2UY7B

Crystal structure of the p pilus rod subunit papa
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
156
structure length
156
Chain Sequence
b'QGKVTFNNTVVDAPCSISQKSADQSIDFGQLSKSFLEAGGVSKPMDLDIELVNCDITAFKGGNGAKKGTVKLAFTGPIVNGHSDELDTNGGTGTAIVVQGAGKNVVFDGSEGDANTLKDGENVLHYTAVVKKSSAVGAAVTEGAFSAVANFNLTYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERIPLASMID CHAPERONE PAPD PROTEIN
publication title Crystal Structure of the P Pilus Rod Subunit Papa.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 21
structure length 156
sequence length 156
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00419 Fimbrial Fimbrial protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 2uy7B01
4AV0A 1N0LB 4AV4A 4AV5A 5AALA 1QUNB 5AB1A 4AUYA 4AVIA 5FWRA 2UY7B 3BFWA 4J3OF 1KIUB 4AVHA 5AAPA 2VCOA 3ZL1A 3ZL2A 2XG4B 1PDKB 5F2FA 4X50A 4XO9A 5F3FA 4XOAA 4X5RA 5IQOA 2W07B 5ABZA 2WMPB 4XOEA 4AUUA 3BFQG 5IQNA 4J3OG 5FS5A 3BWUF 4X5QA 1KLFB 2JTYA 2JMRA 3JWNH 2XG5B 5LNGA 3SQBB 5FX3A 4XOBA 2J2ZB 5JQIB 4XO8A 1UWFA 4BUQA 3ME0B 4X5PA 5FLUA 2UY6B 4AVKA 4AUJA 4CSTA 1ZE3H 3JWNE 3JWNG 5CGBA 4XOCA 3RFZA 4CA4A 1TR7A 5IQMA 3ZPDA 1N12A 4ATTA 5LNEA 4XODA 4CSSA 4AVJA 4LOVA 4J3OH 3MCYA
chains in the Genus database with same CATH superfamily
4WUUA 2E56A 3DTXB 4PJBA 2NYZA 4HQQL 1NBYA 3Q6GL 4GW5A 4DUWA 4H8QA 2APSA 3KPOB 2UZPA 3REVA 1F4YL 4PJDA 1NGWA 1TJIH 3CPLB 4WHCA 1DQJB 1MAKA 3E2HC 4FJZA 1AO7B 2E59A 1MWOA 2VW4A 1A1OA 1H8SA 3AXLA 1XZ0B 4NSKA 2XBDA 4G8IB 1IAIM 2AAAA 2ZUQC 1D5IH 4LPWA 4W9CC 3BDBA 3BDXA 1J5DA 3PRZA 1XHHA 2BNRB 2J12B 3ULSA 4DKDC 1RZ7H 3FH5A 3MNWB 3DO4A 2BJML 1FIGH 3O3AB 4EF3A 4X4XB 4JRYE 5IMKA 1A6AB 3QISA 3UP1A 4XN7A 5GGVH 2K70A 2DIEA 3HMXH 4EOWL 2XZQH 4RSVA 5E0FA 2X6BA 4JN2A 3VXOB 1RJYA 3LKQB 3N1FC 3PWUA 2ZCLH 5LCVL 4YLCA 2WXGA 4JFEA 3MCG1 5KSBA 1UWXH 5GRJL 5F9JB 3KPNB 1DQLL 5HYJA 4NRYB 5JNYA 3V9EA 2VKXA 2YFOA 5KVGE 3B9DA 1KNOB 3HPLA 4EI5A 3IMSA 5DC9B 4MBRA 4GSDL 2EDEA 2Y69B 5AVWB 3ABKB 3D2UB 1UUSA 1NCUA 1NTDA 4YWGL 4LHUB 4EI6B 3H7LA 5LNGA 1NLBL 3T6WA 1ORSB 2KQNA 1BJ1J 2WUBH 3C60A 2PPDA 3L3JB 3O4OB 4YN3A 1R75A 4NENA 5DK2A 1E4JA 1NCBL 3ATDA 3UJTH 5ISZE 4ZTOL 3P2DA 3KL5A 1G5AA 4KMTH 4O58H 3V6OC 2XZCL 3VG0H 3D69A 4OGAC 3W39A 5F0LB 3UZVB 1DQDL 4F7MA 2OL3L 2OMWA 4HF5H 4HJ0D 2Y1AA 2CDFB 3ESOA 2VRAA 2F5BH 4FFTA 4HJ0C 3DGGB 3S5LG 4HMDA 1NCGA 5FF6B 5D4QA 3S3CB 3SJVA 2AXJA 5LB1A 2AJ3B 4WUUB 5C0BE 3T3PB 1JCKA 2EC8A 3QEUA 4PJBB 3RVXC 1NBYB 4UBDD 3RX9A 3O2DH 4GW5B 2AFNA 3CLWA 4UBDC 3PF2A 4H8WH 3REVB 1VB9A 1F02I 4PJDB 4XNUH 5EU4A 5DR5H 1IO4C 3FCUB 2BXZA 3D30A 5CN1A 3FTGA 4QKXB 4R4BA 3BJ91 2YJLA 1A1OB 2H1LM 3AXLB 3FO2A 3LX9A 4AJYV 3C09C 4M61A 3O6LH 5I66A 1WC7A 4HWEL 2MNUA 4XNQB 3RUGE 3ULSB 5JO5B 1WZAA 3MOQA 4RWHA 3K80A 5IMKB 3AS3A 1S7RA 5D7JB 2GJ6D 1SHSA 1GMIA 2TSAA 4YHPA 1RUMH 5D8JH 3QXUA 2X2HA 4ZI8A 4JN2B 4QWWD 1RJYB 2NY2D 3PWUB 4JFEB 5KSBB 1WD9A 4LDLB 3RFZC 3FFOA 2NY2C 4MGXA 4GAGH 5I9QC 4CVXB 5BV7L 5HYJB 5JNYB 3LJ3A 4KAQH 5DURD 3BKCH 1GTNA 2XFXA 5SX5K 3KCPA 5ACZA 3S96A 1G7HA 3Q13A 1NFAA 3MKKA 3HPLB 4EI5B 4ZFQA 3HLAA 1ZV9A 4WTWA 3SPHA 3H2WA 4OLUH 1IFGA 1OV8A 4JQVA 5KJRL 5EF2A 4TMPA 2UXVA 1RJCA 2BIOA 1F0LA 3BZ5A 3SYAA 3TZVD 4YDKH 3C60B 2H45A 3RHWF 2NNAA 2P3YA 4NENB 3TZVC 3WMPA 5DK2B 5JR1H 3KJ4B 5BQ7A 2IWGA 1I8IA 4MJ6A 4G5ZL 2KYIA 1KB5H 5E9DE 3EDFA 3RIKA 4GY4A 3ZDYF 4HUUB 5IR1A 1OY3B 3D3VD 3OMIB 3D69B 1IEBA 1UXMA 3WLBA 4Z7OF 4F7MB 4R90H 3CMOH 4KQ4L 1U41A 4KVCL 5FYJH 4PP2A 1FWXA 1RIUL 4AQ1C 1RIHH 4BUGA 1GGCH 3NQIA 5E4AA 5A2KH 1BYOA 4KTDH 3SJVB 1B0IA 4Y5VC 5DU7A 3PDOA 1IGFH 4YHLL 1JYNA 3NIFF 1BV8A 4QDGA 4A1RA 1MCJA 3QEUB 2AI0L 4JDTH 3LZPA 4XHQA 5MERA 4LAQH 4WVRA 4GXFA 2ADGA 2XIIA 5GJSL 3RI5F 3QPXH 1IE4A 4QMEA 5GGVY 3ESUF 5EU4B 4F9LA 3IRCA 3QIUA 1VA9A 3FTGB 2VDKB 4G9FD 4R4BB 3Q06A 4LARL 4M61B 5I66B 1WC7B 2F6AA 5FIEA 1JDAA 1U3HD 3LDBB 4RZKA 1TO4A 4NN6B 2DWDB 2WLJA 5C07E 1NEZA 4NI3A 1U3HC 2E4FA 4OCYH 5J5EA 2YPLD 3BD4A 3UO8B 2HA1A 1S7RB 2Z64C 2B59A 3QWOA 2P8LA 5F9OL 4AKOA 4XZ4A 2A9MH 1FO0L 4WJG3 5AALA 3HC3H 3LHPH 5DCCA 5I6XC 3NSYA 4LASL 4QF1B 3LRLA 4S1SH 3W81A 1ZGLA 3WJJC 4PUBL 3SDXF 1E6JL 3U79A 5LQBH 4LHQB 2WSKA 4GMTL 2DKUA 1GSMA 1ZTXH 3D18B 4U49A 1G7HB 4UT9A 5JHBA 2A9DA 3ELAT 1WITA 5LGKA 4Z78A 1G6RL 1P1ZB 3HLAB 1U8PA 3K5RA 2GT9A 3ZSSA 1UTDA 2Y5TA 3GMQA 3NPSC 1ULVA 3CCHB 3SEPA 2G60L 4DPBX 5EZJA 3TJPA 4NNXA 5C0GB 1FNSL 4JGNA 5HTSA 1OK8A 2NNAB 4ZTPL 1BXAA 2X89A 5BQ7B 2X4TA 3H9HB 4MJ6B 5IR1B 3WFBL 4X5WA 1XBRA 2DQCL 4I85A 3EYSL 1CVSC 1CR9H 4MJJA 1SEBA 2P5WD 3NSXA 4XOEA 3HAEH 4PP2B 4JPQA 1HI6A 2YEVB 4ELMF 4HDIA 1XO8A 3BAIA 3L4UA 1OGAE 1R46A 5DC2A 4JRXD 4HXAH 5TE7L 3DI2B 2CLVA 2YRBA 1ANUA 1PGRB 2X3BA 3CZNA 1IAOA 2ZG3A 3JWOC 3VYOA 5MERB 2ADGB 2VRKA 5BZZA 5I19H 1TJIL 3QIUB 1TTAA 3O6KH 1MCPH 3PS6A 5D7LD 4OIAA 4N5ED 5I26A 1D5IL 3U6XA 4BM7A 4N5EC 5DZAA 4GBXD 5E8PA 2AQNA 4KXZH 1RZ7L 3B2MA 1T5KA 1FC1A 1FIGL 4HCIA 2A73A 4MQXD 25C8H 2B59B 2L7EA 3QWOB 5GGVL 1NFKA 1NCDH 1UA7A 2P8LB 3IKCA 1NM4A 2DLGA 5C0CA 3EBAA 3HMXL 4WEEA 3GEWB 2X9XA 5H37A 3NH7H 1OP5K 3DMMD 3QIWB 1CYWA 5CU5A 5B38G 4FGMA 2ZCLL 4MNHA 4KUCF 5I5MA 5F0MB 3FQWA 3DMMC 3P11H 4CSSA 1PY9A 1ZGLB 5I15H 3P4LA 2GB2A 5EIIA 3UTZA 1K8IA 2CIKA 3V8OA 1Z0MA 4WF7A 5E1AB 4KWUA 4UINH 2RB8A 2PPEA 3QP3A 5B8CA 4R2GB 2YC1A 4Z78B 1IGCL 3IVKA 3B7RL 3JV5A 1U8PB 2GT9B 3A4EA 2Y5TB 3GMQB 1BVZA 4DEPB 5EZJB 5CSGA 4NNXB 1S7TB 3HMWL 1CS6A 2WUBL 3IJEB 5L2JA 4J5VA 1K5WA 4HJJL 4XX1G 3RDJA 2V9TA 1QUNA 5AZUA 4YX2H 4MWFA 1OGTA 5BPPA 2X4TB 3UJTL 2J7LA 1WDAA 3DX6A 4KMTL 4O58L 2KDYA 2PN5A 3VG0L 5FW6A 1YA5A 3I02A 2PR9A 1OW0C 3LIUA 4X5WB 4BCZA 3H2PA 4BZ2H 1JERA 1FZJA 1SEBB 4P2OD 2ZXQA 4UANA 3IFLH 1NIDA 4XPGH 4HF5L 5E7FA 2VZOA 1V54B 1HI6B 4MNGA 3WHE1 2F5BL 3M1OA 1W91A 4HDIB 3FBKA 4HOWA 4ERSL 3MRBB 4GRWB 4ANXA 3QO0A 4ZBJA 2BY2A 5AB0A 4QHPA 3QW9A 1KTKE 2QHRH 3BSHA 1BJMA 2E6PA 3VXQA 4DIXA 1IAOB 3ZMRA 4OKVA 3QUZA 2WZ0A 4PLKD 4L18A 4ZW5A 1PX8A 1P69B 2EE6A 3CFBA 4KKBD 3O2DL 4YHYC 4PLKC 4MXVE 4H8WL 4KKBC 3UTOA 4XNUL 3KL0A 1E6OH 4RRPG 5DR5L 2W07A 1O6TA 1A6WH 4LQ1A 4DW2L 1H6EA 5HVWA 4WHDA 1BM3H 4FP8H 4I9WE 3O6LL 5I8KH 3MV7D 1K3IA 4O5LH 3D0LA 3ARPA 4QRBA 4B9FA 5E2WH 2Q3XA 4P2RE 5AAMA 2A73B 4IGBA 5KZCD 1RUML 2XVKA 3IKCB 5D8JL 5C0CB 2QVTA 5C0DB 3VFWA 3O41A 2V8LA 5DO2D 2YARA 3FB7B 4JM0A 4MNHB 3D52A 5ALCH 1MRDH 1QI4A 5DO2C 4GAGL 2CR6A 2WKOF 5D4JA 5EIIB 3UTZB 1K8IB 2CIKB 2BOLA 2CHWA 4NIKB 4KAQL 3X1NA 1JV2A 2XHNA 1KELL 3VFUA 3LZOA 2J1YA 3TX4A 2YC1B 3V5DA 5LNEA 1QTSA 1WVZA 3GI9L 1SVCP 3IVKB 4TNGA 3DX7A 4OLUL 2FWOA 2Q7AA 3AU0A 2OMYA 1IKNC 5EU5B 3L1EA 1KZQA 4MS6A 4YDKL 1L5GA 5L2JB 1KJ3H 1QUNB 4XN2A 5DTFA 1EEUA 4QRFA 5DXWA 1OGTB 1O0VA 2K9FB 1KB5L 1NCNA 2W80C 1SFDA 1PZ5A 3ATBA 2QFRA 3I02B 1YYMH 1FZJB 1SRDA 1UZGA 3FXIC 4Y2LA 4R90L 4WSGA 1PSKL 1INEH 4JHUA 5FUZH 2DLFH 4MNGB 1FN4A 5AKTA 3EYUH 3QHZH 4FHKA 3MRLB 1L7IH 3MRNA 3QO0B 3ZW3A 3QZPA 1IGFL 4YDLC 1M4KA 3VXQB 1BXVA 1U8QA 2NY6B 4YAQA 4OKVB 4JDTL 3QUZB 4JL1A 4HFWB 4W9EC 3CFBB 1BYPA 4LAQL 1M2OA 3VUAA 3AAZA 1F3DJ 4PJXE 4LT7A 4XMVA 2W07B 2RCSH 1QSZA 3UABA 3OZKA 4D3CH 2FQDA 1YYCA 2MOQA 3MXVH 1FYHB 4R7XA 1GY2A 2XWJA 4R97C 5CKGA 3UEQA 1RJZA 3D0LB 4K9EC 3ZE0B 2B08A 5ES4B 4L0YA 4OCYL 3WAJA 2AZAA 4NOFA 2DL2A 2R2EA 4PJCF 4YDJA 3VFNA 1B9KA 2L7UA 1PKQA 4HEMA 2BNQE 1PTZA 4JPKH 1KFAH 2NSQA 5CKAA 4FOMA 4MDIA 5PCYA 4JFHD 3B56A 4QRUA 3HC3L 2F7OA 5LHDA 1SJEB 1F18A 1T0MA 3FCGA 3EHBC 1D5BA 4S1SL 5GS1A 5JXED 3OMAB 2OMTA 4XMWA 3ARXA 5EN3A 5JXEC 2CJSA 1EO7A 5LQBL 1YUKB 4JY4A 2IANA 3FH7A 1JV2B 1IGTB 4BZYA 5FCSH 5KS9E 1YEJL 4FQQB 5IROC 4ZD3H 3TNNB 3ILDA 2YQGA 3OAYK 4OB5L 3TL5A 5IJDC 3DX7B 4LCCC 4PBVC 4KJWC 1SZNA 3DGCR 4CILA 2YA0A 2X1OA 4RVBA 1A1NA 3RB5A 3RZCD 1WUNT 1X9RA 3EXLA 1WLHA 2IO5A 4N2HA 1MHPH 1CD1A 3RZCC 1L5GB 1HCZA 3U9WA 4DFHA 2I5YL 2VLLA 3FH8A 5DTFB 2CJTA 3BWZA 4Q74A 4BFGA 3ARZA 4PJ5E 1HNYA 3GLDA 2J20A 3ZQWA 1PZ5B 5AB9A 4OCLC 3FSZA 5CSZA 1RH8A 1G9HA 3ZQ9A 3L9EA 3VH8B 4Y4FC 3AUWB 5CF3A 5EOCJ 1SLVA 2PXYD 2V3DA 4J4PA 3TESA 2XY2A 3RNKA 3O6FD 1FN4B 2VDLH 4KXDA 2GJJA 1I1RA 3W11D 3K6NA 3MRNB 1AR1C 4HXAL 3W11C 8FABB 4FFYH 3FSOA 3W0WA 1YJDH 1NKGA 3FFDA 1PLAA 4B97A 4YAQB 4HJGA 3QQNA 4IBQA 5K59F 5EU6A 5B1BB 4H1LA 1OQOA 2NW3B 3WE6A 1UKSA 4E9YA 1FF5A 4D9QD 3UJIH 1OP3K 4AQEA 5I19L 1MJ7L 1EK3A 2VMJA 4TN9A 3S48A 2VUOA 1ETJA 1TIUA 3ARTA 3O6KL 1MCPL 3Q8FA 3QIBA 4U31A 2N01B 5T1LD 4P4KC 4MJID 2IDCA 1PIGA 3HR5B 3DROA 1JZIA 5K69A 3MUHL 1RJZB 3VD9A 2ZXWB 2R2EB 4X7DC 4YDJB 2A1WH 3SKMA 3VFNB 2XG4A 4P2QA 1PKQB 25C8L 1HJCA 1NCDL 2PCYA 4BWTA 1FHGA 3FCSA 2TSBA 4MDIB 2K8QA 4R84A 4F1SA 1WICA 4UT6A 4YUEH 1WFMA 3NH7L 1T0MB 5GS1B 1E2VA 1V3MA 3P11L 4FQ1H 4AYMC 2OMTB 4N0CD 5I15L 4CU7A 3X3GH 2P1YA 4N0CC 4JY4B 1JZGA 2IANB 4PJEF 5H4ZA 2WMPA 3IGKA 4UINL 2WAHA 1D5XA 1ZPUA 1A6UH 4UI2A 1AZZC 1X9QA 2JF1A 2QQKH 3FQRA 3IAQA 4RWYH 4FQLH 3RFRA 5BQDA 4AGQA 1S7XA 2O5ZH 4OT1H 1YECH 2QGBA 2X12A 4P2CG 4MNQE 4NJAH 3EG9A 1A1NB 5DJAB 2X6CA 1SFHA 1A5FH 2WXMA 4QHKI 1ZS2A 3JWOH 1GZHA 4ZS7L 4TLTA 2KZBA 2VLLB 4P3DA 3F7VA 1TEGA 4Y7OC 5HDOA 4YX2L 3FUFA 2K1MA 2WUCH 1V3KA 2ZWSA 2E27H 4L1SA 5EU7E 4EPSA 4DNLA 4U1GB 5F9WB 4PJHF 4LOEA 3QNFA 4C56B 4BZ2L 1E9PA 2B7DT 1PZCA 1F1GA 4EMZA 5D93C 4XPGL 1VADA 2LVEA 3RNKB 1KZYA 2XWEA 3NJVA 2ZXGA 1WIPA 4IBLT 2R59A 4OGXH 4MMZA 4OV6F 2AXGA 2XBTA 1LDPH 2VT0A 3W0WB 1JFHA 1BAFH 3FFDB 3QDJE 3TVMA 4HJGB 3QDAA 5HJDA 3IETA 5EU6B 4H1LB 5EO1B 3BPCA 5EFIA 3ZYZA 5K9KA 3QYMA 3IDYC 5DK3A 3WE6B 2XTJD 1GS8A 4X7TA 1DEEA 1UGNA 2LGNA 2XTJC 4AQEB 4KU1A 1E6OL 5EF0A 1A6WL 4HLZG 2GIMA 5ETUA 5IFAH 2AF2A 3QIBB 3S8FB 2L3BA 3RWDA 1EUTA 1MW2A 1BM3L 4FKKA 4M6NH 5IP4A 5LAPA 4FP8L 3G5XA 2E86A 3TEUA 1RUQH 5I8KL 3DROB 4O5LL 3C08H 5J1AA 3R1GH 4XCYB 3S3PA 3UCQA 3KLHD 4QT5B 4XO3A 2JWYA 3SKMB 4DGYH 2XG4B 4P2QB 4IRJD 3EO1B 4V33A 4ALAC 4XBPA 1CUOA 2VIRA 3TBSA 3QRFM 1LGVA 4IRJC 3ZDYE 3FCSB 3D05A 1XWVA 1AXSB 1MDTA 3EDEA 3MO1B 4ZX6A 4XZUA 1JK9A 1RD6A 2N7BA 5EZOH 5IB2A 5ALCL 1MRDL 4X42A 3SYOA 1H19A 3CDCA 1JGDA 1AO7D 3NCYP 2Z0UA 3L5HA 3U36A 4IBTA 1ORQA 2WMPB 4B7IA 4K94C 5I76B 1N67A 1T6VN 3NIFE 5MEPA 1D5XB 2BNRD 2G9HA 3SCMA 2DEWX 5AG8A 2J6EA 3N41B 1S7XB 5L8KB 2AMGA 4DZBB 1QWHA 5I73B 5SWQA 2ZUUA 3EG9B 3KEHA 5FGRA 1LK2A 5F7WC 4BH8B 1NDTA 4FL4B 4QYOA 4X6CA 5IB4A 5HHMB 4JLRA 3RLSA 1BZ9A 4P3DB 3F7VB 4TV3A 1EZSA 3BPOB 3K2KA 5F6HI 3L5JA 5DD0L 2F58H 3FB6A 4IBYA 5LXGH 2GAZA 1YYML 4GG6A 3OG6B 4HJEA 2A77H 1KOAA 1E9PB 3KPMA 3HB3C 1GYAA 1Y6NR 2Q8BH 1INEL 1VADB 3LMJL 4D7BA 2QGCA 2EJ1A 4G5AA 3WOVA 2DLFL 4LB8A 4V1DA 3EYUL 3QHZL 1L7IL 4MMZB 4E5XG 5F1IA 5KVFH 2AXGB 3BAEH 3HA0A 1RUAH 1O9VA 1JI2A 1K4DB 1PCXA 3AREA 3INOA 1VPOH 5IHUH 3TVMB 3N43F 3SDXE 5KOMC 5IVXF 3O4OC 4C4BA 4IEFA 3BPCB 4FFWD 4R5XA 5EFIB 5EWIH 5T3XD 5K9KB 3OV6A 2MHAA 4X7TB 1DEEB 1EIBA 4RMWA 2PR4H 3O4LA 2HTLC 2Y1YA 3GBEA 2RCSL 3HUJE 3RWDB 4D3CL 3ZHNA 4PIRF 3G5XB 2O6FA 3V0AC 1KTBA 5J1AB 4MA1B 3WKPA 3U48A 2XQYG 4YDZA 4GKNA 4WUUD 3TBSB 2VIRB 4HU8A 3B2UD 4JPKL 4ZW6A 3VFRA 4DN3H 2FJGA 1QSFE 5IT2H 2FHFA 2WP3O 3I50H 3Q2LA 4NQCA 1E4KC 4XZUB 1JK9B 3WFDH 1T21A 5IB2B 1QD0A 4GAAA 3T1FA 4ELME 1JGDB 1N18A 2CQVA 4JAMA 3ESMA 4JCMA 5G2NA 2G2NA 3U36B 1ORQB 1KGUA 5A2FA 1ZMYA 2H26A 5T5FA 4P9MH 5HJGA 3TV8A 5MEPB 4FMVA 2N0KA 1FA4A 3GGWB 3SCMB 2VRQA 1TQCC 3MOAH 1XGUA 1HS6A 1BWWA 5SWQB 2UVFA 4JFSA 4P23A 1GRWA 3VSQA 5KYYA 1MHPL 4P57A 3NCJH 1OHQA 4QYOB 5IB4B 1H8OA 2E7CA 4JLRB 3IFPA 4JFED 2F18A 4FAAB 5FW8A 2AK4E 1BBDH 1TYJA 3WCYA 1JXKA 3FB6B 4EZKA 5HYJD 2GAZB 2C34A 3HIZA 4XAKD 1VCAA 4GG6B 5D72H 1UOWA 4K9EH 3ZE2B 1GPOL 4TNVF 4K5LA 4EI5D 4Z76B 1F4WH 5I1HH 2Z1KA 2Y36L 3FYEB 4FG2A 1DVQA 1JMXA 2VDLL 4V1DB 3SYQA 3WXVL 4PD4J 5BMFH 2LV4A 3IS0X 4M43H 5F1IB 5EORH 2J8UF 1D6VH 4L2YA 3AREB 4FFYL 4HYTB 5IBUG 2CR3A 3D5OF 3C60D 2HMID 5IHBA 4XVJH 4D0BA 2XDHA 1ECZA 2R83A 3C60C 2HMIC 4IEFB 3IBEA 3P40A 2XZZA 4RMRA 2MHAB 3O4LB 3C5XA 4HK3J 4JRYA 3R8BB 1NPUA 1KENH 1G4MA 1W0WA 3MLXH 2XX0A 5EEYA 1J1OH 2MQ0A 1I9RH 1FVCA 3C5ZC 4JM4H 1PZBA 4S0SD 5HPOA 1DVSA 4PV8A 3JSSA 2X9ZA 2EYSA 3GUFA 3V0GA 1C08B 3SJVD 4NKIH 2A1WL 2FEEI 4JHWH 3VSVA 4EN3A 4JQXA 1YY9D 1CZ8H 2VITB 3PPEA 5MI0C 1E4WH 3VFRB 3KW8A 1T6BX 2FJGB 4KJQD 2FH6A 3BSZA 4YUEL 4PJ7E 1BZEA 4KJQC 4NO0B 4NQCB 4NNPH 4DPRA 3PWNA 1T21B 4FQ1L 1TVDA 1AE6H 3T1FB 4AVIA 3QVAA 1HOCA 1UWGH 3EGSB 3GMLA 3X3GL 2XPGA 2VDQB 1MCBA 4IRSB 1N4XH 3ZYJA 2H26B 4XPTL 2W81C 5IV2A 3TWYA 5ISZA 2JCCF 1A6UL 2DQIH 4EIUA 4RWYL 2QQKL 4RISH 4FQLL 4KK9C 4XVOA 1XGUB 4OT1L 2O5ZL 2X3CA 4WTQA 1YECL 1NPNA 1JGLH 4NJAL 1IFHH 1NBZA 4JFFA 3QR0A 3U6RB 1A5FL 3JWOL 5KYYB 5GRYA 2Y2YA 3NIDE 4XVTH 1AKPA 3LNEA 3IFPB 5AW0B 4UDTA 1NZRA 1UXWA 4GT7A 1EZVX 2B14A 4LCWB 1HQRA 3EUUA 1IGIH 4NQEE 1K9TA 1X5LA 4QO1A 1DVFC 3S37X 3RBSA 2ZOUA 1L0YA 4URKA 4RZCA 1YY8A 5H8DA 5JHDA 3AXHA 4Q58C 5BCAA 4FQXB 1M6OA 1MHEA 3QYNA 1I7ZB 3RIAK 5CZVL 4RDBA 3HG4A 4OGXL 5I8EA 2BW4A 3IKKA 4JQVC 3N5AA 1LDPL 4LSTH 1CLOH 4UAOC 1BAFL 3ISYA 2DI7A 2XU9A 3GD1C 5GRVK 5TFSH 3TIEA 4D0BB 1SJVA 2OK0H 1IBZA 5JW4M 3HC2A 4DJMA 5I8OL 1QWNA 1AY1H 4B3EA 5AOLA 2WSDA 2VDPB 4AH2A 4FD0A 5IFAL 4I7ZC 4MAYA 2LU4A 4GXUM 4J3WA 1W0WB 1S7VA 3BN9C 1KTRL 1FVCB 3EUDA 2X7LA 4M6NL 2LW3A 5T5NG 3ZO0A 3ARFA 4PV8B 1ZHLA 1RUQL 1TG8A 3WO3B 2EYSB 4RGMC 3EADA 3RX5A 4AQAA 4P3CH 2ISDA 3I9IA 3S36H 3R1GL 1A22B 43CAA 1ZJAA 4MCYA 1E5UI 5FO2A 4DGYL 1H9DA 1F4XH 3CZEA 4GP8B 5JUEH 2Y3NA 3HNSL 5TF1H 5EZOL 1BPVA 3PWNB 2PO6A 4FHJA 1U8HA 3QIUD 1YEGL 4F9LC 1HOCB 5EU3A 1YNTF 4JANA 4OJFH 4LLUA 2ZICA 5KN5A 3EJZC 5IV2B 3GZKA 1Z5LB 2BDNL 5E9DA 1PQZB 2H0PA 2VUYA 1UZ6F 1WEJH 2GUYA 2JQMA 1CDCA 1NBZB 4JFFB 3ZL4H 3AWEA 2CLRA 2JJSA 2R0KH 3R0MA 4P49A 4G6JH 2YA1A 1T89A 2ZOLB 1PNDA 5I23A 1VFAA 3WMSA 1HAWA 2AERT 2CM5A 3ARBA 3WY2A 2CCLA 1CFVL 1HQRB 1OK0A 2DH2A 1Y1DA 4PJ8A 4AZUA 1MNNA 2F58L 5LXGL 2QV2A 3TWCH 5C7XH 2AK1H 2A77L 1ZLUH 4QO1B 4AEFA 5DS1A 3NABH 1SVBA 2Q8BL 4R2GD 3Q8BA 4KGJA 1JPGA 4RZCB 1YY8B 5JHDB 1BZDA 4KKLD 4R2GC 1M6OB 2WLNA 1MHEB 4ALAH 4KKLC 2CNZA 4N2BA 5I8EB 2J57A 3BAEL 3MROA 1RUAL 2C8NA 4DEPC 4BRJA 4KNUA 1VPOL 4TTDD 3TIEB 1BZOA 3LV3A 5C07A 2DJUA 2X89D 1UADC 4G3YL 5EWIL 5FYKH 1NBQA 5JOPD 4J3OG 4HHAA 1W2KT 1SDAB 3CC5A 1NBCA 2PR4L 2ZXEB 4AH2B 4ONFH 1WAPA 1XD0A 5C3TA 1XCTA 4K94H 4MAYB 3WTWA 1S7VB 1ZK9A 2X7LB 4OCWH 1N68A 2GSIA 3AQXA 4L5FE 1U4FA 3ARFB 3EYOA 1ZHLB 1OWRM 1P6AB 1PD1A 3BISA 4AQAB 2UVEA 4L8BA 4C4KO 1GH7A 4WRLA 4HKZA 2DLIA 1E5YA 1ZLWH 43CAB 3K46A 3NJHA 4MCYB 3ULUD 4UM9B 3CAFA 4MYPA 4PSPA 2NR6C 4LSSH 2UYLA 4MLIA 4ORZC 2XWTA 2DKSA 5IT2L 3I50L 4QOKA 5AL8A 1QFUH 3VTTA 3OB8A 2ARJQ 4FTVE 5IJVA 1IFRA 4HXBH 3TT3L 3KG5A 1ZRUA 3WFDL 5A6LA 4OIBA 4CNIA 1U8HB 3JV6A 3Q1EA 1WK0A 3CHPA 1TSRA 2ZAGA 5F93C 4U1IB 4IKLA 4JANB 2BVPA 2NX5E 5KN5B 2OM5A 5GJTH 2P47B 3CFKB 3G5VA 3L8QA 4P9ML 4DVBA 3I9AA 4QY8B 3VGBA 5K59E 1HH9A 4XNZC 5E9DB 3MOAL 5K39A 3V4VB 1T1YA 4AL8C 4XP1H 2I24N 5C0CD 3B9KB 4OZIE 2CLRB 3NCJL 1R3JA 2C5DC 3TO4A 5C0JA 3VD1A 4ZXBC 3L1OH 4UQ9A 1G87A 4I8DA 1EGJL 2CO1A 3ARBB 1OGAA 4OZGB 2WTRA 1GKEA 2GC4C 1S8DA 2VDNH 3L4WA 4Z95H 4PJ8B 2EE0A 2Y4SA 2IPUK 1AGCA 3HPJA 2FLMA 2BSRA 3P4NA 4PYHA 5FFGA 1IRAY 4K9EL 1JPGB 4I88A 4LGPB 5E1IA 1F4WL 5I1HL 5B8CC 4XBGA 1KTLA 5BMFL 3PP4H 2VCOA 3QQ4A 5I18H 1OE2A 1A47A 2WD0A 1QZ1A 3QQ3A 4M43L 3QUGA 3ULVD 3MROB 1THAA 5EORL 2IWKA 1D6VL 4AITA 1P5VA 2ALWA 5JIQA 1Q4NX 2VGLM 4W9FC 3WY4A 4QLRA 3LH8A 2VW6A 4XVJL 5GSVA 3LV3B 5E6RB 1J9QA 3FN3A 3RGVA 3MI6A 3SDYL 2ZKYA 3OHXB 4HHAB 1A0QH 3P3YA 4MD4A 3O45A 4BUHA 1KENL 2FCBA 1XCTB 3CNKA 4MJ5A 1MPAH 3BUQA 1J1OL 3L1GA 4JM4L 3OLEA 2GSIB 3RHWK 3EYOB 3FRUA 1GYCA 5L9DH 1CCZA 4L8BB 2DF3A 4HKZB 4PI2A 2XWDA 2AGJH 4NKIL 3ZKMD 2AQ3A 4JHWL 4Y5YA 5D96C 4N9OB 1CZ8L 2NY6D 3QJUB 4B7LA 1E4WL 5FYJE 2LVCA 3QUZD 2XWTB 4DP8X 1FLTX 2JV6A 4PY8J 4QOKB 3QUZC 4PJHE 1H3PH 3CH1A 3KH4A 5IJVB 4NNPL 1JXJA 4CNIB 3LNIA 3JV6B 1AE6L 1BQHA 4OI7A 1N3NA 1UWGL 1FG9C 5HD8C 2BVPB 1N4XL 3G5VB 2FLBT 4DVBB 5DMYA 2DQIL 3RI5K 4GUPA 1KCWA 1HH9B 4RISL 3HRPA 1UD3A 1S7QA 2HFEA 5K39B 2X0WA 4J6IA 1T1YB 1JGLL 4IGBD 4ZS6C 4GOSA 4S1QH 4IGBC 4I1RA 4RESB 1R3JB 1KB9K 2ZX5A 3TO4B 1JZEA 2PP9A 3IJ8A 1YEKH 4EIBA 1AIZA 1IB5A 2RAMA 1OGAB 1S8DB 1IGIL 3CFJA 4AVJA 3UXFA 1S3KH 2BIMA 1W6LA 1R1CA 3QJXA 4Y5XC 1NMBH 3HPJB 3OSVA 3OAWA 2BSRB 3EJCA 3P4NB 4HP5A 3FUEA 4RBPK 1HL9A 4HV8A 4XBGB 1KTLB 2DAVA 5DA0B 2DM7A 3P3RA 2E9BA 1UCBL 3QQ4B 4G1MB 3QQ3B 1I53A 2WKLA 4HGWA 3I6LD 1P5VB 3RWHB 1ZTXE 4LSTL 2WOBA 1CLOL 5D1QE 1AQ8A 4JG1H 3SE4C 3E6HA 3MJ9H 2OK0L 5GSVB 2BFGA 1KXTA 4XXCA 3NTCH 4XE0A 3RGVB 1AY1L 1HN1A 1N5AA 3I9GH 4W68A 5AZEH 3KW7A 5C0FA 4MD4B 2VM4A 3O45B 4P2RA 4TQPA 5FEBA 2X05A 3ROOA 2VDKH 3WNNA 3T4YA 5M7QA 4N28A 4A6YA 4PU2A 4WEBH 1LE9A 2VDOB 4Y19E 2MPAH 4A7VA 3FRUB 3OXRA 4F33A 3S36L 3SIKA 2EABA 4Y5YB 1MJ8H 2EH7H 3GC3A 4U6TA 1F4XL 3AY2A 4WFEE 5F70A 1VAHA 4JX0A 4ZRGA 4LIQE 5JUEL 3CH1B 3GXMA 3BHBA 2HX8A 3N44B 2DZEA 4Z7VF 4PB0H 2E8YA 5TF1L 1EVTC 1KG0A 1TENA 3ZIYA 3NZHH 4PGDA 1BQHB 2MNJB 1BPLB 3AY4A 1N3NB 3FS9A 1UEYA 4M9OA 1XGPA 1U8IA 4URTB 3VG9B 3O3EA 3P0VL 3RVTD 4MD0B 4UV7H 4GUPB 5J7CC 1WISA 3RVTC 2Y7MA 1MW1A 1WD8A 1S7QB 2HFEB 5BOJA 4JFZH 1UA3A 3ZL4L 1N7MH 2VO8A 2XWRA 2R0KL 2ETWA 4MJ2A 3BXNA 4G6JL 4X5PA 4GFXA 5CBAA 1SMOA 2E9IA 2VMEA 3SE3A 4N87A 1KEMH 1JYXA 1ZT4A 2IAND 3TWCL 3VXTA 5C7XL 2QBWA 4TSCH 2RQEA 1WA2X 1DL7H 2CBOA 4FMKA 3NABL 3CFDA 4JGUA 7FABH 1JTOA 4HV8B 4KI5C 2FDBP 3VD3A 4GQPH 3SGJA 4A2HA 1CXIA 4PJXA 3WHE0 3C5JA 2QLYA 3HFML 1RZKH 3MRKA 4ALAL 2HX9A 2ENYA 3MBWA 4NZFA 2VXQA 4H8VA 4HGWB 4E9TA 3E6HB 4TS6A 1KXTB 3BE1H 1SYSA 4E36A 3MA7A 1N5AB 2AQQA 4KKAC 5HP5A 4WEUD 5C0FB 1B9ZA 2BNQA 4ONFL 2DQMA 3ROOB 3W3BA 2EO9A 4WJ5A 4K94L 4U33A 3T4YB 3O0LA 4U1GC 5F7LB 2V7NA 1QVOB 3HKZA 4A6YB 4J4PD 3FTVA 4OCWL 1ZVYA 4F7TA 1WAAF 3PXHA 1LE9B 1G7QA 1XGQA 2CRZA 3L4XA 1FZOA 3OXRB 4F33B 1KY6A 3TONA 3ZE1E 1QBLL 2VC2B 3W0WD 1MFDH 3SKJL 3GBLA 5D2NE 4N2CA 2UY7A 1G7JA 3QPQC 2YD8A 5EU6D 5KS9A 1AH1A 2GSGA 3FAXA 2O6CA 1A3RH 3BHBB 3S8GB 3G5YB 4OLWH 1KG0B 2GCYA 3EDKA 2EDOA 4PGDB 3FBQA 2A9BA 3GINA 3QIBD 5IQOA 1XGPB 1U8IB 1JF5A 2VM3A 3O3EB 5KUMA 1FSKB 1JCVA 5GJTL 3ARSA 4YGVA 2YD1A 4PFEA 4WGKA 3T6ZA 3G08A 5FECA 5D7IE 4P2QD 4QRTA 3D85A 4WWPA 5EBGA 2Z93A 4PBDA 4XP1L 1OB0A 3KYOA 2P49B 4M7LH 1KGXA 1OB1A 1SVZA 1X5IA 4NYLA 3BXNB 3LH9A 1HZLA 2E7BA 3L1OL 5CBAB 2X4QA 1X5AA 1JF1A 1QUPA 2YN3A 4M7ZC 2VDNL 5LGHH 1UOKA 4ZMZA 1NIEA 1ZT4B 4Z95L 4Z8FL 1J48A 3VXTB 1AZCA 4OIIH 3VXMA 4JHZA 3GXTA 4KDTA 3CFDB 3FAWA 2IOMA 2WXQA 4ZT1A 3BCDA 1NOAA 4UB0H 4PJXB 3JTSA 1CXKA 3C5JB 3K1KC 3MRKB 3H9SE 3MBWB 5DQ9A 5LBSA 1R4XA 5I73C 1SGKA 1UG9A 2AV1A 2D31B 5DS8A 5HHMD 3MBXH 4FL4C 1JG9A 5E99H 1JPFA 3MA7B 3FN0H 1PZ3A 4ZO6A 1A0QL 1XB8A 3BPOC 4OM1H 4U6YA 5G5DA 3DARA 3G6JE 5FO9A 4EVNA 1P4UA 2BNQB 2JCCE 1EHKB 1QW8A 4NOBA 4J8RA 5LDUA 1MPAL 2P80A 1OKEA 2AVGA 2EXTA 3QUMA 2V7NB 4HC1H 1IC4H 4I89A 1RZ8A 5GRUL 4F7TB 2WXPA 3T2LA 1G7QB 1XGQB 1BVLA 1CDJA 1D2OA 1PZDA 1UHVA 3MJ8A 1FZOB 3PY9A 2IALA 3VSUA 4H8PA 3F01A 5HYSA 1SUJA 3CSYA 3OKYA 4AL8H 2AGJL 3SOBH 2MCG1 4MMZC 1DLFH 2D0GA 3BUTA 3SE9H 2IBZX 2HH0H 3TVMD 2UY7B 1HWGB 4D0CA 2V8MA 1G7JB 5KS9B 3TVMC 3V4PB 3F8UB 2GSGB 3WDJA 1PKOA 3WNOA 1H3PL 5IWLA 3HS8A 4ZMLA 3TBCA 3U2IA 5HYFA 5E7BA 1EJFA 2GCYB 4MNQA 5FO8B 3PWJA 4UU9A 3P3TA 4L4VE 4MKTA 4XMZA 4HEPA 4OGZA 2ZT9C 2X0UA 1PX4A 1I9IH 2NXZB 2R1WA 5EO0A 2YAHA 3PGFL 1QFPA 3GRBA 5I0YA 4YGVB 3RTLA 4GPVA 4LSQH 3G08B 1BG9A 1XX9C 3CXFA 4QRTB 3QJHA 3D85B 4LCUA 1H15A 1QWUA 1MJJA 1W72A 2G3ZA 2Z93B 5IJKC 4ZX5A 3U2JA 1I1AC 4S1QL 4AGOA 4NYLB 4ZNCD 3CDYA 2X4QB 3F6LA 1JZ4A 1X3DA 2EDNA 1IX2A 1JF1B 2FNWA 2GHZA 3LSOA 4XMKH 3T2QA 4JFUA 1QSEE 1AXIB 1S3KL 2EEXA 2K45A 3F2LA 3SDCA 3QDJA 1UWXK 3VXMB 2CUAA 1TQBB 3ARUA 4JO2H 5ANME 4ZW8A 1E5ZA 3UZQA 5JORA 3KPRE 5E6UB 2NT1A 3MLZL 3GSUA 2EH8H 1U8NA 3SCMD 3D09A 4QCIA 5BO1H 3JTSB 1Q9LB 1PX3A 2ZWZA 2DICA 4GO9A 1YDPA 4KRMB 5A3IC 2WVSA 1GZQA 4XO8A 3C8KB 2F54E 3QARA 5DQ9B 1OAXH 3Q7JA 6PAZA 1BG1A 4ZMNA 2BIPA 2AV1B 4TUJA 3CXDH 4HAKA 4JG1L 3D06A 3B1TA 3GEFA 4X4YA 3ABZA 3CSPA 1JPFB 1J86A 3I9GL 2Y0SA 2ZCHH 5AZEL 4U6YB 5G5DB 5FO9B 4EVNB 2ERJC 4R7DA 4MQTB 4XAWH 5AOMA 2VDKL 2ORBH 4R0LB 3M8OH 5INDA 4MJ4A 3QUMB 4ODUA 4LEOA 3RE0A 3SY6A 2E9WA 1RZ8B 4MFHA 3FB5A 4NQDE 4WEBL 1XH0A 2MPAL 1BVLB 3MJ8B 3CFNA 1O7VA 4V1DD 2IALB 3VCLB 1K2DA 2YPVH 3WG7B 2DWXA 4X2UA 5HYSB 1J05A 1XCWA 5KYNA 1B3IA 5I0WA 1MJ8L 2YXMA 2EUZA 3ARED 3I9PA 2EH7L 2I60H 3TCTA 3AREC 4D0CB 4OLZH 1E5AA 4I0CC 5JHLA 5FUOH 3OKDA 4ECNA 5K9QI 5D7KD 2MWCA 1JVLA 4WWID 3O4LD 2VZ1A 4PB0L 5I6NA 2IG2H 3K2MC 3ZDZE 3J8F7 5K1NA 3NZHL 3PWJB 1FLRH 4UU9B 1WA1X 1B4LA 2I7OA 2WINA 3CFUA 2D7NA 5E2TH 2QDWA 4M3JA 1QEXA 5DMJB 5F44A 2R1WB 3DURA 5EO0B 1T22A 1QZNA 2DLEA 3UEZA 4F24A 5H35A 4UV7L 3TF4A 1X4ZA 2J4WH 4N2DA 3MBEA 4IMKC 4XP4H 2PW2A 3QJHB 4LCUB 1H15B 4M7KH 5I75B 1MJJB 1W72B 4XVUD 1VGKA 1N9PA 1EH9A 1N7ML 3K4ZA 3VU1A 1U9KA 4XVUC 1R3HA 2FTAA 1NFIB 4NQCD 2HSIA 5HJ3A 3Q2NA 1P1VA 5IK3A 3UBXI 4Y9EA 3LSOB 3OKKA 2XRAH 4KZEH 4R6UA 3UERA 3APCA 3K4AA 4E42B 1J1XL 1J11A 3EZ8A 3SDXA 4PW9A 1DL7L 3UZQB 4RGOH 1X5YA 2X4SB 2XIDA 2HT3D 3GSUB 4WENB 1U8NB 4E9VA 2EUXA 3GMRA 3O3UN 4QCIB 4BEIA 1TVHA 2HT3C 4HWBH 3VGAB 3WDIA 1YDPB 1GZQB 3HUJA 4MDJA 3HE7A 4P23D 2X2UA 4WWOA 5E6ZA 4PJDF 4RFEA 4Z1PA 1UD2A 3UG3A 4F7PA 1MDAA 4P23C 2M83A 2BOCA 2FGWH 3T04D 3QRBA 3EJPA 1OCRB 4ZAKB 3BE1L 4X4YB 3QJQB 1TMCB 2Z65C 4ES8A 4DKTA 3NCBB 4PP1C 2D03L 2OL3A 4R7DB 4JMNA 5I1KL 1CTMA 1N10A 3GQFA 1XIWA 3ZDYB 4W6YB 1TZIA 1QSFA 1ZJBA 4LEOB 4ODUB 4R4ND 3WJLA 4JFYA 3RWJA 4KOCA 2PP8A 1PL3A 3X12A 3WEOA 4Z7OB 1S5HA 2DB8A 2ADJA 1K2DB 2W65A 1J05B 1W9XA 4ELMA 3DRQB 3CV5A 5B4MD 3O2VH 5SV3A 1MFDL 4B5ZA 5B4MC 4EN2A 1F1AA 4G7RB 3NIFB 2WAQA 3OKDB 1N12A 1A3RL 3P9MA 5D7EA 2WQWA 4XPHL 4XX1E 3UTPE 4BFFA 1DBKH 4OLWL 4JRYD 4R96A 2IAMA 3FU8A 4K73A 1OLZA 3Q2WA 2WINB 5J3HD 1O5PA 1WZLA 2W0PA 1N6VA 3AUVA 3B34A 3MC0A 4UT9L 4LQFH 4ELKA 4NC1E 4YSUA 1XT5A 1XBDA 2WO4A 3DURB 2X38A 1GMEA 1T22B 9PCYA 2AK4A 3B2DC 5H35B 4FFVD 1BZ7A 4Y1AB 3MBEB 1BMWA 1JJUA 4EN3D 2ZF9A 2PW2B 3FU3A 4AUYA 4BGLA 5J13C 4P4RB 1J87A 4EN3C 1VGKB 3IFNH 4JQXC 3L13A 2FX9H 1F45A 4DP6X 1ZXKA 4M7LL 1DQTA 2BCKA 1R3HB 3HS0A 3J7HA 4DPCX 4MSWA 5I6OA 4FQ2H 5HJ3B 4AEIH 5IVOA 3SYPA 5B3JF 3OKKB 1YAIA 2OKMA 3QEHB 5LGHL 4ODHH 4LDEB 4HBQA 4K5PA 4WHTA 2B2XH 4H88L 4OIIL 3SDXB 4YSCA 4WTZG 3KMDA 3VI4F 2VR8A 5ISZD 3UH8A 1MRCH 2ZPKH 3GMRB 4JFOA 4UB0L 1TVHB 1TJXA 2DTSA 1T7WA 2ZIDA 3BI9X 1V3JA 4W9LC 3RWGA 4JFFD 3HE7B 4ZYKA 4RFEB 3D4CA 4RGNE 4RX4A 1AHWA 5E6YA 4F7PB 3IPBA 5HDWA 1A4KA 4G80A 2BOCB 3MBXL 4S11A 3L17A 5E99L 4HOXA 3FN0L 4YR6A 1CLCA 2AJSH 3QAQA 4PGBB 1KCSH 4OM1L 3QDGE 1MW3A 2OBGA 1I9EA 2OL3B 4QTHA 2FIRT 4Y2DB 3DV4A 1XIWB 1JZ5A 3BKMH 3DA0A 1TZIB 1QSFB 3R19A 4HIXH 3N1MC 4G6MH 4HC1L 1IC4L 2OR9H 3AZUA 4JFYB 1CXEA 3RWJB 5L2KE 5JHDD 3X12B 5L88H 1OTSD 2V5RA 1S5HB 1DJSA 2V5SA 2ADJB 3CD4A 3L9YA 4ZJ9A 3IMTA 2Y1VA 4MA3B 1OTSC 1XSOA 2W65B 2X70B 4AL8L 3HHMA 4YLBA 4ZQKA 3SOBL 4ELMB 4M5YH 3GBNH 3HI5H 4WTXA 3SE9L 2ZYHA 3DSFH 2HH0L 1MI5E 2CU9A 4WFFD 2DBJA 1NGQL 3VW3H 2Q6WA 3M7OA 2PW1A 3P9MB 2O6EA 1XEDA 5KVFE 4DK3A 2WB7A 4R96B 1MFNA 2IAMB 3NCCB 1TU2A 3P3SA 2OR8A 4MAYD 2DQJH 3KYNA 2H6PB 1YC7A 1G43A 3FW6A 3L7FA 4JDVA 2VR5A 4MAYC 2JKTM 3M88A 5I0DA 5JOEA 3RL1A 3ARFD 2OZNA 4YSRA 3TEXA 2Z8WC 4IDJH 1JL8A 4UTBA 5K9QG 3KR3H 4LSQL 3F00A 1BZ7B 3IK2A 2CPUA 2YQ3A 4EJ1C 2NY1B 1U2YA 2X4UA 1FO0A 4BWWA 1E9OB 4KZDH 1A7QH 2BCKB 3HS0B 3MRPA 4IBSA 5FOBA 1HEZA 1XV8A 2A2QT 4KPHH 3E8UH 4MSWB 1UASA 2DW5A 4AV4A 5TDNA 2PO6D 2IAAC 5BV7B 5HVHC 4XMKL 2NUPB 4L3CA 3UX9B 5AB1A 2PO6C 1DCEA 3FT0A 1LO0H 3O9WC 1ZV5A 5DHDA 2GIYA 4WHTB 1DSYA 1E3ZA 1MQKL 3CMGA 4IHOB 2WKOA 4LLYA 4JO2L 1QHQA 2WGXA 1ZEAH 5IOPA 4C4UA 3D25A 1M9WA 2L0DA 4HG4K 1IILE 1JMZA 5FPIA 3BPLB 4JFOB 5E9DD 5BO1L 5F8QC 3OJ2C 3UBXG 2X1XR 3RWGB 4IBWA 1OAXL 2P5EE 3ARGC 1S9WA 4ZYKB 4Z7VE 1AHWB 4PS3A 5DEZA 1YEIH 4FXLA 1QR1A 3CXDL 5BOZG 1WS8A 1A4KB 2HG0A 2OMBA 4G80B 5C0EA 2JJSC 5C6WH 4ZFFA 4KMLB 3HC4H 1T89C 5CP7A 4AC4A 2I85A 3ARBD 3ZZLA 4YR6B 4UTAA 2V2XA 1YYLH 2ZCHL 5CAYB 4PJ8D 3ARBC 3LRSA 4GRLB 4P46A 4PJ8C 4XAWL 4JPVH 1TZGH 2WNGA 2ORBL 3ARYA 3BWSA 3DV4B 2UXGA 1QOKA 2WXFA 4G72B 3NZUA 4Q89A 4PRBA 5DSCA 1MCKA 3LZFH 4DTGH 3K1DA 5BZDA 1M7XA 4ZQKB 2QKSA 3S2CA 4Z3JA 4PCTA 3I6KA 4J6RH 2ITEA 2I60L 2VLJB 4QAWA 3LN9A 4J3TA 4B3VA 2JMRA 4OLZL 4TNVK 3WI9A 5C07D 2E7HA 4JKPL 2DMGA 4MCMA 4Q2ZA 5DFAA 5FUOL 5FX3A 2Q6WB 3ROLA 3ZHLA 4Y9CA 2EICA 3AMLA 2DYPA 1XMEB 2IG2L 5KW9H 3KPQA 3PV7A 1BQLH 1TU2B 1KJVA 5E2TL 3L7FB 3DIFA 1N5YL 2DM3A 5DD3L 3RL1B 5ESAA 4LE8A 1OGPA 3M45A 3ZXAC 4OBSA 4BFEA 4F80A 3DXAA 5CS7A 3T65A 2IH1A 1UURA 4N3TA 2B1HL 4KK8C 2FR4A 2LTQB 3AB0B 3UAEA 2DQEH 2J4WL 1FYTA 2J25A 5IW1A 5AYUL 4XP4L 1GAFL 2X4UB 4M7KL 4NQSB 1FO0B 4TQIA 1L9TA 1YO4A 2YGNA 4PJCA 4FG4A 2C9RA 4YGAB 3Q01A 3MRPB 1HZHH 4QOKD 5FOBB 1HEZB 3NZ8B 4JPWH 4NKQB 3V4LA 4H5SB 2UY6A 3II3A 3OWEA 1PD6A 1KPVA 2AANA 3M1CA 5DK0A 5SWZE 3CU1A 4L3CB 2XRAL 4KZEL 2CBTA 1LP9E 4LLYB 1CICB 2X0VA 5IOPB 2QSCH 1UT2A 3L5WA 4RGOL 3D25B 2WZAA 1XVSA 1MWAA 4PWIA 3QXWA 3BQUC 1XGYH 4HWBL 1GS6X 4AW4A 3EH3B 3E9UA 3IJHA 3VGHA 1S9WB 3OKOA 4ZMTA 3PQYE 5T1KA 1QR1B 3T6QC 5C0EB 3TO4D 1YN6A 2PLTA 2FGWL 3SE6A 4UOZA 4ZFFB 2WQVA 1DE4A 4GP5B 4J3UA 5CP7B 1W8EA 3TO4C 1HTYA 1OGAD 2B39A 2V2XB 4XN9A 4MBOA 2R56L 3GJEB 3LRSB 4IM8A 3UL4A 3HZ3A 4P46B 3QJFA 3CFQA 2QZ5A 3EKCA 5DLLA 3H8NA 3L3DA 1SJXA 5JOFA 3G7TA 3LNDA 2BS71 4PRBB 5D9SA 5DSCB 4FTVA 3NFSH 5KWYC 1WQVT 1ND0A 2W59A 2Y6TE 4F27A 2D2OA 5BZDB 2IDQA 3KHOA 1JPTH 5CIPA 3UAFA 5ID0A 1TZHB 3O2VL 1CFQA 3MA9H 3PLYA 3BVNA 1VGEL 2P43B 5DUPH 2OYLA 5KVDH 3O2DA 4HT1H 3ZDXF 3JV4A 4Q2ZB 3RGVD 4NZRH 3WSQL 3ROLB 1FC2D 4UOJA 2Z0BA 4OFPA 2DWTA 2DYPB 3BKYH 2Y06H 4H26A 5JIPA 1WCBA 1CE1H 3FQUA 3KPQB 4BCXA 2LAGB 2ZCKH 4YXHH 1VJSA 4OQ1A 1RIVH 2VDQH 2JKWA 2Y6SD 3B8SA 4BFKA 3DIFB 1U92A 1GVIA 1BQ5A 1KTCA 1T5XB 1VF5C 5ESAB 3U4AA 3G04A 1IGMH 3DXAB 3T65B 2IH1B 2FR4B 3WL9A 5LDSA 3NACH 2WLHA 1RP8A 1JGVH 1Z9MA 1FYTB 5IW1B 5G55A 2OCJA 4NHCH 1RSYA 4Y5YC 2VERN 3IFNL 1OPGL 2CG9X 2FX9L 4PJCB 1CFSA 4U1JA 4LHUG 2VW7A 4XB8A 5ID1A 1DDHA 3O3DA 3UTTE 2WLKA 1DN0A 4FQ2L 3L54A 2UY6B 4MHHG 3PABB 4W93A 1KPVB 5FOJA 3BX7C 4M93B 3MGAA 3OM3B 4ODHL 3B3IB 4XCNA 5EC2A 2VAAA 1LILA 3MTRA 3P02A 4JO4H 5I6MA 2B2XL 3V0JA 2DQFA 2FO4A 4KJYA 2YD3A 5CR8A 3VG9C 2KLRA 3L5WB 4N2FA 5JQHC 1PF3A 4OLXH 1BJ1H 1MRCL 3FRPA 4X7SH 2ZPKL 5DFVC 1BLNA 1HXYA 2JQAA 1XQ4A 2F7IA 3FUHA 5I71B 3PWVA 3OKOB 1OD7A 4LDCA 3BLKA 4X6BA 2CBMA 1NOLA 4QXTB 5BRQA 1KB5A 1DE4B 2YXVA 2LAAA 2AJSL 1KCSL 4K7FA 1WH0A 2C7FA 4YSSA 3QJFB 4AW7A 3OKMA 3BKML 3AWFA 1LVEA 4KX9A 2AEIT 3L3DB 1FPTL 2WYZA 3FU6A 4FQJH 4G6ML 4HIXL 4Y7MA 3SGDI 2OR9L 3EFDH 5JOFB 5L88L 4PJHA 5D9SB 4YHOH 4FTVB 1E4XI 1H0DA 1E0OB 2K8MA 3LS5H 4K3EL 3WXWH 3TOPA 1ND0B 4JFDE 1YZZA 1O9WA 4PMEA 1GW6A 2XT1B 5DUBB 5IGXH 4M5YL 3GBNL 5ID0B 2BIIA 5KVGH 3NGBB 1CFQB 1R6VA 1W15A 2MTAA 3BVNB 2IC2A 4I9WD 1T04A 3DSFL 1YN7A 1XDTT 3VW3L 3JV4B 1AHMA 1HU8A 3KBEA 5DJDA 3TIDA 4XC3H 2A6IA 4XXCC 3GHPA 4H26B 4P2RD 1WCBB 4GIAA 4AYSA 1YNKH 1KYAA 2DQJL 3T6VA 4KO7A 2P42B 4DQAA 3LH2H 4OZFG 4D9LH 1U92B 5FYKE 4CSZA 4D94A 1PZ2A 1X44A 3G04B 4IDJL 5GZOA 2NRDA 4CADA 3WL9B 5HYIA 2D7PA 3QUXA 4FKHA 3QZMA 3RKDD 4R5VA 4F1ZA 1PJ9A 5J4MA 4PRIA 1CFSB 3FJTA 4U1JB 2ZONA 2OV0A 3B7SA 5ID1B 2E7LC 3JWDL 1DDHB 1PIFA 2FYVA 3E8UL 1DN0B 1XB6A 4GQ9H 1EUUA 1V55B 2CXKA 3IDIA 5EA0H 5HDBF 5BUGA 3IDNA 5EC2B 4XCNB 2VAAB 1LO0L 3QPKA 5D1QA 2JNZA 2DQFB 2HVJA 3AY4C 1TZOA 1ESOA 1QRKA 3ZZQA 2IV8A 4PJEB 2QDVA 2HJFB 1SQ2N 3FRPB 5DYOB 3TT1L 1BLNB 1HXYB 3UTQA 4AGLA 1U6AL 2C9XA 1DFXA 5CZXD 3PWVB 3R8QA 1FGVH 4FRWA 3WUWG 4X0KB 4X6BB 5FGCB 1YEIL 4E9SA 4ZOEA 4N85A 2XN9E 4M9PA 4Y19A 1TQTA 3RILA 3SQOH 3WE1A 4ZW3A 1H5BC 1KB5B 1P0SE 3HC4L 5D1XE 3QRGH 5L6YL 4NZ8A 1NGPH 2AQTA 4K7FB 2Q5BA 5F1SA 3GUTA 5JIMA 1CLVA 2O5YH 4E9RA 4KKRA 4OGYH 3HG5A 1TZGL 1JHTB 2XG5A 3EGDA 1J0KA 1KWGA 4PJHB 3U1QA 1H0DB 2RTTA 3LZFL 3QK0A 4DTGL 4XBEL 2JI1A 5DZVA 2HRPL 4FXTA 1GIGL 1R33A 4BDVA 4GKSA 6CGTA 1EFXA 2LLGA 2YXWA 4J6RL 1T04B 4LVOC 1SM3H 1YN7B 1UZ8B 2XKSA 4JO1H 5CEZE 5D1ZB 4AYEC 4F9PA 2XIBA 2ZTBA 2JKRM 4PJAF 3TYFA 5C6TL 4N8CL 5DJDB 3TIDB 4NBXB 3PGDA 2A6IB 1PG7X 3VX1A 2F15A 4KI5F 1B6DA 4AK2A 4KOBA 1JYWA 5KW9L 2GEQA 2BNQD 2R4SH 4W9KC 1BQLL 1OEZW 1LWHA 3IAPA 4KO6A 2V2WA 4N24A 2ICCA 1OIOA 1UM5H 2XETA 5H2BA 4NKMA 3F58L 1EX0A 4M62H 2H0JA 1HZKA 2J6EL 3IRPX 4CADB 6PCYA 1V05A 4MMXC 4NO5A 4D0DA 2DQEL 2WO3B 3QUXB 3R7QA 1G5GA 1MAMH 1MCQA 2OQJA 5TE6L 4WZ9A 3LRGA 5ACLA 1BQUA 1AXTH 3QS2A 4PRIB 3BP7A 4PLJC 4MB1A 2CJUL 3H0TA 4BSWB 5J6SA 1HZHL 2BO0A 4F8NA 1KPUA 1UT1A 4XNXH 4JPWL 3UAAA 3UP6A 1Z7JA 4RA3A 2Q0ZX 2F8VA 3ET9F 3MLWH 4HIQA 4Q6YA 2JJTC 5I6LA 4G42A 5M95B 3IDIB 2VH5H 1DZ0A 3IDNB 2QZQA 1Z5HA 1KJMA 4P05A 5J12C 2ICEA 3DJTA 5D1QB 1RULH 2HVJB 2NXZD 4H40A 2D3NA 1ZT7A 2QSCL 4OH2A 3DJZA 3MACL 2TAAA 1EDQA 1N0XH 4IKJA 1HHJA 3D6GA 1FL3A 4L23A 3GZQA 1XGYL 3UTQB 3KPTA 3D85D 5F6IB 2V9QA 3CX5K 4LL9A 4X6DF 2MCPL 1XF2B 4P59H 1XAUA 1P4BH 2ZOOA 1MCRA 3DOHA 4Y19B 3ZX1A 1AGEA 4QHUA 3WEAA 5IHLB 4HJ1A 4PJIE 1CDYA 1MCSA 3WU1A 3C8DA 2GK2A 3D08A 1SYVA 3KPSE 3VQ1C 3BRGC 2GYSA 4DAGH 4RRPM 1A7RL 4PI0A 2EDJA 3HAEB 3VXMD 3OKLA 3QDHA 3EGDB 1MH5A 4F37F 2V6HA 1AS8A 4KDTC 1T1WA 3HRZC 3NFSL 4HWNA 5EC1A 4EEEA 1W8OA 2CNYA 2F53A 3CFCH 2DWSA 2OCFD 1TCRA 4BDVB 3NEEA 5EOQH 1INQA 1P84K 1EFXB 2OP4H 5B3JE 4POZD 3VAEA 3EOTH 3AG3B 3ECVA 3QAZB 4HT1L 5DUPL 2J8UA 1X6NA 3IGFA 1UD5A 3TYFB 4NZRL 3PGDB 3N43B 5EV7A 1OT4A 5IVXB 3NRPA 3BKYL 3OX8A 2Y06L 4PTTA 4RMVA 2FO8A 3NDZE 3S5LA 4NUGH 3VI4E 2ZCKL 5GS2H 2E6JA 5AW7B 2P80D 1RP9A 2VDQL 1GJIA 2AJXL 1FRGL 3FZUD 3QUYA 1FNGA 2V2WB 4M6AA 3FZUC 5H2BB 1BFOA 1A9BA 1J0HA 1IGML 1P2CB 4I48A 3WS3A 3FNKA 5ICUA 4D0DB 4NO5B 3NACL 2KHAA 5A6IA 4M8QA 3N1GC 3T0DA 4XMTA 2OQJB 5TDOA 5M94B 2HRHA 7CGTA 5D2LE 5JW5A 3V52L 3BP7B 3MLTA 2WZPA 3H0TB 1HL5A 1KPUB 3FPYA 3QZLA 4C59B 1UCTA 3OAUH 1Q0XH 2QGDA 5IWLC 2CBPA 4HJIA 2H5UA 4G42B 4MNQD 1J5CA 1KDIA 4TVPE 4U1NB 1KJMB 5I1IH 2ICEB 1UH4A 4WWKB 4X9GA 2FH8A 4JFWA 4ESKA 3SZ6A 4JJHA 2HFTA 1ZT7B 1FJ1A 5C7ZA 3BP5A 4N6RA 3W57A 1HHJB 1JTPA 4LBEA 1FL3B 5AOZA 1IT9L 1ZSDA 4JBSA 4QRRE 2FX8H 4MA8L 2JCCA 1A7NH 5JTWA 1A21A 3PYCA 5EU7C 1USZA 2RD0A 1DBJL 3GIVB 3MAWA 1F90H 3QZOA 1VEMA 1R5VA 1EQWA 1XR8A 4FQPA 1AGEB 4QHUB 3B4NA 1NGYA 3E2HB 3UGUA 4F20A 3WFCH 1SYVB 3F7YA 4N1EA 2ZUQB 3SSGA 5A2IH 3SDCD 3EJSA 3QDJD 3U9UB 3ASOB 4UV4L 3SDCC 3KZ8A 1KIPA 3IDUA 1MH5B 4MASA 1TZAA 2MOGA 3WKNA 3A6OA 5HPMA 4YHOL 3LS5L 5IQ9A 1T1WB 3TF7C 1NCJA 3WXWL 3LZNA 1XR9B 1EEQA 3Q5TA 2F53B 3VGAC 1NCWH 1TCRB 2H6UA 4RIRB 5E5MA 1A66A 2A83A 4L4VA 2W9DL 1INQB 3C9NA 4NN5B 4JUSA 5KVGL 2BHYA 1RAMA 5SV4A 3RFZA 4XWOD 2J8UB 2WLIA 4WW2F 3ZPDA 3IRZA 3K6IA 4XWOC 4U05A 1CIUA 1ZAGA 4XC3L 3CSFA 3LQZA 3OBAA 3OX8B 3S5LB 3CVCA 4PTTB 3IFOA 3K5SA 3WGUB 2WXHA 4BXSV 2CDEA 4UIMA 1YNKL 4J28A 3WELA 1UJ3A 3RJOA 3QUYB 1FNGB 2YGPA 2WLLB 4D9LL 2FZ3A 1DJGA 1TJMA 3FT2A 1BFOB 1A9BB 1RV6X 3KPLA 4X6CF 2BRQA 4M8QB 3N1PC 5CILL 1TCMA 5JW4N 1QSEA 3SBWA 2V5MA 5TDOB 1JGIA 1NUFA 3B2XA 2YD7A 5JW5B 3DYMA 5ANMA 5FYLE 3MLTB 1J0IA 4GG6F 4CMMA 5E4IA 1F3JA 4I18C 4EBQH 4ORGA 2LQRA 1KY7A 2IV9A 1ZVSB 3I84A 3ZHKA 4OZFH 1JK8A 2OPCA 3GKZA 5DLML 4BELD 2LFEA 3OXSB 4AQ1A 1J7VR 1HAUA 1U8OA 4YZFF 1OPOA 1M42A 3PJSA 2AHIA 3FTXA 1FJ1B 4U1HA 4LEXH 4N6RB 2HUHA 4B9GA 43C9A 3MBED 1ZSDB 4P48A 2JCCB 3MBEC 4ABQA 2FIKA 2PWGA 1NCIA 2NY5H 1MELA 4W6XB 5DUJA 1TITA 2V5YA 3QC5X 4B9KC 1R5VB 1XR8B 1G1YA 2G4GA 3LZRA 4NQDA 5IY5B 3SQOL 5H4YA 1ETZB 1NGYB 3BH8A 1BBJA 4HLEA 3QRGL 1BF2A 1NGPL 5TQ0H 3HBQA 3BFQG 4AUUA 3F7YB 1WFNA 4UM8A 1P6WA 1CYGA 4N0YH 2WN2A 1UC6A 5IQ9B 5KBDA 2RJMA 5BRPA 4E2OA 3MV9E 1JP5A 1PYWA 5E5MB 3HE7D 2DWYA 4K4KA 3C9NB 4XCFL 1TPXC 2CBQA 4YFDB 1F3DH 5CINH 1AZUA 4E0RA 1SM3L 3RFZB 2NY2B 2WLIB 4ZMOA 3G3LA 1ZHNA 4IIQA 2PNDA 2OI9B 3LQZB 3MJ7A 4HGMA 4JVUA 4LVEA 3IFOB 5JXAH 2R4SL 1UKQA 2CDEB 3MYJA 3ZR5A 1XIWD 4JM2A 1UJ3B 2EEFA 1QSFD 2X28A 1QSVA 1UM5L 4XOCA 4AM0Q 3FT2B 3VRIA 1QBAA 1M53A 5KBPA 2Z8RA 4TRPH 5FYJU 3KPLB 2Q7NA 3DC0A 1UD6A 4PHZA 1MAML 1QSEB 2UZIH 3TZVB 2DQDL 3WFZA 4MA7H 5J0BA 4ICWA 4LOUD 4C83A 4UYQA 2YD6A 1AXTL 3G9VA 5IREA 2YO3A 4LOUC 5DEGA 4CMMB 1F3JB 5CFHA 3GWJA 4ORGB 1YMMA 3GSXA 3BESR 3MZGB 4A39A 1JK8B 3D3VB 1YSOA 2IAMD 5I1LA 4XO4A 2VH5L 4AQ1B 4RMSA 1T0PB 1XB3A 4NZJA 3ARDC 1ES0A 1G9MH 3OWRA 3PL6A 1NIFA 4TSBH 3PJSB 5I1EH 1YNTB 2B1OA 4U1HB 2C9VA 5MHSD 2AK4D 1N0XL 3VH8G 4F7KA 3FOLA 5B38A 2B9AA 3DVGA 2NY1D 2XVBA 3W56A 3U4KA 3U2SA 4C47A 2FIKB 2NY1C 4XNBA 3T4AC 4P59L 3CK0H 1P4BL 3L3HA 2KZWA 1J0ZA 1UA6L 1L0QA 3HS0C 4NQTA 4NQDB 4WI3A 3RG1C 3BH8B 1BBJB 5EOCH 5DI8A 1YNLH 4NGHH 5I82A 4KUCD 4XOAA 1E8XA 3GXUB 3HKFA 2CGZA 2FGZA 4UM8B 5G4OA 1IJ9A 1UH2A 4JS7A 2VDLB 1ITBB 1ZLUK 5DVMA 3MNDA 2HKFH 1Z9LA 5EUKA 2AVFA 4Z3FA 3MRMA 2WWKT 2YS4A 3ZDZB 2FD6H 1MF2H 5EOQL 4RX4D 5I6XB 3ZT5A 4EXKA 2D0FA 2OP4L 1OHZA 4GW1A 4PJ9C 4XX5A 3EOTL 3BGAA 1DFBH 4PB9H 4DF9A 4IIQB 3MV8A 3MJ7B 4D8PA 1A4CA 5FFOA 3LXBA 3S37H 2FE0A 4JFVA 3FT3A 4X4KA 2EZ0D 3MYJB 3VTAA 2F08A 2CD0A 4YPGA 3TV3L 2QT6A 1BZ8A 2EZ0C 3BT2H 5BRZE 1GYUA 2XV6B 3VRIB 3NPSB 2ZUXA 1MFBH 5GS0C 4NWTH 1MCIA 3B1UA 1MFCL 2D8KA 4X7FC 4AVKA 1TNNA 3SGDH 2CCVA 1RCYA 2LU5A 4HETA 3V6FB 4RRPA 1E4XH 1ZLWK 4C83B 2BP3A 3HEIB 4ZFZA 5IG7A 5C08A 5DEGB 5SWSA 5E6SB 1YMMB 3EYFA 2BH0A 3GSXB 3V7AE 3OAUL 1Q0XL 1DJIA 4H2CA 4JZOA 4YBQD 1U0QA 5I1LB 4YBQC 2WXIA 1BVKA 5I1AA 4FKEA 5I1IL 1ES0B 2Y3AA 4TNEA 3KGRA 4KBPA 4NJ9H 1HHKA 3PL6B 5T1DL 4OVVA 4OD2A 1YEWA 2HTKD 2XQYK 3RRQA 3U0WH 2EE3A 4JO8A 4QRSA 2BZDA 1NCOA 4RMUA 3FOLB 3NJFA 3O2WH 3DVGB 2LTQC 2IFGA 2NSMA 3NT0A 3OR7A 3RUGF 1A7NL 3U2SB 4PVBA 3CDGB 3L3HB 5L2KA 1F90L 2PKDA 1JZDC 2VQ1A 3O6MH 5JW3H 1JZ7A 2XXCB 5A16A 1CG9A 5DI8B 4FI6A 4U3SA 3L6FA 3V8CA 3WFCL 1FDLH 3VVWA 2AEPH 3HZYA 3VD5A 4YE0A 3PJNA 3QUMH 2QR0B 2YKKA 5DZJA 1CU4H 4PY8I 1OTTC 3IEAA 2AC0A 2YMTA 4JGMA 2E46A 5EUKB 4ZMYA 1EAJA 3MRMB 3BAKA 2FT7A 1TEFA 3FL7A 4LP5A 4G8EA 1NCWL 1MUJA 2NW2A 2PP7A 3ETSA 4OF6A 2L7JA 4GW1B 5DHEA 5DUMH 5IMOA 1S9VA 3MREA 4N2GA 4LLAA 3MV8B 3RX8A 4D8PB 3THMH 2YUVA 4P46D 2J8HA 1N8OE 1IAKA 4YPGB 4P46C 3UGEA 2JFCA 4AC2A 4FQIH 1KCBA 2B4CC 2CIIA 3CVDA 3W82A 3KVDD 1BREA 4OFYA 3BD5A 5IW3A 1G7IA 1T7XA 2G3XA 4MB3A 3H6JA 1W72H 1XF4A 4LOFA 3GDCA 5AL0A 3BW9A 1DDTA 3NK3A 4ZFZB 5IG7B 5C08B 2NNXA 1S9YB 3N50A 5SWSB 4EBQL 2CWRA 4MZRA 4PV9A 4JZOB 2DYPD 3QT2A 2GJ6E 2P5EA 1BVKB 4XI5D 4RGNB 4Z7VA 3FQTA 5I1AB 3CXHK 1S46A 3PP3H 3FONA 2EDBA 4OD2B 1GGBH 3DXAD 3DTUB 4BINA 4LEXL 2CGRH 3FB8A 1NMCB 4QRSB 3DUUB 1J10A 3GSOA 3OGCB 1FYTD 1TFHA 3RX7A 3OR7B 3VFOA 4PJAE 4H20H 1JHLH 1YEDA 4XN4A 3TCLA 4YHYB 3JT0A 5F0PB 2YA2A 2GJRA 5B1KA 5J6HA 1D7CA 2VQ1B 3KBHE 4P5MB 4XPFH 5FM5M 3VFGH 4NO3A 4IHBA 2GBUA 5A16B 1FCGA 2HJLA 4U3SB 1XSKA 1L6PA 3L6FB 5TQ0L 4KQ0A 1UD4A 1EZVY 3MPCA 1CGTA 1P53A 3MV7B 3LPFA 1EV2E 1GKOA 1ZANH 4KKZA 5G4MA 2EIJB 4W9JC 4LNVA 4N0YL 4NDMA 4NWUH 5JYLA 4P04A 4N2MA 1OWWA 2YOCA 1HHGA 2VC2L 4PSRA 3WLWD 4G8EB 1MUJB 3MOBH 2NW2B 1KCVH 5I71C 2Z91A 1FZMA 3LPWA 5CINL 5T1KD 2C9AA 5JHLH 1AGDA 5IMOB 1EXGA 1S9VB 1UGKA 2XN0A 1B3JA 3MREB 1JI1A 3L4CA 5E8EB 2ED7A 3IBOA 3TJHD 4KK6D 2DOCA 4HK3N 1DBML 3HG2A 1AIFA 1C16A 2QSVA 4DUVA 3QNYA 1DSWA 2HT4D 5JXAL 3HLKA 1OAYL 5IROA 1IAKB 2HT4C 2AXHA 4YL4A 1DBBH 4LCCA 3A67H 4MB4A 4X6DE 4FTVD 3MMEA 4Y2OB 2IBGA 2CIIB 2MNWA 4ONHA 5SWZA 1KWKA 1Q0YH 2HWZL 2FWSA 1MREH 2Z9TA 1WAAA 5L4FA 1G7IB 3RPIA 4R7LA 4B9YA 2I32A 3EXJA 1XF4B 2RFXA 2UZIL 4QEGA 4MA7L 3WUZA 4JB9H 1NL0H 1RHFA 3BW9B 3SDDC 2BRRL 1HCYA 4KZ0A 5E2VL 3T2PA 1QRNE 1B6UA 2YPLE 3GMMA 1L6XA 3QWNA 2FQGA 2VDRH 3CHSA 4NP4H 2PMZA 4Y4FA 4UZSA 3IMBA 2GK0B 1EPFA 2P5EB 4DGIH 1IC7L 4Z7VB 3FQTB 4ENED 3RY4A 2QVFB 3PQYA 1IBGH 3O3BA 2XN2A 3FONB 4LMQE 1HNGA 4ENEC 4PAZA 3BIKA 3H1ZA 5I1EL 3CVIL 3SBRA 3U7YH 1F41A 3FB8B 4YDLB 1ZTMA 4G8FA 4M5SA 3GSOB 4RMTA 4ZFGH 2ATAA 5FLUA 2ADYA 3VFOB 3D1MC 1YEDB 4ODVH 4PW3A 2ARWA 3TCLB 1DVYA 4MXQD 4L8DB 3U25A 1T5WA 2NY4D 3CK0L 3MR9B 4MXQC 5GGQL 3FHAA 4F93B 2NY4C 2D4DA 3NP3A 3K91A 2XOTA 1JXFA 3J2PA 1WUZA 4BA0A 1VDGA 4NO3B 4L8SA 3QFJE 5EOCL 4E9XA 4P4KA 1YNLL 5IB5A 1CLZH 2MH4A 4NGHL 4HHGA 1NM9A 3BYYA 2RHEA 4JHBA 4X9YA 4C55A 3IDGA 5CGTA 2XWCA 1HXKA 4M56A 5C92A 4NQXA 2XCMC 2HCZX 1RL1A 2VLME 2W0LA 5KSVA 2D7MA 4M8VA 2HKFL 2XFGB 4ZUUA 1Z66A 2G5RA 4FZ8H 4LU5L 1LMIA 1HHGB 2FD6L 1DTUA 1U8KA 5HDQH 1LE5A 2P5WE 3CZKA 4PS8A 2ZG1A 4BE6A 1A2YA 2Z91B 1FZMB 1D5ZA 2G9KA 3QUKA 3EHBB 4QUOA 4Y1TA 1AGDB 2AW2A 2VN6A 2VWEE 4PRAA 1DFBL 1IV8A 3W9EA 5EEWA 4O2CA 1AIFB 1C16B 3QNYB 3GSNH 3S37L 5C97A 1OCCB 3QZBA 2AQRA 5FYJD 3RGBA 3BDYH 3BT2L 3FHEA 4LCCB 1AQKH 3FQ2A 2APFA 3MMEB 3POHA 4ONHB 1MFBL 5SWZB 3QEGH 4NWTL 1ILSA 2AQPA 3JXAA 5AVXB 1N6UA 4FHBD 4WDIA 5D7LE 2Z35A 3FSAA 3RPIB 4WY7H 2KKQA 2RFXB 3GFUA 1FGNH 1NJ9A 4PJFF 5E8DH 2O93L 3QULA 1E4XL 4FI8A 4HBCH 2WCPA 3CHRA 3OQRA 1JOIA 1NAKL 1NPJA 3C87A 4ONGH 3IT8D 2IDTA 3ULAB 3ZYOA 1WS7A 3GMMB 3NCYS 4UMGA 5GGUB 4M8RA 4KNQA 2BSTA 3ZBMA 4Y4FB 3DK0A 4MXVF 1P7BA 5HGDA 1F00I 3PQYB 1BCIA 2YRLA 4A7UA 1EO8L 3BIKB 1AR1B 1YRKA 4OF7A 3UBGA 5GZOD 4WHYG 4WI8A 4X4ME 4U0RC 3U0WL 2EDDA 3QUXD 1VFMA 2QQLH 5EBMA 1LQBC 5AAWA 5LBSL 3LKNA 3QUXC 5D7HA 2R39A 2FSEB 4QI3A 5K1VA 1MFMA 2WY3B 1T5WB 4PRID 4ZODA 3SPIA 2QKIA 3V0EA 5JW3L 1OP4A 4L8SB 4JFDA 4JQIH 5AVRB 3U6XS 4HA1A 4P4KB 2AEPL 3L1FA 5D1QD 2R2HA 3HJ0A 3IDGB 3QUML 3ARVA 2MCMA 5AWNH 1CU4L 2Y07H 4MZIA 4XMXA 5D1QC 4NQXB 5F7EH 5GS0H 3AS0A 5KSVB 3NRFA 1FNHA 3DNKA 4ZUUB 2D3JA 3ECBA 4K71C 2ZP0T 4M6OH 1A2YB 1D5ZB 5CNHA 2X1PA 2A6JA 3QUKB 4Y19D 5DUML 1BAGA 2RMNA 5FM8A 1FV1A 1LWRA 2IADA 4PRAB 4ZOBA 4G83A 3W9EB 4JPSA 3D39E 1CXHA 3RJDA 3B6SA 3SPGA 4O2CB 1WSST 2OX5A 3APDA 5DWUH 5ESQA 5HVGB 3PAZA 3M1BB 3THML 4DKAA 4E5XA 1PLCA 4NT6A 1A3LH 2ZP9A 2VQ4A 1T2XA 2WTPA 3N0AA 4FQIL 4CU8A 4UTBH 4J3BA 2BPBA 1ASOA 1CL7I 4N1HB 2Z35B 1W72L 5I16A 1NJ9B 1EFXD 3QULB 4PY7A 3ZL1A 2L4OA 2YEQA 4Y1SA 5B1AB 4XPBH 1T2QH 1JRHI 3DIDA 3WDHA 3F7KA 3WTUA 3QAZC 5J8OA 4F9PC 1QLEH 3KWWA 3LNGA 1XXDC 3MHZA 3WJMA 5D93B 5HGDB 2XQYA 1KULA 3EJTA 3BGMA 4HAGA 3BN3B 5CFAA 5KVDE 1O75A 2GUOA 4CBZA 1B0GA 2YIHA 1TTRA 3APFA 3LEVH 4JGJA 4K3HA 3UG5A 5LN8A 1DR9A 2QL1A 2XN9A 2XV3A 1IC5H 3ASNB 1GGBL 3WNLA 2K9UA 5D1XA 2C4XA 2CGRL 3NJLA 4WQOA 1JNHA 5EBMB 4L3EA 2X44D 4H20L 5D6DA 3LKNB 1JHLL 4HZLA 4FYTA 4G43A 3VXSE 5TE4H 2XTJB 5B1CA 2QKIB 4H13C 4XPFL 1ID2A 3N40P 5CJBA 3VFGL 4MKMA 4JFDB 3SDAA 4X0NA 3LKSA 1C8QA 1OALA 2J6WA 2BSSB 2IOIA 1H6TA 2R2HB 4RNRB 4Y16A 4A55A 3SGEI 5CWSA 2ICEC 1HJBC 5FR3A 3CDZA 2OTUA 2R1YA 4RMQA 1UACH 1E3XA 5IBLD 1N6QH 5IF0A 1WP6A 2ZAIA 4NWUL 4ZDHA 1LD9A 1L7TL 1EFQA 4OFIA 2ATKA 3VQ2C 3WIFA 1HE8A 3LKOA 3BPNC 3ECBB 3MOBL 1KCVL 1RZFL 2GY5A 2NNCA 1E4KA 1JZJA 2A6JB 2J44A 1HKFA 3H85A 5JHLL 1OCOB 1WZKA 3NSJA 2WWMD 1FV1B 2IADB 4W9DC 1KC5H 4Q7DA 2WWMC 4LLDA 3B6SB 1UQSA 5ESQB 2ICWJ 3VRLF 4X98A 5FHBH 4JL2A 4JKWA 3QJRB 3QXDB 5D5ME 3L48A 4CVZA 1I9JH 4XODA 4NT6B 2J3SA 4HCRH 1AP2A 2LU3A 5D2NC 2MIZA 6TAAA 3A67L 5C0AE 4ANKA 3E8VA 1DJHA 1N2RA 2R0WH 1WV7T 2V9RA 2ZJSH 2F53D 2H8PA 2UUDH 3PAYA 2B16A 5I16B 4KROC 4PLNC 4YSQA 3ZGIA 4PY7B 4JB9L 4WNSA 1NL0L 1OCWL 4NN5C 5F9AC 1RFDL 5EF1A 3ILQC 5IBTH 3ZUCA 4X83A 5TQ2L 5JDSA 4X8CA 2CRIA 5F7MC 4LPVA 4NP4L 3HB3B 3WJMB 1H3XA 4G82A 2JSFA 2P28B 3BZDA 3BGMB 2H7WA 2GUOB 3QUYD 4OQTA 1B0GB 4TNWK 5E56A 3PU7A 3TCXA 3QUYC 4XXDB 2XN9B 1MWAH 2E9JA 5D1XB 4PJIA 3U7YL 4ANVA 4ZFGL 3S3JA 3KPSA 3QB7C 5ADOH 5JIHA 1JNHB 4L3EB 3INUH 4ODVL 1KCRH 4HZLB 1WIUA 4IMLA 1Y18B 3U83A 4L5FH 3QS3A 1T7ZA 1SBBA 2ZD0A 2WZPD 5HYQA 2M1KA 3E3QE 1D6EA 1JD7A 3DX8B 3RTQC 4OGAD 4KITB 3BRFA 2VDNB 3LPPA 3EH4B 3LNHA 1WTLA 1VFOA 3OB0K 4YFEA 3SDAB 2R8SH 1BXXA 1PD0A 3C5ZA 3FCTA 3NEOA 3EJJX 1YG9A 1CLZL 2WXKA 4YHNA 2JB6A 3D51A 3EJYC 1RQ5A 3LKPA 2WJ7A 3ABMB 1NSNL 5CWSB 2ILLA 4WK2B 2OTUB 2R1YB 1J8HA 1PPIA 1NAMH 2ZUWA 3HG1E 1Q72H 3VXRA 5IF0B 2J1XA 1C1EL 4ZDHB 1LD9B 4ZZKA 2CA4A 3TA4D 2ATKB 2DN7A 4FZ8L 3AT0A 1X5MA 3SGKA 3VI4A 3RVXD 5CIPH 3U82B 3WIFB 3LKOB 3NJKA 2ZQKA 4ZX4A 3MJ9A 1NUNB 4LFHG 3L3KA 3T09A 4UCFA 1P7QA 1ZVNA 4GMSH 4PH8A 1NGWB 2E74C 3OHMB 1PJWA 4CVUA 4LLDB 2JKSA 2YPKA 1IU1A 4P99A 4LK4A 1UQSB 5E51A 1KBGH 4X98B 3U0TA 2IGFL 1BGXL 4CVZB 4NSKB 3MLVH 1GJWA 4Q9CA 1UB6A 4J12A 3CSGA 4HHWA 1TQCB 1AP2B 5IBUB 5BVJA 1AQKL 4D9QE 1E65A 1K6QH 4XCCH 4NZUH 2NY0B 1DZBA 1HOEA 3QEGL 4OZHE 1F86A 4XE5B 2H8PB 2JH2A 5F1OB 4IJTA 4PGCA 2C1PA 4YDVA 3JYBA 1FFQA 4L4VD 4WY7L 4HUWA 4MJIE 1ZLEA 1FGNL 1ADQA 3KD4A 4HBCL 3FN9A 2XV0A 4ONGL 3K6FA 5JDSB 2BSDA 2EUVA 1GSKA 3DYOA 2GIXA 1MW0A 3T0EE 4BWUA 1DVFA 2OI9C 4J3XA 4F8TA 1QA9A 4N0UE 3VFMA 2EIKB 1Z3RA 1OAUH 1WCQA 1UJ3C 4HIIA 2WP3T 5TDPA 4FQHA 2APBA 3SBPA 1ZPLA 4TQHA 2KC0A 5KG9A 5DZLA 3ECQA 4Y8DC 3KPSB 4NS0A 2VYRE 2QQLL 5HBBA 2F19L 1QSED 2NDFA 2HRLA 1QEWA 2ZCZA 1GOFA 2AJUL 4IMLB 3SBWC 1ET5A 4FERA 1E9QA 3BKJH 3HHSA 3KPPA 2NZ9C 1XTMA 5HYQB 1JGEA 1D6EB 2GHWB 4E41A 2WWKO 2I9TA 2D9CA 1NDGA 2R15A 2MPVA 4PRHE 2N7SA 4JQIL 3W39B 3FCTB 3C5ZB 4LPXA 5DVLA 4FNUA 1ECYA 2OS7A 4WHYH 2YSTA 2JB6B 2OMWB 2BFVL 4P9HH 4UQDA 4EKJA 4PTUA 3LKPB 2VN7A 2Y07L 5F7EL 5GS0L 3B2PA 1J8HB 3D0AA 2G2PA 3TJEH 3VXRB 2P5PA 5T33H 3PWPA 5MI0B 5C2BH 3LQMA 3U9PH 3VI4B 2WQ8A 4DQOL 4JZJA 3ZU8A 5F7HA 2Y7NA 4U6HA 4OFDA 4I3GA 1Z9SA 4M6OL 4QXWA 4U4BA 3BWAA 3IN0A 3UPRA 3L3KB 2Q3AA 4NQDD 1P7QB 3ZO9A 3AADB 3TPUA 1JZFA 5LWYL