2UY7B

Crystal structure of the p pilus rod subunit papa
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
156
structure length
156
Chain Sequence
QGKVTFNNTVVDAPCSISQKSADQSIDFGQLSKSFLEAGGVSKPMDLDIELVNCDITAFKGGNGAKKGTVKLAFTGPIVNGHSDELDTNGGTGTAIVVQGAGKNVVFDGSEGDANTLKDGENVLHYTAVVKKSSAVGAAVTEGAFSAVANFNLTYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords PERIPLASMID CHAPERONE PAPD PROTEIN
publication title Crystal Structure of the P Pilus Rod Subunit Papa.
pubmed doi rcsb
source organism Escherichia coli
total genus 21
structure length 156
sequence length 156
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00419 Fimbrial Fimbrial protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 2uy7B01
4XOAA 4CA4A 4XOCA 5FS5A 4CSSA 5AAPA 2J2ZB 5ABZA 5AALA 4AVJA 3BWUF 2XG4B 3JWNH 2XG5B 4LOVA 4X5PA 4X50A 5JQIB 1KIUB 3ME0B 5IQOA 4AUUA 4J3OH 1N0LB 3JWNG 1PDKB 3SQBB 4AV4A 1N12A 4AV5A 3ZL2A 1KLFB 1TR7A 4J3OG 4XODA 3ZL1A 2JTYA 4BUQA 4AVIA 2VCOA 2WMPB 1QUNB 4X5RA 2W07B 5IQMA 4J3OF 5FLUA 4XO9A 3RFZA 4AUYA 5FWRA 1ZE3H 5CGBA 4ATTA 4AV0A 5IQNA 3MCYA 5LNGA 5FX3A 3BFQG 4X5QA 5F2FA 4AVHA 4XOBA 1UWFA 2JMRA 4XO8A 4AVKA 5AB1A 2UY7B 5F3FA 4XOEA 5LNEA 3BFWA 3ZPDA 2UY6B 3JWNE 4AUJA 4CSTA
chains in the Genus database with same CATH superfamily
1EEYB 5D93C 4WI4A 3E9UA 5DFAA 2DJUA 1SMDA 1I8IB 4QCIB 4G9DA 4AENB 4HPHA 2WWMD 2XQBH 2O6FA 4FXKC 1AQDA 2CUHA 4JO1H 4L8SC 5E2TH 4HWEH 3CQPA 3ARUA 5FHAH 3CC5A 1I7RB 1PX4A 2IFFH 5HVGB 1MCPH 1M7DB 2ED7A 2VDRL 2I9TB 1XSJA 1AQKL 2QSCH 3MMEA 5I8CB 4G8EA 4D0BB 4MNGE 4EXPX 4JZNB 3P11H 4G6FB 1WT5C 3FBKA 2F61A 2X2UA 3MRRA 4AQ1C 1DJHA 4LKCB 5IF0B 3GK8L 2AEOA 4AQZA 5C07D 4FL4B 4L18A 3KL0A 3RX8A 3Q2CA 1JNHA 3QIUD 1N9PA 3HC3L 3OJVC 1I1AC 4L1TA 4AV4A 4BH7B 3FF7A 2VZVA 2R23B 5CHNB 5LBGA 5I5MA 3I02B 3F3HA 2BNRD 5LLIC 3DJRA 1LE9A 3REVA 1UM5H 1NCTA 2J1XA 1KC5L 3ECBA 3T1FB 5CD3B 3QG6A 4LIQL 4QXUL 5AVXB 2CLZB 1D6EA 1ECZA 1T7YA 5B39B 2X4OB 3W5NA 3BWUC 2BY2A 4N2AA 1DJWA 1PKQB 3P4MA 3QXAA 3V0AC 4NC0B 2HVKB 3V0JA 4C4KO 4XNYH 4XNXL 5E8DL 5D72H 5HGDB 1CDJA 5IKCB 5F1NB 4JKPL 2K45A 2XV2A 2QQKL 2UX6A 1E28A 1IJNA 4HWBA 1H0DA 3HUJF 1XGYH 4JO8A 2YSSA 5C08E 4JN2A 1RKRA 1QFOA 4TUUA 2Q7AA 1GJUA 2ZPKL 2VE6A 3HE6B 5HHNB 1NUDA 1JVOA 5T33H 4DF9A 1AG6A 2VLLB 4XBPB 3ZDYB 4G9DB 2CKBL 4HIQA 3B5HA 2FR4A 1R0AL 5KANG 5BW7A 4PG2C 3TZVD 4ZMTA 5IGXH 2Q0ZX 4PRBA 3UTPD 3C8KA 1HI6B 5GGUB 4IDJH 1FFOB 1PEZA 3APNA 4LLVB 1WF5A 3RY5A 3BXNA 1FO0B 5D70H 3ESUF 4L4TB 1J8HB 4GSXA 3OAUH 2ZNXA 3FT4B 3QARA 4XB3A 3EHBC 4I7ZC 4JJ5A 5IV2A 2ZXAA 3CLFL 2D7PA 1EXUA 2BSTA 5ICYA 4TRPL 1P5VA 1I7UB 5IB5B 3ZE0F 3KE0A 4BH8B 1JNHB 3T0DA 3L9RB 5I1EL 1Q38A 5CSGA 1HL5A 4RIRB 4X7SL 3SODB 3D87B 3U9PL 2W38A 5C2BL 4E0RA 3P77A 5A2IH 2W8CA 1G7IA 1FG2A 4Z76A 1LE9B 4NN6B 5DGRA 1KGXA 3NJVA 3JWNH 2GVYA 2I60L 4NB7A 5GGTA 1FNGB 4WWKB 2FJSA 3WENA 5L2JB 5E5UB 3UTTB 4ALAH 1FZOA 5ENWA 3SGEH 1JHKH 2GYSA 4AZ8B 2YGPA 1DJGA 2HRGA 3U2JA 4FQQB 2V9TA 3MX0A 5ICXA 4L05A 1VADB 3MLXL 3WKYA 1H8LA 1C5CL 3DYPA 3NIFB 3CK0H 1UUNA 3RVTC 2UZYB 1W72L 3Q06A 3H8NA 3SDAD 3TJEH 3ESOA 2YD0A 5LNDA 2BZDA 2EEDA 1JRHL 2EH7L 4LRIC 5I16A 1YUHA 3N1PC 4JQIA 1FJ1A 5C0AE 4B9ZA 4N2FA 3TNNA 3NSXA 2D0FA 2FR4B 1FZKA 1WA0X 5TFSL 3RFRA 2Q10A 3NQKA 3KYKL 2A9DA 1T83A 1KJMB 2EECA 3C8KB 1F2QA 1F58H 2XPGA 2WWKT 3W0WE 2E7DA 2PCFA 2P46B 2E7HA 4TMPA 4UB0H 5E4EB 3CUPA 5I1JH 4ZOCA 3BVUA 5FLUA 5DT1H 2C9RA 4JY5L 1MJ8H 4Q52A 4RCAA 3OPZH 4KQ0A 4JJ5B 5DD3H 2CBTA 4DK6A 4YL4A 1EXUB 3MFFA 5C0CE 4CMHC 2BSTB 5SWSD 1KF9B 1ZHKA 1D5BA 1AO7E 3BEVA 5HHOE 5TJWK 2H1PH 3MLVL 3V5KA 3K74B 5FPIA 3EH5B 4NBXB 5I0YA 3G5VB 3FL7A 4MX7A 2Y7MA 4ELDA 1X9QA 5KVDL 1FE8L 4MNQA 4Y16C 1ANUA 1R5IB 2DKUA 4XAKD 4JEGB 4HWNA 2YKLH 3EO1A 1A5FL 3V52L 1G7IB 3N55A 2LABA 3RWCB 3LQMA 5ERWA 3WXVL 1N0LA 5TPWL 4HMCA 3T6ZA 2FLMA 2VZUA 1QD0A 3BP6B 1DUZA 1TITA 2DLFL 2L3BA 3IRCA 1JJUA 1UJ3C 3PFQA 4JZJC 2ED6A 4LSUL 2XN9E 4WTZA 3VFUA 1FZOB 4M6MH 4I18A 2R29L 1ZVYA 2WM0A 5L88H 3JUYA 3IXAA 3MX0B 1GR7A 3DSFL 1NEPA 3FKUS 4A6YH 2FHFA 1NM9A 1UYWH 5LGHH 1S8DA 5FYJD 5CN1A 1KEMH 5MENA 1F1GA 2ALWA 4LSVL 2ZG2A 4XVJL 3RGVB 4EMZA 5GS0D 2OSLA 4ODTH 3PL6C 2P5WE 1FJ1B 3A21A 1J0KA 3P73A 3DI3B 3AC0A 1N59A 4U6XB 1X9RA 1EBPA 1QWUA 5IB2B 5CP3A 3KWXA 2Y2YA 1F3DH 1E6JL 1ZHBB 4M8RA 1KJ2H 2XPGB 4W9GC 1MFUA 2Y6SD 4L1HA 4JO4H 3KPPB 3OL2A 3QDMD 2CJ3A 2C1PB 2C7UA 3N43F 5DJ0A 4EEEA 1SYSB 3LDBC 2WQVA 4NQXB 2PPDA 2VSDA 4LNRB 2FB4H 5TF0A 3UBXG 1TJXA 1DQLL 2R4SH 4G6FD 1KGJA 2L7QA 3HG1B 3BEVB 4YFLF 3FZUD 4Q2ZA 4C83A 1ED3A 3CBRA 4GKSB 4O9HH 5DLLA 2GT9A 2VDLB 5JIPA 1Q9KB 3E8UL 2LAGB 2NQ3A 2R51A 3ZXAC 4Y2NA 2ED8A 1U8JA 3WS3A 2IWEA 1NFDE 4XP5L 4G72B 4AGOA 3EO1B 5F7FA 1VCBC 3L9YA 4GG8A 2N59A 4HLZG 1W6LA 4ZNEE 3PFUA 5FKAA 5ERWB 1X5KA 2H45A 3LKQB 1BIIA 4G8IB 1HILB 4X98B 4N2MA 1TT6A 1DUZB 4UDTB 1R75A 5DYFA 1HHHA 4NKDB 4FRWA 4K8RL 5AW0B 2DQUH 4IIQB 3RTLA 4KKBC 5MEQA 3JYCA 4BSJA 5LCVL 1SBSL 2GFBB 3AGVA 2L7JA 4A7TA 2HFGH 3QIWA 2VDQB 4LB8A 5F9WC 5HHMB 2WO3B 1VDGA 3Q8CA 3ZN6A 4KTDL 4XC3L 4H8WH 4P06A 1T1WB 5D9SA 2VZOA 2HWZL 2EDQA 1AGEA 3HE6D 3L3KB 1ZGLM 5DR5L 2BLFA 3P73B 4JM2A 1Y18A 1ADQA 2LVCA 4PJDA 4YLBA 5EPMB 1VZHA 5CJ8A 1O6TA 3MJ6A 2F74B 1HESA 3MA7A 4QIRA 3RJOA 3RWHA 5JW5B 3MRBA 1OP5H 3T0EA 2KQMA 3HS0C 4IBVA 2WWKO 3ULVC 1CFNB 1J8HD 5DJ0B 5D2LF 4XOCA 1A9VA 1EO7A 3BSZA 2MNJB 3FUNA 4IMLA 1IGFL 4WDIA 5SX5H 4KKLD 2NTFA 4L9LC 3VRLE 2VUYA 4LMQI 3JVGC 4Z95H 5C6TH 3X2QB 5KYWB 4X4YA 4YWGL 5KS9B 3ASOB 2GJRA 2IG2L 4DP2X 4UQ3A 4C83B 2J56A 1ED3B 4HISA 2XXGA 4FFVD 3VTTA 3DX7A 5JPNB 1RIVH 1A4AA 3WKNA 1VLXA 1U8JB 4Z7QB 3CFKB 4LHUA 1NCJA 2ARJB 1MPAH 4TLSA 4FNRA 2YPVH 5LQBL 3C2AH 1MOEA 2CJUH 1KN4H 1BQUA 3WKML 3U4EA 3L5WB 4PJGF 2A6KB 3MACL 3L9EA 2V2XB 3MRIB 4WWKD 4H20H 3VCLB 2NXYB 4P9MH 4I88A 1AAJA 1RUPH 4S1RL 2BXYA 5MEQB 1Y07A 5FKPA 4TQHA 1TVHA 3RIFF 2C9SA 1MHCA 3NBNA 3VH8A 3BRDA 3V4UL 3CVHB 4B9CA 4OF7A 2CM6A 1YN7A 3VSQA 2WIMA 2GITA 2YQ3A 3DOHA 1H15A 4XN7A 5E6UB 1MWOA 5D2NA 2KZ1B 2AGJH 4JW3A 5AOMA 3P2BA 2HYMA 2G60H 1XSOA 5DJCB 2FTAA 5I1KL 4U1IB 3FO1A 3RZWA 5LDUA 4JM2B 2QGDA 1MWAB 5CJOL 5BUAA 1FN4B 2Y7QB 1LDSA 4GRWE 3QEHA 3VXNA 5JQHC 3P1VA 1PG7L 4PJDB 3ILQC 1L6XA 3LKSB 2QQQA 3RTQB 4X9IA 3VFTB 5F8QC 3VD9A 3PP3H 1F6AA 3NT0A 1KYDA 4EZJA 1GS7A 2D9CA 4FQJL 4LF3B 3T0EB 3GD1C 4P5KB 5AYUH 3KPMB 5E2VL 4NZRH 5GSRB 2HRPH 3NCEB 3NJMA 4DGVL 1KELL 5E1AB 3DBSA 3KS0J 4WDIB 4LSTH 2QQLL 2XDHA 4EJ1C 4X9FA 3CNKA 4ACTA 5IVXF 2YD9A 4LXFA 1VEMA 5IZ7A 4EI5A 3QUHA 3HW7A 2D7TH 4DGWC 1A3ZA 1F4AA 4BINA 5K9QG 3WY4A 3OXRB 4BCXA 2IGFL 1UCBH 5CFAA 1S4IA 1FF5A 1INDH 3MLRL 3TZVC 5I5RA 2VN7A 3PGDA 4GIPD 5E94A 5IIEA 3K2UL 3UZQB 4LHUB 4KRMB 3GZPA 3PWPE 3W9DA 1SVZA 2WLLB 4WO0A 3OZ9H 2RR3A 4CSPA 5K39B 3MLTA 1TZIA 3IAPA 5HVHB 5KSBB 3AUWB 2P8LA 1NAKL 2DWDB 5IW6A 4JG9A 3E3QE 4JREC 3U4EB 3VI3F 5IJVA 3LIZL 4TUOA 3F7VA 2AQPA 2VL5A 3QUKA 3DUSA 2JFCA 4Y4HA 4ZYKB 4ZZKA 3SSGA 3L95B 4NUJA 5FKPB 4J23A 3VXSA 4OLXL 1TVHB 1ZD6A 2A1WH 1CU4L 1AXSB 1JNNH 3L7EA 4PCYA 1YN7B 2GITB 1UOLA 3AG3B 2APWA 4TPRL 3SDDB 4AQEA 1GGCH 4X50A 5BQDA 3RGVD 1GZHC 1E90A 3F12A 3GQFA 1UB5A 5D5MA 4OUUB 1EZSA 2HX8A 1GTNA 1IEHA 2YBRA 3AS3A 2JKTM 2C3HA 2JVUA 5IMOA 1OL0A 3GO1L 4W9IC 3JWNG 4KDVA 3RX5A 3L1EA 4MNGB 5SX5K 3DUUB 2J5LB 4M8QA 4X9GA 3JV4A 4DFHA 3V7AG 4A55A 3OKLA 2K70A 2BX5A 1IKFH 4M9PA 5F96L 1CVSC 1CFVH 1P1ZB 4QNPF 2EDOA 2OSYA 1T2QL 2DI9A 4PJXE 4TULL 1RUKH 1SHWA 1NUFA 1XAKA 3SDAC 2X2HA 5DK3A 1JZEA 1NGPH 3KGUA 2A7BA 3U6XA 2IJ0C 4BFOA 1PCXA 3FTYA 1HINL 4F93B 5DHYA 1DE4B 3RB5A 4EI5B 3QDAA 3HG1D 3MSPA 2E9JA 2VYRE 1BP3B 4FP8H 4Y1AB 5T3XH 1J1XH 1H8OA 1C8QA 4J3OF 4Q0XH 3RYMA 2ADIA 3PGDB 3DXAE 2YZ1A 3TLRA 3B2PA 4LLDB 2BP5M 3WHXA 1YQVL 2UYLB 4D8PB 3QPKA 3W9DB 5I1HH 2OM5A 3TYFA 3KM1A 1UWGL 1QABA 4CDHA 3QCVL 1FCCA 1NOLA 5ESQB 2CHDA 1T0NB 3FQ2A 3K2IA 1SXBA 5GZOC 1RIUL 1QNZH 3GLAA 2WLHA 4R83A 4S1DD 3HG0A 1HZHL 4M3JA 1YEEH 4OIBA 3R1GH 4HH9A 3NCJL 4OCSL 2CGYA 4HK0A 5CUSH 4X42A 1KCLA 1M1SA 5EEXA 3ZHDA 5LXGH 1WICA 3Q6GL 1KENL 2AQQA 1E4WL 2CHWA 2EVHA 5HHMD 3C9NA 1AC6A 4DGUA 5GRUL 5E24E 1EVUA 1NBVH 4AEIH 2WLIA 4AQEB 4AMXA 3HRZC 1I1YA 5CILH 3F5WA 3N42B 4KXDA 1TQCB 4IU2A 4ZMQA 4ONHB 3F12B 3PP3K 1VFUA 2HKFH 2Z7WA 1HIML 3QUYB 3OR6A 3L4ZA 3KEHA 4P5SA 3Q9QA 4UV4H 2EIBA 5J1AB 4Q9QH 1OSYA 2GQHA 2UXFA 2YAMA 3DTXA 3BYYA 2J7LA 5DLMH 4H88H 4OGYH 1D5XB 3FONA 4IOFD 4R4FL 4N2OA 2Q87A 4CVXB 1SYVA 2D03H 1WE5A 2B1HL 4NAJA 2V3EA 1FL3A 2E46A 3G5ZB 1JTPA 4HMDA 4N0FA 2HP4A 4OJFL 4G8AC 4YHLH 4C47A 4HJJL 1MIMH 1RJYB 1CL7H 1SXSA 5BPPA 3EOBB 3SKNA 4N3TA 2AJXL 3AU0A 2QQNH 4PRHA 4Y7OC 2ADIB 4FA8A 3HA0A 3RWEA 5KZCB 3UBFA 3FO0H 2ITCB 3IMUA 3QWQB 2IIJA 2Y6SC 4E9YA 3US1A 2WK2A 4NWUL 3LKOA 5D55A 3DRTA 4TVPE 4UINH 4D9QD 1XF3A 3EH4B 1C8PA 3CFMA 5B1JC 1JVLA 3VRJB 2NXYD 4XBGB 4Z7WE 4KKZA 3AG1B 4CKQA 5JW3H 4P04A 4G1MA 4GW4B 1K6QH 1NFIA 1NL0H 1OZTG 4FL4C 4HALA 2C9UA 2RH0A 3WFBL 1A6TB 2C3GA 5DXWA 5F3BA 5AAMC 1BZEA 1SGKA 1HJBC 1FQ9C 3QIWD 3C9NB 2AQ3A 2AITA 1UXSA 4YXHL 4I2XA 1E42A 3SKJL 1E5UI 2WLIB 1OXYA 1U91A 3FFOA 2PW1B 5AUMA 1WG3A 1YPZA 3KBFA 2EH8H 4AV0A 3GNML 1EAPA 1DVTA 1PZUB 3OR6B 4JM2D 2ICWJ 5MHSD 1KLGA 4TUKL 3PLYA 2D0HA 3DKHA 3LHPL 3STLB 4BSWA 1DBKL 3DTXB 1P4LB 4GXVH 3D48R 2LLGA 5GS3A 3BKJL 5JDJA 3RTQD 3PG2A 4NQVB 5C0CB 2OCCB 3BKML 5GHWH 1GMIA 5F6IC 1AO7B 3G5XA 1JPTH 3FONB 5FWQA 4HAFA 3I74A 3L54A 3T0ED 1YJDL 3KLKA 5AAWA 1WSST 5BRZA 1MFEL 3FQXA 3T6WA 4Y0GA 1MCFA 1HSAA 3B9KA 5E5LA 3VGGA 1FL3B 3GRBA 4AG4H 5KAQF 1F45A 4KK8C 5TE7H 4DO4A 4PJIF 1J10A 2HCZX 1HC1A 12E8L 4PJFA 4OCWL 2W9EL 3HE6C 1ADWA 2ZG3A 5I30H 3VMOA 2Q7YA 1HYSD 4HH8A 1FYTE 2ATPA 3V9EA 1PLGL 4JKKA 5CN3A 1ZEAH 4WEEA 3ABZA 2VABB 4NEHB 1OCCB 3RWEB 1NGYA 4FYTA 5KJRH 1MCHA 3BPOB 3NP3A 2VLMD 4LHUD 2ZTBA 3ZYJA 1L9SA 2ZNWA 1LEGA 2VQ4A 1PS3A 8CGTA 5C09E 5SV3A 2XSKA 2B1OA 3TH2T 2LU5A 1RUMH 4GP5B 3TBVA 2ZOLB 4OD2A 3T8MA 4ZPTB 3TWYA 3VFNA 1FFTB 1PY9A 1DQDH 2D8KA 2ZCKL 4LP5A 1H8NA 1R3IL 1WS8A 1JZFA 3NDZE 2P5WB 4FFVC 4FFYL 3TBBA 2H26A 4UV7L 3QFJE 2F19L 2RB8A 4TM9A 4I2XB 4JJHA 4WY7L 2XZAH 1NPUA 1NUNB 1A4JB 3H6JA 4PSPA 2NNCA 3SDDD 5AUMB 2VTFA 5IFHL 3QP3A 1OHZA 4PAZA 5HDQH 5BCAA 4YHYB 2IBZX 1EAPB 3UG3A 4ISVA 1VEPA 1SMAA 3G9VA 2GAZB 3FH8A 1NDMA 1UVQB 2ENYA 4GXUN 4HUMB 4BSWB 1ZVNA 4UOJA 5CEXA 4JRYA 3GSQB 1PZCA 3ZTNH 1FNSL 1G7LB 1N6QL 3MYZA 2F08A 4K9JA 2BPBA 1CBVH 2A9NL 4G8GA 4H4NA 3U1QA 5BRZB 1XSIA 2XFGB 3FQXB 5FB8B 5JOPE 1HXYA 2DQCH 3CBKB 5ITBL 3D0AA 1GJIA 1RZIB 5E08L 4IM8A 3GI9L 1K5NA 1CGSL 4LPUA 1PD0A 2EXYD 2NY5C 5E0QA 2PTTB 3OKKB 1JPFB 3WFDL 1LHZA 3D0VB 4JLRA 3JV6B 4EI5D 4OLUH 2YD3A 5EZOL 2WBWB 4Y1AD 2ATPB 3CHSA 1NCDL 2O5NA 1JNLH 4Y9CA 4F2FA 2XWJA 4YLQT 1R3HA 4PJCF 2VR3A 4WJG3 3RDTA 1TTGA 1JZ8A 4OCRH 4JFYA 4K5MA 3QPXL 5E4EC 3LPGA 1IFGA 3L4WA 4GMTH 2J4WH 4UDUA 4IBWA 2W07A 4G9FA 4NYLA 4JFDA 4LSRH 5CZKA 3CZJA 3VFNB 1HT6A 5JIKA 4D0DA 1UURA 3TFKD 2XBDA 2YGOA 5H37A 3N41B 3H9HB 3FQRB 3QNFA 4HD5A 5FDWB 2OMVB 3VXSD 5C92A 1KG0A 2VDMH 3BT2L 2O61A 4DKFH 1RCYA 1UXLA 4MWFB 3WBDA 1UC6A 2KZKA 2X42A 3KXFA 3N44B 5ITFA 1RZ8B 4HIEA 4F15B 3UPCA 4AE1A 2FVNA 4JG0H 2M83A 4BFGA 3P0VH 4YSRA 1Q94A 3HNTH 1H19A 1OK0A 3QUYD 5DRWA 1A7OL 4G43A 1HHIA 1FFNA 1W91A 2NY4B 4YHIB 1U95A 2GC4C 4YGAB 4Y7MA 3X1BA 4UTAA 2HJFA 4R7DA 3U9WA 4CW1A 3QRGH 3TBSA 5EU3A 2MPAH 1F3DJ 2EE2A 4M1CD 1LDPH 2PMZA 2R69A 3G9AB 5A16B 2ORBH 1N7ML 1N8ZB 1IIIA 1OCWH 4X6FA 1BZOA 3FOLA 1HXYB 5EUKA 3TBYB 3IJHB 3QJTB 4JPIB 1X7QA 2P48B 3IKCB 4X4MA 5I8KL 4ZJ9A 5AEAA 1CI3M 1ETJA 4JDZA 3LXAA 2MNUA 1MJJB 3RGVC 4PS3A 4AIEA 1FLRH 3IM1A 4JLRB 4IEFA 4TF4A 3MRHB 2Y5EA 4PRNB 5D8JL 3BVNA 5HDBF 1PZDA 3OXSA 1QACA 2E3VA 1R3HB 2FJGB 3O11A 3ZO0A 1E7UA 3N1MC 2F53E 3P2DA 1CO1A 3AITA 3DJZA 3MUY1 4EI6B 5ADPH 2WB1A 4JFZH 1P9MA 9CGTA 1ORSA 3UTZA 1ND0B 5KVEL 3LEYL 1ID2A 2OQJA 5E2UH 1E5AA 2A6IA 3DJSA 2W07B 3NACL 4G9FB 5KW9H 4R7LA 2K3HA 3ROOA 2BVQA 3S0PA 5LG6A 1JL8A 2BFGA 5ISZA 3HI6L 3IFPA 1QPXA 5JIHA 2IANE 3BE1H 1VAHA 2FX7L 2BNQE 1LP9F 1KG0B 2HZHA 4OLWH 5FECB 2EDWA 3FRPA 3OJMB 3TBWA 3OVUB 4R4ND 4X5QA 3KXFB 3E9TA 1TZ8A 3VFMA 1S6NA 2BSRA 2XJLA 1BZ8A 3CCHB 2O5YL 1RZPA 1A6PA 4JRLA 5BOZG 5J1TC 2Z8SA 1NCBL 1UB6A 4PH8A 4S1DC 4FI7A 4G43B 1C1EH 3BP7A 3DPBA 3IPEA 4HBCL 3WL9A 2BVTA 3AT0A 4KJYA 1BF2A 1U95B 4NUPA 3V0FA 5JOEA 4HZLA 4YSAA 1A9BB 1D5RA 1BAGA 4I18C 5C0CD 5EU3B 3MLWH 1AO7D 1YAZA 5A43C 3ZRFC 3O9WB 2CAKA 3DVGA 1R5VA 3FOLB 4RMQA 4OF3A 2FJFB 4P2OB 3T4YA 3IB4A 2BNUB 2DDQH 4V2BA 1KB9K 4JDZB 3D39A 3O41B 2DIEA 3PWPB 1R24A 5ETUA 2DLEA 1YSOA 1HH9B 1FIEA 2IBBA 2WTPA 3BVNB 3NA9H 1K8DB 1A65A 2X6BA 4I13B 4OT1L 4QRAA 1ASPA 1DSFL 8FABA 4UILH 4EKXA 1CDIA 1YLBB 2G3XA 4LVNB 4PRHD 5I1DB 1QW8A 5FYLL 2XLLA 4I3SL 2W1NA 1EJ6A 2YJQA 2OJEB 4IOFC 5C71A 1RP8A 1JHLH 3GEFA 1SMOA 1UWEH 4XPFH 3ZIMA 2OQJB 2OMXB 3LNGA 1GY1A 3BRFA 2PN5A 2Q1EA 2P42B 5EO0A 4CN1A 1N64H 4Y8DC 5ISZB 4GFTB 3GMMB 5IW1A 3KPSE 2OW7A 3FCSB 3LN5A 5IK3A 3G6JE 3OLGA 3OKNB 4NP4L 1MCOL 5GS1B 2J1ZA 4RSYA 5DJAA 1UTDA 2P5WD 2OP4L 3F84A 3MLUH 4XNUL 4TXVB 5JPNC 2CHXA 3FRPB 3QJHA 4FTVE 3TBWB 5KVGE 4C4BA 3KLQA 5D6CB 3ZR5A 4AK1A 1DLFH 3WUWB 1WFJA 4CSZA 1MELA 4OZGF 5IREA 2BSRB 3OMNB 1I7ZA 4OD1L 1RZJH 2WWOA 3I3BA 3SO3B 1SF3A 4Z7UF 3MRFB 4K3DH 1NC4A 2DQHH 4M1DL 4PJBA 3ZKMD 1UB6B 4APQA 4JY6A 3DPBB 3L81A 2VR8A 5IEKB 2NXYC 4ORGA 2YUWA 1L0XA 4HZLB 1THAA 5AVUB 4YHML 2OXHB 2BRQA 4MCZB 4NN7B 5F9DC 4G70B 5IROA 5BUGA 1BVNP 3GHBL 4OI7A 1MJUL 2F5AL 4PS8A 1DHKA 2FO4A 2F2HA 1R5VB 3VVVA 5BRZD 3QIWC 5TQ2L 5JMRA 4M5YL 3RPKA 1XCQA 3ZBMA 1JI1A 5HVWA 1PZ5A 1YHPA 3EOTH 1UCTA 4M3KB 3D39B 4YDNA 4MS8D 1MZYA 5ETUB 3UO8B 2AK1H 5I66A 2JNZA 1MY5A 1U8NB 4JM2C 4PJ7A 1MCIA 3GB7A 3O2VL 3BAEL 4W6WB 2YK1L 8FABB 4YE4L 2NUPA 1DDTA 3C75A 3ZRSA 4F7EA 3SPVA 2ZX6A 3RTQC 4Z7OF 1BYPA 1QBML 4Y2OB 2B0SH 1KEGL 3WIFA 2Y22A 4FXGB 3U2SA 2XPZA 4JDEA 5JNYA 3FQTA 4KITB 1DTUA 4LSSH 3T0EC 3ARSA 3FF8A 2G9KA 2D9QB 2CKNA 4R96B 4D2NA 1FPTH 1KPUA 4PVMA 2CXKA 3QS3A 5EF3A 2W60A 3RNKB 5B1AB 2AAAA 2W65A 1S9XA 3OGCA 1L3WA 3LN4B 4RGNB 1UACL 5D7IE 1KY6A 1WBZA 3BO8A 4ODWB 5EOCJ 1QFUH 2DH3A 5CAYB 1BFOA 1CE1L 3LN5B 3UIZA 2WTRB 1H3XA 1H3PH 1QFWH 4KRNA 1W0WA 1WIPA 3MJ8A 3EYQD 4U3SA 4PCSA 4MRBA 3O45B 4H8VA 1V7ML 3A22A 2J1KA 2AF2A 2A99A 1MCLA 3IU3B 4HC1H 1I7ZB 2H3NA 4GKLA 1U2YA 3FTGB 5HVHC 2WVUA 1ESOA 3STZA 4NHUA 3P54A 3V4LA 4YX2H 1S3RA 2A3TA 2GABA 4M00A 1RJZA 1YEIL 1U8KA 1EJOL 3S5LA 2NY4D 4FS0A 2W9LA 5AD0A 3MRDB 1T21B 4OIIL 4HUUA 4L3CB 3VG9B 5C0BB 4OI9A 5CCHE 1U8OA 3VWKB 3QG7H 4HFUL 1HXMB 4XN8A 3QDGE 2FO4B 4G8GD 4JFWA 1WZ1H 1EUTA 3ES6A 1QTSA 2C26A 3GMRB 4ONGL 1T4KB 35C8L 4J39A 3BN9D 4XN4A 4ZUTB 4LFHD 3SDDC 5D2NC 4FKEA 1PZ5B 5HSFA 5A7EA 5DA4A 3LNEA 2NZIA 4FZEH 4D7BA 1H6EA 3TXAA 1KCKA 1JWSA 5I66B 4PJ7B 3GB7B 2K9FB 3MNDA 2VCOA 3HG4A 3MV7E 4GH7B 5K1NA 2NUPB 5D7LA 4NQTA 2J5LC 2JB5H 1BZ9A 1XCTA 4ILDA 3U2SB 3HMWH 4FLQA 4BFKA 3FCGA 3QEGH 2X9XA 4TOYH 2NW3B 3OD3A 1NPJA 3MNVB 3FPYA 1JF1A 3IN0A 4GMSH 1FIGL 5FUZL 2HKHH 3OGCB 4G9FD 4FCAA 2RACA 1CDHA 3BO8B 1EERB 2IH3A 4PQXA 4EI5C 5T1JA 2EO7A 4DNLA 4AIZA 1E4XI 1TYJA 2I26N 1A7PL 1KIRA 3U7YL 1W0WB 4DEPB 1TEFA 2X7LB 4YOKA 1OTSD 3MRCA 4LAJH 4P49A 1M1XA 5D7JA 3CZFA 2C7FA 4NZTL 3F62A 3KXFD 4PCKA 3P0YL 4ZPVA 2O93L 2ZOTA 3CH1A 2D31B 3L4YA 5FA3A 4AQAA 1DBAL 3X17A 5HGHB 1BBDL 4DW2H 3K71A 1E9QA 2ZE0A 4OB5H 4KO6A 3GHPA 4NHUB 5CLYA 3MGTA 3UTSE 1B3IA 4KX9A 1RJZB 4KZDL 1FUNA 4HK3N 4NENA 4W93A 4KNQA 3PP4L 3ZYOA 2LW3A 1AQMA 4NJ9L 2VWEE 4QTIH 1ZA3A 4HUUB 3ILDA 1BAFL 2FX9L 1IL1A 2G2NA 4AJWA 4ZNCD 1FYTB 1XHHA 3O9WD 4KV5E 4P5MB 1BPVA 3UAFA 3BGAA 4CVZA 4JKMA 1CICB 4YSSA 3NJXA 5T1DH 4P2OD 1UD3A 5HD8C 2XWBA 2VR4A 1TQCC 3LH8A 1HE7A 4XHJC 3VXQB 3QR0A 2WGNB 5C09B 3QUYC 3MCKA 1JWSB 2X4TB 4QRSB 2OL3B 4ZT1A 4XPBL 3QXTA 5G4NA 1YEHL 2A6JB 2Y7LA 1F3RB 3G5YA 5INCA 3FFDA 1S2EA 5I23A 4Z6AT 1BZ9B 1K3ZA 3TESA 3WE1A 3U0PA 3H42L 4E9TA 4LOEA 3ULVH 3PAVA 4R84A 3SYOA 1UA3A 1X3DA 3P4NA 1ROCA 2VW7A 2MJWA 1BJ8A 3QFJB 1DCLA 3VD2A 2UXTA 1ES0A 4PGCB 4D9LH 4TTDD 3UC2A 3GBLA 1QQDB 3FQNB 4ELMA 3GJFA 1G1YA 2VOTA 5ISZD 2R0KL 4AIZB 1Z5YD 1SPDA 2IPTH 5K93A 3MOBL 5DJYA 5BXFB 4AC2A 3CAFA 4JBSA 1NCUA 4AJYV 5D7JB 1HWGB 5H4YA 1OHQA 4ZPVB 4N0UE 4PUBL 2OXGB 1YC8A 5FA3B 2YXWA 3ELQA 3RKDD 5CCKH 3BZFA 3X12B 3K71B 4ZMAT 4BD4A 2EUWA 1G6RA 2FX8L 4MA3B 3MBXL 4NO2B 4X6CE 1UA6L 1WBXA 4YXLL 1OALA 1Z32X 5J6HA 5A40E 1QLEL 3S4SB 2VXSH 5EZJA 3DROB 1E6OH 4PU2A 1PG7X 2NRDA 1ZA3B 4GSQA 1IEBB 4JE4B 1Y1DA 4X8XA 3TH4T 2WOYA 1IL1B 4AKOA 1CK0H 3J07A 5JIMA 3I3DA 4PJEA 4X80L 2RFXA 4R4NC 5K9KA 4CVZB 5F3HA 1U8HA 4JFXB 5KSVB 5IUSA 5I71C 2WXMA 3SDYL 1XZWA 3I6LE 4H1LH 3ZDYF 4X0NA 2Q6WB 1N19A 1PPIA 5DEGA 1UG9A 3D39D 2QVIA 1DR9A 2MH4A 1O9VA 4UQ9A 3RZCA 1WIUA 3GSNL 3NCBB 1BZ7A 4LPVA 4E41A 4BJLA 1NDTA 3KLAA 4XX1E 3RAJL 2IAMB 3NCFB 1V7NH 4O02L 1E5CA 3FFDB 2JLPA 5EIIB 1UGKA 2IO5A 1N6VA 4X6EB 1PZ3A 4LCUA 1CG9A 5GIRA 4B7LA 5HY9B 5D7HA 3GUTB 2BJMH 4NM8L 7CGTA 3GTNA 1WCBB 2DOCA 2B2XL 2PP9A 1EAJA 4RGND 3GT6A 3KR3L 4AQ8C 2A4CA 4PLJC 5GS2H 4HT1H 3OJDA 4NNPL 2EDTA 2WKOF 5EMYA 5E9NA 3KPQA 3UGUA 5L2KA 3IEAA 4N90E 5IQ9B 4XB8A 4MQ7A 1NMAH 1DBML 4LDLB 4NZDA 4XMPL 1A6VH 3BPOC 3O2DL 2EILB 2J44A 1J9TA 1T5XB 4R2GB 2NX5A 1AYRA 1KBKA 4TNGA 5DD1L 1G6RB 4KHXL 3V4PH 4NXSA 1KIPB 5LJYH 1WBXB 3EGDB 3U7WH 1AE6L 1Q90A 1X5YA 2JJSA 4FC3E 5DVPA 1Z5LA 3AQZA 1FVDA 4XXWA 1N6UA 2OJZL 1R3KB 3GMPB 4YAQA 2BIPA 2YQBA 3NG5A 2FEDD 2XZCL 3TV8A 3HCVB 3E6HA 3QNXB 3MXVH 2G9HA 3VSUA 3WN5B 2R56H 3NIFF 5C0BD 1OVZA 3MJ9H 5F72S 4BCZA 4PVBA 3VWKD 5IROD 1GC1H 3ZDWA 2N0KA 3ARBA 3CHRA 4NKOB 1CPUA 4TQEL 1CFTB 3NABL 2RGSA 2NNXA 2VAJA 4JFHD 3BVTA 4Q6YA 1FVEA 3LB6D 3X3GH 5IQ7L 4PJ9A 4ADJA 5JDSB 1DQQB 2Z7UA 1PX3A 1T4WA 4RA3A 3RZCB 1YECH 4YHYC 3ZKMC 3MRLB 3RKPA 4EPSA 1XH3A 3SBRA 3BLKA 4LCCA 2O5XH 4V1DA 1T22B 4O58H 4E41B 3LKRA 3KLAB 5DUML 3WO3B 1BIHA 4U1LA 5A6LA 2FWOB 4PPTA 2WKGA 3FW6A 3ZTEA 4YPGB 3QFDA 1KB9J 1DLHA 1EXGA 2CU9A 1B2WL 4BFIA 3O2WH 2IANB 2Y9RT 2OTUA 2CZNA 1QO3A 1PCSA 2BNQB 3T2NH 2VC2H 3B9KC 3GSWA 2DMHA 4H0IA 2WVTA 3CTTA 3W3BA 1ET7A 1SFDA 2UWEA 5TQ0L 3ZL4L 2B15A 2HTKD 1T20B 4PGDB 3SYCA 2H9GA 4RA0C 2VDOB 5HBBA 3D09A 3DOSB 4NKMB 3SE8H 4QYAA 4U6VH 3L5HA 4Z1PA 2CXGA 2CK0H 1P6AB 4IBSA 4OZIE 1M6OA 4J27A 1JPEA 5J4MA 5EU6E 1S7TA 5KVDE 3LV3A 2BWQA 3MBWB 1CGUA 1K3IA 4X0KB 4YSQA 3CFEB 3RU8H 4MHHG 1S7UA 1QSFA 4P5TA 1FVDB 2J8UE 2WMPA 4WFEE 3S37L 2MNWA 1K72A 4XBMA 3K0WA 4NP9A 2EH7H 5T3ZD 1ZHNB 4NOBA 1SM3H 3GXPA 5I8EA 1JK9B 1WZAA 3EYQC 4ZMPA 7TAAA 1FYTD 2Z8RA 3VFOA 2KLRA 3BRGC 2RA1A 3GIZH 1JN6B 3FB8B 3BD3A 2CJSA 4KVNL 4MDJA 5ICZB 2JIXA 3EJUA 1FORL 1CICD 1YY8A 1J48A 4X9YA 2OMZA 1Q4NX 4BQCA 4F37F 1A1OB 3EYOA 4WWOA 1SDYA 5FYJL 1FBIH 3DECA 3FC8A 4JY5H 3RGHA 1L7IH 1XH3B 5GS0L 2UVEA 1JZDC 1NLBH 3A23A 1CN4A 3L8QA 4OQ1A 5LAPA 4V1DB 3HR6A 1VPOH 2Q8BL 4NLHA 2Q3AA 3HFMH 3LKRB 4OTXH 4U1NB 5EU4A 4JFFE 3MREA 4Y5XA 1AZBA 4UQEA 2WXFA 4XVTL 3QFDB 4FYSA 3KPSB 2NNAA 4BFIB 1YEKL 1MCWM 4E9VA 2HPOA 3FN3A 1DL7L 1NINA 1NCOA 4KMTL 1JV5B 4WFFE 3BN9C 5L6YL 2BHYA 3GSWB 1MFAH 2R59A 3F8UB 3QFJD 4M6NL 3IBEA 1I53A 1F1DA 1LQBC 2CO3A 3HB3B 5IG7A 4OQTL 2VXQA 3WJMB 5HHVH 2HVBA 2O30A 3P69A 4JHBA 5TPWH 2QLVB 5J6SA 4YHOH 4DP1X 4WKXA 3MKGA 2PTUA 1QA9B 2DLFH 2DLTA 2FEJA 3PWLB 4MJ6B 5FF6A 5IMMB 5D7JD 1AP2B 4AYEC 1QR1A 3N9GH 1W80A 4OJCA 4LSQL 3ABKB 1IGIL 4LEOB 4A7UA 4AYSA 2X4NA 3DX9A 1D2OA 2IADA 3QUZA 3B2DC 2CDFA 3LQZB 3UYPA 2FIRT 4LSDA 3MA9H 4FTDA 3BP5A 4GAYA 1OE1A 4P5TB 4UT6A 2A6DB 2YEVB 4QT5A 4AEFA 1KWGA 2Y24A 3D3VE 4F8TA 2E4TA 3QYCA 2WLKA 2G4EA 3ORJA 2EDKA 2F5BL 3VFOB 4AITA 3RHWK 4TNVF 5CBAB 3U6RB 5E2WH 2IDSA 43C9B 4XPGH 5KG9A 4YSPA 4ERSL 3U9UB 2XX0A 2LU7A 1CXIA 2HLAB 3GSXA 5DJZB 5GGRB 3QO1A 3DI2B 1OK8A 3O6MH 4Z0XA 3WE6B 2WYIA 2WXIA 2ED9A 1UM4H 4ZFZA 3FOMA 3MR9B 4RESB 1YYML 5I2IB 5DJXB 4A7VA 1KBGH 3I6KB 5IB1B 2IAMD 4LCVA 5EBMB 1JGIA 4UU9A 2XG4B 2NNAB 4KO5A 3O9WC 3E8UH 1TQSA 5J56B 1HFUA 5KS9F 4IGBB 4P2OC 2Q8AL 4FJZA 2C3XA 1FO0L 1FNFA 2GW5A 4ZMYA 4JPSA 3F58H 1CCZA 4XNBA 4AY0A 3DV4B 1TNNA 5DS2A 1ZIAA 4N24A 4Z7QF 2QT6A 3COOA 4M7JL 4ZW7A 2CHNA 4DTGH 1NQBA 3WOVA 4WWID 3IFOB 4NQEA 3BH9A 4LVNC 3BVVA 3UBXB 5FF6B 3ALXA 4WW1B 3OKMB 3P40A 4K8RH 1QR1B 1XB6A 2FECI 3CXHK 3U30B 3ZYIA 4R2GD 1P9MC 3KBEA 2X4NB 3ECQA 4RAVA 1SBSH 2IADB 3V10A 3QUZB 3P9LB 2ADFH 2XV3A 3HNVL 2ZX9A 3QDGB 1BQHA 4HXBL 5M94B 1F4XH 1WAAE 3UYPB 4Y89A 3BP5B 4TTDC 2IWGA 3HHSA 4PRDB 5F1SA 3ZE0E 1AQHA 1P0SE 5C0FB 1F4WH 5DJ8A 2IDTA 2HWZH 3DTDA 4ORZC 3ZDZB 5AB9A 1UXWB 3HI1B 5F9OH 5GS1C 3L3HA 1AVAA 4RGMB 5IBUG 3QCTH 3O3BA 3ZE1B 4ZMVA 2DI8A 2YRBA 1F6LL 4NRXA 1IE4A 1A21A 5B8CB 1TIUA 4JM2F 3RKDC 3SDCA 4ETYA 5IUCA 3SO3C 3FB5B 3D34A 4MMYB 3NCWA 3RZCD 3P0GB 4PJDF 2BMKB 2NY5L 3MLSL 4G59C 5BMFH 5LXVA 1O5DT 4ZFOB 4ONOA 3PWNA 2DKMA 2ZOOA 3EOYG 1T2JA 4WK4B 3T77A 1MNUL 3VAEA 4E41D 2BSBA 1G7QA 1KCVL 1QSEE 3CE1A 3QI9B 5DK2B 4NN7C 2TSAA 3V0VB 1E8ZA 1QVOA 1XGZA 5EC2B 4I0KA 3U7AA 4G6MH 1MFNA 5DMKB 5L9DL 4NUGH 1H6FA 3KLHD 2IAND 4LEBA 3FCUB 4LEXH 5DZPA 5I26A 3QIBB 4HWBH 1OM3L 4WSJA 2EVIA 1U58B 3O4LE 3CFNA 4MXQC 2KQNA 1YYCA 3PHOA 4K3JH 4OSUL 4IOSD 3UG4A 2WIIA 1ZS8B 2K78A 4H1LG 4YPJA 3SBWA 4HUXB 2K6WA 4HGWB 2YR3A 3C6SA 1LL1A 2BERA 3ET9F 1M2VA 2WLJA 2XA8L 3MOAL 3BH9B 3GLEA 2JXMA 2AABL 3ZY7A 5SWZA 15C8L 5KSBF 5E6IB 5E4OA 4YFEA 3I84A 3N1GC 4FXGC 4F24A 3GMNA 1X44A 2G2RA 2NX5D 3BW9B 3N04A 3K6OA 4TLKA 4Z3IA 2V2TB 3EYUH 1IEAA 2B59A 2Z34A 2EABA 2ICWA 2VDNH 2A77L 1AKJA 2ZYSA 3WFCH 2ODHA 5AZEL 3Q44A 3HHSB 1AMYA 4RGNC 4CC1A 1EGJA 5I73B 2YQGA 3U48A 1KYAA 4PD4K 5DJ8B 5GGTL 1E4JA 5B1CA 3KPRE 3CQQA 3I9GL 3L3HB 3MAWA 4Y8AA 1NMCB 4LKXA 1W6WA 3ZTJH 5LN4A 2AQSA 2CIKA 1YYLL 1J5HA 4HFWA 4NIYE 4P4RB 4PJ9D 3NSCA 1U3JA 3D7PA 1AGCB 1SY6A 2QHLA 4APQC 4ZSOE 1RUAL 3KLLA 3NCXA 2AQ2A 4WHYH 2K9UA 1KELH 4XPHL 3I85A 4HXAH 1RSFA 1YMME 2AI0H 2Z3FA 3FSOA 4V1DD 1ACZA 5JORA 4PP2B 4JQIL 2FEDC 4NNXB 4PYGA 4FQ1H 3VG9C 4YH6A 1U8LA 5IROC 4I0PA 3VWKC 4F5CE 3KPSD 2D2OA 3QH3A 4FQCL 5C08A 5TE4L 4RGOH 3MBEB 2DAVA 2APXA 4K23L 1H5BA 5E6ZA 3K6SB 1JFHA 4KUCF 1UQSA 2YAFA 5HJGA 4B9PA 4GT0A 2E6QA 4NJAH 4ZX5A 3MUJA 4MA7L 2FK9A 4P3DB 1KWKA 3HB3D 3PHOB 4N0UB 2HT3D 4U1SB 1SEBB 2P52A 3LS4H 2FQDA 3C6SB 1EHLL 1EAOA 4HLJA 1ETZB 4IOIA 1HDMA 5FYKL 4AYGA 1YA5A 2JXMB 3F7YB 4OZHA 5SWZB 3BLBA 4XP9L 2W0LA 2VDLL 2JI2A 2G2RB 2Y1ZA 1EA9C 3NUKA 4ODVL 1S78D 4ZDHA 3MRNA 2V7HB 2F9BT 2ICWB 2QL1A 5FC9A 4HKJA 2GSMB 4P05A 3O81A 2OULB 4FADA 2JKRM 3PXLA 4OAWA 4P5TD 2ESVA 1UM6L 4PRAB 5BJTA 3AXLB 2VN3A 1MEXL 2HTKC 4N5UA 4N8CH 3ZSTA 2P4AB 4OFQA 1IGYA 1EWHA 5I17B 4DEPC 4WSGA 5IM7B 2ZXQA 4QRRE 1LQSR 1S7RA 4LKXB 5CINL 5IOPB 3N42F 2R0WL 4KUZH 2X70B 2BS71 4L0ZA 1LE5A 1T7ZA 2DY2A 2FO1A 3R4RA 4J1UA 3QHTC 5FYJU 2VDQL 2MEJB 3APMA 2CKBB 4HFWB 3SQOH 4Y4KA 2CH8A 3DJTA 3IPFA 4P59L 5DZJA 5AL8A 2RCSL 4MZ2A 4OLZH 1SOSA 1LWRA 3F04A 1EMTL 2EXSA 3R7RA 2AJ3A 4RETB 4YO0A 5E6RB 1MI5E 2BVEA 3FQWB 4I0PB 4K07A 1CWVA 3N40F 3L3JB 3RVUD 1AXTL 2MMXA 5GSVA 1CICC 4F7CB 5I0ZA 4IGBD 4ZQKA 3S2AA 4NBYB 3V5DA 1GS6X 2IALB 1ETB1 2ZYIA 5DZLA 5F7NC 4XMUA 3V6ZB 1UWGH 2DQJH 3UAEA 2OR8A 2VNCA 5HI3D 4ECNA 1ZV5A 4L29B 4DQOH 4M5TA 1BG9A 1NCWL 3OHMB 3W0WA 1A1MB 2A74B 5F7BA 4JR9L 4HU2A 3ARGA 4XB7A 1BWMA 4G5ZL 1Q72H 4MYWB 4TV3A 4UNIA 5D6DA 4OZHB 1OSZA 4D94A 5D2LE 3DBXB 4X4XA 3ZW3A 2AXJA 4QOKB 1WGVA 3QEQE 4KNSA 4ZDHB 3EOAA 4FFTA 4WNQA 3QUZD 1NMBL 3J27A 4FHKA 3VMPA 3QDGD 4HKJB 4D9RE 2EC8A 5L8LB 5FWRA 1NBZA 2FWLB 4OAWB 3WY2A 1CGWA 1N0XH 2ESVB 2YJLA 4K94H 2FZ3B 3MYJA 5E51A 1ZA6A 2CCVA 3TVMA 1KJ2A 5FUOH 4PTUB 5HGAA 4GSDH 3RWFB 4YBQD 2ALAA 2VERN 3MJGX 1U8CB 2F7OA 3FRUA 2YD5A 3PABB 5TDOA 1P1VA 5D7JC 4CVWA 5D1QB 1KIUA 2FRGP 1RURH 3IFLH 5DS8A 1LE5B 4HAKA 1B0WA 3CVHL 1I8LC 3IFNH 4U1KA 1TTAA 4PJGE 5LO7A 4JHAL 2QMJA 3INUL 3KHOA 3L7FB 3P3UA 1B4JL 5FDYA 5HVFB 3EJZD 3UZEA 1L0YA 4Q9CA 4GG6E 1LWJA 2PLTA 3SHSA 1MFCL 1MWAL 2AXGB 2AJ3B 2ICEA 1VFAA 2OMBA 5GRWA 3QI9D 4EBQL 3D0LA 1T1YA 4XOAA 5J13B 3QJZA 4L1BA 3US0A 3A24A 2WJ7A 1M56B 3S35L 3QIBD 2D3LA 3GBNH 4WU7A 2AVFA 5FFOA 4NHCL 5K9OA 4CADB 1AI1H 1LO4H 1ZT4B 4RFOL 3ZT6A 1U8QA 2FJUB 3F00A 4B9YA 3ARPA 4LCYA 3VGEA 1ZLEA 4PV8B 1PNCA 2BOCA 1ADQH 1CXHA 3PY9A 4HS3B 4JFPA 4A6YB 1IAOB 2MRYA 5IVZA 3ARGB 3OR7A 2J8UB 2VN5A 4I5BB 3IGAB 1UADC 1S9KC 1TSHA 2XZQH 4EUPH 5J7CC 1NGQL 4X4XB 1HQRA 1V3JA 4P4KB 2D3VA 3I6GA 4WNQB 1SJHB 3BSZH 3QJXA 4IK7A 1NFKA 3FCTA 1XSKA 1TPXB 2WLNA 4UQDA 5CLZA 4DKTA 2WUCL 4ONFL 4IKIA 5T1LA 5EDXA 3VXRE 5KVFL 4G80A 1G9HA 1GGBL 1FL5B 1NFDA 4JUSA 1DEEA 2HN7A 3FRUB 1HU8A 5TDOB 4AM0Q 1I9JH 2OMNA 3S34L 2FBOJ 3ZL1A 3WCYA 1GAFH 3FTUA 2A4ZA 1G0YR 1S5HA 4LK4A 4R2GC 5DC2A 2EEBA 4U1MA 5AZ2L 1VKXB 1OF2A 3V4VH 1ZAGA 4U1KB 2Y4SA 3VI3E 4WUUE 3FMGH 5CP7A 4F57H 3JTTA 5I1GL 4Y4FA 1HYRC 5DO2C 4KFZC 2Z4QA 3WXWL 4AWJC 3HZYA 5CGBA 1CMOA 1X5XA 2JH2A 3HJ0A 4OLVH 2ICEB 1ET8A 3JBG7 1VFAB 4FFZH 3WN5C 1GZQA 5IP4A 2YMOA 1T1YB 4QUOA 2QV2A 1RHFA 3PF2A 3U25A 4AYMC 3MBED 3IS1X 3LEXB 4RMVA 4HKXA 3LQAC 4HZ1A 5IBTL 2AJSL 5C0ND 3UO1H 1MDTA 5F1IA 1IE5A 1TF4A 3MODL 4C55A 1G7MB 1SEQL 4KDTA 2QLYA 4ZTPH 3RZCC 4Q9RH 4KKAD 2MPVA 4UMGA 3DIFB 2EVGA 2BOCB 2C9VA 4JFPB 4WI2A 1W15A 5HJBA 3PXHA 3L5XL 4G3YL 3T5WA 3OR7B 4JFQB 3UROR 1MVFA 2ZCKH 5SWZD 4QNPE 4S1SH 2DQIH 4OIFA 2IH1A 4NWTL 2NY3B 4GXFA 2AERT 3D3VB 3KLHC 3HIZA 3N2JA 4H13C 5IMKA 1IFHH 1U33A 4ESKA 1ZTXH 1JD9A 4IRZH 4MD5A 4UV7H 6FABH 2LT9A 3QW9A 3CN2A 5B4MD 2V5YA 4AYFB 3N41F 1F13A 2ZF8A 3APFA 1TJIH 3B3IA 3B3BA 4N0YL 2WNGA 5DUPH 4ZS7L 5CCGE 1TQWA 2FBJL 1VZGA 5T1LB 3I50L 1GZPA 3CXHJ 3EH2A 1MHHA 3T0WA 1HHGA 1Q1JH 4G80B 4IKJA 3N44F 1BLNA 3K5SA 1MQKL 2JCWA 3OMZA 1DEEB 1EHKB 1TLMA 2SEBB 1NOAA 3VFSA 1TCRB 4J6RH 3PWJA 3VUAA 3VXOA 4EOWL 4FERA 3HPJA 5B1BB 2HAZA 2ODIA 3GRWL 3DX3A 1KTCA 1QBLL 4U1MB 2PPFA 1S9YA 3FPXA 5LKNA 2W5PA 1WWCA 2A9NH 1YEFH 1BFVH 1JS4A 5CP7B 1F0LA 3JTTB 2JJSC 2R8SL 3EGXA 4DGYH 5IJCC 2NQCA 3A6CH 1XZ0A 5EF0A 4S0HA 4AIOA 5GJSH 4ZUVB 5BQ7A 1JGUH 1OAUL 3TA3B 4DAGH 1T03H 1S9VA 2A73B 4IW4C 3RL1A 4O51B 3A4AA 4I0PD 4LLUB 2J88H 1J05B 4M4PA 4QRUA 1C08B 1HOCA 2WVSA 1G5GA 5KTEL 4NZ8A 4J5VA 1F1AA 4YFDB 5EFIB 2FQGA 4WGVB 5KVMC 1I3RA 4Z7VA 3D85B 3ZTJG 4PJ9C 3D18A 1QEXA 1IQWH 2DTSA 3EFDL 1GSMA 2QPUA 1T7VA 2OYPA 3RWDA 5DD5H 4YHZH 4GSRA 5DQ9B 1VGEL 4QJ5B 4LCCC 1XF2A 2HMID 5A2AA 1G6VK 2QFPA 4KMQA 1IM3B 1M05A 3CZSA 4N6RA 1PDKA 3IMRA 4WHYG 4UT9A 4CGTA 2Y07H 2CJTA 1JV2A 2IH8A 2IH1B 3BVDB 3FUMA 3GIVB 1ZHLA 2VH5L 3ATBA 4QOKD 3VXTB 1FDLH 1GYVA 2NLJA 2ZSVA 4RMWA 5FO7B 1CLVA 2DD8H 2FSEB 4JM0A 4IRJA 4MD5B 2OZ4L 3KNBA 3VA2C 2BXZA 2VQ1A 4TNEA 4CVUA 5KVEE 3ECUA 2ESVD 4Q97A 2HT3C 5L4IA 1JXKA 4OLYH 2ZX7A 1L4IA 3BC9A 2PCXA 4WU5A 1MHHB 3Q01A 1NAMH 1NLDL 1MHEB 2XQYA 1BLNB 2VMEA 2JJTA 4FQHB 1UEMA 5F8RC 3VFSB 1CLZH 4XO3A 3MV8A 4XX5A 5D1QD 1F4HA 1C16B 3FUFA 5I1IH 4HJTA 4YHNA 4PFEA 1T66C 3T0XA 3TWCL 3WIHH 1QSEB 1S9YB 2V7NA 1S78C 1ZLWH 1V8HA 1HOEA 1ZANL 4PD4J 4FNSA 5D71H 3T65A 4NPYB 3K4ZA 5JW4N 3O3DB 3BPLB 3B7SA 1NGXB 4P5TC 1CZ8L 4KZCA 3IDXL 2ZJSH 3TH3T 4BE5A 5AKSA 1XIWA 3ESNA 4Z77A 5GGVY 3ZU8A 1S9VB 3VNZA 4A2MA 4ZMZA 3VE0A 3UJIH 4WNJA 1MNNA 4FMVA 4ZO7A 4QRUB 2ZX8A 4PLNC 3ABLB 2AAVA 4UIKH 3JWDC 2AFNA 5ECGA 1JHTA 1J12A 4FQIL 4X5PA 4HGMA 3G08A 5JQIB 3LS5H 1W8NA 1RZQA 3BEWB 3KJ4C 4J8QA 1YN6B 5ACLA 4XN1A 5SWQA 5DHXB 2J72A 1ZSDA 3HAEA 2E7MA 4B95C 3B7UX 4KXZI 3ARGD 4N6RB 1PDKB 1NGWA 1D7CA 4WFED 2V37A 1IJ9A 2L7UA 4PJXA 1H9VA 1FC2D 1D7DA 3NVQA 4XCEA 3DETD 5EIVA 4H8HA 4PMFA 3CDFA 4P4KD 1SZNA 3GI8H 3KPRB 4RRPM 4PJIE 1ZT1A 4IRJB 4M5ZL 1BD2E 1RHHA 4IGBC 5K5YA 3Q2VA 3ETBF 3RUGE 1NCAH 5E8OA 4ZX3A 1RJLA 1FGNH 4R4BA 4PJAE 2FGWH 2O5YH 2FE0A 5HI3C 2EVJA 4WU5B 1EX0A 1QX1A 2Y7OA 2DYPA 1G0XA 1DFBH 4U6HA 4QJ4B 1U8PB 4XXCC 3BZ5A 4XAWL 3S6CA 3MV8B 4RMSA 5HI4C 5IMLB 4AXWA 4CJ1A 4YHNB 2XV0A 4PIBA 1IAKB 3HS8A 2K6YA 5FCSH 4I77L 3TT3H 3IMTA 2XRAH 3QUZC 3T65B 4Z7NB 4WEBH 3E1ZA 5LNGA 4GUPB 1HH6B 3CHQA 3K8KA 2RJMA 4BZ1A 2E7LA 3QRLA 5EZLA 3NZUA 4XMKL 4Y1SA 2OMUB 5LBSL 4IRSB 2HVJA 3BQUB 4KJPD 3ARRA 4YBQC 3VE0B 4R5TA 4I3RL 3QUMA 2SODB 5FIEA 2WLYA 1AS7A 4M93B 5FYLH 2VN6A 4X5WB 4HD9A 4MKMA 1LO5B 2AC0A 4JKNA 3M17A 3S97C 1AHWA 3C87A 4KBPA 3B37A 1MJ7L 3RPIA 3QI9C 1S3KH 3MRKA 4XP4H 3HLAB 4MA8L 1D7FA 1OGTB 2IFGA 2NY3D 1CXEA 3D3VD 3BKYL 2FWSA 3KLSA 4XNUH 4UQIM 2P9RA 4QRRB 4ZX4A 4PRPA 3S8GB 3HVDA 1TNMA 3EDFA 1A6UH 4JM4H 3Q0HA 3EDEA 3S37X 2YWZA 3FT9A 3ZKSD 5D4JA 4R4BB 5I0WA 3D4CA 3H9SA 5T1LD 1CDUA 4HIXL 4GRMB 1ZLWK 4KKRA 4LLYB 1DN0A 1O7SA 4E42A 2AJUL 3PPSA 4PREA 3ARZA 2J71A 4S1QL 5IFJA 3JWOC 4CILA 1UH2A 4U6HB 4HKZB 3S88L 1J0YA 3ULUH 5ACZB 2Q3ZA 4X8JA 3HG3A 4GAGH 1D6VH 3QUGA 2BSED 4ZQTA 5J11B 4MNHA 5CJQL 4M3HA 1QKZL 5B3JE 4QRTA 1JXDA 1MI5B 3OKDA 3TC9A 1FA4A 1OAXL 1SBBA 3CN1A 5KSUB 5FV2A 4EUPG 3AG4B 1A0QL 1BBJB 1RZGB 1OAZH 2VRKA 1HQ4B 3C8DA 5I73C 2EIZA 3QDHA 1QI4A 1A6AA 3FBQA 3GZOA 5B21A 2EO9A 2XPYA 3IS0X 3QQ3B 3TA3D 2OMYB 2HVJB 4BDVA 5FM8A 1X6LA 4X5RA 2ZP8A 1FCGA 4Y88A 5CSZB 1G87A 3IDUA 4IMKA 2ZKHL 4YDLB 3U0WL 3UFIA 1P7QA 1U2HA 2J21A 3H54A 4PY7A 5JXEA 4PJ7F 1WHPA 1WFIA 3D85D 1XR8A 2XFXA 2CBPA 3O6FA 3QNZA 4KROC 4R9HA 3U46A 5LG1A 4CBPA 3TIDB 2XIIA 5A6MA 4GKNB 1B6DA 2Z92A 1AHWB 4L8DA 1IM3D 1CF8H 3SJVE 2CQVA 1X4XA 3IDIB 1X5JA 1L9TA 2AJVH 3MRKB 2IBGA 4HUWB 4BZ2A 1NBYA 2Z7YA 1PVHA 2WXPA 3IJEA 2XNAA 4JFEE 3CLWA 5DTFA 5CO1A 4GINA 3PV6B 3HBQA 2P1YA 2XN0A 1OSPL 5HDBE 5C9JA 1X5FA 3UJJL 4GFXA 1OPGL 3CDYA 3H9SB 1ILSA 3X14B 4KKAC 4ELKA 3SBWC 1AC0A 5IJKA 1YRKA 4NO0A 4JDVB 4ZTOH 4PREB 4XE5B 4AT6B 3AAZA 3AWFA 2VISA 4MCNA 2JELH 1EJOH 2XZZA 3VXMA 1NOFA 5C6PB 3W9EA 4KH9A 4GG6B 5DK0A 3BISA 5JO5A 1BXAA 3BH8A 5B38B 3OKDB 1IFRA 4TNWF 1TG8A 4YXLH 5ID0A 4GAJH 1R6VA 3HMXL 4U1HB 2RHEA 1OAKL 4XNAA 4ONGH 3KPOB 2PYEB 3CXDL 5F9JA 3N5AA 4C57C 5B4MC 3S2CA 3WY1A 4I48B 4F9PC 1A6AB 1LP9E 4DZBB 5H37H 4MBRA 5FO8B 3K7UA 3ZJAA 3EZJB 43CAB 2EC9T 4WI8A 1ZSHA 4XZUA 3T3MB 1V54B 5EBWB 4AKPA 2EDFA 4UTAL 3FQ4A 4L3AA 3GBMH 2R69L 2X4PA 4JRWA 4OCYH 5JOFB 1AOZA 1P7QB 3U1SL 3O6FB 4LASH 2XFXB 5ANME 2R1WB 5EO1B 3U46B 1KIQA 4K7PY 4UM8A 2N4IA 2WQAA 1OW0C 2Y36L 4LCIH 3VI4E 3J8F7 3EGSA 3ULVE 4CDGC 4JB9H 1PFOA 1MFBL 5AZUA 3D2UB 4J4PD 2KKQA 4MB3A 4MJIA 4XI5D 4PWIA 4KOCA 1C12A 3OHXA 4UAOB 1OB0A 2FDBP 3CDZB 4I0PC 4UQCA 5CLXA 1NBYB 5HYQB 3VXRB 1R3JA 2VL4A 3IXTA 1CD9B 3JWNC 1H5BC 1GTFA 4IRJD 5ESAB 5L4JA 5CJBA 2NW2B 3BKCL 5KBDA 3FT1A 4MSWB 1KXQA 4ALAC 4A63A 4HWUA 2V4LA 1MCCA 4CN4A 4TSCH 3EG9B 1URIA 2HMIC 3GINA 3IDNA 4KZDH 4KPHL 3MROA 1ID5I 5FA4A 5I0VA 3W9EB 4M1GH 3MV8D 5CZVL 3D4YA 2ZUTA 4YK4B 5CBEB 3TPUA 4GXUM 4DVRH 5LGKA 1ITCA 5FGCE 3QQDA 5C07E 3RL2A 1WK0A 1PJWA 4E9WA 2AV1B 4JANB 1AD9B 4Z78A 1MLCA 1XGUA 4WHTA 1IO4C 3T4AA 5F9JB 5T3XD 4M61A 1BEYL 4Y1TA 3LNIA 2LHAA 3T2PA 3TV3L 1JPSH 1HL4A 4JKLA 5I1AA 2X4QA 4CNIA 3TOPA 1CFMA 5DJDA 2W80C 1NFAA 1A7BA 1GYWA 2OBGA 4IRSD 2YD8A 1IGCL 4OZGE 4KKQA 3POCA 5D1QC 1N4XH 2ZD0A 1XQ4A 1I8MA 1SLUA 3MZGB 4L3EA 3O0RH 4LBEB 2OSWA 3CN4A 4K3EL 5D1ZB 3WDIA 3ZUNC 4Y4KC 1WEJL 1KIQB 2CGRH 5HDWA 1KTDB 1A1NB 1JWMA 5A2LH 2CRZA 3VQMA 4EIGB 1HHKB 3ARDA 1B9ZA 1CB4A 1GGUA 2KDYA 4KK9D 4NPJA 2VDMB 2NNRA 4YLCA 5CWSA 1AGFA 2R0ZH 1K8IB 2F54E 4KZEL 1FVCA 2UZXB 1BMWA 1R17A 4XO5A 3WNPA 1D3CA 4LGSB 3UX9B 5JXAL 4MDRA 2DBLH 4R97B 1XAUA 1UD6A 2W94A 3GJEA 4TSAL 1S9WA 4QYOB 4WW2B 3EBGA 1A7QL 2VIRB 4UUJB 4PJHA 3UTPE 1G9MH 4BRVA 2GI7A 3M88A 4ZAKB 4N22A 2WCGA 1EO5A 1NANI 4GBXB 1AXIB 1EEZA 3C5SA 3L3DA 4WI3A 4X6BB 2J5WA 2VMDA 3BQVA 2AMUA 2DLGA 3NIGE 3ARGC 5FA4B 4B9JA 5D6DC 1TZHA 1L7TH 2X6VA 1QI3A 3LEVH 3WGVB 3WEMA 2HLFD 4NM4H 3MRPA 3TPUB 1MUJA 2DQEH 3DETC 4MD4A 3G6DL 4P4KC 1AGBB 1MI5D 1OPOA 1QWHA 1BDYA 5JIDA 1Y0LB 3LRKA 4FXLA 4RAUA 4Z78B 1XGUB 4WHTB 3NJIA 2K6ZA 1RMFH 1JAEA 3WTTA 3KDMB 2JKSA 4L8SB 2R7EB 3MPCA 7FABL 3MO1B 2AVGA 1TZGH 2J2ZA 4IKKA 8PAZA 3TVMC 5DJDB 1U3NA 5F89B 1F90L 3LH2H 4P99A 4HCRA 1V05A 4QRPA 1N5YL 1FYHB 3DMMA 2D2CC 3WO4B 4XT1C 3ZMRA 3FJTA 1J0ZA 4N0RA 4B41A 4Q56A 1FNLA 5KN5A 4NT6B 3JTBA 4AQ1B 1Y1UA 2KZWA 1G4MA 1DQTA 1D5ZB 1N68A 2YAPA 3AT9A 4D9RD 3A6BL 1GPOL 3UZEC 1MREL 3I2CL 4EAEA 5T5FL 3QQ4A 1E3ZA 1A2YA 3NCMA 4K2UH 3N50A 2ICEC 1TZAA 1OWRM 5E00A 4XVOA 4XRCA 2VSKB 3K3QA 1P6FA 3FTSA 2RBLA 3EF4A 2P5PA 3M1BA 5H94A 1TTRA 4LZKA 4BEIA 1TJMA 2AW2A 3R06A 4PG9B 3O2DH 4PS4H 4P0DA 4J3WA 5MERB 3GZQA 1DO5A 3H9SD 3PGFL 3UACA 5DQJA 3CSTA 2XCMC 3C5SB 1QPPA 1RD6A 5LUMA 4KZ0A 4LU5L 4MJ4A 4Z0BH 2DF3A 1A4BA 1NA8A 1TZHB 3C5ZA 3UJTH 5I15L 1DVFA 4N2BA 1E2VA 3T09A 2NY3C 1MUJB 4MD4B 3UXFA 4UOZA 1BF5A 4H8WC 2HT4C 4KO9A 1KJ3H 5HPMA 3FUDA 4RAUB 4XH2B 4TQEH 1TETL 4FGMA 1A14L 2O1AA 4OF6A 5DI8A 5EN2A 2PYED 1LM8V 2ZCHL 4KJQD 4W4OC 4XAKE 4Y5VA 5CKGA 3U82B 4XMLH 4CN6A 5L4FA 3H3KA 3FSAA 2C4FT 1MFDH 5DZVA 2B20A 3N6YA 3DURB 2PWFA 5DRXA 4J3TA 1IAIM 2DL2A 5AG9A 4QRPB 4XCNA 3HG2A 2CRYA 1MVUB 3EFFB 1P69B 1EO8L 4LRNL 3EHBB 4P2QA 4O2EA 4ZD3H 1P7QD 5JXED 2IPKA 1KCRL 1XX9C 4R0LB 1Q9LA 1FGVH 3E8VA 3U4BH 5L4MA 3SOTA 3O6FD 4ODHL 4TL4A 1OGAA 1O6VA 4R5XA 1OD7A 5HHXL 1PIGA 2BIQA 1QUNB 5KOMC 3AS2A 1OGSA 1XB3A 5FYJE 3RUGB 4FNPA 3L3IB 3G6JF 5E9DA 1GA2A 5JTWA 3TA3C 1CR9H 2ZT9C 3GMOA 2OL3L 4PJAB 4M02A 1F8TL 1G5AA 4BGDA 5F88A 3VXRD 4KK5D 1VFBA 2ARJQ 2AEQL 2NYZA 1IC4H 3M1BB 4YUEL 2PO6A 4N1EA 1MXDA 3ATFA 4M7LH 1N2RA 4ODUA 2GK0A 4TUJB 2RMNA 5F2FA 3EO9L 2NPLX 3PV7A 2W0FA 3LZPA 1NKOA 3FNKA 1UWFA 4UM9A 4KDTC 3KL3A 3OBAA 4JN1H 1U6AH 1MRCH 3QDME 1NPNA 2NY2B 3HN3A 4C56A 3QXVA 3WTUA 5I24A 1NCGA 2MOGA 5I1CL 1VIWA 1FZJB 4MZIA 1RK0B 3WG7B 2NY7L 1VF5C 5BVJB 1QUPA 3ZT7A 1INQA 5D7IA 1L0QA 4F9LA 4O2CB 4FA6A 1UKQA 3RBGA 5DDHB 3BN3B 1RXLA 5D7KE 1XBRA 4PJ6A 5BUPA 4ZMXA 2JK5A 3DYMA 2VLJE 1Y6MR 2YA0A 4EIZC 4Y5VB 1MCKA 2B4CH 2BO0A 2F58H 2R2BA 3VSVA 3TT1H 1JSYA 3HG5A 1DQMH 2X2JA 4E9RA 5EORL 2MKWA 4MMZA 1OCOB 1C5DA 5DRXB 1Z6JT 4F2MB 3BUBA 2HFFA 3S35X 1KFGA 1YVLA 2Z91A 5AVYB 5E8NA 4GEJA 1D9KA 4P2QB 3RI5F 2CDEB 2CK2A 2GJ6E 3QUXA 1IMHC 1ECYA 1ODAA 1BQSA 3AABA 3UEQA 3WSQH 5F0PB 3KWTA 4UWQB 5GRJL 5C8JA 3NJLA 3BPLC 1OAQL 4DK3A 4ODXB 1G1OA 1IC7H 1A4KA 1N3NA 4LVHB 4DKEH 1VGKA 3POHA 3FU7A 1X5IA 5EUOA 1Q0XL 4ADIA 3GKZA 1N12A 4R7NB 1VFBB 5H37G 4O2FB 1E4KA 2PO6B 1NJ9B 3C5JA 3PGCB 3Q13A 1IIKA 1U93A 2GK0B 2EYTA 4B0MB 3KGTA 2G5BA 2CO7B 4WSKA 4ZAKD 3TO2A 1UOKA 4Y9BA 4GBXD 1J8HE 1JGLH 3K46A 2IDFA 2OV0A 4KAQL 5IR1A 4J4PC 4XI5C 1NSNL 3T0BA 1VENA 1I7TB 3CPLA 5ESVB 2X2IA 4IHBA 2Q5BA 5H2BA 1INQB 1UASA 3LKNB 3S3BB 1ONQA 1JGEB 2E9BA 2F5BH 3CX2A 4Y2DA 3RIAK 4UI2A 4IRJC 4ENZA 1J1OL 4UYQA 5BS0A 1I4FA 3ZDZF 4RBPH 4O4YL 2IQAA 1G6RL 2NCMA 3QULB 5DHVA 5F6HI 1F4YH 2ZAGA 3G04B 4XP6H 1I9IL 3LSOA 4YZFF 3GJFH 3WJJC 3HNSL 3ZE1F 1B4TA 1KTJA 2PCPB 4MMZB 3T8XA 2J20A 4R26L 3DO7A 4XPTL 1EJ8A 4XCCH 3CZLA 4HX1B 4R90H 3BAWA 2FATH 4LARH 2WZPA 2PKDA 3A3YB 4ZFGH 5FK9A 3L17A 4Z9KB 1MHPL 3SJVB 1NDGB 2OMTB 1BM3H 3ARXA 4JMNA 3UTSA 1XF4A 2BSSA 1UOVA 3CVIL 3NSDA 4DP9X 3SKOB 2QGCA 4K7FB 3MCLL 2Y06L 1I82A 3ISYA 2G30A 4JFEB 3W1ZA 3NIFE 1RVFH 2I5YH 4NZUH 3IJSA 3ZIYA 3TM6A 4UF7C 4CA4A 3L08A 4QEGA 1VGKB 4ZUUA 3D9AL 4IRSC 1TXKA 4QJ3B 3DIVA 4GI9A 4QHPA 1MZZA 1NBQA 3MUGB 4BUGA 3BSHA 5DD0H 2AV7A 4IK6A 2C3VB 4N87A 5LHDA 2K3TA 3C5JB 5IHZA 4M93C 1U93B 1GGIH 3QHFL 1ZVSB 1M71A 2G5BB 4P57B 1QTYT 2E9GA 3NP4A 2EKJA 3DX6A 1QLRA 4KK9C 1USQA 4MDIA 2HPTA 2VKWA 5F9WB 2NSXA 1XF1A 2VDOL 1Q0YH 5FM4A 2MQ3A 4H1LA 4KV5F 2JKJA 5H2BB 4ZO9A 1GHFH 4Y2DB 1CD0A 2PF6A 5FEBA 3CHOA 4OGAC 4YL9A 5DJ6B 4WTWA 4I9XA 3HZVB 5CM1A 1IKOP 3IGFA 2DYRB 4WVRA 4L5FL 4WI5A 4WUKL 4BBWA 3DPDA 1F11A 1SDDA 4WAFA 5IHLB 3PCYA 2FHCA 4MGXA 2XG5A 2N1TE 3VI4B 4H25A 3HS0B 5IT2L 1C9SA 4XC1H 1I85A 4QRPD 3SPIA 3NZHH 5BNXD 4YEFA 4X6CA 3GXFA 3EHBD 2HLFC 5DRZA 2YD1A 4L9LB 5J11C 3FFCA 3RWGA 4GQ9H 1QZ1A 2PR4H 2ITDA 3IGKA 5CLWA 1J11A 2BSSB 2DWXA 4FFWC 3EYVA 5HDRA 5IBUB 2GBVA 5CEZH 3MNWA 1W9XA 1T89C 2BP0A 1IC0A 4OJDH 2WPGA 4O5LH 3BX7C 4HCFA 1P7HL 3HHMA 4WK0B 4X6DB 3FB7A 4G1EA 2ZSWB 4K3HA 3PWUB 4OM0L 1CLOL 2K4WA 4P5RA 3JYBA 3B1UA 4JVPA 3S3DB 3IMBA 5JYMA 2KLSA 4YHPB 4FQ2L 3BZEA 3S36H 2BW5A 5MEOB 1F56A 1PSKL 2DM3A 2G2PA 1ICTA 5FO9A 3EJSA 4FZ8H 1M71B 4KHTL 2VXTH 2R2CA 4JPVL 2Q76B 4UTBL 1CGYA 2YMXH 3SQBA 5C07B 2NR6A 2K4AA 3VXPB 2NY2D 1MCBA 4I1PA 5AZEH 1EDHA 1O6SA 4FABL 1AHWC 1MDAA 4RBPK 4DVBB 2H6PB 3GSUB 2A9ML 4LP4A 4H1LB 3C5ZD 3O8XA 2HJLB 3GJFK 3HG1E 3MV9A 1A3LH 2P24B 1DJSA 1EFQA 1RSYA 3ASWA 3I9GH 3HLKA 3NJNA 4IU3B 2OKMA 4YDKL 3X3FL 3LZRA 1R46A 1F6FB 1PG7W 2EYSB 3D51A 4MB4A 3MXWH 3KYOA 4MNQE 1LO3H 2XY2A 2IWFA 1F11B 1SDDB 4PJ5A 5B3NA 5SX4I 5TF1L 3AQXA 4F3FA 3QJSB 4YHKH 2ATKA 2XG5B 2L8AA 5JQ6H 2H0PA 5C0RH 3PDOB 2HJKA 3S5ZA 4A2DA 4F33B 2ZXBA 4QO1A 1EDYA 4WFHD 1U36A 2K7QA 2PXYA 25C8H 4KNTA 3SOBH 4P2QD 1P7KB 4PM1A 3FFCB 4HIIA 2VN4A 3RWGB 2F54B 2AJYL 4PLKD 5TDNA 4HAGA 2ITDB 2XUWA 1XF5A 3JWDL 5TE4H 2F7QA 2Y0SA 3N1FC 5KYYB 4PGEA 4BFRA 6CGTA 2XKNA 2BP0B 1JWUA 1IC5L 3B7RL 3H55A 5HHME 2D7NA 1BREA 3HZMA 3O6KL 3NH7H 1MF2H 5AW8B 4HIJA 2YD7A 5MENE 1IM9A 3VM7A 4GQRA 5GGVH 3FB7B 3IDGB 4HHAB 1HS6A 5EO9A 2P8MA 3LN9A 1MY7A 3V4PB 2OI9B 5FYKH 4IMKC 1CTOA 1TZOA 1XTLA 4J12A 2PO6D 4DQAA 3BZEB 3OTTA 3NA4A 3NIGB 2XVKA 1RZFL 4GP4B 5HI5D 5JXEC 1OAYL 1W72A 4WV1A 1LEIB 3O6FC 2EO1A 4NO5B 4H26A 4A38A 3WEBA 4GRLA 3DX8A 4OZHF 4GW1B 3L1OL 2BWDA 4KK6D 5MEPB 4QGTA 1E4XH 4DN3H 3MNZB 1KLUB 3N3EA 4YBHA 1KLFA 3IU4H 4UAOC 4G6KL 3S5LG 3ZKQD 1E5ZA 3MV9B 1C5BH 2GTWA 2VZ1A 4KK5C 5EDSA 2X1QA 2OS7A 5EN3A 2R0WH 3IAQA 1BX2A 1MAML 3FU8A 3HKZA 4GW5A 2LE9A 4Y19A 3UDWA 1ACYL 3N91A 3KYOB 3ME0A 3L4XA 1NCCH 4JHZA 4MAUH 3NK3A 2VDQH 1KPVB 5IESL 1DCEA 2YOAA 2VXQH 1UGNA 4OGXH 2ADGA 1ZPLA 1G9EA 2OTWB 2V2WA 3ULSB 5IJKC 2H0JA 3QNYB 4U2YA 5JIIA 1CLYH 3QHZL 1WPCA 4D9QE 3B7TA 2JE8A 4PV9B 3SGKA 4F80A 2VC2B 2WBKA 2Z93A 3GMQB 2PXYB 4YK4C 3SDAB 3N0PB 4YR6A 3X1EA 3H2PA 3SJVD 4L1LA 1KCSL 1T3FA 1XF5B 3KL5A 1YDPB 3C60B 4HV8B 4JO2L 4FNLH 4BELD 2LFGA 2VKXA 4ODBD 3R0MA 3C6LA 4ODSH 4UT6H 4F1ZA 3MV01 5FCUL 3VMNA 3S96B 5ALCH 1FAIL 1HKLL 3NPSB 4YSOA 1IGJA 1SLWA 3VFRA 4ZFOL 2VERA 3KJ6H 1DZ0A 2YXMA 1JF5A 2WXKA 3NESA 5ES4B 1O75A 5KWYC 4RDQF 5FGBC 2YC1A 5MHSE 1PF3A 4YFLI 5I82A 3ESPA 1EBAA 4WFGD 3KYMA 5AL0A 4OCXL 4PJDE 4WV1B 4WCYH 3V0GA 3AROA 4K9EH 5AOIA 2Y3AA 3AY4A 1QMUA 2R4RH 5FHBL 2J8UF 3T0EE 1E8XA 3DX8B 4P2AA 5C0JA 5EWIL 5M95B 1LMIA 1JNJA 2YZ8A 2EDBA 1ZGLB 1GIGH 4XNMB 4QHLA 1IAII 2HG5A 5G5DA 4OZFH 1TKWA 4WLCA 4G8FA 1KLFB 1BGXH 3JWOL 1R34A 2WTOA 2BSDA 1U8MA 4MJ5A 1J8RA 1L5GB 3CFBA 3KCPB 1QFWM 3E1F1 1RU9H 2XN1A 4R97C 4Y2DD 2FH6A 2R2EB 3C08L 3L2MA 3MHZA 4HPYL 1X7SA 4Y19B 5F44A 4LPTA 4GW5B 2NY1B 3A0OA 2VAAA 4POZD 5JUEH 3SE9L 2QSQA 5EHFA 3W5MA 4GY4A 4YDZA 4ZOBA 4F37K 2VLME 1U4EA 2DW5A 4FDWA 3LAFA 1WC7B 4BGLA 1COBA 4AJ0A 1WFMA 2L4OA 2F7PA 3AS0A 2W92A 2V2WB 2XQBL 3FU3A 1ZLSH 4GBXC 3CIAA 4JO1L 3FYEB 2F15A 4B0MM 3ULVD 5ILTH 5C0EA 1O7VA 2Z93B 5KVFE 2D7MA 2IFFL 1T1ZA 1JK8B 2WZPD 1MCPL 1SN0A 5BVPH 1BW8A 2QSCL 3NFSH 6TAAA 4NQDA 4E9QA 3HE7A 5B39G 4DZ8A 3P11L 4QGYA 2O5ZH 4GLRI 3C6LB 1HWHB 3L6FB 3JTSB 1R3LB 2IV9A 3O3EA 5CJ5A 5D2NE 2Z8WC 1A47A 1JF6A 4RFOH 4XCYA 3D8MA 3VGAC 4PI0A 2WXOA 4G71B 3GMLA 4UZSA 3VFVA 2ATAA 3OB8A 3QDMB 1E8WA 3BZ4A 5LCVA 2YC1B 2KMWA 4YDVA 4JGMA 3WO4C 2J55A 5CEYA 1QYGL 3CSFA 1UM5L 3B9AA 2HG0A 5IW3A 2VXVH 4YVNA 4W68A 3U79A 3OF6A 1JGVH 2NZ1A 4PB0H 5C0JB 3QDJA 1JGDA 5E7BA 2B77A 3ARDC 1J0JA 5AVRB 3LKPB 3PHSA 4XNYL 3DV6A 4JL1A 3HUJA 5D72L 2VLJB 1TKWB 2LTQB 2OMWA 2O6PA 3SKUD 4QRQB 1VRSA 2IXQA 4YDJA 1CGXA 1U8MB 4KMLB 4LAQH 5I5JA 1UKSA 3CFBB 4R7VA 4EZMA 2D73A 4Y1AE 4JPWH 2G75B 3MLYL 1J88A 1HEJC 2X4UA 1RPKA 1G43A 4B9IA 2VAAB 2ZYRA 4G2AA 3QPQC 1UZ6F 2GJ6B 2WVVB 4HJ1A 3CFJB 5T33L 1MCNA 3ILQD 3NAAH 3NSFA 5T1KA 1NIEA 4MMXA 5F6IB 2BZ7A 5E5MA 1PQZA 1HEZB 4AYID 4WTQA 5FFLA 1NWPA 2CMRH 5DJ2A 4B3EA 3EDJA 1KNOA 2N56A 1ORQB 1Z66A 4IDJL 4N8PA 4HG4K 1JYWA 1C7SA 5D70L 5DWUH 3FFCD 2X40A 4WJ5A 3MLPA 2F54D 3DA0A 1QATA 3OAUL 3OC5A 5GS2D 3VXSE 3AM8C 5IBTH 3E7JA 1BOGA 2AJSH 2XWCA 1N26A 2BVPA 1K9TA 1EGJH 3QFGA 1AQDB 2CO2A 3ARTA 4PW9A 3FN0L 3CC5B 3UPRA 2YAOA 4GIAA 2OR9H 1Z5HA 5D5ME 4I1NB 3X13A 4XXDA 4N2KA 1MAKA 4HUKB 2HFTA 3MMEB 4OFYA 4BK5C 3DMMC 4G8EB 4F58H 1E27A 3IJYA 2EUVA 5JZ7C 1WJ3A 2FL5A 4R0LC 5C0GA 3CG8A 2D4DA 3UC0H 2W88A 1WAAF 1THCA 3MRRB 4K7PH 1JFQH 1SY6H 4HP5A 4U0RB 4AW4A 1LLAA 2NR6D 5CIPA 3V6FA 5E95B 4M62H 5E7FA 1JE6A 4ALAL 1JHKL 3DV6B 3L3OA 5IY5B 1KMGA 5EF2A 3HC2A 4M43H 4YDJB 2ILLA 4NFBA 1OOAA 4N0CD 4MYPA 1J1PH 3MV9D 1RZJC 3REVB 3CK0L 1RLBA 3ECBB 3O4LA 4IQHA 2WN3A 5F1KC 3TJEL 1BLIA 3QG6B 4KQ3H 4EOWH 1SNRA 2Q7NA 1D6EB 4MA1B 3HJEA 1F3JA 3TBTA 4PB9H 4PJ5D 2C1OA 2P44B 2FJHA 3P4MB 3ISWA 3QXAB 5F9AC 3HZKA 3GF8A 5T1KB 1J0IA 2CRMA 4P2RA 3KEDA 1E9OA 2NY2C 4W9CC 2L04A 3DLQR 3ALPA 2R0LH 4YNYA 4DWHA 5CKAA 3TEXA 1E28B 4UB0L 4MB1A 2DWSA 1H0DB 3C5ZC 5AALA 2PXYD 2YSSB 3OZLA 5I1JL 1NCHA 4JN2B 4WJ5B 5DT1L 1MJ8L 2KERA 2VE6B 1GKOA 3OPZL 3U6XS 3C60D 5DD3L 5KTEH 5KOVC 4L0YA 1M53A 4BXSV 3V0WH 3LIZA 5D1ZI 4Y5VC 4OF0A 4QDGA 1J5OH 2H1PL 1OT4A 4HUNB 3EFDH 3H3PH 4PRBB 3BI9X 2UVFA 3SE4A 4TTGA 5C6WH 3BXNB 1VGEH 4XXDB 4YC2C 2H32A 2ZKXA 4OD3H 2VDNB 2YKLL 1R47A 5GZOD 1E27B 3ZUCA 1E4HA 5IV2B 2IVFC 2Z1PA 2FL5B 1XGRA 4PLKC 3FB6A 4WGKA 3VFPA 5H35A 2OSXA 1CI5A 4E9LA 5ICYB 1YMMA 4RH4A 2P8PA 2BFVH 2VRQA 1P5VB 4GRLD 3BYTA 3ZHLA 4BIKA 4FMFA 4N25A 3L4CA 4D3CH 3HRPA 4M6ML 4Q6KA 5L88L 3PHQA 2IEPA 4LVHC 3RVWC 2R39A 4FLSA 1Z3GH 5I28A 3IAGC 5EOTA 3A4DA 1MCDA 4A6YL 4E0RB 3P77B 4Z76B 1FG2B 1UYWL 3RY6A 3SZ6A 5LGHL 2GK2A 1USZA 2PO6C 1KEML 3PRZA 4HEMA