1F8TL

Fab (lnkb-2) of monoclonal antibody, crystal structure
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
219
structure length
219
Chain Sequence
b'DVQMTQTPLTLSVTIGQPASISCESSQSLLYSNGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLRISRVEAEDLGVYYCVQGTHFPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT (LIGHT CHAIN)
publication title Spatial structure of a Fab-fragment of a monoclonal antibody to human interleukin-2 in two crystalline forms at a resolution of 2.2 and 2.9 angstroms
pubmed rcsb
molecule tags Immune system
total genus 54
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2000-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f8tL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f8tL01
2FEDC 1YNTB 2VXUL 3AM8C 4QHMB 2F8XC 5DS8B 2HTKD 2SEBB 2VZ3A 4NRXB 1UXSA 2D7OA 3O11B 1IT9H 4IM8A 4DVRL 1GSMA 3HAEH 5LVEA 3QI9A 2CK2A 1AXTL 1W72H 4B7IA 4OM0L 4JFHD 1NUFA 1FO0B 3ARDD 5EWIH 4RIRB 4ZAKB 1HXYA 5IHZB 3INUL 4YHIA 1U6AH 3WXWL 2VH5L 4URTB 1AC6A 5FV2A 1LE9B 4N8CL 2F5BH 1NC2B 4KKLD 2E7MA 1UT9A 4IDJH 2FEDD 5F7WC 5D7KD 2IG2H 25C8L 2CDEA 1R6VA 1UZ6E 4ZUSB 1KIPA 3RAJH 2X9YA 4LSTH 1MY7A 4U1NB 1NLDH 2D7TL 1QSEA 1NCBH 4FQXC 5SWSE 5DDHA 3BMWA 4G80A 4XPHL 4YHNA 3GHBL 1KIRA 3OR7A 1RIHH 3U7AA 4ONOA 3T2NH 2AJXL 4KWUA 3JWDL 3HI5H 3DX9B 2B1HH 5IB3B 5E8EB 1CZ8H 1OAKH 5L88L 4IRJB 5I30H 5IFHH 3RIFK 1RULL 1SEQH 5AG9A 1P4BL 5TGBA 3VRLF 4AG4H 2EIDA 3I3DA 5DRWB 1EJ6A 2BRQA 2R4SH 1D3CA 2J8OA 1D5ZB 2DM4A 2PW2B 3V4PL 3VXOA 3BHBB 5IB4A 4PPTA 4J8RB 2WMPA 1AFVH 4HDIB 4U6HA 4EDXB 4OCWL 4FXKB 4FQXD 1U8OB 1PAMA 3A6CL 3QWQB 5JQ6L 5LGHL 1RK1B 3D39D 1JV5B 3CMOL 3MUGA 1FL6A 4DTGH 4WVRA 2EE9A 2X41A 1RV6X 1MHHB 2EDQA 2APWA 2RQ8A 5FYLH 3WHXB 4JFDD 5A3IC 3O6KL 4HQQH 4ODTL 4F3FB 2NY2C 4ZXBD 3REWA 5KSAB 3E1F1 1N5AA 1XF3A 4OCNC 4ZSOB 3RNKB 3MNZB 4ZOAA 4NM8L 5FECB 2QBWA 4PRID 3RGVA 3B3IB 5GGTL 4PJAB 3V4UH 5HDBF 1MOEA 5DEGA 3QUZB 1U93B 5ISZE 1TFHA 5BO1L 5CEZD 4JKWA 1T5WA 2NY3B 1CLYH 2VLME 1BM3H 2DS4A 3ARYA 3DTXB 3PABA 4KHXL 3S36L 2XZCL 1BWWA 3T0XA 1GC1H 3BKCL 5A3ID 3QI9B 4L5FH 5JIIA 3KJ4B 1WJ3A 3CVIH 2R0KH 1P9MA 3QO1A 1XGQA 4DAGL 2CUHA 1FZKA 4HS3A 4DGIH 3ZTNL 4PJ5D 5JPNA 4YHIB 1WZKA 1KC5L 3I3EA 4O51A 1CK0H 3MBEC 4M5ZH 4H20L 1AC0A 4YDKH 1A1MA 2EO9A 1JZ8A 4HJ0C 2YZ1A 2H8PA 1QSVA 1K8DA 1F4WH 3QEGL 1AJ7H 1MIML 4RZCA 3U1SL 4KKNA 3QUMA 5C09A 3QFJD 5TFSH 2CKBL 3P11L 1CWVA 5ESAA 4G80B 2VAAA 2IMMA 3GMOA 3Q0HA 3OR7B 2VZOA 1AQDB 4OB5L 3HCVB 4Z78A 1KYOJ 2VDNL 5FYKE 4M8VA 4UQ2A 5A2FA 5D72L 2CJUL 1N4XH 2CRZA 3T77A 4QHUA 4Z7VB 5TGBB 3PWNA 3MBED 4OF5A 8CGTA 3O6ML 5K9OA 2JJWA 4OD1L 2AV7A 4HJ0D 4L4VA 3VXOB 3GSWA 4CU6A 2DLIA 5IB4B 1G7LA 1VKXA 1UQSB 3KPLB 4HWNA 4U6HB 4R8WL 1QLFB 2EE6A 2JIXA 4DK6A 2EYSA 5F21B 3NA9H 4KVCL 4U6TA 1MCPL 4OF3A 4QRPA 3VFGH 3MUGB 1GZPA 3HLAA 2HLFC 1MHEA 4JZNA 2ZKHL 3S3JA 4LDLB 4FQCL 5EZOH 1I7ZA 3SE4C 1XF3B 1ORSB 1JGLH 3F12B 4LP4A 4HUWA 4KROC 3WYRA 5INCB 5CAYB 3BUYA 1UZ6F 4RGOL 2C4FT 3RGVB 4MXWL 4JVWA 1FE8H 3DROB 3SDAC 3UYRL 2IANE 2QQKL 1NMAH 2Y23A 4DN3L 4OM1H 1OTSC 3MV8D 1F2QA 1AHWC 2JJVA 2GSGA 5KVGH 5B3NA 2HLFD 1LMKA 5F3HA 4XZUA 1MJUL 4PJ9A 1FGNL 3QO0A 3PABB 5LQBL 5EZIH 1AKJA 3QXDA 5B3JE 1H5BB 1U8LA 4M6NL 4Y16A 5JIKA 4KKBC 3QO1B 4IOFD 5IBTL 5HHME 4A6YA 1XGQB 1U58A 1MAMH 2X1QA 3WN5A 4E0RB 2VIRB 3KPRE 4BUHA 4FXGA 3CH8A 3H42L 2AQ2A 4DUWA 4GW1A 2YC1A 3SDAD 4HS8H 3U9UA 4UV7L 4XP1L 3U7YH 1XH3A 1JNJA 5CIPA 5I1EL 4DZBB 3TGXA 1OTSD 2V5RA 4PLJC 4NJAL 4HCRL 5I2IA 3OPZH 2H8PB 5LCVL 2YA2A 4KHTH 4K94C 2DKSA 2AJYH 4DZ8A 5ABDE 1EVTC 5C09B 1NAML 2J88H 4KKBD 2RFXB 2X4TB 1T04B 1ES0A 3V6OE 5KOVC 2NR6C 2J6EL 2Y4SA 4UQ2B 2B8OT 5FHBH 1WBYA 4QHUB 4QOKA 3ORJA 1XIWB 3PV6A 2XACC 1NDMA 3DURA 5E08H 4Z7UA 2O5YH 5K9OB 1RZFH 4PLJD 2CRYA 3IB4A 4GXUM 2AV7B 4MJ2A 4O2CA 5MENE 1G7LB 3RPKA 4G7VH 5EU6E 3KYMA 3EOTL 2C9AA 4NC1C 2F19L 3ZO0A 2JIXB 4HG4K 3QJFA 2EYSB 1VFMA 4ZFOL 4ERSL 5GRVL 2P8PA 3OKLA 2D31A 4FN0A 2PO6C 2NR6D 4NQDE 2P1YA 1F6AA 3VXSD 1P2CB 1RZJL 4G7YL 1KUMA 4JZNB 4LRIA 5KG9A 1HH9A 4QLRA 5D2NB 5CGTA 5T5FL 3F7VB 4YHML 2QSCL 1FORH 4RSVA 2AK4E 4O5LL 2LU7A 4JFQA 5IR1A 1HE7A 3EGSB 4HUWB 2GKIA 4TUOA 3HZVA 1TJGH 1E4JA 4I3RH 3MRMB 3VXRD 1A6UL 2APXA 1MCOL 2UWEE 3BD4A 1YEKL 4JDZA 2GJ6A 4BJLA 1KULA 1OT1A 3KGRA 4CN1A 2VLJB 3ZTJH 4ELME 3HMXL 1E28A 3FQNB 3WFDH 3B5TA 4LPVA 1HOCB 5EO0A 1NCAL 3NPZB 2HA1A 4XZUB 4PJ9B 1GGTA 2W60A 4K9EL 5KBNC 3O4LE 2KUTA 3ZE1E 2RJMA 5HYJE 2DLTA 5A2IH 1MPAH 5E2JA 1U8LB 3LN4B 1CD0A 1V3MA 4Y16B 4S1RL 1XR8A 2NZ9C 4UZGA 4HKJA 1QFWH 1U58B 5FGSA 3X12A 1LEIB 1XGPA 3LVEA 4N8VA 4HPYL 2OJZH 1NBYA 4LFHG 2NY0B 4ODBD 2Z92A 4FG6C 4FXGB 1QBAA 3PL6A 5FYJD 2YC1B 4Z77A 2PCPB 1YQ2A 1XH3B 4M7KL 5CIPB 5GHWL 1Y0LA 1GGBL 1J1XH 3DSNA 1OF2A 1KN4H 3KYNA 3QHZL 4XRCA 4ORGA 4JVUA 5C9JA 1VEPA 2EEBA 2M1KA 4G5ZL 4F7CA 4R4FL 3BO8A 5IHUL 3TYFA 4BZ1L 5JXEA 5CEZH 1FFRA 5D2LE 1TZIB 3IDMA 3QQ4A 4K71C 3S3PA 1G84A 2NZ9D 1JHLL 1A7PH 1ES0B 5EBLA 4YXHL 5KVFH 4UTAL 3G04A 4FG6D 4LAQH 4UIKL 1OP9A 4U2YA 2FD6H 2R0WL 2BSED 2VWEE 1DQTA 3PV6B 2XZQL 4HUKB 4RMRA 1NDMB 4ESKA 1WFTA 2AXFA 3RIAK 2VDQL 3LS4H 1DQLH 4XMKL 4MHHI 3CGTA 4O2CB 5HDQH 1TVBA 2FX9H 3BKJL 4P5TD 1A3RH 3UDWA 3KYMB 1JPTH 4LLAA 4CVZA 1WBXA 2PXYA 2BZDA 4XPTL 3QJFB 4TQEL 1JYXA 2VO5A 4TPRH 2FIRT 1J18A 3OKLB 1A5FH 2D31B 1XF2A 1QFOA 1AO7E 1F6AB 3IF1B 5IK3B 5EULV 3LQZB 1U95A 3JTTB 4OZGE 4RGNB 1N6VA 3RL2A 3QSKB 5KG9B 2MOVA 3Q3GA 5DC0A 1NCCH 5IR1B 5GGTA 2VE6A 4IJ3C 2MWCA 4N8VG 4OZHB 3OJMB 5DRNB 2QV2A 3P3YA 4KDTC 4TUOB 4WHCA 4MCYA 4XMLL 4PB9L 1IE5A 1FVCB 2OS7A 2EDBA 1FAKT 1SJHA 2GJ6B 1HNFA 1KIUA 2IGFH 4P57A 5IESL 3MV9E 4R96B 2ZUQB 2BNQB 2W60B 1A14L 1CQKA 4YH6A 5CD3A 3KPSE 1CYGA 3PWVB 4PJCE 2CLRA 1U6AL 4BFEA 1XR8B 3IXTA 1ZGLM 3PG2A 2ENYA 3X12B 2B2XH 4MDJB 1XGPB 4WFGE 4LEXL 2J8UE 5LXGL 3O3EA 1NBYB 2GCYA 3JWNC 3CXDH 2F5BL 3FKUS 5I71B 1Q0YH 5H37G 1PZUB 4RGMB 2IG2L 3EW3B 3MLSH 1GGIH 1I3GL 1OPGL 5D96C 3AROA 3OKOA 1KNOB 2FLRT 1CFTB 2VQ1A 4PGEB 4XNMA 4XRCB 1Q9WA 2F15A 3RDTB 4Z5RA 4NN5C 3OB0H 1F4HA 5L2KA 3OAYK 4MNQA 3KPTA 1FNLA 1I8IA 5I6XC 4OCYL 3TYFB 4UU9A 2EXYC 2HJFA 1S5HA 1IC5L 2YMXH 5D70L 2W92A 1BFVL 1OAKL 4JPIA 3MOBH 1SEQL 4PBXA 5EBLB 4K55A 1CVRA 3ZKND 5F9WC 3OKDB 1P7HL 5E9DA 4X4YB 5I73C 1H3VA 4I1NB 3AFLA 4LCWE 1YZZA 3TBSA 1ZT1B 4GKSB 4XP6L 3WXVH 5F1IA 1JPST 2IQAA 1AQKH 3E6HA 3UJJH 1MRDH 1DBAH 4ELMF 1K8IA 3LKRB 2AXGA 3RZCC 4YNYA 2OSLB 3O2WH 5T33H 1J1PL 4G43A 1U3YA 1J87A 2R39A 2H32B 3ZE1F 5GS3A 3QEQE 4CVZB 4DTGL 2FGWH 3JV6A 2JCCF 2PXYB 5BMFH 3V0WH 1MLCA 5FYLL 4PR5B 5J6GB 3KDMA 2YZ8A 1KOAA 3PNWA 5ICXB 1MCHA 3K8KA 3FQTA 4JRXA 2A0LD 1A6VH 3HE6A 4XVSL 2W07A 2M26A 2VE6B 2CRMA 2VLRE 3RZCD 5ADOL 2YUWA 1M4KA 3TESA 4ZUWA 2JLLA 3X14A 1MRFL 1K3ZA 4WW2A 5F1OB 3SE3A 3ULVC 3EFDL 1CLYL 1CR9L 1U91A 5D7IE 3UX9B 3IDYB 1SJHB 3KPPA 5C07E 3QR2A 1EGJL 2DKMA 3Q6FA 4NC0B 4P57B 4NYLA 4JFXB 3CVIL 3D5OF 4FA8A 3RY5A 1Z9LA 4X83A 2BNRE 3W9EB 3GI9H 5FCSH 2CLRB 3IETB 2PYEE 4L4TD 3IXTB 1CBVH 3MRGA 5T1LA 2P5EE 1A21A 1G6VK 3EFFB 4DVBA 4M5ZL 3Q48A 3V4VH 4NZUH 1DDHB 3U48A 1YNLH 1BVKB 1JRHH 1V3LA 1PX3A 4HCRA 4NHCH 3ULVD 3UTPE 4MXVE 2BY0A 1IGFL 3QBTB 3VGDA 1H3UA 1HWHB 5B8CA 1F90H 1QHPA 1LEKA 1Q9WB 2P4AB 4Z5RB 5L2KB 1NAMA 3L3IA 2CKBB 3BE1H 4XC3H 1I8IB 4H5SA 5FDWB 1VENA 4OV6F 5JHDE 1QSFD 1IAII 4UU9B 4W81A 2QHRL 2J6EA 2X4PB 5CJQL 5ICZB 3HPLB 4R4BA 1RFDH 1F13A 1NEUA 1MCQA 1Q9OA 1Z5LA 2ZSWB 3QDJD 1ZVSB 2NY4C 2VUYA 5J12B 4P4KA 1XFPA 3K2UL 1RUAL 4L3EA 1IFHL 3E8UL 1G9EA 5H8DA 3FMGH 2XTLA 1HHIB 1CFNA 1G7IA 2FJGA 3E6HB 5FYJH 1R3LA 1UC6A 1K8IB 1I1FA 5E4EB 2DWDA 4NNPL 4JANB 4YNYB 3LHPL 2IPTH 1PGRB 4KRPB 4GAGL 4UDUB 4S1SH 5I8KL 4PGJA 1BFTA 3VFGL 4LNRA 4Y4HD 3JV6B 3VA6A 4WU5A 2HFEB 3K4DA 4JRYA 4MQ7B 3ZHDA 3TP4A 2NY4D 4ZFZA 3Q1SL 3AAZB 4H1LA 2ZCHH 1KPRA 5GPRA 3TO4C 4KU1A 3FQTB 4JRXB 3ARFB 2KH2B 3HE6B 4GW5B 3RTQC 4KZEH 5C0JB 1U3HB 4YEFA 3MRDA 3R06A 4NN6C 4ZTOL 1TCRA 4LCUA 4S11A 4EBQH 4JR9H 4KTYA 4NQCB 2IH3A 2LAGB 1NMAL 3FO1A 3HMXA 3ZKQD 4J3WA 1KTKE 3GEWB 1OTTC 3B5GA 1DTUA 4WW2B 2X5PA 5HPMA 1U91B 2KBGA 1F4XL 3KPPB 2VDMH 2VDPH 3L3HB 3QISA 1U8HA 4YE4L 3Q6FB 1MFBH 5EZIL 1WAAA 2D7NA 3QQ3A 3GBNL 4P2OA 2H2SC 4XXDA 2CQVA 4PD4K 1VEMA 5GGUA 3RTQD 2VDOH 4GQ9L 4K23H 2VLKA 4LIQE 4NN7B 1J8HE 4FOMA 1N8ZA 1TDQA 4WFHD 2YD4A 3D0VB 3MRGB 4DVBB 5E2WL 5AG8A 3MGTB 3RY4A 4OLEA 4NZTH 1OTTD 2LFGA 5TE4H 4YDLC 4A2MA 3H9SE 5B8CB 1QBBA 1HCVA 4YBLB 5D1XA 2P5WA 2COQA 3RGHA 5I74C 3WD5L 1NAMB 5TQ0L 1CFVL 5TH2B 4H5SB 4N68A 3QUYC 3TH2T 3SKOA 3PGDA 4AL8L 4BQ8A 1SHMA 4U33A 3MLYH 3CFDA 2G2RA 2OL3L 5I0DA 1EPFA 2Y7QB 4XGZB 3BYTA 4ZS6C 5E08L 1Z5LB 3EBAA 3TVMA 3MO1A 3G9AB 4H1LG 1VCAA 4HUUA 3HE7B 3U4BH 5F1SA 4P4KB 2GK2A 1RZFL 2Q76B 4LPYA 3D1MC 3NCCB 3HN3A 5I1GH 1JNNH 5IMOA 5D7IF 5IIEB 1KPUA 3QQNA 3G6JA 4G7VL 1JHKH 1G7IB 1I1AA 3C8DA 3FN9A 3QNZA 4W6XB 5DURB 4R6UA 1VFUA 1F97A 1ZS8A 3VWJB 2A38A 3MREA 1PBYA 2XICA 4MA8H 3I50H 5MP6L 1KBGH 4ZFOB 3QUYD 1X5XA 4IDLA 3I3BA 1A64A 5C0RH 5CUSH 4JN1L 2DDQH 3TM6A 1Q0XL 3OGCA 4Y7MA 4KI5D 3P9LA 4LNRB 2NY6C 5DFVC 2VDRL 1R3HA 2YUXA 2QQNL 5T3ZE 1AD9A 1YYML 2DQGH 2FBJH 2VSDA 3BWAA 4JRYB 5GS0L 3LKPA 4ZS6D 5DUBA 2C4XA 4JZOA 3DVNB 2V17H 1A6ZB 4H1LB 1KPRB 2ICES 3CX2A 2DTSA 3TIDB 2RBLA 2XN9B 2D03H 1U8PA 2LAAA 4KRNA 2VZ1A 3MRDB 1BLNA 1TCRB 3RX5A 1PG7W 4UUJA 1EBAA 2P47B 1ULVA 4FP8L 4X4MA 3B6SB 5A43C 1DN2A 4Z95H 3OKMA 2ZUTA 3MLXH 1RPQA 3IDXL 2A1WH 4CADB 2CDFA 1YA5A 1W72A 1ED3A 1UKSA 1OP5H 2NY6D 4AMKH 1FYTE 4MJ4A 4MXQD 5HPMB 1IAKB 4KJYB 3MR9A 3IDNA 1MCLA 3GSRA 3CUPA 5E6YA 2R1XA 5C3LD 5EOCL 1U8HB 4EZMA 1KIQA 4X9IA 2X10A 3I9GL 4WFEE 2HFGL 4ZD3H 1XCTA 1A0QH 1OGAD 3ZKXB 3BD5A 1QFWL 5C0BB 2C1PA 2JJSC 5GGUB 2E9WA 2ESVA 3C2AH 2YD9A 2VLKB 2Y72A 3K0WA 4NM4L 1N8ZB 1NUGA 3EYOB 2P49B 3V7AE 5H94A 3T0EB 4R0LC 2BY2A 1J1XL 5EC2A 4YWGL 3SO3B 4LDOB 3VGAC 3V5DB 1WISA 4ZFFB 4UQ3A 2JKXA 1JE6A 3ESVF 5DA4A 4Z0BH 4ODXA 4JREC 1P5UA 1IGTA 5FUZL 4MD0A 2BSTB 1LNUB 2NY7L 5D1QA 3O3UN 3PGDB 4TRPH 4MB4A 5I66A 2G2RB 5IVXE 4U1JA 1YMHA 5DGQA 4PGZA 3TVMB 1D5MB 5F8RC 2AJVL 3HC0A 5IB5A 2CGRH 3QCVH 4OUOA 3WV0A 2KQMA 4P2RE 5F7EH 1FVDB 1YEIH 4ISVA 1UB6B 1IL1A 1Q94A 3QFDA 3FO9B 5IMOB 1SM3L 5F93C 3G6JB 1Q1JL 1I1AB 3QNZB 1RSFA 3VI3F 3LDBB 3W0WE 1JPTL 1F11B 3KVQA 3OL2A 3T1FA 5JA9A 4L3CA 3P9MB 2XY1A 1MCIA 2VUOA 3RWDA 3OGCB 2NCMA 4NSKB 4QWWC 4U0QB 4JQIL 1IM9A 3TPUA 4Z76A 1J05A 2OXHA 3BWAB 3IKCB 5DUBB 1CF8L 1MCWW 2ZCKH 4WDIA 3O0RL 4PTUA 3DYOA 1NCCL 1HYSC 2Y36L 4YGVA 3BP7B 3KXFB 3RRQA 3ZDZE 1CFBA 3HG1A 1FG2A 1U8PB 4U1MA 1KYOK 3FFCD 1UGNA 3IDJA 3VD9A 2XG4A 3QUXC 3SE8L 1CLZL 1QBMH 4UUJB 3B2VL 3OKMB 1PVHA 1PX4A 2IALA 4CN4A 5FA3B 4QWWD 2CDFB 2ZZUT 4M7LH 2V2TA 2DLFL 2R69L 4G9FE 4WW1A 2X09A 5D6CA 5ESVB 1EEUA 5BOZG 1CDHA 5EOCJ 4JPVH 1KIQB 1NGXA 1ZLVH 1H8OA 4Z7WE 2C1PB 3QP3A 1WICA 1N5YH 4DOHB 5D6DA 3QUXD 4AK1A 4OGXH 1HHKB 4FTVE 5IMLA 1MREL 2C3HA 2XI9A 1BECA 4F7EA 3VXUD 4CAGA 2FH8A 2DI8A 1LP9E 1WWCA 5HHOB 3QDME 4KK5C 3GRWL 3JUYA 3MRKB 1KEGL 3WFEL 2WAHA 2XKUA 4APQB 2ENSA 1MIEH 1P84J 4QTIL 4JPWL 5C6PB 4ODXB 1Y18B 5C0CA 4PRBA 4MD0B 4EN3B 2WANA 5CILH 4GAFB 3O41A 3NOIA 4JO4H 2JTDA 1KCVL 1K3IA 1XEDA 4LSVL 2QEJA 5HGAA 3U30B 1WF5A 3RHWK 5JMOC 5I66B 3I6GA 2DQJH 4PY8I 2BC4A 4EUPG 1I8KA 4E41B 4QXGL 2Q3ZA 3TC9A 4V2CB 5MI0B 3WLWC 4YBQD 4KK5D 5L9DL 1KN2H 2UUDH 1ZLSH 4Q9RH 1CGVA 1AY1H 3H9HB 3C5ZA 5C0EB 3TPKA 2BVEA 5FKAB 3UZVB 5E2VL 5EU7C 3X3GL 1N6QH 3SDXB 4L3CB 4PJBF 4MAUL 1RUKH 4OFYD 2AABH 1V7NH 5DD1L 5IM7A 1JWUA 5DQDL 3OV6A 1L7IL 3QNYA 4NQEA 1IM9B 1XF1A 1T83C 5EOQH 3CSYB 4EUPB 1J05B 4Y2DC 4WJ5A 2Q87A 3WLWD 1U8NA 4NCC1 4WDIB 4MD5B 3ZKSD 1INQA 1GHFH 2AJSL 5F7HA 1WWWX 4KVNL 4YGVB 3JSSA 3QQ9C 4EI6A 4EVNA 1W0VA 4U1MB 5SWZD 5IJKA 1WGOA 3IDJB 5EIQA 5A16A 4M3KB 4MNGB 4FFVC 1AH1A 2XY2A 5CJBA 4LARH 4UINL 3BP5A 1OB1B 4XNXL 2DLEA 2DQTH 3VFVB 2IALB 3MRRA 4H0IA 4XPBH 5F6HI 1UM6H 2V2TB 4DEPC 5F7DB 5BRZA 4WW1B 4LLDA 1S3KL 4IMKC 3GSOB 3KWWB 3KLSA 4JVPA 1ONQB 1QEWB 3DBXB 3MX0A 3NIFF 2A6KA 1GAFH 3SQOL 3WFBL 5KVEL 2HKFH 4M6OH 3OZ9H 3FN0H 4PRHB 4GG6A 3QQ9D 2KZ1B 4YDIH 1T7VA 3ZT5A 4WO4C 4ZSOE 4FFVD 4JFFA 5IMLB 5A1AA 5M95B 3WL9B 1CICA 1F90L 2F54D 1XZ0B 1FDLH 2OLDA 4PJAE 4XP5H 3VD7A 2BHYA 4PB0L 1G9NH 4HXAL 4LLQA 4K2UL 4FFZH 3FO0H 5C0CB 4PRBB 1IQDB 3QH3A 2E27L 4OQTL 5JLZA 1IGYA 1N59A 2YRPA 3ESUF 2A6IB 4YK4B 5HGAB 5I1HL 4WWKC 5CINL 1QR1B 3I6GB 4WO4D 2BC4B 1I8KB 3DX7A 43CAA 4I18B 3ZSSA 3QYCA 4WI5A 2DQEH 1CGYA 1RJLB 2KKQA 3AM8A 4WRLA 3RX8A 4U7MA 1MI5A 3AUVA 3C5ZB 5SX5H 5E2TL 4F57L 4UILL 4Z9KB 3NTCL 1KB5L 1XGTB 4X99A 1ZLWK 2GT9B 4PJXF 2HWZH 5IM7B 1JWUB 5EU4A 3QNYB 2GIYA 5CZVH 3KYKL 1NAKL 3CLEH 1AI1H 1UWEH 4WJ5B 2XYCA 4OTXH 2CIIA 2BSSB 2R23A 1QQDA 3LH2L 5ACZB 2GTZA 9CGTA 3CK0H 2QADB 2R1WA 3HPJA 1C12A 3WDJA 5BW7A 3D3VB 5EC1A 2BVOA 3VXMB 5HYQA 5J11B 2A9ML 1NEZA 2IAMC 5KJRH 1I85A 5EIIA 5KSBF 1ZGLB 5A16B 2NX5A 2ADJA 3O9WC 3DETC 4P3CH 4K7PL 3RIAF 5I1JH 1MFBL 4HWBH 3FQUA 3PF2A 4J3XA 1LO3H 3GIZH 5IGXH 1PQZA 4OFIA 1I7UB 5GGRY 2MCG1 4LLDB 3RVWC 3C6LC 3VI4E 3MOAH 1NBZB 5KZCB 3RWJB 1W2KT 1LO0H 2A6KB 3KPOA 2D3VA 4UV4H 3GIVA 2DIBA 2KQNA 4N90E 2VN7A 3R0NA 4X9BA 2IAMD 4KC3B 3QEUA 1YY8A 1MLBA 3F7PC 1IGMH 3O9WD 3DETD 1MEXL 5FYKL 4IMLA 4LKCB 1CICB 2X40A 3L6FA 4MJIB 3DNKA 3TCLB 5L6YL 3HR5A 5IHBA 1OAZH 4LLQB 3E6FA 3RVWD 1CU4H 3C6LD 5GJTL 4PJEE 5JW5A 1UKTA 1GGCH 5BS0D 5ILTL 4N8PA 3ARWA 3UROR 3ZKMC 3G6AB 3BZFA 3QH3B 4GSDH 2C3XA 1B0GB 4FMKA 4X6DE 2OL3B 1IGYB 1N59B 5FFLA 2C5DC 3EKCA 4M7ZB 3VFWB 5JLZB 5ANMA 4J3UA 2OMNA 4PJ5A 1ZSDB 5ALBL 3MLWH 32C2A 4XAKD 4OD3H 4HV8A 5CEXA 4LASH 3QRGH 2BRRL 1T20A 43CAB 3U0PA 4EQ3A 3UPCA 1J86A 1M71A 2ADGA 5J6HA 5EOTB 3VGEA 4NJ9H 1NEZG 3SKMB 5BXFA 1MI5B 3WE6A 5C0RL 3MLUL 4QRSA 2CUIA 2XWJB 2DDQL 4FNLH 4OIAA 4LVHC 4RBPH 1ACZA 3ZKMD 2HMIC 5IV2A 1Z0NA 3V6ZB 3P73A 3QDGE 1JBJA 5D1ZB 4ZAKC 3UMTA 1D6VH 4X99B 4TOYH 1IAOA 1DUYB 3RVVC 2BVPA 1WTGT 4GJTB 3HC4L 3MBEA 4LLYB 3WFHB 4D3CL 4JFED 1A7QH 4ZODA 3S96B 4ZOEA 1UWXH 1QQDB 2GTZB 3U83A 2DM3A 3QIBA 4YDVB 1C12B 4PJAF 5TDNB 3ULUD 2BVOB 5AD0B 2YRZA 3WS3B 5ALCL 1A6AA 2PTVA 4FQ1H 4X7TA 5EDXA 2FZ3B 1G6RH 4PFEA 5EIIB 3F58H 2HMID 1KXTB 2NX5B 2ADJB 4J6RH 3UTSE 4ZAKD 5D9SA 3NCJL 4UT6L 3V0VA 1HHHA 2ZG2A 4OZFH 2R2HA 4O9HL 4ZD3L 3FT2B 4PJFA 5E94B 1NMBL 1M7IA 2FECL 4ODUA 4XVUC 2X4NB 4HGWB 1NC2D 5F6IC 5A2JH 4HT1H 4XTRC 3B4NA 2IH1B 3KPOB 2XTJB 1WCBA 2AP2A 3GIVB 4NKMA 4JRWA 3UJIL 4HD9A 2R2CA 4RX4D 3IRPX 5C0AA 5D2NE 3SJVB 1FIGH 1HDMA 1YMMA 3S35L 1WV7T 2DTMH 1AXIB 4LSDA 1BJ8A 4IRZH 3GRWA 1C7TA 2D0HA 2C3VA 2OK0H 1MUJB 5D7LB 3L6FB 2RB8A 2VITA 1MFAL 3HR5B 2VL4A 1IGIH 5F9OL 4C56B 3VXQA 3BSZH 2Q86B 1BIHA 1JPFA 2VLJE 2DJUA 1K2DA 2IPKA 5DMKA 1IKNC 1MFCL 1Y6NR 4XTRD 3SE4A 5KSAC 5E8NA 1QRNE 2EICA 3PHQA 3BZFB 4G3YH 4X6EA 3WO4B 5LWYH 4Z7VF 1EBPA 4PIRF 1MCNA 3BJ91 2I24N 1AGFA 1JVKA 1A2YB 2MHAA 4PYHA 4XP9H 3TNMA 1KJ2L 3SDAA 2CXKA 1I3RB 2E8YA 1T20B 1RZIA 4O2EA 3U0PB 2C1OB 3FB5A 1G7JB 3PP4H 1BBJB 3QUZC 5IB1B 1AHWA 5DJ0A 4HUXA 5T3ZH 2ADGB 5J6HB 2NY3C 4V1DA 3IGAA 4QYOB 3U46A 5L7XL 1A47A 4Y5VB 3C6SA 3Q5OA 3QI9C 3WE6B 1SY6H 3KJ4C 3VI4F 5ID0A 3F6LA 4QRSB 4XCEA 4HIEB 1XR9A 5KSAD 3IAQA 3D2UB 5JR1H 4M5YH 5IV2B 1S8DA 2AJUH 5DUPL 4U4BA 2HG5B 1WWAX 2FSEA 4OBSA 3V0AC 1IAOB 1JGVL 2ZCKL 3KLDA 2BVPB 1IAIH 2KPNA 5DJZA 4AIZA 2DN7A 5C2UB 4QXUH 3L3JA 3QA3B 3QUZD 2YOCA 4QHKJ 4OJFH 3QIBB 4IS6B 5BVJA 1V7MH 3QI9D 4BQ6A 2OX5A 4X7TB 4U1IA 1PW3A 4LSRL 1XMWA 3DUUA 2XZAL 1CLOH 3FONA 2J4WL 2YPLE 2NW3A 4JB9L 3K3QA 1QR4A 1GXEA 1HHHB 2B4CL 1TQBB 5I18H 3DGGB 4DKFH 5EO1A 4PJFB 5KVMC 2D9QB 5SWSA 1EVUA 4F7PB 1DQQA 3G6DL 4BKLB 3U4EA 3BQUA 3BGFB 3LEVL 1WCBB 1ACYL 5CD5C 3TF7C 2PTTA 5C0AB 3KPNB 1HDMB 1HI6A 1QSED 1WZMA 4WEUD 1MNUH 1T1WA 5IMKB 4OZHE 3OXSB 4WV1B 2HT3C 1MIEL 2PO6A 4CVWA 2G9HB 3NN8B 1S5IH 2VITB 5FIEA 2O5ZL 1QVOB 4JG1L 5SV3A 4OQTA 4R7DA 4H26A 1X5KA 1BAFH 1RUPH 1WFOA 3NFPA 1JPFB 4WY7H 1K2DB 4JO4L 4KZDH 3RY6A 5DMKB 1B9ZA 2AAVA 5EORL 1X4YA 2D7PA 4U3CA 4GKZA 2DQJL 3PHQB 4MA3B 1T3FA 2BNQE 5CD5D 4X6EB 3CCHA 5E03A 3NZ8A 3RGVC 1BGXH 4GW4A 4JO3L 4PUBL 1F4YH 3RJDA 5IOPA 4LU5L 3VG0H 4O2EB 3FB5B 4Q9QH 4OCRH 5DJ6A 4XPAL 4HUXB 3D48R 5MEQA 1LDPH 1DL7H 4LPXA 4NFCA 3IGAB 3U46B 2CUMA 3W11C 4OD2B 1CFSB 3LN5A 2V7NA 1JFQH 4XAWH 1H5BC 5DVNA 3DV4A 1P9MC 3FHAA 5D8JL 1XR9B 4Y1AB 5EBGA 1BVLB 3UTTB 1BD2E 3O3DA 1S8DB 4JY4B 1T1YB 5E1AB 5JPMA 5ISZA 2FX7L 3AXLA 3S37X 3AB0B 2ATPA 3RGVD 2VLLA 5KOMC 4LVNB 1I9JL 1SQ2N 5JDSA 4RAVB 1NGZA 2OMBA 3L5JA 4PY7A 4KFZC 3NCBB 1N0XH 3NIDE 3MJGX 4NWUH 1ROWA 3W11D 3CFKA 3Q6GL 4I3SL 2DQTL 5B38A 1CD8A 3FONB 1RHFA 2P45B 2W0FA 1BQHA 2OR9L 2GAZA 1CGTA 5IT2L 2NW3B 4AEEA 2A77H 4ZUVA 2PKDA 1KTDA 1S7RA 1GAFL 1ZA6A 4WHTA 4BZ2L 3MA7A 4FHBD 4UB0L 1XIWC 1X9QA 2DQUL 5EO1B 3SBWA 1FC1A 4BFIA 4ZYKA 3WEXA 3ZDYF 2EDOA 1FH5H 4DK3A 1FBIH 1S7QA 4P9MH 1FAIH 3U4EB 1SBSL 3BQUB 1VERA 1KXQE 5IFJA 1RUQL 3IFNH 5DZLA 1M6OB 3CH1A 4KMTL 5GGSY 1INEH 1V8HA 5C09D 4LQ1A 1ADQL 1FDLL 4LVOB 2WWKO 4AEHL 3TJHC 3CSBA 4F80A 2WNGA 4FFZL 3W2DL 3CPLB 2AEPL 3FO0L 5FUCC 1QYGH 3MRJA 1YEGL 1FO0H 1R5IB 1XIWD 3BGMA 1FSKC 3KS0H 4MYWB 5D2NC 3NFPB 4FQ2H 5DJCB 3IU4H 4L4VD 2P8LA 2WBKA 5BZDB 1QPXA 3O45A 4GKZB 1EHLL 4TVSa 2DBLH 2IC2A 1J11A 4KDTA 4XP4H 5DR5H 4P59H 5A2LH 3CCHB 4RQQA 2EDLA 3SDDB 4I0KA 3NZ8B 2EDNA 5J1AA 4OF6A 2JIXD 1OAYH 3CZFA 4Z7NF 1C5BL 3F5WA 3O2DL 4KRMB 3TJHD 3ZE0F 1MFEL 2W9DL 5EA0L 5CHNA 5DJ6B 4XPFL 2MQ3A 4OV5A 5MEQB 2NW2B 1N3NB 1PG7H 4PJ9C 1BOGB 2DKUA 1BFOB 3LN5B 1KB5B 4WUUE 2V7NB 3NZHL 3PWPB 5B38G 3L95A 1E4XL 3DV4B 4Y16C 4DQOH 5CZXC 2IANA 4POYA 1ORQA 3UC0H 1BQHG 2F58H 2NY0C 1UA6L 5ISZB 4ELKB 3F7YA 2VLLB 3VFUB 43C9A 3V5KA 4QT5A 5MHSD 5E99H 3CK0L 3EYUH 4OCSL 1F3DJ 4BYHA 1IZJA 5JDSB 5INDB 3OAZK 4OZHF 1WC7B 2MKLC 1T80A 1KENH 3IJHA 1CXKA 4PY7B 3F65A 4ODHH 2O61A 4PJ9D 3VFOA 3U36A 2AK1L 1U2HA 3KPRA 4P3CL 1AKJD 1OLZA 5I1JL 5JXAL 5I1IL 1SMAA 2A6DB 4XPGL 4PGBB 4Y16D 3SE9H 4JKKA 5CZXD 3OAYH 4HIJA 4KKAC 3GIZL 5IGXL 1G1YA 1BQHB 2DM7A 2EKSA 2NY0D 4NUJA 4HWZA 2RCSL 3UTZA 1N2RA 1IRAY 4JGMA 4JHAH 2IWGA 3MV7E 1KTDB 1ZA6B 4WHTB 3MA7B 5CCKL 5B21A 4RFOH 4ZYKB 3OG4B 3B9EA 3BP4A 1I9RH 5DLMH 4HJJL 3REVA 1U92B 5HHVL 2BFVH 1QFUL 5DVOA 1T4KA 2C7UB 1A1NB 3BYYA 3V6OA 4CVXA 3BT2L 1IGML 4F58H 4Q9CA 4GXUN 3CH1B 4KQ3H 4XXCC 3LIZL 1OQOA 4D9LH 1CE6A 3WNPA 4KKAD 1L4IA 2AJZA 4NQCE 2AXHA 4OLVL 5I8OH 4DJMA 1BVZA 4HF5H 4RCAA 1YN7A 1F58H 4JFYA 5MENA 2VDKL 3MRJB 4TULH 4R2GB 4RGNC 4ETYA 4LCIL 5EU6A 4LRIC 2Q20A 3JV0A 1ZHBB 4XB7A 5T5NG 1K6QL 3O45B 3QRGL 4I9WD 1T2XA 4NQDA 2D0GA 5HVGB 4RQQB 3WKML 4DKDC 1FNEA 4HFWA 5J1AB 4JFPA 4NRZB 1CD9B 3CZFB 1J1OL 3BXNB 2O5XH 4NJ9L 3TV3H 1CGSH 2AK4A 3IDIA 2QHLA 5CHNB 1JF5A 2YHGA 3H8NA 3DUSA 4LPWA 2ZUQC 4GRWB 1VGEL 4RGND 4ONHA 1QA9A 1FLTX 3HUJB 5T3XE 4TOYL 5EPMA 3L95B 2UWEA 2IANB 1ORQB 2H41A 5J13B 1HEZB 4ELMA 4AT6B 5DMIH 3F7YB 1JWSA 1RURH 1P84K 5I71C 2LVEA 1CGXA 1CDJA 1U8JA 43C9B 1WWBX 4G9DB 3V5KB 4LMQE 4QT5B 2AEIT 3O4LA 2GJ6D 4JGJA 4KY1L 1A7NH 5HGGS 5HYJA 3EO0A 1NLBH 2JCCA 3RDTC 4FQ1L 3K1DA 5HHMB 1DQDL 4QRTA 1G6RL 3VFOB 1PKOA 2B1AH 4LCYA 3U36B 4XCNB 5E8PB 4J3VA 3GJFB 1O5DT 2GTWA 1O7SA 4LIQL 3U2SA 3JWDC 3W9DA 3IFPA 1CE1H 1R0AL 1UCTA 2V2WA 1MRCL 4HWUA 4TUKH 2Z9TA 2BXZA 4NUJB 1V5JA 3UTZB 1N2RB 4EJ1C 3PL6D 4HT1L 2Q8BH 1MELA 5FA4A 3BZ4A 5D2LA 3MJ9L 4YR6B 3BP4B 3L3OA 3RDTD 2Z31A 1YQVL 1BQLL 4X7SL 3REVB 2X4RA 4TUJB 5LKNA 1DR9A 4CVXB 4ZPVA 1Q9LA 2Y5TB 3PQYE 2XN9E 5JXED 5ECJE 2VL5A 5MEPA 2PXYC 5EFIA 1CE6B 5DMJB 1MCEA 2AJZB 2EIZA 3UBXG 5IEHB 1NGPL 1YN7B 3TO4A 2W0PA 1KT2B 4JFYB 3FHQA 1H15A 1WIUA 4F7TB 3GZKA 3FCTA 1QZ1A 5EU6B 4X8JB 4L29A 1S78C 1I8MA 5DZNA 5E7FA 1OAUH 1IGJA 1EFXA 4TSAL 5E7BA 1GIGH 1T6VN 4JCMA 3OMZA 1KJ2B 3B8YA 3PHOA 1MHPH 5C0FB 1BZQK 4XNQA 5DQ9A 2GJZB 1XAUA 4NQDB 1S9YB 1AO7A 2JF1A 5L8KB 1C1EL 1EEYA 4KUZH 3TH4T 5FK9A 3HRPA 3TWCH 4R3SA 4JFPB 2PXYD 2HVJB 3GSNL 4JKPL 1W8OA 3GJEA 3GMLA 4EIGB 3IDYC 3QHFL 3T0EE 4U6VL 2AK4B 3IDIB 3UBXB 3HHRB 1QOKA 1B4RA 3KNBA 2W0LA 7FABH 1QA9B 1S78D 3KLHD 2E3VA 5DI8A 4HUVA 3O2VH 5EPMB 1HN1A 4XBEL 3T0AA 4MWFA 3HNTH 5I75B 3WIFA 1OHQA 4I4WA 2UWEB 3GK8L 4OZIE 4F9PA 1R3IH 1MQKH 4M48L 3ZSTA 1F02I 5K9QG 2CO7B 2X89A 3GI8L 3C60B 1F4AA 3MV9A 4XWGH 5I1DA 1SJEA 1JK8A 2X4OA 3R1GH 3WS6A 1C08B 2QKIA 1NCWH 1TVHA 4ZTPL 1MFNA 4RDQG 3O4LB 4QF1A 4M9OA 6FABL 3KPSA 5HYJB 3EO0B 5J56B 4PJCA 3GBML 5HPOA 5F1NA 2IFFH 4QRTB 3BKML 4GUPA 1EO5A 4KDWA 1JUFA 3IFLH 4LCYB 2J8UA 5DD0L 1CLOL 4WW2F 4BFBD 4YO0B 2VNCA 2GTWB 2NNAA 3G5VA 2YEZA 3E3QE 4PRPB 1PD6A 3K81A 2ICCA 1LO5A 3P40A 5LGKA 1WCQA 1F8TH 2EH7L 5FA4B 3BZ4B 1B0RA 5D2LB 1PZ5B 3L3OB 1BWMA 1HHJA 1LILA 3AS0A 1AGBB 5IEKB 5L2KD 2Z31B 4MNQD 5E4EC 2X4RB 1XF5B 1MNUL 4KRPC 4H8WL 5IW6A 1B4JH 3KXFE 4XX1E 3NACL 4LCWA 1Q72L 2VL5B 3NH7H 5MEPB 1OY3B 4JJHA 5EFIB 5DF0A 1JTTA 3LKNA 3CFCH 2FWOA 2EIZB 1XGRA 1WT5A 3KPQA 1A7BA 1B88A 4WGVB 1OSPH 2LTQB 4LLMB 4XNUL 5JHLH 2FDBP 2V9RA 3BH9A 4O00A 4OAWA 4PGCB 2HJLA 3FCTB 4L29B 1I8MB 3ARFC 3HE6C 1M05A 5DK2B 3MV11 4JY5H 1IGJB 4OIBA 1U3HC 3QEQA 2ARJA 4N0CC 3WLBB 1BGXL 4RMSA 3T4AA 5CIPH 3Q5YA 4LEOA 4ENEC 5BQ7A 4DN4L 1OARH 4NOFA 3VG0L 4XNQB 1FYHB 3O6LL 3O2DA 1XF4A 4Q9QL 1KCUL 1WZ1L 2P8MA 1EEYB 1L9MA 5FK9B 4OZGB 1WFNA 4WW2C 4AIOA 3ARBB 4GAJL 3QCTL 3GJEB 3IFOA 2A2QT 3P4OB 1D5BA 3MLRH 3PGCB 4HSQA 3PDGA 1B0WA 3WIIH 3GMQB 1MF2L 1CS6A 2EC9U 4QHNA 5HHOE 5FB8A 3RNQA 2VLRA 4NKDA 4ALAH 5L2JB 3KNBB 3OKEB 3DO3A 3HFML 4ZFGL 3PGFH 5GGRA 4JRXD 2ZOLB 2JJSA 1H8NA 1MVUB 2EDHA 2F8OA 2VXSL 3ARFD 3HE6D 5F96L 3VDAA 5DI8B 4YUEH 2NY5H 4HUVB 2FL5A 4NN7C 4J3OC 4MWFB 4N0CD 5E8OA 2G75A 1BP3B 5IVOA 3SKJH 5D7IA 4MQTB 4ENED 5C07A 4NQCD 4ZOBA 3WJJA 1CG9A 2I9LA 1KB9J 1WUNT 3DECA 3MV9B 1CXEA 1SJEB 1JK8B 2X4OB 4RMVA 3WNOA 4CU7A 1TVHB 4OGYH 3NPSB 2OR7A 4AY0A 1N0XL 2BNRA 4E41E 1BEYH 3H6JA 1LO4H 4QF1B 5B8CC 4YHZH 4YBLC 3T3PE 3STLB 4N0YH 2A73B 4P48A 4PJCB 4GAYB 1CDUA 2J8HA 3VFMB 2PYEA 4WI6A 2YD8A 3V52H 4GUPB 1JUFB 3IDGB 1KJ3H 2P5EA 3FOLA 2J8UB 3KAAA 5FGCE 2XNAA 4U3XA 2NNAB 2R0LH 3G5VB 2YEZB 2W9LA 5C08E 3RVTD 2VXQL 3SDXE 3HE7C 1S7XB 1F00I 4P4KC 3LEYL 5FUOL 4OLWL 4AM0B 1KCLA 5ICYA 4ZO6A 3VWKB 4KGLA 3V6BR 1A6PA 5GRUH 3ZYOA 2IBBA 3RWEA 2BXYA 2VXUH 3VWJC 4QRRB 4DVRH 1TJHL 1DBKL 1AXTH 5KSVA 5F97E 1A7RH 4Y19E 4OM0H 5DC4B 4KJPC 5E0QA 5JUEL 4K94L 5IQ9B 1RZJC 4MNGE 3LKNB 1JGDA 4ZQKA 2FWOB 3LB6C 3INUH 5FHAL 5ERWA 4FQ2L 2P24A 4P4KD 1LD9A 4NT6B 1CLCA 2OJEA 2YPVH 2WUBL 3IU4L 1VHPA 1YEHL 3BH9B 1BBDH 4OAWB 2HJLB 4N8CH 3OKNA 4XP4L 3LS5L 4P59L 4UT9H 3QEQB 2ARJB 1YYLH 4XWOD 3VWJD 3ILPA 25C8H 5DA0B 3VW3L 5BQ7B 1IEBB 2I60L 3VFSA 2B5IB 4M6MH 4PRHE 1XF4B 2VISA 5SWQA 4KJPD 5F71A 3G6JF 4HMEA 4XPHH 3GHBH 4D0DB 4Q0XL 4X4XA 5MEOB 1OAXL 4PYGA 2LQRA 4JRYD 3IFOB 5FYJU 4K9EC 1D5BB 1EZVY 5KANG 3LB6D 4Q9BA 5L88H 3BMVA 4QHNB 3EYQC 1RULH 4CMMA 2RHEA 5FB8B 1P4BH 2VLRB 4NKDB 4DQOL 2MMXA 5GGRB 2F58L 1I3UA 4YIQA 3I84A 3UXFA 3VFRA 5FOJA 2W1NA 3CX5J 5E8OB 3EYUL 3T0EC 4OFVA 2EC8A 2I9LB 1JMZA 4OCWH 2EDKA 5ID1B 2ICWJ 1E6JL 3SKUD 5D71L 5GSRB 3SO3C 5LGHH 4E42A 4Y5YA 1G6RA 1KJMA 4ODHL 3M17A 1T22A 4TSBL 2DQCL 3LRSA 3W81A 2DMBA 2H32H 5D1XC 3CMOH 1QFWI 1J8HA 3EYQD 4LLVA 2PYEB 3T3ME 2CR3A 4OZFA 5C0BD 4BH8A 3FOLB 4OKVB 3O6KH 1JGEA 2BOCA 2VLKD 3L7EB 4P5MA 3KYAA 2X4SA 3K8LA 1SMOA 3TO2A 3H9SA 3GMPB 4NM8H 1JZ2A 2J5LB 3TVMC 1MJ7H 4MMZC 3LSOA 4DKAA 2XQBL 5DLML 3MCKA 4YDJB 1AGDA 1UWGL 2R15A 2H26A 5TE7L 5JHDB 2BFVL 5D1XD 5BO1H 2P5WD 1I1AC 5SWZA 2VERN 1JIBA 4R26L 3LDBC 3BH8B 1NSNL 3S36H 4KHXH 3WJLC 2XZCH 1G7HB 1RD6A 3BKCH 3D3VE 4AENB 3VXME 5KSVB 3S4SG 4M1CC 3FOMA 4KV5E 5FYKU 4DAGH 2HRLA 4P3WA 4Y2DA 1R24A 3QJHA 4HS6B 4MAYA 5FAAA 2B0SL 3TVMD 3FB8A 3ZTNH 4JLRB 3LPFA 3GSUB 2I25N 3O3AB 1RZGA 2OJEB 2W9EL 1B6DA 3BRDA 3M1BB 4H20H 4CNIA 4ODVH 2DQFA 1I1AD 1OP5K 3T3PF 4HIIA 1OP3K 2DOCA 3GJFK 3UAJC 4P5KA 3ZDXF 4NQXA 1MIMH 3ECBA 1MCJA 4GMSH 2FNBA 1AGCA 1GPOL 4G8EB 3U1SH 4HHAA 2CKBH 5SWQB 3S4SB 1SY6A 4X4XB 1HK6A 3DVGA 4X5LA 3LQAL 5JW4R 4OB5H 2VDNH 4K8RL 4L4JA 5D72H 2CJUH 3SDXF 3NA4A 3UTQA 4MJIE 1QPPA 4CMMB 3ZE2E 4OZFG 4XBPA 4PG9A 2M2DA 4UNTA 1VADB 3MLTA 3O6MH 1AD0A 1M1SA 4OD1H 2V7HA 3RFZC 3VFRB 3DMMB 4MJ6A 5E5MA 2ARWA 1FYTA 3C87A 3UAJD 4HIHA 1PEZA 2GFBA 5F7KC 4N1EA 3SQBA 3WFCH 1D5XA 3SY0A 1ZANL 3GUTB 1P1ZA 1DBBL 1G6RB 1KJMB 5T1KA 1ZT4A 3M17B 1T22B 1HZHL 4APQC 4KVCH 1P6FA 4PRNB 3P77B 3C5JA 3QG6A 1J8HB 3CLFL 1CE1L 2K9UA 4QEGA 3G9VA 4EN3C 1E4WL 4PRAA 4OZFB 4BH8B 2JB6B 2ZKHH 4TUKL 2KL6A 2K3TA 4FQCH 5FGBA 1R3JB 1A22B 3FN3A 3AREA 1UM4H 2ESVD 4FQHB 5D1QC 3EO1A 1NL0H 3U30C 4P5MB 3LAFA 4WWKA 2X4SB 1RQ5A 1SYSA 4S1QH 3H9SB 3NAAL 4NQVA 1IM3A 4P2QE 4RGOH 5MI0C 5GXBB 1YEJL 3MRBB 3CXHK 5HJ3A 3OJDA 3MLZH 4AEFA 1T1XB 2QQKH 2F53E 1YDPA 2APBA 3KJ6H 4APQD 2X9WA 1J10A 5JW3L 3B2UC 5I8CA 1ZMYA 4YPGA 1KLFA 3RZWA 1FGNH 4EN3D 1FLRH 5IVXA 5LQBH 1AP2A 1V3JA 3MZGB 3LOWA 4I2XB 1N64L 4M6NH 5D1QD 4P2RA 5IBTH 1CXLA 2FJHA 5KS9E 4PJIB 2GJJA 3BX7C 3TFKC 5B39A 4MAYB 1LE5B 2HVKB 3H42H 1VSCA 1OAUL 1ZLWH 3W0WA 4UV7H 4XP1H 1RZGB 2D9CA 5I1EH 2OQJB 1WVZA 4QRPE 4ZXBB 4ZO8A 1W8NA 5HGDA 4CNIB 3B2UD 4TTDD 4NJAH 2DQFB 5LCVH 5CFHA 2XTJE 3GSNB 4PREB 5HDOA 3EHBC 4WI8A 4PRIB 5T3XH 3T3MF 4ODWB 3SJVE 5FYLD 4HHAB 1NAMH 1GC1C 3D85B 2BSRB 3QWOA 2F74A 4KKCC 3R0MA 1IM9D 1S7TA 3DVGB 4TVPL 3C8HA 3TFKD 4QO1A 4PS4L 1VESA 2Y9RT 4PG2C 3STZB 3IJSA 2HFFA 3QXAA 3V7AG 1CT8A 3L7FA 2C26A 3UTQB 1X5LA 1AXSA 4K7FA 2OP4L 4PG9B 1R3IL 3T04D 3MLTB 3G5ZB 4XB8A 4B50A 5EBWB 1RIVL 2V7HB 3HG1D 4X9GA 4FFWC 4LKXA 4MJ6B 4ZPTA 5E5MB 2V5SA 1FYTB 1VFAB 5D6DC 3G5XA 1NCWL 3T8XB 3W39A 1S9WA 3EHBD 1UJ3B 1U8KB 5FO7A 5GGSA 3AS2A 1D5XB 1UENA 5J1TC 4KKCD 4ERSH 4Z7WA 3PV7A 5DEFA 3VFTA 3IFLL 1IC4H 3RWCA 4Z7QE 1DBML 5HVWA 1VGKA 3ULVL 4B7LA 2H3NB 1U42A 1RZJH 4G7YH 4JN2A 4FTVA 4PRAB 5T5FH 1Z3GL 4YHMH 4H1LH 4O5LH 4YAQB 1LP9A 4PJGE 3AREB 3RWHB 3QDMA 4YK4C 4FFWD 4QGTA 5FKPB 4HPOL 5AZEH 4R97B 4YHYC 3OX8B 5B39G 3CAFA 1F8TL 1CFQB 1CL7L 4I18C 1IM3B 3I6LD 5I8EA 2WWKT 1AE6L 2EZ0C 5HJ3B 4WFFE 5L0QB 1A6UH 3OJDB 4DFIA 1MCOH 4H25A 4XBGB 1YEKH 5DS8A 2RIKA 2SEBA 1YDPB 4NRXA 12E8L 3O11A 4EXKA 3HMXH 5DHXB 2OI9B 5HVHB 1P7QA 5I8CB 3ZHKA 3BEVB 1JI2A 5EU5A 4CJ1A 1NCAH 3C5ZC 2XFXB 3NH7L 5C0CD 2YA1A 5IVXB 1FO0A 1AP2B 1IQWL 4XHJD 4KK6C 5IHZA 4WI3A 1OM3H 4FXLA 4S1RH 4D9RE 2FJHB 3HNVL 1LEGB 4LGPB 1LE9A 1YN6A 4HPYH 1CGWA 5B39B 4D94A 4OLXL 2WM0A 1EAJA 1IC7L 3GMNB 3P4MA 5KAQG 1NCDL 4JY5L 2EZ0D 4Z6AT 1H9VA 1XT5A 2QADC 4M7KH 5GHWH 4F37K 1KCKA 4RX4A 2E7LA 1OARL 3ME0A 5J11C 1RZKL 3QHZH 2DWEA 2GITB 2XWBA 4U1NA 5D7SL 3C5ZD 5IJKC 2OR8A 4R4FH 1BZ7A 5IHUH 4BZ1H 4KK6D 3GSXA 3VGFA 3CNKA 3DX9A 5CWSB 4C4KO 5IB3A 5E8EA 4HUMB 2XXCB 4IRJA 1JHLH 2DQIL 4NQED 2FB4H 3MV8B 4YXHH 3QXWA 4LQFL 4UTAH 5DRWA 4UIKH 5HGHA 3JV5A 2R0WH 3GSQA 3QXAB 4XH2A 3BHBA 5JO5B 2QADD 3JV4B 4NP4L 4U49A 4ODSL 1YECL 4NOBA 4TNVF 3WO3B 4EDXA 2ICWB 4XMKH 4FXKA 5EIVA 4XI5C 2CD0A 1E27B 4G9FB 1GOFA 3W39B 3G5XB 1IEAB 2P44B 4YZFE 3FZUC 1Y6MR 1LO4L 1RK1A 1CICC 1AIFB 1S7WB 4CU8A 4XPTH 4TQEH 3FRUA 4Z7WB 5BRZD 3VFTB 3RWCB 1HINH 1F2XK 1VGKB 3ARVA 4Q58C 1UH4A 1IKNA 1JHTB 4P3DB 1T03H 2R0LL 5KSAA 1RZ7L 4ZSOA 4JN2B 5K9KA 3SHSA 2ZP0T 4JHWH 5FECA 1ZTXL 4R90L 1NBQA 3O6FA 1LP9B 1NJ9A 1W0WB 3QDMB 4HLJA 4PJAA 5TF1L 4XI5D 1R5VB 3EJJX 4Y1AE 3UTTE 4IIQB 4JFFD 4P46A 1CTNA 3FZUD 5GRUL 1U93A 1CICD 4QCIA 4XMLH 5I8EB 3VGBA 4X9HA 5DYOA 4BM7A 4H25B 4JJ5B 1AR2A 1U2CA 4JKMA 4Z7OE 3DTXA 5IESH 1P7QB 5EU5B 5TPWL 1A7RL 1HNGA 3QDHA 3VJ6B 1A14H 5GS0C 5D1ZC 4YFEA 2CK0H 3CZJA 3TH3T 2W91A 4LLWB 3PE9A 3RWIA 1JGUH 4JQVA 3RWGA 2YPVL 1KG0B 4HXBH 4LEXH 1J9CT 1YN6B 5LXGH 1BBDL 4MQXC 2DD8L 3P4MB 5DD3H 1RMFH 4UT9L 1YYLL 5KVDL 3L9RB 5BW7C 1I3GH 1OPGH 5I1LA 1MI5D 2DWEB 2XWBB 4M6ML 3E2HB 3QZWB 2BX5A 4OGAC 2UZIL 1I85C 3HA0A 1EFQA 2WQ8A 3CDYA 1J8KA 2HN7A 3L3DB 4HMCA 1BZ7B 4OCYH 1AQDA 5FEBA 5GS0D 5DC9B 4HKBB 1MFDL 3HCVA 3GSXB 4RMWA 3VXRB 1IC5H 5IKCA 5D70H 2B20A 1BFVH 1T21B 2EDEA 4S10A 4QHKI 4Z7VA 1QD0A 4KTDL 4MQXD 5HGHB 5HYEA 4WEMB 5JIHA 1OSZA 3GSQB 3QIUA 4XH2B 2NXYB 4XP6H 2XTJC 4EDWL 3EZ8A 1UQSA 3KPLA 4GMTL 4UNUA 1BOYA 5DJXB 1QLFA 2ERJB 4HGMA 4OGAD 4FQIL 5HY9A 2NX5D 1J1PH 2P43B 1D5IL 3BISA 2X9XA 3MUZ1 2GUOB 3QAZB 1QLRB 4CN6A 2FECI 3BPLB 3JWOH 3FRUB 2WINB 4AEIL 5M7QA 2P48B 1J0KA 4GRLA 1ORSA 2XTJD 4EUPH 3F12A 4AQOA 5K9KB 2XRAL 5INCA 5F8QC 3WO4C 3SJVD 4XVSH 4U1GB 1MJ7L 3O6FB 1DJSA 1NJ9B 3PWPE 4PJFF 1JZ7A 4PP1C 3DROA 5ADOH 3RPIA 4NCC2 2VXTH 4PJEA 4P46B 1KCSL 1E4KC 4KAQL 1ZHKA 2FGZA 4QCIB 4RBPK 5D7LD 1MRFH 3EFDH 1CR9H 5DYOB 1EH9A 4X6DA 5E9DE 1EGJH 4Y5VC 4C56D 3K4AA 1DLHB 4MNHA 5LAXA 4G6AC 1H5BA 1ZE3C 2Y06L 2NY2D 4ZUTA 1URLA 4P5TB 3WDHA 3GHEH 4Q6IB 1YPZB 1NQBA 1PLGL 4X6CE 1JP5A 3NFSL 4E0RA 2VIRA 1UWXK 2CLZB 4FABH 3GDBA 3RWIB 3RWGB 3NABL 4DZBA 3O4OB 1A3QA 4ODVL 5CLTA 5A40E 1MHCA 3UBXI 2DQDL 1IGFH 2PW1A 3QIBC 3QDGA 3D25A 4OLUH 5I1LB 4GMSL 2FATL 4G6AD 4X5XA 2RFXA 2X4TA 4TSCL 1ZHLB 3TBWA 5KN5B 5F7FA 1T04A 2HN7B 4ZMAT 2R9HC 5L8LB 4LSUL 1WK0A 2QHRH 3L3GB 5CJQH 2R2BB 4HUNB 3K1KC 4Q6YA 5IKCB 4WU7A 3T4YB 1XIWA 3QPXL 1TQBC 3SDYL 4P2CG 3PXJA 5GRJL 3DXAE 2BOBA 3BP6A 2VABB 3H3PL 5BV7H 3K2UH 1RUAH 2QLVB 1OSZB 3QIUB 1IFHH 3E8UH 4KQ4H 3EO9H 3DRTB 1H0DB 4K3EL 3BGFC 3QIBD 1EMTH 5F7UA 1MCSA 5GJSL 4WI2A 3UTSA 5JOPD 3WFCL 5ELIA 2YWZA 4JKLA 2Z91B 4NNPH 2MPAL 4H0HB 5HY9B 2ZG3A 3LHPH 2R9HD 4GAGH 3MRIB 5I8KH 4WV1C 1GOHA 4E5XB 4OI7A 3PJSB 1XCQB 2MJWA 5K9QI 4C55A 1P2CA 3PWUB 5I19L 5IWLC 5D2NA 1T0MA 2BVTA 3F7VA 4WHYH 3Q1SH 2EC9T 5CJ5A 1UM4L 1NL0L 3F6IA 4HK3J 4GRLB 1CIUA 2H9GB 4LCCB 4GRWE 3P30L 3EGSA 2VOTA 4S1QL 4MJ5B 5C0AD 3HUJE 5FO9B 1YMMD 5DRZA 4ZTOH 4D9QE 1P4IL 3MRMA 3RPIB 1ERNA 3MLZL 1HHGA 3KJ6L 2VLJA 4PJEB 4WI9A 4DGYH 5KW9H 3FQNA 1ZHKB 2F5AL 4JAMB 4HWEL 1HOCA 3MRCA 4HC1H 1QRNA 4F8TA 5IHLB 1F4XH 2OTPA 4X6DB 2AS5M 1FLRL 4GO6B 4YE4H 1IJ9A 4MNHB 5LAXB 3LN4A 1MAKA 3GBNH 1KB9K 3QUKA 1NCTA 4ZUTB 2VC2L 4MX7B 1A4JB 4YGAB 4H88L 1LEIA 3ZHLA 3U7WL 4KROD 4Y8AA 4GQ9H 3AB0C 4Y4KB 3BN9C 1OD7A 3EYSL 4LVNC 2PCPA 5I73B 3L1OH 1JI1A 4LDEB 4U6YA 3T0VA 4YQXL 2FR4A 5E2WH 2H1PL 2H45A 2GQHA 3IS0X 2NYYC 4V1DD 1MHCB 2BJMH 2PW1B 2HKHH 3QDGB 3D25B 5AUMB 5T3XL 1L0XA 5D5ME 1TZIA 3T0DA 3WD5H 3OAZH 3SGJA 4X5XB 3MRPB 5TQ0H 1CFVH 4HH8A 3X11B 4Y1AD 1OTUC 5DD6A 3TBWB 2BY3A 3HZYA 3VE0A 3HI1A 4AL8H 4WU7B 2VZVA 1UACH 5K9JL 3WNKA 3CMGA 5CJ8A 2OL3H 2XXMB 1TCMA 4OFDA 2V6HA 2BOBB 3BP6B 3ARPA 2ID5A 2NYYD 4NZJA 4NO0B 1U8IA 4O4YH 3ARUA 3S7GA 4JHZA 3BQUC 2IF7A 5DGRA 3DI2B 3UTSB 2YPLA 4XXCA 5HGBA 2BDNL 4CGTA 1OTUD 5MP6H 2ITCA 5IFAL 4JN1H 4MA7L 1IC4L 3RUGB 3UZEA 3UEZA 1Q0XH 4N0RA 1ZT7B 3IF1A 4HLZG 5IK3A 3LQZA 3QCUL 3JTTA 2VDRH 4P4RB 2QQNH 1YYMH 3QNXA 2ZCLH 5GS0H 1T0MB 3S34L 4Z8FL 5SWSD 3RY6C 3BQUD 4OZHA 2O26U 4HH9A 5DRNA 1KCRH 5AZEL 1KPVA 2I26N 4OCMC 4GKNB 3SDDC 5DRZB 4YPJA 3QDAA 3MUHL 4WTWA 1FVCA 3K46A 4FP8H 35C8L 4QGYA 1HHGB 1LHZA 3IDXH 2PO6D 3MRQA 3TIEB 4R96A 5DQJA 3MRCB 1QRNB 2OZ4L 2BNQA 1WZLA 3CX5K 2Q7YB 3QHTC 5IVNA 5EOCH 5HHQB 3ZL4L 3PWVA 1OM3L 3I9GH 2HFGH 3QUKB 1JYNA 4N0FB 4BQBA 4RA3A 2CXGA 4MDJA 1S9KC 1NMCB 5DJ8B 2FX8L 3EYVB 4Y4HB 4HJGA 1K4DA 4NM4H 4XCCL 2FEEL 4PRPE 1F6LL 2HH0L 4PJ8A 2CPCA 1UH3A 1PY4A 4DKEL 4U6YB 2FR4B 1KNOA 5T1MB 1CFTA 2J3SA 3TNNA 4PGEA 3RDTA 5GQBA 4YWGH 3ZT7A 1CVSC 5IVZB 1BD2A 5HHPB 3BAEL 2VZUA 5C0NC 4LPUA 4HKXB 1IEHA 5FUZH 3P0VH 2DM2A 2FYYA 5DD6B 2NY7H 1SJXA 2FB4L 2Q1EA 4I48A 3HZYB 4GRWF 3VE0B 3OKDA 3ROOB 4X4YA 5ISZD 1KFAL 2ORBH 3HUJF 3HI1B 2HLAB 1ZT1A 2VLMD 4GKSA 3BW9B 3BKYL 4OLYL 5F1KC 2VN4A 2OM5A 3GKWL 1I8LA 5KTEL 2AJVH 5T5NF 3SBWC 1NPUA 4CW1B 1JNHA 2Y07L 1QBLH 2HT4C 3LKRA 1U8IB 2D7MA 5KANI 1C16B 3RTQB 2OSLA 5DD5L 1SM3H 3D9AL 4XC1H 5C0ND 1Q1JH 2G5BA 2YPLB 4W68A 3D69B 2H32A 4YXKH 5HGBB 5B3JF 1V05A 3LKQA 2APFA 2ITCB 3U9PL 2NXZB 4Q7DA 4XT1C 4Y5XA 3S9DB 4LF3B 1HINL 4N5EC 4PR5A 5J6GA 4JQIH 3FTGA 1T03L 4UOJA 4R2GC 3QNXB 5ICXA 3IVKB 1X6NA 3NMEA 1CF8H 5I1CL 1MCWM 3U6RB 4JHWL 1TJIL 3O0RH 2HT4D 1FFNB 2HJKB 4WUKL 3T65A 3JBG7 2Y36H 4HH9B 4FZ8L 4NKOB 2CDGA 1KPVB 5FYKD 1EJOL 1L0YA 5K93A 4U2ZA 3SE8H 1CLZH 4HEPG 4X7DC 2AGJH 3HKFA 1UM5L 3ETBF 3B2VH 1BREA 1T66C 3BDYL 1GYAA 3MRQB 4JFXA 3A6BL 5DQJB 3K8MA 1BPVA 2DLFH 1BFSA 2R69H 3LCYA 4R2GD 2DI7A 1FL5A 4M3JA 4PLKC 4M6AA 3FB7A 2Z4QB 3W9EA 4EQ2A 1EV2E 4PB9H 3ROLB 2Z8RA 2K7QA 1N6UA 3IETA 3HI6L 2CK0L 1FNAA 15C8L 5J13C 1JGUL 4HXBL 3N1QC 1RAMA 3HNSL 3EFFA 1DUZB 1KXVC 4OSUH 4HJGB 1DDHA 1K4DB 3IXAB 1BVKA 5DD3L 4IRSB 1EAPB 1RMFL 2YXMA 3N9GL 1MREH 4PJ8B 4HX1A 5DTFA 1T66D 1GGUA 2AJ3A 3GRWH 2CKBA 2RR3A 1KEGH 3WFEH 2WIMA 1BD2B 5FDWA 4PLKD 5CLWA 4QTIH 1E6OL 4JPWH 4ZOCA 3X13A 1TETL 1BQSA 1UKQA 3I75B 2X4PA 3MODL 5ICZA 3WUZA 3HPLA 3ULUL 2YWYA 3ARTA 4U0RB 1Z9SA 2IAND 2FYYB 4QRRE 4I48B 4ORZC 1KCVH 4YHPB 2JELH 5LBSH 2ZSWA 4LSVH 1ZVSA 4UNVA 1HSAA 1UXWA 4NO3A 4D0BB 4QXGH 2UWEF 3B9KA 1HHIA 1I7RA 2DYPB 4OKDA 1JNHB 5L9DH 1YEEL 3DVIA 3LEXB 5HHMD 5ACMA 2CIKA 1IC1A 1PYWB 4JANA 1FRGL 3RKDC 3V6OC 2DJSA 4WTZA 4UDUA 3KPRD 2G5BB 2EXYD 3MV7A 3LKQB 2HFEA 5E2VH 3JWOL 3X3GH 4MQ7A 4KDVA 4MAUH 4Y5XB 4JM2B 2QQLL 5DD1H 5EUOE 3AAZA 5DQDH 1L7IH 3FTGB 1NFDE 3BVNB 1HKLL 3W5MA 3ARFA 4GW5A 2Y1VA 5C0JA 2RAMA 3I2CL 1U3HA 3VXTA 2R0ZH 5BCAA 5JOFB 2CO6B 2AJSH 3T65B 3BUTA 3FO2A 3CVHL 4JG0L 1QLEL 4NQCA 4KVNH 2YK1L 2YN3A 3K4ZA 2VXTL 2CDGB 4KRLB 2N7AA 5C0GB 4RDQF 1T0PB 4RNRA 5D2LF 5EBMA 3BPOB 3OR6A 3K74B 1QP1A 1K5NA 4UINH 3L3HA 4XNXH 4Y0GA 4TYUA 1J0ZA 2Q3AA 4MCZA 4HK0A 5DT1L 5MEND 1PFCA 1FN4B 4LGRB 3S8WA 1FL5B 1S3KH 3FB7B 3SGEH 3GHEL 4JREB 4OFKA 5EU6D 1F5WA 3SQOH 1Q9KB 5I75C 3WFBH 1T89A 5KVEH 4FABL 3EDFA 3S37L 3ALWA 3D0LA 2BVQA 1BX2A 3D0VA 3C60C 4NQDD 1OW0A 3MGTA 4M7LT 1L6XA 3BIKA 1A8JH 4K3DL 3ABZA 4Y88A 8FABA 2L0DA 4WUUB 3TA3A 5F7NC 4HX1B 5DTFB 4OLUL 4NC2B 1CDYA 2AK4D 2AJ3B 4JZJA 2FLBT 4PB0H 1FPTL 5TH2A 4HXAH 4K2UH 3RQ3A 4WTZG 4OZGF 3VFNA 4RWYL 4PP2A 3X13B 3FFCB 4FFYL 4YHLL 1YUHB 4NUGH 2E27H 3V6FA 4OQTH 2W65B 2Y7QA 4XGZA 3IJYB 3PIQA 2IBGA 3HE7A 1H3GA 2EYRA 1HSAB 1F45A 1R5WB 5BV7L 5I1HH 1UXWB 2Q76A 2AVGA 3A67L 5CINH 1DVFA 4NO3B 5GZNC 1KGCE 4KQ4L 3EO9L 3O4LD 4PJDE 5IIEA 1EMTL 2ADIB 3B9KB 3CU7A 5HYJD 4O2FA 1I7RB 4WNQA 3T2PA 2Z31C 3MJ6A 1DEEB 3MNWB 3VWJA 4L1DA 1FHGA 2R4RH 2CIKB 4ZFOA 4HULB 1CXHA 5E8DL 2AKRB 4CVUA 5HI3C 5K59E 1EUUA 3JVGC 5E2TH 5ITFB 2VWEC 2FHBA 3MV7B 4PJCF 4F57H 4G6JL 4QTHA 4UILH 2X70B 4F37F 3NTCH 1KB5H 4G6ML 1S7UA 3DVNA 3FRPA 1MJJB 1A6ZA 2J8UF 1X5JA 3MXWH 3RL1B 3ET9F 5EN2B 1U8QA 2ITDA 2LTQC 3KYKH 1NAKH 1A7OL 3OAUL 4EKXA 5BZWA 3T0WA 5LG1A 3TIDA 3PQYA 4FZEH 2XN9A 4JDTL 4N1HB 2AV1A 3LH2H 3VXTB 3H0TA 2Z31D 4JO1L 2BY1A 3FO2B 2HRPH 5IB2A 3SO5A 3B6SA 5EZLB 2A9MH 1DBJL 5HI3D 4DGYL 1DQJB 5KW9L 4JFHE 2EDRA 4CADA 5C92A 1YC8A 4RNRB 5EBMB 2ZUSA 4HC1L 4F2MB 3OR6B 1IAKA 1K5NB 4KJYA 5CKAA 5J89A 2HYMA 4K7PH 3ES6B 3IYLW 4OF0A 3TO4D 1XGYL 4L9LB 4MCZB 4HK0B 4CL7A 3KHOA 3RWFA 3B9VA 5C0BA 1RIUL 4OGZA 2IBZY 5D7KE 1EFXD 4QY8B 4N0UE 2WLZA 3EYOA 1T2JA 3C8KB 4WI4A 3D0LB 4NCDA 4F9PC 2BVQB 1BX2B 3T0EA 5BVPL 3BDBA 3L1OL 5DHYB 1AO7D 1ZGLP 3BIKB 3WS6C 1FNGA 2IADB 3V5DA 8FABB 3FQRA 4C4KT 1MEXH 2X42A 4ZFFA 3PWJA 2BJML 5FYKH 1Q38A 5GGQL 2HKHL 3TA3B 1JL8A 4K7PY 1NBVL 3MJ7A 4JZJB 4P2YA 1T1ZA 5L6YH 2VXVL 4OZIA 2IJ0C 2BSTA 2QTEA 1LNUA 2H2SD 5E6ZA 3VFNB 1ND0B 5GJTH 4PP2B 2ZPKH 1NFIB 4L8CA 2V9QA 5ILTH 3IAGC 3NVQA 4MB3A 2ICWI 2DIAA 4GLRI 1UACL 3V6FB 1DEDA 2GK0A 3FRPG 4NO5A 2X89D 1D5MA 3OWEA 3SGDI 4ZS7H 3PIQB 1ZAGA 4I2XE 5ALBH 3TT3L 2EYRB 2DICA 3MV9D 5F88A 1WEJL 1UZ8B 1DVFB 2BRRH 1FVDA 3DLQR 4O4YL 1UB6A 3VWKC 4PJIE 3D39E 3T2QA 3FO9A 3KPSD 1TPXB 4O2FB 2BVUA 4WNQB 1PSKL 2AXJA 1F11A 3J8F7 1X7QB 4JFDE 3WJLA 4WFGD 1U0QA 1G9NC 3MLUH 3P9MA 3WIHH 1U8MB 4NSKA 4GRWH 4HIXL 1CQYA 3SDCA 4QTHB 1DN0B 3QUML 2ZCLL 3IKCA 1S7UB 3GO1L 4PRIE 1MSPA 1QSZA 1WT5C 5F72S 5C0IA 1U8QB 4PTTB 2ITDB 5FOBA 3S5LB 3ALXA 5BZWB 3HC4H 1C5CH 3CFBB 5EUKA 4MXVF 3BP7A 2YN5A 3KXFA 1KCRL 3PQYB 4D3CH 4AYFA 1IAMA 4EI5A 1II4E 2AV1B 3H0TB 1N7ML 5IB2B 1J0YA 2B5IC 3EDDA 5ALCH 4EOWH 5FA3A 2QSTA 4LCWD 5CEYB 4C57C 5DFVD 1OP3H 5ESVA 3GJFH 1HQ4B 2M8XA 3NCJH 4UT6H 3DPBA 2OTUB 2YBRA 2ZUXA 2VQTA 4O9HH 3I02B 3RWFB 1NMBH 3TLRA 3QEQD 2YUZA 1HHKA 1J0IA 3T0BA 3UJIH 4J2XA 4Y2OA 4YX2L 3WJJC 3QFJE 4M1DL 3S35H 4S2SB 5HHOA 3MRKA 1FNGB 1XGUB 1EIBA 4APQA 3FQRB 5C6TL 3PWJB 1T7YA 2NTSP 4QXWA 2CLVB 2BK8A 3O3BA 3QXVA 1Y18A 3MJ7B 4QHLA 3VDBA 5DJYB 1MFAH 4M93B 1T1ZB 2VLRD 3P0VL 4EN3A 1M7XA 4OZIB 5F9OH 4U7KA 3LV3A 4J4PC 4PJ7B 1MFCH 4HW6A 4L8CB 2H2PC 2ORBL 4ONFL 2Z8SA 3DX8B 5JW4N 4E41A 5C07D 2GK0B 4NO5B 2G60L 4A6YL 3D18B 1TMCB 4IOIA 1KJ2H 1X4ZA 5F88B 1QBLL 4I77L 4HZLA 5F6HJ 2BNRD 4X98A 4XX1G 4M4RA 4ZNEE 2EDXA 4XC1L 3H9HA 3WSQH 3S97C 1JF1B 4YXKL 5C0EA 2PYED 4IHOB 1X4XA 5L7XH 3LQMA 4YEEA 5FKAA 1G7QA 2BNUB 2P5ED 4OLZL 5HDBE 3SDXA 3B43A 2I5YL 4X8XA 2VRAA 2H2PD 1H3WM 3O9WB 3UTPD 1DFBH 3SDCB 4EXPX 3HMWL 3CSYA 4EUPA 5DUPH 3IS1X 1YJDH 4D8PB 1BQUA 1JGVH 5C0IB 4MD5A 2X7LB 4U7SA 5FOBB 3KR3H 3SPVB 5EUKB 3MV8E 4LNVA 5JHDD 1TTGA 1S9VB 5D7JA 4Y19A 5IQ7L 4EI5B 1J0JA 3WHE1 1FFOA 2L4OA 4MNGA 1QFPA 1HH6B 4N1CA 2AGJL 1EGJA 4UOW1 1OB1A 2YPKA 1DE4B 2LABA 3PUCA 3VFVA 4OCXH 4LSRH 3C08L 1JYWA 2XZAH 3QULB 4G8GB 2VYRE 2EO1A 4YHKH 5F7DA 1T5XB 1D6EA 3GSOA 2J4WH 3KWWA 4OT1L 5DUML 5IBLC 4UDTA 4JB9H 4PG2A 1ONQA 5L8JB 1QEWA 2XWTA 2YBRB 3DBXA 5J1SC 2B4CH 4PBWD 1HYSD 1AGEB 5IJVB 4BSVB 4PRHA 5EG6C 1X44A 2NY1B 5B4MC 2OTWB 4PJIF 3R8BB 3DMMC 4OSUL 3G6DH 4J1UA 4FMFA 4OZ4A 3LEVH 3ZLQC 1I3VA 1ACYH 1KLUA 3LPWA 4BZYA 3WL9A 3UO1H 3AVEA 3MLVL 1XZ0A 1A9BB 1D9KA 2YXFA 4Y5YC 4JFEB 4A2LA 1FGVL 5IBLD 3I6KA 3O3BB 4HKZA 3J7HA 4QHLB 3GNML 2O5ZH 3KYOB 1IQDA 4JG1H 5DO2C 4OBRA 3VFPA 3DYMA 3S6CA 2A6IA 5CMAA 5B4MD 2YD1A 3LV3B 4LVHB 3X17A 2JELL 5LBSL 3VG9B 3DMMD 4OIIL 2E9IA 5FM4A 5EORH 2WV3A 4P49A 1QR1A 1IARB 1DSFH 4QKXB 4I18A 2WWMC 3VH8G 1G0YR 4JO3H 2WBJB 4PUBH 4IOIB 4NBYB 4TN9A 1RJLA 3VXPA 4CRPA 4LU5H 4HZLB 2L7UA 3MGOB 4F7MA 5FGCB 4X98B 5C1MB 3TBTB 3VXSE 4XPAH 3P0YL 1J8HD 1O0VA 5C08B 5DO2D 3UPRA 1G7QB 1A9EA 1XGTA 2GT9A 5D8JH 4WWID 1ZWIA 1ZA3A 3H9SD 2FX7H 4MAYC 2VJXA 4NC1E 2LV4A 2WWMD 1UFUA 3VXRE 2BSSA 5ACZA 1F3DH 2E6PA 3QG7L 3VH8B 1I9JH 4PJHB 2R0ZL 1GJIA 2H6PA 4N9OB 2HT2C 3CVHB 3D3VA 4BH7B 5F6IB 1VB9A 3VXMA 4ZXBC 1EERB 4U6XB 1L6ZA 5D7JB 2I07B 4Y19B 1ZGLA 3QXUA 1MH5A 4HC1A 1FFOB 2XPGB 3VD4A 3ZYIA 4AH2A 3Q6GH 1X5AA 2YPKB 4I3SH 5DFWH 3BGAA 3TJEL 1IGCL 3FB6B 3PDDA 1I7UA 4F9LA 2OR9H 1JNLL 4Y2DD 1D6EB 3BDXA 4MAYD 4J12A 5IT2H 5FYJE 5IVXF 1NBZA 4UDTB 4LLUA 3RWJA 2XWTB 3MBXL 2EDYA 4BZ2H 2P7TB 4UB0H 3U0WL 3JXAA 1NKOA 2HT2D 3ZYJA 2DQUH 1A4KA 1OWWA 1TZGL 3QB7C 2Y25A 3F62A 3MFFA 1K4CB 4NBZB 4NQUA 4J1UB 4OZ4B 1SBSH 5T3ZD 1KLUB 1RUQH 4NNXB 1UJ3C 4IOSD 4KMTH 4I0CC 4LKCA 4GG8A 3D85D 4MJIA 3ARGA 2E9BA 1ADQH 1EX0A 5DJAB 1BJ1J 3TCLA 1D9KB 4AEHH 2JB5H 3CFIC 3OG6B 3V2AR 3RI5K 2YD2A 4AIXA 1OQXA 3I6KB 1J5OH 5TF0A 3W2DH 1EK3A 2AEPH 4N5UA 4HKZB 4JPKL 1UXSB 1YEGH 3G6AA 4NUGL 1B0GA 3VFPB 2OL3A 4B53A 3VFWA 4NFDA 1SYVA 3A0OA 5CMAB 5FGBC 4WHYG 5GISL 3AREC 1ZSDA 3ZDZF 1DLFL 1UYWL 5BV7B 1FYTD 1OCWH 4XVJL 1EHLH 5FO8A 1HXYB 4R97C 1T0NA 5KAQF 1YPZE 4QNPE 1MVFA 4HGKC 1FG9C 3L5XL 2B7DT 5L0QC 5AYUL 5EOTA 4WFED 2BHUA 3VXPB 5J3HC 4NPYA 1C5BH 4P23A 2R4RL 5T1KD 4B5EA 4F7MB 2VKXA 3O2DH 3SKMA 5F7LB 4H8WC 5C7XH 1MFEH 2OI9C 2W9DH 5EA0H 5HVHC 4XPFH 2XWJA 2CDEB 5SX4I 1KIPB 1QSEB 1B90A 3V6ZA 3UPRB 4P2QA 5D1ZA 4Z7WF 1A9EB 3NZHH 5DDHB 2XV6B 3ARED 4YHNB 1DUYA 3IU3A 1E4XH 1CL7I 1KIRB 1UADC 3MXWL 3VA2C 4WWKD 2FCBA 2F53A 1ZWIB 4LLYA 3WFHA 1ZA3B 1UA6H 2GW5A 2R2EA 4FZEL 3S96A 4KK8C 1LP9F 4OCSH 2H6PB 5J3HD 4YDVA 5TDNA 2MSPA 2HRPL 5AD0A 3AY4A 3WS3A 4P9HH 1NDGA 2FZ3A 4GBXA 5M94B 1MH5B 4K3HA 5KS9A 1P53A 4NZRL 2AK1H 4AH2B 3FT3A 1J88A 4BFGA 4WENB 4J3SA 3G5YA 5JXAH 5I1IH 4XPGH 4P2RD 4AJ0A 4LRNL 3CC5A 5IW3A 4M62L 3FT2A 5E94A 1FL6B 1Z9MA 2RCSH 2X4NA 4HGWA 4LLUB 4S0SD 2IH1A 4KK8D 3W0WD 5CCKH 4S1DC 3SOBH 4KJQC 5I1KH 4O02L 1A4KB 3OJVC 3REWB 3SJVA 5E24E 4IOFC 1KV3A 1VPOL 1N5AB 4I0PA 1BZ9A 3MFFB 3QIWA 5GRVK 4HJJH 5HHVH 1QFUH 1M7DA 3BT2H 3BFOA 2A9NL 1Z2KA 1CXFA 4GG8B 1MUJA 3RX7A 5D7LA 3LIZH 5CBAA 3ARGB 1I9IL 5DEGB 5IF0A 1ZOXA 4OLVH 4C56A 1LO2H 1T5WB 2Q86A 2ZPKL 4X6BA 5CS7A 2VDKH 4S1DD 1BF2A 4LCIH 3GMMA 4KJQD 1SYVB 1IZKA 1W0YT 4X7EC 4ZS7L 2ZOKA 1A2YA 1K6QH 1FZKB 2WUCL 4HS3B 1A6WL 4G9FD 1I3RA 4GXVL 5FO8B 4IIQC 1T0NB 5C2BL 5JPNB 4ZO7A 3BZDA 2C1OA 1E4KA 1G7JA 1BBJA 5IB1A 3WKMH 3ILQC 4O51B 4L8SA 2EKJA 4OF8A 4QYOA 1TNMA 1J1OH 4NPYB 4Y5VA 4P23B 1A1MB 2PETA 1LWRA 5F3BA 2APVA 5GIRA 4PJGA 1FNSL 1EHAA 4HK3N 1K8DB 4HIEA 3WIHL 4K3JL 3D2UA 4RZCB 1AR1C 1VGEH 4FTVD 5EH1A 3QUMB 5GSVA 1JF6A 4OQ1A 4P2QB 2HG5A 5ESAB 1QTYT 3IU3B 1MWAL 2VAAB 3GMOB 3QDMD 4LGSB 4Z78B 2F53B 1C5CL 5EO9A 3BN3B 3QA3A 2ATKA 4JY6A 4TVPE 5DJDA 2R2EB 5JZ7C 5ADPH 1IKFL 5GRZA 3T77B 1UEYA 3ILQD 4NQTA 4MDIA 3PWNB 4KY1H 2MNUA 3TT1L 3WUWA 4IS6A 2E7LC 2QQQA 4L4VB 3BESR 3GSWB 1P7QD 3E2HC 3N50A 4EOWL 1VKXB 1DQDH 1NDGB 3DOSA 1DCLA 4GBXB 1AR1D 4O58L 3M8OL 1ETZA 1TLKA 5KS9B 5T1DL 3FAXA 4LIQH 3FT3B 1R0AH 3G5YB 4L4TE 4XMPL 3RVVD 4IRJC 1MRCH 2E7HA 3QXTA 3CC5B 3NCFB 2R8SH 4QRPB 3DGGA 4C83A 4KMLB 1GZPB 3HLAB 5JZ7D 3RUGE 1YPZF 1MHEB 4QNPF 3ULVE 4F7PA 1CCZA 5CP7A 3TN0A 1FSKB 2NXYC 4NGHL 1WBZA 4BKLA 1FFPA 3K7UA 2IFGA 3MJ9H 1I7ZB 3KPNA 3CFJA 4I0PB 2ERJC 1YQVH 1BZ9B 1BQLH 3QIWB 4X7SH 3GFUA 1QSFE 5IMKA 3BUYB 3CD4A 1M7DB 1F3RB 3OXSA 4WV1A 2AEQL 4HBCL 3RA7L 3D6GA 1TZHA 3I85A 4UT7L 1B3JA 2JJTC 2UVEA 1CI5A 3QAZC 3CIQA 2AW2A 3BPLC 4IRJD 5CBAB 2G9HA 3DGCR 3NN8A 2ICEA 5IWLA 3RU8H 1QVOA 5IF0B 3QDJE 3OJ2C 1GRWA <