1F8TL

Fab (lnkb-2) of monoclonal antibody, crystal structure
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
219
structure length
219
Chain Sequence
DVQMTQTPLTLSVTIGQPASISCESSQSLLYSNGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLRISRVEAEDLGVYYCVQGTHFPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT (LIGHT CHAIN)
publication title Spatial structure of a Fab-fragment of a monoclonal antibody to human interleukin-2 in two crystalline forms at a resolution of 2.2 and 2.9 angstroms
pubmed rcsb
molecule tags Immune system
total genus 54
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2000-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f8tL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f8tL01
4M3KB 3WXVL 3HS0B 1Z5LA 3JBG7 2WQRA 1EUUA 1CD1B 4HGWA 5MEND 1Q9LA 2V2WB 5GHWH 4HJJL 3ECBB 4K2UH 5HHOE 4PLJD 4JZOB 3NTCL 1E6OL 4CGTA 1JHKH 3STLB 2R1YB 1U91A 1U93B 1JHTB 5GGVH 3QHZH 3LCYA 4LVNB 4U1SA 3F7RA 5C0AD 5IQ7L 5H2BA 1AE6L 1KXTB 1A6AA 2VN4A 25C8L 4AH2A 4I18A 3VH8G 3AM8A 4TYUA 4P3DB 3U2SB 2R69H 5ALBH 4OFKA 2VDPH 1RZFL 1A22B 4PJ8C 3GSWB 1EZVX 1EFXD 4Q58C 1R0AL 3ARDB 1IT9L 1F90H 5ADOH 1HXMA 2PXYD 4TQEL 4G8IA 4XTRC 4X80L 3RA7L 2AJSL 3WKML 3HE6D 4YIQA 3TYGL 5A2IH 1OP3H 2BMKA 3BH9B 1MRDL 4KROB 4YHYB 5C09D 4UOW0 5LCVL 1GIGL 3T0BA 5KSVA 1NBZA 3CXDH 1T1WB 3DMMA 3SE4A 4AK1A 3HC0A 4L4JA 4PJ9B 1AHWB 4ZOBA 3DSFH 3RX5A 1T7ZA 3CC5B 4RX4A 4CVWA 2JB6B 4U3HA 3FTGA 4MQSB 1LP9F 4MJ4A 3O2DH 4JFFB 3GSVA 2BNQD 1RUPL 1R24B 3ULVF 3IDIB 1IGYA 4FQLH 4JN1H 3KYOB 4IRSB 4NQCA 2NXZC 4CN6A 3BKMH 4PPTA 2J12B 2QR0A 4XHJC 2YSSA 1FBIH 3MV8E 4XCYA 1AH1A 3B9KD 5KSUA 3WYRA 3V5KB 4UT7L 1MVUA 3C5SA 2EXWD 2XZQH 1L9NA 4GUPB 4RGMB 2VDNL 1IAKB 1PLGH 3ALPA 4G9FB 3MLSL 4QO1A 1MSPA 1QFUH 4MJ6A 5CSZA 4YAQB 3C5JA 3HMWL 5BRZD 3VU2A 1ZVSB 2ICWB 1A7BA 2GW5A 3A6BH 5KG9A 4JDZA 4TSBH 4JGUA 3X3GL 2VABA 1J8HD 2EICA 2A9ML 2WBJA 4S1QL 1M7DB 3GHEH 1HCVA 1IJ9A 2A2QT 2FECL 2NY0D 3LEXB 4PR5A 4L8BA 2P8LA 2DQCL 4YBLB 3MV7D 1ZLUK 1T21A 2H9GB 3BWAA 5JPMA 1KT2A 4OLEA 4NZTL 4NP4L 4MA7L 4QF1A 4GBXA 2HKHL 3FQNA 5DURB 5JZ7C 1QFOA 3HNSH 4DCQB 4EI5C 1A7PL 5KVEL 5FYKL 3KPRE 4YBHA 3B9AA 1LE5A 1BGXH 3HUJB 4Z78B 3PL6A 3PHOB 1ES0A 3L7FA 3MRMB 4L5FH 4S1DD 5K9JL 3IDXH 1YY9D 1T22B 1I7TA 2A9NL 1KELH 4JZJA 1KYOK 3LQAH 4BQ9A 4PJFA 1U8IB 1VPOH 3ARBC 2JLLA 2Y7QB 4F7CA 3U4EA 5CJXA 4K3DH 3DVGB 2YKLL 3DWTA 2C3GA 3G6AB 1HHGB 4WHTB 4P9HH 3R8QA 4WJ5B 4WO4D 1UH4A 4MNQD 1U41A 1WBXB 2R1XA 2P8MA 5D9SB 3QDHA 4DK6A 4X8XA 1IAIL 2R2BB 3C6SA 1OF2A 5JW4N 3EYFA 1OW0A 5ISZB 4JFZH 5T5NG 1IGJA 1RK1B 4Y19E 1AKJD 1CTOA 3QPXL 5D1XB 3V7MA 4U7SA 4UIMB 1UENA 4CMMA 1XF3A 1KNOB 1R3HB 5J3HD 4FA8A 2FEDC 3RGVD 1W72B 4XRCA 3NOIA 4XNXH 5I1KL 3THML 4U1HA 3O3AA 4YK4C 5F7DB 1HE7A 3OKNA 4H5SB 4JN2B 4OGYL 2DRUA 4FQXB 3UAJD 4H88L 2HJLB 3NCYP 4CW1B 3T1WA 5AUMA 3SY0B 3EOAB 3BD4A 4WDIA 2O61A 2CLVA 4P46D 4L4TA 1IZJA 1T5XB 1F8TH 4PJ5D 5KSAB 4QLRA 2ADJA 5F89B 4TVSa 4J8RB 4LASL 4W68A 2GAZB 4JB9H 3LH2L 4EDWL 2BRRH 3MRBB 4MA8L 2FGWL 1ZA6A 1UGNA 2DD8L 4NQSB 4UTBL 1IC7H 1UWEH 5C0IA 4XP6L 4LIQE 1YZZA 3G9AB 3E3QC 3VI3F 1NL0L 3RGHA 1MCWW 3P73A 2ENSA 1NUFA 4NZRH 3FB6B 1JZ2A 1M05B 2WIIA 3S3PA 3U9UA 4F37F 2BERA 1TQCB 3GM8A 1O5DT 3P4OB 3CDCA 4M5YL 3MO1A 4X7DC 3ULVC 2O93L 4NKMB 4OV5B 2A0LD 4Q9QL 2GSGA 3QFJD 1SYSA 4QXTA 4JY5L 3BKYH 1F42A 5IMKB 2LQRA 5EBWA 5C2BL 4JANB 4OV6F 1KJVB 5DQ9A 3HZKB 1DQQA 4MB3A 3QEQB 3VH8A 4F7TB 4JO2H 1F3DH 4U1JA 4WW2A 1BVLB 5DI8A 4N8CH 5FDWA 3QEUB 3BRDA 5GS0L 4JG1H 4F2MB 3DJ9A 2X1QA 1Q1JL 1A6WL 1I7UA 2MNUA 2BHYA 3L7EA 1BLNB 4PJ8B 3I50H 4JKMA 4KKAD 3BKCH 2D03H 3QXVA 3QUMB 4DGVH 1OL0A 1OGAE 3C6LD 4QHMA 5FO9A 3MRGB 5E6ID 3ZHKA 5J11C 1VDGA 2CQVA 2WV3A 3VXOA 2EDRA 1YEDA 3STZB 5SX5H 3KWWB 3W11C 2X4NB 3NGBC 4YBQC 5DC0A 2CK2A 5DD3L 3FL7A 5ACMA 4PB9H 1F3JB 1MWAB 2HVJB 3TBYB 4WY7H 1DFBH 1WWCA 5KS9A 3ZKNC 2CUIA 3KDMA 3LN9A 2FR4B 4R7DB 5GRJL 1P2CB 2E6QA 1IFHL 3CXHK 2VLME 5FM4A 1NC4D 4AYFA 1TMCB 4P2OA 4OCNC 1HKLH 4RSVA 3C9NB 3VG9C 2X4UB 3MC0A 4GLRH 3LS5L 4QTHA 4TOYL 1G7JB 2VKXA 2Q8BL 5IB1A 1L6XA 4FFZH 2XWJB 1X7QB 3SO3B 4ZG1A 5GISL 3O4LE 4XPGH 2L7UA 1PW3A 3RQ3A 1LK2B 3MRNA 2VDRL 3DI2B 2OP4L 5GRUL 3QDJD 1JFQL 3X17A 1CE6B 4NRZA 3VFUA 3SKNA 4JKKA 1I3GL 3GBNL 1QBMH 1SJVA 1XF4A 3OKKA 3WD5L 3M8OL 3E6HA 4IRJA 1U3JA 1UXSB 5C07E 2A6JA 2HFTA 1KB5B 1JPST 2UZYB 3HC4H 2NYYC 4PJXF 5JOEA 4OZGA 4Q7DA 3RRQA 3NACH 4C54A 1XF2B 2IWGA 3QH3B 1KULA 4U1NA 1ORQB 3BMVA 1MWAH 1FZMA 1OAUL 5GS1A 2FIKA 1BQLH 3CX5K 1R5WB 1LNUA 3KLAA 5EFIA 3TBSA 2NY6D 4KUCD 4LKCB 4APQA 3T0EA 4ZO8A 4JQVC 3KPNA 2GJ6D 2P5EE 1AGEA 5E2JA 3SKOB 5DLMH 1NFDF 4OFDA 1MFAL 4XC3H 4BH7A 4GJTB 2FH8A 4Y5VA 3DHMA 3RBGA 2F58L 3VFMA 5CILH 1NUDA 1H0DB 4NT6A 4J4PA 2J4WL 5ESAB 5HHQB 5ADPL 2HFFA 1D5ZB 3G5XB 3RWIA 1NAML 1U0QA 3MJ6A 3ARBB 1DEDA 2LE9A 3MBEC 2BVOB 3X11B 4E9LA 2CGRL 3IXTA 5CEZL 5DJAA 1PX4A 3BMWA 2ZUUA 5HHOD 3VFTB 4KMTH 4UNTA 5D5MF 1ZGLB 4QRQB 2RHEA 5FA4A 4CAGA 2VQUA 3OXRA 4ZAKD 2CR3A 1RIHL 4QT5A 1DDHA 2F5AH 4POZD 1TZGH 3WHE1 1YEFL 3PWVB 3E6FB 3O3EB 4LNRA 3SDYH 2Z9TA 3KG5A 1JGDB 3IRZA 5J6HA 1XGYL 4BJLA 5CHNA 2R9HD 4NN5C 3RPKA 1H3VA 5I16A 3R06A 3AAZA 3NZ8B 1FC1A 2BJML 4YK4B 1MCWM 1LK3L 1MLBB 2G75A 2H26B 2I5YH 4M43L 4YDVA 4EN3A 5DJZB 1WWAX 3OJVC 4GMTL 2VDQH 4XNZB 1NJ9B 2CUHA 5EU6E 4FQQB 5EUOE 4B5EA 3SDXA 3RL2A 3QCVH 4MXVF 1W0VB 4DEPC 5IB5A 2XQBH 1K5NA 5F6HI 1ZK9A 4NN7B 3SCMC 5C3LD 3L3KA 4I5BA 3MXVL 4XPAL 1G7LB 2E6JA 3G08A 2WWKT 4CU6A 4P49A 4JY6A 5JW3H 2L0DA 4M3JA 5F7MC 4BUGA 4WUUA 1CFVL 1LP9B 1G7HA 5F6IC 5H37G 4F80A 5EU4B 2NZIA 4DW2H 1WK0A 3OX8B 4F7PA 4HEPG 3HE7C 3MXWL 3GUTB 3MV8D 1CL7L 5D96C 4OZIA 4C83B 5EUKB 5DRWB 3PWPE 5I8OL 3IFOB 1U8NA 2PCPB 3TPUB 5EBGA 4NZUL 4N1CA 1CXIA 4V1DB 1KG0A 5IFHH 3RVTD 3U0PB 1YMHB 5DF0A 4BKLB 1AD0A 4C59B 2CDFA 2OXGA 4ZS6C 2I9LA 4XI5C 3ME0A 1QKZH 3CK0L 4H1LA 1BAFH 1UWXK 1S7UB 2DLFH 4G3YL 2GK2A 1ZE3C 3M07A 4IEFB 4MWFA 4RFEB 4X6CE 5F88B 1S3KL 4C56E 4U1LA 3UJJL 1F97A 1CIDA 4HIHB 2JIXB 1QFWL 1B4JL 1L7IL 5A3IC 3LV3A 2XIDA 4Q2ZB 4RGNE 5E2VL 5GGUB 3VD9A 1QYGH 4OCLC 5DD6A 5TH2B 2NY5C 3TBTB 5BXFB 4TVPH 4MQ7B 1MCQA 5EZOL 4MNGB 2OR9L 1XF1A 3NGBB 4ZUTB 3I9GH 3ULVH 2AXFA 2R39A 2W60B 4LCIH 2YPLA 4WTWA 3WFCL 2P43B 1QFHA 3K1KC 1BZ9A 4HWBH 4ZNCD 1RJYA 1KPVA 1D5BA 4H8WL 3MR9B 3UTTA 5IW1A 3WS3B 1AXTL 5EOTB 2XZAL 4NBXB 4KK9D 1J1PH 2Y06H 4S2SB 1C12B 1P9MC 3TGXA 3GMRB 3VG9B 1N64H 4JM2A 1AGBB 3O6FD 1MPAL 2KZWA 3DVFA 1QSED 1XGQA 4YHLL 4P5TB 2OM5A 4FFWD 3Q0HA 2GUOA 2Y1VA 1OGTA 3IJHA 3AU1B 2F54B 4Y19D 5FM8A 3TP4A 4K8RL 3SOBL 1JTTA 2ADFL 1VFMA 5D7SH 4S1SL 1TNMA 5FECA 5HDOA 2F53B 2NTSP 4BM7A 4OI7A 3ET9F 3D18B 1S9XB 3AB0C 3KPMA 4HXBH 5DWUH 3WDHA 5EIVA 1R5IB 1AO7B 4NKDB 3SE3C 2AXGA 4OZ4B 3SQOL 5CINL 1TCMA 1HZHH 3FFCB 4AENA 3QFDB 4M5ZL 2BVPA 5JUEL 1SYVB 2C3VB 1S7TA 3P0YL 3LB6C 5TDPA 2D7TH 5CJOL 5DEZA 5E8PB 1CQYA 4YHNB 4Y7MA 1SEBA 5DK2A 1KEML 1HDMA 4M61B 2DYPD 2P5WD 1G9EA 3IDJB 1AGDA 1XGUB 4HS3B 4OD3L 5DGQA 1KSRA 3HI1A 3BXNA 1HILA 1ITBB 1D5XA 1B0RB 2R2CA 4KRMB 1J0HA 5CJBA 2MWCA 2F8VA 2NY2C 1ZAGA 4DZ8A 4JM4H 1F45A 4U1MB 2V7HB 1G9MH 1HSAA 2ZSWA 3HN3A 4JKPH 4PGEB 3QA3B 1AP2B 5DJCA 4KZEH 1JI2A 1YNKL 2WANA 3JV5A 3MBEB 2YXMA 3QP3A 4JHZA 3CLFH 1C5DB 5I8EA 2XWBA 3S96A 3P9LB 4UIKH 1RUQH 4A6YA 1HH9A 3PWJB 4Z7VE 4KJPC 3DV4A 2OJEB 1HHHA 4UOW1 5JNYA 4NM8L 3QDGB 4GXVH 4Z7UF 2IQAA 1D9KC 1XCTB 1N3NB 4NN5B 3V6ZB 4NRXB 3M1BB 2XRAH 3QEGH 4GH7B 5KOVC 5I1GL 3GNMH 4ELME 4JRXA 3KPRA 3HG1B 2Z31C 1CICA 1OAKH 4OAWB 4YE4H 4UOJA 5LJYH 2GJZB 4ZYKA 2LAGB 5EC1A 5H94B 1A3QA 5CLTA 1OGAD 4PGJA 1G6RA 1QTYT 4WFHE 4KTEH 4NNYB 1NPUA 4YR6B 3V6OE 2DMBA 2EDWA 2EDBA 4BUHA 2BHZA 4DEPB 5B39G 3ARGB 1A14L 4K55A 3G5VB 1BOGB 2AJYH 2BNRE 4HHAA 1X5XA 3SCMB 5TFSH 5FEBA 4XT1C 1OOAA 1OTUD 4M7JL 3IJSB 3MNWA 1KV3A 2XA8H 3CSPA 1VEOA 5DT1L 3U7YH 4LSQH 3LKNA 3U46B 3KHQA 1MHPH 5L7XH 4N1EA 4N8VB 3IFLH 5CD3B 5F6IB 1ZHNA 4OM0H 3LKSA 2B4CL 3TBWA 1T2QH 4QRRA 2FEEI 4MA3B 3O4LD 3RPIA 4JO4L 3DVIA 5E00B 4F7EA 5T1DH 3GMMA 2ZPKH 5SWZE 1IVLA 1K4DB 5D96B 5EN2B 4AIXA 5FOBA 1CXLA 4NWTL 5CZVL 3WIFB 2ARWA 4GG6E 3ARDD 3PIQA 4HH9B 3GIZL 1FZKB 3OKOA 1JZ8A 3GSNH 4OZHA 5C07D 4ODBD 2VXQH 4UT9H 3EO9L 1I4FA 4MX7A 4CNIA 2CKBA 5HHPB 2EDNA 3QZWB 4XBPA 2RIKA 1N5YL 1A7OH 1O7VA 4YX2L 4NKOA 2DQJL 3F7VA 4PJXB 3W39A 1C08B 2ICEB 5D71L 4LSUH 3E3QE 1A9BB 2R0ZL 2Y5TB 2FLBT 2WUCL 2O5ZH 3DVNA 3QXDB 3GHBL 3ES6B 2N4IA 2Z93B 3T2OA 3KLHD 4JFFD 5DC9B 4CU7A 1G0YR 2ATKA 2DWEB 5TGBA 3W0WE 5CBAA 3Q3GB 5L2JA 1FDLH 4TVPE 1RZ7L 2A38A 3O3BA 3BEVB 1YEGL 2P5ED 1CYGA 4IRSD 4OKVB 4FXLA 3T2NL 5J6GA 3ULVE 2MPAL 4R4NC 2EH7H 4QXWA 4DWHA 5LVEA 4IMLB 4XPHL 4G8EA 3N9GL 4RISH 4Y5XA 5A43C 3H9ZA 5EZJA 1NFDB 3MLTA 3GMLB 2HH0H 3KYMA 3FT2A 3T4AA 2PTTA 3TT1L 1X5AA 1NEZB 4G9FD 4KDWA 4HUVA 3KPLB 3RIAK 4ZUSA 2Q76B 1CGVA 3S8WA 1V7ML 3LKQA 4JJ5B 1QEWA 5DGRA 1FCGA 5CIPB 5EBLB 1P84K 1TVBA 3GBMH 1EUTA 1EBAA 5IQ9B 5L8JB 1R3JB 1YQVL 3EYOA 2HTLC 4GW1B 3CH8A 4HEME 2FO1A 5D5MB 4JPWL 3TVMD 2VL4A 3LKPA 1TVDA 3A6CH 1M7XA 1MEXL 4X9BA 4NHUA 2XACC 1WICA 3NIFF 4QGTA 1G7IA 3DRQA 2LVCA 5DJ0B 3IDYC 4ETYA 4F8QA 2WLYA 3MLVL 4QHKI 2HN7A 3RP1A 3HPJA 3AB0B 4TSAH 3ZKSD 4G43A 1YNLL 4Q0XH 4JFOA 3L95A 5GRYA 1FGNL 4QOKB 3DRTB 2A6IB 4KKCC 3IDMA 3UROR 5DJ6A 5KVMC 1ITCA 1BZ7B 1A4JB 3B3IB 1VHPA 3FN0L 4B0MM 1P7KB 4X4XB 5CS7A 1KIRA 3O2DA 2NX5B 4O2EA 5FGCB 4K3GA 4ZPTB 5GZNC 3O4OC 3VXQA 3VFGL 2QTEA 2E27H 2Q8AH 3UDWC 4D0DB 4I0PD 4KHTH 4LLYA 2C3HA 2F8OA 2XY1A 2CJUH 1NBVH 4OF0A 5ISZD 4IDJL 4R90L 1OAQL 2P49B 2XTLA 5KVGH 4EJ1C 2NY2B 3BHBB 5IFAL 1UM6L 5EO9B 3NAAL 2CH8A 4NO0D 1RJLB 2HAZA 4NUJB 3I6KB 3V0VA 1JWUA 1YYMH 3E0GA 1GXEA 1Y18A 1FFOA 5BVJB 4FQXD 3WS6C 4HUWB 1S7SB 3K8KA 4K23L 1N5AB 2H41A 3NA9H 5SX5K 1AO7E 3PWPD 3FT4B 3QCUL 4P57B 3BP7A 2HT3C 1S7RB 5KSAD 3UPRB 2A6KB 3CNKA 1PY9A 3IFPA 1IM9B 2GIYA 4JFEB 4PJDE 4CVZA 3WN5A 3D25B 1QZ1A 5DHVB 4Y16A 1U8OB 1D9KB 1RK0A 4EIGB 3L5JA 1AXIB 1EO8H 3SGJC 3OAUL 1N59A 2VDMH 1KLGB 4HX1B 1OP5H 4OUUA 1ZV5A 5CZXD 3QDMB 5LBSH 1U6AH 4NZDA 5CUSL 2VC2L 5TQ0H 5B39A 3DX9A 4RGND 3MA7A 5HD8D 3S5LA 3T8XA 3D2UA 1ADQA 1MF2H 4R96B 4CU8A 5CLWA 4Y2DA 3S3SA 4PRIB 3N1PC 3RVXC 1HCFX 1QR4A 1JUFA 1CK0L 3IAQA 4F33A 3WE6A 2XA3A 3VXME 2FATH 2ED9A 2ZCLL 4U6VL 2NQCA 3VGHA 4OQTL 5D2NE 5ITFB 4UB0L 4JFHD 2B8OT 1VSCA 1QLFB 3W9DB 5LG1A 3QEQD 4ZDHB 4YHOL 2VR5A 1N7MH 3DYPA 4JRYB 1F6AA 1FQ9C 1J88A 2O5XH 3V79C 2UVEA 3RWJA 3U7WH 2DTSA 1LO3H 5DS8B 1S5IH 1U8HB 1GOFA 5A40E 4O9HH 1NLBL 2D3VA 2AJ3A 3PUCA 4MQXD 4HKXA 3V4PH 4PJ8D 1MQ8A 3HHRB 1U2HA 2VLKB 4ALAL 5FUCE 4YDKH 1TJHH 2C1PA 1HQ4A 1KXQE 3QWRA 5JTWA 1MI5A 5FKPA 4K7PL 3KPQB 5EU6A 3R0NA 5EUOA 3LHPH 4XTRD 4KPHH 1E28A 4X7FC 4D8PB 2BFVH 5KN5B 1J05B 2X89D 4KQ3L 3GMQA 2WLZA 4WFED 5I76B 2VZSA 3AS1A 4LSRH 1CGYA 4XGZA 2W0PA 4XPTH 1U3HD 2EDDA 3P4MB 5JHDB 1F4XL 5GPRA 4ZXBC 4BFGA 4OM1H 2DQIL 2XKNB 3G9VA 1EJOL 1I9RH 3H2WA 1Z3GL 3IU3B 5J9PB 1IE5A 5FUOL 5ETUA 3NCJL 3TIDA 4E41B 2X4TA 1K8IB 4XHQA 1CDYA 4ODVL 5BJTB 1I85A 4MXWL 4DKDC 4I3SH 4AEHL 2NXZD 2RR3A 3CUPB 2R0LL 2ZWLT 1LO2H 1Z6JT 4XHJD 4R4BB 1FZOA 4LIQL 3LN5B 4X7TA 1YEHL 3HRPA 3CFJB 4PJIF 1X5ZA 3QUKB 4ZNEE 2DQTH 2AEQH 2Y5EA 1ZLVH 4LKXA 5C0GB 4XVJL 5FO8A 5IVZB 5GGVY 4AG4L 1YQ2A 5D7LE 1RSFA 5I30L 4GKNB 3I02B 2H6PB 3MLZH 1G1YA 1MJJA 5H35A 5F1NB 1JF1A 3RI5F 1ZHBB 5F21B 5GHWL 2MHAB 4YXHH 4K2UL 2Y36H 4HMDA 2YWYA 4R2GC 3ZT7A 5T3ZH 4U1IA 2EE9A 2NLJA 3L5XL 1EHNA 4F9LA 1JHKL 3I6LE 4C56A 3BISA 2I07A 1H3GA 1OAYH 4Y4FA 5GGVL 5DEFB 3QHZL 3D39E 2XNAB 1DN0B 1MVFA 2C1OB 2MQ0A 3TCLB 1UB5B 2J6EH 3UC0L 3IDYB 2CLZA 3JVGC 5H8DA 2YC1A 3G6JA 5JZ7D 5DQDH 4Z7UB 3NFSH 3KPPB 4EI5D 2R69L 5ALBL 5ESVA 2VDPL 1T03H 1AXSA 5FGBA 5I2IA 1MCLA 4YLQT 1TJGH 2HFGH 1XCQB 1F90L 4U05A 2NY3B 1UQSA 5C8JB 3ZDXE 3ARBD 3SE9L 5MHSE 1AFVL 1BBJB 1ZA3B 2BNRD 1LE9A 3GKWH 2EDFA 4QKXB 4Z5RA 2C4XA 3GBLA 3ZYOA 4TNVK 1R3LA 3VCLA 3CXDL 5M95B 3MJ7A 4LLDB 3ZTNH 4PJGE 3PQYB 1S9WB 4AEIL 3MRKA 3DSFL 3PV6B 4HUMB 4FQJH 3QQ3B 4NQXB 3QWOB 2GCYA 3O2DL 5FB8A 5C86A 1YPZE 2FEDD 5F1IB 5IEHA 3WL9A 4QRSB 1K2DB 2EEAA 4FQLL 4R8WH 4JN1L 2DIJA 3BKML 2C26A 5DMJB 5F3HB 1S9YB 1L9MA 4FZ8H 1FBIL 4NCC1 5IB3A 2QQKH 4XBGB 1A0QH 2XZQL 3SDDA 1PLGL 3MPCA 4ODXA 4JAMB 2KBGA 1QFUL 1HSBB 2KUTA 4ZUUA 1CGUA 1Y0LB 1E4WH 2GTWB 3A6BL 3IF1A 3WUZA 4TSBL 4FZEL 2FNBA 4MXVE 5D7IA 1IC5L 3MRCA 1CFSA 3WDJA 1JZ7A 4PJ7F 1EBPA 2X4OA 2HT2C 4RWYH 1X4XA 2JK5B 1FL6B 1SY6H 2YN5A 5FM5O 3WLBA 3MGTB 1IC1A 3W0WD 3GB7A 2BSSB 2HFEA 4TVPD 1ZGLP 4F7MA 4P2QE 5JXEC 1QACA 1WBZB 1S7VA 5J12C 3ULVD 4KMLB 4TUOA 1MRFH 5KW9H 1G0XA 4OUOA 4FQIH 3GSQA 1Q94A 1FVDB 1BGXL 4NQVB 2E8ZA 4L5FL 3BZEA 32C2A 3EDFA 3IDXL 5DVLA 1IGIH 3L3HA 4FQCH 4DTGH 4V1DD 3W2DH 1VPOL 1QA9B 1ADQL 4G6FB 4K3EH 2KPNA 4K3DL 4L8DB 4YH6A 3RWHB 1DR9A 2ORBH 1UYWH 3RWFB 1A4KA 4W4OA 5F6HJ 2NXYC 2MKWA 3HB3C 3ROOB 3BGFC 2PW1A 3EKCA 3VFOA 4DUVA 4BH8B 4ELMA 3ZE2E 4JY4B 4ZS7H 1QBBA 4FHBD 2G5RA 5B38B 2FCBA 1RZ8A 1DQLL 5ITBH 5I1DB 4LPUA 4JFZL 4ODSH 4ZQKA 1GGCL 5DFVD 1JTOA 5I8CB 2Y23A 3V6OA 2X9YA 4X6EB 5D1QA 4LSVH 2V17L 4LCWB 1T83C 2W9EH 3W11D 4XNXL 2EYSB 1QBLL 4MJIA 2ESVB 3QXAA 1F6FB 5BS0B 1FFNA 1P7QA 5HYJE 4YBQD 1N2RA 4MD0B 4I1NB 2X7LA 4LAQH 4ORGB 4PS4H 4GAYB 4L4VB 4K94C 4LEXH 4K07A 3ZKND 4RAUA 4ZXBB 1F8TL 1B2WH 1F4YH 4QXGH 5GQBA 5FCSH 1WEJH 5IR1A 5ID1B 3O2WH 4G9DB 3RAJL 4G7YH 4JB9L 4XNMB 3WXWH 5BW7A 3LRGA 4HV8B 2BRRL 3UTQA 3ILQC 5IJVB 4FP8H 1WV7T 3I75A 5EO1A 2MKLC 1IC7L 1UWEL 3RDTA 5D2LE 3STBA 3SGEI 3C5ZA 4PYGA 5SWSA 4JPKH 2MTPA 5SWZA 4WTZG 1OY3B 2Z8VC 3AC0A 4NZRL 5ACZA 4GG6A 1UKQA 3VE0A 3ARYA 3UBXG 4YXLH 4W70A 3SDCC 1FIGH 1JN6B 4UUJA 5HYQA 2GKIA 2CUMA 1CG9A 3JTTA 4EZMA 1B6UA 2IH1B 2F53D 3G5YB 3IDNB 4DOHE 3VW3H 1A1OB 1BJ1H 3CH1A 2NYYD 5FGRA 7FABH 5CFHA 1DTUA 4G7VH 3EO0A 2X70B 1I1AA 3VXSE 4X83A 5T3ZE 1AO7D 5E1AB 4R2GB 1D5IH 4M6OH 4DKAA 5TDOA 3IGAB 1AC0A 1EZVY 5I0ZA 2F74B 4JO2L 4OZFH 4TULH 2VE6B 4PV9B 5FYLD 4U1KB 5IMOA 3FB5A 4XXDB 1NMAL 1T5WB 1FRGH 5IMMB 1T04B 3VXRE 5D93C 2X41A 1FYHB 3K4ZA 4HWBA 3BKCL 3MGAA 5IFJB 3DUSA 2D03L 4MD4B 4O51A 5JPNB 1FZJA 3EO1A 5EOCH 3QYCA 4KI5E 5INDA 4KJQC 3QHFH 2XWTB 3CVHB 1K3ZA 3JV0A 1NFKA 3MBED 3TZVC 2EC9U 4UQ2B 3UEZA 4WI8A 1W2KT 1WIPA 1OSZA 4XWGL 4ZUWB 2EO1A 3BAEH 5FHAH 1K9TA 5C3TA 4PB9L 3D0VA 4WY7L 3RWEA 5J4MA 4R97C 3FT3B 2C4FU 2FSEB 3P4NB 2ADIA 3F62A 4UV4H 1KBGH 3WNKA 1EERB 2P4AB 4O5LH 3LZFL 2AK1H 1E4XH 2K9UA 1HKLL 3QDGD 5ESQB 1A1NA 4TSCH 3HMXA 1GGBH 5E5MB 5CEXB 3HPLB 2F15A 2AK4B 3M17B 2Z4QB 5LAXA 4TN9A 3HG1D 3ZDZF 5FYJH 4XPGL 3FONA 3REVB 2AQ2A 3F5WA 4U6YA 4XXCA 2EDOA 1SJEA 3VD4A 3CMOH 4I13B 1QBML 3QIBA 3MFFB 4R6UA 3Q48A 4NNXA 1FYTB 1IEAB 3V4UH 1U8LA 5FO7B 3SCMD 3HC4L 1SBSH 2A1WH 2WP3T 4M8QA 2X4QA 3QUZA 1ZLSH 1ZHKA 3HZVB 4PJHA 2APWA 2AQ1A 3DX7B 3S6CA 2VLJA 3CDGB 4ZSOA 1BQLL 5I1CH 2UYLB 3KXFA 3OKMB 4MAYC 4JKWA 3EZ8A 2E6PA 3KGRA 4X4YB 1VGKA 5IUSA 3UXFA 4WFGE 5HHNB 1FL3B 5IHZB 2AXHA 1QO3B 3EGSB 35C8H 4GRLD 5CEYB 1VFAB 5A1AA 5J12B 3TFKC 5DRZB 1I8KA 1DCLA 3LSOA 1BX2A 3HE7D 4QHUB 3W82A 2P24B 5AG9A 1KCLA 4XC3L 2YUXA 5ILTH 5CILL 2FL5B 5ERWA 2MQCA 4PJIB 5BQ7A 1IC4H 1MCSA 2VXUH 4HC1H 4PJDA 3OJDB 2X4RA 4JR9L 4JFXA 4ZS6D 3FQRA 4XI5D 1INEH 4Y2OA 4Q9RH 1PKQE 2OTUA 5J57B 5CSBA 5HGHB 4ISVB 1QLRA 4AL8H 3EAKA 2NXYB 5K93A 3BGFB 3NZHL 3VRIA 5IHUH 4P5MB 3D69A 3MYZA 3I6LD 1N0XH 2F5AL 3JTSB 3V8CA 3RWCB 1TZGL 3C60A 1CXEA 4PJFF 3SDYL 1DVFC 2YWZA 1H5BC 5A3ID 2NW3B 1FNLA 1YDPA 3SJVA 4JEGB 4Y1AA 2FO4A 3OBAA 3GI9H 3P0GB 2JB5H 3W5NA 2X40A 1YMMB 1M4KA 4DN4H 3H9SE 4LF3A 2XG5A 3D48R 4M7KL 3VXMA 2I5YL 1CFQB 5D2NA 3E2HC 1K85A 4JE4B 2VDQL 5EO0A 1ZTXH 1BM3H 1CQKA 5DFTA 4EQ2A 3NABH 3MQIA 1CI5A 3QCVL 4WTZA 2XQBL 2QADC 4HKZA 4RQQA 1RIVH 1IMHC 4UNVA 4EVNB 4XVTH 3UBXA 4I18C 3AM8C 4HS6B 1PG7W 1PZ5A 4L8SA 2R0KL 4ORZC 3K74B 5SV4A 4X98B 1ZGLM 4N0YH 3GGWA 3KLDA 5EU3B 5EZLA 3SDCB 4QHNA 4PRHE 1OP5K 5JW3L 4O2CB 1ZT1A 2DL9A 1IGMH 3NIFE 4NSKB 1IGTA 1T3FB 2AEPH 3WFZA 1CE1L 3DURA 4LCWE 5IQ7H 2IAMC 3QNZB 4DW2L 3V95A 3L3OA 4OLUH 3RNKA 3GSUB 5D8JH 4QOKD 1FO0H 4ODWA 3DMMC 3SE4C 3MUGA 3BVNB 5ICXA 3TYFB 5FKAA 4P9MH 2FECI 4K94H 3KR3H 1PYWA 3PP3H 4WWKB 2SEBA 4XNUH 3UJTL 2NX5D 5IFHL 1CDIA 3E1F1 3FO9B 4MZ2A 3LQZB 2EECA 2Q3AA 3GSOB 3NPSB 1QKZL 1I1YA 1JPSH 2AJSH 1REIA 3LB6D 2DQFA 4XBEH 4GRWF 3RHWK 3ARXA 3FKUS 1MRDH 2J7LA 1GIGH 5E6ZA 1I9EA 1YUHB 4P59H 4PJ7B 5D6DA 3WNMA 1KJ2B 1U8PA 3VI4E 1G7MB 1UXWB 1Q8MA 4XNYH 3W9EA 3JWDL 2R29H 5D7LA 3B8YA 4WW2F 1QYGL 1WAAA 4P2QD 2IPTH 4TVPL 3O9WA 3TZVB 1PKOA 4KTDH 1ZHLA 4YGAB 4QHKJ 4B50A 3I9GL 3ULVL 4LCIL 4R26H 1AGCA 2GT9A 3QDAA 3VMPA 2WBJC 3O41A 2ATPA 1NBYA 1IAII 4HWBL 3CZFA 3F8UB 1FAKT 3GSRB 3JV4A 1BQSA 5DHYB 2Q6WA 3T3PE 3DXAE 3D39A 1IM9D 4UT7H 3GMPA 3MRDA 4JFED 4PJAA 1V3LA 4O2FA 4KJPD 5I66B 4LPCA 3BGMA 4WHYG 1J1PL 3S7GA 1YN7A 5I1AA 1D9KD 4GBXC 3V8OA 1N64L 4GQ9H 5K59E 5LQBL 5FYJE 3BN9C 2Z31D 1BD2E 3QDMD 5DYOB 3PL6C 5KS9F 1VFBA 4S1QH 4XCCH 3T4YA 2L7JA 5BZWB 2I26N 1ZXQA 1QRNB 2VLRB 2VUOA 4CADB 1ZANH 4JZJC 1KJ2H 3WBDA 4RNRB 5D7SL 1ZLVK 5CJXC 2MQ3A 3KNBA 4I77L 1IL1A 4LLMB 2V2XB 4IDLA 4NZTH 4WI3A 3CFDA 2P7TB 2J1KA 2PYFB 4HXBL 5DWUL 1BVZA 3FO2B 5AAWA 3BZFB 5HHMB 5DZLA 3EOTH 3FFDA 3WUWG 4PJGA 5HTSA 2YHGA 4H0IA 3OSKA 5E9DE 5C0DA 1Y6KR 1OW0C 2XTJC 3VFVB 1EVUA 5IK3A 1MJUH 5K9JH 2WMPA 3H7LA 4MAYB 2A9NH 1HH6A 2LVEA 5HYSB 2PXYC 2E9WA 3WIHA 2VYRE 2DBLH 1A2YA 4LLVA 1YPZA 2ARJA 2D7TL 3FAWA 4GKZA 4OZGF 1B0GB 5CKAA 1AJ7L 2YKLH 4Q6IA 5EOQH 3BYYA 3D3VB 3FQTB 1H8NA 1QVOB 3BOVA 1PG7H 2NTFA 4PBVC 2MJWA 2CIIB 5L0QC 3NIDF 2DKMA 3ZYIA 1I8LA 1T1YB 4JM4L 5J1AB 3BZ4A 4PRPB 3QPXH 4WHDA 1G9ML 3SKJL 4EBQH 1P6FA 2I27N 4JKPL 5C2UB 3QULB 1E0OB 1FYTE 4R0LA 3Q6GH 3TV3L 3ABZA 1U58A 5I1KH 4Q74A 3P9MA 2NPLX 4CVXA 1N8ZB 1RUQL 2VITA 3HA0A 3PDDA 5BOZG 1S9VB 3W5MA 2I60H 3QIWA 4NO3B 1DVFB 3WHXB 4KY1H 4DUWA 3LRSB 1NGYA 2AEIT 4LASH 3O11B 2WINA 3TCXA 4EDWH 4GXVL 4MA8H 1Z5LB 5AD0A 4JJHA 4JZNA 3V4VH 4R4ND 4UTBH 3QEGL 2XRAL 4OLWH 1OAKL 4W6YB 5ENWB 2DIAA 1UEYA 4X7SL 5F44A 3I6GA 1KN2H 4YFDB 2YUVA 2RCSL 4PJIE 4MVBC 4KTEL 2C3WA 1WUNT 1GPOL 3U0WH 4KZDH 3PG2A 4I4WA 5JO5B 4WW2C 3BIBX 4MXQC 5H2BB 1RD6A 4H25A 3ZE1E 2QADB 4I9WE 4PP1C 1A6AB 4M5YH 5TFSL 4AH2B 1WJ3A 5HPMA 2HTLD 4Q9QH 4R7NA 5KTEH 3GM0A 1KPRA 3O81A 4TTDC 2OK0H 4S1DC 2V7NA 4H8WC 4M9OA 4U49A 3DUUA 2V9QA 3MLWH 4LBEA 3SKMA 5L7XL 1II4E 1DANU 2UZXB 3IFLL 3OF6A 5B8CA 3OWEA 4DKFH 4DKEH 4OM0L 2IAMB 1T2QL 2YK1H 4YIQB 5HYEA 1J0ZA 2BMKB 5CGYC 1YN6A 5HYJA 2ZJSL 1U3YA 4GAGH 5T1DL 1DBKH 3D85A 4W6XB 5KSVB 1NBZB 2DM2A 1B3JA 1WC7A 3DMMB 4RBPH 1XZ0A 4K8RC 4NKIH 4FOMA 4PGCA 1UG9A 4M48L 3GRWH 3IETA 3GSNL 2CLRA 3FTGB 4ONFH 3RY6A 4P2OC 2VXQL 3GSVB 4UT9L 2E5EA 2ZCKH 3EOBA 3QRGH 1NUNB 2DJUA 5D2LA 2FX9H 4QCIA 5FA3B 1Q38A 1A7OL 1T1XA 5DK0B 5DVKA 4OZIF 3F58L 3PQYD 3OR7A 2QR0B 2JJTC 4LSUL 3ORJA 5T3XL 4FTVA 3ZMRA 2H2SD 2O5ZL 4XCYB 4O00A 2BY2A 4DJMA 3OKLB 3U30C 3K4AA 2CDEA 3CPLA 1FDLL 2AJXL 3MOAH 4MJ6B 5CSZB 3C5JB 4IRJC 3RTQA 4DGYH 4FXGA 5KG9B 4JDZB 2EH7L 2VABB 3QIUA 4EDXA 3R1GH 3VXSA 5JDSA 3B4NA 1MNUH 4RISL 3U9PH 2WBJB 5J89A 5AZEL 2HH0L 2HT3D 1KXVC 4BSWA 1MFEH 2X4PA 1NANI 3DX8B 4L3CA 5GS1C 4U0RC 1BVKA 1WVZA 5IHLB 4PR5B 2P8LB 5DD1H 1NAMB 1T21B 3BWAB 2EE6A 2BY0A 1CT8A 1Q9KB 4APQC 1KT2B 3M8OH 3T0EC 5JPMB 3RZCA 2Y25A 4QF1B 4GBXB 3FQNB 4LGSB 4WFFD 3U79A 2D4FA 4OZFG 4KAQH 4X5LA 4HG4J 3I3DA 4QHLA 1X5YA 4RGOH 5E8OA 3VXRA 1IM3B 3MCLL 1IEBB 1LE5B 3KYNA 2BCKA 3PL6B 4Y5VC 1RZKH 3L7FB 3A6CL 4PJ7E 3CSBA 1I7TB 4GAFB 4J4PC 4JZJB 3U2SA 4PJFB 2M2DA 1IKNA 4F7CB 4GMSH 3RVXD 3U4EB 3MOQA 3TNMA 4TSAL 5E4IA 4C4KO 1JNHA 2PUQT 4Q0XL 2NZ9C 4X0KB 2P8MB 4X4ZA 3C6SB 1OF2B 1J5OH 4KVNH 3EYFB 2XTJB 3GJEA 3MRLB 3T08A 3RKPA 2EC9T 1IGJB 4Z0XB 2HYMA 4G6FD 2Z92A 4UQ3B 3QEHB 2PXYB 1XF3B 2ENYA 3KAAA 2YUZA 5E6IC 4PJ9A 4XRCB 3INUH 1F4WH 4U1HB 2E27L 2CGRH 2Q8AL 3O3AB 2IPUG 2C4FT 4LU5H 5HY9B 4KHTL 3OKNB 1CL7I 2IANE 1I8IA 2OSLA 1R24A 2CJUL 1A8JH 4EN3C 5AUMB 2O61B 2CLVB 4PRHD 4L4TB 3QUYA 1NCUA 5KVGL 5L0QB 1I1RA 4NQUA 4M7LT 1T89A 4LCWD 4LFHG 4AZ8A 4E42B 3WIHL 5KZCD 1P5VA 1XF5A 4B7LA 1ZA6B 2YD1A 2ESVD 5TJWK 1AQKL 2IGFH 2D9QB 2ED7A 1YYML 5IVXE 3LIZL 3AXLB 4WW1A 5C0IB 3ULUF 1NKOA 3S36H 3NA9L 1ZVSA 4L4VD 2YD6A 1ZT7B 3ELAT 4ODTL 4J1UA 1J1OL 3P73B 1SY6A 4X6FA 1QFWI 3F7QA 1AGFA 3P30L 5I74B 4M02A 1ACYL 5BRZB 4XP1H 2VLLA 2XN9E 1EO8L 3HCVA 5MEQA 2IPUK 2H9GA 4KDTC 2GSGB 5KBNC 5LBSL 4QXTB 1U6AL 1Q9OA 3MXVH 5TQ0L 2PW2A 3MYJA 5I15L 2FJHA 4WVRA 4IHOB 2G9HA 1DQQB 1MF2L 5GRVK 3VH8B 4CN4A 3HUJA 4G6AC 4PJEE 4U1JB 4WW2B 4Z78A 2OYPA 5DI8B 3MRMA 1X5HA 1XIWA 5FDWB 2W9DH 4G42A 4KJWC 1U8IA 1JGLH 4R2GD 4E5XA 3T0DA 1I3RA 2GK0A 2Y7QA 1I7UB 1NKRA 2UUDH 1F11A 1AD9B 4NCDA 4OIBA 2W1NA 4NZUH 4M4RA 4QHMB 1N7ML 5FO9B 2VSDA 2O5XL 2R2BA 3U7WL 1LO3L 3VXOB 1S5IL 3C87A 1UFUA 1YEDB 4O9HL 5GSRB 3FQXA 1RK1A 3H9SA 1MCEA 2AAVA 5D1XA 1OAZH 4G3YH 4YJZL 3V4PL 4ONOA 2W38A 2HMIC 3GI8H 4YDKL 1TJHL 4GRWH 1CGTA 4N9GA 4KKBC 5HJ3A 1GHFH 4PUBH 3KDMB 1OTSC 3U36A 2VO5A 2Z0BA 4H5SA 4JN2A 3NCYS 5TE7H 4KPHL 3S34L 4EXKA 4P2OB 2FH6A 4LMQE 4P23A 4BA8A 4LSRL 3RGVB 4QTHB 3CFBA 3QR2A 2CKNA 3MRBA 3S97C 2ID5A 2N7AA 2K7QA 4MDJA 3MRNB 4L3EA 4OM1L 3I84A 4H26B 3U30B 1I9RL 5CBEA 4OZHF 4PJ5B 3VFUB 3SKNB 1XF4B 1K8DA 3OKKB 3E6HB 4IRJB 5C0RH 2DLIA 1MFDH 2AK4D 3FB6A 1M05A 4I3SL 1WT5A 1U8QA 1LO2L 4K3JH 1N6QH 2R15A 2WWMC 2BNUA 3RKDC 4U0QB 4U1NB 2DQTL 2AEQL 4I0KA 2DM7A 2YOCA 1FZMB 2NCMA 3PGCA 4PJCA 3ZO0A 2FIKB 5GS1B 1IZKA 4KKNA 2XICA 4OZFA 3GEWB 4AJ0A 1SVCP 3KLAB 1TETH 1FH5H 5EFIB 5GRWA 3TBSB 4OGXH 3N0PB 3MLZL 4OF5A 1DL7H 1FYTD 2BC4A 3QJFA 4APQB 4JANA 3T0EB 4YXHL 3QNYA 2Y36L 5E2UH 1AGEB 4NQCE 4EUPG 5T3ZL 2APFA 1BVLA 4N0CC 3SQBA 1TLKA 1CTNA 2AJVH 4LPTA 2HT2D 3ULUC 1L0QA 5IEKA 1MQKH 3S4SG 1E4KC 3CCHB 3QFJB 4BH7B 4WU5A 1OAYL 1X6LA 4RCAA 1B0WA 2ICCA 1HNGA 2ZKHH 1JGEA 2J6EL 1Q0XL 2HFFB 3RWIB 2VZUA 5JXED 3S37H 3QBTB 1FN4B 3QISA 2QHRH 5DQDL 3BUTA 3NFSL 5DJAB 1PSKL 3MV01 3P2TA 1T03L 2YXFA 4OFPA 5FA4B 3OXRB 5IKCB 5MEPB 4KTYA 3GKZA 3QUXA 1DDHB 2R23A 4QT5B 2UVFA 2HFGL 3DXAA 4IMKA 4LNRB 1RU9L 5HI5C 1IGCL 5F7FA 5J6HB 3TBYA 5E6IB 1YEKH 2VDOH 2IBBA 3GKWL 2NXYD 3RZWA 5I16B 2ADGA 1P2CA 3R06B 3HB3D 4P3CH 1BD2A 3X12A 3ZYZA 3ZTNL 1CICC 3KVQA 4YDVB 3C9NA 1LVEA 2QQNH 3N85H 4FQJL 1UZ8B 1QPXA 1UEMA 5C0NC 2ZUQC 5HDLA 1JNNH 2XWJA 1X7QA 4FFYH 5EC2A 4F57H 1LK2A 3TM6A 3X14A 1HOCB 3RL2B 3VXTA 1YMMD 4R8WL 3SO5A 1K5NB 2IFFH 1LO0H 3UZVB 1CE6A 4FZ8L 2D31A 3L3KB 2JJWA 4I5BB 3EYSL 5E9DA 1A0QL 1KB5A 3G08B 3AMLA 3DX6A 4LQ1A 4DFIA 5IBTH 2Q1EA 1IRAY 2HRLA 4JY6B 3QH3A 1E4WL 2EIDA 3ILQD 1G7HB 4Y4KA 2N56A 3WFHA 1UA6L 5FK9A 4F9PA 4FQ1H 2J8UE 3MV9E 4KKLD 5D70L 3ULSA 1F2XK 5FFLA 4OZIB 3X3FH 4LARH 1SY6L 1U8NB 1MCBA 3N1MC 1KG0B 1YYLH 5J06A 1J0KA 3ZHDA 1QSFE 2CDFB 2I9LB 5HHVH 1QSZA 1H0DA 1MRFL 4BQ8A 2VXVH 5KW9L 4LCUA 4FQIL 3G5XA 2GJ6B 1I7ZA 1TPXC 3ZKMC 4BFIA 1FVCB 3EDJA 2IBZY 3VGBA 3BIKA 4K7PX 4U6TA 1IGIL 5KSBE 3X11A 4NWTH 3MCG1 2VISA 4DTGL 3W2DL 3GMOB 3LV3B 1E6JL 4XPFH 4K3EL 1BF8A 2R2EA 5DD6B 2ZUSA 4N68A 4IRZH 4BZ1L 1RZJH 1UYWL 2ORBL 4U1GC 5DJDA 1DLHA 1TITA 3O3EA 4YPJA 4WI6A 1RPQA 4IM8A 2AXFB 5HHOB 4XH2B 5L6YH 1I7RA 3ZKQD 4YX2H 4GRWE 4ZPVA 1BZ9B 5ITBL 3UTZA 3BWUC 4ODSL 1RJYB 1KPVB 1D5BB 3GHBH 4KJQD 3UTTB 1LDSA 4KK8C 5FV1L 2ITDB 2E9JA 1P4IH 4PBXA 3WFBH 3BYTA 1D5MA 2VZ1A 1PVHA 3TZVD 3ZTJH 2W9EL 5DJZA 2CPCA 3QG7H 2I25N 4H1LH 3RIAF 5DMGC 4FQQA 5FYKD 3T2NH 4OD2A 1XGQB 5C9KA 4LAQL 4PS4L 3CFEB 4YC2C 3V6BR 1W0VA 3N9GH 1CBVH 2GUOB 5JW5A 1HHJA 1B2WL 1OGTB 3IJHB 1F4YL 4QXGL 1EAPA 1WEJL 2EKJA 5EUOF 5BMFL 3O2WL 1FCCA 5JQ6H 4JHWH 1EX0A 1UM4H 4RMUA 1G7LA 5I1IH 5FECB 4Y4HA 4FP8L 3Q5OA 3TO4A 3AVEA 2X2YA 3LDBB 3KPMB 5T1LA 1FO0A 4JPKL 1YQVH 1OTUC 2DQUH 1QRND 2VLRD 4XNQB 3RBSA 1C5CH 4YXLL 1DANT 2AXGB 5KS9E 2VIRA 3L5HA 3GUTA 5FCUH 1R3KB 4EUPA 1U2CA 5JIHA 4X9IA 3S4SA 3VFWA 4ENEC 3TPUA 4G6KH 5TDPB 1SEBB 5HHMD 5DK2B 2D0GA 4J3XA 1D5IL 3HNTH 4M6OL 3MV8B 1AGDB 3IFNH 1P53A 1F4AA 3WO4C 5IB2A 1S7UA 3HI1B 3BXNB 1HILB 1D5XB 3QI9A 4MAYD 5K9QI 4EOWL 5JW4Q 3BP4A 3MNVA 4TULL 4DZ8B 4OFYD 3TA3A 3MJ9A 2JJSC 5I1EH 1OHQA 2ZSWB 3IRPX 5DJCB 5B3NA 3TFKD 5IBUG 4HFUH 3HI6H 2JIXA 1FRGL 3KPSE 4W81A 1F00I 4JCLA 4OZGE 5I8EB 3U48A 2XWBB 3TBTA 1KIUA 2YRZA 4K7FA 4G8GE 3S96B 1UT9A 4HIEA 3D5OF 3TWCH 5GRXG 1RUAH 4PRPD 3QHFL 1UM5H 5F9OH 4RBPK 3NIDE 2EYTA 1S7WA 5CP3A 3WN5C 4HQQH 1UH2A 3DV4B 3G6JF 3NAAH 5AYUH 5JNYB 2NY4C 4Y16C 2IQAB 3NCEB 4OCXL 1ORSA 3BAEL 3MZGB 5FHAL 3KPRB 1CICB 2OL3H 4IS6A 3WDIA 4K23H 4Z7WE 1SEQH 4YO0B 5TE4H 4ZYKB 3ULUH 5EC1B 2EIZA 2Q86A 2HT4C 1DVFD 5JMOC 2DQGH 1G6RB 1T1ZA 5JLZB 4P5TA 2ZUQB 1KBGL 1IAOB 4O5LL 2AK1L 1E4XL 1XEDA 1Z9OA 1ZMYA 4TSCL 4Y2DC 3WEXA 1GGBL 2F54A 3T3MF 1DQJA 4HHAB 5T33H 4OB5L 5FYJL 3O6FB 2X9WA 2H3NA 3OAUH 5GRVL 3VJ6A 1ZOXA 3L5WA 1XGRA 3MREB 1XR8B 4HPYH 3ARFA 1RVFL 1S9XA 3TVMC 3AY4A 4D9RE 5D6CB 3CMOL 4Y19B 4A6YH 4NC2B 1NAKH 3GK8L 3LKNB 4M1GH 1I3UA 4DFHA 2ZNWA 4AM0A 2QADD 3V4UL 2KKQA 3MODH 4OZ4A 4TUJA 1ZHNB 4M03A 1SBSL 1MFBH 3TBWB 3FFCA 3RX7A 3VFNB 1S8DA 3QFDA 2VL5B 3RPIB 1CK0H 1ZLSL 2IANA 4F7EB 3GMMB 1SYVA 3UPAA 2ZCLH 4U6VH 3O3DA 2LABA 3OV6A 5KVDH 5I1CL 3PIQB 4JQVA 4NJ9H 4LOUC 3OKOB 1G6RH 1UWXH 5J56B 3IDJA 2DMKA 3NFPA 3IAPA 4LDOB 3ZT5A 5HHXH 3SDXE 2W59A 35C8L 2Z8SA 3B6SA 1I4FB 5D7IF 4CNIB 1G7QA 2CKBB 5IVXA 1JP5A 2PYEE 4LHUG 4OF6A 4XBPB 4NC0B 3DMMD 3F7VB 3W39B 2XZZA 1TPXB 4CVUA 4PGEA 5ILTL 4UV7H 2DYPB 5E24E 3DGCR 3DVNB 1CGWA 4RX4D 1IC4L 1C5DA 2W0LA 4HC1L 5H37H 1ZWIA 2M1KA 4K7PH 2ATKB 5TGBB 1INEL 5CBAB 4Q9RL 3MUHL 3P9LA 1WIOA 4WUUE 4AL8L 4YFEA 4WRLA 3VG0H 5J13C 4U1GB 5MI0C 1I85C 2XN9A 4NQCD 4KQ3H 5C92A 4LRNH 5J6GB 3ROLB 3KLSA 5TQ2H 4ONGH 4L8CB 5E94A 1N0XL 4PGDA 4KGLA 5EZJB 3WJLA 4ZOCA 3DI3B 3MLTB 5DSCA 3BPNC 1T20A 3KYMB 1N3NA 3RVVC 1CZ8H 3QAZC 3FT2B 2PTTB 4JFQA 4HUVB 4ZUVA 2EDEA 4Z7VF 3LKOA 1U36A 4ZUSB 3FRUA 5CD5C 4PJEA 3GI9L 3LKQB 5DZOA 2J3SA 2QKIA 2JB5L 1U8JA 2VXTL 4NBYB 4DN4L 4ZTOH 4GT7A 5LGHH 4ELMF 1EH9A 1H8OA 2CKBH 2A74B 3CIQA 4YR6A 2R0LH 2WBJD 3EYOB 5IJKA 3IVKA 4YC2B 1OCWH 4YXKH 3MRPB 4F9LC 3ZYJA 1C7TA 3ARGA 2J8OA 3G5VA 3BQUA 3LKPB 5F3BA 4F15C 4Y4FC 1BM3L 2DL2A 4NHUB 3NABL 4QRPA 1OGAB 1G7IB 1F4HA 3DRQB 5LGJA 3IJSA 5I30H 1FE8H 3NH7H 3L6FA 5B4MC 5DVOA 4GBXD 1RIVL 3RUGE 2I9TA 5CEZD 4O02L 4XVTL 3GO1H 2HN7B 1MCOH 3HPJB 3BN9D 4G43B 2BVEA 3JZ7A 4JFOB 2YPLE 3PP4H 5FGBC 3L95B 3PL6D 5CD3A 3IDMB 4N0YL 5DJ6B 4O4YH 3L5XH 3RU8H 5I19L 3GRWA 4NYLA 5T1MA 1WCBA 4JFDE 3UTTE 3UTPE 1IGML 1PDKA 4P3WA 2IQ9H 2AEPL 4O2EB 5D1ZA 1F2QA 2HKFH 3DO3A 4LQFL 3UC0H 3PF2A 3S3JA 3EYVA 4OLUL 3BI9X 2VZOA 1C16A 4K3HA 5D8JL 3VXQB 1A3LH 1FO0L 3HR5A 1NMBH 3O4LB 4MQXC 4GG6F 2D7PA 1EGJH 2VKWA 1A6PA 4P9ML 2XTJD 4LLUB 3WO4B 4K94L 1W0WB 3KR3L 2FIRT 4XNUL 3OAZH 4TNVF 4M93C 2UUDK 1A9BA 1JPSL 2Y5TA 1XGPB 3SE9H 5C07B 5JIPA 3QXDA 2H8PB 3C09C 2IALA 1AFVH 4OF3A 4XBEL 3V0VB 1JWUB 1K4CA 1CDJA 1Y18B 3T2QA 1U3HC 3BEVA 4P59L 4L4TD 2EDHA 1KTDA 3BP7B 4XNYL 4GRMA 3SDDC 4AEIH 2R29L 2GFBB 3IFPB 4IMLA 1DBJH 5DRXA 3TIEA 2IPTL 3HRZA 4CVZB 3CD4A 3WN5B 4YQXH 5IW6A 4N90E 3GMLA 3VXUE 4KTDL 2ICWI 5C08E 2DB8A 2NY4B 4Y16B 3KPLA 1RK0B 2P5EB 4R26L 3GSXA 5E4EC 1EPFA 2Q76A 3NCFB 2BY1A 5EBLA 4OUUB 3S35H 3KS0H 4HH8A 5I1LB 3ULUE 4WV1A 4TUKH 5DJXA 3KPOA 3ZE0E 5B39B 1EDQA 3S5LB 3D2UB 3T09A 2Y07L 1NGZA 4B41A 3MRQA 1S7XA 3K81A 2WUBH 4GQ9L 4R9HA 2E7MA 3Q6FA 1OVZA 4AQOA 3WJJA 2A6DB 4F33B 1X3DA 1ETZA 5CP7B 4FZEH 4RMWA 1PAMA 3WE6B 5DEGA 1UWGH 2DAVA 1IC5H 4OIIH 5FXCH 4XCCL 2GHWB 2P1YA 3WNPA 3HLAA 1ZANL 2IPKB 1KJ2L 4H0GA 3TVMB 4MVBD 1D6VH 4MXQD 1F6AB 3ILPA 1EHXA 4PY7A 4PP1D 4CRPA 5GS2H 3IKCA 1HHIB 4W4OC 1FL5A 3UYRH 3WIIH 4F8TA 4CUCA 2UY6A 4GSDH 4NFDA 2WW8A 3H42L 3LAFA 4YNYA 4YWGH 2AJ3B 3EOTL 4HKXB 4YHKL 4ZTPH 4JRXE 1NFIB 2VQ1A 4TTDD 4Y88A 2KH2B 4ZPTA 2C1PB 4X5WA 5EU5A 1HQ4B 1MJUL 1MI5B 5FKPB 3FMGH 5F9DC 1EV2E 4LHUA 2OS7A 4M6MH 4RFOH 5EU6B 4D0DA 3V6OC 3VD7A 5EUOB 3BH8A 2DBLL 4KXZH 5D1QC 4AEEA 3C08L 1JL8A 1ADQH 1E28B 1UJ3A 3O8XA 5E8NA 4A2LA 1HHKA 2R4SH 3GMQB 5CGYD 5EOQL 4XGZB 4P2RE 4PJHF 5EIIA 3QT2A 2VN7A 1U8KA 1L6ZA 1MCPH 1PG7L 4I0PB 4PG9A 3VWJA 4K8RD 4YHIA 3I6KA 4YGVB 4LNVA 4X6BB 5I75C 1DQLH 1IAIM 4QXUH 1GGCH 4FQPA 1TFHA 4HUWA 3ALXA 5BW7C 3IU4H 4P2OD 4EBQL 1JPGB 4G80A 5ETUB 3TIDB 1S7RA 2X4TB 2V17H 2A6KA 3Q6GL 2DMCA 1EEYA 2EKSB 5MI0B 4NO0B 5J13B 4UDUA 4ETQA 1QBLH 3ZKXC 2J8UA 3C5ZC 3QHTC 4QRRE 3MV9A 1AR2A 2O26U 1XH3B 2I60L 1U8OA 3BPNB 1J1XH 3PWPB 4LKXB 3QAZB 4PJDF 3BUYB 4KY1L 5C0FB 2EDJA 5CZKA 4HX1A 4IRJD 1QSFA 3RAJH 4OZHE 3AS0A 1OSPH 5H35B 1UACL 3V4VL 1JF1B 4JREC 2IG2H 4OLWL 3H3KA 1IQWL 3ESUF 1I1AC 3LPWA 1AIFA 4I8DA 1HNFA 1KN2L 4U1IB 4X6CB 4MQTB 2NLJB 4PRIA 5KSBA 4C56B 3SDAA 2I07B 2H2PC 3JWDC 4F15B 4Y4FB 5DTFA 3K4DA 3U0WL 4KZDL 4RGNB 1FV1A 1A6ZB 1GL4B 4APQD 3T0ED 4POYA 4HGMA 4LSSH 2CLZB 2YC1B 2MFNA 3W9DA 3G6JB 4GLRI 4HG4K 1HKFA 1KB9J 4QRTB 3WNLA 3ZHLA 5KTEL 4Z9KB 5ESVB 3TNNB 4JRYA 4PRBB 1A64A 1AXSB 1LGVA 4L1HA 1FNGA 2MMXA 3ARWA 3RY5A 2OK0L 3HR6A 4J4PD 2AW2A 1UQSB 3MLWL 3PXHA 5ID0B 2VLKA 4X8JB 4DKFL 4DKEL 5GGTA 2YK1L 5JORA 4P4KA 1NMAH 4Z5RB 2VB5A 4GAGL 5MERA 2V2TA 2NZ9D 1DBKL 5DMIH 3ZTJG 3VCLB 1JRHH 1X44A 3BEWB 3MJ7B 4N9OB 5E5UB 2F8XC 2XY2A 4H1LG 4NKIL 4PY8J 4AIZA 3VGDA 3GRWL 3KYKH 4ZOEA 2VNCA 2GCYB 5JHDA 4ONFL 5DFVC 4M93B 4F3FA 4W6WB 5C0CA 2ZCKL 3QRGL 4QY8B 5FB8B 4QEGA 5IEHB 3RY4A 3WL9B 2FX9L 4NHCH 3C09B 2OI9C 1A6VH 3IU3A 2X44D 5JR1H 2FX8H 3N1QC 4XWGH 1U3HB 5HGBA 1V05A 4E41A 5K9KA 4EN3D 5IB3B 4XXCC 3CUPA 3KJ4C 4CMHC 3SDDB 5C0JA 5F7NC 3DTXA 3QIBC 4ODXB 3MOAL 4HT1H 2D0HA 1V7NH 4ZUUB 4MB4A 3LZFH 4DGYL 3IF1B 1RIUH 1MOEA 4GG8A 3R1GL 5E4EB 1MNUL 3OL2A 2NXZB 3QUZC 1CFSB 1N0LA 4V2BA 3U9PL 2WQ8A 1FNSH 3UTSE 4AMKH 1MFEL 2GI7A 5DUPL 3DSNA 5F1NA 3VWKA 6CGTA 1URLA 1T0NB 3QNXB 3OKDA 1WAAF 5DD1L 1UC6A 1EHLH 3GB7B 2HFEB 4D0BB 4U6HA 1G9MC 4L9DA 4WUUD 1NCDL 5IF0B 2W65B 1S7VB 2FJFB 4KAQL 1DUYB 3FB7A 2C1OA 3KPSA 3TCLA 4N0FA 4RGOL 3GSQB 2C5DC 3O2VL 4F58H 3K2UL 3CZJA 4QWWC 4G8GA 1RZKL 32C2B 1VEMA 2YR3A 1U95B 2OLDA 3L3HB 1CVRA 4PJAF 3VMNA 1IGFH 4RA3A 4D2NA 4G6AD 4Z7VB 4GMSL 2GTZA 1XFPA 5JXAH 1S5HA 2APVA 1A4KB 1FVEB 2FD6H 4KJWD 1JGVH 4YPGB 2XPGA 3CU7A 3VFOB 4X9GA 4ELMB 4NBZB 4XCEB 4EI5B 3CXHJ 2Y6SD 3VRJA 4Z7WA 1KIQA 2IF7A 4PJBE 1J5OL 3C60C 4KVNL 3G04A 4ZQKB 3ZDXF 5MEOA 3DUHA 3VDCA 2VDLH 1GZQB 2COQA 1X4YA 2W91A 4LLDA 2LU3A 5D1QB 4JR9H 4NDMA 1ZSDB 3W81A 2AQ3A 1CGSH 1YJDC 1OTTC 3INUL 4CJ1A 1LQSR 4KFZC 1F4WL 3QQ3A 1OPGH 3A67H 4MJIB 3SBWA 1PEWA 3QWOA 2BNRB 1KTRL 3BO8A 2YPLD 1FFNB 4LU5L 4NQDE 4PJGF 1MHHA 1N2RB 4NO2B 2HMID 3GIVA 1AR1C 4KGJA 1UKTA 3DROA 3NZHH 4XP9H 8FABB 1P4BH 1T7WA 5D2NC 1K2DA 2W9LA 4KKBD 5LXGH 4RAUB 1OTSD 3UTTD 5F3HA 3FB8B 1A7RH 3C8KA 5IR1B 5L2KE 1J11A 1YPZF 3QRFM 2ZOKA 3UTQB 1CFBA 3MX0A 2IGFL 4JM2D 4UT6H 5EO1B 1Q0YH 4JAMA 1LILA 3OKEA 5IVOA 5FHBH 3C5ZB 3ZKXB 3TH3T 1EEUA 3S36L 1HSBA 5SWSB 3CX5J 1WITA 2K1MA 1S78C 4M7KH 5FUCC 2VZTA 5SWZB 1JPTH 4GG6B 2V9TA 4E0RA 4UUJB 4U7KA 4LK4A 1MI5E 2WWKO 5HYQB 1WCQA 3JTTB 4JVUA 1GGIH 5K9OB 4OJFH 4XP1L 5DDHA 2CDGA 1QHOA 4XVUC 3MGTA 2PYEA 4JREB 4R3SB 2WWMD 1I1AB 1QQDA 3RKDD 1X5FA 3IKKA 2XG4A 2R0KH 3DARA 3L3GA 2P47B 3QWQB 4LLAA 5HGDB 5TDOB 2PTUA 3BP6B 1D3CA 4N90D 3W0WB 1UVQA 4DK3A 3RWDA 2W9DL 4RIRA 1CE1H 1VKXB 4LEOA 1QNZH 1TDQA 4GRLC 4PTTA 5EBMA 2BOCA 1JGLL 4N0CD 4YZFE 3ULUD 1EMTH 3D1MC 5I17B 2BY3A 3GJFK 1NGQL 3RWHA 3RWFA 3WNNA 1N6VA 3DUSB 4H0HB 3WFEH 5HI4C 3FQWA 4L3AA 4O51B 3RHWF 1GZPA 2BSTA 3JWOH 1BECA 4BH8A 5INDB 3H3BC 3MROB 3FN9A 3BN3B 3UJTH 4QTIH 2J5LC 5IT2L 3O9WC 3HAEH 5I1DA 5IV2A 3C8DA 4U6XB 5DJ8A 2GSIA 1CLOH 1OAZL 2IEPA 4FQHB 1OSZB 3ZE2F 1K3IA 3MJ8A 1VERA 3P4LA 4K9EH 3GI8L 2EEBA 3BSZH 3TJEL 1C1EH 5CJ5A 1JYWA 2YA1A 3RWEB 1GHFL 4PUBL 4PV8A 4ZO7A 5BS0A 3ARUA 2CR6A 4XAWL 2ADIB 5HI5D 5TE7L 3JWDH 4QRUA 1KPUA 1QFWM 1MCHA 4GAYA 5J11B 5FF6A 3RUGA 1A1NB 4NJAL 4ZXBA 2EYRA 1EK3A 3G6JE 5EA0H 2OI9B 4JRXD 3KPRD 1CICD 2DWDA 3FONB 2GY5A 4HXAL 5F9JA 1RFDL 3CSYB 4U6YB 4D0CA 5C0ND 3KJ4B 4CMHB 1SJEB 4PB0H 3LRHA 4JFDA 3QIBB 2C3XA 4NNXB 5SX4H 5C0RL 5IG7A 1MFDL 5D2LF 2YEZA 1MUJB 4UTAH 1U8LB 1JN6A 2AABH 2LFGA 4K3JL 1N6QL 1M6OA 5LQBH 3T3ME 4M8QB 2X4QB 5JIIA 1ZHKB 2MCPH 4PJHB 1DE4A 1A1OA 1VGEH 3EYUH 3OXSA 4M7LH 3KXFB 5BO1H 1T4KA 1TETL 1FH5L 4OGXL 4HZLA 1CD9B 1DL7L 2CRYA 4R4FH 43C9B 5HDQH 3AS3A 4QRRD 4I77H 4JVWA 1XGTA 1JTPA 1T66C 3HMXH 4Q6IC 5E2UL 1S9KC 1IQDA 2F74A 1BX2B 2EH8H 3P77B 2AJVL 4PV9A 1MQKL 4JPVH 4WI9A 3DYOA 3BT2H 1T5WA 5ERWB 2ZKHL 5IMMA 1I8LC 3OR6B 4LCCA 5BQ7B 1T6VN 3OJMB 5MENE 4UDTA 4PJDB 2X4RB 3S37L 3LPFA 3FQRB 2OTUB 3VXUA 4BSVB 5TE6H 3DGGB 1A9EA 2QHRL 4R0LC 5C08A 4IOIB 2F5BL 5D7IE 1EAJA 3GMNA 4HK0B 4L29B 1AJ7H 2OL3A 3MLUL 3ZKMD 3VRIB 3BPOC 3D69B 1I3VA 3I3BA 1BIIA 4I2XE 5C0AE 1DQTA 1X5GA 3C60B 4KI5F 3VA2C 4B7IA 2BHUA 1ED3A 4XCNA 1XR9A 1YDPB 3SJVB 5F8RC 4Y1AB 2FO4B 1LD9A 1YEKL 5ANMA 2VDOL 5C0BA 3SKJH 1MJ8H 3OAZK 2X4SA 3P4NA 4EKXA 4P2YA 3UBXI 2AS5M 4LF3B 4P3CL 3TV3H 4PRDA 3CDFA 2CRZA 3VXMB 5EZIL 3FOLA 1MCIA 4URTB 2APBA 2QQNL 5D2NB 3N85L 5CEXA 3HPLA 1ZVHA 4JQXA 5EO0B 1JNNL 3TO2A 1DBMH 4FFYL 4RMQA 4F57L 4KK8D 3REVA 1YNTA 5C09E 1LO4H 5CMAA 1KACB 3GJFA 1ZLWH 2IFFL 1LO0L 4RQQB 4XWOC 4P5KA 2ZOLA 1R5VA 5DMGD 3K0WA 3UBXB 1CXHA 2DQDH 3P0VH 4M6NH 3PGDA 1QFPA 1FAIH 4X7SH 2G60H 3PGFH 5D7JA 1CFTB 3GFUA 2DI7A 2RCSH 5IBTL 4QHNB 3GSNB 3HZVA 1ZT1B 1GPOH 4GAJH 5B8CC 4OCWL 1FNFA 2UYLA 3OKMA 1LO5A 4FQ1L 4MJIE 1YJDH 1YY8A 3L3OB 3RNKB 4X4YA 3DETC 3S5LG 3FOMA 3TN0A 4P2RA 1MJ7H 5I1JL 5GGRA 1NCWH 3DIFA 4ODWB 3NFNA 5IHZA 3MUGB 3EIFA 2Y72A 3X3FL 4LARL 3T77B 5GXBB 3EGSA 4UAOC 5ICXB 1VFAA 4MNHB 2GITA 5FKAB 2VLMD 1PYWB 2XZCH 4QHUA 2SEBB 4HLZG 2NW2A 4J3WA 2FYYA 2P24A 2PN5A 1J8HE 1YYLL 3EW3B 5DXWA 4M7ZC 3RY6C 1I1YB 1OARL 5HHVL 5BOPA 2L4OA 4KUZL 4ENED 1OT1A 2VXVL 2DQFB 4NNPH 2OQJB 2BP3A 3V6FA 4GRLB 1G84A 1Z0NA 2ZJSH 3MRRA 2Q20A 3HE7B 5SWSE 3QXUA 3I2CH 3RWGB 1X9QA 4YUEH 3PHQA 3OZ9H 1U8PB 3VGAC 4XB7A 3W9EB 5D7LB 1BFOA 5T1KA 4XPFL 4M48H 4IIQA 4K71C 1VEPA 2E7LA 2J5LB 4IRZL 1UCTA 3O9WB 1RZJL 5TDNA 3FCTA 1IBGL 2OTWB 3OGOE 1ZHLB 4NC1E 2NW3A 3QIUC 1AGCB 3RVWC 2GT9B 1MLCA 3SGDH 5L6YL 4HBQA 1WIUA 4WIQA 3OMZA 3F58H 3O41B 2ATPB 5T3XH 1NBYB 5KANG 3CZFB 3JV4B 3LKRB 2Q6WB 2DLTA 2D7NA 3BE1L 3D39B 1TTUA 1MFCL 2QSQA 3GMPB 1P4IL 3WFBL 1L7TH 2M8XA 5GS2D 1FJ1A 1NMCC 1CFQA 2AJXH 3RZCC 2BVYA 3BGMB 4MNQE 4YDIL 2NY4D 3L9RA 4Y16D 3LEYL 5E5RB 1FGVL 3QG7L 2HJFA 3MRFA 4KJYA 1Z9MA 4Y89A 2VAAA 1CBVL 2YD9A 1VFBB 3CSGA 3DBXA 2VZ3A 3OB0H 2HT4D 5AZEH 3L3DA 2R2HA 3MRHB 3D2UD 4KI5C 2Q7YA 5JQ6L 4JHWL 1HI6A 1UM4L 5I1IL 1IKNC 5C6TH 4Y2DD 5F7KC 4X98A 1RZGA 1TZHA 5C0EB 1IL1B 5FGSA 1A7QL 3SDCA 4U3CA 1TCRA 5JOFB 4O2CA 5F7EH 1YEJH 2AGJH 3PWUA 2ICES 1EGJA 4NQEA 3FFDB 3WHE0 4PJGB 2HJKA 2DQUL 4OBSA 3EZJB 3MCLH 1C5CL 2YA2A 5C0DB 4YEFA 2FHFA 5IK3B 4KROC 3GSUA 5E03A 3H7BA 4QYOA 5FCUL 1HH6B 3G6DH 3QG6A 1JPFA 3BVNA 1TXKA 4X7EC 4LLVB 1YPZB 4PJ9C 4G6KL 2BOBA 2ICWJ 4WWKA 4GKZB 4YHMH 4J3TA 4Q6IB 4PD4J 2HTKC 4MJ5B 1RZIA 2V6HA 43CAA 3QQ9C 1PFCA 3HNTL 3IFNL 4Z95H 4RMVA 2NTFB 5D72H 3QWRD 4PJCF 1MI5D 2FZ3A 2XT1B 3QUYC 1OQXA 4LOUD 3QPQD 5EU6D 1T89C 5I1EL 4C55A 3NA4A 1VFUA 2AV7A 4ODUA 4LLQA 4HK3J 4HFUL 3HI6L 4NGHH 1G7MA 1UXWA 4R0LB 4DVBA 1U58B 3V5HA 1WLHA 4OQ1A 3P9MB 2F19H 5FV2A 3UTSA 3BPOB 4CVXB 5L9DH 4PJHE 3AREA 1M7IA 3VI4F 3WSQH 1A1MA 2VITB 3HC3H 2H2SC 2VLJE 4ZSOE 3TWCL 1RUAL 2N7BA 4B53A 2X42A 1UM5L 3QB7C 2JCCE 3KXFE 5F9OL 2BZDA 4HQQL 2DDQL 1NGYB 1UCBH 2YA0A 4P2QB 5AYUL 3GSRA 1WZLA 3WIHH 5HXMA 5AD0B 2DM3A 2IADA 4JZNB 5HYIA 1AQKH 1IKFH 3LIZH 2FDBP 2OL3L 4HKBA 5FYKU 1SEQL 3T3PF 3I6GB 5TE4L 2EDQA 1RHHA 5GJTH 3RVVD 3ULUL 4ODTH 1KLUA 1J1OH 2DQGL 5FM5M 5E95B 2AKRA 2VR4A 4I4WB 5CD5D 1EXUB 2V9RA 5DYOA 5GGSA 1XIWC 3IXAA 5BZWA 3MCKB 3P30H 4NO5A 5K59F 5KAQF 4ZD3H 4C58B 1ACYH 3DHJA 4RNRA 5T33L 3OAYH 1T0MA 2FBJH 5HPMB 2PO6A 3IYLW 1RULH 3DO7B 4YDJB 2I24N 4GKOA 2Z31B 4HPYL 2EDKA 4C56D 4GKSA 4PJBA 3MRJA 1CF8L 4Y4FD 4BZ2H 1DUZA 4KK5C 2V7NB 5I15H 4X5XA 4A6YL 5HVGB 1NAKL 2FJGA 3BZFA 3DUUB 4M1GL 1JHLH 5C6PB 1LEGB 3SJVE 3SKMB 1F3DJ 5DQJB 4Y1AE 1I8MA 5B4MD 5J7CC 4Z7NF 5F70A 1BPVA 3MODL 5B8CB 1VENA 3VFPA 2J8HA 1MELA 1MFBL 4KWUA 1R6VA 1PGRB 4XC1H 1YN6B 5HYJB 4NQDA 2DQHL 1J86A 5IIEA 3D85B 4Q9CA 3ALWA 1ROWA 3D9AH 4UAOB 5KVDL 1XZ0B 4NJ9L 4CKVX 4JLRA 4PGCB 1GJIA 3D3VA 3FQTA 3TBVA 1G6RL 2EDXA 5L2KA 3IETB 4K7PY 5HHXL 4M7ZB 3OHXA 2C7UA 4P23C 2EXYC 4JO1L 4MSWA 4TNWF 3EDKA 5D2LB 2E8YA 1GC1C 5EULV 2IBZX 4NOBA 1T1YA 4QCIB 3WV0A 3AMKA 5J1AA 4MMXC 1T1XB 3IDGB 3DPBA 3OR7B 2BSED 4UV7L 4FTVB 1OB1A 3CFKA 1VACA 1ZT4A 1J9CT 4HCRA 3S9DB 4NPYB 2CDEB 1DEEA 5GS3A 3CPLB 5F7HA 1UB6A 1SJXA 1T2JA 4K71B 4OFVA 3NIGE 3OGCA 5AZ2H 2NR6C 3S34H 3VG0L 4X9FA 5EPMA 4DOHB 1BWWA 1JWSB 4LRNL 4FXGB 2IJ0C 3WHXA 2CIKA 5TQ2L 2Z91A 3QIUB 4EDXB 4ONGL 3VXSB 2E7HA 3BX7C 4XX1E 5F9WC 5JDSB 1KIPB 1J18A 1FG2A 5T3XE 2EEDA 1RURH 1CZ8L 4BSWB 2X4PB 3N1GC 3SDDD 4L3CB 3LS4H 2P45B 2NY7H 1BVKB 2WK2A 5ENWA 1YC8A 2CK0H 1VADB 2ZZUT 1NMCB 1CT8B 3UX9B 3RZCB 3D0LA 4HWEL 1J0YA 1TNNA 2ED8A 4ZTOL 5LGHL 4UU9A 2CKBL 5ALCL 5FAAA 3SPVA 1TZIA 4OFIA 5JO5A 4M1CC 1M71A 4UZGA 1OCWL 4QHLB 5E8OB 3VXRB 5EWIH 4YXKL 4OLZH 4RMSA 3KYNB 2BCKB 2KL6A 2F9BT 4LVHC 2ZUXA 5DMKB 3ZLQC 3T1FA 1FG9C 3OQ3B 1WAAE 1FE8L 3WCYA 3ZE1F 3NH7L 2R56L 3WUWB 3REWB 1NC2A 3GO1L 1MCOL 3TNMB 1MCDA 4YDLC 1X5KA 1AQDA 1DLFH 1JNHB 1YA5A 3HAEG 3PP4L 5IP4A 3AROA 3QUXC 3MFGB 2IAMA 3QQ4B 4O4YL 3RU8L 2PR4H 2AI0H 5BZDA 4IMKC 3GJEB 4I3RH 4WHYH 3VFRA 4Z76B 2B1HH 3AS2A 4HUNB 2IQ9L 2Z92B 2HKFL 4PJAE 4GQPH 1Q0XH 2DI8A 2JJVA 1GCFA 3HZMA 2BRQA 4MDIA 2X05A 1A3LL 4YHZH 5ICZA 5HVHC 2OTPA 3B2VH 1NMBL 1PSKH 1JMZA 1EGJL 1I8IB 2OSLB 5K33A 4ZFFA 1P1ZA 1XT5A 5FA3A 1HYSC 3QUYB 2LV4A 3OJ2C 4WFHD 3SO3C 5DK0A 5D4QA 1RU9H 2HVKA 5D1QD 2HA1A 1IGCH 1XF5B 4LGRB 4MJID 1WFNA 1I9IH 3OKLA 1P7QD 1UH3A 2OMBA 1PX3A 3PWLB 3O4OB 1VFOA 4WW1B 4ZFOA 3BPCB 1NCBH 1NGXA 4I3GA 3MACH 4J1UB 5IESH 4X6FB 3F65A 1BJ8A 1DBJL 2RBLA 3CAFA 4YQXL 1AGFB 3F12A 3NN8A 2X1PA 1EO5A 4Y4KC 3DX8A 3RDTD 2HP4A 3PDOA 4WGWB 4F9PC 2VLLB 3C5ZD 3HCVB 5SWSD 3PABA 5MEQB 1NAMA 1KCSL 5SWZD 1Q9KA 3S35L 2BVQA 1Q9OB 3EYSH 2PW2B 3MYJB 4TUKL 1NH6A 1S7QA 2FJHB 5FIEA 4WWID 2G9HB 5MENA 2A83A 3C8HA 3K7UA 2XQYG 1IM3A 2FRGP 1HYRC 1IEBA 2WUBL 3Q5TA 1RY7B 1PKQB 3V5DB 3OB8A 1XIWB 5GGSY 5ELIA 2BK8A 3HFML 4D9LH 2EZ0C 1UA6H 1I1AD 4G42B 5JW4M 1UWGL 2V5RA 2D7MA 4J3UA 9CGTA 4OIIL 4E5XB 1I3RB 2GK0B 4MCYB 5D70H 2YBRA 4I2XA 4PRAB 5C0AA 1F11B 2H2PD 1TTFA 4X99A 1D6VL 4UINH 4OF7A 4X0KA 3FRPG 4RAVB 1BREA 4J6RH 3MTRA 1QSEE 2JE8A 1AC6A 4RZCB 1KB9K 1N6UA 3UYRL 3WIIL 1UKSA 1EFXA 2X6MA 5HGAB 3MRLA 4GSDL 5IROA 4YWGL 3ZT6A 4Z0XA 3FQXB 3H9SB 5IGXH 3FQUA 4XCFL 4UQ3A 3QEHA 1WBYA 2HRPH 2PXYA 4ZTPL 2BXZA 4MZ3A 5I73C 2AJZA 1OT2A 3BFOA 4N9GB 5HJ3B 3FMGL 3HE6A 3U36B 4M6ML 2YRPA 4RFOL 5HY9A 1KCVH 4MD5B 5C09A 2XQYK 4Y5YA 1E6JH 2E9IA 4JGMA 1ONQA 4P23B 4XNZC 2R4SL 1NSNH 4XMLH 4BZ1H 1I9JH 4YFLF 3CFBB 4E42A 3SN6N 1MCPL 1QRKA 4LVOC 4BSJA 4MDJB 4HUXB 4NN7C 2BNQA 5IB4B 4L3EB 2VH5H 3RX8A 5E8EA 3AXLA 4QXUL 4PRHB 5CBEB 3IU4L 1K8DB 1ZT7A 4Y8AA 4NUGH 4Y4HC 3TF7C 2QQLH 15C8H 2P5WE 1U8MA 4N0UA 5IVXF 5KZCB 3TO4C 3B9KA 3QO0A 4AQ1B 2CO6B 3F7YA 4GW5A 5EDXA 4FABH 1U8QB 5F9WB 1NGPH 4G6ML 2BNUB 2R8SH 1TTGA 3EJYC 5BRZA 2B5IC 1J1XL 5A16B 4MHHG 4HCRL 1W72H 1Z2KA 2JTDA 3PGCB 3QIBD 4PJCB 2HG5A 4OZFB 5BMFH 1J8HA 5DUML 3NCCB 1A47A 3IDUA 4MLSA 4X6DE 4HK3N 2BC4B 3QJFB 1OSPL 5JW4R 5E2WH 4HKJA 4OI9A 2IG2L 4OSUH 4IHOA 3QNYB 3BDYH 3QUZD 3BKJH 5ACLA 1GC1H 1ZLWK 3S88H 3MV7A 2DLGA 5DO2C 4KKLC 2VWEE 2VLJD 4OT1H 1KJMA 4RFNC 4FTVE 5IEKB 1BEYH 4WU5B 3KXFD 3QI9C 4XMPL 4LVHB 4HIXH 1JGEB 4PJEF 1EEQA 1WSST 3TA3C 3HAEA 2FHCA 1E4XI 4LSSL 2CXGA 1AD9A 2UWEE 1CWVA 4HUUB 1INQA 4YDLB 2FB4H 1JBJA 1EEZA 3LD8C 4ERSH 4JFPB 1SMOA 3H9HA 4QWWD 3QUXB 2R23B 5GSRA 4UMGA 3DXAB 5F97E 4OBRA 2CSPA 3PNWA 1T7XA 4XX1G 4EOWH 4WO4A 1MHCA 1U9KA 4MNQA 4XVSH 4D9QE 3VXNB 2ADGB 4ZFZB 1LEIB 5DMIL 5HVHB 1JRHL 3FO0L 1BD2B 1AKJA 1JIBA 1W8OA 2XI9A 4HW6A 3X12B 1KTLB 4I48A 3T65B 3C60D 3QO1A 3KYKL 3RGVA 4P5TC 3SJVD 1KFAH 5MP6H 5KVFH 3O6ML 4Y1AD 5EC2B 3U7AA 3RL1B 2JJTA 4HGKC 4XMKL 1LEKA 3X14B 1OTTD 4J3SA 3VXTB 4NHCL 3GZKA 4HIJA 4P46A 4H26A 1A6VL 5I9QC 4PJ5A 1HQRA 5JR1L 4XPBH 3VXMD 2FX8L 5EORH 3QUMH 4OCXH 2D31B 1AR1D 1QP1A 1F58H 4HDIA 4OGZA 5DJYB 3ARFC 5E9DB 3VGEA 4RA0C 3DX6B 3AY4C 3PE9A 2MOVA 1P4LA 4HT1L 4JKLA 4PRNB 1V7NL 2FWOA 3PJSA 2DQEH 3KJ6H 4M00A 1RIUL 4XAKE 4Y4KB 4M9PA 3EDEA 3WFHB 5FK9B 1HINH 3P9WB 1WZMA 2WP3O 2JJUA 1JNLH 1EHAA 4ZFOL 5SWQA 3RFZC 4OB5H 1FNSL 1S78D 4JFFE 3ULSB 5C71A 4AMKL 1VB9A 3U0TA 4YHPA 5E99L 2ZSVA 1TVHB 1JK8A 4D94A 5IWLA 1Q9WA 1RVFH 2OCFD 1EHLL 1QR1B 4KHXH 3BW9B 3OB0K 3GK8H 3QFJA 3CCHA 4XVUD 4LCUB 5F1OB 4G9FE 5T3XD 1X5LA 4PREB 3FRPA 4HFWB 4F58L 1I7ZB 5BV7L 3O0RH 1FN4A 4BFIB 2X1OA 1EVTC 2R1WA 2Z35A 1HXYA 3U6RA 3BIKB 5IMLA 3LY6A 3O6LH 1FNEA 4MJ2A 3O3UN 2VISB 2YPVH 1KB5H 2JCCA 4JDVA 1IGFL 4PP2A 3MNZB 2J88H 2R2EB 5IKCA 5MEPA 5A2JH 2P8PA 2B39A 4L9LA 5JXAL 4PIRF 5DJDB 4GW4A 1DLHB 2FD6L 1JGVL 1PG7X 3PWNA 4RRPG 3HTLX 3C6LA 1I7RB 1YEIH 1G7PA 5E6IA 4WNQA 3WJLC 4ZPVB 4XP5H 5I73B 3UTZB 5HI4D 5K9QG 1XAUA 3O45A 1J87A 5D7LD 1JV5A 2VDLL 2W0FA 4HJ0D 2FX7H 3O9WD 2APTA 3L3IA 1D5MB 1CGSL 3HUJE 1UZ8A 1OPGL 3A67L 2HLAA 5A2FA 1BHGA 5I8KL 2FLRT 1RAMA 4ODHL 4OD2B 4LCYA 5IJKC 1IAMA 4XP9L 1HOCA 3H0TB 1P4BL 1NC4A 2NY1C 5I18H 4LVOB 5LXGL 3ARGC 5JW5B 1HHJB 3BQUC 3D39D 3HZYA 1GH7A 1EAPB 2PKDA 1A7RL 2APXA 6FABL 4HWZA 1QUNA 4Y4HB 4UT6L 4HF5H 3TO4B 2VXT