1F8TL

Fab (lnkb-2) of monoclonal antibody, crystal structure
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
219
structure length
219
Chain Sequence
DVQMTQTPLTLSVTIGQPASISCESSQSLLYSNGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLRISRVEAEDLGVYYCVQGTHFPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ANTIBODY FAB FRAGMENT (LIGHT CHAIN)
publication title Spatial structure of a Fab-fragment of a monoclonal antibody to human interleukin-2 in two crystalline forms at a resolution of 2.2 and 2.9 angstroms
pubmed rcsb
total genus 54
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2000-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f8tL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f8tL01
2D7PA 4HAGA 5F7KC 4JPWL 4Q0XH 4LSVL 5GRUL 2QSQA 3G5ZA 3U4BL 1C1EH 1PFCA 5K93A 5L2JA 4FQXD 5DURB 2KZ1B 3FQXA 3VXSD 3DVGA 4LLMA 4CVUA 3BISA 4JKPL 1OTSC 3Q2CA 5SWZD 5ICXA 1G9MH 1AD9B 3PGFL 1J1OL 4LSTL 1WIOA 5DXWA 4UZGA 4EUPB 1QFUH 1MI5E 1T3FA 4NNYA 3QIWC 5FKPA 2XACC 3WFEH 1X4YA 3GRWA 4NO0D 2ZPKH 4O2EA 4R8WL 3CXDH 3ROOA 4GRWB 1AGEB 4CMHC 5CKGA 3KJ6L 2HFGL 4P23B 3KPQA 4HX1B 2G5BB 2F58H 4JANA 5GIRA 2Q3AA 1NUFA 1KELL 3HE7A 2BVTA 4LASH 3S96A 4FTVE 3IETA 1OARL 1XEDA 4G9FB 1GGIL 1XGPB 3RJDA 3I6KB 5IB2B 5DEGB 1Q0YL 4YDLC 2VL5A 4ODHL 1ERNA 1RVFH 4EI6A 3MLXH 4P0DA 3QULB 1J88A 3RWHB 3CGTA 4G6AC 5D7LD 4G43B 3WEXA 4NC1E 5CLWA 1XF2A 3AS3A 3CDYA 1KN2H 5EU5A 3V6ZB 2ZCLL 3BKML 5DD3L 1RIVH 3DMMA 4R90L 3SDDC 5DFVD 4P4KB 4HKBB 2X1QA 5DRNA 1ORSB 1EFQA 1DQLH 3HNTH 3MXVL 5E2UL 3WNOA 4AZ8A 4E9LA 1AGFA 2BOCB 1G1CA 1D5ZA 2M2DA 4XP5L 1MJJB 1GVIA 3D3VE 5LQBL 2WBJD 1BREA 4G8FA 3DUHA 3PXHA 4Z7OE 3L95B 3BO8A 3WIHL 3JWDL 4JB9H 5CD3A 1DANU 1KB9J 1QOKA 4U1GB 4Z9KB 1MY5A 3RU8H 1TNMA 2MPAL 2YD5A 4UT9H 1JHKL 3PQYB 3QEQD 4WU5B 5F21B 4AEIH 1BQHB 5I17B 2F54A 3CZFB 1QSED 2VZSA 5C0BD 1EERB 1EHNA 4N8VA 3VFUB 4GW1A 3ESVF 4DKDC 4URTB 4WW2C 2E7LC 5TQ0L 1UEYA 3O9WA 5EG6C 5IK3B 3CFDB 5FUCC 3H7BB 1W2KT 4F57L 3VGHA 2RGSA 3LQAL 2Y36H 3RRQA 1SEQL 4A2MA 4NN7B 2HJLA 5KVGH 1XT5A 3THMH 1TVBB 2E7CA 1F4AA 3SGJC 4L5FH 3VD7A 2IAMD 5CJOL 3VA6A 2AKRA 2FR4A 3FFCE 1EEZB 4OCYH 2X1XR 1QLRA 4QHMA 5F96H 4X5LA 4X98A 2WINB 4FXKA 4ONHA 2J12B 3MYJA 1XFPA 4PTTB 1Q8MA 5E1AB 3D39E 1J18A 2R2HA 1RU9L 5JW4Q 3KPRB 5C7XH 4G6FB 4UBDC 1OTSD 3ALPA 5J0BA 4N8PA 5KSUB 3IDIB 1WVZA 4JFHD 1QFWM 3WDJA 5HHOB 4ZUVA 1Z3GH 4F7EA 4PRPE 5T3XE 4K94C 3QIWD 5FCSH 3BRGC 1L7TH 1K2DA 4NRYA 3VFPA 3HZMA 2NCMA 4KKBC 1EJOH 4PJ9C 2HT4C 2FBJL 3LH2H 3I3DA 3P4NB 5EH1A 4LRIC 4M7LT 1LK3L 3RX8A 1A7PH 2FJFA 4LARL 3TIDA 1I7RB 4ELKA 1ZVYA 3U7WH 1F3JA 5FM5O 5CSZA 3VMNA 3IF1A 1A21A 5GS2D 3WHXA 2A74B 4K8RC 4MB3A 1XGTA 4IRJC 1H8NA 3A6CH 5DMIH 4G6AD 2IANA 4WI6A 1WZ1L 3RWDA 4I3GA 3L7FA 4WEMB 2CRMA 5F7EL 3G5XA 5I76B 5DUMH 1PLGL 1U6AH 1TZGL 4FXGA 5E2TL 5TFSH 3SDDD 5J8OA 3X12A 1IQDB 1MAKA 6CGTA 1A3RH 3LCYA 2XFXA 4TQEH 5DT1H 4BSWB 3CVHA 1T0MB 2YWYA 1XGUA 1FN4B 3U4EB 2YBRA 5ITFA 5BJTA 1FE8H 1F42A 3QZWA 3GHBH 2FDBP 3BEVB 4QTHA 5KVFL 1NLDH 1U8LB 3U0WH 3AROA 1KJ3L 3O6FB 2I9TB 2QR0B 3T65B 3BEWB 4Y5VA 5CZVL 4GRMB 4OCSH 4HFUL 1FZMA 3FONB 3QHFL 4KVNH 1F4WL 1OAKL 4ETQB 2NXZB 3OR6A 4QGYA 2DQDH 2F53E 2K7QA 3A0OA 4W4NA 1LQSR 5GGTH 3P9MB 4QRSA 4D9QE 4XNXL 3BKYL 3AFLA 1HH6A 4NCC1 4OF7A 4W81A 2EH7H 3WYRA 3GHEL 4K23L 5F44A 4YX2H 4UILH 1I3RA 2IEPA 3PWVA 4JZJB 4QTIH 3RBGA 1C5BH 4YFLF 3GJEA 2RAMA 1ES0B 2Y06L 5K9QI 4N8CH 4Y1AA 3LS5L 3WFBH 2XZQL 4ZD3L 5C3LD 3P0VH 4GKOA 1IZJA 3TM6A 5D5MA 1GXEA 3FT3B 2A1WH 3DVNB 4GBXA 2HG5A 1H5BB 4IDJH 4OCNC 4ZPTA 1MRCH 4LCWD 2VN7A 4NZRL 4UBDD 1ADQA 1MWAH 4N0CC 2JIXD 5CMAB 4Y16B 4Z7NF 4U1NA 3BT2H 3FJTA 2HT2C 4U0RC 4WUUB 1EHLH 4ZFGL 4U6YB 3NH7L 4ZFOA 1G7MA 4HKXA 1CLOH 1VHPA 4PJ9D 4KKBD 2E5EA 2HT4D 4ZPVB 3REWA 2YZ8A 4R96B 4HSQA 1A3LH 5KSAC 3NN8A 3H9SA 3LRSB 3P40A 3QT2A 1NGXB 5J6GB 5DGQA 1JPSH 2QQQA 5I75C 2Y72A 5CP3H 4OBSA 5DJXA 1T1ZB 4RMRA 1CTOA 1Q9KA 3P4MA 5F72S 5IQ9A 4BSVA 1URLA 4UDUB 4UTBL 4AK1A 4D8PB 4K8RD 1UB5B 4NM8H 5HVWA 4IRJD 2J6EH 1M05B 5C6TH 2E8ZA 3Q3GB 1CFQB 4JPWH 4NRXB 1R0AL 4LSVH 4ZXBA 1N5AB 3HI5L 5GRUH 1C8PA 3BZDA 4Y5YB 1IEBA 3T0ED 3U4BH 3C5ZB 3S34L 1HHGB 3VE0B 4HF5L 3QJHB 3D9AL 5HD8C 1A2YB 3QEGL 2OCFD 5DFTA 1HYSC 4JKPH 1I75A 3PGFH 4LSTH 1CQYA 4LSQL 4OZGB 5KSVB 3V5DA 1NGQH 1FVDB 4AIOA 3MV8D 1N4XL 3H3BC 3T09A 4XVJH 1DLFL 3SBWA 5JO5A 5D7IF 2P8PA 5GSRB 3GB7B 3KJ6H 2HFGH 2PYEA 4NDMA 3GI9L 4PRAA 4O9HL 3QUMA 4X4YA 4MZ2A 3C08L 1KELH 5MP6L 3BDYL 4TNVF 4RSVA 1H3GA 4ZFZB 2VR5A 1OARH 4LBEB 2C26A 5EOQL 1T1YB 2ITCB 3OX8A 4IOFC 4LCCB 4MA1B 3KHQA 1GGIH 5C07D 3HMXL 4WTWA 1Q0YH 4QHLA 2D31B 4ODHH 3LD8C 1DEEA 1XGYL 1BM3L 4QNPF 2X4TB 4H0GA 3TBVB 3PXJA 2WBKA 4TPRL 5I74B 1A0QL 3FAXA 1LD9B 3P30L 4X6CE 4MD4B 3JVGC 2ZCLH 3BKMH 5DD3H 1CLZL 1E4XI 5CJQL 4YNYB 1KPRB 3DTXA 5I1CL 3O2DA 2VLRE 1Y0LB 5F7NC 5DLML 5DHVH 3H9HB 1HHJB 3INUH 4WFFE 2VIRA 3SJVD 3MXVH 2OYPA 3L5WA 2W38A 2Y5EA 3DX7B 4HJ0C 4KTYA 4XP5H 4N0CD 2R39A 1XCTB 3E6FB 43C9B 4ZSOA 2DQTL 5LQBH 2HT2D 1C08A 1U8MA 4WFGD 1YEJL 2CLVB 3JWDH 3WIHH 3WUWA 4PJIA 3ESUF 4I4WB 2MPAH 3VWJA 2VLKD 1JHKH 1MCWW 2DTSA 4PGEA 2EDQA 5KSAD 3B8SA 4DJMA 5SWQB 1XF3A 3MA9L 5TQ0H 1YN7B 4JFPB 5C0GB 1DJSA 1R24A 5CHNB 4F57H 2OQJB 5IOPB 4M6OL 1UXWA 1YEKL 3LQAH 1IM9D 1SEQH 3FFDA 1FH5L 2BOBB 4HV8B 1X6NA 4XNZC 1JF6A 1KB5B 4CMMB 4Q9QH 1NUNB 4ZUWA 3UZVB 1MCIA 3UYPA 4OUUB 5JOPD 3ARWA 3LVEA 1S9XB 1RU9H 1FAIL 4PGBB 5DA4A 4J3VA 3WCYA 4MNHB 5HD8D 1DCLA 1QVOA 4KY1L 3VH8B 1HYSD 4PJXA 4C59B 3VMOA 2B2XH 5J9PB 5ITBL 2IPUK 3WN5B 2GK2A 3GRWL 4M43L 1KCKA 1MCKA 4O2CB 2XZZA 4DEPC 2E7MA 4Y2DB 2FBJH 4OLUL 4IM8A 1NC2D 4I2XE 5E8OA 3QDJD 3I9GL 2NR6C 4HIJB 3VXUB 4NQCB 3M17A 2OMNA 4MJ6A 1Q0XH 4X0KA 3WXVL 4IOFD 2CXKA 5EZLA 3OB0H 5FK9B 1U8IB 2AJ3B 4I0CC 5D1QA 2X4NA 2IMNA 2GJ6A 4PS4L 5D7JB 5KBNC 3W5MA 4GAYA 5KZCD 1H3XA 1IFHH 4IIQA 5MENA 1NAKL 4LHUD 5A2LH 3LKOB 2PYFA 1PLGH 1TZGH 5DMGC 1IGTA 5E2TH 3ZDXE 1JWUB 4U2YA 4OGZA 1RK1A 1MCDA 3B6SB 4QXWA 1BD2D 4HJ0D 3QUXC 1ZHBA 2UVFA 5I1DB 3QDGD 1NFDE 1T1XA 5CBEB 1UWGL 5F7FA 5HGAA 2LQRA 1KJ3H 4WWKB 4GT7A 5I8EB 4MSWA 1KJ2L 2DLHA 5TGBA 3TC9A 5CZVH 2WZPD 2DLGA 4HFUH 3CSPA 3QHFH 3MBEB 3U0PA 1AGCB 3E1F1 3GSOA 4J4PA 1UEMA 1OCWL 2FJHB 1J0IA 5A2IH 4U1SB 3HI1B 1IC1A 2D03H 4PJCE 1WWBX 4XNXH 3BP4A 5KSBA 3VXMD 3GSVB 1NBYB 3V79C 2L7JA 3GHEH 2UWEB 4MA8L 2UYLB 4UOW1 2FLBT 3FHQA 5DHYB 2Y06H 4BZ2L 5EBWA 2C3XA 2G5RA 5SWZB 4F15B 2VABA 4I0KA 2QSTA 5DJ0A 1ZT4B 4ZQKB 1NCTA 1LMKA 5HXMA 2HJKA 3BN9C 1V3LA 4NO0B 1X5IA 5IVXF 5AD0A 4NZRH 4L3EB 5IJVB 1KTRL 2O5ZL 1TCMA 2AAVA 4MWFA 3A6OA 4ZFGH 3NH7H 3WNMA 5BQ7A 2BNRA 4IMLA 4PUBL 5DTFB 2MMXA 4YZFE 2YD4A 4P2RA 2AQ3A 2EDWA 3GSWA 4K94H 4KH2A 1CFTA 5EULV 2MKLC 2NR6D 3C6LD 5CP7B 5D7LB 5DHVB 2FHCA 4JFZH 4XMPL 1OAXH 2PXYC 3UMTA 3BRFA 2ID5A 1JRHH 3GM8A 4UTBH 2OZ4A 3VXTB 3D1MC 3FRUA 3O3DA 5KVEL 1I1CA 4UNTA 2ICWJ 3VGAB 1CGSL 1I9JL 3ZL4L 1R0AH 3EYSL 2P8MA 4NUJB 4R26L 4K8RH 4PJ5D 5DMGD 3IXAA 3FQUA 1Q72H 1RUML 2WBJB 1V7NL 3MA7B 1D5IL 3MRLA 4DTGL 1V8HA 3VFVA 3DGCR 3S34H 4YBLC 4HF5H 3D9AH 3CVHL 3QNZA 3QEGH 1F11B 1U8JA 3ETBF 4MJ5A 3QUXD 3QEQB 4ODSL 1G7HA 4JHBA 1WK0A 5C0BB 3DGGB 2OMBA 3QYCA 4Q7DA 1DLFH 3T3PE 2PN5A 3KJ4B 4PPTA 4HFWB 3MNVB 3RWCA 4NZUL 4W4OC 1SBBA 5DMYA 2V5SA 1SJXA 3GI9H 4O9HH 1ZGLB 4K7PX 4WFEE 5C70A 5E6IC 1OQXA 4X83A 2DBLH 4J2XA 2ZJSL 3C08H 3WFCL 2V7HB 5MP6H 2PUQT 3BDYH 3IB4A 3EO9L 4EEEA 4JQVC 1XF4A 3IDNA 5E94B 1KC5L 3BFOA 4GAJH 3HMXH 4R3SB 2HMIC 4LKXB 1XGYH 4HKJA 5CGMA 1BM3H 2QHRL 5GGSA 1DN0A 1ZANL 1RSFA 4S2SA 4TPRH 2Q76B 5CBAB 5HYQB 1A0QH 1R3JB 4EN3B 3DBXB 1CLZH 3HZYA 4RNRB 5CJQH 1FDLL 5I1CH 3GIVB 2DOCA 3RDTC 5B38G 2DWDB 5DLMH 2KQMA 5EUOF 3VXRE 5JIKA 3SDXB 4JRYD 3QIWB 3L3IA 4PJHA 3SGEI 2CLRA 1TMCB 5J1SC 4QOKE 1I8LA 4PRNA 1ADQL 1S7SB 1IZKA 2ZG3A 3LEXA 5LKNA 5I19L 3EYQC 1U92B 4J7RA 3TGXA 2DQTH 5JHLL 1S9WB 5DD1L 5CJXC 5BW7C 4CVZA 1YEJH 4IS6B 5MHSD 1UQSA 2UV3A 4BELD 1HI6B 3OZ9L 1G7IB 1MPAL 1SYVB 4YLQT 4HH8A 1OWWA 3E8UL 4YDLB 2OXGA 4I9WE 4KZDL 4Z7WF 5FO9A 5CEZE 4AIZA 5IUSA 4PR5B 1WC7B 3ARFB 3MA9H 4I3RH 5CAYB 4OV5B 3KGRA 4HUUB 3RTQA 4M6OH 3AUVA 1YEKH 4JFXB 5C0CB 5I2IB 4OF8A 5FOBB 2NZ9C 4PBWD 4PJEB 5FCUL 5I1IH 3GBNH 2J8UE 3UJIL 2HFFA 1P7QA 4R6UA 1II4E 4OFYA 4P2QB 4B5EA 2Y7QA 3U2SA 3UROR 3JWOC 4QYOB 1OAQL 3NFPA 2ICES 4P2OA 1FAIH 5ISZD 1D5BB 4JFDD 4DVBB 3KPSB 4HS6B 4KY1H 2V2XA 3HG1E 3FQRA 5F93C 1WBYA 5JLZB 2CDGB 5ITBH 1PG7L 3MRHA 4QRRE 5DJDB 4ZS7H 1ULVA 3NIFE 3Q6FB 3GRWH 4BH8A 4Z77A 4PJDF 2HT3C 4M43H 5GGVY 5ELIA 3VG0L 5C0JB 2DS4A 1QPPA 2IADB 2DYPD 4YR6B 3QUML 1D3CA 4E41A 5E6ID 1QFOA 4WJ5A 5DR5L 3I9GH 4FQLL 5JNYB 2XNAA 3WIFB 5FHBL 5D2NC 3WXVH 5DEFB 1UKTA 5F1KC 5IMKA 1JYVA 1UVQB 2HMID 3FB8B 1PYWA 3GSXA 4PS4H 1RZFH 5SV3A 1ONQB 3IDYB 4OSUL 2AV7B 1CDBA 2H6PB 4NQUA 4G8IB 4RFNB 4NWTL 4H1LG 1HYRC 4PLOB 1NAKH 4O02L 3O2DL 4L8SC 3RDTD 2JIXB 5EO0B 1WT5A 1I1RA 1KEGL 5E2WH 1YJDC 2XPGA 3MCLH 1K85A 1MCQA 3ZE2F 3F8UB 3FB6B 1DDHA 5JMRA 2HFEB 4RFEB 5DQ9B 7FABL 1EK3A 5EZJB 4L9DA 1N59A 5F89B 5BRZA 4NIKB 3RWFB 4QY8B 4CKVX 4FOMA 1KJ2H 1I3VA 3PWJA 2XN9A 2MCPL 5HHXL 1E28A 2E27L 4MX7B 1ND0A 1M7IB 1OCWH 1PX4A 4H5SA 4GKNB 1ORQB 4LSRL 3VCLB 3PWLB 4PTUB 2JCCB 5EU7E 3FT4A 2EIEA 1J0HA 2NZ9D 4O2FB 1OM3L 3C9NB 1BOYA 1NGPL 3TJEL 4MA8H 1JZ5A 3EYOA 1YEHL 4NO2B 1P4IL 2GIYA 4WFHE 4BZ2H 2VDKL 4CL7A 1EEYB 3ZKXB 5J6HA 1N3NB 3VWKC 1ETZA 5GRZA 4XRCB 3UTTA 4OIAA 2AXHA 3MV8B 1HXYB 4N90E 2P45B 1WZKA 1RIHH 5D2LA 5FKAB 3KXFA 1HXMA 1BF8A 5C0AD 1LK2A 5IB1B 2JJSA 2O5ZH 3CLEH 5GS1A 3O2VL 2YUWA 4XCEB 4HUVA 1LEIA 4RQQB 4PUBH 1XCQB 3TNMB 2HT3D 1MSPA 3VFWB 3W0WA 5C07B 3QQ3A 3OPZL 5JDSA 1FG2A 3HPJA 2IWGA 3WS3B 3GMNA 2IALA 1A6AB 3EOBA 5IEKA 3BH9B 3MJ8B 1RHHA 4L8CB 3O11A 3WE6A 1BQSA 4XMPH 1ZLVK 3WFHA 1ZHNB 5CFHA 3SKOB 1MHHB 5FYKD 4X7FC 3IDGA 1ZLUK 3SE4C 5FA3B 1IGJB 2ZOLB 4A2LA 4U7MA 3HUJE 1RY7B 2RB8A 2H41A 2YHGA 1XF5A 5KVEH 5I8KL 4PP1C 3L5IA 4X6CF 1CGSH 1I9JH 1SYSA 3ZL4H 3EYSH 5I16A 5DD6A 2GJZB 4JFFE 4EBQL 5EBLA 1LP9F 4R26H 1IGIH 3RWEB 1RUMH 4DW2L 1B3JA 1QLEL 2KQNA 1V7NH 4HUWB 1D5IH 1JL8A 4U0RB 4DTGH 1Q9LB 3V6OE 3T0EA 2G60L 1YZZA 4P2YA 3L3DA 1OP5K 5T3ZL 3CVHH 3BZEA 3BI9X 5DJ8B 1GL4B 4Y19A 1FFOB 2ESVD 2NXYC 4KPHL 4X5WA 4MJ2A 4ODUA 4BZYA 3PE9A 4LF3A 2K9UA 1CICA 1MHEB 1PZ5A 3BZ4A 4G3YH 1JGDA 5GGUB 5IW6A 1PKQE 1G9EA 3ARZA 1FIGL 2FBOJ 2OR9L 1E4KA 3PIQB 2W0FA 1R3HB 5CGYC 4XBGA 2UUDH 5F7LB 5DMJB 3G5ZB 2ZJSH 1WFNA 5LGHL 3U9PL 5FYLE 1YNLL 3EO9H 4DK6A 1KC5H 2GJJA 3HC0B 4RGNC 3FQXB 3G6DL 5CJBA 4BKLB 4QHUA 5I1JL 1NCUA 4LQ1A 4NN5C 3TT1H 4BQCA 2QHRH 4FABL 2QSCL 1ZANH 1T20B 4X9HA 5F1IA 1T3FB 1IAKB 4LNRA 5FKPB 1BBDL 2LU7A 5H37G 2AEWA 3ROOB 1FDLH 2W92A 2DQFA 4U2ZA 3VWKD 3FO0L 4C58B 1OOAA 1AJ7H 3HS0B 3MNWA 3S5LG 3KPQB 4UIMA 3ZE1E 2J8OA 5ALCL 3QCVL 2FSEA 4PREA 4PRHD 4XPBH 4HK0B 5BO1L 3HE7B 4MXVE 3SJVA 2EC9U 1ADQH 3VRIA 2VC2H 3S96B 3MREA 1MREL 5JHLH 1NC2B 5DD1H 1D5MA 2VL5B 1SY6A 5ID1A 1FFNB 3BHBB 5L2KA 4MJIA 1OW0C 2F5AL 3OB8A 1K8DB 3OZ9H 4IRSA 1MPAH 3WEXB 3GSNA 2SEBA 2XG4A 3PF2A 4GKSA 5F1OB 4RISL 1Z5LB 1I1AA 3DMMB 5EOCJ 1GRWA 1FHGA 1AH1A 1OAYL 4ZUTA 3BWAA 3UP1A 1S9VB 1S7RA 1NEUA 3O4LD 4MNQB 1YMHA 4LHUB 1VB9A 1AGFB 5FCUH 1N6QL 5LJYH 1JV5B 4XWGL 1IM9A 3QCTL 4P5KB 3W9DA 2O5XL 5SX5H 1TDQA 1JNLL 3G6JE 4QRPD 3UJIH 3MRRB 3BO8B 3BWUC 4PRIA 4PP1D 5IHZA 4RMQA 4Y88A 3LKPA 2PO6C 1HHIB 4X8XA 2PETA 3QDGB 3ZDXF 2ZUSA 1KJ2B 2F54B 4WRLA 4UDTA 2GAZB 3GSUA 5SX4I 4DZ8A 3D18B 3E0GA 1UM5L 3QPXL 4LLAA 1B4JH 1KBGL 3O9WB 4IBLT 2HKHL 3OJDA 4OD2A 1TXKA 2Q8BL 5F7HA 5FB8B 5FGBC 5F8QC 1DQTA 2NXYD 2XKNA 4CU7A 2GK0B 2HJLB 3R8BB 4JO3L 2Q8AH 4RX4A 5FUZL 4K7FB 2PNDA 4POYA 5ADPL 5ANME 1BVKB 2AKRB 4X6DF 3VG0H 4U6TA 1RZIA 1QLRB 5AEAA 4X98B 4DCQB 3KPNB 3UBXB 1T2JA 5DR5H 4FQLH 1PGRB 4MCZA 1S8DB 3P0GB 5FHBH 1IKNC 4N0UE 5IEHB 3MRPB 4PJCF 4HIXH 5KS9A 4RGND 3UTQA 3MRDB 4WHYG 1VFUA 1CGXA 3BD4A 1DVFC 1SBSL 2DIJA 2AJXL 3MLRL 3RNQB 3TVMC 1YMME 4OSUH 4ZUVB 3AY4C 3QQNA 4NWTH 3QNYB 4YC2C 4RWYH 1OGAD 2WNGA 2YN3A 4O02H 3O2DH 1V3KA 2VQ1A 4TSBL 4UUJA 4A6YA 1KEGH 5DDHA 1DBMH 4FQQA 4OCXL 4EI5C 2X7LA 4KGJA 4DZBA 3SCMC 4HAFA 3TIDB 3D85D 2LTQC 4ELKB 1N6UA 3I85A 4X7TA 7FABH 4DUWA 1F3JB 5BVJA 3KDMA 4HWEL 3EJJX 4U31A 3WHXB 4F7TB 4C54A 4GKZA 1FL3A 4G6ML 1XGTB 2EDRA 2WIIB 3MCKB 2IANB 1RZJC 5ERWA 1KGCE 4NSKA 3L7FB 2MCPH 4Y4FA 5HHXH 3FAWA 2W1NA 2E27H 2A38A 3NIDE 1SEBB 2BHUA 4U33A 1YPZE 4O51B 3BIAX 4NQSA 1EGJL 4LSRH 3K74B 3MV9A 1NCWH 5I30L 3FT2A 4X4ZA 3AXLA 4YUEL 5IF0B 1X5HA 4LLUB 3CVHB 2V5MA 5E9DE 1P4LA 1XGUB 1OM3H 1NGPH 3VXMA 3M45A 1VGKB 2YBRB 3TJEH 4Y4KC 1YEHH 5L9DL 1IBGH 2R0KL 3FRPG 3UZQA 5A40E 3CFKA 2BERA 2VDKH 1FORL 2PO6D 1ZLSL 1I8KA 1UXSA 2GQHA 3GIZL 1RUKL 4Y5VB 3T0WA 4CVXA 4S1SL 3IJHA 2EE2A 1FNEB 3MR9A 2GTWA 3RGHA 1E27A 1FCCA 4QF1A 5D7KE 5DZLA 4HG4K 4RAUA 2BSSA 3IDXL 3S4SG 1P9MA 1T4KB 3EKCA 1HH6B 3O2VH 5LXGL 5IIEA 1MFBL 5D1XC 5EU6E 3QFJD 5EO1A 2G75B 3G5VA 1I3RB 1TVDA 4QCIA 3PWVB 4PJBF 3WIIL 4LU5H 1C5DA 4JFEE 4U3CA 1MCWM 2OSLA 5FM4A 4LP4A 4XCFL 5HDOA 2MKWA 1QRNE 4JPVL 4Y1AB 5F9AC 2JE8A 4D94A 4L3AA 3RVWC 3MOBL 4DN3L 1EUTA 3C6LA 2HG5B 2R23A 3QQ9C 5IJKC 1YYML 3OHXB 4WHDA 3WXWH 2BNQD 1DVFD 4JRYB 3TVMD 1AXSA 1AGDA 3TLRA 3KG5A 2AEPL 4HKXB 1IAII 5C09A 2A77H 2FO4A 2OX5A 4EBQH 4QXGL 4DW2H 2I25N 3REWB 3V8CA 3NN8B 2G60H 3QDMA 4TVPD 4EI5D 3QO1B 5GISL 5T3ZH 1HCVA 3SCMD 4LCYB 2YPLE 4OQTA 1YN6B 3MRQA 4NOBA 5CIPA 2NY3C 4KPHH 2ZUWA 3TPUA 3P4MB 2MQ0A 4BSVB 3UJTL 1IGYB 4NKDB 1NCAL 2PXYB 2OR9H 3S36H 2AJSL 1ZLWH 1HQRA 1YEGH 1EBAA 5DYOA 4NC2B 1QSFE 2DLFL 2ZZUT 5C08D 3ZTNL 5LGHH 3JWNC 3U9PH 5L8LB 1KCVL 1YNLH 3CDCA 1BOGB 3U7YL 4JHZA 4JO4L 2ZKHL 3MXWH 1MI5A 3VXNA 5HYIA 1NPUA 2HVJA 5I1JH 3N1GC 1FL5B 4FABH 1FZJA 4E0RB 3PUCA 4Y4KD 5ISZB 3L3JB 4JFDB 4HH9A 3JTTA 3MLTA 1BEYL 1XIWC 3MLSL 1BBDH 3IU4L 4R0LA 2MCG1 1B0GA 3RY6A 3B9KC 4LKCA 2ZNWA 5D9SB 3FO0H 1VACA 1S7VA 1G1YA 4FTVA 2PYEB 4NDMB 3QUYA 5ALCH 3UTZA 4ZYKB 2EDKA 4P49A 5BO1H 1CD1A 1NBVL 4NT6B 1P5VA 2WM0A 3B5GA 1MREH 4ERSL 3W9EA 1BZQK 1T22A 1I1FB 5D1XD 3NIFF 2GSGB 2F5AH 1B88A 4RWHA 5TF0A 1GC1L 4C56B 5HI5C 3OAZH 4OFVA 3MZGB 3RQ3A 3EDEA 4X8JA 1AFVL 5IWLC 4RISH 4BUGA 3SQBA 3RVWD 1OAYH 5E56A 1PJ9A 1NFIB 4CU8A 3VD5A 3X14B 1TLKA 4HULB 3D3VA 4NM4H 4NNPL 4POZC 2GTZA 2B1AL 2MJWA 3QQ9D 3U6RA 3L5WB 3N06B 1N6QH 1VFAA 1MH5A 3QCTH 4ZSOB 2NW3B 4WV1C 1JNLH 4KI5E 1UYWH 1JZ6A 4PBXA 4YPGA 4JJ5A 3VWJB 4OZHF 4PGEB 3LEVL 5IFAL 2XZCL 1JNNL 1XF3B 1UM5H 1HEZB 3D2UD 3QPXH 4F80A 1IAOA 4FQ1L 4XC1L 2HKHH 2Q8BH 3FFCA 4PG2C 4YHNA 5LVEA 2NY3D 5JXEC 1VGEL 4LSSL 2GI7A 4JO3H 4UI2A 4Z0BL 3GK8L 3PDOA 4I0PB 5FUZH 2BMKA 3SN6N 1QR4A 5ADPH 3B43A 4FQHA 4XNMA 3SKUD 2VL4A 1OL0A 2ITDB 4GXVL 2RFXB 4GG6E 4OLXL 2FYYA 3U46A 4D0CA 4YHZH 2X4OA 3TO4A 5E8EA 3WS6A 4LNVA 1VCAA 3U82B 5C0IA 3TZVC 2M8XA 1JMXA 3O3BA 4YHYB 3PV6A 3G08A 4PRPA 1KENH 3F7PC 5H35B 4M9OA 3MLRH 1SBSH 4HIHA 4M7ZC 5K9QG 5GS0C 4NQDE 3OKYA 5GSVA 1XIWD 4LLVA 3FHAA 3W2DH 5SWSE 4WENB 3B9KD 1JBJA 1KCSL 3IXTA 2YA2A 4F9PC 4Y89A 4Z7VE 4OCXH 5E8OB 5HYSB 4V2CB 4WI8A 4KI1A 2BVYA 3QR2A 4NBXB 4X0KB 3JV4A 1QP1A 2AK4E 1HIML 5EZLB 1J8HD 3W82A 2X4UA 2C3HA 1SY6L 2AQ1A 1FG9C 1BLNA 2X4NB 4WI2A 2VKWA 2GJ6B 5HI5D 4G6MH 3S37X 5D2NB 3LQMA 3TWCL 3GSNL 4GAYB 3ZHLA 4XNQB 2OR7A 1UWEL 3L3GA 5DSCA 5CUSL 5JIIA 3ZDZF 3GMQB 1JF1B 3AC0A 4JPIA 4UV7L 5FAAA 1EGJH 2EDYA 4EIGB 4POZD 3QIBC 2OJEB 5I30H 4L8SB 4FFZL 1BP3B 2BX5A 5T1LD 2ZOKB 4PJDA 5DK2A 2XV6B 1ZHBB 4M1GL 2MQCA 3UJJH 3UTSD 3ULUE 3O8XA 1T1XB 2EE6A 1LO3L 5L9DH 2ZCKL 4M02A 2R0KH 3NOIA 1DTUA 4OI9A 1BZ9B 1FORH 4LP5A 3T2PA 4LSDA 4YK4C 1A4JB 2ESVB 2F53A 1RUKH 5TGBB 2HJFB 4L8BB 3UC0L 5HYJD 3HE6A 4S1SH 3MJ7B 4MA3B 3MV11 4NFDA 3GSOB 2VSDA 3CMGA 3HZKB 5C9JA 4X6EA 1YUHA 4GRWE 5C0AA 4XZUB 3WO4B 1SQ2N 5LXGH 1F4XL 1MFBH 1PSKL 1U42A 1MCEA 2LABA 3P2TA 4PGDA 1MCCA 4J1UA 5CEYA 5C0NC 1F6LL 1WICA 3REVB 4UQ2A 1N8ZB 1J11A 4G9FE 5L0QC 2VAAA 5EBWB 4JPVH 2VUOA 2BRQA 4TUOA 4U6VL 3BGMA 5GGRY 3S3SA 1G7PA 4LLWA 5CWSA 4YFLI 1INEL 2Z35B 3AMKA 1AO7D 1Z9MA 4KUZL 4DN3H 5GRJH 8FABA 1C5CL 4D3CL 3TZVD 5DVMA 2HJKB 1HQ4A 3AMLA 1YYMH 4O5LL 5ILTL 3RPIB 5AD0B 3EYUL 1KTLA 5T1KB 2AEPH 3BP5A 5C2BL 2BNRB 4IMLB 3SDAC 4KKAC 5C0RL 4HHAA 3MODL 3OKMB 3MLYL 4OFDA 4QXGH 4OZIF 4P2RB 4A6YL 2H2PC 5GS0L 5JQHC 3GSWB 3ZE1F 1CIUA 2C3GA 3DROA 3DIFB 5GISH 1A6WL 5ESAB 3NZ8B 3CFJA 4TUKH 4M1DL 3P4LA 3QDAA 4DKEL 3PQYE 2E9JA 3RGVA 4OF6A 3UJTH 2IQAB 4BFEA 1NCAH 1CF8H 3O4LB 4MAYC 2AJSH 1MY7A 3BPCA 3VDCA 1S7WB 1QR1A 4X7CC 3IXAB 3FQUB 3Q5TA 4U1JB 3V5KA 1UB6A 2F5BL 3P73A 5FFLA 3BDBA 5B38A 3QIBD 3ARGA 4HWBH 1X5ZA 3U7YH 2ZKHH 3QNZB 1U8JB 12E8L 3BAEL 1G7HB 3PWPD 4GS7C 2IPTL 3LS4L 1FLRL 3G6JF 1CXFA 3QEHA 1C16A 3U30C 1BEYH 3MLSH 4M5YL 3HN3A 3IU4H 4HWZA 5JW4N 3EGSA 1NMCC 4IOSD 3TH3T 3WJLA 3C60C 3ULVC 4P5MA 2VXSL 1FO0A 3DYMA 3WNLA 5ABDE 2DQUL 3MLWL 5HHOE 1S5HA 3E6HA 1LO5A 1KLGA 2IGFL 3P3YA 4LQFL 2BNUB 3TFKC 1KG0A 1NBVH 1XR8A 5DUBB 3S8WA 4WEUD 4ERSH 4TSCL 1T03L 4WO4C 2DB8A 4X6CA 2EDOA 4HKJB 1GC1H 5GGSB 3CUPA 2VLRA 1GPOH 1TENA 1T2XA 5C0ND 3SDCA 2FL5B 1NEZG 4PRDA 4QRTB 1FL6A 1AFVH 3OTTA 4NN5B 4Y8DC 3BVNB 3HZYB 3PNWB 1FNHA 3C8DA 2CJUL 2NW2B 1TNNA 3CPLB 1CXKA 32C2A 3UTPE 5JW4R 5IMOB 4GSDL 2B1AH 1FVEA 1FNSL 1CGWA 3FMGH 4Z76A 3QH3A 5F9JA 4XCYA 2W9DH 1UQSB 5I8CA 3SDAD 4KTEL 1IGCL 3G5YB 4KKAD 1I4FA 4G7YL 2H2PD 3JV6A 3SY0B 3C8KB 3LEVH 5IVOA 5IFAH 5FO9B 5C1MB 2XZCH 4AIZB 3IDJA 4FQ1H 4JG0H 4KRNA 4OQTL 3DLQR 3RI5K 1QO3A 3RTQB 1WIPA 3V5HB 1G9NL 1ACZA 1VGEH 4LSSH 4Z0BH 2V9TA 3GK8H 1PAMA 4JLRA 3WSQH 1K8IB 1RI8A 4L1HA 4MAYD 2HFFB 5EIVA 4GXVH 3VFSA 3VXPB 4OLXH 4F7MB 5BOPA 4H1LA 1MCHA 4OI8A 3U2SB 3DRQA 1JFQL 1YPZF 3NFPB 5J13C 3OXRB 4P2OB 1J1PL 1JMZA 1MCSA 2PO6B 2V2XB 1P4BH 4I48A 3TYFA 1WBYB 2K3TA 5TDNB 2NY2B 3LV3B 1MHCA 1BFVL 2DMKA 1FPTL 4BH8B 3EAKA 3EFDL 3ULVD 3C60D 3DYOA 3M07A 1P84J 3JUYA 3NCFB 3NCJL 5GRWA 3KR3H 3AREA 1QFWI 4WJ5B 4ELMF 4UT6L 3TFKD 4YWGH 4XVTL 1A4KB 3GZKA 5BS0D 1BJ1H 1HIMH 2B39A 4AENA 4LLYB 1SMOA 5TE7L 5IMKB 1I1YA 4WO4D 1SY6H 2EDXA 4PJFF 3ISWA 1JNHB 5EU4A 3RZCD 3GSXB 3TN0C 2AS5M 4FMFA 1NANH 1P7HL 3UEZA 2V2TB 3TWCH 1KULA 3F6IA 1CXHA 4LPWA 2E7BA 1UWEH 5CUSH 5LGJA 2BNQB 5JIPA 1RZKC 1UCTA 1HHHA 1RV6X 1BZ7B 1KT2B 5HI4C 4APQD 4LMQI 4FFZH 4BQ8A 4NOFA 4FN0A 2BC4A 4J3TA 3K1KC 3WFZA 4M1GH 2CD0A 4V2BA 1VFBA 1FZKA 1A7OL 1G7LA 1MLBA 5TE4L 3FKUS 1OF2B 5DJYA 2AXGA 4BJLA 5D6CB 1SJEB 1B2WL 2LTQB 4X80L 1XR9A 4Z0XA 4RAVA 2JELL 4LCIL 3UC0H 5C86A 4PJCA 3C5SB 4U7KA 4UQ3A 5GGVL 3CZJA 5DK0A 1ND0B 1RJZA 5TDPA 5KW9L 3UO1H 1WWAX 3QWRD 3L1OL 1EAJA 2X1WL 1GZPA 2EYRA 4R7NA 5FDYA 4PJ7B 3WJJC 3HLAA 4AEEA 4X4XB 4AT6A 4Z95L 4OGXL 5INCB 2P8LB 2HN7B 5J6HB 4U6VH 1ETZB 5HDBE 4Q6IA 1INEH 4Y4KB 3UTTB 5L8JB 4KUZH 1LHZA 1C5CH 1BX2A 4D3CH 5D2LB 5T3XL 2VLME 1S7XB 4NQEE 4O5LH 5ILTH 1LK2B 4WDIB 4YJZL 1W0WA 4CJ1A 4XPGH 2Y5TA 1R3LA 5GS1B 3DSFL 1IC4L 4EUPG 1ZSDA 1CFNA 3LN9A 1LEIB 5C2BH 4Y4HA 5C0RH 3MODH 1MCFA 3MLYH 3WLBA 1TZIA 4JRXE 4A6YH 4KDTA 4KK6C 5GS0H 2P5ED 1FG2B 5FA4A 2IALB 1RULL 1X5AA 3EOBB 3CAFA 2R1WA 3ARXA 4G6KL 1RHHB 1A6WH 4L4TE 3WE6B 1F45A 5IBUB 1B0WA 5I73C 3WFHB 4M1DH 4HIIA 2CUIA 4DKEH 3TIEA 3MRCB 5C0DA 2DDQL 5A2FA 3TN0D 4CN6A 3IDGB 1TTGA 3BZFA 2XZAL 1TIUA 4MQXC 1VKXA 4FQIH 1I3UA 1SYSB 5I16B 5KG9B 5EBLB 4JRWA 1H15B 3D0VB 4YGVA 3MRBA 3PL6C 2A6KB 4OLYL 5F6IC 3KYAA 5HDQH 5JR1L 4AEHL 2F5BH 2EC8A 2ZUVA 5IBLC 2EKSB 3S5LA 3J7HA 3QCUL 2VLJE 3L3DB 4ETYA 5HJ3B 5EBMB 3BZEB 3RPKA 12E8H 3BAEH 4G42A 4PJBA 1QSZA 1UKQA 2IPTH 3LS4H 2YSSB 1FLRH 4KI5F 1L4IA 3KHOA 4LF3B 4XP9L 1PDKA 1PZ5B 2AEIT 1JGDB 2PCPA 3JV0A 5IW6B 4LEXL 4M5YH 4G9DA 4R9HA 2DIAA 2G9HA 5C9KA 2W0FB 2NY3B 1LE5B 2WLYA 5ICYA 3LKRA 2VXSH 1BQHG 5F3HB 2QKIA 2P5WD 2DQUH 3MLWH 4LQFH 4RFOL 3MLVL 3GBML 1L0YA 3BXNA 3OBAA 4P9HL 1EFXD 4TSCH 1I7TA 1I3GL 4QHUB 2F9BT 2AV1B 2P24B 5JW5A 3ZT5A 4JQXC 5KAQG 3U1SH 1RZ7L 5F1IB 3C2SA 3SGKA 2Q7YA 3VXRA 4LNRB 3ZHKA 3IDMA 2XWTA 4QOKA 1HSAB 1BJ1J 1SVZA 2OL3B 4WU7B 1L9MA 3MNWB 2BDNL 2C1OB 2FZ3A 3LSOA 4UIMB 2FSEB 4GSDH 4P48A 3ILPA 3CH1A 4P57B 3B9KB 4JY6B 1FNSH 2FEDC 2P46B 4O58L 3MREB 4X7EC 4WGWB 1GAFL 1BJMA 5L2KB 3K8LA 2BK8A 1A47A 4KTEH 1IGCH 2EDEA 5BXFA 4G7YH 2X89D 1MQ8A 3ZSTA 4GKSB 1EAPB 2JB6B 1FGNL 4Z7VF 5FF6A 4X9IA 2MFNA 3C87A 4ZUTB 1KPUA 5HHVH 3OKEB 5H2BA 4OQTH 1GGTA 2N1KA 5CINL 4BQBA 2J8UA 2FEEI 1YMHB 3DI3B 1G9NH 1QA9A 3L3KA 2ATPB 3LPWA 3W9DB 4JQIL 2X44D 4PLJC 4MQXD 4PBVC 5IHZB 2I27N 3BIKA 1G7QB 1UWXK 2QADB 3O81A 1MJ7L 1GHFL 1Q9OB 3NGBC 3UTSB 1JFQH 4JCMA 1ZEAL 5IBLD 4UDTB 3V4UL 3GSUB 1J1PH 3O6KL 4DZ8B 3PHOA 3CJJA 4LSUL 2E6JA 3VXSE 3RNKA 1A5FL 4FRWA 1NLBL 3D5OF 5SWZE 3OJDB 3H3PL 4NQTA 1KEML 5BZDA 1QNZL 4JJHA 1FPTH 4HS3A 5E8NB 1DUYA 1CFSB 1XIWA 3EFDH 1O7SA 1U8NA 4NO5B 4CADA 5C6WH 1FO0L 1D9KD 4XPHL 4WY7L 4ZG1A 3BW9A 3NCJH 2V5RA 3JUZA 1A3QA 3BMWA 2OP4L 3CDFA 4UT6H 4OLWL 2X4PA 4MCZB 4XVTH 4GRWF 3GMLA 2P1YA 1FRGL 4ODVH 5KS9B 3UTQB 4PG9A 3E3QE 1OVZA 4U3HA 4OBRA 5I66B 1AO7B 1J05A 2J5LC 5D7LE 4H20H 2PR4H 3TZVB 1OQOA 3WL9A 5FYJD 2DI9A 1CTNA 3S7GA 4MXQC 4U1GC 4PRBA 5E08H 3FRPA 5IV2B 4Q6YA 2ED7A 2R29L 3DXAD 4UUJB 3T2NL 4M7ZB 5DDHB 5HVGB 1BIIA 1I8MB 5EO9B 4G8GD 1CGVA 1U8PB 2PTUA 2XYCA 3MMEA 4U1MB 2FEDD 1YY9D 1N7ML 5IB4A 3S4SA 5BVJB 3OAUH 1A7OH 4GG8A 4YXKH 5TE4H 1OT2A 2XG5A 4LPTA 1H0DA 5HY9A 5T1MB 2AW2A 1FL3B 1FFQA 1B2WH 3QI9C 4MAUL 4X80H 3LDBC 2FLRT 4M6AA 1J87A 3QEQE 5ERWB 4LCIH 4GAFB 3RZWA 2R2BA 1QSEE 4UNVA 5C0BE 4KKNA 5GGVH 3LOWA 3UDWC 5KW9H 2BJML 5D1ZA 4OCLC 3KYMA 3L1OH 5GGRA 3DV4A 1KXQE 1R5WB 1X5YA 4OZFH 2XWBA 3BKJL 1IGML 4L9LC 1P4LB 2WBWB 4ZTPL 3U48A 5FUOH 3QIBB 2R0WL 1CFBA 3QFDA 4Z95H 2CLZB 1ZVSA 5B3JE 2AXJA 2GITB 3CFKB 3CNKA 4M5ZL 1I8KB 3MV01 3MRGB 3KPMB 4P23D 4CVXB 3MYZA 5KAQF 3IJHB 4L4JA 3MR9B 2PTVA 1E27B 5HHMB 3F58H 3RVTC 5T3XH 5B3NA 3TNNA 4RAUB 1ZHKB 4Z78B 1YC7A 4JFHE 3QUKA 2DD8L 3F6LA 3MGTA 1IC4H 3SDXE 2VJXA 4TUJA 4CVWA 4P2CG 3CSBA 3G5VB 4NO3A 2BSTA 1MVFA 4YE4L 5IVZA 1QBML 5MEOA 2Q86A 3CX5J 1JZ8A 2HH0H 2OSLB 4BH7B 1RULH 3IFLL 2JJTC 3K7UA 4M7JL 1Q94B 4DKFL 5L0QB 3RWJB 3HUJA 2PTTA 4NHCL 4RIRB 2DDQH 1U3HC 1NCBL 4JFFA 2UZYB 5C0FA 2XZAH 3V6OA 3VXOA 4NJ9L 3A67L 5C09B 4MXQD 1PG7W 4TRPL 1NGZA 1TQBB 4OLYH 3QDHA 5GZOD 2DRUA 5JR1H 2V2WA 5IW3A 3GJFB 2VDNH 3QDMB 2NXZC 3QCUH 5H8DA 3DNKA 5M94B 4KRMB 1RZKH 5K9KA 1PQZA 1PKQA 3L5HA 2V17L 3MRQB 4RRPA 4K7PL 1KSRA 1X5JA 4PJAB 1PY4A 3MROB 4MMZC 3F62A 1S9YB 1FQ9C 4XH2B 4GJTB 4LEXH 1W72A 4ZFFB 3QI9D 4RDQG 4JZJC 5B8CA 1VENA 2NY5L 1GJIA 1QEWA 3Q0HA 4LDOB 3TT3L 4DK3A 4UOW0 1RURL 3FL7A 4RMTA 1ACYL 1MOEA 3QXAA 2VQUA 4MNGA 4RFOH 4MAYB 4XHJC 3MLVH 1EJ6A 3KPRD 1WAAE 4OIIL 2A6DB 3PWUB 4P9HH 2X05A 4G6FD 4P99A 1BFOA 3MUHL 4JM2A 1I3GH 2FX7L 3SGDI 3AM8A 1FZJB 4U1HA 1RZ7H 2FNBA 2A73B 4GS7B 1VACB 2CUHA 1CVSC 2BDNH 4FTVB 1CR9H 4LPUA 2A83A 1FYHB 3D69B 4G5ZL 3UTZB 1LWRA 4LCWE 3FO2A 3IFNL 2Z93A 2OTWA 3VH8G 4QLRA 4O58H 2Q6WB 1WFOA 2JJUA 2XT1B 1GAFH 2YUVA 3W9EB 1T22B 1CFVL 1J5OL 1FZOB 4GUPA 1BHGA 5E70A 2AXFA 4Y5XA 3SDAA 2VZTA 2UUDK 4WO4B 4X8JB 2BVUA 2KZWA 1FGNH 2ORBL 1CD0A 2ADFL 4I18A 5EFIB 3G6JA 1K6QH 4OM0H 2GTZB 5TE6L 4U1LA 5A43C 4JY5L 1GOGA 1VFAB 4JQIH 3PWNA 3BQUA 4U1IA 4R4BA 1OLZA 1VFMA 2H9GA 4NKMB 2YD1A 1U8QA 3GO1L 4KXZH 4YPGB 4JJ5B 2EXYD 5HDLA 4F9LA 3VJ6A 3LIZL 1MJ7H 1GHFH 1U2CA 3T0EE 4Z5RB 2DQCL 1LDSA 1WCBA 1ZEAH 3V4UH 4F33B 4LVNB 3O6KH 5ACZA 4R7DA 2NXZD 3BOVA 4LSUH 4MZ3A 2IH1B 4D9RD 1OSZA 4N5EC 1A5FH 1NLBH 2J88H 3H3PH 2W59A 3L5JA 5ANMA 4QHKJ 3MGOA 4YHNB 1KEMH 4MA1C 1FYTD 1RUAL 2WQRA 1TPXB 4NZDA 3MV8E 4OZFB 1EEQA 1A9EA 3PDOB 1XH3A 4XNMB 1A02N 3BSZL 3D39B 4NNXA 3OKOA 5I74C 1FO0H 3STZB 3DHJA 3NIGF 4XPHH 4N0UA 2YR3A 2NTFA 4OZGF 4D0CB 1KF9B 4EDWL 5AG9A 3EO1A 2OP4H 3TO4B 4OLWH 4XHJD 1ZGLM 1BIHA 3OKKA 5C0IB 1FRGH 5C07E 1YMMA 1QQDB 4PRPB 5SX5K 4NWUL 2YEZB 2CIIA 1JPGA 4RAHA 4PGCB 1FV1B 2X4RA 3WUZA 2OI9B 3MFFA 4HIHB 3RZCA 1WBXA 2CKBL 5BZWA 4WUUD 2BY0A 2EDNA 3LKNB 4LLVB 4K07A 1M6OA 3HB3C 5EWIH 1JPFA 3ARBC 2R29H 3T2NH 4GRLC 1P6AB 4KK9C 4E5XA 5IMMA 2HA1A 3TBWA 3SJVE 2Y07H 2L4OA 1F2QA 1Z0NA 3X11A 4YDJB 4APQA 3JV4B 1AIFB 3EFFB 2X4UB 2ADJB 4WFGE 3IFOB 3TO2B 4G80A 4I3SH 5CEZL 4FQ2H 3RL1B 3SOBL 4MAUH 1T0NB 2VLKE 1YPZA 1KJMA 3NCYS 4JPKL 2W07A 4NN6B 1NCDL 4X99A 1IEAB 1N2RA 3U36A 3VDAA 1DBKH 5ETUA 1N5YL 2LFGA 1NGWB 2BJMH 5C3TA 4RDQF 1B0RA 3MRJA 1UJ3C 4JN2A 2EXWC 3HCVB 5L6YL 2XI9A 3BKJH 1IGMH 3R4DA 5D7IE 5GS3A 4ZTPH 4F37K 5DK2B 1OB1A 4F3FA 5IB5A 2R0WH 1K4CB 2H8PB 3KYOB 4YEFA 1WWWX 3GSQA 5TF1L 4M5ZH 1KTKE 2F53B 5JOPE 1JI2A 4YHIB 1NSNL 1QLFA 2WP3T 4M62L 2O61B 5IQ7L 3H6JA 1JGEA 4N5ED 5EU6A 3MV7D 4X6BA 1LE9A 1JUFB 5I8OH 4OD3L 1I85C 1YUHB 4PJ8C 2OS7A 3D25A 2R4SL 4K9EL 1CIDA 5B39G 3P9LB 5IFHL 4JFEA 2VQTA 3RUGE 5INDA 1QRNA 4PGDB 1B6UA 3M8OL 3DO7A 2P49B 3DX6A 4YHPB 4YE4H 3LMJL 2AJZA 2BP3A 5D7JC 1QBMH 4LAQL 3VI4F 3EYFB 3N85H 1XAUA 4XMLL 3IFLH 4TUOB 5HHQA 3QDJE 3GM0A 2G2RB 1G7PB 1U93A 5CWSB 3G6AA 4M7JH 1NJ9A 4DKFH 1HDMB 3WLWC 4NHCH 4M9PA 3EYVA 3T1WA 3KWWA 1S7UA 3SE3A 1NCBH 1OGTB 3GSRA 1OTUC 1KTLB 5DJ2B 2R4RL 4HGKC 1U8OA 1UZ6E 4EQ3A 4KRPC 2BHYA 4NJ9H 3A67H 3HB3D 3I75A 4TRPH 5HHNA 5EN2B 4GRLD 4KK9D 2YPLA 1O5DT 1WBZA 1AC6A 1YA5A 3DROB 3GKWL 2DIBA 2D3VA 1BD2E 3CFJB 3HR5A 1G7JA 2V17H 1X4ZA 4K7PH 1LEGA 3QDGE 5GHWL 3SKNA 4HDIB 3RGVB 2NY4C 3GDBA 1P7KA 4KAQL 1CE6A 1QSFA 3DARA 1MCBA 4DVRL 2FGWL 3GKZA 4OAWA 2NY5H 3NCMA 1E0OB 2M26A 2D4DA 3BPCB 1A14L 3IRPX 3TT3H 1T6VN 1NQBA 1RURH 4X5XB 4JAMB 1ACYH 2C4FT 1BF2A 1UB6B 1F8TL 4L4VD 1KIQB 1SJHA 4M8VA 4KJPC 4OIIH 5DI8A 2EXWD 5F9WB 3VXME 2P47B 4YFEA 2FX7H 3EO0A 3PL6B 4LPYA 5F6IB 1AHWA 2DWEA 1M7DA 4WW1A 3TA3A 4JHWL 1H8SA 3QEHB 1C16B 4LGPB 1MQKH 3BMVA 4MD5A 2Z9TA 4HWZB 1YDPA 4E42B 3EGSB 3PGCA 1FO0B 2UWEF 3TH2T 1ED3B 2NX5D 2BXZA 4GLRH 4ZDHB 4G5ZH 3VXUD 4NQCD 4BM7A 2BFVL 1KG0B 4PJ8D 3RWIA 2Q3ZA 3KS0H 3RHWK 5MEPA 5IROA 3IT8D 4OUOA 1CFVH 1G6RL 3IS0X 4LMQE 1J5OH 4MCYA 2H45A 1ZLWK 5M7QA 3CUPB 2VLRB 5D7JD 3MRNB 4JVWA 3V8OA 3SDCB 1BAFL 3QNXB 1CD8A 5EC2B 5JHDD 1L0QA 4PRDB 3BRDA 1FL6B 3JWDC 4CRPA 4XBEH 1BFTA 4X9BA 4Q9CA 3RI5F 2VITA 4ODXA 4YHKL 32C2B 5HGHA 2ORBH 1Q1JH 4GW5A 2BVEA 4EDXA 1RPQA 3F5WB 3DX8A 2ADFH 1UH3A 3WLWD 5TE6H 4PY8I 1WJ3A 2EDDA 4JY5H 5KANG 1CGTA 4Z76B 3IJYA 1JHTA 1R5IA 1OTUD 3CK0L 5I1AA 1CT8A 1HSBA 1YEDB 2I07B 3CSYA 3QIUC 4FNLL 4KRPD 4FP8H 3W5NA 3O6LL 4BYHA 4ALAL 4RMSA 2GUOA 4FFWC 2FO1A 4PJ5E 3LIZH 3KJ4C 3JV6B 2DQCH 2KH2B 3FO9B 5TDOA 4XCNB 5DJCB 1RUPL 3MBED 1Y18B 1ZS8A 2VXVL 3MJ6A 3VFRB 5TJWK 4UAOB 4EXKA 1BECA 4DUXA 2ZUXA 1QO3B 2H32A 3IFPA 5FV2A 1JZ7A 3EJZC 3RJQB 1YQ2A 2VISB 4GG6A 2NY4D 3K80A 4LRNH 2WQ8A 5DJ6A 1D5XA 2RHEA 1W72L 1AKJD 2I9LA 5DJZA 3BSZH 5FYLL 1NUGA 1PBYA 5IVXE 3QRFM 4JDZB 3LPGA 4EN3C 4ZTOL 2AQ2A 4EDWH 1D9KA 4MQ7A 3CDGB 5D70L 3TV3L 1HHKA 1F6FB 1UJTA 1F3RB 2UZIH 1I8IB 4KJPD 1X5GA 4NQDA 4EJ1C 1X5KA 2H26A 4NWUH 3FB5A 3NGBB 4L3ED 1T89A 4W6YB 5SWSA 3RVUC 3I2CL 2C1PB 4LPXA 2CKBH 2VE6A 2PW2A 1V5JA 4Z7VA 5B3JF 4I2XB 2FIKA 2NNAA 1HOCA 4J3XA 1T21A 4JRYE 2AK4A 5C8JA 1KIUA 3AREB 3WFDH 3ARFC 2FD6L 1GZQB 4CNIB 3HI6L 3RIFK 3MZTA 5KJRL 1NAMA 1I1YB 2VDML 3EOTL 2UZXB 4ONFL 3SDXF 5MHSE 5CEZH 1M71A 1FNGA 2HLAA 3SOBH 1TJGL 5KTEL 3QISA 2XXCB 3IKCA 5GGSY 1T04A 4JPKH 4ORGA 2HYMA 4P3DA 1NCDH 1N5YH 1QUNA 2J5LB 1JZ3A 2APTA 1KTDB 3HFML 3T4AB 1NFDB 5L6YH 4LVEA 3ARDC 4NUGL 4WHYH 3OGOE 5F6HJ 3QUZB 2P42B 3QIUD 1G0XA 1VFBB 1FZKB 2HLFC 1AD9A 5EIIB 1G7LB 5IG7B 1IM3B 1MLBB 1X6LA 3EW3B 5DJYB 5TF1H 1TVHA 1U95A 1CL7I 3L5XL 4PJEF 4RAVB 5TH2B 1NSNH 2RJMA 3B3IB 1AGEA 1HH9B 3H2WA 1HINL 3QG7L 4P46A 5ISZE 3B9EA 4P23A 4JFDE 5IQ7H 4HX1A 3QI9B 5DK0B 3LDBB 4OD3H 3SQOL 3R0MA 2R4SH 4K9EH 2EIDA 2VDRL 2EYRB 5IFHH 2VXUL 4G9FA 4ZAKA 1XGPA 4S1QL 5EUOE 5IB2A 3M8OH 3HLAB 5TQ2L 5F97E 1ZHLB 4P5TA 4AT6B 3LMJH 3RWHA 3IDYC 1A8JH 3B9AA 2F74B 3IGAB 4LAQH 4RFNC 2VDOL 4EN3D 2N4IA 4L9LB 4XMLH 1S7TB 5GRVK 3OKNA 5DUPL 3EDDA 4WW2F 4U3XA 3KS0J 3V6ZA 5HYFA 3JV5A 4JY4A 4P4KA 2WW8A 4HKBA 4PD4K 3T4YB 1WAAF 1ORSA 2YMXL 1W0WB 3RVUD 1T5WB 3P77B 2W91A 4Z7WE 2D7NA 4HCRA 4RGOH 1MJJA 4TNWK 1WUNT 1DUZA 1T83C 4Y4HB 5D72L 4X9FA 3FTGB 5E5RB 1A6VL 3QEUA 3RAJL 1ZXQA 1RK0A 3PQYA 4WU5A 3S3PA 1BQHA 3NCYP 3GKWH 1VPOH 3ARFD 1MF2L 3VFUA 2IBZY 4I77L 1UKSA 1F00I 1SHMA 3TH4T 4HIIB 2C4FU 2VDLH 5GHWH 5C0CD 5BV7L 1GCFA 4CDHA 2WWKO 4HLJA 4N1HB 4KAQH 5IM7B 2M1KA 3BH8B 4DVRH 5E5MB 2FGWH 1RD6A 3MUZ1 1NL0L 3BZFB 1TVBA 1VKXB 5FXCH 1A14H 3OL2A 3C5JB 3O41B 4M7LL 3R06A 4XP1L 1U3HB 4P2QD 3ZKXC 1MIML 4JR9H 5F88B 2WINA 1F8TH 5DA0B 2VR9A 5E1AA 9CGTA 1DFBL 4LHUG 4PJDE 1Z9SA 3KPSD 1U91A 3MNZB 4JVPA 5K9JH 3ARDD 4G42B 2NYYC 3RIAF 2B0SL 4XMKL 1FFPA 3ES6B 1AE6H 4JHWH 4Y8AA 5KSUA 3IDIA 5ESVB 1FNFA 1X9QA 2PCPB 3G04A 5HHOA 3V2AR 3VFMB 1E4XL 5MEQB 4G9DB 2G9HB 3W11C 3T1FA 1FYTB 1C12A 1AGBA 1HN1A 3LKRB 5JPNB 5AYQA 1P2CB 4WTZG 3RWGB 4NP4L 5E6YA 5C0AE 2DQIL 3GMMB 4WHTA 1VEOA 5CJ5A 3KLAA 5ECJE 3BXNB 4CBPA 5D8JH 5EOTA 5E1HB 1T7XA 4Z7UB 2Q87A 4F2MB 3K2UL 1G6RH 3KLSA 5JW5B 2WUCL 3CFIC 2QEJA 4Q97A 2A74A 2CKBB 1BAFH 5FECB 3ZE2E 3IDMB 4QOKB 3UBXG 1F90L 1T5XB 1F97A 4YHKH 4FZEH 4GQ9L 5D2NE 2ENYA 4GXUN 3ILPB 1G84A 2D0GA 5FYKE 2Y1VA 5DQDL 3CK0H 2KDGA 2XTJC 4JFQB 5D6DC 1RJLB 4FNLH 5E4EC 3DURA 1FN4A 2NLJA 2R1YA 4S1RL 2VR4A 1UZ8A 3U4EA 3O6LH 1PEWA 2LAAA 4K71B 4ALAH 3CFCH 1CU4L 1LGVA 1KN4L 1YECH 3L6FB 1J1XH 3JTSA 3X17A 1DQDL 1U8LA 2YXFA 3O6FA 2P48B 3DX9A 4OM1L 1RUPH 3T65A 3BEWA 1TZHB 1KCRL 3K81A 4XP4H 5FEBA 1JPTL 4ETQA 5H2BB 4EZMA 2ESVE 2J8UB 3X3GL 4IMKA 3P9MA 3I50L 4KVCL 5FGCE 2BSRA 3FQTA 5IGXL 3X13B 2XQBL 5FYLH 3MO1A 4EVNB 3BIKB 1H9VA 4ZTOH 5ENWA 1GGBL 1ES0A 1J1OH 1OP9A 4X9GA 3N1MC 3HG1B 3QHZL 3TV3H 3FZUC 1O0VA 1FSKC 4JZNA 5IVNA 3PHOB 4QRRB 2FIRT 4DUVA 3RNKB 4R8WH 3HE7C 3Q48A 5J1AB 1IEHA 1H5BA 3VW3L 1ZT1A 2NYYD 3CXHK 3I2CH 1NDMB 5BZDB 4YDIL 1MNUL 2BVPA 4Y16A 3MV7B 1A1NB 2V9QA 5J89A 4WUUA 1MCLA 4U6YA 2DQJL 4XPAL 4M61A 3W11D 4OCWL 4J6RL 1RIUL 4V1DD 4Y7MA 3BW9B 4ZPVA 3DMMC 3S37L 3WKNA 4PRHE 3EHBC 1GSMA 4OT1L 4R96A 2X4PB 3R1GL 3QPQC 2FD6H 3GMLB 3HI6H 3OR7A 5KJRH 4PG9B 4R90H 1LP9E 2YPKA 2VDMH 3MJ9A 5HTSA 2R56L 3EOTH 4ONFH 3RL2B 3RUGF 2COQA 1INQB 1T1ZA 2BVOB 3QRGL 2EIZA 4BFIA 1KOAA 1NC4D 3DHMA 1J05B 1TJGH 4XAKD 2X09A 3N1QC 5KTEH 3WL9B 4D8PA 5E2UH 1UB5A 4YHML 4D0BB 4PRBB 1CFQA 3MTRA 4NRXA 1EZVY 1N26A 2P44B 1N5AA 2XICA 4Y5YA 4NGHL 1BIIB 3O4LE 3F12B 3HFMH 3HZVB 4L8DA 3C5ZA 3K46A 1LILA 3ARBB 4JCLA 1HHGA 2W60A 4GRLB 3O9WC 4NUGH 2IQ9L 1CS6A 2XTJD 4QRPE 3BD5A 1UZ6F 1MRDL 4NZTL 4MB5A 2F8XC 1H0DB 1FVDA 5HY9B 3V4VL 3P0YL 2R1XA 2YD9A 2YZ1A 4LPVA 1ZA6A 1CE1L 3QG7H 4UU9B 3LZFL 3CFEB 3GB7A 2AERT 5CJOH 3EOYG 5ACMA 4O4YL 3FQNA 4XB7A 3SQOH 5GGRB 2AP2A 2VDRH 3DV4B 3MLZL 4M4RA 4LBEA 2VXUH 1T1YA 2ITCA 4LCCA 1Y6KR 3S36X 4L4VB 4S1QH 2D31A 1UJ3B 2X4TA 3FN3A 2VDOH 2XA8L 1LD9A 4NQEA 4MD4A 4HW6A 4QRUA 3DSNA 3C2AL 3MLUL 2FH8A 2K7PA 4RGNE 4UV4L 5CEXB 3QJFB 2D9QB 2YMXH 3HE7D 4KQ3L 3DX7A 1LDPL 4OCMC 2NX5B 1A7QL 4JRXA 3MGTB 1KIRB 3TBSA 1LK3H 1BBJA 4YAQA 1G6RB 4LEOB 1OGAE 1TETL 4GO6B 4LARH 4NO3B 2CLVA 2P7TB 4PJ8B 5D72H 5IVZB 2ARWA 4XNUL 4L4TA 2Q86B 4I4WA 1F58L 3RAJH 5ESQB 1U3ZA 3GMPB 1MWAB 3DMMD 2LV4A 1EMTL 3EHBD 4P4RA 1EX0A 3SKJL 1MF2H 3QPQD 4I77H 1WZ1H 5SWQA 5JHDB 4U6XA 1NAML 3HUJB 1YN7A 2PTTB 4JFPA 4MNQD 5F7EH 4Q74A 4X4MA 5BV7H 5CHNA 5IOPA 8CGTA 3TBTA 2Z31A 4BFGA 4NRZB 2BOBA 4WI4A 4HV8A 1DBJL 3FN0L 1KB5A 1NL0H 5EUKB 4DGYL 4M7LH 5K59F 2QQNL 4XP1H 2VLJA 5EOCL 2BCKB 1SM3L 4M8QB 1MIMH 3O2WL 1NGZB 1F4HA 4Y5VC 2V2WB 4KRPB 2D2OA 2F54D 1T66C 2FWOB 3ULUL 5KVFH 5EDXA 4HT1L 1DBAL 3L3HB 1DFBH 1S9XA 1DR9A 2BY1A 4PGBA 4X6DE 2FECI 3CCHA 3O9WD 4MNHA 2B0SH 3STLA 4XMKH 1J9CT 1F4WH 1OAKH 5DVNA 5DJAB 4QT5A 5J9PA 2BHZA 1YEIL 3STBA 1E4XH 3WN5A 2ZG1A 5B8CB 3CMOL 3RVVC 1OY3B 4AMKL 3BKYH 2NY4B 2X5PA 4XPFL 2VH5L 2V6HA 4Y2DA 1AKJB 4K23H 4D0DA 4NP4H 1T1WA 2DQIH 2H1PL 3C09C 1B4RA 4CJ0A 2IMMA 4HIJA 3VXUA 5IR1B 2Z4QB 4GBXC 2W9EL 3C8HA 3Q1SL 3LS5H 1BFOB 2XZQH 4JM2B 4ZD3H 5HGBA 3K2UH 3C6SB 3QFJE 1OWRM 2CDFA 2WUCH 3U79A 2JK5B 3UCRA 5HPMB 3MRMA 4U1HB 3RKPA 1MAML 2X9XA 1FIEA 1LEKB 3VFTA 1F90H 4YQXL 1E4WL 4OLZL 4UOJA 4ESKA 3NABL 5FO8B 2A83B 4GQ9H 1H3TA 1TCRA 4HXBL 3WNNA 5J06A 1JWUA 3B2UC 2C7UB 3BX7C 4M48L 2FX9L 1PX3A 2BNQE 1S7QA 3VGGA 5DQDH 3B6SA 5E6ZA 2VZUA 4S1RH 4XAWL 4GUPB 1INDL 1CU4H 4ZO6A 2AXFB 1RZGA 4C55A 5ICZB 4Y5XB 2IAND 1CLYL 1DQDH 4LAJH 4PLKC 4WWKA 3R8QA 4UTAL 4KWUA 4ZXBC 4OM1H 4TSAL 4TVPE 3T8XB 3AAZB 5HYSG 1KCRH 3DRTA 1P6FA 3EIFA 3MBEA 1JPTH 2WSKA 4C4KT 1H3VA 1KIPB 3F7YB 3X3GH 4XWOC 2FJHA 4U1SA 3HI1A 3HI5H 3ULSB 3WKML 1QTYT 2DLIA 3IAPA 3I50H 5A3IC 4NC0B 3BQUB 3PGDA 4UINL 5IGXH 1I7UA 3GSVA 1KCLA 1NBYA 2XQBH 2UWEA 4FQXA 1U8QB 2ICWB 4WIQA 1GGBH 3VXSA 3L3OA 5DHYA 3SBWC 5C08E 4LSQH 3QIUB 5SWZA 3QHZH 3S35X 1RUQL 4PJ7E 4GAGL 1FVCA 1N4XH 2X4QB 1M1SA 1OSZB 4PJBE 5IFJA 5LCVL 3T0AA 2MHAA 2NTSP 3KNBA 4NO0A 3SO3C 2CDEA 3VW3H 3MGOB 4QXTB 3O3EA 4L3EA 4JGUA 1OP5H 4YDIH 1MNUH 2JJVA 2YPVL 1A9EB 2N56A 4RZCA 5CCKL 5CLTA 2DQJH 4XPAH 1GOFA 1P69B 3QP3A 3GJFK 4OCWH 5EOQH 5E7BA 4J6RH 4NNXB 5DTFA 3RVVD 5ID0B 1RIUH 3ZYJA 1JHLL 4Y1AD 3S37H 2WANA 2CIKB 4YFDB 4N9GA 2APBA 1F3DJ 3DO3A 1NH6A 3R1GH 1L7IL 4P9ML 1MRFL 1PKOA 5CP7A 4N0FB 4GBXD 3P30H 5D7LA 5AUMB 5DHVA 1YMMB 3LKSB 1V7ML 2R56H 2CIIB 3HHRB 3S6CA 1GGCL 2X4RB 2IFFL 3CU7A 4X6FA 1WBXB 2DM3A 3KYKL 3BN9D 5F70A 4TYUA 2VWEC 1M6OB 3VXTA 2ERJC 4HKZB 4YIQA 1JPFB 3VWJC 3H42L 3WIHA 2YUXA 4E5XB 4NUJA 5IMMB 4NGHH 3WHE0 3TBWB 4XXCA 4ZFOL 4ZS6C 4F37F 2WBJA 3B2UD 2AJVL 2B5IC 1OLLA 3H9SD 2ZSVB 4PGZA 1CG9A 5GZNC 4HLZH 1K4DB 4HZLB 3D0LA 2IQ9H 3W39A 2NY0C 3QEQA 1KPVB 3I6LD 5BV7B 3IVKB 1MRDH 1QSEA 4G80B 4NZTH 5C0BA 5B39A 4I5BA 4I0PC 3DGGA 3PABA 3V4VH 2ARJB 2PXYD 1JK8B 2X41A 1C7SA 4PLKD 2GSIB 2VSCA 4NHUA 1VSCA 5EPMB 1FH5H 3HAEH 1ZAGA 4ZXBD 3LZFH 2XKUA 2WV3A 4Q0XL 1CWVA 1N2RB 4IEFB 3U36B 3OV6A 5ETUB 5E9DB 1P1ZB 3F65A 2HVKB 4O4YH 2IAMA 2YK1L 4M03A 1J0YA 2V7HA 4XWOD 4DGIL 3KYNB 4YHYC 3MLZH 4H8WL 5E94A 2EDTA 5A3ID 5A2KH 5DGRA 1VEPA 4R3SA 5DHXB 4F3FB 4LKXA 4IDLA 1JWSA 4JFOA 3F7VB 3GSQB 4ZO7A 3ARDB 5CBAA 5HYQA 2XA8H 1D7FA 2ADGA 4HXAL 2APXA 4PYHA 4RNRA 3C2AH 5LAXB 1QFPA 2PYED 3GIVA 3MLUH 2DWDA 4MLSA 3VRLE 4UV4H 3SDXA 1VESA 2F58L 3Q5YA 3QIWA 2H3NA 2VZOA 4WEBL 4X6BB 2QL1A 4KQ3H 1X4XA 3TBYB 1XMWA 1OP3H 4KROB 3ZMRA 2ED8A 4OLUH 4LASL 1A7QH 5D1QC 2VERN 1U92A 1QRNB 1S9WA 1TETH 3DO7B 4C56D 5I6XC 3DX6B 1TTFA 4XGZB 2AJZB 3ECBA 2OTUB 25C8L 1G7IA 1F58H 4IIQC 2Z92A 5HHQB 5F7MC 1EMTH 1U93B 3BKCL 2YD7A 1BVLA 1NJ9B 5CD5C 1CDHA 1DBBL 1J8HE 1NAMH 3Q6GL 3P4OA 2V5YA 3EYVB 3MJ9L 1KACB 5T1DL 4OZHE 1F5WA 1WSST 2QQLL 4JFXA 5I2IA 1R6VA 5FOBA 3SDDA 4OIBA 4H26B 1DBJH 3FN0H 2XA3A 4DGYH 2R2EA 4OKVA 1X5FA 2QQNH 2WMPA 2YD3A 1VEMA 3BIBX 5EOCH 3VWJD 5HHNB 1SM3H 3EYQD 3O2WH 3RU8L 4WHCA 2YPLB 2CUMA 1WBZB 3HRZB 1NCNA 4ZS6D 5IKCA 1UWGH 4KV5E 2WIMA 3ULUH 4KRLB 4HIEA 4BK4A 1DBAH 4J4PC 5GZND 3BPLC 1D5BA 1JN6B 2E3VA 1U0QA 3KPSA 3FO1B 3UTSE 3WO4C 3VFOB 5J3HC 3B5TA 1DANT 2Y36L 5JLZA 4I0PD 1IKFL 1H3PL 5FDWA 1QSFB 2W0KA 4WW2A 2E7LA 4YEEA 1AQKL 3Q6FA 4JFYA 4OAWB 1WFTA 3K8KA 3CMOH 5HYJE 1ZWIA 2NQCA 2PW1B 4XPFH 1WAAA 4HUXB 4OCYL 3SGEH 2VH5H 2IADA 5F96L 3QWQB 3RHWF 2H1PH 3SGJA 2C3VB 5JNYA 1IC5L 3MRIB 5DI8B 3PJSA 5DEFA 3EO0B 3T0XA 5LWYL 3FB7B 2DWEB 1M7DB 1W0VB 1UVQA 4MA7L 1YC8A 4WW1B 3TA3B 1U41A 1MAMH 1QBBA 5DRZA 2DLEA 2AV7A 1X7QA 1YDPB 4LCWA 2R15A 1MVUA 2E8YA 4XI5C 1E4WH 4OLZH 1AO7E 3PP4L 3NABH 43CAB 2JIXA 3HPLA 4HXBH 5EO0A 5F1NB 3LH2L 3MJGX 4LGSB 3WD5L 2FX9H 5JZ7C 1KYOK 2DAVA 2F8OA 4V1DB 4N1EA 4PJ9A 2YUZA 4PV9B 3SE9L 3ZDZE 3O45A 3ELAT 5MEPB 5B21A 4RFEA 5D1QD 3U7WL 4XAWH 5DQ9A 2X42A 4LRIA 4MCYB 1A9BB 2GJ6D 1INDH 4PJGB 4S10A 3OJ2C 1CLYH 3RWFA 4UTAH 5MEND 4NKOA 5J4MA 4TSAH 1LNUB 1P53A 1NC4B 5SV4A 1T0PB 4ODXB 5HGHB 1U6AL 2W65B 4IRJA 2FATL 4MX7A 1ORQA 4WI5A 4MDJA 3PWLA 5T3ZD 4PTUA 4BFBD 3I02B 1JHTB 1R5IB 5F71A 1HSBB 5I1AB 3CSYB 4UINH 5J12C 1KB5L 3U4AA 3VI3E 1QD0A 1L9NA 4KUCF 3C9NA 2GUOB 4AG4L 2B4CL 3AVEA 4ODSH 3ZTJH 1RJYB 5JQ6L 1NLDL 1FC1A 2XTJB 3U0WL 5DS8A 5E4EB 5TDOB 1RUQH 1AXIB 5MERB 3HAEB 1G0DA 3I84A 4XRCA 5IW1A 5MI0C 3MV8A 4J4PD 3IAGC 2DQHL 4KVNL 4EIZC 5LCVH 1QZ1A 4NZUH 3PWPE 4M3KB 2VXTL 3IFPB 3OXSA 5IB1A 5J3HD 1JI1A 4GG6B 2CRIA 4NFCA 2YPVH 3WFCH 4ZO8A 3HMXA 2I9LB 5E95B 3OWEA 5DJZB 5E03A 5L2JB 5CCKH 4XCEA 3LPFA 4RQQA 3TNMA 1XCQA 3DVGB 4LLMB 1C5BL 3NCBB 4MNGE 1JHLH 1GGYA 5C07A 1J0KA 5ICXB 3RIFF 3WS3A 4N8CL 3ZE0F 4YHOL 5EORL 3HC3L 1L7IH 3RFZC 4P9MH 1MRFH 3BH9A 4NNYB 1QHOA 3JSSA 4L8CA 5KOMC 4NQDB 1I8LC 4O2EB 4CGTA 3TCLA 1V7MH 4OZIE 2R0LL 2YD2A 4IDJL 1GGCH 1ZHNA 2IFFH 1U8HA 1FSKB 4JANB 5GIRB 5T1KD 3SKOA 3KYKH 2VE6B 5FM5M 5FA3A 1IGJA 5BVPL 1KJVA 2BNRD 3M1BA 4Z7VB 1AR2A 4B53A 2FIKB 2VB5A 3IETB 2NNAB 5I19H 4XI5D 4P2RD 5E4IA 2H2SC 4K3DL 2AK4B 3RWEA 2EKJA 4EI6B 5C8JB 2AJVH 1Q9LA 2QLVB 1A3LL 3V52L 2ENSA 5JZ7D 4KUCD 1XF2B 3VG9B 3ARYA 3E8UH 1MFEL 5EU5B 5DJ8A 3RTQC 1NAMB 3RX7A 2VLKA 4KZDH 3QAZC 2GHWB 5DRNB 5KSAA 1FNGB 1MHEA 5GGUA 1T04B 1D5ZB 4PJAE 4OLEA 1X3DA 1R3HA 2OZ4L 1EA9C 5D7IA 4G8FB 4HJJL 3HC4L 5IBUG 2YK1H 4P2OC 5CD3B 4DGIH 1IJ9A 4H8WH 3HC0A 3HTLX 1OAQH 4BKLA 2NY2C 3VGEA 4N8VB 3OF6D 4GW1B 4Z8FL 1T20A 1NGQL 5F7WC 3OQ3B 1TVHB 1IAKA 1AR1C 1U95B 4HXAH 4XVJL 1RZ8A 1PG7H 1KCUL 4P46B 2DL2A 2MQ3A 3HS0A 1DZBA 3RUGA 2FR4B 4F7CA 4TNWF 4WEBH 2GFBA 4HK0A 1DQML 4QHMB 5JA8B 5CGYD 5DD0L 4FXKB 3QUMH 4ONHB 3MYJB 1WLHA 2Q7NA 1IAIL 4ZAKB 2YOCA 1NC2A 3QDJA 2R69L 2A6IA 1FFNA 2R2HB 3BHBA 4P5TB 3ULVE 4J3WA 25C8H 1K8DA 2HTLC 4KHXL 3OKNB 2Z0BA 3VXQA 5HHPA 2D7TL 1Z5LA 3IU3A 1WT5C 3BKCH 4HG4J 4JY4B 4F7EB 1HKLL 1GYAA 5BS0E 1WQVT 1DBBH 1K2DB 3Q6GH 3MRFA 4NRYB 4W68A 3INUL 4HK3N 3MJ9H 1S9VA 3VFPB 3HZMB 5T1DH 3JVGA 4MNQA 4LHUA 2QQLH 2YD6A 4KJQC 1CXIA 1JV5A 1FBIL 4P5KA 1DUZB 2Z8SA 5D71L 2FJFB 3MRRA 1MIEL 2EEAA 1HILA 3QQ4A 5C71A 3S9DB 4NQXA 1BD2A 4HZAA 5IV2A 3S97C 3QEUB 2H2SD 5CSZB 1RK0B 2KPNA 3I3EA 1HHIA 3IF1B 3QDGA 4LK4A 1KJ2A 4J23A 2GAZA 1A6PA 4WTZA 3RWDB 3D18A 1WV7T 3G5XB 4FFYL 3RTQD 5FB8A 4Z18A 4FXGB 4W6XB 3X12B 4U4BA 1IKFH 1H3PH 2XFXB 1A1OA 2GK0A 4PGJA 5FIEA 1AQKH 2MNUA 4HC1A 4K7FA 1AC0A 4JHAL 1P7QD 1BVKA 4Q9QL 2XXMB 3R06B 3TP4A 4OFYD 3ZT7A 1OD7A 4DCQA 3KPNA 3VU2A 5ITFB 3UBXA 5BJTB 3ABZA 4ZNCD 3QZWB 5K9OA 1P4IH 1M7XA 4P2OD 4QTHB 3T04D 1IC5H 1S8DA 1WGOA 3WBDA 1U91B 5I9QC 5T33L 5IEHA 3MRPA 1EUUA 5LWYH 2OBGA 3MRDA 3ZKSD 2JJSC 1FZMB 1FFPB 4MA7H 2NY2D 3BN3B 3OR6B 5GS1C 5FGRA 4K7PY 3NVQA 4ELME 2B2XL 3RNQA 3G04B 4K3GA 5DC0A 2Z8RA 1AR1D 1GC1C 3T1FB 3QNYA 1FP5A 4JM4L 1C12B 1AGBB 4QRSB 3MACL 3PP4H 4PJFE 5I0ZA 4PJ7F 3L9RA 3T0VA 5CZXC 2Y6SC 4LIQE 2X1PA 4E41D 3IYLW 4WHTB 3WD5H 3GJEB 3KLAB 1JNJA 3QXWA 2XOTA 3OPZH 4R2GB 1MCPL 3SE9H 5EOTB 1Q0XL 3QBTB 1KB9K 5EZIL 4BZ1L 5D5MB 2W0LA 3C09B 4BK5A 5D2LF 1OAUL 4GBXB 4S0SD 4ZPTB 4F7TA 2P5EE 4FQCL 2WIIA 3MCKA 2HTLD 4ZNEE 3VD4A 5SX4H 4MMXC 1IFHL 2ZSWA 5GRYA 4U1NB 3HNVL 3NAAL 2FATH 4ZFOB 1E6OL 1G7MB 3T0EC 1KFAL 1SEBA 5I8KH 2CQVA 5L88L 1EBPA 2YN5A 3BGFC 2YS4A 4O51A 1WITA 3BJ91 4OGAC 1ROWA 1N6VA 2J8HA 1QLEH 5IF0A 4KJQD 4PJ5A 3OGCA 4LLUA 1KB5H 2R1YB 2NLJB 3DURB 1UZ8B 3H9SB 3MPCA 1VGKA 1CICC 5BRZD 4AG4H 2B4CH 3JTSB 2WP3O 5JQ6H 1E4KC 2VDPL 5DJXB 3QUXA 2XN9D 3DX9B 1Q9KB 5IQ9B 4GOSA 2DQHH 1FIGH 1FNEA 4HWUA 1T80A 2X6MA 2VXTH 4JDTL 4ZXBB 1CYGA 2D03L 1IEBB 1T4KA 4RBPK 5IVXA 2DM7A 1UA6L 4J8RA 1G6VK 2BSRB 3FQTB 1MFAL 2G75A 4UT7L 3G6DH 3MO1B 3K8MA 2P5WE 5ENWB 4KJWC 5GPRA 2A6JA 3ARQA 2D9CA 2ICWI 2QSCH 3V5DB 3B5HA 4YHOH 5EORH 3UTTD 3HC3H 3V4PL 4F8QA 4JZNB 2CR6A 4DQOL 3KXFD 5JO5B 2R0LH 2P8PB 1ZT1B 3OHXA 3P11L 4PRAB 3QCVH 2BVPB 2VRAA 3QUMB 4X4YB 4JRYA 5BVPH 3UAJC 5T5FL 3SO3B 4P3CL 4M61B 4IRSC 3OX8B 3W0WD 4DAGL 4U49A 1ZK9A 4QHLB 4K3DH 5CZXD 1DEEB 2Y6SD 1I1AC 5ACLA 3VRLF 1YY8A 3DV6A 2GT9A 4K94L 3V52H 1VFOA 2BRRL 3QO1A 1J86A 3OR7B 4LCYA 1MFEH 1L6XA 1VERA 4OI7A 4JFZL 1OAXL 2YA0A 2YPKB 3DTXB 1YN6A 2KUTA 3PP3H 5FHAL 3OKLA 3S3JA 3EUUA 2EIZB 4BFIB 3T0BA 2VIRB 1JRHL 4H25A 1IGYA 1OHQA 2VXQL 4NKDA 3NTCL 3BP6A 2PXYA 2CSPA 4XWGH 2QADC 7CGTA 2O5XH 5H94A 4M93C 5DVLA 2OZ4H 2A9NL 1QPXA 4HJJH 4K8RL 1C08B 1NDGA 1I9EA 1Q72L 1U8MB 3HC4H 4UB0L 3WUWB 3ILQC 2ERJB 4L8DB 3AS0A 4PJIB 4OGAD 1BOGA 4ZUUA 2W60B 1CK0L 4KMLB 4Y19D 1A6TA 5J57B 1WIUA 2BXYA 2D0HA 1FL5A 2B5IB 3VD9A 2D7MA 1CICD 4Z8FH 4E0RA 5ISZA 1KBGH 3L3JA 4JFDA 1T7VA 1R24B 1NGYA 1QYGL 2R1XB 1WZLA 1ZA6B 1UXWB 2NY0B 3EDKA 3FFDB 2R2CA 1KCUH 5D9SA 5E8DL 4BQ6A 2OK0L 4KV5F 5HPOA 2WWKT 2OLDA 5EUOA 2DBLL 4ZYKA 3FQNB 1DL7L 1MELA 1DQMH 4ZUWB 4OCRL 1UT9A 5DD0H 4W4OA 4ODTL 2ICEA 4NT6A 1CGUA 4XVSL 5JUEL 1IAIH 2DYPA 4GAJL 5E6IA 2R69H 1I1FA 3OSKA 2GSGA 4OB5L 4C56A 4JQVA 1QVOB 1K5NA 3GGWA 4LPCA 4KJWD 4KHXH 4PJXB 3DUSA 4NQEB 2D7TH 2C3WA 2AJXH 4QRUB 1WFUA 1HKLH 1NFIA 4Z7WA 4DKAA 3MQIA 3X14A 4TSBH 3RDTA 3V0AC 4JRXB 5F7DA 3ZKQD 5FYJE 1FBIH 3TBSB 1BBJB 1WWCA 4YAQB 2NW3A 3UAJD 5L2KD 1CDGA 4MJID 3M17B 4NKIL 5KS9F 4MJ6B 5D71H 2IJ0C 1EVUA 1MIEH 5J11C 2DKMA 3K1DA 4IRSD 3DXAE 4L4TB 1U3JA 5D1QB 4HWEH 4Y4FC 1I1AD 3T3ME 4G8GE 5CJXA 5BW7A 5I6XB 4P4RB 5KANI 3H0TA 3LRGA 4U6XB 1HEZA 4I3RL 4IIQB 5MENB 4FFYH 4R4FL 2PYFB 1IGTB 2OTPA 3TBTB 2GYSA 2Z31B 3GUTA 1Z9LA 5I1IL 4I0PA 4JHAH 1RK1B 3GBNL 4YUEH 4WUKL 4PRID 2ITDA 2VLJB 2QADD 4R97C 2RFXA 1TQCC 1PY9A 2QTEA 1CDIA 2XWJA 2J3SA 1J7VR 3ILQD 3MUJA 5HGAB 5HVHB 1S9KC 5T33H 2B8OT 1ZLSH 2JJWA 1A7BA 1JRHI 4MSWB 3CCHB 3GIZH 1P9MC 3STLB 3FOMA 4LOUC 1CDCA 3VI3F 4LGRB 5H35A 3U0PB 4RX4D 2NMSA 4LDLB 4QT5B 3BPLB 4ZS7L 3IDXH 4JM4H 4HBCL 2D0FA 3BP4B 5JXED 3MACH 5KSBB 1JWMA 3TEUA 3BESR 1EIBA 1L0XA