 2HTLC 2D4DA 5CKAA 1KYUA 4J2XA 1PNDA 1NAKL 2EICA 1AMXA 1SUJA 2ZG2A 3EF4A 3U7YH 4HG4J 2BLFA 1PG7W 2UV3A 3WS3B 1BFOA 2PTTB 2R4RH 3B9DA 4M1DL 1N67A 2YHGA 3EF7A 4UDUB 3F64A 2FGWL 15C8H 3TZVB 4OD1H 2UY7A 4IIQA 2ZSVB 3RY6C 2QSQA 3ABZA 4PIBA 3VJ6A 3EYOB 3QAQA 1HSAA 1NCAL 1WHOA 4RH4A 1Y1DA 3DVNB 1VFBB 2OJEA 1SDAB 3HR5A 1GHFL 3A6BH 2FHFA 3NIFE 4H26A 5E8EA 3DBSA 1IQDA 2ZKXA 2QV2A 4HSQA 5AW0B 6FABL 3DX8B 1FYTA 4PJ9D 1MCIA 1W80A 4K2UH 4N9GA 1OM3H 3I6KA 1JGVH 3GWJA 1AGBB 1VACA 2VITA 1KBKA 4ZMQA 1HI6A 1N0XH 1QFOA 5DR5H 3B9EA 4KTDL 2QFPA 3LY6A 4ODSL 3UROR 5B8CB 1HEJC 4NHCL 2OMWA 4OQTL 2XT1B 1MW0A 4HC1H 1M4KA 5T1DL 4H8VA 4PRDB 5C0AD 1H3TA 3BUQA 3APMA 4PIRF 5HJGA 5JO5B 1EAPB 1I53A 4AYFB 3LIZL 2EE0A 4CVZA 2ZAHA 1LO0H 2QMJA 4AK1A 3V0WL 2A99A 4LCWE 3VFVB 3NUKA 4QT5B 4ZMWA 2C9SA 5MERB 2F7OA 4JM2F 1D9KB 3GMNB 3P73A 1A6VL 3SQBA 4BEIA 3QXAB 2OK0H 1ZS8B 4AIZB 2AVFA 4L23A 4Z95L 1EXHA 2W9DL 3D18B 4KQ4L 4YBLB 3SODB 4MRBA 1PIGA 4Q4IA 2E76C 1MW3A 3GSVA 1FNLA 4H13C 1T7YA 3VWKC 3R0MA 1HVXA 4HWZB 5SWSE 2VQ4A 3MCKB 1D5BB 2XIBA 2A6JB 2VQUA 2IEPA 4X9FA 5HHOD 3PPEA 5EU6A 1OCWL 3CSYB 4JG1H 2PP9A 3IDIB 1PLGL 4XMLL 5TK2A 4HIIB 3QDJB 2FATH 2B5IB 3SJVB 5DJYA 3CHPA 3ISYA 3QFJD 5DS2A 1UT2A 1CFTA 4JFPA 4OLEA 1F42A 2CBPA 4KDTA 3R1GH 1FQ9C 3TYFB 5LDUA 4OJCA 4XCEB 2I9TB 3FOMB 1X7QB 1MUJA 1WFOA 3UG3A 3WIHA 4JUSA 2VR5A 4ZMTA 4RRPA 5KSBB 1ZLWK 4LKCA 3FQXB 3KPRD 1BZ9A 2D2OA 2Z8WC 5JZ7D 3GUTA 4WI0B 5EBLB 2PYFB 1G43A 4GAGL 5KN5B 3O0RH 4EBQH 2PETA 1EMTH 5FKPA 2Y7NA 1RK0A 2W88A 1R3JA 1QWUA 2CKBB 1GOGA 5E95B 2OYMA 3TBSB 4Z1PA 5AW9B 4K23H 2XWXA 2K0RA 1CI5A 2F5BL 4FTVA 2LU3A 1EO5A 4D8OA 5IFJA 2ZWNA 1XSJA 3UAJA 2C3VB 4U33A 5J11B 2KC0A 1IU1A 2HVKB 2P8LB 4RDQF 4WJ5A 5B39A 4BCXA 3QXDA 4HZAA 1OALA 2FL5A 2VDKH 1RUAL 4HUUB 3UPAA 4QEGA 2YEZB 4ERSH 4H25A 2P5EE 1R3LB 2JLPA 2EKSA 3RWDB 4BRJA 5D96C 5BRZB 4Y2LA 5I30L 4NO0D 3WFZA 1P6AB 3QEUA 5AW5B 4UB0H 1J1OL 1AE6L 1KPUB 1GA2A 3ZT6A 3IN0A 1FGVL 4UT7L 2C3GA 3ZKQD 5KSAB 4Z76A 4DW2L 3GRWL 4G5ZL 3IFNL 5TQ0L 4Q7DA 4ABUA 4XO8A 3KH3A 2VZOA 3O6ML 3BQUA 4K71C 5CLYA 4QIRA 2X7LA 1TKWA 4K8RL 5IBTL 3SPVA 1IGTB 1IAIL 4LCYA 3GGWB 2GK0B 1J9SA 1U8HA 4MZRA 5BOZG 3DHUA 1QUNA 1MDTA 4N5ED 2FNWA 5IHHA 3MKKA 2WKLA 1AZRA 1UWGH 4GMTL 4PRHB 4H40A 4QHUA 4HDIB 1P9MC 5JR1H 3VAEA 3T1WA 5DJ2A 4OZGE 3GINA 5IOPB 2QLVB 5HD8C 4NNPH 3QFGA 1TQUA 4J1UA 1WH0A 4KKPA 2HP4A 2ZWLT 3TPUB 5LGJA 3BWZA 1YEEL 4PP1D 1Y07A 4CL7A 1A6WH 2VXQA 5AAPA 5ICXA 5EF1A 3LN4B 1CG9B 2E46A 1MN4A 3WMPA 4PJDA 4YVNA 2B2XL 1RD6A 5L2KB 1MAML 5CR1A 2PO6C 2NY4C 3RGVD 2AJXL 5I8CA 4A66A 1S7XA 3IFPB 4M5ZH 4WO4A 5T1LB 4W4NA 2OYLA 1RZGA 4E0RB 7FABH 4UBDD 1FNSL 2OBGA 3BGFC 1THAA 2AV7B 5HHNB 4E41E 3RZCA 2VLJB 3LQZA 3OWRA 4D0CA 1IGML 1W72L 4Z3TA 3TN0D 3E38A 3M6DA 5JIPA 2CIIB 5C0RH 4Y1AB 4S0TD 4UZUA 1KGYE 5LWYH 4LIQL 1BDYA 4IHOB 2HFFA 2BOLA 2Q1EA 3BSZL 4G6FD 4OJFL 4RBPK 4KAQH 3KLLA 2DLFL 5T33L 4DN3L 4BQ9A 2GIYA 4UUJA 3A67H 3WHXA 3ZHDA 1RERA 3RI5F 3L3OB 1PTZA 1NJ9B 3WGUB 1DQLH 3HZYB 4JRYE 4HCRH 3L5XL 5MEPB 1TO5A 2MTPA 2QDWA 2DB8A 4Z7WB 1HH9B 5E4EC 2F8VA 1Q9KB 2WMPB 3DXAA 4M56A 1H15B 4HGWB 3D51A 3THMH 4ALAC 1LE9A 3E8UL 3CQQA 1YN6B 2R9HC 2XFXB 3UGXA 1JNNH 4YHMH 3B7SA 3ARBD 4ZT1A 5E99L 5HDLA 4N2AA 1WT5A 4R8WH 2N1TE 1MFUA 3P77B 4LVHB 3EJTA 1LEIA 2Y7SA 4KUCD 2DWEB 1FL6A 1E28B 2XZQH 1IC7H 1QHOA 2UX7A 4F7TB 3W9DB 3MX0B 3QUZC 4JUTA 1OP5H 3LD8B 2ITDB 3ILDA 3S5LG 1E2ZA 4EKXA 4HKBA 2X4QB 5F70A 1DBKH 2P4AB 3B9KA 3EYFA 2CO6A 1WUZA 1U92B 1WUNT 2H6PA 2QKIB 3ECBB 2I69A 1T2QH 3KWWA 4PBXA 1S7QA 2GFBA 1P1VA 3QHZH 2AEPL 2ZXEB 2FJGB 4I8DA 4Y5XB 3AXLB 3WEAA 5CJXC 4KRNA 5CD3A 1N64L 1WISA 5HDRA 1AJ7H 2DBLL 2ESVD 4U6VL 5GRZA 5AD0B 4AVKA 5A2AA 1NCNA 1RZIB 3S3DB 3Q2CA 3N40P 3QR1A 4LGPB 4H7VA 4XVJL 3LVEA 3SBPA 4HUKB 5MEND 1CBVH 5E94B 1XGTB 2O5YL 4FADA 1TMCB 3OJVC 4NQCB 1G7MA 5H4YA 4F2FA 5C0DB 3GI8L 2I85A 4M43H 1U9KA 3GLDA 5L2JB 3PNWB 3DIVA 3UC0L 4Y19A 3WFBL 5GS1C 5A40E 2CKNA 4H4NA 4NZJA 2Z8SA 4ZFOA 4IIZA 1N9PA 4LQ1A 1P69B 2HZHA 4KGJA 3GMMB 4PRIA