1F8TL

Fab (lnkb-2) of monoclonal antibody, crystal structure
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
219
structure length
219
Chain Sequence
DVQMTQTPLTLSVTIGQPASISCESSQSLLYSNGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLRISRVEAEDLGVYYCVQGTHFPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT (LIGHT CHAIN)
publication title Spatial structure of a Fab-fragment of a monoclonal antibody to human interleukin-2 in two crystalline forms at a resolution of 2.2 and 2.9 angstroms
pubmed rcsb
molecule tags Immune system
total genus 54
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2000-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f8tL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f8tL01
1C08B 3OAUL 3K46A 1E28A 1ETZB 4MXQD 5DSCA 4HWZA 2FYYA 1BVKA 1D6VH 3BHBB 3UMTA 1OAYH 5IB4A 1V5JA 1NAKL 1YMMD 1G7PA 2ZKHH 1G7LA 4S1SL 3GDBA 3LMJL 4OIBA 4OZGB 3ISWA 4U6XB 2I27N 1QSZA 1GZQA 4DKAA 2GJJA 1RUML 5D7LA 1B90A 4DN3L 2CPCA 1A1MB 1YEGH 3O11B 4MD0A 3ARBC 4OZIA 1CLOH 4NKMB 4IOIB 5C0BB 1JE6A 4CMMA 5ISZA 2DQUH 4R96B 3QCTH 5ICXA 3LRHA 2R4RL 5DMKA 1I7UA 5JORA 4FFVC 1WLHA 3TYFB 3U36A 5IB2A 2FX7H 2QSCH 2VDKL 4YDVA 3HTLX 1CGWA 1K5NB 4A6YA 1MPAL 3MUGB 1T7YA 1IC7L 4UTAH 4JY4A 2H2SC 35C8L 3UDWC 4TQEH 4QRTB 4HIEA 4X9HA 1HQ4B 2BNQD 4YBHA 5EU6E 4Q0XH 3KYKH 5DEFA 1UM4H 3QIUD 4HGMA 4QHUB 3V7AE 5B38B 3TESA 5I8CA 4AEIH 4PLJC 2BXZA 3FRPA 4K3EH 4S2SB 3MCKA 4CN4A 3ZYJA 4FG6D 3MJ9H 5FV1L 4J2XA 1A0QL 3LV3A 3RPIB 4DUXA 1OGTB 4MAYB 3O3AA 3J7HA 3V6ZB 3JUYA 3B9DA 1M7IA 3G5VA 3TNMB 3MMEB 4DW2H 2A1WL 1BM3L 1FJ1B 4JHWH 2D0GA 3BDYH 5C0CE 2WANA 4G42A 3V5KA 3MRRB 5D72L 4HK3N 4I4WA 4X9BA 4UNUA 1HKFA 3F5WB 2VUYA 4LKXB 4PBXA 4X7DC 5FDYA 1N5AA 4YJZL 1IGCH 1IEAB 2B2XL 1D3CA 5KANG 3MZTA 2EDQA 4GRLD 4PFEA 2HJKB 3F7QA 3P4LA 3CSGA 3L3JB 1IC4L 3GIZL 3KLDA 1KTDB 2FO4A 4UMGA 4ZOCA 4I5BB 3U0PB 1M6OA 4D9RE 5E99H 4P3WA 1O7SA 4U31A 1WIOA 5EFIB 1T03H 1A1MA 3TZVA 4HMEA 1LDPL 4AENB 5KSBF 4P5TD 1EVTC 3IJHA 4NKMA 4NZJA 4UT7H 1WAAE 5C0BA 3CCHB 3I9GH 4ZFOL 5ADPH 2Y4SA 5FYJE 2IQAB 1J1XH 3QUXD 3LIZH 2XFXB 5E1AB 3BO8A 2JJVA 4WUUD 4CU7A 5CJXA 1HDMB 2XTJC 5IGXL 3HG1D 2AJUL 2EO9A 4H20H 2MHAB 4OCXL 5IEHA 3NCCB 4OB5L 1FZKB 1A7OL 3RVWC 1HEZA 5ENWA 1ZHNA 3MUGA 3VGHA 2DWEB 2X4OB 2NTFB 2EEAA 3W2DL 4DGYH 5ESAB 3DARA 2AQ2A 5D8JL 1LP9F 4YFDB 2JELH 4MJ2A 3SPVB 3GUTB 4QHUA 5B38A 2O93L 2IQ9L 5EC1A 5I15H 3QXDB 4NWTL 3EO1A 3O6FD 2OBGA 3AUVA 4RX4A 5FYLL 5EO9B 3O3DB 5I0ZA 1QRNA 4PJHE 1WCBA 5F9AC 1OGTA 3S97C 2YS4A 3NIFF 2UY6A 1KCRL 1MWAH 4ODBD 5EO0B 4P48A 2DJ4A 3IDUA 4FTVA 4ODWA 3QQNA 5ICZA 2FLRT 3GIVB 5T1MA 3SOBL 1FDLH 3RL1A 1H0DB 5CD5D 1JZ7A 4H1LG 3MRRA 1DBMH 4P4KB 3CC5B 4DN4L 5F6IC 3GMRA 5DDHB 5D2LF 4F7EB 4LKXA 3F5WA 4EN3B 5FDWA 4PLNC 4K9EH 3QO0B 3X11B 2A74A 2OL3L 4X5WA 4BYHA 3O2VH 5FHAL 5C6WH 1LNUB 3WNLA 1P5VA 1NFKA 1RZIA 1OW0A 1EFQA 4QCIB 3NCFB 5C09E 2W60B 5KTEL 3RWHB 4M93C 3WFDL 3U0PA 1U8IB 4EIGB 3QXAB 3O0RL 4V1DE 1NAMH 3FN3A 3MBED 2VLKE 4O58H 4L29B 5EFIA 4PJ8A 1MREH 4CAGA 4NQVA 1CL7I 1AGCB 1ZTXL 2AQ3A 5EBMA 4YO0B 4GAJH 1F4WL 5C8JB 5HHOD 4N68A 4P4RB 1LEKA 3RVTD 3RTQA 1JRHH 1ZVSB 2PR4H 2IQAA 2FJFA 2I60L 3BMWA 4JEGB 1UB6A 1NFIB 4X99B 2CO7B 3SJVA 4N90E 4QNPF 3MV9A 4Q9QL 4PJDB 1T4KB 2LV4A 2R2EA 4JCLA 1K4DB 4JO1L 2MHAA 2W38A 3BZDA 3HC3H 2ED8A 4P2OA 4I0PB 4XC3H 3MUHL 1FZJA 4XCFH 4NYLA 1A7RL 4XX1G 2B8OT 3SPVA 4H88L 5JPMB 1EZVX 4H8WH 5K9JH 1IGML 2R2BA 1BAFH 5D96B 3QXDA 1FNAA 2J8OA 3VG0L 3UJTL 4PRIA 4GXVL 3BPLC 1TPXC 3S4SA 3MCLH 4P2QB 5C71A 5BRZE 3MNVB 2AJVH 1S7TA 5HGAB 1U3YA 2EICA 3GIVA 5D1ZB 3HMWL 2P5WE 3D9AH 1H0DA 4JRXB 5JOFB 3Q48A 3NPSB 3KS0H 4P4KA 4HUKB 1CU4H 3D2UA 3G5XB 3L3GB 4KJQC 2EXYC 2YN5A 4XMLH 2C7UA 2NXZD 3SDDA 1QLRB 1Z3GL 3CSPA 3ARFA 4LIQE 3CFCH 1T7XA 3MV8A 4IHOB 3RZWA 3RUGF 1PX4A 1X5ZA 2ZG1A 1KIUA 4QKXB 5DMGC 5DF0A 2JTDA 4NQEA 1PG7X 3F58L 1U8IA 1CK0H 1PFCA 4BZ1H 3KYOB 3QNYB 3RX8A 4RFOL 4GW5B 4YWGL 4XVJL 5DD6B 2HVJB 4WEUD 1WT5C 1AGCA 3PXHA 3UPCA 1S5IL 4YO0A 5LGKA 1DN0A 5C8JA 2YPLD 1A1NA 4HUXB 2YC1A 3ROLA 2OTWB 4X99A 3U4BH 3KPRE 1OAXL 5TDOB 3ZDZF 1UH4A 3GMOB 5EU4B 4QRPB 2V7HA 2D0HA 4Y88A 3X12A 3B2UC 5JHDB 1JNNH 4JM2C 3SKUD 4PJ5D 4G8FB 1JYWA 3IJSB 2H8PB 4OTXL 4IDJH 4JY6B 4KDWA 4OZHB 1CFQB 1JPTH 5E6IC 5E7FA 2HKHH 3TJEH 1VACA 4TPRL 1E4JA 3O6ML 1MQKH 1P9MC 5JPMA 4M7ZC 3VXSB 3MR9A 3P9LB 1MCOH 5MP6L 5IVOA 3LEXB 1U8QB 3KNBB 2P8PB 4HAGA 4RMRA 3TT1L 3W9DB 4HG4J 2QSVA 8FABA 2VDMH 4XI5D 3LY6A 3AB0B 3ULVL 3MLXH 3WNMA 1WICA 5E56A 1RJZA 3DV6A 2XQBL 3N9GH 2XN9B 3RKPA 3CH8A 2WINB 4QNPE 2BJMH 1RZJL 4HQQH 4XPAH 5I1CL 5JOFA 2AJSH 4OIIL 1NGQH 4LPWA 4Z7VF 4TTDD 3OL2A 4O9HH 3DO7B 5I1HL 2XWTB 5D2NB 3HI1B 3TP4A 3VXOB 3QUML 1AXIB 4QRRA 5HDBE 4HWBH 3ZYOA 1MCJA 1S7RA 1FH5H 4KK8C 3QEGH 4RSVA 4WGWB 1RU9H 1OTUD 5JW3L 3PDGA 3I75A 2GJ6A 5SX4I 4UV7L 1YEHH 4KUCD 4M8VA 4HKBB 1F8TL 4M61B 4RCAA 1UVQA 4KHXH 4CU6A 4XNYH 3UTSE 1F4XL 4ZFOB 1RULL 2HVJA 3QDMD 3PG2A 1P1ZB 3BQUC 4HEPG 2CSPA 5AAMA 1HH9B 1BFOB 3CDYA 5JIIA 4HKZB 3O3EA 1KB5H 2PN5A 3CH1A 4I2XE 4G3YL 1I9RH 4NO0B 4URTB 3UP1A 3FRUB 2OTWA 1FIGH 1RK0A 4UOW1 2JCCA 1EH9A 3TBYA 4D3CL 1CDUA 2IPUG 4O4YL 1QSFA 2KH2B 3AVEA 4GUPB 4YH6A 3SGDH 2X4QB 5EU4A 4RDQF 2OP4L 4RGNC 4EDXB 3QI9A 4ZAKC 4X6FA 2Q86A 3JV6B 4JDVA 5A3IC 3P9MA 1N4XL 1KCVH 4XP1L 1KJ2A 2H8PA 3BKYL 5L88L 3ZKXC 4JY6A 2QADB 4GAGH 3T3ME 1ZS8A 3AXLA 4LVNB 5EUKA 5JDSB 1FVEB 1RZ7H 1ZT4B 1KT2B 1A6TB 5JQ6L 3PL6D 4JM2F 4P9MH 3IU4L 4YHML 3SDCA 5EZLB 1LO0L 2R0ZH 3LEXA 1MAJA 1EXUA 2CK2A 1U8QA 5FUCE 1QBML 1GPOH 3KNBA 4OQTL 2DLGA 2DLFH 1R3LA 2Z4QA 3S7GA 4M5YL 5C2BL 4JZJB 4O51B 4LSVL 1MHEB 3MRLB 5J13B 2OL3B 1A7QH 5FCUL 3EYSH 4Y4KD 3VWKC 5EOQL 1YPZF 1U8OA 2YBRB 1Q1JH 1M71B 1NANH 2ZOKA 4OFDA 1TIUA 4CVXB 5IVXE 1CLCA 2R0LH 2XWTA 4XC1H 2VDQH 4M8QB 3MLWH 1P4LB 5D2NA 5FA3A 1CL7H 3BPOB 3V7AG 3RWEB 1UJ3A 1P6FA 2HH0H 4M62H 4QEGA 3KLAA 2AI0L 4XBEL 1N2RA 3QNXA 4XWGL 4XNUL 4PJ9D 1DE4B 2JLLA 2J5LB 5EC2B 4MYWB 2OSLA 2X4RB 1LO3H 4PY7A 2PO6C 4M61A 3JWOL 2FCBA 5DC9B 3RZCA 2P8MA 3DURA 4CN6A 2GSIA 1ES0B 5F6HI 1J11A 2DM2A 5IFJB 3BEVB 3CFDB 1BJ1J 3E6FB 4PGEA 5IW1B 1P1ZA 3NAAL 1EAPA 1O0VA 4U1IA 2VWEC 2OZ4L 3HNSL 4RISH 4XPHH 3DI3B 5TF1H 3EFDH 5GGTH 3BIKB 1IEHA 1J0YA 1MI5D 5IUSA 3UAJD 2BNRE 5E5MB 5LGJB 1MLBA 1T20A 1CT8B 2HWZL 4GUPA 5TE7H 1CR9L 5E8PA 3I6KA 3VXRD 3K1KC 5LWYL 1J0ZA 3WNNA 5CEZH 3P4NB 5IROA 1R5VB 1OP5H 4DWHA 3ARBD 3QWRD 3MRFB 2DWDB 3BEWB 3JWDC 4L4JA 4MCZB 5DFVC 3SDXF 4MB5A 3IT8D 4U4BA 1IGFL 4U1KB 4JFEA 3PV6A 4QHLB 4DKDC 2D2OA 1HYRC 4KU1A 3FFDB 5SWSB 2F54E 1XR9B 1NC4B 1R5IB 1M7DB 3G6JE 4FFVD 2NXYB 3LCYA 2IBZY 4UZGA 3SKMA 4X6BB 3MOBL 4N0UB 5IHZA 4O51A 2XZQL 3QXTA 1JHKH 5FYJU 2H2SD 4NJ9L 5SWZD 2OL3A 2AV7B 4X6DE 5FO8A 3VXUB 3TO4C 5ERWB 4APQB 1OP3H 3S96B 3FT2B 1TETL 1YEJL 4IOSD 3UJIH 3EJZC 1ZT7A 4ZQKB 3OPZL 4PLJD 1F5WA 3RHWF 5FXCH 5MERB 2Q3AA 4U1NB 3QDGA 1JF5A 1X5KA 3QEQA 3D3VE 3VFUB 1CF8H 4M8QA 4PREB 1E4KC 1CDBA 2NY5H 4GQ9L 3CFEB 1OWRM 2HN7A 5E9DD 2V2TA 2NX5D 1NFDE 3MJ9A 4JANB 5DC4B 3VXMD 1QPXA 1HZHL 3PNWB 2HT3C 1S8DA 3DYMA 4HK0B 4N0CC 1ZEAL 4OLWL 1ES0A 3ILQC 4S0SD 3VRLF 3BEVA 3QXWA 3CFDA 4M7LT 3UYRL 1I85A 5IW1A 1LO4L 1EEYB 1C1EH 4FN0A 5DQDL 2VLLB 2FH6A 4NFCA 4M6NL 1EV2E 1Q9OB 2HYMA 4MDJA 5I30L 1FPTH 3DXAB 4MJIB 5LGJA 1ZAGA 1ND0B 3H9SB 3TPUB 1ORSB 1IZJA 3D85A 4YXKL 5CINH 3B8YA 1BP3B 5EA0H 3FHQA 1U42A 3IF1B 5FV2A 5F7WC 3TBVB 1FNSH 5GGRY 4WW2C 2VNCA 4YUEL 3N0PB 2VQUA 3UXFA 3T3PE 4FXKA 3P4NA 5C0ND 4OD3L 3S6CA 1X4YA 3BKMH 5ILTL 4TVPH 1PBYA 4WTZA 1I4FB 3BT2L 4NKQB 3BEWA 4F2MA 4NBYB 5MEPB 4K94H 1P69B 5ITFA 3IKCB 4Q2ZB 1I3RA 1CDGA 4X4MA 4Z0BL 2ITCA 5B21A 4X6CF 4JGMA 2LFGA 4U1KA 4B41A 4QHLA 5JOPE 4ZPTB 4FXGA 1BECA 2R0KL 5EZJB 5SWSA 1R6VA 1NEZB 1L0QA 4KAQL 2XTJD 2ESVE 4TNVF 3ARXA 4B50A 1T7ZA 1OQXA 5C0IB 4X6BA 3MFFB 1AFVL 4PP1C 1JUFB 3LQMA 5BZWA 3RVWD 4PJBB 3KPTA 4AMKH 3HB3C 4NQDE 4P23D 3WJJA 3QUMB 4FQ2H 4JZNA 4GLRI 3TIDB 1OB1A 4N0YL 2KUTA 3MA7B 5HDQL 2DQHL 4UI2A 1IM3A 3VGAC 1Q9LB 4U1NA 3H6JA 4WI8A 1AD0B 3BPNB 1J05A 3C5SB 4PREA 2I9LA 3FQXB 4OFIA 3TVMC 3WIIH 3V0VA 4PRNB 3CFEA 3ZTJG 4LSDA 3MRDB 4Y19E 1MCWM 4G9FD 1HH6A 5I9QC 1CDCA 3NCJH 5DEGA 4G8GE 3ALPA 3PNWA 1MWAA 5JUEL 1IE5A 4NKIL 3DX9A 1A6AB 1JYNA 4XCCH 1AD9A 1P7QB 3WFEH 2V5MA 5C0AA 3KPSD 1VERA 1OT1A 1CGXA 1EEYA 4G7YL 4KXZI 2WQRA 2VLLA 4KVNH 4ZTOH 2P5EB 3V4UL 4LAJH 3S5LA 1Q9OA 3OZ9H 3GHBL 1ND0A 3H7LA 3H9SA 4FFZH 3TPUA 1ORSA 2EIBA 2NQCA 3JTTA 1O5DT 5T1KD 2VDLH 4N8CH 1BMGA 5JIHA 5HVWA 1EERB 2F58H 2WUBH 4FQCH 3VG9C 4Z7WE 4RGMC 5F7UA 5KG9B 4Q6IC 2IH3B 1I4FA 2QHLA 1AQKL 3GHEL 3NTCH 4QTHB 5FYKE 1MHHB 3HCVA 4WW2F 3LZFH 4AQ1B 2DLEA 5MEPA 1RZFL 3MNWA 1YEEL 1NCWH 5FOBB 3C6LB 1D9KB 3CFJB 4PRHE 3OKNB 2NY3D 4OLZL 2IAMB 1JFQL 3TH3T 3QRFM 1Z6JT 3LRGA 3IETB 4NM4H 1UM5L 4Q9RH 5J12B 2QQNH 3SGJA 2FLBT 4X98B 3P4MB 5EIIB 3TJHC 1T2XA 3MFFA 3WO4B 1JUFA 1N6QH 3V0WH 1N59B 3HLAA 4YC2C 1XR8B 5T3ZL 1JN6B 4I0CC 3ZL4L 1LK2B 1NCCH 5IQ9B 4NP4H 15C8H 5CLTA 1Y6MR 2Q6WA 4JE4B 3RY4A 2F19H 3MOAH 3C09B 3L9RB 1QFWI 4XHJC 5L0QB 3BKJH 4HT1H 2R56H 4LLUB 4B5EA 25C8L 1JL8A 2A0LC 2AS5M 5E2JA 3BXNB 1AHWB 3BGFB 3C5SA 3HMXA 3NVQA 2X7LA 5H2BB 4GBXC 2P24B 2Y25A 1CXEA 4P9HH 4UUJA 4PY8I 2LU3A 1IT9L 4CADA 1JHTB 5KVMC 2Z91B 1EVUA 2D03H 3HI5H 3HPLB 4M6OH 4UB0L 4PTUA 2VDOH 2VLME 3MXWL 5GJTH 4HD9A 1P7QA 4NC0B 1W0WB 2E6PA 3ARGA 4JHAH 2EXYD 4KJQD 43CAB 5LVEA 4G6JH 2HT4C 4JO2H 4YDIH 4IMKA 1WFNA 4XCEA 3KXFA 1BJ8A 1KCKA 2FBJL 4PGDA 2E5EA 3TA3D 4PJGF 5B39G 2HFEB 3WJLC 1KBGL 4PJEF 4R3SB 1N7ML 2HLFD 3WKMH 2VOTA 3WHXB 4JVWA 1TZHA 4ELMF 4CVUA 4GRMA 4UAOB 3OSKA 3FB8A 1PG7H 2BERA 2MKWA 3V52H 1U91A 2VH5L 3KPPA 4CDHA 2JJWA 5I8OH 1C7SA 5KG9A 2PTTB 5B8CA 4BH7B 1XCQB 2J6EL 1P4IH 4XWOC 5CWSA 4QTHA 5CZVH 3C6LA 3CFJA 4AJ0A 4OSUH 4LCWD 1KLGB 3LKNB 1UWGL 3OKNA 3CLEL 4JREB 1BZ7A 5ETUB 5H35A 2OQJA 3QG6B 2GI7A 2IAMA 3AS1A 4GKNA 1DBBH 4PJXE 2DQJH 4EI6B 4XBGA 2Y06H 4MAUH 3BUTA 4OZGF 2P43B 4F3FB 4I48B 3B2UD 1YECL 1ZLVK 2GQHA 5D7IA 3FO0L 5EZOH 4PB0H 2BOCB 1XR8A 1JN6A 2DBLL 1GGIH 2DAVA 2YOCA 4WO4C 5E6ID 2EDNA 2QEJA 3L9RA 12E8L 2FSEB 1HHGB 4KK6C 5D9SA 3INUL 4LLUA 1P7HL 4HUUA 4GG6F 5KSAC 3V5HB 3BXNA 4Z77A 3NZ8B 3BW9B 4C56B 3IRPX 1NCDH 3NN8B 4KZDL 2P24A 2FHFA 4JKPL 4F7CB 5EORH 3VFPA 3SHSA 3EYOA 3MRBA 2M1KA 3BFOA 5CD3B 4UINH 5DGRA 2J8UB 2YWYA 1OAUH 1XGQB 3BWAB 1JHTA 3H3BC 3ZE0E 3HRPA 2F74B 4S1RL 3BD3A 3NACL 1CBVL 2AEPL 2NCMA 5ELIA 5EDXA 1W0WA 3OG4B 1DEEB 4XCNB 1G1CA 1A64A 4LF3A 3OGOE 5IHUL 4P5KA 3FO2A 6FABH 2F15A 3V4VL 3E8UL 3HPJB 5D7LE 5F97E 3ARVA 4I1NB 2WBWB 1L0XA 3T08A 1J12A 1IQWH 3GM0A 4OZIE 4KK8D 1FC1A 3WHXA 4LLWB 2O5XL 3EYUH 5ISZE 5IMOB 2EYTB 1RVFL 3VXPB 2VXTL 4F9PA 2JE8A 4YDKL 4MVBC 1YYLL 3FMGH 1U3HA 4DZBB 2AKRB 1XGRB 4YHPB 2DYPD 3U0WH 3B4NA 3BQUD 5FFLA 2FHBA 2PTTA 3DVIA 1XCQA 2G60H 2V17H 5DVNA 2GUOB 1UQSA 1Q38A 3SN6N 4F9LA 1KPUB 3FT4B 1KLGA 1DQQA 3CDCA 1KB5A 5TQ0L 2F53B 1FYTA 4GLRH 4D0CA 2VISA 1H8OA 2OXGA 4NT6B 4NHCL 2HJFA 5D7KE 4M48L 4ZAKD 4F3FA 1KJ3L 2BNUB 4CNIB 2UVFA 5A3ID 5ECJE 4HUNB 4UBDC 1NH6A 3AROA 3FKUS 3FOLB 3W5MA 4PJFE 2BRRL 4MXWL 5CFHA 1I1YB 4L4VA 4HUWB 3V6BR 4KHTH 3ZT5A 2Z8SA 1QACA 3PJSB 5TGBA 5I18L 5LQBL 1HHGA 4GMSL 3DUSB 2MOVA 3EOTL 2LU4A 2PXYC 3QUYC 1BQHA 5CJ5A 5E6ZA 3BW9A 1MJ8H 4PJIA 3DBXA 1ZHBA 4KXZH 5DC0A 2BVQB 2V2WB 5EUOF 3GGWA 1BX2B 4F7CA 3EIFA 4ZFFB 2ZSVB 5CD3A 4EUPG 4HW6A 2BSTB 2F74A 4NO3B 3LQZB 4PPTA 1RMFH 1XEDA 2FGZA 3VWKD 1DLFL 1NMAL 4ONGH 5L7XL 3ILPA 5BMFL 4FFWC 1BFVH 5F21B 2UV3A 5HHXH 5DJ0B 1NGYA 2ZJSH 1D5IH 1JGDB 1WZMA 1RJCA 3SCMC 4IRSA 4H25A 1M7XA 4C58B 4NHUB 3HPJA 1ZANH 1U8KB 4U1LA 1NUDA 1CWVA 3GSOA 2VKXA 3K74B 3OQ3B 3BKCL 4ZNCD 1MCKA 1LWRA 5C0BE 2BSRB 5DD0L 5FO9B 1AC6A 3ROOB 4QOKB 2EYTA 1KV3A 4JFZL 3VXPA 2BDNL 4JFDD 4RAHA 2MMXA 4YE4H 5CS7A 3QIBB 1MJJB 5D7JD 1TTFA 3OJDA 2ZNXA 4U6HB 3UBXI 4RBPK 2RR3A 2PYED 4U0RC 1CDJA 2GUOA 5GSRA 3QUKB 1GC1L 4LBEB 1NCAL 3LRSB 1ZLVH 1W0VA 4MA3B 4ZO7A 5CILH 1QFWH 2XV6B 2GSGB 1TVDA 2V2XA 2OK0L 4P46C 1S7WA 2D31A 4NT6A 5DJAB 1CGSH 3HAEB 3L95B 5CKGA 1D5ZA 2P47B 4KRMB 4LVHB 1ROWA 2BNUA 4I9WD 4ZO9A 4CNIA 1RK1B 4O2CB 1ZT1A 5E00B 1AXSB 1G9ML 3H0TA 4M43H 4EBQH 1J1OL 1GH7A 1BZ9B 5CUSL 4ZG1A 3VFWB 5H8DA 2JIXD 3DSFH 4HUWA 5IK3A 3T77A 5DFVD 4S1QL 1LE9B 3MGOB 1D5BA 4JGJA 4ZUTA 4BUHA 1DBKL 3B2VH 2FRGP 4OLVL 2ERJB 1JNHB 4PJ7A 2VLRA 5GSVB 3MRCB 5HGDB 3I85A 4LCCB 3LQAL 4KDTA 1XIWC 1A9BB 1OOAA 3MV11 5I1IL 3ES6B 2IG2H 3DVNB 2EYSA 4U3XA 5FYJH 1EFXB 4ZFFA 1J8HA 4JJHA 1I8IB 4ORZC 5FA4B 1IL1A 3D39D 1S3KH 3LQZA 3RGVB 1KOAA 1AY1L 1G84A 1JPST 3C5ZB 4JRYA 4HKXA 4RMTA 1ZLSH 2BSSA 4JY5H 3TC9A 2MFNA 4NHUA 2FL5A 4JM4H 4Z7UB 3ULUE 1GL4B 1QSEB 1YEKH 2ED9A 1YNKL 4ETYA 4OAWB 1CLOL 1CLYH 3LD8C 4WWKC 1PGRB 2VR4A 1YC7A 2DQUL 1FL6B 2W0LA 2H32H 2GFBB 3OKMB 2BSRA 4KFZC 4F7TB 5FO9A 3V8CA 3WKNA 3ROOA 4QOKA 2HT3D 4Y4HA 1AGEA 4YPJA 1DSFH 1KEGL 4XXCC 4DJMA 3BPCB 3QIBA 1MJJA 5KN5A 4NN5B 5J0BA 5C0JA 2XWJA 1YMMB 2EO1A 3O8XD 3SJVE 5JA8B 3ILQD 5INCB 2QSCL 4L9DA 3IU3A 3MV9E 2R69H 1EHNA 3RWGA 2DD8H 2FZ3B 3SE3C 3FN9A 1KIQA 5D93C 1KIPB 4BQ6A 4UTAL 3QUKA 4MA8L 1FLTX 4Y1AD 1HIML 3HE6A 1Y6KR 2FJGB 3OXRB 4JB9H 1QFUH 4X7EC 1BQLH 1IGIL 4Q0XL 4L8BB 1MJUL 1Z9LA 3KYKL 4IRZH 4X4XB 1GGYA 5ALBH 5CLWA 3V0AC 1E4WL 5BS0D 2GSGA 3IVKA 4KI5C 4AEIL 4YHYB 5HDLA 4P49A 4MZ2A 2BOBB 3HN3A 5HTSA 4Y0GA 4GAYA 2FJHB 4K55A 4TSCL 2CUHA 4MJ4A 1U8JA 1SEQL 3FQTB 2XA8H 4PRIE 4OM0H 3ARUA 1AXSA 3WCYA 3VFVB 1YEDA 2IPKB 5JLZB 2NY2C 4DW2L 2DIBA 3WIFB 5I19H 3VFWA 4BSJA 2VQ1B 4JHWL 4YK4B 5EZIL 1A7NL 1A1OB 4U3HA 4J3OC 2BFVL 5KVEL 4LHUD 1IKFH 3MC0A 4JDTH 1GGTA 1HXMB 3EHBC 5BQ7A 5HGDA 1LO2L 3MODL 3MRCA 1ADQH 5KS9B 2BNQB 3DMMA 5FYKU 2AXFB 3QIUB 4MCYB 1S5HB 4PP1D 1ED3B 1MAMH 3HB3D 4JLRA 3MV8E 3VD7A 3L3DA 1U58B 1YC8A 4B7IA 1HHKB 3C60A 2DB8A 4ZD3H 5E99L 4OZHF 2XACC 5J6GA 4NQEE 1FFOA 4GH7B 2EC9U 3QDJA 3F7YB 3SGKC 4Z7UA 4YGVB 3ARDC 3NGBC 2XXCB 4L3AA 3TVMD 3O6KH 5J13C 3FAWA 1KJVB 4EEEA 2VABB 4PLKC 1FL6A 1AKJA 5KVFL 4RBPH 3ZTJH 3OKMA 3WXWH 2DKUA 1J1PL 2VDPL 1NDGB 4PJAF 3RVVD 4LDEB 5DWUL 3VRJB 4YAQB 3K8MA 3M1BB 5DS8B 2E7LC 3ZZ1A 2PCPB 1SM3H 3TEUA 5E8OB 3GM8A 3BPOC 3GMMB 4PJDE 1A7PL 2VLJA 2F5BH 1KIPA 1FV1B 5F3HA 2E9BA 3TT3H 4DGYL 4NNXB 2PKDA 2O61B 4NSKB 4P2RD 3D48R 4Q74A 4ZYKB 2QR0B 4NRZB 2JELL 5FKAA 3R0NA 1F3DH 4X4XA 4P5TB 4ZOBA 1KLUA 1MLCB 3H9HB 5MEQB 2Y36H 3O9WC 1N5YL 4XRCB 1JNLH 1QQDA 3THML 4LIQH 1MUJB 5FUZH 2X70B 1RJYA 4FQJH 3WFCH 3FQTA 3KHOA 2EYRB 4LLYA 2LAAA 2RJMA 4KI5F 2CQVA 3D25B 4WUUB 2Q8BL 5DYOB 5BV7C 3HG1B 2VQ1A 4P2QE 1JGEB 3JVGC 4ZTPL 1G7IA 1A1OA 3DETC 3BMVA 3RAJH 4F15B 4W4OC 1MCEA 1BOGB 5KOVC 2IFGA 1JZ4A 3GSWB 4K9EL 2ADFH 5TDNB 2MPAH 3FL7A 5KS9A 2FX8H 3H3KA 1O7VA 2WWMD 5FO7A 4ZUSA 5HYQA 4PRBB 1TENA 5HSFA 2ZPKH 2OMBA 3QIUA 1RZKC 5BZDB 1T89A 4HBCH 3BYYA 3BUYB 2BVPA 1S5HA 4LSQH 3TJHD 5J1SC 4N9GB 1ED3A 3I84A 1QLFA 2HA1A 4LPXA 3WD5L 1QKZL 3O6FB 3U4AA 4JKWA 2C4FT 1HHKA 2GEEA 4ONFH 2R2HA 3WV0A 2NXYC 4JPWH 1NAML 2NY0C 2GJ6E 2A0LD 1MREL 3LN9A 4WI6A 1T1XB 1JPFB 5TPWH 3DGGB 1XGYH 2F8OA 4EOWH 1FC2D 4GBXD 3VI3E 1KXVC 4FMKA 4Y5VB 1GGUA 2XRAL 2EDTA 5ICYB 1OPGL 3O2DL 4D9RD 1U6AH 3G5ZB 1OGAA 3P30H 1A7BA 1Y0LB 1U8MB 5IHBA 2ZCKH 4OLEA 5DS8A 3C9NB 1ZSDA 1NMBL 3KR3H 4Y4FA 5DZNA 2JCCE 2AK4B 2J2ZA 3DUUA 5LJYH 3JSSA 3PF2A 4NGHL 2JB6A 4YHIB 3MRPB 4Y16C 5AD0A 3GMMA 4OCRH 1IAMA 2EDLA 4M7KH 2HT4D 4XC3L 4JN2B 4UTBH 3VFGL 1FV1A 5EWIL 1EJ6A 2EC8A 1CIDA 1GAFH 2CMRL 3MBEB 4NSKA 4XCFL 1B9ZA 5TQ2H 4X0KA 2BVEA 4LCUB 2BCKA 3MBXH 4KUZH 3VRIB 2WMPA 4XVSH 4H8WL 3H9HA 5L2KA 5HHOB 1BAFL 3QEHA 5D6DA 4F57H 2EDYA 1NLDL 3HFMH 4U7KA 4K7FB 1MELA 1G6RH 2D4FA 1T0NB 1JMXA 3LKSA 4N9OB 4UDTA 3RY6C 3Q6FB 4XWOD 2HLAB 4EVNB 4WUUA 5DYOA 2AJVL 3QJHB 5AWNL 5I1GH 1WGOA 2W9EH 1JGEA 1FFPB 4BZYA 1XGTB 4DKFL 2FATH 5J6HA 3RA7H 4HIXL 3BAEL 3SEPA 4MA7H 3GSWA 3KS0J 2GTWB 4XMLL 2XA3A 4J12A 3VMPA 4NZTL 4PRBA 1OCWL 3MLPA 3BUYA 2YRLA 1U8PB 5LKNA 5D2NE 3WS3B 4OJFL 3T0EC 3STLB 4QY8A 2K7QA 4WO4D 3FRPG 5DHXB 5CP7B 3BE1L 3MLTB 3ULSB 5ID1A 3G04A 4MNGA 4LU5L 5GJSH 4KK6D 3LS5L 2VZ1A 1RZJC 3P0YH 2OR8A 3E1F1 1CZ8H 3HNTH 4BUGA 2MSPA 5KSAD 4Y5XB 3B43A 3WHE1 1JPFA 1MCRA 2P49B 4X4YB 1N8ZA 5FB8B 5C09D 4AH2B 1HE7A 4WDIA 4MNQD 3GSNL 2HRPH 4DGIL 2A73A 1S9XB 1QFHA 2QQLH 4ISVB 5DJZA 2VLKD 2NXZB 2H26B 1Y0LA 1U8MA 4K7PY 1RI8A 3TFKD 4RNRA 2Q8AH 4O2EB 3C9NA 5CGTA 3F62A 5I74B 1IGJB 4L9LC 2AK4A 3B9KB 1KN4L 2DL2A 4XPGH 1KEMH 3AREC 1D5XB 3MRPA 5DXWA 3HE7C 3BZEB 1G1YA 1T1YA 2BVUA 1EO8H 2YUWA 5IIEA 3PHQB 3TNNB 4HZAA 4JN2A 4YHNB 3P3YA 2H2PC 4AL8L 1YYML 3QUZD 4GAFB 1K8IB 3UC0L 4ZUUB 3TJEL 2FH8A 2JB5H 1RUAH 1HWGB 3MV7A 5FYLE 1RFDL 2X1XR 2DJSA 5DK2B 4PS4H 4XPBH 2NY6D 4JR9L 4C83B 4MVBD 2YPLB 4DEPB 2B0SL 2ZUQB 2UUDK 1TFHA 4XT1C 1S9KC 5DGQA 1RHHA 5F71A 1CD1B 2X42A 1T0NA 3Q6FA 4WEBH 4EVNA 1WC7B 5GRJL 1LILA 5GHWH 3KPQB 3D18B 2A83A 4A2LA 4KJPC 3NFNB 1XGTA 2EH7H 4PJ5B 1E4XH 2DTML 4MQXC 4OGXL 1NGQL 4ODHL 4KV5F 4PRPB 2OCFD 3TN0A 1A4JB 4YQXL 3GSVB 5D5MB 3MRIA 4RMUA 1V7NH 3OKEB 2CIIB 5TFSL 3VFTB 3OF6D 4HJGB 1WFUA 2C3VA 2Z31A 3QDGE 5GGVY 4UBDD 1JP5A 2P5WD 3BP6B 1TITA 4XMKL 5B38G 4HF5L 1F02I 1YNLH 4OCSH 4V2CB 1IAOB 2PW1A 1M05A 3BIBX 1CGUA 2GCYB 4GRWB 1Q94B 2OJEA 3IJYB 5CP7A 4XP4H 4U6TA 2X5PA 3SDAC 3W9EB 4HAFA 4KHXL 2WSKA 3PDOA 4NCC1 5HYJA 5DUBA 1IGTB 4G8IA 2PXYD 3QUYD 1KXTB 5F88B 4FQIH 2B1AH 1UG9A 4PLOB 2NYYC 3S34H 3ULVF 3KPNB 5K33A 1TQCB 1H3PH 4J3SA 4KKAD 2VERN 4ZDHB 4C54A 1G7QB 4TUJB 4QT5A 3OHXA 1Z0NA 4DZ8B 4NZRL 3FQNA 3MA9L 4DVBB 2H26A 5HXMA 3A6CH 1H8SA 3O2WH 4PJBF 3VA6A 4O2EA 1IAII 4DK3A 3QAZB 2PNDA 4FFWD 2DDQH 3KYMB 3A6BH 3B9KA 3DGCR 3K2MC 2WIIB 1BGXH 1QR1A 2XNAB 1V3KA 3SCMD 4P3DA 1KCVL 5KAQG 4KPHL 2EKSA 3MFGB 5K9QG 3FO1A 3VW3L 2IFFL 1LO5A 5DRNB 5IW6A 2O5YL 2Y5TB 3KJ6L 4FABH 1T0MA 3KPRD 1PZ5A 1K8IA 4GAGL 1WVZA 5E4EC 4YXHH 2HTKD 4XNXL 2BMKB 4UNTA 3QDMB 4Z0XB 3IDXL 2SEBA 5DK2A 4OV5A 1VGEL 2WK2A 3IXAB 5EU6A 3LEVL 4C83A 4MLSA 2YPLA 5HGGS 2FR4B 5ITBL 4PRAB 1QOKA 5SWSE 4IJ3B 4Q9CA 2KBGA 3D0VB 4G80B 4LFHG 1CD1A 1CGTA 3ME0A 3X17A 5MHSE 4NQSB 4OUOA 4JO4H 4UU9A 3VXQA 3HR5A 4R7NA 3LKOB 1OARL 1LEGB 2Z35B 5ADOH 3ZSTA 3NABL 1W8OA 4WI5A 3VXUE 1T2JA 1NGWA 3V2AR 4PRPA 2CKBL 4WUKH 2AXGB 1FNHA 3FQWA 4HK3J 3GKWH 1K2DA 4BFGA 4GS7C 4Q9BA 5C0CA 5D5MA 4P46D 2E9WA 2R0LL 3Q5TA 4XC1L 1VPOH 3VFTA 4HJGA 3IFOB 1AI1H 5DHVH 3T4YB 3PL6B 2DQEL 3TBTB 4JFPB 5DRWA 2XPGB 3VCLB 2HH0L 5SX5K 2NZ9C 2YUXA 1C5BH 3FFCA 5M95B 3NCYP 1DQJA 4O02H 4CL7A 5FGCB 3FB7B 3TYGH 4FNLL 5GISH 1LO3L 3IJYA 1NCUA 3MRGB 5T1LA 3WIHL 3W9EA 1R24A 5HYSA 4LLAA 3PP4L 1IGYA 1MCPH 2NW3A 1QA9A 2P7TB 1MIMH 5AYUH 1BLNA 5I1EH 5DHYB 4YPGA 3S4SG 4ZO6A 4FQPA 4Y4KB 1FL5B 5C0AE 1OM3H 1XIWD 5F93C 1VGKB 3KPNA 4RISL 5IF0A 4ZDHA 5I66A 3AMKA 4HS8H 2DLHA 2W07A 3UTSD 1PLGH 3NZHL 1WAAA 3CDGA 3HC4H 3T0AA 4TTGA 5F89B 3B3IB 4M1DH 3DXAE 3ESUF 3FHAA 5TE7L 3H9SE 1L7TH 4YXLH 2WIIA 4BSVA 4Y5YB 2X2YA 5C7XH 2ICWA 4PJ9B 3U1SH 5JOEA 3EOBB 2Y5TA 5D71H 1KJMB 4N0FB 3GSXB 2YPKB 2NR6C 1A2YB 1LDSA 2DQIH 4WWKD 4X80L 4LLQA 4Z5RA 4Z0XA 3S98A 5C9JB 2DLTA 5IWLA 1F90L 1UFUA 1IEBB 2E7BA 5DO2C 3GRWH 4DTGL 1AP2B 1IKNC 3EW3B 3T0XA 3V6FA 3N1FC 1MI5B 2H32A 1S7VA 4PRAA 3ULVE 4W81A 4MLIA 5KSBB 3R8QA 2AGJL 1FSKC 1YJDH 3VXRB 4HXBL 5I71C 3E0GA 3ZHDA 1XF1A 4PJBE 2YK1H 5JXED 2X4NB 4N5UA 5IJKA 3TIEB 3ARBB 3UJIL 4KI5D 3BRGC 3BWUC 5JW5A 1VKXB 1UYWL 3L5HA 1RZGB 3NIDE 4L1HA 1AJ7L 5INDB 1U0QA 4XP9L 4KROC 3T2QA 1S78D 1T3FA 4WY7L 2FWOA 2NY2D 3GBML 4U6VH 3D87B 1KC5H 4FFYH 1LP9B 2A6DB 3U7AA 3GSNB 4JQVC 1FE8L 4G5ZH 4CBPA 3BP5B 2VDRH 3MNZB 5E8EB 1FAKT 3O2DA 4QGTA 5CBEB 3TZVC 2P7TA 3QQ3A 4JDZB 3MXVH 5DHYA 3EHBD 5SWZB 5KSVA 4LSRL 4JQXA 4V1DA 2GY7B 3ZKMC 1FL5A 4HJ0D 1LEIB 4NPYA 4IEFB 3R4DA 1G9NH 4RWYH 3TH2T 5L8LB 1I8MB 4MD5A 5IT2L 3OV6A 1HQRA 1FPTL 3PHSA 4J3UA 1BBDL 1KGCE 2IANA 5F89A 3RNQB 2YD4A 1I7ZB 4PTTA 5HI3C 1VFMA 1F58L 1JPGA 4HBQA 5E9DB 3GSUA 2NX5B 4NZUH 4NNYA 4DVRL 2VZVA 1YY8B 2C9AA 1BJMA 4WU5A 3NFSH 1WFTA 5TH2A 3VXMB 4Z7OE 1UZ8A 1MQ8A 2VC2L 3PQYA 3KPOA 3ARDD 2HMIC 5FECB 1KJMA 2F5AH 1DQTA 3H7BA 3ZDYF 1H5BA 4K94L 4PLKD 5CJOH 2WNGA 5C3LD 3UBXB 5C9JA 1EGJH 1IEBA 1OTTC 4GW4A 5F7YC 2GT9B 2J8UF 1IM9D 2XY1A 5GS2D 4LEOB 1JTTA 5AZEH 4TNWF 1QO3A 4Z78B 1G7HB 5KSBA 5CIPH 4J3TA 1T7VA 2OR9L 3JV5A 4XBPB 5D7IE 5FAAA 3VXRA 5F7EL 5GGSA 2F54D 4U0QB 4PRDA 1ULVA 2CK0H 4FQ2L 2XWBB 5DJYB 2M8XA 2W65A 5BRZA 5SX5H 3JUZA 1HSAB 4P57A 4AQOA 1WZLA 3BSZH 4RMSA 3CXDL 1VKXA 1VHPA 4R90H 1HXYB 4HC1L 1U41A 1RZGA 1HILA 5EPMA 1QZ1A 1B0RA 1J5OH 4NRYA 2FX9L 4XMPH 3PWPA 4X7SL 4MB4A 3CFBB 3WFZA 3I2CH 2XTJB 3NCJL 4L3CB 1LP9A 2GY5A 4D2NA 5E4IA 4PG9B 5E8EA 4XCCL 4FMFA 4PJ8C 2EDXA 2CJUH 3MUZ1 1P84K 5GRUH 3UDWA 1FVCB 4K3DH 1JI2A 1LEIA 2RHEA 1NKOA 4TSBH 4G43B 4X7FC 3T2NL 1UCBH 2CLVB 3MLUH 2ZNWA 5FM8A 1W2KT 3OZ9L 1CS6A 4IMLB 4JPVH 2CRIA 3H42L 1RIVL 4FFZL 3RWIA 4XTRC 2C3WA 4PGBB 3VH8B 2EH8H 4R4NC 2VDLL 3TCXA 1WWAX 4LNRA 3W5NA 2ORBH 5D2LA 2NY0D 1YY8A 43C9A 4G9FB 1FGVL 4P2OC 1DQDL 2HVKB 4H26B 1QBLH 4YHKH 2EIZB 4KRPC 2DM3A 4U49A 3C08L 3F65A 1NJ9A 3U82B 3RUGB 5ACMA 1B6UA 1NCWL 5BCAA 1X5YA 5F6IB 2L7UA 3SY0B 1A02N 4OT1H 2KQNA 3UBXA 5C0EB 5D1QC 2DQCH 2GJZB 2GT9A 4XHQA 4MA1C 1H3WM 4OZ4A 2VRAA 1FYTE 4Q9RL 1SYSB 1RIUH 4R2GC 3I50H 2H9GA 4Y16D 2IPTH 3RL2A 1YDPA 5CHNB 2CKBB 4WEMB 4M93B 3V0WL 5T1KB 2Y7QB 5JOPD 1R3JB 1MEXH 5F1SA 1MNUH 4NP4L 15C8L 5DJYA 4ENED 2DQTH 5DMIL 4TOYH 1HSAA 4CKVX 4HT1L 2R56L 1RSFA 1BVLB 3K2UH 4U1MA 1YUHA 2VXUH 3SDDC 5CSGA 1JWUB 1MCBA 1HXYA 1TVBB 2R4SL 3ARFC 1HHHA 3DVFA 2COQA 4YZFF 1GGBL 5D7SH 2E8YA 1UXWA 3FOMA 4P9HL 5B3JE 4C56E 3H3PH 3G08A 4E41B 4JHBA 4TSAH 5GIRB 4BK4A 3C87A 3N1QC 1QSVA 1YEIL 1EJOH 5KAQF 4GW1B 1J8KA 1UM6L 2ZOLA 3G9AB 2YR3A 4DAGL 5IG7B 4TULH 1LMKA 5DD5H 4JHAL 4Y19D 5GQBA 4ACPA 3S88H 2IC2A 1OF2B 1SJVA 4A6YH 5IKCB 3WUWG 4WFGE 4G43A 5SWQA 4K23L 1RUKL 5LBSL 3T0ED 5JMRA 5T1DL 3WKML 3JZ7A 4ODXA 3BX7C 4M3JA 3JWDL 4KC3B 3RJQB 1PDKA 1D5MB 3VH8A 3BPLB 1TPXB 4HKJA 4OCWL 1OL0A 3FCTB 4K3JL 1RJLA 5CKAA 4KY1H 3VGGA 4FQXD 4KJYB 1L9MA 2VAJA 2HVKA 1NL0L 1BPVA 1QEWB 4ODSL 1P4IL 3LKRA 4H26A 3LSOA 4B0MM 4U6YA 4NM8H 3RUGA 4X83A 3OR7B 5DK3A 4OSUL 3T04D 4GMTL 1MRCL 1PVHA 5CEYB 1CD8A 4H5SB 1IAIL 3Q1SL 3EDEA 4QRUB 4MAUL 5FYKD 3CVHL 5A2IH 1IMHC 4KDVA 3ARED 3QCUL 3HE7D 5CHNA 8CGTA 2OJZH 2W9DL 2IMMA 3HRZA 4PRHD 5T1KA 2Y7QA 1EMTL 2H2PD 4LSSL 4GRLC 3MYJA 2F8XC 5AG9A 2IH1B 3CVIL 5F1IB 5FEBA 3KWWB 1YEFH 2BHUA 5CEZE 4HV8A 1MJ7H 3VI4F 1FVDB 3NPZB 3GMLB 1BVLA 4ZUVA 3QZWA 4UILH 3U79A 5HHPA 2AJZB 1ACZA 4WTZG 4XP6L 1ZGLP 3WIHA 4LCWB 1MFDH 2VLRE 2A77L 3CZJA 4PJ7E 4GKSB 5E8DH 2JJUA 1HINH 3T09A 4TUKH 4E41A 1OAUL 1XH3A 1B0GB 3BP7A 5AAWA 2RFXB 3T0DA 4WJ5B 5C92A 1J8HE 1FBIH 4AG4L 4KJPD 4JM2B 4JFOB 1XCTB 5JZ7C 1K3IA 4QF1A 4MQXD 1ZHKA 4YHOH 3QUXC 5E6IB 5DRZB 1BF2A 1U8HA 4N1CA 3QJFA 5IKCA 4M7ZB 2M26A 4GSDL 4Z76B 2VLMD 32C2A 3CPLA 4NFBA 2AJYH 3VFSB 1FZOB 1OAKH 3AAZB 1DBAH 2BNRA 1FZMB 3REVB 1YPZB 4S1DC 3SDAD 5GRXG 4Z7VA 4QOKE 5MI0C 4ZXBA 1EUTA 5L8KB 1NBVH 4S10A 1NDMA 1QEWA 2Y5EA 4LHQB 1S7QA 2NYYD 4LARH 2V6HA 5T5FL 3BESR 1JNJA 1FAIH 2C4FU 5C6TL 3EDFA 3VFNB 3O6FC 1MFCL 1SJHA 4ZFGH 1MF2H 4BSWA 2VXQH 3OR7A 2Z92A 1WWCA 2IGFL 3NIGE 2H3NA 4LK4A 5CP3H 4ZFZB 1DVFC 4JPKH 3SDCC 1AO7A 4MWFB 4JFHE 4R26H 4L8DA 3U7YL 3I6LE 3WUZA 2CH8A 4WRLA 2EXWC 1K9TA 1DUYA 4LRNL 3L1OH 3Q3GB 2CXGA 3S5LG 4MS8C 3CD4A 4HDIA 4X8JB 1SY6L 1U2HA 1JK8A 4KHTL 3N1GC 4KK9C 1KG0A 2DYPB 2IH1A 4NQCD 3KWWA 3BQUB 3BH9A 4PGCB 1KTRL 1A21A 4AEHL 3ULUH 4ELKA 4L8SA 2CGRH 1Q0XH 1CICA 2W91A 1G7JB 1MJ8L 1AGDA 1I7RB 3MLYL 1UJ3C 3GJFA 1BIIB 1DANT 1MFNA 3HZKB 1U9KA 1EBAA 4YHZH 4U1GC 1FN4A 4H1LB 3IFNH 1G9MC 5IB5B 4RGNB 4U2ZA 5D1XA 4ZAKB 3RZCC 1NFDA 3QFDA 3DX6A 5DTFB 3CFIC 4JM2A 4K2UL 4ONGL 3RVTC 3ZKND 1BFVL 1JV5B 3MRQB 1PQZB 5CMAA 1D5IL 3ZKXB 3QG7H 4M00A 5DRZA 1ZANL 1EX0A 3V4PL 3QDJE 2XZAH 3K7UA 4OBRA 4I0KA 3ZMRA 3L5WB 3O6LH 4Z7UE 5EBGA 1QBBA 1IARB 3RNKB 4W70A 3U0TB 2NZ9D 5JO5B 2YA0A 2YWZA 3KGRA 3VFSA 3AAZA 3WHE0 5EOTA 1FZMA 2QHRL 5E2TH 4E42A 5D7LD 2A9NH 3TWCH 1LD9B 1FNFA 4GKZA 2VR5A 1A3LL 3A6OA 4CW1A 1YMME 1MHPH 3VWKB 3ZYZA 1YNTB 2NLJA 1QD0A 5HY9B 1IILE 2VLJE 5ISZD 2J7LA 2APXA 4I18A 1S9VA 2NMSA 5DVMA 2W0KA 5CILL 3V9FA 5DK0B 3MTRA 4ZFZA 5EU5B 2VZSA 4NWUH 4DKEL 3LOWA 5JR1H 4XNMB 1MCLA 5I1KL 4POUB 2HG5A 1CGSL 2AJXH 3QPXH 3Q3GA 4NFDA 4EBQL 5FUOH 4JFDB 5EU7C 5FOJA 4X8JA 1XF3A 4HC1A 5J1AA 2I5YH 3BQUA 2YN3A 1OSZB 4PGCA 5ESVB 3DIFA 3G6AB 1B0WA 1DUZB 3P11L 2PYEB 5DO2D 5GGQH 3DV4B 4N0RA 2BK8A 4M6ML 5TE4H 1KCSH 1G7JA 3CLFH 3H9ZA 5C08D 5IR1A 4LRIC 5KS9E 2BNQE 5HHVH 3QFJA 2HFFB 4YNYB 5C0FB 5IB5A 3SDXA 4YR6B 5DTFA 4X6CB 1INQB 1T7WA 2D4DA 2ICWJ 1IQDB 3ZTNH 3MRQA 1I85C 1PQZA 1RUQH 2HJLA 1OP9A 2RBLA 3O3UN 3LH2L 3VDAA 4Z7NF 3U6RB 4D94A 3LN5B 2JIXB 4R6UA 1RURL 3QA3A 3P0VH 1YEKL 3P4OA 4DCQA 1F3JB 3WE6A 4OUUB 5JIPA 3ELAT 4JO3H 3FQRB 3OKOB 3UTQA 2YD7A 4KROD 3GSRB 3RNKA 3U0TA 5DRXB 4HCRH 2EE9A 1ZKAA 5D70H 5J06A 4YIQB 3ARTA 1A4KB 1T6VN 1MRFH 3CZFB 4X6EB 1I1FA 4F58H 1DSFL 1CVRA 5A2KH 4IM8A 3TZVD 3T1FB 2R29H 1QHOA 5F8RC 2G75B 1WEJH 4NUJB 3BJLA 3D39B 1CLZH 3TO4B 3ZKMD 3VWKA 1YNTA 5CCKH 3SE9H 5C0BD 1OLLA 3OAUH 3CVHB 3GI8H 3BI9X 3V95A 3PGFL 3H2WA 1A6ZB 1B3JA 1QFUL 1BQLL 4JB9L 4XI5C 4YDJA 5TDPB 5EU5A 3OKLB 4RFEB 5KSUB 2VZTA 5J3HC 2YD2A 2ZUSA 1NAKH 5HI3D 1MCHA 5A2LH 4HIJB 4QXTB 3ETBF 3LMJH 4EQ2A 3QIWC 3PDDA 4MDIB 2ITDB 1RUMH 4M7JL 2ZG3A 4NKOA 2D7OA 2HMID 2PO6A 3D69B 4JG1L 1J10A 1AXTH 2Z8WC 3G5YB 4U1HA 2CRYA 4W6WB 1VSCA 4WUUE 2YA2A 5DURD 5EBLB 1DUZA 4YFEA 1OTTD 2MQ0A 4JVPA 1PAMA 2Q76B 4RX4D 2APVA 5AZ2H 1LVEA 5GPRA 4F8TA 2YHGA 1QRND 2A6KA 3UYPA 1ADQL 2L0DA 1EGJA 2R4RH 4HFUL 4XGZA 4X9FA 5BS0B 1HI6A 5I6XC 4FTVD 1JTOA 2HFFA 1FNEA 4WW2B 5C0FA 3STZB 5T5NG 5BJTA 4WV1B 3VD4A 3F12A 4YR6A 3MROA 3VJ6A 4OF7A 4YLQT 5IBTH 4NC1C 1IC7H 1W72L 2AXHA 4KKCD 1I3GL 2MKLC 3L3OB 35C8H 3V5DA 4G6FD 1S7XB 4IJ3C 4WI4A 1KPRB 4NDMA 1VDGA 3TO2B 4BH8B 5C6PB 1U92B 3LN5A 4MNGE 2R1XB 1F3JA 3H9YA 3UJJL 1JHLL 4K9EC 5ALCL 3RQ3A 2BHZA 4DFIA 1HOCA 4FXLA 3SDYL 3GSRA 3LKQB 4LHUB 4NN6C 3MZGB 3S3JA 2CDEA 2NY7L 4MSWB 3WL9B 5I0DA 5LXGH 1EPFA 3WXWL 4X6EA 1T1WA 1BQHG 5DQ9B 3ULUD 1OSPL 5DJ8B 1JF1A 1BWMA 2YD9A 3BGMB 4QRQB 2A1WH 1BM3H 4PJ8D 1PSKL 4LKCB 4AIZA 4G6ML 3PGDA 2AK4E 3MJ6A 3TO4A 2F5BL 5D72H 4LFHD 3RTQD 1MHCA 2ADGB 4U1SB 2B2XH 3VGAB 5MENA 4UQ2B 3OMZA 3SJVD 5TDPA 1VB9A 3OX8B 4LSUH 4XTRD 1E4KA 3MV9D 4MJ6B 3TVMB 1BOYA 1DBJL 3GIZH 1CFNB 3MREB 3SGJC 2X1PA 5A16A 3MCG1 1JNLL 1WIPA 2WBJA 4LIQL 5HHOE 3EOAA 1H3UA 5I9QB 4GRWF 4P2OD 5FUZL 1I8KA 2APFA 2PYFA 4E0RA 4NOBA 3EO9H 2ITDA 3S37L 2WUCH 3J8F7 3O41B 1J88A 3OKDB 4XZUA 5ESQB 4KRPD 4HIIB 2B1HL 4JN1H 2CKNA 1FRGL 1JI1A 1U8LA 2EDHA 4PJEB 1C16B 3TM6A 3ARWA 3BVNB 2WLYA 3GMNB 5EBLA 5EN2B 3AY4C 2GIYA 3K4DA 4L3EA 4PRID 2UWEF 2FB4H 2MPAL 4P2RB 4H8WC 2FX8L 2R9HD 5HD8D 4R0LC 4R2GD 5CJBA 1FNGA 2YUZA 2ZPKL 1MIEL 1RIHL 2GK0B 4LSQL 1KPVB 3L3KA 2RB8A 1VFAA 5IGXH 2AJUH 1GZPB 3GNML 4WW2A 1JCKA 4OCXH 1X5GA 2DI8A 1A7OH 3MRKB 2I9TB 4KUCF 1XGPB 4ONFL 4XXDB 3VG9B 4RGMB 1KIRA 4H0GA 4Q6IB 4F80A 3W2DH 3UAJC 3ARGC 3D2UD 1KPRA 3TO2A 4FQLL 3WBDA 4EJ1C 3O4LA 3SDDD 5D8JH 4IMKC 5CJQH 4UV4L 3ARFD 5T3XD 5HYJE 1C5CL 3IDIA 3MV8D 3P73B 2IWGA 3EO0B 3LKPB 4M5ZH 5JA9A 4LHUA 1A3QA 3QHFL 1U6AL 1AE6L 5FYLH 3WL9A 1RUPH 4MSWA 3P30L 3PE9A 2YZ1A 4NQED 4ZO8A 3X14B 4Z7QF 4R7DB 1KCRH 2EDOA 2ZCKL 5DQ9A 1VEMA 2QKIA 3OB0K 3KR3L 2KL6A 3L3HB 2YEZA 2VL5A 3ARZA 3BRFA 1YN7B 4YC2B 4GG6B 3VDBA 2DM7A 4HHAA 5B8CC 3WS6C 3SOBH 3U2SB 4MJ5B 3FQUB 3UTZA 3T0WA 4M7KL 4R4FL 4UTBL 4DN4H 5LGHH 4HEME 1EZVY 4LVEA 2OL3H 4UQ2A 1TVHA 4JFFB 5FHAH 3MBXL 1DEDA 4QTIL 4Y2DC 3TV3L 3RWJB 4GBXB 2VJXA 3VFOB 1TXKA 3QHTC 1FO0L 4AT6A 2NY1C 4WU7B 4F57L 5K9KA 4IRJC 4XH2A 1NCNA 5BVPL 2YPLE 2CIKA 3WFDH 1G6RL 4UNVA 1H3XA 3O0RH 4OFVA 3IS1X 3DOSA 2I26N 1NUFA 4PJGA 1ZMYA 5I1GL 2ZUVA 4F8QA 3HS0B 3DX7B 1ZTXH 5ACZA 4QHMB 4PJFA 3BVNA 1F4WH 2UYLB 5C0GA 1CXIA 4WGVB 4ELMA 2X4SB 4OF5A 3BIAX 4OLYH 1J0IA 4LASL 1MCDA 3KYNB 4OGAC 4HPOL 2DI9A 4PRPE 3R06A 5F9WC 4OD1L 1B88A 1IC5L 5D5ME 3ZE2F 2APWA 3WN5B 1KPVA 5DJ2B 3ZLQC 4Q9QH 1NGPL 1C08A 1F4HA 2GYSA 1ETZA 3IDYC 1GZPA 4JO1H 4YEEA 1TLKA 3BHBA 3FFCE 3MRKA 4LVOC 2ID5A 1P4BH 1I9IH 4GRWE 5F1NB 2FD6L 3BN3B 4GFTB 3JV0A 1A14H 4OZGA 1UACL 1A7RH 2G5BB 4U6XA 5IMKB 2DL9A 4H88H 3MLRL 4QRRD 1BFSA 1MCNA 4BELD 3H8NA 5LAXB 4NJAH 3LKPA 4ZOEA 4PJHB 2W0PA 5I1JL 3UJTH 1I9JH 1MFBL 3UTTD 5C0NC 3O11A 3RX7A 4GXVH 2KZ1B 2MJWA 2GJ6D 3HNVH 4F9PC 3AS0A 1EEQA 1U3HC 2Q8AL 4IOIA 2ATKB 1IAIM 5JZ7D 1KEML 5I73C 1R0AL 5I1AB 4R96A 4MJ5A 3HMWH 4WO4B 3FQUA 4TUOB 4L4TB 2NNAB 5EUOB 1MH5B 3TYFA 4F9LC 3BN9C 4OF0A 5L8JB 4FQQB 3ZO0A 3MUY1 3MRNB 2DKSA 1BFTA 1Z3GH 4JFFA 5KSAB 1K5NA 4XCYB 1JWMB 3T8XB 1QSFD 4PS4L 4A2MA 1N0XL 5C09B 3QDME 1X5AA 6CGTA 4MNQB 4S1DD 4ODTL 3VFOA 3QI9D 5JQHC 3RWCB 4P23C 4QRTA 1HQ4A 4WU7A 4YHLH 1QYGL 2VLKB 1PX3A 4OGYL 3PWJB 4TN9A 1EEUA 1T1ZB 3TBSB 4PR5B 3C2AL 4RFOH 4YWGH 1T6WA 4XVJH 4S2SA 1TQBC 2J3SA 5JW4Q 5GHWL 3DX7A 5HHQB 1A5FL 3LAFA 4PD4J 3RPIA 1S5IH 4MAYA 2EH7L 4FHBD 4PJCB 2UYLA 1E4XL 3V6ZA 3SDCD 1DVFD 2X4SA 3TNMA 3VMNA 3MMEA 2K7PA 4WTXA 1FJ1A 3R1GL 2LQRA 1XF5B 3WJLA 5CP3A 4BM7A 4MZ3A 2EXWD 2VXSL 1W72B 4MS8D 3NFPB 1T22B 4OM1L 4HH8A 4NN7C 2NY6B 1NC2D 1YNLL 4OCSL 1IEAA 2VXVH 4YBLC 4KK9D 3IGAB 1MFAL 3L7EB 2HJKA 2BSED 5FGCE 4OTXH 3L3JA 2YRZA 4IRSC 5K59F 2YKLH 3PWNB 5DUML 1KTDA 1TJIL 4DQOH 5HGHB 4M1GL 4JZOB 3QYCA 3O6MH 2B1AL 1NBYB 3REWB 1KACB 4I5BA 1UZ6F 1HCVA 2ZSWB 3OB0H 1RPQA 3S34L 1XZ0B 4DGVL 5MP6H 3T65B 5DI8B 3WYRA 5CBAB 3AC0A 1XFPA 1II4E 4AENA 3TT1H 3LN4B 3RZCD 4K8RH 3ULVH 3CCHA 2IANE 2DDQL 2P5WB 1JZ2A 3BP4B 4AY0A 5I1AA 2NY3C 4NRXB 5DJ6B 4C57C 2MNUA 3GKZA 2XFXA 4L4TA 5I1CH 5E1AA 4OIIH 1WZKA 5EUOA 1FL3B 1HDMA 2X40A 5H94B 2XKSA 3E3QC 3PQYE 4YXHL 2X4TB 5I1HH 2PXYB 3QUYB 3DECA 1FZKA 1T5WB 3T8XA 2VZ3A 5BV7L 3UTPE 2DWEA 2X4OA 3KDMB 2EIEA 2NTFA 4WVRA 5KW9L 4HZLB 4XPTL 5C0DB 5ESAA 5CEXB 2J1KA 5DT1L 4BQ8A 3HMXH 3GUTA 4Q7DA 3CDFA 5F96H 2V5TA 1T1ZA 2AV1B 4JG0H 5E8NB 4F7MB 5KSBE 1RULH 4JAMB 2X1OA 1RZKL 2V7NB 2D7TL 5EO9A 3O3DA 3SKJL 4JFED 3S36X 3SCMB 3RI5K 3VXRE 4YFLF 2XICA 5EO0A 3PP3K 1NCBL 4FZEH 4LCYB 4N1EA 4WUKL 1OTSC 3UZQA 3KPRB 4G3YH 4KDTC 4N8PA 1FG2B 1F6AB 3LPGA 2UZIL 1MVFA 4XVUD 5IHLB 1W72A 1RV6X 4TRPL 3CC5A 1T22A 4OD2B 2BC4B 5DDHA 2OP4H 4EN3A 4F7EA 1C5BL 1QR4A 3QO0A 3CK0L 4PJIF 3X11A 1N4XH 3ECBB 3FB5B 3PWPE 1LNUA 5GISL 5IFAL 3L7EA 1G7MB 3TA3C 5L88H 1LP9E 3RIFK 2HLFC 3QDGD 4U0RB 5AYUL 3QEQD 4JGUA 1CDIA 4QCIA 5HGHA 5I1EL 3C5JB 4BKLB 1PW3A 2W60A 5JQ6H 1NBYA 5FK9B 3REWA 3RWHA 4P3CL 3QXAA 4YHMH 3T65A 1LO0H 4GG8B 1QBMH 4L29A 3SBWA 4KZEL 4HS8L 3NIFE 2NY5C 2KPNA 2WW8A 4P46B 3RIFF 3LN4A 3HC4L 3EUUA 5E03A 5JTWA 4P4RA 1L7TL 4LSVH 2WLZA 1ZVSA 5C7XL 1XF4B 5FCUH 3UX9B 4J23A 4J6RL 5DJCB 4CN1A 3HZVB 4NRXA 5DJ6A 1NFIA 3U1SL 5EOQH 5D2LE 3BDXA 1KFAL 1K8DB 3AS2A 3HE6C 3VXME 2B5IC 3FO9B 3ZHKA 1GYAA 4PJDA 1T4KA 1OD7A 5EH1A 1FO0B 3WO3B 4KQ3H 3T4AB 1WUNT 2DQIL 3QR2A 1K4DA 5HPOA 3D85D 1G6RB 1T5WA 4AM0B 1DTUA 4I0PA 1XIWB 3KDMA 3GRWL 3GMPB 2AI0H 4HCRA 4XBEH 2CRZA 4JFXB 3EYFB 5DJDB 1UWEL 3OR6B 3EDDA 4IIQB 5BW7C 1QVOB 5GGRB 3ZE1F 3DSNA 1X7QB 2AV1A 3JWOH 5T33L 1DLHB 1OP5K 3JWNC 4EDWL 3MLVL 2IALB 2V7NA 2OTUB 3RKDD 3NAAH 4YBQD 4EI5C 3SCMA 5TJWK 1X5FA 3HNSH 4LLVB 4PJAB 4K94C 4P2QA 4WFFD 5J3HD 3MNVA 5HGAA 3LD8B 3HZYB 3DMMC 4WWKB 3VA2C 3RU8L 5D1ZA 1F6AA 1XMWA 3QIWD 2DMCA 4Q6YA 4JRXA 3QEUB 1CR9H 5LWYH 3G5XA 3L3GA 3QNZB 1CFVL 3QWOB 4U6VL 3C60C 1JZ8A 1QLRA 1KC5L 1C12B 5J4MA 4G5ZL 1OP3K 5DLMH 5ID0B 1TJGH 4IHOA 4AZ8A 4KRLB 5D93B 1ZA6B 4BKLA 3MRHB 2I07B 5GS1B 1E6JH 4Y8AA 1QNZH 5HHME 5FYKL 3KYOA 3QNYA 1HYSC 3M45A 4GW5A 5DD6A 3OKKB 3OB8A 4RAVB 1TZIB 4KQ4H 2DTSA 1Y18B 3MOBH 4U1JB 4R8WL 2XZQH 5C0AD 3FJTA 1DANU 4NJ9H 4HUXA 4I3GA 4XP5H 3F7VB 1XF4A 2NY2B 7FABL 2BY2A 1ZGLB 3GSQB 4G9FE 1K8DA 1TETH 1GIGL 5TDOA 4Q97A 5IVXB 3OPZH 3GMOA 4QRPA 1MRDH 3C8DA 4C4KT 2E6JA 2X4PB 5JHDA 1YQVL 1VEPA 4G8FA 3RUGE 2C5DC 1VEOA 3IJSA 2AEQL 4OZHA 1CFQA 4YX2L 2O5ZH 2WIMA 5AZEL 3EYFA 1YN6B 5DJDA 3PP3H 5GGRA 1X7QA 3VXSA 3P9LA 1M1SA 1DLHA 4OLWH 3QCVH 5F9JB 3FONB 3KAAA 3NA9L 1KB9K 2P8PA 3ZDXF 1CFTB 5AUMB 3UYRH 3QO1B 1LO4H 1N6UA 3W9DA 1UADC 4K8RD 2EC9T 4PJAA 4M6NH 1SQ2N 3ARDB 1BD2B 3NGBB 3BSZL 5J8OA 2ZZUT 5I30H 4R97C 2X89A 2XN9A 3QQ4B 2WINA 1TCRB 3O81A 1T89C 4YXKH 3O4OC 5C07B 3ZDZE 2R39A 2MWCA 3P9WB 5E95B 1BHGA 2OI9C 2IEPA 3C8KB 4OLUL 1QLEL 3DO7A 3QNZA 1IM9B 3VWJC 2X09A 4KMQA 5GGSY 4E41E 2DRUA 3HI1A 1CFSB 3VXOA 4W6XB 3AGVA 4N5ED 3BT2H 3S35L 4CGTA 4MHHI 3U46B 1ZA6A 1SBSL 3HI6H 2CJUL 2I07A 3X3GH 2RGSA 4Z0BH 2F54B 2J88H 4EUPB 4K3DL 4J3WA 4HKBA 5D7JC 2E9JA 4ZFOA 3T0VA 3HHRB 4JPIB 4KAQH 4XAKE 1UCBL 4RAVA 1JMZA 2ILLA 1TZIA 4P9HC 1BIHA 3O9WB 1HH9A 2YSSB 1BFOA 1R3KB 4HKZA 4Y4FC 1Y18A 1P7QD 4J1UB 1KNOB 3U48A 2ORBL 3ARGD 4NO0A 4JQIH 3FRUA 5MEOB 4WTWA 2PUQT 4AIXA 5BV7B 4Z7VE 5HBBA 3KXFD 4HS3B 4N0YH 1ZE3C 1QBLL 5HDQH 2AAVA 3X13B 2X4QA 2DICA 4ORGB 4EDXA 5HYSG 3JV6A 5IFHL 3OGCB 4LCIL 1YMHB 4P5MB 3M17B 1T5XB 4K71C 2R15A 4G6KH 4ODVH 1AO7E 5JDSA 1FVEA 1H3TA 1V3JA 2HFTA 1A3RL 1ZT4A 2QL1A 3I50L 1KT2A 1A6TA 3QHZH 4WIQA 1SYVB 5JUEH 4NKIH 5EZLA 5F3BB 2VAAB 3FONA 5GRZA 4XVTL 5AUMA 2NY0B 3SGEI 4L5FL 1CE6B 1QPPA 4G7YH 5FIEA 4WI7A 4OCYL 1K85A 4M7LL 4BK5A 1GOFA 3D0LB 4PP2B 3MLSL 1BD2A 4Y2DD 2DMKA 1T21B 5E7BA 2PTUA 1CTOA 4JZJA 3K2UL 2VXUL 1MHEA 3MRLA 1KTLB 1KF9B 4UIKH 1I3UA 2VDNL 2NY1D 3OWEA 5C07A 2VTFA 4IRJD 2YBRA 3FAXA 3LHPL 4RMWA 1NMCB 4KTDL 1M71A 1JWSB 4TYUA 2XTLA 4TSAL 1IM9A 3C6SB 4CVXA 1QP1A 4OI8A 2R1YB 1P4LA 3B9EA 1EO7A 1CFSA 4Y16B 3CSYB 3RWEA 1AQKH 1I1CA 1ZVYA 3UO1L 4G8EB 2WWKO 4D9QE 1YEEH 1DE4A 4I77H 5IQ7H 4OGAD 5EC2A 1A6VL 2X4RA 3NH7L 2CLRB 2GW5A 1A9EB 1DQLL 4A6YL 3ZDXE 3O8XC 5IFJA 3E6FA 1UKSA 3O9WA 4HFWB 5E08L 1R3KA 1BBJB 2G2RB 2B4CC 3ALXA 4J1UA 3BIKA 1KNOA 5FF6B 1JJUA 2N4IA 5T3ZH 3HUJF 1P53A 5E5MA 1YPZE 1AR2A 1WV7T 3HAEH 2EDKA 3VGDA 1CT8A 1JGVL 5HVFB 1NUGA 3X13A 2ZCHH 3T1WA 5FM5O 25C8H 5E94B 2XKUA 4WV1C 3LDBC 5E1HB 1R5VA 4NCC2 4Y19B 2FIKB 4MGXA 2R23B 4ZNEE 3MRFA 2DWDA 4WHYH 2CLZB 1U3HD 1IT9H 3GK8L 3MYZA 4MCZA 3RWFB 1SEBB 5BO1L 1JGLL 3T0EB 4FQHB 3WLBB 1FCGA 4HMDA 4LLMB 3FFDA 1H15B 1ZA3B 3VXNB 2VAAA 1XR9A 4F7PB 1NC4A 2EDJA 3V6OC 1DDHB 1M7DA 1R5IA 4QXGL 5J9PB 2VMFA 3BN9D 4RIRB 1RZ8B 1CE6A 2JK5B 1FYTD 1YEFL 5D6CB 3TN0C 2FBJH 3Q0HA 1EK3A 4N0UA 3MOQA 4UILL 1KBGH 1N7MH 1PYWB 2AV7A 3RPKA 5IOPB 5FKPB 2Z31C 2DI7A 3RY5A 3VXUA 4HX1B 5ERWA 4APQA 2W92A 1CXHA 3S96A 3FT2A 3WNOA 4ESKA 5SX4H 1MFDL 4LPCA 3DPBA 4ZQKA 3D1MC 1HINL 3HZMB 1JIBA 5MERA 3PWVB 4L4VD 3C6SA 4L9LB 5IJVB 5JHLL 3VFUA 3QFJE 2QLVB 1P84J 2N7AA 2ATPB 3AREB 2J6EH 4QXUL 2W0FB 1CTNA 2C3XA 2ED7A 3HE7B 1T83A 4O00A 3SDXE 4RGNE 4JANA 4PRHB 4XNQB 5IB1B 3RVVC 4KMTH 1UWGH 2YMXH 3CLEH 4HK0A 2QSQA 1RAMA 5I1DB 4MXVF 3B9VA 1IRAY 5BXFB 3SE8L 5DD3L 1ACYL 2AJYL 1E0OB 2VB5A 3FO0H 1BBJA 1U93B 4OI7A 1HHJB 3ZKQD 4LEXH 3RY6A 3DXAA 4IRSD 4MJIA 4QYOB 5IVZB 3LS4H 4QHKI 3KVQA 4WW1B 1NBVL 3VD3A 3IF1A 4LARL 3TBVA 2BVOB 3PIQB 3INUH 1J9CT 4J8RB 4M9OA 1Q0YL 1MF2L 4N1HB 2VXQL 3EJYD 1N3NB 2YD8A 4R4BB 4M3KB 4I3SL 4EIZC 4KZDH 3ESVF 3I6GB 4JKPH 4NUGL 2FIKA 1QFPA 4PV9B 4R26L 1FHGA 1Z5LB 4LSTL 3K8KA 2IBGA 3VDCA 5K9OB 2XY2A 3IKCA 4FQHA 3WLBA 2FDBP 1WZ1L 4Q2ZA 4S1RH 3L1OL 3NACH 3VRLE 4LLMA 4ZPTA 5FHBL 1H15A 5EZJA 3UYOD 1FLRL 4LAQL 3SDAB 1NEZA 3WFBL 3SE4C 2WWMC 5IHUH 1RZ8A 3V4VH 2LTQC 3E8UH 2FGWH 1F11B 3BZFB 3FT3B 5C0IA 5EOCH 5JXAH 4PJBA 4PG2C 2DOCA 2VN7A 3ULUL 3MGAA 1PYWA 3MO1B 5IOPA 2CGRL 3VE0B 2O5XH 2VWEE 2N1KA 3QUMA 1RVFH 3TIDA 1EDQA 3MA7A 4YDKH 1YYLH 3RFZC 1Q9LA 5CEZD 4O5LH 3UBXG 4X9GA 1B4RA 1AD0A 1UEMA 5IJVA 4AEFA 1CCZA 3FQXA 3SQOL 4LPVA 1H3GA 4PRNA 4D8PB 1DL7L 5M7QA 1UB5B 4FP8L 4NIKB 3MRDA 2P4AB 3S36H 4I9WE 4X6CE 3LEYL 2VLRD 1QFOA 2DJUA 4NNPL 1OTSD 3QG7L 4RFNB 1JZ5A 1FGNL 5E4EB 1LK3L 4PJXB 4NQCB 5TQ0H 4AIOA 5IV2B 4JVUA 2QSTA 2Q7NA 4OZFB 3RGHA 5KVGL 1A6AA 1J8HD 1XAUA 2LU7A 1D6EB 3SO3C 4NHCH 4M48H 7CGTA 1S9WB 1KJ3H 2A6JB 2PTVA 3UZEA 1I8LC 4JRYD 1AH1A 1VCAA 2VR9A 1UJTA 5E2TL 2XZCL 2P5EA 1AIFB 4UT9L 4O2FB 4MNHB 5C0RL 1KELH 5EO1B 3PWUB 3RIAK 3WN5C 3JV4B 2R8SH 1G0XA 5LQBH 2YD1A 4J8RA 3EOTH 2VN4A 4Y2OA 4FS0A 4HWZB 5DSCB 4R4BA 5IWLC 1HSBB 4GS7B 3SGEH 2FYYB 4Z6AT 4NO2B 3WXVL 4RGOH 4Y4HD 2DMBA 2IH3A 3I6GA 1I1AC 4PV9A 5MENE 5JR1L 4I8DA 1MHHA 1G7PB 4OQTA 1SHMA 1G7LB 3EDKA 5FOBA 1D9KA 1T04B 4DOHB 3GI9L 3TH4T 1DLFH 1NMAH 5DD1H 3F7RA 1MCIA 5L7XH 1GZQB 5T3XL 5BMFH 3SDAA 3HE6D 5D7LB 5DUPL 3IETA 3IDMB 2I5YL 4MX7B 3VH8G 4MD0B 5IJKC 4KTEL 4K7PL 4X98A 3P4MA 5EIIA 4OZIB 1T2QL 5IESH 1BF8A 3W0WD 1N59A 3CIQA 1WBZB 3BKCH 1N64H 1Z2KA 1LK2A 5AG8A 5IQ9A 1X9QA 2AABL 5TE4L 3X3FL 5DD0H 2N7BA 4L3EE 4JFZH 4LSPL 1ZXQA 1I7UB 2D7QA 4WI2A 5JORB 1K6QL 3HA0A 3G6DL 3U36B 5IB2B 1JZ3A 1AHWA 2JJSC 5BS0E 4YDVB 4TVPD 5H2BA 5F9OL 2XKNB 4A6YB 5IBUG 4RRPA 3U7WH 4EI5D 3VGFA 3AM8A 1J0JA 1UB5A 5GXBB 4JY4B 1GC1H 1NCAH 3N85L 4HIEB 2B4CH 2HKFL 3Q6GL 3DMMD 2Z91A 2OZ4A 5DEFB 3TFKC 5IEKB 5KJRL 3I02B 4P59H 3HPLA 3O4LE 2E6QA 3I3DA 4OZFA 1HK6A 2A6IB 3MCKB 2OK0H 5C1MB 43CAA 3C60D 3LV3B 3O3AB 3QZWG 1OAZL 2QQKL 5C08B 3QUZC 1M7IB 1J1OH 3G5VB 2HFEA 4UT6H 1CD9B 2W9LA 3QDJD 1FSKB 4R3SA 3VGBA 5EO1A 3KPMB 1WAAF 3PWUA 4S1QH 5I71B 5GGVL 3LVEA 2BY0A 2E7CA 1UCTA 1DBKH 2NY6C 4G42B 3RX5A 2A9ML 3V5KB 1H5BC 4OLVH 1HYSD 2VQTA 4HXAL 5A2FA 1AKJD 1N5AB 1A6WL 3GI8L 3B5TA 1HKLL 3LQAH 1HSBA 3SQBA 4NO2A 5A43C 4XAWH 4BH7A 5I1IH 3UROR 3S8WA 1WWBX 1DQML 4HMCA 2MCPL 4KROB 2GKIA 4KWUA 1T04A 2OXHA 2FO4B 2VLJD 1NSNL 5LCVL 3WDHA 3LKNA 1AY1H 1TCMA 4PB9L 5ETUA 1M6OB 1QUNA 1A6UL 3OBAA 3QG6A 4HJJH 2ZP0T 4EI6A 1AXTL 1ITCA 3IDMA 3TZVB 4FA8A 3FTGB 4MX7A 1AC0A 4I48A 4AYFA 4PJGE 1YNKH 3P77B 3IJHB 4PJEE 4PJHF 2ADIB 2BOCA 1B6DA 1WBZA 3MPCA 3JBG7 2AP2A 5AZ2L 5GZNC 4ELME 3QPQC 5IMMB 1F4YL 4RQQB 2FSEA 4GJTB 1KEGH 1IZKA 3K1DA 4P2RE 3BO8B 2RAMA 1JYXA 1C8PA 5HVHC 3V5HA 3EBAA 3NZ8A 5IEHB 2E3VA 4C56A 3NN8A 2XKNA 5IBTL 1HEZB 5ENWB 1ZHNB 4KKAC 1OWWA 2OTPA 4MA8H 1HIMH 1HN1A 2J8UA 1XGQA 1Q8MA 3BWAA 1IGIH 1VADB 1MJUH 5IEKA 1E4WH 3CMGA 3I02A 5DURB 1GHFL 2F9BT 2X6MA 2A6IA 4OZGE 1KJ2L 5EC1B 3EO1B 1DEEA 4XCNA 3IFPB 1IKNA 4TSCH 1QRNB 3VWJD 1WCBB 3W82A 5LXGL 1SEQH 4RDQG 3IRZA 4U3CA 5C08A 1WBYB 1NLBH 1Z9OA 2HTKC 3B83A 4FTVB 3WEXB 4ODWB 5ICZB 3KPMA 5T1MB 5IMLB 4LLWA 4PJCF 1A7NH 5EZIH 3RL1B 5IMOA 4GG6E 2BFVH 5KVEH 2D9QB 3Q5OA 3LB6C 2JJTC 3GMRB 1OGAD 2QQQA 4DZBA 5FDWB 4G6FB 2AKRA 1LO2H 1XGRA 3MODH 4YHPA 2A74B 4X5WB 2AEWA 2L4OA 2KZWA 5CZKA 4LSUL 4Y4FD 1RZIB 4JFFE 4ETQB 2X9WA 4W68A 4D9LL 5TE6L 1KPUA 3FT4A 4XNZC 3CX5J 1JZ6A 2V9QA 4PGZA 2F53A 3EO9L 4LOUD 4JQVA 2WUCL 1JPSL 1L6XA 1CQYA 4JN1L 4PJ8B 3FTGA 4CJ1A 4NQVB 3MJGX 5GS0H 1KXQE 5EBMB 2LVEA 3P77A 2UY7A 4ZS6D 5L2KD 4GRWH 1LEKB 2ADIA 3FOLA 3RTQB 5FCSH 2QV2A 4BFBD 1I1YA 1E6OL 2FB4L 5KVFH 3PJSA 5IMMA 2FJFB 2VDPH 1J1PH 1UB6B 4RQQA 5DWUH 3SJVB 4NZDA 1T66C 3RRQA 3V7MA 3S3SA 3DUSA 3MV9B 5J89A 2R2EB 4C4KO 4DUWA 1A7PH 1D6VL 3KHQA 4P2OB 1X5IA 2BVQA 2V2WA 1OAYL 1BX2A 4N8VB 2ZKHL 2ZSVA 3CX2A 1XF2B 2YD3A 4NO5B 4J4PA 1FZJB 4HIHB 4KRPB 4NYLB 4IIQC 5CJQL 2BSTA 4NO3A 1VADA 5B4MC 2DF3A 4YFLI 3SGDI 4M5ZL 5D1QB 2R2BB 2MTPA 5DJ0A 4DK6A 1JGDA 1N5YH 3IFPA 1KTKE 4D0BB 4MA1B 4PRIB 1RUPL 1YEGL 3THMH 4YGAB 1U8KA 2NY4C 1KYOK 3V79C 4R2GB 1WBYA 1SJEB 3S4SB 2XIDA 3KJ4C 2Q8BH 3WEXA 3GBNH 4XPFH 1S7TB 5DVKA 2BX5A 3FB6B 2FNBA 2O26U 5IMLA 4ZTPH 3QCTL 2YD5A 5LGHL 4L4TE 5HPMB 3D2UB 2C7UB 4JFQB 1ZLWK 2FX7L 2C1OB 5EUOE 5JIKA 1SBBA 3SDDB 4POYA 4U6HA 1BWWA 4LDLB 3ARFB 1U3ZA 4UOW0 2XXMB 3MV8B 2AK4D 4ETQA 2XI9A 5GS1C 4LBEA 2JKXA 2EE6A 3LRSA 4TQEL 3WD5H 1QKZH 4MNQE 5FUCC 5JXEC 4MA3A 3VFMB 5I75C 1UM4L 4NQEB 2GTZB 4QHKJ 1NANI 4K3EL 5DJAA 3MJ9L 2OYPA 3HAEA 3L95A 4NC2B 3MV7D 1RK1A 1XGUB 4O2CA 1DN0B 1KULA 1S78C 5E00A 2XRAH 2LABA 1OPGH 3O2DH 1A1NB 4OLYL 1BZ9A 4PJCE 1CXKA 2YC1B 3ROLB 1LE9A 3MGOA 3BDYL 2HFGH 1NMBH 2V7HB 1UA6H 4P2CG 3X12B 1IGCL 1JNHA 4NGHH 5GSVA 4CDGC 4LCCA 4HWNA 3L5JA 4HJ0C 1A9BA 3ES6A 3DVNA 4NKDB 3TN0D 1TTGA 3VFGH 2KKQA 1EFXA 4N8VA 1P4BL 5EWIH 1XF2A 1I8IA 1I9IL 2ZUXA 4NO5A 2CMRH 5HDBF 4HIHA 5FA4A 1VACB 1A14L 3DLQR 3RGVA 2Z31D 1MOEA 1KENH 3MR9B 3C5ZA 3U30C 4NJAL 5D1QA 2Z9TA 4D0BA 1I9JL 1MFEH 1T03L 5CJ8A 3FZUD 1YY9C 3HNVL 1NLDH 1QSEA 2NPLX 8FABB 3DI2B 4OAWA 1SJEA 4UT7L 2OX5A 5HYJD 4ZXBC 1IBGH 3I9GL 5AWNH 5ADPL 1RJZB 3DV6B 3FB6A 2GFBA 1J1XL 4F7TA 2J6EA 3LIZL 4JKKA 4DKFH 4GRLB 4ZPVB 4HPYH 3MSPA 3BPCA 4HIXH 3SKNB 3BAEH 2DLIA 1ZK9A 1YMMA 5HPMA 5INCA 4JFQA 5J11C 4H20L 2C1OA 3ARSA 4NZTH 1OCWH 4QRRB 2FZ3A 5F7LB 2EKJA 1T80A 4OJFH 3B9KD 1S7RB 4WHTB 1TDQA 2FJGA 3OXRA 1F3RB 3UTTB 3VFMA 3I75B 3T3MF 4YHLL 4L8BA 2GJ6B 1GJIA 3BE1H 2GTZA 1UVQB 1JGUH 4LU5H 2BOBA 3LS5H 5I15L 4RAUB 2FJHA 4LQFH 1XGUA 5IP4A 3QUXB 1MWAL 3GSNH 4PUBH 3O3EB 5CGMA 5EU6D 3VFVA 4DGIH 3CH1B 4L8SC 2IPKA 5JLZA 1CICC 3WIFA 3EAKA 4K3GA 1FDLL 1RK0B 2JCCB 1I3VA 3TBYB 1SMOA 1QSFB 4K3HA 1DBML 1MCSA 3IXTB 1HXMA 1KN4H 2X9XA 3QI9B 4JRXE 5D1XC 4X6FB 2Q86B 2YZ8A 4PD4K 4JDVB 2BNQA 3P9MB 2VXVL 3O2VL 5MI0B 2AXFA 1KJ2B 4GQPH 5IVXF 4CMHC 1NGZB 4MCYA 4HLJA 3CXHK 4NKDA 4PRPD 4CU8A 5KANI 4AL8H 1YYMH 3UC0H 2YKLL 2DIAA 5C0CD 1BVZA 1ZS8B 4LP4A 3AXLB 4DQOL 5EUKB 1U58A 3ZT6A 1RFDH 2ZG2A 4LGRB 3SDCB 1DVFB 4JR9H 3FFCD 2J8HA 1EXUB 4O58L 4Y7MA 3VGEA 5GS0D 2B0SH 3F7YA 4LMQI 3B5HA 1R3LB 4YGVA 2WM0A 5T1LD 2RQ8A 2Z4QB 3WNPA 1FORH 4GAJL 1CI5A 4M6AA 4K8RL 1KJVA 1ZLWH 2ARJB 5GRJH 2VABA 1JRHL 2FEEL 3A67H 1NC2B 1F6LL 2PR4L 4P0DA 1NMC