3X1EA

Structure of copper-containing nitrite reductase from geobacillus thermodenitrificans without chloride
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
295
structure length
295
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence of the flexibility of the CuM site
rcsb
source organism Geobacillus thermodenitrificans ng80-2
molecule tags Oxidoreductase
molecule keywords Nitrite reductase
total genus 98
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3x1eA00
3DKHA 1ZIAA 3ABMB 1MZYA 3ZBMA 4G7SB 1E5ZA 1JOIA 1IUZA 1ZIBA 1JXGA 3FYEB 3CDZA 4KO9A 3SBRA 2N0MA 3TA4D 4YSTA 2H47C 2YXVA 1PZAA 1AQ8A 2PP8A 4AI7A 2I7OA 3FQYA 2ZXWB 7PCYA 2DWSA 1A65A 2OCCB 4GYBA 1KGYE 2IDUA 2Y1AA 4E9RA 2AVFA 2R7EB 1PLCA 3AG1B 5E9NA 1SHXA 5B1JC 1FFTB 3FU8A 1E67A 1IC0A 1NIEA 5EHFA 4A2GA 1ASQA 4Q89A 2TSAA 1J9QA 1UATA 3IEAA 1FA4A 2AANA 2ZOOA 2IDTA 4AKQA 4A2FA 1OCRB 2BHFA 3EF4A 2YAOA 1XB3A 4G7RB 5D4JA 2W88A 2XWZA 2Q5BA 4HALA 1MDAA 1L9SA 1OOWA 2XUWA 2VM3A 1W6WA 2FT6A 2PPEA 3KW7A 1AOZA 1URIA 4YVUA 3MX0B 2I85A 4YSOA 1NTDA 4BWWA 1L9PA 1ID2A 2Q9OA 2XXFA 2H3XC 2FQDA 3V9CA 5AKRA 3X1FA 2H5UA 3EHBB 3TU6A 2QPEB 1M9WA 3JTBA 1ILSA 3NSCA 2FWLB 2OJ1A 3FSWA 3CVCA 3WNJA 1JXDA 1JERA 2FJSA 2XV3A 3PPSA 2PLTA 2CALA 4NB7A 3H4FA 3T6WA 4HCIA 1M56B 1WS8A 2AFNA 5I5IA 1NWPA 2WSDA 1CYXA 2JKWA 5I26A 1AAJA 1BXVA 3FSVA 1TU2A 3FT0A 4JHVA 1A3ZA 4E9WA 2ZWNA 4E9TA 4A2HA 1WAEA 1A4AA 1XB6A 1PY0A 2X87A 4GP4B 3UAEA 3SQRA 3TASA 3OMAB 4E9VA 1GR7A 5I6NA 4GXFA 1CYWA 1ZV2A 1JZFA 2B3IA 4BXVA 1DZ0A 1SFDA 4DP8X 3HEIB 2XVBA 1MZZA 5B7MA 1BXUA 5D4IA 2PPFA 3QJRB 4E9SA 1GY1A 5A7EA 1WA0X 1AZNA 4DPAX 4G72B 5B1KA 2J56A 3HB3B 4P5RA 4KNSA 9PCYA 2YAEA 1FWXA 2YAFA 1KCBA 1V10A 3FU9A 3AY2A 2HX8A 3MBWB 2CCWA 5D4HA 4P5SA 1NDTA 4DP5X 1N68A 2YARA 4DP4X 2JXMA 1ASPA 3X1NA 3WKQA 4BWUA 1GS8A 2IWFA 3FU7B 1GY2A 3FSAA 2YAQA 3N2JA 3OMIB 3UADA 4N8UA 2CJ3A 5LDUA 4KNUA 3NSDA 4UAHA 2BW4A 1E65A 1OCZB 2VMJA 3CZUB 2PP9A 3GDCA 4F2FA 3FYIB 2BW5A 1OV8A 1PMYA 2Y69B 1A8ZA 1J9SA 3NP3A 3X2QB 2BP8B 2MTAA 1L9QA 2XV0A 1IBYA 1CURA 1F56A 3S3BB 2HX9A 1OF0A 5B1BB 1ET8A 1AG0A 4M4RB 4A66A 1PZBA 4E9XA 1GYCA 1J5DA 2B08A 1IBZA 1ET7A 2HLEB 4F2EA 4W9ZA 1JZEA 1W6LA 1YLBB 2VSMB 2IDQA 4YSDA 2GIMA 4PCYA 3PAVA 1AACA 4YSCA 1KCWA 2QDWA 4HIPA 5B1JA 3GXUB 3NJLA 3T71A 4X4KA 3FU7A 2XU9A 4L0PB 1BAWA 1L9TA 2E86A 2PCFA 5FC9A 2W8CA 5AFAA 2GHZA 3T6XA 2R7EA 3NJFA 2CBPA 1PNDA 3WI9A 1AR1B 1I53A 3U25A 3H56A 4AX3A 2QPDB 3CVBA 2RACA 2LLNA 1J9TA 3GYRA 4W1TA 4AZUA 2FQEA 4BDVB 3ABGA 4YSAA 3UAAA 4F7KA 1BEXA 1AZCA 5PAZA 3UACA 4YL4A 1AZRA 3PAZA 2WO3B 3IN2A 1BQ5A 4N4YB 4M3HA 1PF3A 6PAZA 1JZIA 5B7FA 4K9JA 3X1EA 3OQRA 1SHWA 3PCYA 3SBQA 4WKXA 1NZRA 4BDVA 3AG4B 1MG2C 3NJKA 5B7EA 1KDIA 1JVOA 2BWIA 4GP5B 1E5YA 2P80A 3AZUA 4A2DA 2XXGA 2VN3A 3ERXA 1PZCA 2I7SA 4KO5A 2GC7C 4YSRA 1RZQA 1E30A 4Q8BA 1ZDQA 1SDDB 1HAWA 2J5WA 2XX1A 1XMEB 2UX7A 3RYMA 3OD3A 1SJMA 4YVNA 2XLLA 1WA1X 1SFHA 2UXGA 1N70A 1DYZA 1KBWA 1W8EA 3PAUA 4A2EA 1JVLA 1QNIA 1GW0A 4MFHA 5B3SB 3EH5B 2FNWA 2PCYA 1L9OA 2AZUA 3FPXA 2BO0A 4QLWA 4YSEA 4DP7X 3NT0A 4UANA 3NJNA 1NIDA 2YAMA 1ZDSA 1KV7A 3FPYA 1RZPA 2IAAC 4DPBX 4YSQA 3FS9A 3QJQB 5AZUA 1TEGA 3TBBA 3FSZA 4QKTA 4PAZA 4A67A 1NPNA 3FQ2A 3OM3B 4KOBA 2DV6A 4NAJA 1HFUA 4KO6A 3QQXA 1BQKA 2XV2A 2UXFA 1GS6X 1KBVA 3AW5A 2CUAA 2DWTA 2FTAA 3CDZB 3H4HA 3G5WA 3TBCA 4AKPA 2FT8A 2VW6A 4JHUA 3NJHA 4HCFA 4DP0X 3D12B 3WIAA 1RCYA 2BP8A 3NYKA 5TK2A 1A4BA 2OV0A 2HRGA 3ZIYA 4DP9X 2GI0A 1EZLA 2BWDA 3IN0A 1QLEB 3S3DB 2ZONA 3QJVB 5I6PA 1PAZA 1AG6A 3WKPA 5I6KA 1J5CA 2VSKB 2DY2A 4HZ1A 1B3IA 5TK4A 2FQGA 1BXAA 3PXLA 1ILUA 1V54B 3PLYA 1NIAA 1TEFA 1CUOA 1OCCB 1ASOA 1QHQA 2JFCA 3QJTB 2CAKA 3NJMA 1VLXA 1OCOB 3T9WA 1AS6A 1ETJA 3NSFA 5B1AB 2UXVA 2BP0A 1SNRA 4EF3A 2HX7A 2BZCA 2UXTA 3QPKA 4GY4A 3ASOB 4FA7B 1RKRA 2BP0B 1SF3A 5I6LA 2HZHA 1PLAA 4E9YA 4HAKA 2EIMB 5ANHA 3UABA 3V9EA 4E9QA 1V55B 4KNTA 3T6ZA 1JZGA 2DYSB 2AZAA 2J57A 5I6OA 3ZDWA 3IBOA 3OMNB 5I5JA 4G71B 1BYOA 1TKWA 1EHKB 5PCYA 3NJGA 1OE2A 4CSPA 2TSBA 2WO2B 3S8GB 2FQFA 1CC3A 1PCSA 3ASNB 4YSUA 1BQRA 1WS7A 3T6VA 3QJUB 3FQ1A 1X9RA 5F7AA 2IDFA 1GS7A 4KO7A 1ET5A 3NJIA 3UGEA 2YQBA 3X1GA 8PAZA 4HCGA 3X1BA 6PCYA 2MRYA 1JXFA 4DP1X 2EILB 1WA2X 4ZK8A 2XX0A 4WTQA 3ZX1A 4TXVB 3SBPA 5I28A 1SF5A 1AZBA 1M57B 4BXSV 2GBAA 1GSKA 1JZHA 1ZPUA 2GSMB 2VW4A 1AIZA 2IH9A 1OE1A 3BQVA 3EH3B 3S3CB 4ENZA 3AG3B 2XYBA 3NSYA 2UX6A 1BYPA 1X9UA 3BVDB 2GB2A 3DIVA 3IE9A 3L45A 4HHGA 2PPDA 3WG7B 4BK5C 1AZUA 4DP6X 1NPJA 1SDDA 4JKNA 2P80D 4RH4A 4YSSA 1NIBA 4DP2X 5IY5B 3S8FB 2YXWA 1IKOP 3AG2B 4GP8B 2VM4A 4UF7C 2J55A 1KYAA 5I6MA 2A3TA 1OE3A 4NERA 1KDJA 2QT6A 1HAUA 3CG8A 1XB8A 3NJJA 1L9RA 4G7QB 4HHWA 2NRDA 1MG3C 2EIKB 1AS8A 7PAZA 4AKOA 2VW7A 1NINA 3DTUB 4YSPA 1AS7A 1A4CA 2IWEA 4CSZA 2YAPA 3JT2A 2FT7A 2GC4C 1ADWA 3WNIA 4A68A 2HXAA 2PPCA 1JZJA 2DYRB 4FAAB 4DPCX 5F7BA 4G70B 2EIJB 3CVDA 1AANA 2QDVA 1T5KA 2HRHA 2BZ7A 2IWKA 2IDSA 3ABLB 1NWOA 2X88A 3KW8A 4KOCA 4BWTA 2YAHA 1PLBA 1R1CA 2PPAA 1NIFA 3ABKB 5I5MA 3QJSB 3NP4A 2EINB 2IH8A 1J9RA 1NICA 3N55A 3EH4B 2PP7A 1PNCA 3C75A
chains in the Genus database with same CATH superfamily
1L0YA 4Y5VB 5E2UL 1RIUL 2HTKC 4YX2H 2KDYA 1IFGA 4X5QA 2A0LD 3AY4A 1AI1L 2ZYSA 3KHQA 3IK2A 4FOMA 4UTCA 2MCPL 3SGKC 1F4YH 2NT0A 3VI3F 2D03L 1P5UA 3L2LA 3O4LD 4EUPG 4DZ8A 3QPXH 4R5XA 2NDFA 2I7OA 2DIEA 4GPVA 3H2WA 1ACCA 2VR8A 4UV4H 3V0DA 2GPZA 4KI1A 4X80L 1B2WH 3PWNA 4PY7B 4WKZB 5BJTA 4KZEH 2NR6D 4OD1H 4TUOA 5EBLB 2R7EB 3BIKB 2JIXD 2XY1A 1NPUA 2KERA 1E9PB 4P59H 5I1DB 5EMYA 3OG4B 2ZCHH 1U8PB 4FQ2H 1J0ZA 5BRPA 1I4FB 3IFPB 3AB0B 7FABL 4JY4A 2OTUA 3H7LA 1XAKA 3MJWA 2PTTB 2OYPA 4O02H 3QNYA 4XX5A 1JNHA 3UZVB 3WHE1 3G6JE 2EYSB 3QEHA 5IMLB 3L4ZA 2VSCA 2ZOUA 2IWGA 3BP7B 3C5ZD 2ZIDA 1H0DA 3OKYA 4RESB 3S36H 4N9GB 2BMKB 2FT6A 4KZ0A 1NOLA 5DQDL 4J5VA 4FYTA 2VKXA 3QXDA 5L2JA 1X6NA 4R4NC 3FT9A 1JDAA 4S1SH 2H6PB 4WSGA 4YSOA 3L5XH 2RALA 4HFUL 3EH1A 3FUDA 4OJEH 1CVSC 4ADGA 3RA7H 1V05A 1WQVT 1H3WM 5EBWA 3UJJH 1Q9LB 5KUMA 4MTMA 2EVJA 4PS7A 1UEMA 4DW2H 2QFPA 3PRZA 4WWOA 3FSWA 3MLXH 4ZOCA 3CVCA 1FQ9C 4QRRE 5ESVB 1ZGLA 3GB7A 4ECNA 2JKXA 1IC1A 1GAFL 3FH8A 4GAYA 3VJ6A 5KG9B 2PCXA 3NH7H 1DQIA 1NGXB 1JGIA 4XGZB 5DFWH 1IEBB 2IG2L 3P02A 4DVBA 4G6JL 3D69B 5CJ5A 1BG1A 1NWPA 3UTZA 1G7MB 3WDIA 3KLDA 1SY6L 4JHVA 3RKDC 2KQNA 5KYXA 1WT5A 2QEJA 3UGUA 1A3RH 1O7DE 2AXWA 3KJ4B 3ZL4L 1DVUA 4KQ4H 5DC2A 1DCEA 2WC7A 1UXWA 3O4LB 2OZ4L 3ILPB 3LDBB 4FMKA 4YHNA 4XMTA 4BRJA 1K5NB 3OKOB 3OXSA 4U4IA 4OZGE 2YXFA 5T1KA 4AIOA 2NCEA 5D6DA 1OAYL 1X4YA 4KXZH 1SFDA 3P3RA 4DP8X 5TPWL 1PIGA 5HYQB 3DPBA 3LKOA 4G9FE 4E9SA 1GY1A 1SXSA 3FTYA 4FJ6A 4PJBB 4G72B 1EEUA 2VTFA 1AFVL 1EAQA 1WE5A 3THMH 2APXA 4NSKB 5D7JD 5JZ7D 1CI5A 5IT2L 4X4XB 4N0YL 3CBJB 4W9EC 5E8NB 2EKJA 1U8IB 2DIBA 4RWHA 2XHNA 4AYBA 4YXHH 4FHBD 4U6YB 1HSBA 4P5SA 5D2LB 1XH1A 1T4KA 3KPMB 1JZ7A 3L3OC 3N40P 3QIUA 1TDQA 4JM2A 2HJFA 4OGXH 2LU4A 3SDAB 5C0NC 3U4BH 5MENE 4QPEA 1OL0A 3WY3A 1R5VA 4IBWA 4EXKA 2YAQA 3MV8A 2WYZA 3CPLA 4Y2OA 4HS6A 3V79C 2PWHA 2Z92A 4URKA 5C3IA 3WTWA 4HH9A 4JFZL 1RPKA 4P07A 3CHQA 1WBXB 5D6CA 3RJQB 1BVKA 4IBLT 4N0UE 5CZXD 2WUBH 5E6IC 1J1OH 3TO2A 1TFHA 4OZHA 4G9FD 1U8HA 2D3NA 2HFTA 2BIOA 1S2EA 3IJHB 4JJ5B 4QTIL 5FO2A 4DUVA 2BSCA 3C6LD 3O11A 4Z0XB 1K9TA 4OZIF 2HPOA 4FXKC 3SCMD 5GSVA 4MMXC 4KK9C 1EJFA 4O4YH 4WWKA 1PVHA 4IIQC 4I3SH 3VAEA 3SY6A 4E42B 4Y1AA 4R83A 3IJEA 1WAPA 1AQDB 3MOAH 1D9KC 2K0RA 2EXYC 1ZCRA 2VSMB 1XCXA 4NQVB 4NO5B 1HK6A 1U8CB 3NCFB 2LTQB 3BP6B 1UJ3B 3PAVA 2R4SL 5DRWA 4R4BB 3N0AA 2HT2D 1S8DA 1G1OA 4R2GC 3B7TA 5D1XE 3VU1A 4NPJA 3EFOB 1WPCA 5AFAA 5AG8A 4P2OD 3BXNA 2OMXB 3VGFA 1OHQA 2GK2A 3QQNA 4BE6A 5I8OH 3FFOA 3KMDA 4QRBA 4UT6A 1YQVH 2DQFB 3HMWL 5TGBA 4HQQH 4AZUA 1JF5A 5BUPA 4KHXL 2UZIL 1MEXH 4P59L 2UWEF 2XKNB 4BSVB 3CIQA 3CH8A 3QIWB 4NEHB 3SOTA 3D8MA 3IJ8A 4WGVB 1R9FA 4JG0L 1SYSB 1RUQL 4GRLC 3WFZA 2NUTA 2Y22A 5T1MB 1T6WA 1LGVA 2VDQB 5ABZA 3D4YA 4WJKB 4M7KH 5JXAL 3MLZH 3RWGB 4FQXB 2H3NA 4DKTA 5HDLA 5FV2A 3H9YA 4WGWB 4KZDL 1L9NA 4PY8J 1Y6MR 4QRSB 5E0FA 1N19A 5DUBB 4JL1A 1YECL 2VR6A 2E6JA 2NY5L 2OXGA 4GS7C 4AEHL 5A3ID 2DS4A 2AJ3B 2B15A 2YEVB 3QR0A 1UADC 3KLLA 1FG2A 4PJ7A 4BK4A 4JM4L 3ZSSA 5JLZB 2APTA 4MNQA 1PZCA 2BVQB 3GI8H 2CZNA 3IAQA 4LOFA 2XX1A 2UX7A 3LD8C 4KI5C 3TBWA 5C0IB 3HUJF 5EV7A 3O0LA 4PGZA 5DVPA 2FEDC 2CO1A 4TQPA 5L7XH 3QZBA 3KLQA 5GRJH 1ZLWK 4GMSH 4QEGA 1DYZA 3DDFA 4X8JA 2FO4A 4JY6A 3IJSA 2CO7A 5IESL 1DSYA 1IILE 2FNWA 1QPKA 4KKBD 4UZUA 3RP1A 1CS6A 5DMKA 3B9KC 2MCMA 3BPOB 2OTWA 1LD9A 3B7SA 4RIRA 3RWCA 5LBSL 2A73A 3MLZL 5CJXC 1KB5A 5JHDA 3I75B 2EC8A 5CEZE 3F7KA 1D6VH 4JJHA 5E00B 1U41A 3TBBA 1L6ZA 3KLSA 3MRLA 4ZMLA 3B2VL 4N3TA 2CO7B 5FCSH 4XP5H 5CU5A 2Q8AL 1NPNA 4YDZA 3WFHB 4ZFOB 2FH8A 3CXDL 4UWQB 5L2KB 1UWYA 4GBXB 4XMWA 4NN7B 3EAKA 1FYTE 3VACA 2BHUA 1TZAA 2EEAA 4TKWA 4RETB 3N85H 2VDPH 5DHVH 3KL3A 3TBWB 2YA2A 5CHNA 4LAJH 2VW6A 3TA3C 5DI8A 4GUPA 1EDYA 2QSCL 3WO3B 3NAAH 3QEQE 1M1XB 1OGPA 4U1NA 3HZMB 2X89D 1UD4A 5T3XE 5JLZA 3MCKB 3OX8B 3NOIA 4ZUWB 1ZVHA 3SY0A 4MNHA 4MCYB 3DUSA 2XACC 3CFKA 4TSBH 4D8OA 2P9RA 5INDB 4QOKA 4KXBA 1OAKH 3U2JA 5KSVB 1KIPA 2VSKB 2Y7MA 5AOKA 5JXEA 5FGRA 4JZJA 5JMOC 2DYPD 2AJSL 1RK0A 1BV8A 3LS4L 3ULUF 2W95A 1UACL 4XOAA 1CUOA 4PVMA 3IPBA 2NYZA 2JXMB 1BQHG 2GCYB 4N2BA 2P8LA 3KGSA 1WWBX 2YD5A 3U0WH 5GS0D 1TXKA 2FECI 2KZ1B 3L9RB 3OHXC 1F5WA 1RPQA 4G8GE 3S37H 3EGSA 4G8EB 3F5WA 3QJZA 4PR5A 4QXTA 3HHSB 4MQXC 3TZVA 3C60C 1S7UA 3HB3C 5CIPA 2F2HA 4LSSL 1XFPA 2BZCA 2EDRA 4U7MA 4ADIA 2JH2A 2VO5A 3V4PH 3N42F 2OMTB 2C3VA 1BW8A 1RURL 4XNAA 3TC9A 3OC8A 4QRQA 2RFXA 3T6ZA 3TP4A 1EGJH 3W0WE 5TQ0H 3BWSA 43CAB 4HXAH 1LQBC 2VYRE 1UCTA 2ZWLT 1AZZC 4ORGB 3AADB 5E2UH 1QFWH 4ZQKB 1N0LA 2XDHA 3H9SB 5GS0C 2J1YA 2TSBA 2QHLA 2FATL 3LX9A 5LCVL 1H6EA 3V0VA 4U0QB 3V7AG 2WXMA 5HPOA 1FF5A 3UTQA 3UZEA 3BVTA 1KACB 1KJVA 4YZWA 3GTTA 4WTWA 5FDYA 3DO3A 4RNRB 3JYBA 5LGJA 1JGDB 1CDGA 1BZ7A 5I0WA 1HN1A 5IB2B 3QCUH 4XAWH 4EAEA 1NBQA 1JTTA 2ADIB 2EXYD 5T1JA 4G1MA 1UVQA 1IEHA 3CC5A 4I18C 2XWBB 3AREC 4QLRA 3HI6H 1DQQA 4WTQA 5HHOD 4K8RL 3ZZLA 2UZIH 4GRLA 1SF5A 2A99A 5FGCE 3RE0A 3DIDA 1I3UA 5DK2B 1JZHA 3RL2B 2X7LA 2JV6A 3C9NA 1MRCH 2YGOA 2VUYA 1AIZA 2HB0A 3TS8A 4GBXD 2APVA 2P8MA 3ZVVA 1UQSB 3BCFA 3V6BR 1JPST 4L37B 2WXIA 3UBXB 4ZZFA 3L4TA 1XV8A 5D93B 5HJBA 3O41A 2BFGA 4MD4B 1WFNA 4G80B 3PDGA 4HIHA 1RL1A 8FABA 1CK0L 2DMBA 1MH5B 1XZ0A 1AXTL 3E6HB 3LQZB 2EXSA 1A3QA 2J55A 3V5HB 2LLLA 4KQ3L 3X3FH 4BA8A 5IVXB 1E90A 1T0MA 2E46A 1TYRA 3L3HA 2G0KA 4HHWA 4G8AC 1GL4B 4OV6F 3N50A 4AE1A 1FNFA 1G7QB 1MWAB 5JPMB 2V5YA 3U79A 5IJBC 3DTUB 1KG0B 2Q0ZX 2YAPA 3IJ9A 4GW4A 2JJSA 5LGYA 2FT7A 3O4LA 1EHLH 1MFEH 1N4XH 3FZUD 4JGNA 4QTHB 2VL4A 3HTLX 4L48A 2A74C 3UTZB 4D0CB 2NTFB 2K9UA 2CHWA 3OKEA 1IAMA 5ESQA 2Q7YA 5KG9A 4D0CA 2EYRA 3MJ9A 2Z1KA 5EC2B 4YDVB 3SKNA 1NJ9A 5ESVA 1N10A 3TA3B 4C56A 3AUWB 5GZOA 1A7OH 2P49B 1JHKH 3HBZA 1CLCA 2VDRL 3HC4H 1FLRH 4JY5H 1H9DA 2B9BA 1T66D 3NFPA 5DJ0B 3MOQA 2E9GA 3GHBL 3IMWA 4AGNA 2J8UA 5MEQA 1E5ZA 2G9HB 2MSPA 3PJLA 3Q2LA 1O7SA 1IUZA 3UL4A 3KPPB 3II1A 1KCRL 2F8IA 4WUUE 3PP3K 3GHPA 4FCAA 5I6XC 4K23H 1J1PL 4Y2DD 2BC4B 2VQTA 5BVJB 4WI6A 1WRFA 5HDBB 3ZKXB 1KMGA 4PS3A 5AAMC 2H32H 4YC2B 2PTTA 3IYLW 3TH2T 5IVZA 3EDKA 4WNJA 4LQ1A 3QNXA 5M7QA 4CJ0A 4J6IA 2X4UB 4PJDB 1OVZA 2DD8L 4ZOAA 1CU4H 4V1DA 3U46B 3ZE2E 2F18A 2OCJA 3S96B 4CC1A 1L0QA 1WHPA 3T3PF 4BA0A 1CFVL 5GGVY 4X4ME 4MAZA 5FAAA 3GGWA 5BNXD 4OY9A 2OMUA 4Z78A 1VSCA 4JVWA 2ZCZA 4LOEA 4Q9RL 2VXUL 4NXSA 2JLPA 3AM8A 1MFUA 2X1XR 4AQ8C 5K9JH 1K6QH 1ND0B 1DJSA 4CSTA 1E6OH 1NCUA 5GS0H 5EZPA 2XZAL 4JZNB 4PJ7E 2XWBA 3KW7A 3O3BB 1AOZA 4MGXA 2OTPA 4CMHB 4ENEC 4E0RA 5BVPL 3O3EB 2V5TA 4KX8A 4FMFA 5C8JB 1L9PA 4PUBL 3WBDA 2ARWA 4A7GA 4Y5VA 4M7ZC 2B1HL 3SDDA 4UDTB 1IT9H 3RFZB 1NCNA 3NSCA 1MIML 1WFJA 1QNZH 3P1VA 4JANA 2QHRH 4U1SB 2CDGA 2FJSA 4NP4L 5JHDD 3K2MC 4M3KB 2AXGB 5BV7L 2CE6A 1AGFB 2DICA 3H9SA 1U92B 4X4ZA 3ROOA 3IMRA 2UUDK 4ZQKA 5DUPH 5C0DB 1F18A 1SMAA 2ZX8A 5EIIA 3D87B 1NANH 5TJWK 2K8MA 3GMQB 4XC3H 4JPQA 1KPRB 2ZXAA 3FRUB 5J56B 3SDXF 1E7UA 2JELH 4GI9A 5FX3A 3FOLB 4G2AA 3SQRA 3S5LG 3BAXA 4B53A 1YEHL 4NCDA 2OMTA 4AGMA 5IB5B 5LN4A 2WP3T 1OLLA 2GQHA 3WV0A 2JIXB 1KIRB 3F83A 2WLZA 1VESA 2VMFA 3RWHA 1DFXA 1JGVH 3KEDA 4I18A 3NEOA 2FIKA 4KKNA 5B1KA 3VB9A 5DLML 4AW7A 3FQ4A 4G9DA 2X6UA 4PR5B 1DVFD 2LOEA 1UH4A 1WUNT 3WIHA 1X5HA 5AD0A 4PP2B 2HX8A 2HFGH 3K7UA 5D4HA 5LN8A 1DJXA 5INCB 1MF2H 2UZYB 2WB1A 2GFBB 1NFIB 2YKKA 4Y7MA 2JXMA 4G6FD 4AJWA 3WKQA 5J06A 1MJUL 1K8IA 1TZOA 3K8KA 3RTQB 5FV1L 5CCGE 3M07A 3QWOA 4P5KA 2VH5L 1FE8L 5HJDA 2XI9A 5F1NA 5D8JL 3ZZQA 5INDA 2RB8A 3ARRA 1E65A 1Q0YL 1AIFA 1U0QA 5DDHA 4HF5L 4S1QH 3LNDA 3C09C 3GRWL 2A9DA 4KJPC 4R84A 1J9SA 1AKJB 2X2JA 4U6XB 3R1GL 5D7IF 2B59B 4PJGA 4DOHB 1I8LC 3ULUD 5E6IB 4Q97A 1EQWA 2OULB 5KOMC 3EO1B 4Y4FC 4MQSB 4XMPH 2CDFA 4ZW3A 3TTSA 1QPXA 3WN5A 4A66A 2B59A 1QSVA 2CK2A 4PJGB 1E2WA 3OXRB 4PYGA 4X6BB 3MDJA 4R6UA 2HLEB 4OCSL 1NC4B 1ZANH 1HCFX 3HAEG 1D2OA 4JY5L 3MLYL 4JREC 1LWHA 4WFHD 2B7DT 5D5MA 5ENWA 2WYIA 1ZVSB 4YSDA 4L0YA 1KBGL 3DBSA 1AQHA 2OLDA 3C08L 4JFFB 2AXFB 3K6DA 3RTQA 1FBIH 2HFFA 2J25A 4I1NB 3RDTC 4ODVH 4XB3A 3SDYL 1LD9B 1W0WB 3BN9D 2P5WD 3T6XA 1XIWD 5AOIA 3ARBC 1CICA 2CM5A 1J0YA 3K0WA 2ZX5A 3RNKB 4AUUA 4PJEB 4Y9FA 4G9DB 1A66A 1SUHA 4AEFA 2C9QA 4DIXA 2O5XL 1BEYH 4GKNB 4POZC 4Y1AE 1RAMA 5FA4B 5CJ8A 4M7LH 1U6AL 2ZAHA 1VZGA 2FK9A 4ZNEE 3LN5A 1I3RA 3LXBA 5KAQF 3QYCA 1TMQA 1SVBA 4GW5A 3FSOA 1JUFB 1H5BC 1BJ1J 4QXWA 3W9EB 3BFWA 4K73A 2ZUTA 1H3VA 5GHWL 4DEWA 1BQSA 5C0FA 4Q6YA 3RKDD 5JOEA 3KWXA 4DK5A 2YUXA 4M5YL 4X6DE 4KV5E 4A2DA 2N1TE 1PX8A 3I2CH 4KO5A 4OFVA 3QR1A 4FNRA 4OSUH 3NBNA 3AS2A 3RIFF 2WLLA 3T0AA 1RZQA 4YO0B 1U8MA 2A9BA 5DQ9A 3BT2H 3BAEH 1TF4A 1HAWA 1LK2A 4HAGA 2DTMH 4NO2B 5ETUA 4NZUL 4UTAA 4Y16B 2J5WA 1A6VL 4AGOA 5ESAA 3O3BA 4QRTA 1PEZA 2PW1A 1MLBA 5EOQL 1KB5H 1T7YA 1U8QA 2IBZY 2F5AH 2WKOF 4E41D 3UX9B 1SDYA 2BNUA 2MKLC 1USQA 4HWUA 4R5TA 2APFA 5IQLA 5AVRB 4B96A 4U1GB 5BZXA 2J1XA 4O02L 2AZUA 2N7SA 2ZXGA 4QHUA 4TLUA 4ZSOE 3RB5A 3FC8A 1KJMB 2J3SA 1NQBA 3WEMA 4GQPH 4LEOB 5AZUA 1JSYA 4LU5H 4D0BB 4JJOA 2JWYA 1Z32X 5BO1L 1G7HA 3QDAA 1DJYA 4Y5YC 2P4AB 4A67A 1K5WA 2WSKA 3BN9C 4HFWA 4ODHH 3BZ4B 3G04A 4PW4A 4HOXA 3RKPA 4PJBF 1SQMA 3R8BB 5KYYB 4S1DD 2K7PA 2CK0H 4PJAF 5AL8A 1I8IA 1QFWM 3LNFA 3OZKA 1BLNA 4ETYA 5HP5A 4NYLB 2W81C 5ID1B 4AQAA 2IANE 5EUOE 3H4HA 4K5MA 1WGOA 5JMRA 2IG2H 1EBPA 4LSRL 1BBJA 1FBIL 4PREB 4ZT1A 1YN6A 1DVFB 5TQ2H 2WLMA 1ZT4A 3QBTB 3KWUA 2OV0A 4MQXD 5I17A 5DO2C 5DXWA 5JHBA 2FDBP 3L1EA 5B3JE 4PJ9C 2BJML 1YDPA 4LCCC 4EMZA 2ZKHH 3MRQA 2P5PA 1JNLH 4MRCA 4Q0XH 5CLWA 3VMOA 1SJEA 5GS1B 3QJVB 2EYRB 1ZLDA 4JE0A 2EVFA 4YHPA 4FG6C 2Q7YB 3G6JF 3QO0B 3CPLB 3T0EE 1DE4B 5BS0E 4N2DA 3MV8B 5G2NA 4UYQA 1TEFA 3E1ZA 3I6LD 3QJFA 1TETL 1P2CB 1ASOA 25C8L 3GSVB 3RWEA 1YEGL 3NACH 4YZFE 1IL1A 3B2UD 3HE7B 4L4VA 4NNXB 5EC1A 2CAKA 3EO0B 2BRQA 4KH9A 4U6YA 2E7MA 1HH9A 3UO8B 2QQKH 1IAII 3CTTA 4DZBB 1CCZA 1D9KA 3EYSL 1CFMA 4HJTA 1MWAA 3WEAA 5BZDB 3UTTD 1G7QA 1HQ4A 5T3ZE 2QSCH 4P4RB 3BAWA 1R3LB 2WWMD 1INDL 2FLBT 4UM8B 4K5OA 2HX7A 1U42A 1HHGB 1KIUA 2ALWA 3HCVB 1R3LA 3D39D 2WVSA 4UAOB 1HQ4B 1YY9C 2O5ZH 1KLUB 1PYWB 3QUYC 3MACL 4P2CG 4TNVF 4XXCA 1E9QA 3V9EA 2WJ7A 3CDGB 1V55B 4KNTA 3DX7B 1N8ZA 1IL1B 4NNXA 5FYLE 4HIHB 3VXPA 5J11C 5I6OA 4KVCL 4A7VA 3STZA 3VFNB 5DJ6B 1TPXB 2CBMA 4RZKA 1OXYA 4UQAA 3VSVA 2OK0L 3BDBA 1RZFL 1F2XK 1AXSB 1F4YL 1NGXA 1ZD6A 1FN4A 3MJ6A 5JW5B 3LKQB 1AHKA 4W9DC 3L1OH 1TJIH 1W72L 2D7PA 4GKSA 1UOLA 4U6HB 4Y19B 5SWZB 1JHKL 4XPFH 2L7QA 4PV9B 1WS7A 3UEQA 3RX8A 2B14A 4G6AD 3E2HB 1DVFA 1LDSA 1Z5YD 4J3WA 3VFUB 3NJIA 5J12C 1IZKA 4G1MB 1F6AA 1DQJA 5H2BA 2G75A 3BEWB 3DSNA 4Z9KB 4RMVA 3T0WA 4ZMVA 4N9GA 1KXVA 4TXVB 5F9JA 5I74C 1VA9A 1KJVB 5IVXF 2O1AA 1W8NA 5IUSA 1BECA 4HFWB 5AWNL 1E8XA 1A7RL 3DX4A 2D8KA 4FI7A 1BAGA 1DLFH 2ED9A 4ODSH 4APQC 2X28A 4ERSH 1KTRL 1SHMA 3BMWA 3B5GA 1RP8A 5EIIG 1AGDA 3RVTD 3T2OA 4R26L 2MPAH 2QLYA 2X4NA 4R7LA 3WG7B 3KPRD 1WLHA 1T1YA 2YPKA 3QUXA 1X5GA 3HAEA 4IOFD 1MREL 1E9PA 4ZUSB 3T3PE 2A77L 2NY5C 4KKLC 4L9LA 5F7UA 3Q3GB 1G84A 2H45A 3CIAA 1IKOP 2J6EH 4PI2A 3MKGA 1DBAL 1GGBH 3QG6B 4XPFL 1KF9B 2IGFL 1X3DA 1FORH 2AVGA 1W8OA 3CHRA 4TNEA 5L7XL 4WFED 15C8L 1QW9A 2Z7UA 3OZLA 4JRYA 2W9EL 3ZZ1A 4MNGB 5I76A 1F4WH 1CBVL 3QPQC 4PSRA 2D7TH 3GMOB 4JFDA 1JZ4A 2EDLA 3HKZA 4GLRI 5AB2A 5F7BA 1MFBL 5EZJB 2GT9A 1KN4H 3AQZA 1OIOA 3WE1A 1OTSC 5D7JA 2IDSA 2YAHA 1PLBA 1T83A 3EUDA 3QIBA 4QYOA 2I5YH 3BPLC 4MCMA 1LEGB 1O9ZA 3H3PL 4BQBA 5KSVA 1A7NH 2XT1B 4UU9B 3H54A 4NWUH 2EDKA 4NFDA 2BOCB 4LSQH 3MPCA 4XE0A 4GW5B 1F8TL 4D3CH 1M7DB 5ICYB 4P5MB 3REVB 5E4OA 5C07D 3I74A 3KBFA 4ZMTA 1MXGA 3OKDA 5J11B 2APWA 1OGAE 1ZHNA 4JEGB 3RDJA 2CLZB 4FS0A 4HIXL 3IXAB 2HG5B 2Q7NA 3QC5X 4U1LB 4P2QB 4Q4EA 4KDVA 5L2KA 3OGCA 2HCZX 3X12B 1CK0H 1M2OA 4HUNB 1D3CA 2VJ8A 4IOSD 1P53A 2QV4A 1M7XA 4B9YA 5DF0A 4M8VA 1IAIL 4PJXF 1D6EB 5AOZA 3C6LA 3TYGH 1OSZB 4A7TA 1SHXA 4NZ8A 1FFTB 1N3NB 1XGZA 3FQXB 1AJ7L 2HFFB 1S3KH 3WL9A 4BQ9A 1YMMA 2DQJL 4A2FA 3U2SB 5KSBF 3GUFA 1I9RH 2HP4A 1OAXH 1XB3A 3QJOA 4PJIA 2W88A 1C5DA 3CZNA 3OGCB 3T04D 3UP1A 3X12A 3QARA 5FWRA 2WXRA 4XXDA 2YQ2A 2V2WA 2OZ4H 5J1TC 1SEQH 1UZGA 1D5MB 2D4FA 3BJLA 3CN2A 5DJXA 3M8OH 2OSWA 2AKRA 4QNPE 1DDHA 3K71B 2X9WA 5KVGE 4RVBA 1DBKL 3FT2A 5E6IA 2EUWA 4JO1L 4MDJB 4Z23A 1P9MC 2K1MA 1T7VA 3EHBB 3TU6A 5J0BA 3U1PA 5E08H 5CR1A 3LRSB 3HRZC 5BS0A 5AYQA 5E95B 4DCQB 2AJ3A 1IGCH 4ZO6A 4UU9A 4FQ2L 3F00A 2WSPA 4X6CE 5EBGA 4ZDHB 1AR1C 1SMOA 4I4WB 4M7JH 5JYLA 3ULUC 4NB7A 3ROLA 3QK0A 3CSGA 4KDTA 1KEMH 5CN3A 4NHUA 1CYXA 5C0CA 1BVLB 2VERA 1IBBA 1BXVA 3NA9H 3FSVA 2GY7B 5GS2H 1MIMH 1QX1A 1UB5A 3IDGB 5BMFL 1FYTD 3IDYB 2W65B 3OHXA 5HHVL 3CSFA 3VXTA 5E1QA 5ALCL 5E8EB 3LY6A 4L4TE 3T5WA 1E28B 3WGUB 3HNSH 1SXZA 2OW7A 3BLPX 3PGDB 4U1GC 1IE5A 2R1XB 2ENSA 5D6DC 1IC5H 4NQED 3MRBA 1E5AA 2OL3A 1LWJA 1QOKA 3IDNB 4Y19D 1WD8A 1ZLWH 3OBAA 1QASA 3V5DA 4IDLA 5DZJA 1DVZA 3MRRA 1OGSA 4S0TD 5GZNC 1NMAH 2UY6B 1QLEH 3DRTA 3F6JA 4HISA 5HHPA 1F8TH 1N0XL 1EEZA 1RVFH 1HSAA 3GMQA 4B9KC 3A24A 1UTDA 1P4LB 4PJFA 1KELL 3DROB 3D4GA 4R4BA 4XX1G 4POYA 1KFAH 3C8KA 4KNUA 5GGVL 5K9KA 4ELMB 1W0YT 5CJQH 4JLRB 4PS4H 3BKYL 4WTZA 1CFTB 1S9XA 3FXIC 1MFAL 4HCRL 4UDTA 5DHXB 5EUOF 3D39A 3DX9B 3EDJA 3VVVA 2Z8VC 3S4SG 2XSKA 4Z0XA 2IPTH 5LAXB 3Q8FA 1JBJA 2B8OT 1NKRA 3NG5A 4FFZL 3APMA 4HIJA 3VWKA 2VDRB 1WDAA 3WD5L 2VXVL 3KR3L 2VXSH 4N5ED 1G4MA 5EUKB 1FORL 3RTLA 3L13A 3VW3H 5E8OA 1V5JA 1OGTA 3FTVA 5CMAA 2X70B 1YLBB 4H8HA 1RLBA 2H2PD 3JWOL 1T0NB 4AQ1A 3CMOH 5F44A 5D1QC 2ORBH 4Y2OB 3VFSA 5IQ7H 1PKOA 5DS1A 3MCYA 5G4MA 3W56A 3NJLA 4B5ZA 3FU7A 5HYSG 1YEFH 3S3JA 2HJFB 2ZCHL 4JCLA 4IYKA 4RGMB 3Q6FB 3UFIA 1FC1A 1FVCB 1U3HC 2BVOA 2GAZB 4U05A 4XN1A 3FHQA 3TJHD 4LPVA 2C4XA 3ZRCC 5KSAA 1U8IA 2K6ZA 4S1RH 1IGMH 5DWUH 5T3ZL 1ROWA 4M93C 5LO7A 3CVBA 1NLBH 4GW1A 2HKHH 4W9LC 4OD3H 1PPIA 2WQXA 1CXLA 3NACL 4H13C 2R83A 3EYVA 3O3AB 2IAMB 1FE8H 2BNRB 4KJWC 2TRYA 4P2QD 2OS7A 3DVIA 5E1AB 3R7QA 5JW4R 1QSEA 2AJXH 2XNAA 3QNFA 4LIQE 4S11A 4YHNB 1EVTC 3QEGH 4NN6C 1WIUA 3VXRA 4BEIA 1UXWB 2Y06L 1DQVA 3OWRA 3RWEB 3VU2A 1IM9D 1F90H 3MLRL 3QO1B 2R4RH 4L3CB 1GIGL 3SE4A 4GUQA 3WELA 5EC2A 3SKNB 3K4AA 2OSLB 3RB7A 1SHWA 3N3EA 1HINH 3C09B 1IEBA 2K3HA 4RAHA 4A04A 1IBHA 3ZDYB 4AL8C 1KCSH 1KJ3H 2NY4B 2ZCKH 4YHPB 5CUSH 5B7EA 1KDIA 3RX5A 3FW6A 5EIVA 3QDJE 4NKMB 5ELIA 1YDPB 3AZUA 1X5LA 5ADPH 1E43A 2YPLE 2VN3A 3RIKA 1Q9LA 4GW4B 4QGTA 4YSRA 3S7GA 4KRPB 2ARJQ 5CD5D 3U6RA 2DIJA 1R3HB 3X3GH 1CF8H 1FJ1A 2J21A 1WZKA 3RVXC 3H3KA 1ESOA 1MFDH 2IAMA 3OD3A 4Z7IA 4TSCH 1I8IB 4WNQB 2C9SA 4LPXA 5KZCB 1P6FA 2OMVB 1OQXA 4N0RA 4U4BA 5LNEA 3T0EC 3FONA 1JNHB 1N70A 3OKMA 4FNQA 1W8EA 4LRNL 2WZ5A 5BV7H 1RI8A 2FATH 5EUOA 5LCVH 5J6SA 5ILTH 4QXVA 3VRLF 1ONQA 2BSTA 2ATKA 3BUQA 3IF1B 4ODTL 1OAJA 3WEOA 2V5SA 4R7DA 1VF5C 2IAAC 3PJSB 4YSQA 3DA0A 1GOGA 3BIKA 4JX0A 3Q8EA 4PWFA 1DN0A 1SLVA 2E76C 1T0NA 3T8MA 4AQ1B 4ZTOL 1V7MH 4WKZA 5BJTB 5I1GL 1YEDB 5IHZA 3C9NB 4KROD 4Y1SA 4I5BB 4OTXL 1DBBH 3LRGA 3BOVA 1VFBB 3QQXA 2CJUH 2G3ZA 2IH3A 2WXFA 3OJVC 3MJ9L 4YE4H 3WIHL 1C5BH 1TJGH 1I7UA 1PS3A 4KUCF 4NO2A 1Z9NA 4OU3A 2GTWA 1KPVB 1BPVA 2BNQA 3JV6A 4RGOL 5TK2A 1UJTA 1NC2D 4OZIE 4Y4HD 1N2RB 5DWPA 3HZKA 5C0CE 2F54B 4IQHA 3QS2A 4KK8C 4Z7OF 1JGUH 3G5YA 5HPMB 4JFFD 4FQIH 1AG6A 1J5CA 3BD4A 3C8KB 4R9HA 1VACA 1YMMD 4F7TA 5TK4A 1OAQL 1BAFH 4ORGA 4NJAL 1CE1L 3QXTA 2ITCA 5CSZA 1A2YB 3LB6C 4LNRB 1DEEA 1EWHA 2ZAGA 1HCVA 3LH2L 4XWOC 1JWUA 4R8WH 4MA7L 3DRTB 4G6MH 2UY6A 3V6OC 3HPLA 1FV1A 3ALPA 2W9LA 3PGCA 4FABH 1B6DA 4A6YB 1N64L 4P8QA 1YMME 1CL7L 2CO3A 3K91A 5KVMC 1N59A 1JHLL 2PW2A 1F4WL 2JB6B 3DV6A 3F12B 4FGMA 1CBVH 2G2NA 4PRAB 2O72A 4HWEL 4W9GC 1WFTA 2UXTA 4YHZL 1G5AA 3MNVB 1UZ8B 1W72A 4NS0A 4WVRA 4K9EH 1RKRA 3WIHH 3IMSA 5TF0A 5I6LA 2YJLA 3EOBA 4QRFA 3QDMD 1MAML 2NX5D 3BQUC 5CP7A 4PJXE 2OI9C 2PO6C 1MCJA 4KK5C 1J1XL 3L9RA 4OJDH 1K4CB 8FABB 3RWDA 1IFHL 1B0RB 5FYJL 1A6TA 1ULVA 1FZOA 1LHZA 3N1GC 4MKMA 3VXSB 5JQ6H 1NCTA 4F33A 1P6AB 1GAFH 4K2UH 5GJTL 1FYTA 5I18H 1XO8A 4QHNA 1T0OA 2CO6B 2R0LL 4FQQA 4AK2A 2B5IB 3O4LE 3OV6A 4LCCA 4PIBA 1EZVY 3FT1A 5KVDH 3SN6N 2YMXH 3BO8B 2P46B 3N41B 1X5YA 3WFCH 3PWUB 1NGPL 3OXRA 1BWMA 2OL3H 4LCVA 1P4BH 1TQCC 3E8UL 5JNYA 2YQBA 4BRVA 1G7JB 3SE4C 3Q7JA 4UT7L 3SPVB 4C54A 5CGYD 1YHPA 1Z3GL 2V2WB 4QKXB 2XX0A 1HKFA 2CRZA 3D25B 4JQIL 5F93C 4WU5B 3OF6D 5IJVB 3POHA 5BQ7B 1LDPL 3QCVH 1GSKA 5TD4A 4GO8A 1MVYA 5AUMB 5CP3H 3OKLA 2EEDA 1FIEA 3GXIA 4FJYA 3D06A 2ERJB 3NIDE 4OKVB 5E00A 4P3DA 2IFGA 2JJTA 4Q58C 3KLHD 2Z4TA 3TYFA 4HLJA 4HWBA 4JFDE 3UCRA 1F0LA 5ACZB 4I3SL 1O7DC 1B0GA 4IS6B 3VMPA 4HYTB 2YD0A 4GG6B 1WZ1L 3FO1A 2WJ5A 3P11H 5I6MA 1CD0A 1CIUA 4OLVH 4AYGA 2W38A 2YK1L 4MB4A 2DQGL 5AZEL 1N7MH 1M4KA 4A7UA 4G7QB 2ICCA 2V33A 5CAYB 2IC2A 1CE6B 4MSWA 2VZTA 5D1QD 4UQ3A 3GS4A 2OX5B 2AQ1A 2N0KA 3U82B 3VFRB 5K9QI 4X5LA 4K3EL 5E99H 4P5TB 3BN3B 3Q2NA 3QFJE 1TZGL 5AVYB 3BFOA 3D85B 5L6YH 5DR5L 3AT8A 1DLFL 5ABAA 2HT3D 2BVQA 2XFXA 4PJCA 4C4KT 1JNNL 2F7PA 4NQDB 3SQBB 2GC4C 4EIGB 1XSKA 1RK7A 3LN4A 2XBZA 2GJ6B 1YYCA 2V9TA 2VITA 4KKCC 4LSUH 4N5EC 5FW7A 4MAYC 1FFPA 2ZD0A 3QDJA 1EAOA 4AYSA 5GGUA 3PS6A 4QYOB 2DQUL 1J5IA 1WHOA 3K72A 3UTOA 1AHMA 1ZY9A 1OF2B 2FWUA 4AT6A 5JIHA 4RMRA 1EFXB 5IHBA 4JRXB 4GRWB 5MHSD 1OLZA 2YEZB 2BOBA 3B37A 5LGHL 3C5ZA 3RFZA 3VD3A 1FAKT 1B0IA 2AJUL 3VXMB 2FX7L 5L4MA 1YYMH 2YJQA 4PJ9B 2NW3A 5FB8A 3TV8A 5C8JA 2ZUQB 4YIQA 5AAMA 1BYNA 3BAKA 4XPAL 1RV6X 3U1SL 5HYJA 4J2XA 2EECA 3TVMC 2PR4H 4DVRH 3EXJA 4FQHB 2BWQA 1FDLH 2OR7A 3MA9L 3QG6A 5F8QC 5TGBB 1JZ5A 4LLUA 3IKCA 3GSOB 1X7QA 4WUUB 1ZA6B 4FZ8L 1MCOL 2FBOJ 5HHNA 1QLEL 2FECL 3NQIA 3BLBA 1SYVB 5HHXL 1IC7L 1RU9H 3LH8A 3P73A 4IGBC 4J2QA 3ATFA 5B1JC 2YGPA 1J12A 1IC0A 5EHFA 1UOKA 2OYKA 3R0MA 1TLMA 3OR7B 3U46A 4XP9L 3P0YH 4PJ7F 5EO1A 1SGKA 3LTVA 4LGRB 1KUMA 3L3KA 4LPTA 1OCRB 2ORBL 1U2CA 1CZ8L 1XGRB 3EYSH 2VISB 4QR7A 5DRXA 5HJGA 2WNGA 1HHJA 3RA7L 3WDJA 4PGJA 3IMBA 5C2BH 5JPNA 3FFCD 2BC4A 4RQQB 5I74B 3SKMB 5BVJA 2BINA 1HQRB 2WQRA 4YVUA 1I9EA 2I85A 4JVPA 1MW3A 4AVJA 2P52A 3MXWH 2H3XC 2Q86B 5DK0A 2NX5B 4CAGA 1HJBC 5F7YC 3E38A 1BFVL 5CU9A 4MCNA 5KANI 3UIZA 2YPVL 1RFDH 3GTVA 4R90H 1IM3D 3TBTB 5I24A 2DBLL 2IALB 4MBRA 4OJCA 5D6CB 3II3A 4HIIB 3PDDA 5LQBL 5JR1H 3PPSA 2FX9L 5D7EA 3FB8A 5GGSB 1IBFA 2DQ6A 3OTTA 4N2HA 5MEOA 2YKLL 4XXWA 2YK1H 2FBRA 4MASA 2HT4D 4JO1H 2AK4D 4P46A 4OV5A 5FYJH 1W9XA 2VQ1B 2X1PA 3H3BC 1AQKL 1MCWM 2G5BB 4U1KA 2NZ9D 3LKPA 1K3ZA 4F3FA 4BJLA 3WFDH 4MHHI 5ACLA 4YNYB 1E9QB 3C5JB 3WSQH 2ZCKL 3RBSA 1KLUA 1PYWA 3A67H 1TEYA 2R69L 1AI1H 2MOQA 1FVEA 2JQAA 2WM0A 2X4TB 1MI5E 4M7ZB 3GMPA 1MHCB 2JKLA 1F58L 3KGUA 1SRDA 5DVOA 2ICWA 3JTSB 3D39E 1FFQA 2M1KA 3ULVH 4DZBA 4EI5A 5IROD 3FU9A 1BZ9A 2V7HB 3OC5A 4JO3L 4X6CF 1I1RA 4DP5X 4PJEF 2XRAH 4XPTL 2WUBL 3X1NA 3N6YA 3OWEA 3RBGA 5KYXB 4ILDA 1ADQL 3SPCA 2ENYA 2IVFC 2ZKYA 2H0PA 4OV5B 4LAQH 1BP3B 1ZV9A 3UADA 4DVBB 4KROB 5C0GA 4GAAA 4OD1L 3ZE0F 1S9WB 3BWAA 2D73A 4XMZA 2X7LB 1P5VB 1T2QH 4XBEL 3WUZA 5GS1C 4MJ5A 5JYMA 1S7SA 2PP9A 3NFSH 1JD9A 1WGVA 3FAWA 3P2TA 1UXSA 4FFYL 4X9BA 4P4KC 4BHUA 2NX5A 1CURA 4NKOA 4F7PB 1OB1A 4FQXC 3SBWC 1AG0A 2FEDD 3IE4A 3IKKA 2ZSVB 1MCQA 1U8KA 3AT9A 1DBBL 3DHPA 4MLSA 1GZQB 4XCFL 4RAVB 3NCEB 4D9LH 4C47A 2VLKB 4LFHD 4N20A 5EF0A 4UM9B 2R9HD 3QZNA 5CCJA 3LPFA 1BEYL 4AIEA 5IMLA 3KPOA 3I85A 3QPQD 5D7IB 3VO0A 3MRPB 1M6UA 3L17A 1JZEA 1XGRA 5IM7A 2O6FA 2VE6B 3MFFA 4MS6A 4EZLA 2HKFH 2VLRD 1CDBA 4OD2A 1VDGA 2XG5A 3VXQB 1AACA 4K71C 2HVJA 2QGCA 4KRPD 2Y7OA 1IJNA 1PEWA 2R8SH 3NABL 4P5TD 3A5VA 4EKXA 1NAMB 5FWQA 2E86A 3QFJB 2AMUA 5CKGA 5BZZA 2ZP0T 2H8PB 3JT0A 4Y7OC 5HHNB 4D8PB 3FO2A 3U9PH 4I9WE 3U25A 4HULB 4F9PC 2XN9A 1CE1H 3IKCB 2B0SL 2Z8SA 2HT3C 4M6ML 4TQHA 4YBLC 3QRBA 4KXCA 5GISL 5TPWH 4I8DA 4BDVB 4WWNA 1DQDL 2PR9A 2JE8A 1P5UB 4O9HH 3TZVB 3VB8A 1S9KC 1VEOA 5FGCB 3ZT7A 4ANKA 1EMTL 2HN7B 1S6NA 4XBMA 1AZRA 5HHOB 2ZT9C 1DDTA 3GSQA 3VXMA 5IBUG 2P8LB 2CKNA 3BPNB 5CEYA 4YBHA 2B77A 2DI7A 1CYGA 2JCCB 3DDGA 4EI0A 3TL5A 3UBXG 4HGKC 5C0FB 4FFZH 1MVUB 1RZJL 3K72B 1S7TA 1B9KA 2J1KA 1LMIA 4OBRA 4Z7WB 3IXTA 2BWIA 4OGAD 5HGDA 4X7CC 5FFOA 4OAWA 3S5YA 2WBXA 4OGYL 1KLGA 4NUGL 2H2PC 3LN5B 1E3ZA 1U8NA 1SDDB 1XTLA 3TYGL 5CHNB 4U7SA 1U21A 4XPTH 2AAAA 3PU7A 1T5XB 1E8YA 3GMNB 1CGUA 1SFHA 1WBZB 4PLKD 1W15A 3B3IB 1RZKC 2VC2L 5JHLL 2EAEA 4UT9H 1FZMB 1CXIA 4MZ3A 4WI8A 4HKJB 5IJKC 5EOTA 5JXED 2PCYA 2Z31D 4JDZB 2CWRA 1GZQA 3MLVH 4JQVA 4WSJA 1Y0LA 1E4WL 1MFDL 2JJTC 3A67L 3WO4B 4LCUB 4BFFA 1KV7A 3QFDB 3RWCB 2GEQA 2PETA 4XMXA 3EGDB 1WCBA 1UXSB 3FSZA 4JO2H 2F8OA 1QBMH 5MHSE 1QO3B 5EZLA 3RUGA 3FQ2A 3NEXA 2W60A 4BQCA 4RLDA 1NC4A 4M1CC 5K69A 5C0JA 3L5HA 2XV2A 4XN2A 3BZFA 5JZ7C 1AY1H 1OSYA 4A55A 1HHHA 1YPZE 3A0OA 2NNRA 3S34L 2JI3A 4M5TA 2EIEA 4LK4A 5TE6L 3P4MA 1UURA 1H3XA 4QO1B 1WFOA 3S3DB 1P84J 4M7KL 5F3BB 3VQMA 4XB8A 2AJYL 3AXHA 3ML8A 5I6PA 5JUEL 2Y5TA 4K9EC 2A38A 2W1NA 5F1NB 4EKJA 4OZFB 5JIDA 1NL0H 4QHNB 4OCYL 4Z5RB 3O0RH 4H5SB 4XT1C 3FRPG 4RDQF 1V54B 3DVNB 4LP5A 4YFDB 1NIAA 4HUUB 1UD5A 2Z65C 2APSA 4S1DC 4RX4A 1BD2B 5T5NG 4LARL 3NIFF 1S78C 3SJVE 5GS0L 1UM5H 2ZWKA 1EO8H 1U95A 2WD0A 3F6LA 2Y2YA 3UGXA 4ALAC 1J05B 2X4RB 1OCOB 3NZ8A 5DFAA 1AGEB 1SYSA 2VXUH 1UWEH 5L8LB 3PWJA 1M6OB 1GPOH 4G7VH 3W3BA 1LO0H 2BIIA 3PXHA 1ZTMA 4EF3A 4Z7VE 2DQFA 2X4PA 2LHAA 4PMEA 5I16A 4BFNA 1TQTA 1YY8A 4ELKB 2EIMB 5CLTA 2X40A 1L7IH 1JMXA 4LLMA 2G5RA 1FV1B 3RPIB 1I85C 1ZA3A 3EFOA 4M1CD 2K9FB 2UZXA 2ZOKA 1U3ZA 2DWYA 4JPVL 5DRNB 5FDWA 2K70A 2N59A 3SE3C 3OF6A 1VCBC 3GSRB 3RJDA 3SHSA 1TKWA 3ESUF 35C8L 3FMGH 5KAQG 1IGJA 5C6TL 3B9AA 2E6QA 3UTSA 4AV0A 1ZT7B 1YG9A 4WI9A 1H15A 4LNVA 3G5YB 3SGDI 3TVMB 2AW2A 4UTBA 2NNFA 4FG2A 4E42A 1GGTA 1CLZH 2WQWA 4KAQH 4RFEB 5ADOL 3ABZA 2ZXQA 5HI4D 3DXAE 1DCLA 3HE6B 3ZL2A 4EXPX 1NFDE 4HWBL 3T2PA 3NIFB 4LSTL 3IU3B 3D4CA 5KW9H 2PYFA 3PUUA 2QADD 1MAMH 1UT9A 1HZKA 3KCPB 2BOLA 1TVDA 4NO0A 1JXFA 2Y7NA 3MRCA 1J8HD 3MU3A 1YEKH 3SZKC 4Q56A 3B7UX 1CXFA 2J72A 4U7KA 3FUFA 3MYJA 3VXUB 1QQDA 5K39B 3ZE0B 4PWGA 2X2HA 2NXYC 3M1OA 3KE0A 1GC1C 1P4IL 1QI3A 3BVDB 2GB2A 2UV3A 4NHCH 3QZPA 5DHYA 3AS0A 1UCBL 2DQIL 4YIQB 3IU4H 4F9PA 4UNVA 1OZUA 3I9PA 2Y7QB 1CICC 3BUIA 5IY5B 1RK1B 4B97A 1FNHA 2FWOB 5H35B 2EDHA 3KBPA 2CIKB 2D7MA 3UBFA 2ZOLA 4Q52A 5FYLD 4PVLA 2A3TA 4NSKA 4J23A 3ELAT 4QAWA 1XB8A 1NM9A 1L9RA 2KT6A 1MG3C 1J11A 5ECGA 5K1JA 4GAFB 1B3JA 1QEWA 2VITB 4HOMA 2NXYD 4CA4A 5TQ2L 2WP3O 2X3BA 2DM2A 4QY8B 3HI1A 2ZOTA 3IDMB 5AW4B 3PG2A 3JT2A 1QFUL 3JWDL 4BZ1H 4XAKD 1CGXA 1HIML 2WOBA 5ACMA 2PNDA 3FTGA 2A1WL 5FKPA 5IB1B 4HKZA 3WNIA 2XQBL 3N41F 3SDCD 3MO1A 4Y4FA 5F88A 1P4BL 1R75A 4NZJA 2BSSA 4KKLD 5FHAH 1SMDA 3D69A 5B8CC 3OKNB 4LLQB 1RULH 4NM8H 3G6AB 4DKEH 5FLVA 2JF1A 2XWEA 4HJGB 4OLEA 4ZX6A 1LO2H 4DWHA 1S9YA 2B20A 5KOVC 2IH8A 3IAPA 4G7YL 2NR6C 1JWMB 1MFVA 1GOHA 4YUEL 3CFIC 3S36L 4CBZA 4FI8A 4OW6A 3ARUA 1T7ZA 1HOEA 3C6SA 3FBQA 4G5ZH 3HW7A 4ZUUA 3OSVA 1U3NA 4K5LA 3PREA 2BNRA 4H1LG 4PJ9D 2ZXEB 3QXDB 5L2JB 5C0CD 2XN9E 1F58H 1XGTB 4XVUC 1TO4A 2B4CH 3OKLB 1JPSH 1D7FA 5KSAC 3PP4L 4W4OC 4N1HB 4IGBB 4XC1L 3D0VA 5C97A 1AH1A 3VI3E 4NPKA 3VWKD 5BRZA 5L9DL 2ESVE 4O2CA 1NMCC 3AVEA 1E8ZA 1F3JA 4G42B 4L4TD 4A38A 5T1LA 3UP6A 4DGIL 5JA9A 1IM3A 1BFOA 1M7IA 4X0KA 4XVOA 4BFRA 2WZ0A 3QE5A 3IEAA 3UBXA 5T5FH 1H3TA 4N6RB 1T7XA 2E8YA 3I50H 2PCPB 1CD1B 3PWNB 1CTMA 1NL0L 2ZUQC 3FOMA 2XY2A 2VQ4A 1DBJH 3MN8A 4P3CL 1MAJA 3G3LA 4FXKA 3ZDYF 4HALA 3LQAL 2XUWA 3K2IA 3RWFA 1HHIA 5EN2A 2UVFA 2O26U 1F00I 1URIA 2Z31C 4NZTH 4UOW0 3ZLQC 1MRDL 1M7UA 3D51A 4UM9D 3VH8G 2A77H 2BCMA 4XWGH 2X6MA 4KFMA 1GHFH 2QPSA 4PJBE 3DX9A 2F53E 1FNAA 1AP2B 1GVIA 1K4CA 2OYMA 1BREA 1MW0A 3AQYA 4BZ2A 2QGDA 2F5AL 2R69A 2RBLA 3F65A 3FCUB 3GI8L 3MZGB 4HLZG 4UIKH 1GJUA 3QXAB 3DO7B 2OMYB 5FGSA 3V0VB 1CXEA 1Q4NX 1ZVNA 3K5RA 1GSMA 5FFGA 5AB1A 1UFUA 3BQUA 4XP5L 3SYCA 4EPSA 4FNSA 4U3XA 3B2PA 1LO4L 2QLVB 4PRAA 3BJ91 5E94B 1MCPH 5GGRY 1FO0B 4H25B 5J9PA 4WF7A 1OZTG 4L0ZA 2WTOA 4X7SL 2LU5A 1WAEA 5CWSA 1PY0A 4ZS7H 1ETZB 2AJXL 4FG6D 1INEH 4XBPA 3OMAB 5CWSB 1MPAH 2JK5B 1GR7A 1IAKA 3K74B 4K94L 4UTBH 2ITCB 4JDTL 4KTDL 4OKDA 1N8OE 1BXUA 5GGQL 4HU2A 1VACB 3R1GH 4BFKA 3JVGC 4DPAX 1TITA 3QI9D 3ZSTA 2F7RA 3UPCA 5ADOH 4C8XA 3HB3B 4ZAKB 2EDYA 2YAEA 4NIYE 4ONHB 5CJOL 5LQBH 3OHXB 3DOHA 2ZJSH 1XL6A 3VQ2C 2DPKA 3JV6B 1UUSA 1YEJL 5J6HB 1YEKL 3DK0A 1GS8A 3BSGA 1JI2A 3GJFB 3TCXA 2IWFA 5EO0A 4U1IA 3TIEA 4PJXA 3FSAA 2E9IA 1IAOB 1YEEH 3MXWL 2WIIB 1LO5B 5KSBE 2VRQA 1CICD 3NIGB 1KIPB 2YD9A 3VX1A 3DUSB 4V1DD 2XRAL 4W9JC 4ES8A 3EBAA 3L81A 4N24A 3HZMA 4DKFH 5I30H 3MA7B 1M1XA 1RUAH 3RX7A 3WXVL 4H1LB 1II4E 4MDJA 1AD0B 2OK0H 2HX9A 2J20A 1OF0A 4M1GL 4QHKI 5B1BB 1A6WL 1F3JB 3K1DA 4YDLC 4RMUA 1ONQB 2J6WA 3FBKA 1GYCA 3H8NA 5EDSA 1IC4H 4WHCA 4NRXB 2VR4A 3IDXL 4RFNC 3WFHA 1XH2A 5D2NC 4RFOH 4UQIM 4ZZKA 4Q2ZA 1XGTA 5SWSE 4MA1C 2BNQD 1XCTB 4PRBA 3VXNA 1UENA 3TO4A 3U36B 1KB5B 1PG7X 3FQXA 3QHFH 5AW2B 2HFEB 4MNGE 2PCFA 5GPRA 5E7BA 5C0BA 2R29A 4QJ3B 2IPTL 3LIZH 1K2DA 3O2DA 2WXJA 4IRJA 3ZY7A 3O8XD 4JRYE 1WP6A 2BS8A 3TJEL 1DO5A 4KKZA 1HHKB 1BXXA 4M93B 4LLQA 1UXMA 3Q43A 3LS4H 4LLVB 2FQEA 4CW1B 2QHRL 4D9LL 3AC0A 4Y9CA 5F88B 2DQUH 1X5KA 1TTRA 1OAQH 4J3XA 1WTGT 4LPWA 2HKFL 4ZOBA 2VUKA 3SZ6A 4M3HA 3UYRL 4M8RA 2VLJB 1KOAA 3FH5A 3QCTH 4U6VL 1TYEB 3DLQR 4QWWC 4DFIA 1BVOA 1E42A 4GS7B 3SBQA 5C7XH 1J10A 1MHEB 3AG4B 4JG5A 4JDTH 2NY7L 3O8XB 1XR8A 5IJCC 3SD2A 2GT9B 3BRGC 3VFGH 2VERN 2JQZA 3LNEA 5JDJA 5E5LA 5EPMB 1X4ZA 1KGXA 5KZCD 2FWOA 4BFEA 3MHZA 3TNNA 5TE4H 4HD5A 4CKQA 5HHVH 3K1KC 5D1ZB 5JORA 3ECBB 3T8XB 5I76B 4TPRL 5KWYC 2Y7QA 2MQ3A 3QXUA 4TRPL 1MHHB 4BUGA 1E5BA 3QQDA 1CD9B 1KT2A 3F05A 2EVHA 2XKNA 3DOIA 1ZXQA 2XTSA 3HNTL 1CF1A 5SWSA 5AVXB 4CDHA 5H8DA 1WFIA 2DBJA 3CWGA 5H94A 4ZXBD 3TNMA 4YGVB 3KVPA 5D1XA 4BKSC 3L95B 4XPBH 3HG0A 3LKSA 1MCLA 4HC1L 5DD6A 5F89B 2IMMA 3KYNB 2XWTB 1RZJH 3GJFK 5LHDA 1L9OA 2E0PA 3ETBF 4OFYD 1G9MH 2B1AH 2KL6A 4DP7X 3NT0A 3QUXB 1R3KB 2V5RA 3LPOA 4MZ2A 1NBYA 4QHPA 3ARYA 4J7RA 2XCMC 4Z7QB 5DYFA 3BP4A 2FAUA 1UJ3A 3FCTA 4ZJ9A 4B5EA 5IOPA 1GZPB 4Y1AB 4N90D 4NAJA 1QG3A 5IOPB 1CN4A 4IIQB 2D0GA 3VTMA 3L7EB 3TIDA 2DH3A 1KBVA 2X1QA 1KJ2L 1IGJB 2P5WA 5D7LD 3SE9L 3TWYA 2E27L 4QRUA 1BMWA 4FNUA 1R3KA 3CVHB 1U91B 3LZQA 1FNLA 4JFXA 3VDBA 3ULSB 3ZRSA 1RCYA 2BP8A 4NC0B 3ZIYA 1MXDA 4BH7B 2E4TA 3GBMH 5DD6B 2WMPA 2Y9RT 3ES6A 3IT8D 5SWZA 1WBXA 3TNMB 2FJUB 2GVYA 1OP5H 5TDOB 2JKNA 4JFEA 5D7LE 3KBEA 1FLTX 1MWOA 4X7FC 4LLDA 1AMYA 2CHDA 4C58B 2WTRB 5JQHC 2P48B 3FJTA 3DJTA 3QG7H 3T0DA 1HJCA 1R5VB 2Y1VA 1MHHA 3O9WB 5CEZL 3H9SE 4QCIA 5LNDA 2YBGA 1HSBB 4GFXA 4KXZI 5D2LA 4G9FA 3U1QA 4YE0A 1UB5B 3IDGA 4YHML 1GXEA 4Z7UF 1T80A 4AYDC 3NRFA 3K6IA 3WY2A 1H3PH 3D07A 4PJAA 3S0PA 3GWJA 3AS1A 3G5XA 3SYPA 1GTFA 2Q2EB 3ROLB 1CFSA 2VKWA 4GY4A 4KKPA 2Y07L 3LEXB 1MHEA 1NOAA 1R47A 3ECQA 2V3DA 2OL3L 4I3GA 2WWNA 3LRSA 4Z6AT 4KRNA 5KS9E 3HNVH 4OCNC 1HE8A 2FJHB 5CJBA 3EO0A 4DGWC 2YGNA 5E9DE 3RL1A 4D0DA 1XF4B 4N0FA 4CADA 2ZUUA 1LEIA 2AJUH 1A6UL 3I6GA 2J71A 4E41A 4HUWB 4WDIA 2HLAA 2YPVA 1EHKB 4ODSL 5DMIH 5KN5A 2WVTA 4L29A 3QO0A 5PCYA 1H6UA 4YEFA 5A16A 3VJ6B 5HDQH 2HRLA 4NLHA 2QMJA 3V8OA 1IJ9A 4JKWA 3GINA 1NCBH 3OPZL 2ZUVA 1WH0A 3CHOA 2KPNA 3KPSB 4L4TB 3DV4B 1X9QA 3VH8A 4M8UA 1MFBH 1BBJB 3WCYA 1IVLA 2ZYHA 3L16A 2WCGA 3B5HA 2CU9A 1SBSH 1IC7H 1RU9L 1QKZL 4N85A 1N3NA 3X1BA 5FHBL 2IPKB 4ZAKD 5GISH 4FFZA 1MF2L 4FTVB 2CHZA 2WLIB 2OR9H 2MPAL 4HKJA 1C12B 3RAJH 1M57B 4GKLA 1OP3H 1HZHH 3VD0A 2BRRH 4IKIA 4UQBA 3HOGA 4Y4KD 2HG5A 5DZNA 2VMEA 3DIVA 1ZHNB 2X10A 3L45A 3BUYB 4X6DA 1AZUA 4DK6A 3NJVA 5GQBA 2ILLA 2DWEA 2ZKMX 3ARPA 1CLZL 4KAQL 1CFNA 5T3XH 3RZCA 1U8LB 1EAPA 1M7DA 5I0VA 5I19H 3T0BA 1WAAA 1KXTB 2NY0B 4XN9A 4GP8B 1F6FB 1OCWL 2Z91A 4E5XB 4F7EB 2XIDA 5FECA 5F3FA 1MCPL 1OE3A 1X9LA 3UZQB 3IDYC 4UTAH 1A3RL 2Q10A 1LDPH 2DMKA 3N9GH 3PGFH 4B0MM 4F37K 4FXGC 1NGQH 4PG2C 5EU3A 1AS8A 3ZIMA 4LDOB 1S7RA 5FA3B 2VW7A 4A63A 5D7JC 3BPNC 2D0HA 4OLZL 5CEYB 2J1ZA 3VFOB 2A4EA 4LCIH 3UJIL 3VG0H 5ID0B 5FKAB 4K15A 1OGAA 3C60D 4MYPA 1JVKA 1PZ2A 1U4EA 4PBWD 5DD0L 4DN3H 2PPCA 3K6SA 2HVBA 3Q9QA 3CVDA 4S10A 2O4EA 2QJDA 5EU3B 5C0BD 3ARGC 5SV4A 3SIKA 3GSNB 1E4WH 5AB0A 5I5MA 4RISH 4UDUA 3HS0A 4FJZA 1DBML 1DJGA 2JKIS 3L4CA 4KUCD 4E5XA 5FECB 1FZJA 1ZWIB 3EH4B 3JTBA 4L9LB 5JQ6L 3LPPA 4NO3B 4K3GA 4MDIA 4PRDA 3HS9A 5AZ2L 4DGVL 1IM9B 3V55A 4MAUH 1JXGA 4H25A 4UBDD 1A1NB 4JM2C 2EZ0C 3ZQXA 4PN6A 1JZ8A 3S88L 1RZIA 3K6NA 1PZAA 4KVNH 3LMJH 4WWPA 4LOVA 4KTGA 7PCYA 1J8HB 4NPYA 4YXLL 3MRPA 3S37X 2AK1L 3QXAA 4WRLA 4APQA 3CQFA 2AXJA 2Y0SA 3AXLB 3CJJA 3EZJB 4HHAB 2DQCL 5HSFA 4XB7A 3GTNA 4DOHE 3W0WD 3GZOA 2WLIA 1H3PL 4AENB 5FYKL 3QPXL 1E67A 1M71A 3O2DL 4XO9A 1A8JH 3CLWA 5D9SB 2AANA 5A6IA 5FGBA 4Z7WE 3O8XC 3EYOA 4KX9A 2VDNL 3ZOAA 2V37A 4N2AA 2BERA 4YHKH 2ZG2A 5EORL 3QG7L 5A43C 4F7MA 2F8XC 5JW5A 5E6YA 1PZ5B 1E6JL 3MNZB 5FHAL 1TQBB 2F5BH 1I8LA 3MX0B 3MV7E 4H44C 4OCXL 1Q9OB 1RUPH 1DANT 4UV7L 1Y18B 3ARBB 3LNGA 5AW0B 5AKRA 1G9NC 4IBSA 4LIQL 4Q9QH 2VIRB 2FJHA 1A6AB 1WD9A 2V7NB 2F19L 2R0WL 3B4NA 4YLQT 1AIFB 3MJ9H 3WNJA 3QI9A 3PWVB 1I7RA 3LEXA 2CXKA 3DBXB 2KMWA 1DVTA 1FVEB 4P4RA 1CGVA 5TQ0L 3DARA 5E4EC 4LVNC 4E9TA 1NGQL 3AFLA 1J18A 4BK5A 3FTUA 1NFDA 3BKML 4F93B 3VFTA 1KLFB 3BP5A 2A4ZA 5I6NA 4U1KB 2Z7ZA 5KTEH 2X2YA 4UCFA 3FQRA 4DK3A 4NQCD 3H6AA 3COOA 5KVFH 3QJRB 1FL6B 1WA0X 3FB8B 5MEOB 4X6EA 1KIRA 3IWUA 4WI0B 1CXKA 4X6CA 4OZHE 5DUML 2H32B 3ZE1B 3HG3A 5C7XL 3A4FA 4J4PD 1KXQE 1V10A 5EOCH 4ZFQA 3CZFB 3NIFE 4L2LA 4XHQA 3R06B 1PAMA 4F8QA 1OTUC 1P5UC 4JFXB 4NZUH 1K85A 4XXWC 4RWYL 4BWUA 2GK0B 1UYWH 4HAFA 2DQEL 4R4FH 5BZWA 1Z0NA 3NN8A 3N2JA 4WY7L 5D96B 4WTXA 5AL0A 4PLJD 2ZWYA 5CEXB 1BLNB 1C7SA 1ODUA 2A83A 2R1WA 3OZ9L 1HQRA 1U92A 3V6OE 3BWZA 5DHVB 1AGBA 3BKJH 4G6KL 1NKOA 1OCZB 4I2XB 2WBKA 1IQDA 3CZUB 5C08D 4Z3TA 1QRKA 4HIXH 2H2SD 1FNEA 3KCWA 4JFOB 1T83C 2Y69B 3CX5K 3EJZC 3V9FA 1QR4A 4ODXB 2WUCH 2HG0A 3X2QB 1TCRA 5D2LE 2R0LH 2VDLB 1ET8A 1B9ZA 1KJMA 3MRFB 5C0AB 3O3EA 2APBA 1VFAB 2DM3A 4GFTB 3QZWB 5AOLA 1B4TA 1ANUA 2AGJH 1WFUA 4DQOH 4FULA 4I3RL 4LSDA 4F2EA 3VXUA 3WKMH 4Y4KB 5H94B 1QRNA 4MKTA 4PRPD 1U8QB 2IDQA 1HNGA 1MLBB 2GIMA 2A6DB 4FQHA 4YSCA 1MI5D 4HIPA 5B1JA 3GXUB 4Y16A 2PYFB 3S88H 4FFYH 3IU3A 2XXMB 5DD0H 4OCWL 1KGUA 1U36A 2GUOA 4I0PA 4J8RA 4QHLA 3WXVH 3WI9A 1CIDA 4QWWD 2RACA 1ZJBA 5HYIA 4G82A 3TVMA 1QWHA 3UTTE 5T3ZD 4P57A 3TT3L 3LJ3A 4MX7A 1Z9SA 2YD1A 3UAJC 5JQIB 1EJOL 1GGCH 3BE1L 4P06A 1D5ZA 5FYKD 3W9EA 3EDFA 2Z9TA 1FFPB 2CQVA 2PXYB 3IDXH 4OJYA 2D03H 4G11A 1OT1A 2ICWI 1D5BA 1A64A 1PGRB 1Q1JL 1RUML 1T1XA 2X4SA 5EORH 5F7MC 5AG9A 2WOYA 4P5TA 4I7ZC 3F64A 5JTWA 4JREB 2GI7A 1BX2B 1GGUA 1E2VA 3I02A 4JKPL 4WWID 3VD9A 3N42B 3OKEB 4JM2F 1FL6A 3BX7C 5F9OH 2MOGA 3PQYB 1RJCA 3I84A 2XN9D 3GBNH 1NEZA 4LSPL 3RILA 1ZGLP 1TO5A 4Y4KC 3RGVD 4WO0A 2W91A 3HUJE 3KYMB 1J05A 4IRJB 3VFTB 3KLAA 1V7ML 4RA3A 5FYLL 1HE7A 1QYGL 4BZ2H 1OKEA 3ZR6A 3IDIA 2HRPL 4OZGB 3Q2VA 1KCVL 3NGBC 4P3DB 3VNYA 1SJMA 2VDKB 1ZVSA 1NGYA 2E7CA 2XKUA 4U1HA 5DHEA 4K3JH 3QUYA 4K5PA 1PLGL 1SVCP 4IU2B 3R4RA 4WU5A 4Z7WF 2V7NA 1O9WA 4TTDD 2BZDA 5BOJA 2N1KA 1OD9A 2NY3D 4G80A 2B1HH 3DSFL 1TVHB 4PJEE 5T5FA 4L8BA 1XH3B 3GI9H 3DUUB 5JNYB 5EEXA 3F7YA 4JRXE 1IEAA 1TEGA 2WWOA 3OSKA 5DCCA 4MXVF 3SGJA 5D71L 4XO5A 4HIEA 5I75C 4GSQA 4KZCA 4TRPH 4AIXA 4IMLB 4LLYA 2HVKA 1OARL 5C08E 3ZL4H 3VGAC 3J8F7 4WI7A 4F92B 1Z7JA 3EYOB 3QWOB 4P5KB 3U4AA 3AW5A 3GBEA 2NYYD 4G1EA 4L4JA 1WITA 4LHUG 4XNYH 2FTAA 4APQD 4WHDA 4NN7C 3CSYA 3NH7L 2BRRL 2R39A 4JHUA 1AR1D 3BAIA 3EYUH 5T3ZH 2F61A 3SDXE 5KJ7E 5LGKA 3GMLB 4TLTA 4FEIA 2O5YH 2E9BA 5INCA 1PZDA 1JF6A 4IIZA 5H37H 1QEXA 4KK9D 1BZ7B 4PJAE 3NCJL 2C26A 4KWUA 3CFQA 1DBAH 2PUQT 4OCWH 4RNRA 5AW7B 3RNQB 3AXLA 4HHAA 2FJFB 4LKCA 1INEL 1SDAB 2WLYA 1DQDH 4LRIC 3SSGA 3GHEH 1VRSA 1BJ1H 5I6KA 3DXAB 2WVUA 5E23A 2IIJA 1D5IH 1N0LB 1FH2A 3CXHK 2P26A 3FHAA 1S7QB 2Z93A 2QPFA 4OLYL 1UUNA 3ZTEA 3F7PC 4HDIB 3DRQA 2YSTA 1OCCB 4CVUA 5HYSA 1IM9A 1QHPA 3GBML 5FFLA 5G4OA 5DGQA 1SY6A 2JFCA 2CO2A 4GMSL 5ITFB 4EVNB 3FOLA 4UOZA 3CDFA 2AK4B 3RIAK 3QAZC 4W68A 3WO4C 3WJJC 4PW9A 1OAUH 1ZXKA 4QD2E 4C4KO 4FZEL 2E27H 4CRPA 3HS0B 2WZAA 1KNOB 3IXTB 2BP0A 1U8JA 4P2RD 2Z93B 3WHXA 1QR1A 3FQUB 5SWQA 3CBKB 1YAZA 2FE0A 4URTB 3BVNB 4EUPB 1BVNT 3LSOB 4OGYH 1I9IL 4O5LL 2JCCA 5IV2B 1IIKA 4ZD3L 2QVKA 4ONOA 4IDJH 1Z3GH 3RNQA 4NDMB 4JKLA 4WW2B 1IB5A 1KZYA 3GSQB 3CQQA 2DYSB 4IRZH 5AAPA 3VFOA 2BNQB 1TIUA 1GW6A 4DPRA 2GTWB 4GG6F 2XKSA 1NGPH 3CSYB 4G6FB 3X14A 3WTUA 2QBWA 3FFCB 1X44A 4G8FA 5DLLA 2H0EA 3ZKXC 3NJGA 4X5PA 5EN2B 3RWFB 3U7YL 1WBYB 2V3FA 3HBGA 5ALCH 2O6EA 1QP1A 1X7SA 2OMZA 2C9UA 2DKUA 4MCYA 4YMPA 1PCSA 2Z91B 5HVWA 4LE8A 4H26B 4NQXB 2OMUB 6FABH 1DN0B 4N1EA 5K59E 5KSBA 5F7AA 4NZRL 1EAPB 1AVAA 3UG3A 1KTLB 1YPZF 4DN4H 4K0OA 4R7DB 3NZSA 1H5BA 5T1LB 8PAZA 3PL6C 4X6DB 3S96A 3LVTA 4DP1X 1OALA 1IE4A 1RVFL 2F7QA 2X4UA 3SE8L 3ZX1A 1ECYA 4IGBA 3UC0L 2A0LC 4X99A 4HSAC 2AQ2A 4WFGD 4FQXD 2HTKD 4A2MA 4UM9A 1K8DB 5DJ8A 2A6JB 4MWFB 4P4KD 1NBZB 4KTEL 1LK3L 2IQAA 5FS5A 4YWGH 1EUTA 2CLRA 1A7PL 5JHDB 1IC5L 3QIUD 3ZE0E 2CPUA 3D4ZA 4LP8A 3QHZH 3O6FC 2JKRM 4ZI8A 4KK6C 1EV2E 2ZUYA 5LXGL 3DV4A 4HEMA 5AW3B 3B1TA 2ESVA 3FUJA 5IVOA 4TPRH 1FSKB 3QCUL 4P9HC 4QRPD 4UV7H 1BAFL 4LSVH 4MBOA 4PJ5A 1B0WA 2JCCE 3DHUA 3Q8BA 2CHNA 3M6DA 2QT6A 3VGEA 3BWAB 4UT6L 1IKNA 2NTFA 1YYLL 2C9RA 4KY1H 2BSSB 2VXQA 4MNQD 4QMEA 5L8JB 4AH2B 1HWHB 4S2SB 2G4EA 3VSUA 3OJDB 4E41B 5SX5K 4N0CC 3ZKNC 1Y1DA 4YSPA 4HKZB 4BKTC 4QNPF 3FTGB 5IB1A 4R97B 1CO1A 2YBRB 3AWGA 4GAJL 2R9HC 4MNQB 1M2VB 2NNAB 2R0WH 4UMGA 4ODHL 2WWMC 3I3DA 4H7VA 2JJSC 3KDPB 3PGFL 4XCCH 4L1LA 2QDVA 4JHZA 3U4BL 2DLIA 4ZFFB 2X88A 4R5VA 4NQTA 1CB4A 1N64H 3O3DA 4QHKJ 2PP7A 5DTFA 4ODUA 3V5HA 2EO7A 2H3NB 4F27A 2ZYRA 2ZAIA 2YWYA 4HPOH 3RU8L 4ZMOA 5D72L 2YUWA 3QNZB 3WEXA 5BXFA 2OMWA 3NZHL 4JDVB 2NUTB 4FNTA 4GIAA 3D3VA 3W1ZA 2VQ1A 3FYEB 1J0KA 4N3UA 3UTPE 2IBBA 2AV7B 3TA4D 4N2OA 1AQ8A 1J7VR 2KUTA 2ADFL 2DQMA 2VZ3A 1DFBL 4DN3L 5CMAB 1X5XA 4HMEA 5KYWB 4ACPA 3ETBJ 2KLTA 3FN0H 2V9QA 3MRCB 4B9GA 1UA6H 1PLCA 3I9GL 5DS2A 3P30L 3E9UA 3DMMB 3VWKB 1S9VA 1JRHL 3WNMA 2OAAA 5F7DA 1WIPA 2P5WB 3MLUL 2XN1A 5IB2A 3QORB 4FERA 1QZNA 3BP6A 1P69B 3E0GA 3N43B 5DRWB 3Q44A 4JFOA 3SPIA 4EJ1C 3LIZL 1FNEB 2EYTB 2EO1A 3LRMA 4IIQA 4MJID 3ZTNH 4AM0Q 3I9IA 4G7RB 1FO0H 2XTJC 3D50A 5DRXB 5AW9B 4U0RB 1UH2A 5DHVA 4P46C 2J6EA 1F86A 2EYTA 4Z0BL 1JZ2A 3L3KB 3ZK0A 5M95B 4GKZB 2AQTA 2A83B 1W6WA 25C8H 5DT1L 3O11B 3OKKA 4Q74A 3A6OA 5FDWB 1A4JA 1G1CA 3L5JA 4HSCX 4X9YA 2XA3A 3JBG7 3N1MC 3HNVL 3Q2CA 1ZSDA 2W0KA 1MCRA 1U8HB 4PH8A 1QZ1A 3P73B 3ASWA 4XP4H 1T6VN 4QRQB 1M9WA 1L7TH 1ILSA 3BYYA 1E6OL 5J13B 5KYWA 2XWXA 2N4IA 1R3IH 5CCKL 4FG0A 3HLAA 4F5CA 2QTEA 1HU8A 1TJXA 1WS8A 4Z3EA 3RWIA 1FCCA 2JKWA 5DYOA 5DVLA 3RGVC 2IOOA 3FT0A 1CMOA 3EGSB 4G8EA 3QZOA 1GYVA 3QIUB 2FD6H 1J87A 1KY6A 1T4KB 3L48A 4PTTB 2X4QA 4JG0H 4K71B 3TNNB 1TZ8A 4K8RC 5I1HL 4E9VA 2QADB 4MA3B 2YEZA 1SBSL 1DZBA 3V6OA 1RK0B 3OMZA 1OF2A 1LK3H 1XR8B 2PPFA 3TX4A 4XC3L 4LMQI 4AGLA 2CHXA 5A7EA 2FWSA 1A6UH 4YDMA 3QRLA 3QDJB 1BF8A 3QI9B 4B9CA 1SHSA 2F6AA 1KCBA 3MBED 1EDHA 5FUCC 3SQBA 3R4DA 4JO4L 4KITB 2YBRA 3L2MA 4DP4X 2X89A 2CLVA 4NUJB 1BLIA 5I0DA 3TN0B 3ZQ9A 1NCDH 3OJDA 4UQ3B 1PBYA 5EEWA 4J3VA 1PZ5A 2WXLA 2G2RB 4GMTH 1J88A 3S3PA 1IGML 3HRZA 3MMEA 5DWUL 1JFHA 3EFDL 4XH2A 1T2JA 5A2CA 3UC2A 1SN2A 4DQAA 3LZLA 2BW4A 1MI5A 2ZNXA 5EZLB 1NA8A 1OV8A 1JE6A 3DGDA 4IK6A 3FTXA 1EO8L 5LXVA 2GY5A 1OM3L 2HFEA 1LJMA 5DLMH 4MB3A 2VDOL 4PWJA 5HJ3B 5TE7L 3O6KH 1N5YL 2WXHA 4HGWA 2ZSWA 6CGTA 5DSCB 5LBVA 3RLSA 1AC6A 3APCA 3A3YB 3C5SA 5EOTB 1BD2D 1THAA 3BP7A 4YR6A 4AL8L 5GGTH 1NUDA 2F0CA 4JY6B 4NBYB 4JPVH 4OH2A 1ZAGA 4MD5B 4W9ZA 1TQVA 1W6LA 1WEJH 3TF7C 4FFTA 3GMNA 5F6HJ 1GZHA 2OJZH 1CT8A 2B0SH 2J43A 3LKRA 3GMRB 2YSSB 3CFJA 1OD7A 2ZKHL 1T0PB 2CK0L 2H1PL 4PRDB 4PJIF 5ITBH 3REVA 4XCCL 1I1AA 1PW3A 1A3LH 2R7EA 4O51B 3TONA 4AJ0A 1ZWIA 1YUKB 5FUOL 5I71B 3MRGB 4N6QA 2C7FA 1XIWC 5GGVH 5L0QC 3FFDB 1KBGH 2DTSA 3ARZA 3PXJA 2LLNA