3X1EA

Structure of copper-containing nitrite reductase from geobacillus thermodenitrificans without chloride
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
295
structure length
295
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Nitrite reductase
publication title Structural evidence of the flexibility of the CuM site
rcsb
source organism Geobacillus thermodenitrificans ng80-2
total genus 98
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3x1eA00
4BWWA 4NAJA 1E65A 2IH9A 3OMIB 5PAZA 3GDCA 3T71A 2CUAA 5B7MA 3N55A 3FQ2A 2FTAA 4YSQA 3BVDB 3X2QB 4A68A 2BP8B 3WI9A 1AG6A 2QDWA 3WKPA 2GI0A 4DP7X 4YSUA 2UXTA 4YSEA 2FNWA 3AG2B 3FYIB 3NJHA 2JKWA 1E5ZA 2BHFA 3CVCA 3AZUA 4PAZA 1ASOA 4KO9A 3X1GA 2EIKB 3FYEB 1KBWA 1AS8A 2YAPA 4NERA 3FPYA 4G7SB 3QJVB 5I26A 2PPDA 2UX6A 1L9TA 2XX1A 2DWTA 1GY1A 1JZIA 4E9TA 4GYBA 2YAOA 1JVOA 5I6PA 2EILB 5AKRA 1ET8A 2I7SA 1GSKA 1URIA 1W6LA 5A7EA 1NPNA 4G72B 3NYKA 3JT2A 2TSAA 2VW7A 4BXVA 3FSAA 3CDZB 1JZEA 1B3IA 4AI7A 2VSKB 1KBVA 1NPJA 4DPAX 4KO5A 3NSYA 2YQBA 4DP1X 2IWFA 1NWPA 2IDUA 2UX7A 2IH8A 1OOWA 2PCYA 4WTQA 2FT7A 3S8GB 1FWXA 4P5SA 4WKXA 1JZGA 1ILSA 4AKQA 3NSCA 8PAZA 4DP2X 5B1JA 2VW6A 3DKHA 1BXVA 4JKNA 3CG8A 1EHKB 5PCYA 7PAZA 1IBZA 4PCYA 1JXFA 3U25A 5IY5B 2J55A 1GS6X 1AZCA 2BO0A 1J9RA 2UXGA 1X9RA 2MTAA 2PP8A 2GHZA 3FU9A 1MG3C 4N4YB 2B08A 4HCGA 4W9ZA 2A3TA 1RZPA 5I5JA 1GS8A 2PCFA 5B1KA 1J5CA 3QJTB 3IN0A 1R1CA 2UXVA 1AQ8A 2FJSA 1BXAA 2BZCA 1WA0X 3UACA 2PPCA 2PPFA 4DPCX 2HXAA 1ZDSA 1PAZA 3ABLB 2BW4A 1J9TA 3FU7B 5E9NA 1PZAA 3HB3B 1IBYA 2WSDA 3FSZA 3NJMA 2HX9A 1J9SA 4QLWA 3UADA 3WKQA 4A2EA 4HALA 2VW4A 3IEAA 7PCYA 4HZ1A 2QT6A 4YL4A 1KV7A 3WNIA 3X1EA 2BP0A 2R7EA 1NIBA 1A8ZA 1XB3A 2YXVA 3UGEA 1M56B 4A2DA 1DYZA 3AG1B 2HRHA 3NJGA 1SHXA 3OMAB 4DP4X 3EF4A 1GYCA 6PAZA 1AZNA 4KOCA 1A65A 4GP8B 1ID2A 1TU2A 1PMYA 2IDQA 4L0PB 4DPBX 5LDUA 4GP4B 4KNUA 2XV3A 2YAMA 3WIAA 2VM3A 1N68A 4A67A 5F7AA 3TBCA 5B1AB 3EH5B 3NJLA 2H3XC 5D4JA 1J9QA 3PAVA 2DY2A 2XV2A 1BXUA 2YAQA 3T6XA 1L9OA 2Q5BA 2W8CA 4JHUA 3OQRA 4DP9X 1AZUA 1MZZA 1NIFA 4BDVA 1RCYA 1M9WA 2XUWA 2H5UA 1TKWA 2XVBA 2TSBA 3JTBA 1IC0A 1ZPUA 2GBAA 2XXFA 3FSVA 2YAEA 1OV8A 1KYAA 3TA4D 1VLXA 2MRYA 3C75A 3ASNB 1L9QA 1OCOB 2I7OA 3NJNA 2Q9OA 1JZHA 1NWOA 4FAAB 2RACA 1HFUA 1AZBA 2HRGA 4DP0X 2HX8A 1IUZA 1I53A 2AZUA 1AZRA 4E9XA 3TASA 4YVUA 4ZK8A 2NRDA 3MX0B 4E9SA 2DYSB 1BYOA 1OE2A 4YSAA 1HAWA 1PF3A 4ENZA 1KDJA 3OD3A 1PZCA 3UAAA 3TBBA 1OE3A 3QJRB 1CYWA 5TK4A 1JZFA 1PZBA 2H47C 1OCRB 5B3SB 5B1BB 2I85A 4AX3A 4K9JA 2XU9A 4KO7A 2PPEA 4EF3A 3FPXA 3T9WA 2B3IA 2QDVA 4A2FA 2WO3B 2YAFA 1SF3A 1JXGA 2XYBA 1ZIBA 4HHGA 3TU6A 4BWTA 1XB8A 3KW7A 1DZ0A 3IE9A 1BYPA 3T6VA 2BP0B 2R7EB 3QJUB 1XMEB 4BK5C 1ET7A 4X4KA 3V9CA 2AVFA 4UANA 1E5YA 3X1FA 1NDTA 2FQGA 2EIJB 1PLAA 1FA4A 2AFNA 1E67A 2N0MA 1CC3A 1OCCB 1NTDA 1AIZA 1F56A 2DWSA 3ASOB 2IDFA 3AW5A 3DTUB 1ILUA 1CUOA 3PAZA 2J5WA 1L9SA 4GY4A 2HLEB 2XX0A 3HEIB 2VMJA 4BDVB 1N70A 1NIDA 2FQEA 2FT6A 1SDDA 1ZV2A 2E86A 2X87A 4HAKA 5I6MA 3T6ZA 1JVLA 1A3ZA 4HIPA 1AR1B 4HCFA 2HZHA 1JZJA 2WO2B 4M3HA 3PLYA 1GR7A 3NJIA 1JXDA 2EIMB 2ZWNA 2GB2A 4KNSA 3NJFA 5B7EA 4DP6X 1AOZA 3PXLA 1WA1X 2XWZA 4YSDA 1JERA 4FA7B 1MZYA 5D4HA 3EHBB 2XV0A 2PP9A 3NT0A 1IKOP 5I5MA 2XXGA 2BW5A 4MFHA 1BQKA 2YAHA 2CCWA 3FS9A 5EHFA 5AZUA 2Y69B 1V54B 1TEFA 4M4RB 2BWDA 4A2GA 2FQDA 3EH3B 3IBOA 4CSPA 2IAAC 3ZIYA 2XLLA 3ABMB 1NINA 5TK2A 4CSZA 1ETJA 1GS7A 3NP3A 1ZIAA 4E9QA 2EINB 1AACA 2P80A 1SFHA 5F7BA 1AAJA 1ADWA 1ASPA 3CVBA 4HCIA 4HHWA 3SBRA 1YLBB 9PCYA 2FWLB 3NSFA 4KNTA 1ET5A 1CYXA 3ABKB 3OMNB 1SJMA 1NICA 3NP4A 4YSSA 1SNRA 1A4CA 1SFDA 2BWIA 3UAEA 4F7KA 5FC9A 2DYRB 2PP7A 3MBWB 4E9WA 1WS7A 3AG4B 2GIMA 2VSMB 3X1BA 4F2EA 1T5KA 1UATA 3EH4B 1AANA 3UABA 4YSCA 1WA2X 2ZONA 3FQYA 5I6LA 3AG3B 1BEXA 2J57A 3WNJA 1HAUA 4BXSV 1AS7A 1OE1A 1QHQA 3NJKA 2JFCA 2IWKA 3FU8A 2OJ1A 5D4IA 3GYRA 1NIAA 1PCSA 1W8EA 3KW8A 1GY2A 1PNDA 4N8UA 2W88A 3FT0A 2JXMA 1ASQA 1L9RA 3ERXA 4P5RA 4AZUA 2ZOOA 2HX7A 5ANHA 4G7QB 3QQXA 1PY0A 1RKRA 1J5DA 3FSWA 2GC4C 3NSDA 2VM4A 3L45A 1WS8A 2CALA 1SDDB 1TEGA 1WAEA 2BP8A 4G70B 1E30A 2CBPA 2QPDB 3ABGA 4UF7C 2VN3A 4E9VA 1MDAA 4A66A 2PLTA 3H56A 4BWUA 2X88A 4KO6A 3ZDWA 2CAKA 1NIEA 1M57B 4RH4A 1SF5A 1GW0A 4NB7A 2IDSA 3S3DB 1KDIA 1EZLA 1A4BA 1A4AA 4A2HA 4YSRA 1KGYE 4KOBA 2LLNA 1FFTB 2PPAA 3QJSB 4G71B 3S3BB 1OF0A 3ZBMA 3QJQB 3SQRA 3X1NA 1W6WA 1OCZB 3T6WA 2AANA 1QLEB 1KCBA 2Y1AA 2DV6A 1BQRA 4YVNA 5I5IA 4AKPA 3H4HA 5AFAA 4W1TA 3SBQA 2OCCB 1V55B 1JOIA 1XB6A 5I28A 3CDZA 4AKOA 2CJ3A 4TXVB 3PPSA 3CZUB 3WG7B 1SHWA 3V9EA 3NJJA 4E9YA 1PLBA 4Q8BA 6PCYA 2BZ7A 2QPEB 4DP5X 3AY2A 3H4FA 2AZAA 4F2FA 4GXFA 2P80D 1BAWA 4UAHA 1MG2C 5I6OA 1KCWA 2ZXWB 2IWEA 3QPKA 4GP5B 4YSOA 2IDTA 3FQ1A 1CURA 2GC7C 4YSTA 2UXFA 3CVDA 1NZRA 3DIVA 4DP8X 3OM3B 4JHVA 4YSPA 2YXWA 1PLCA 1ZDQA 1AG0A 1AS6A 2OV0A 2FT8A 3G5WA 3PAUA 3PCYA 3RYMA 3SBPA 3D12B 1L9PA 1X9UA 4QKTA 3S8FB 1RZQA 2FQFA 3BQVA 1PNCA 4E9RA 2GSMB 3ZX1A 1BQ5A 4G7RB 5B7FA 5I6KA 3GXUB 3IN2A 2J56A 5I6NA 1V10A 3N2JA 1QNIA 3S3CB 3FU7A 5B1JC 4Q89A 2YARA
chains in the Genus database with same CATH superfamily
2P1YA 4QPEA 4NX0A 3APCA 3QXUA 4K71C 1JFHA 1OARH 5T33L 2P9RA 4UZGA 1JHTB 4Q0XL 1K6QH 2MHAB 1QHPA 1BFVH 1ZA6A 4YSQA 4FTVE 4R0LC 1RMFH 4Z7VF 2EP6A 5I17B 3JXAA 4C47A 3FH8A 4LNRB 4QHMB 1X5GA 2AQSA 3FHQA 3FOMB 1TLMA 4L9LC 5LQBH 4Y5VC 4U7KA 2YUWA 4JKPL 3H3PL 2ZOLB 3AMKA 1TVHA 3FYEB 4KTYA 2YO3A 3DTDA 3WLBB 1MPAL 4U1NA 4NERA 3V6OE 4ZPTB 1RUQL 4KVNH 5I8EB 1KCSL 2DKSA 2O72A 4NZDA 3H3KA 2FBJL 4NNYA 2A74A 4JPIB 5DT1L 3DOSB 1JI2A 4PGEB 4LNVA 4PRBA 2NPLX 2OSXA 4ZYKA 1OEZW 3WJMB 3B4NA 4CC4C 5D7JA 3Q05A 1NLBH 4G72B 3A4DA 5F7HA 1MRDL 1JIBA 3QUYC 4G7VL 3VFVA 4G1MB 5CEZL 5DZVA 2CD0A 1XD1A 4I18A 4YAQB 4ZODA 4DPAX 2C9AA 4JW3A 5T5NF 1GRWA 5E6SB 3KAAA 4FS0A 1OAQH 1G7JB 5T1DH 3VWKD 2FYYB 3K71B 1YEWA 3CN1A 2XJLA 1NL0H 1FWXA 4WK0B 3UL4A 1JGDB 5ID1A 3C5ZA 1U8MB 2W9EL 1U3HD 2BNUB 2V7NA 3MNZB 5LAPA 5C0GA 3TNNA 3UBHA 1CLOH 4S10A 2FSEA 3S88L 1X5LA 5BPPA 4AH2A 3QPQD 4JRFA 4JY4A 3D25A 1HJBC 1GZPB 1WGOA 5I71B 4DGWC 4DO5A 3HW7A 3BH8B 3GLAA 5DUPL 2A3TA 2RQ8A 1ZE3H 1GS8A 5EU3A 3U0TB 5DC9B 4PSPA 4OT1L 1A3RL 1ZXQA 4NRYB 1KCKA 1Q9LA 2HKAA 2BSDA 2XKNB 1G7HB 2HVJA 4FXKA 4M5YH 4Q9QL 1EH9A 3QFJE 2FHCA 1P4UA 1OAZH 1O9ZA 4YEEA 3RL1B 2FVNA 2MTPA 3MRIB 4DN3H 2EDRA 1QZ1A 3VI3F 1NJ9A 3DX9A 4UM9A 1KEGH 3AQXA 3WLWD 4ZNCD 4JZNA 1CGVA 3FULA 1J05A 1OCWH 3QYCA 3O6LH 4ODUB 3VXQB 3WJLA 4BSJA 3QH3A 3MPCA 3ALWA 3ZW3A 1EZSA 1PY9A 5EN2B 4KHXL 1AO7E 1ETB1 1UQSA 2E8YA 1JPTH 1UM4H 2QZ5A 4JY5L 3IXTB 1HJCA 1X5HA 2IAMA 2DLTA 4G80A 2X4OB 3B34A 3AG1B 4R2GD 2WPGA 1SHXA 4FQPA 4XMUA 1RXLA 2NY2D 2YRPA 2P5ED 8FABB 3U46A 1AR1D 1F3JB 3FTYA 5EF2A 3L5WB 4MXQD 1I9IH 4L0PB 1KCUL 3TO2B 3DRTA 1PJ9A 1FL5A 3WEAA 2VM3A 1CXKA 4Z3TA 3S5LB 1KTCA 1G9HA 2OTWB 2X0UA 2KUTA 3M07A 1NCHA 2WCPA 3BIBX 3CFEB 3GI9H 4JFDA 3SCMB 4XRCB 3VFNB 3GLZA 4P4RB 3VXTA 4V2BA 1U4EA 3WJJC 3HKFA 1ZHNB 5SWSB 1OM3H 1A4JA 2OMNA 5I6XC 4QYOA 1AZUA 1CBJA 1MJ7L 1X44A 1BEYL 1NFIA 1HIML 1SJEB 1GJIA 2OK0H 2QVIA 1M9WA 2XUWA 2PN5A 1P7BA 4XNZB 4YHPA 1P7QA 4JY6B 3JBG7 3KD4A 5DC0A 5FV1L 4LLQA 4NM4L 4GAGL 2XQBL 4X6CA 3GQFA 4OB5H 1XCTB 2YAEA 4Z7NF 4PGBB 3FQUB 5GGRA 4B6ZA 1E42A 5BCAA 4YBHA 4LVOC 1PG7W 4X4XA 1XR8A 5I23A 1CICA 4UT9A 2H9GB 3BIKA 3MR9A 4QKXB 4DF9A 3BWAA 1MJUL 4P2YA 1GZQA 1EZVY 3QB7C 4KC3B 4HYTB 3PWLA 1EFXB 1PEZA 4KTDH 3VGAB 2YA1A 2O6EA 3BDYL 1LE9A 2W59A 3N43B 4E41D 3KJ4C 2WLYA 1X7QB 4M7JL 1D9KD 4MJHA 4Y4KD 3WXWH 3WNNA 1U58A 4MAUH 3Q8EA 1H6EA 3IWUA 1HKLH 4FG4A 1NOAA 1XR9B 2UVFA 4FHKA 1KTRL 1J1XL 1FIEA 3KNBB 5B1BB 1WFIA 4U3XA 3E7JA 1PZ3A 4W6WB 1QWUA 1XFPA 1AZVA 4TPRH 1B2WH 4X98B 1FRGH 3RPKA 4Z7IA 1R5IB 4JVPA 2QLVB 3LSOB 2BS71 3AU1A 3BZ4B 5KVGL 4F91B 3SJVB 3VFPA 3DV6A 3AACA 1T0MA 4GRLA 5C0CA 2H6PB 2X1OA 3B9EA 4UV7L 4HOZA 2G5BA 3N1FC 2BP0B 3F7LA 4PUBL 1SEBA 2FUTA 3HLAB 4FNLH 1G0XA 5TJWK 5I1LB 4OIAA 4AQ8C 4Z78A 2DI9A 1AGBA 1OGTA 3ILPB 2Z0BA 5FM4A 2JJSC 1BFOA 5JW5B 1JGLH 1UWFA 2W1NA 4Y5YB 1MI5B 5ITFB 4F7MA 5JQHC 2BIPA 2HJKA 3S3PA 3MRFB 1WTLA 4MA1C 4P4KD 1BFVL 4M7KL 5HGHA 5KYNA 1RMFL 3GLEA 2W94A 4YHZH 4AE1A 1XSIA 2P48B 3AS2A 1ZGLP 5C08D 4C58B 4RGND 1P4LB 4MCMA 4NQCE 1ILUA 5CSZA 5LQBL 1X4XA 5BZDA 4OZIB 3DMMA 4N3UA 4IBVA 4MGXA 2EEXA 4ZOCA 1E8ZA 1ACYH 3WNLA 1ZHLB 5HBBA 4HLJA 3NPZB 4KVNL 2BNRA 2HKFH 1NIDA 5AVWB 4P57B 4W70A 5AB1A 2E86A 3JTSB 3L9RB 4MJIA 1U42A 4D9QD 3VFTB 2F18A 1U8NB 4CDGC 1E4XL 1YC8A 3SHSA 3I9PA 1A3ZA 1M7DA 1MCNA 3RX9A 1A14H 4L3CB 5LN4A 3GTTA 2WGNB 3ZL2A 5F97E 5HDBF 2BS9A 4L4JA 3EIFA 2OA9A 3I74A 2VDRB 2Y5EA 4FFWC 3WY2A 4PJ8B 4HG4J 1RP9A 1RK1A 1AGDB 1WA1X 4LLVA 3ZMEA 1QEXA 2VXQA 5D7IF 5T1DL 1OAQL 1GXEA 1BBJA 1FIGH 3CUPA 1QSZA 3QQ3B 4NKQB 1NL0L 2CHNA 1VFUA 4M6OH 2NNAA 2XI9A 1SZNA 3LV3B 1B4JH 2ED8A 2I9LB 3JV4B 2GFBA 5H94B 3D52A 4CW1B 5LVEA 1YPZA 5H2BB 4ELME 5DA4A 4Y5XB 1CLOL 2NUPB 5CLZA 1CQYA 1USQA 4GSQA 3PREA 1BVNT 2AJUH 2QVMA 2NY1B 1BCIA 3KYNA 5C8JA 3OPZL 1JBJA 2EYRA 3LXUX 5BZWA 2F19H 2VDMB 3O9WC 5FB8A 1ACXA 1HI6A 1E0OB 1FLRH 1B0RA 1SFHA 1REIA 4M7LL 4Y2NA 5J1TC 3MJ9A 4JFEA 1DQVA 2N1KA 2DIAA 5CU5A 1RAMA 1IAIM 4IRZH 4M5YL 1N5YH 4OCNC 1JYXA 1ZGLB 4PJIA 4Z7AA 4POZD 1OAZL 1DLHA 1PD1A 3WKYA 4DN3L 4KJQD 1Z9MA 4R5TA 3X1BA 1KGCD 5C2UB 5CN3A 1WHOA 3BGFC 3LDBC 1NM9A 1KEGL 4KZDH 4DKEH 2EO9A 5ETUB 3O6LL 3PWVB 2DQDH 3D50A 2A7BA 1D5ZB 1ZANL 1NANI 1A6AB 4QHPA 3ECQA 3H2WA 2WCGA 3TFBA 4FQCH 1JPTL 1UM4L 4WDIA 5E8DH 1GYVA 5F89A 4PCKA 4PJBF 3RDTB 5TE6H 2RJMA 1JWSA 2B5IB 5EU7C 3UTPE 5IQ9A 1ASQA 3PL6A 1RIUH 1AGCA 3QUXA 4AL8C 4CAGA 1TZIB 4F9LA 1T1ZA 1LWRA 3KCPA 5D6CB 1F11A 4Q9RH 2UV3A 4X99A 2R4RH 2ENSA 5B3JE 3ETSA 5MEOA 1FE8H 1NEZA 2X7LA 1ETZB 1DVXA 4YHIB 4ZPVB 1SDDB 1I3UA 5KVFE 1WAEA 3ISWA 1ADQH 4AGQA 5DD5L 2ZWZA 4GS7B 2AJSL 4LP8A 2FJGB 4YFEA 3QDGD 5BMFL 1U9KA 3STLA 5IFJB 1G84A 4WF7A 1OM3L 4XCEA 3SE4A 2CAKA 1TYJA 2J71A 4V1DE 3VCLB 4FFZL 4JGMA 2OK0L 3PPEA 2BCKA 1KDIA 2KPNA 4RX4A 4A2HA 4YSRA 2LLNA 4WW1A 2UWEF 1OM9A 3LCYA 4OB5L 5GZOD 5FO7B 3RA7H 1PX3A 5E8EB 2H7WA 4K5PA 1KACB 1IEAB 1ESOA 5F3HA 3IGAB 3SIKA 2F68X 4UOW1 1KCLA 1PX8A 2VGLM 4PG2A 1RURL 4R7NB 1D5XB 5DEJA 5D70H 1V05A 3ZQWA 3P0VH 1QA9A 2YQGA 2EDKA 3ETBF 3QEUB 3V9EA 3VI4F 3WG7B 4Z7OF 3EFFA 4PJ5B 2X89A 4KTDL 3WCYA 4DP5X 4JRLA 1CDHA 3H4FA 4Z7VE 2R29A 3MNVA 1G43A 1LO3H 2GJPA 3HB3D 4MAUL 4MMYA 4GEJA 2WIIA 1HKLL 1NC4D 2WLIB 2ZSVA 3BAIA 3K6IA 4XB3A 3OZKA 4HLEA 5GGSY 5F1NA 4FERA 4C56D 1CFNB 2P8PB 1U92B 5DJYA 3JWOH 1PKQE 3IFLL 4TPRL 4DFHA 4YN3A 4TQEH 4TNGA 3V0GA 1FRGL 4PRPA 4AQ1B 4DEPB 2E7MA 4LSPH 2DS4A 3PV7A 4GIAA 4BK5A 1CF8H 2XPGB 3BPLC 4QKTA 5TDNA 1SXZA 3ROLB 1FDLH 2K6WA 3BHBA 1T5XA 4PWKA 3BQVA 2VN5A 1VKXB 1PNCA 4E42A 2ROXA 1K85A 2AV1A 2WBJC 1MWOA 4DERA 1CBVH 4JM2F 4FNLL 3AQYA 1MCBA 3OJVC 5EZIH 4V33A 4HMCA 3RDJA 1A21A 5B1JC 4Q89A 2BRRL 1M05B 3ZE2B 1O5DT 3TCTA 5TQ0H 4L8CA 2DB8A 2BNQB 4JFQB 5F21B 5G4NA 5ABDE 4M8UA 1UEMA 5KSAC 3FQTB 3WHE0 3K81A 1AG6A 2QDWA 2J5LB 5CUSH 4YSEA 5HVHC 4LMQI 2PYFB 3W81A 4ACPA 1E5ZA 2BHFA 4PAZA 4KO9A 1ACYL 1WAPA 2NT0A 2O6PA 1WIOA 4O00A 4NQVB 3RWCA 5EN3A 4C59B 2DQFB 3KPSD 4PJ6A 4EBQH 2CBTA 4NNXB 4GT7A 1UH3A 3BXNB 4JMNA 4NFBA 4UQIM 1RPQA 1GY1A 2BM3A 4B9JA 4HK0B 3ULVD 3Q6FA 1NCBH 1CZ8H 3MA7B 5CD5C 1IIKA 3II2A 1E6JL 4YDNA 3VE0B 4ATWA 4D9LH 25C8H 2DH3A 2Y3NA 1CXHA 3QNXB 3SZ6A 4TTDC 4XCFH 1ND0B 1T66C 3G5XB 1JCKA 3VI3E 3DGGB 3TEZA 5MHSD 1RSFA 1DVSA 3UP6A 2DRUA 1FIGL 1YMMB 3MRRB 4Q2ZA 3FQWB 3V5KA 5FM5M 2UZXA 1NWPA 4OM1H 4DN4H 1BM3L 2A6DA 4CMMA 2F7PA 3UPRA 5H37H 3FOLB 5GS2H 4MJ5A 4PRID 4M6OL 2O26U 1KCRH 1H9DA 2WKOA 4ICXA 4PJDA 1B4JL 4WTQA 4JRXB 4A37A 4J3UA 3MGTA 3QIUD 2DEYX 4YDJA 1A6ZB 1D6EA 3DXAD 4FQJH 5KYXA 2V6HA 3HS8A 1SDAB 4X4MA 4YX2H 4JKNA 5JZ7D 3J27A 3QUZB 2AJUL 3UX9B 3FAXA 3QS2A 1X9RA 1I8LA 3LD8B 5CHNB 1DJXA 3S37H 5KVMC 3BO8A 3G08B 1LK2B 1T1WA 3P02A 3SODB 1FLRL 3ARDA 1RUPL 1HYSD 1U2CA 3FCSA 4FCHA 2BMKB 4IRZL 5ESAA 3CN4A 1N5YL 1HH6A 3E8VA 2FBOJ 3M17B 3SDAB 5E8PA 2OYMA 3OZLA 2OULB 2ERJB 4EAEA 1B3JA 3DVFA 5DUBA 5EU4B 4APQC 2O5NA 3CBRA 3CQQA 4LHJB 4B9ZA 4EI5A 4KZDL 2WWNA 4DKEL 4MTMA 1IGFL 2OBGA 5EU6D 3UYRH 1OAXH 2DQDL 2EKSA 2WXNA 3I2CH 4O51B 5CMAB 4HG4K 3B9VA 3ZDXB 4DWHA 3V0AC 1ANUA 1KGXA 3AXIA 2BCMA 3D85D 5E8DL 1CR9H 1FO0H 5TE6L 3HMWH 1H5BB 3A4AA 3CSGA 2BSRA 3EO0B 3DTXA 3HG0A 4Q9RL 4AUJA 3TEYA 2E56A 2R4RL 5D2LB 4BFEA 4DZ8A 2TRYA 5EEUA 1FE8L 1GYCA 4XNMA 3ZY7A 4J4PA 3BVVA 5MP6H 4FI6A 1ADQL 4JREB 1KJMB 2WTRB 3U1PA 3S48A 3ZTNH 4LLMB 3X17A 4KGLA 2E6PA 4HIQA 2QGBA 1FP5A 1G7PA 1JPGA 1PSKH 2IG2H 5DYOA 3RWFB 2VR9A 3SPHA 4HKZA 1BXUA 4CKQA 2XXCB 3K1KC 4KUZH 1YEKL 1R3LA 2WO4A 1L9OA 3QDMD 4JHUA 3TL5A 2XTJD 3ZYOA 4DP9X 1JK9A 1U93A 3WNMA 1OZTG 2A38A 4OZGB 2BC4B 5CCJA 3L5IA 2GI7A 4L3EE 3S5YA 1TIUA 3BYTA 3D0VB 4F8QA 3IXAA 3MU3A 3U1SL 3FRPA 1AHWA 1FAIH 1FNEA 3QUMH 2VCOA 4HWZB 3V0WH 3WEXA 1VCBC 3HNVH 4LLUB 4GUPB 4BSVB 3QDJA 4ZFGH 2HJLA 1BZQK 4ZOBA 1OCOB 5CIPB 1IGYB 4WJKB 5D70L 2O5XH 1TEYA 3P0VL 3BDBA 4LKCB 1BREA 2PO6B 4KGJA 3S37X 3V4UH 2HT4C 2YWZA 3WDHA 4KJWC 3J2PA 5D7EA 1UT9A 1DFBH 2DYPA 3DDGA 5TPWH 2DMBA 2W60B 1OE2A 4JDEB 3JTTA 1XGRA 3ZKNC 2VLKD 1CS6A 4JCMA 2NW3A 3VYNA 1ZJBA 2G2NA 1OB1A 2R9HC 3H7BA 1K4DA 3JWOL 1YYMH 1J86A 4TQEL 3P11H 4G8IA 1AQDA 3FFDB 4LSPL 4ODSL 3QG6B 1RZKH 2ADIA 1CF8L 3VJ6B 4EF3A 4HU2A 4R4ND 2B3IA 2AAAA 1L6XA 3EYUL 3IPFA 1FDLL 1S8DB 1KENL 1EAPB 5KS9A 3HR5B 4LCYA 4AIZB 5DMGD 2XYBA 3RWDA 5HDBE 1CBVL 2E6QA 2ZSWB 3MLUH 2Q2EB 3IE9A 2VIRB 5D1ZB 3BZDA 3T6VA 3T8XA 3OGCB 4OH2A 5DCCA 5HTSA 1FVDB 4KJYB 4N1EA 1ET7A 5I71C 2FR4B 4G9DA 1KB5A 3CBKB 5D7IE 3V4VB 4CJ0A 4HGWB 4WSGA 1NDTA 2ZXBA 5B38G 3HJEA 3OXSB 2N0MA 3QJFB 4M61B 1OCCB 4KH2A 3KS0J 4XH2A 4J39A 5C09D 2CPUA 2J2ZA 5CUSL 4PJXF 2I32A 3UTSE 3VU1A 4HUWA 5C0AE 1EDYA 4AOFA 4B9IA 3L4ZA 4PR5A 2WQ8A 2P52A 5DEGB 3G5ZA 4AY0A 1IC4H 4KDTA 2YRZA 2G2PA 2JJUA 3VXRB 5IHLB 4EBQL 3O6FA 3HEIB 1TZ8A 4KXAA 4PRNA 5L8JB 4P2RD 3P2BA 2IANA 4IRSA 3WUWB 4MQ7A 4OLEA 2WNWA 2XN0A 3KYOA 5FKAA 1ITCA 1IGJB 4ORGA 2X87A 1XT5A 4JVWA 1CZ8L 1VFBB 4MB1A 5CKGA 1YY9C 4A55A 4D9LL 3DO7A 25C8L 4FG0A 4GPVA 4A7GA 2GW5A 2Z8SA 1RPKA 5IVXA 3HTLX 4IBZA 2R56H 1ZKAA 5CP3A 3PLYA 1HE8A 3NJIA 4WFHE 2ZAHA 3D3VB 2X1PA 5SX5H 4MNQE 4DN4L 2XWZA 4OM1L 2VDOH 5DFAA 4WWID 3U79A 4FA7B 4LAJH 5L88H 3SCMC 3PQYE 5K33A 5BUAA 3DYOA 3VFSB 4ZFZA 4RGOH 5JO5B 1A6TA 4PJBE 4NQUA 5KJRH 3NCJH 1AHKA 1IGTB 4FQJL 5JPNA 2A9AA 1I8IA 2V33A 2WZ6A 3D39D 1CFQA 2OMUA 1YUHA 2Y69B 3TC9A 5T8IA 2R83A 4XNZC 2FQDA 3LB6D 2FL5B 3JZ7A 1TNNA 3ABMB 4PU2A 4OCLC 3KDMA 4WW2A 3S37L 4AYMC 5LG1A 4CN4A 1U4FA 1AGEA 2C4FU 1U8LB 5B21A 2ENQA 5CLXA 4E9QA 1ZIAA 3W0WE 3FJTA 3NIGF 4JUSA 5FOJA 2NXYB 3IU4L 2K78A 4Y2DD 1FLTX 4Y4HD 4EDXA 3E3QE 5H4ZA 5IJKC 5CJBA 2ALWA 5E1GA 1WZLA 5MERA 5ECGA 1HQRB 2ZF9A 3ARBD 4QLRA 3KGUA 5J89A 2VLLB 4PLNC 3A24A 2QVFB 3VGAC 4ELDA 4N8CL 3DBXB 4JFZL 4XP6H 3HFFA 4F92B 5DMKB 2CQVA 2UWEE 2X4SB 4K8RL 1UATA 3UYRL 1OAXL 3LZLA 5AAWA 5D2NA 1QR4A 4MS8D 1LD9A 5I6LA 4W93A 2O6CA 1CR9L 4XPFL 1FO0L 1V3JA 2ITEA 4D3CH 4LIQH 4PJFB 5I9QC 1F42A 1S7XB 4NCC1 2G0LA 2B59A 2EIEA 5HHQA 2M83A 2EJ1A 2JMRA 5F9DC 3VI4E 5JOPE 4Z7OE 2KZWA 3P4MB 3MUZ1 5F1SA 4PMEA 4ZUTB 4LSSH 1ZAGA 3GZOA 4MVBD 4XTRD 5ANHA 4B0MM 4BQCA 1SHMA 4CADA 5E9DB 5F9OH 5LGHL 3FSWA 3EGSB 4Q58C 1BZ9B 2LAAA 4KMQA 4M6ML 1UD8A 1MJ8H 3Q5YA 4DIXA 4G70B 4DKFH 1PSKL 4ACTA 2IG2L 4L37A 5CXPA 1ZWIA 3UTTE 4MDJA 4E9VA 4FLSA 4KUZL 1IT9H 1UB6B 3NCMA 4JFYB 2N0KA 3UCRA 3S5ZA 3IFPB 5L0QB 4KK9D 2J88H 4D8PA 4PP1C 1MVYA 2OCFD 1KTLA 1TCRB 1PYWB 5D1XD 5F0PB 3MCG1 3DUHA 2DBJA 4HQQH 5DVLA 2VLJB 4OCXH 4IU2B 2WUBH 3LKRB 1FAIL 1FORH 1OSYA 3KDPB 3QUML 4JFOB 3V0WL 1I7UB 1W6WA 3HNVL 3IDJB 5E8NB 2YD2A 2ICWJ 3ATBA 4I2XB 3RY5A 3RZWA 4JRYB 5DYFA 4Y4FA 5AFAA 2J6EL 3SBQA 4X5XA 3SY0A 5AD0B 2P46B 1T2XA 3HBGA 4FMKA 5CP7A 1I3RB 3V4UL 3RWIB 2VUKA 4OVVA 5AB2A 1DP0A 5TPWL 3F01A 1UURA 5AYTA 3NOIA 2PR4H 2Z8VC 3OJDA 4GXFA 4BFIB 1KULA 1KTDA 1CQKA 5GS3A 1BAWA 1C5BH 3KPRA 5KEZA 2JKNA 2ENPA 3QIWA 3MKKA 3FQ1A 1YYML 4PJ8C 1CURA 4N6RB 2GC7C 4QRPE 3P11L 2UXFA 1UA6H 3R1GH 1JMZA 4GINA 4X5QA 4B5EA 4GLRI 1Q0YH 1H8SA 3RYMA 5E6IA 2YC1B 3B5HA 4U4BA 3ULUC 2XG4A 4Y5XC 4O02H 2V2TB 3PNWB 1SMAA 2OSLA 3GHBH 3BKYH 3ULVF 1T03H 2YRBA 2Z64C 4ONGH 4BZ1A 2NY1C 4ENED 3U6RB 1QUNA 5IVNA 2R1YB 3MBEC 5E9AA 1FFPA 4CVUA 1V10A 3AJ7A 1QNIA 15C8H 2QKIA 5D7JD 2VERN 2VDKB 1JNHA 4FXTA 4OZHB 3I6GA 4DZBB 2F1BA 2XWEA 3AQDA 3OKOA 2FLBT 1DBKH 4XBPB 1NCJA 3MV7B 1MCEA 2IH9A 3AMLA 2QVKA 2GK0A 2APWA 4BV1A 2W91A 2ICES 4UQAA 2CGRH 3DBSA 3NFPB 3MUGB 2YPLE 5E99H 2X4NB 1DEDA 3QIBB 4G82A 5FIEA 1UTDA 3CVHH 4AJVA 2CA4A 3QJXA 2K45A 4MCYB 3EO9H 1TQVA 2MQ0A 3AZUA 4I4WA 1IC4L 4XNDA 2P5EE 4XE0A 2P26A 1MRFH 3BVUA 3JWNH 4NZFA 3HC4H 2MPAH 5BO1L 4MRCA 1JI1A 4PJGA 4DETA 3MRBB 2Y2TA 3C5ZD 3GK8H 4NZTH 3ZE1F 1UVQA 4NKMB 4AMXA 3RDTC 5BZZA 1XCQB 2B5IC 3ME0B 5CAYB 1KYFA 3RTQA 2CKBH 5I8OH 1ET8A 1JZ2A 5A7BA 1MWAA 1UJ3B 3ZTDC 3SQBA 2R56L 1Z5LA 1EEYA 1VEMA 4ZW5A 4DKDC 5GGSA 4WFED 4FYTA 2N4IA 3IS0X 3BQUB 4GS7C 3FTZA 4U1IB 5L88L 5MI0B 4RMTA 3LKNA 4L1BA 2X9XA 4FULA 4HCRH 2IDUA 4IDJH 4RGOL 1KB9J 2X38A 4WFFE 5KJRL 1KJ2A 3NCJL 1MCLA 2WV3A 1F5WA 3TIEB 3ZT7A 3PWPB 5EO9A 3TVMB 1DLFH 5DWUH 1IAOB 1GGBL 1H3VA 2H0EA 5LGJA 5SWZA 1Q90A 2XSKA 3V9FA 4AKQA 5D1QE 1YN7A 3BW9A 2AI0H 5DSCB 3IF1A 2CCLA 4XMLH 1E5AA 3CE1A 1G7LB 3QS3A 1VERA 2F61A 5LN8A 1IBZA 2VABA 4LGSB 3CDYA 4ZUWA 3WTXA 2IAMD 2PP8A 4QHKJ 3NZUA 2D03H 4HFWA 4WAFA 4EUPA 1J8RA 4NO0A 1WYJA 2QHRH 4ONFH 4OI8A 4WHTA 1RZPA 3O0RH 5MENB 4OV6F 4GG6F 2Z92A 1YN6B 1COBA 2CIIB 1URLA 1UADC 1X5ZA 2CDGB 4JMXA 4BKLB 3CXDH 4XP6L 2PPFA 3DX1A 1ZDSA 3GUTA 1RZJC 4JFDD 2BW4A 4G8GA 2F7IA 3VA2C 3QZPA 5IOPA 2VISB 3W38A 3TEXA 1SXBA 2EH7H 1WZAA 2AEPH 1VA9A 3UYOD 3CPUA 4X6FA 2QSVA 3O4LA 1THCA 4LIQL 5GRWA 3QI9B 2VZ3A 4PJEA 3IMVA 1P6FA 2CHWA 1IRAY 1EAQA 4DEPC 2DQIL 3PJLA 4AQ1C 1P7QD 5A6LA 4NBYB 4N2BA 1A8ZA 1LNUA 3F5WA 3DUUA 4XPAH 4HOXA 5LJYH 1TLKA 3ARVA 4MZ2A 5DVMA 1UOKA 4LAQL 4MCZB 5ESVA 1VACB 5F9OL 5I75B 4G8FA 2D9QB 1M7IB 3ARGB 4E9LA 5I1KH 2GABA 5C86A 3RIAF 1CICD 2QBWA 3MNWA 1MJ8L 5ANME 4IIZA 2XV3A 4DKFL 4TTGA 2Y7SA 4HSQA 2PYEA 3VD7A 4RGNE 5JA9A 3EH5B 1TZAA 5EBWB 5IV2B 1IT9L 2WAHA 1QVOA 1X5FA 1YCSA 2J88L 2OMZB 3B3IA 3QFGA 3WDJA 3O8XA 2Z6FA 2IGLA 1HXYB 1HZHH 1TENA 2XPZA 5BOZG 4HQQL 1YDPA 1FPTH 4OBRA 4OCXL 2J5LC 2WUBL 1FORL 4EI6B 1OPOA 1JWUB 5DZ9A 2TSBA 4ZSOB 4PBVC 1CFMA 2NSXA 5C0BA 1JK8A 3T1FB 4HUVB 4ATTA 4L1SA 4GFTB 2WQVA 2BINA 2E5EA 1EHXA 3MLSH 4XB8A 4O9HL 3E1ZA 5KSBF 5D5MF 2I7OA 2OMWB 2Q9OA 4TULH 1JZHA 3E6FB 4GRLD 5C0CD 5BV7B 4OZFA 4PD4J 1AD9A 4DP0X 4FD0A 3GS0A 2XBDA 5F7DA 1O7DC 4JPVH 4GJTB 1MCOH 3DX7A 4PJXE 2AXJA 3GB7B 1VIWA 4M6NH 4YSAA 3GO1H 4LGRB 3GBLA 3NK4A 2KL6A 3SD5A 4KJPC 4Z3HA 5AUMA 2KLRA 1QLFB 3QT2A 4AC2A 3RVTC 4BQ8A 1NC2A 1P84J 1P6WA 3OLIA 1UA6L 1P2CA 3C8KB 3R1GL 3QG7H 2HTKC 2ZWYA 3QP3A 1Q0YL 5ITBL 1ZA3A 4YLQT 3KL5A 5I24A 4P2OB 2WWOA 1WJ3A 3N44B 3DMMD 3C6LA 4TF4A 5E5UB 1I1RA 1P1VA 5EO0A 4GXVH 3L4YA 4LPXA 3BUTA 2BNRD 4LCCA 3HN5A 4FFVC 3EGXB 3BKYL 1T03L 3QUZC 4D0CB 3BVNA 4ONGL 3OF6A 5CJXC 3RNKB 3TZVB 1CIDA 2R7EB 5DJ0B 5IB3B 2XN2A 3LD8C 1OIOA 1GYAA 15C8L 2G5RA 5AVRB 2Z31A 4KI1A 3WIHH 2G75A 4J6RH 4B9YA 2CLRB 4HWNA 1WO2A 4X7SH 1WUNT 5IW6A 2VJXA 1DBKL 1HNFA 4GQQA 1GZHC 4OF5A 3GMQB 1WFOA 2A6JA 4JLRB 4MSWA 2CGRL 1HNGA 2PXYB 5E99L 2ERJC 2APTA 1HDMA 3MRQB 6TAAA 3GSUB 3CVHL 3K5RA 1XF2B 3EO9L 4YDIL 1E4WL 2NXZD 2VAAB 5ELIA 5DD6A 1OWWA 1MRFL 1UD3A 2MPAL 3HC4L 2HG0A 2B1HH 3PAZA 1A1NB 3CSYA 4NQDB 2WXFA 4Q6IB 4XMPH 3M7FB 2GUYA 3HZKA 4NZTL 4Z7UB 2ICEB 2HLEB 1AI1H 2X2JA 3NIGE 2FECI 4FQ2H 1FGVH 2FEEL 1H5BC 3RUGF 2P8MB 1L0PA 1BD2B 3T4YB 1QEWA 4U0RC 4WTXA 3QDGE 2CKBL 5I8OL 2YEZB 2F5BH 5EB9A 1RK7A 4P2QB 1Y7VA 1OT1A 2OS7A 3RAJH 2CUHA 4EZKA 1CDGA 4JREC 3C5SB 3B7UX 3F84A 4KNSA 4NRXA 2GCYA 4Y9FA 3L4VA 3ROOB 4FHBD 5DC4B 4HCRL 3T2LA 1VDGA 4IDJL 5FA3A 3LRSB 5JDSA 4Z7WA 3EHBB 5SWQA 3M86A 4D9RD 3SO5A 4GSXA 1DLFL 5DWUL 4XMXA 3WFHB 5KVDH 4JFFE 4H40A 4K7FA 1AXTH 2AI0L 4OLZH 3SDXF 1WV7T 4QXTB 1BVKA 4J1UB 3V0IA 3D07A 2CBOA 4XBMA 4ZD3H 2R1XB 3ZIYA 1Y6KR 4CU7A 4P9HC 3BVTA 3QNYA 1Q94B 1XGTA 5AENA 4PP2A 3REVB 1ETJA 2D03L 1QW8A 3IMSA 3PL6D 3QUXD 5F0JB 2QHRL 4ONFL 3SYPA 3L6FA 4HA1A 3NIFB 1HCFX 2BVPA 1MVFA 3MJ8B 4MB3A 4ZAKB 3G6JF 4C56E 4G5ZH 1ET5A 1HHGB 3MDJA 2Z8RA 1FV1B 4PJCF 1HXKA 4KRPD 1SNRA 3NFSL 1SOKA 1WITA 3N9GH 2XY2A 3VXUA 1ONQB 2BHYA 4ZMZA 4FJYA 5DZNA 2QTEA 4E9WA 4LLYB 5AB9A 4G6AD 4F2EA 1I1YB 2YZ1A 5F2FA 2Y1ZA 3IRCA 2EH7L 2AEPL 1BJ8A 4PRHE 4UB0L 3PUCA 3QEQB 4TNVF 1HAUA 4DK6A 2XG5A 1TCMA 3ZDZB 4IOIB 3TIDA 4R7LA 2XXMB 4RX4D 2IO5A 4F7CB 2PWHA 4IMKC 3WTSA 1FNHA 1EXGA 1KB9K 1NIAA 1YNTF 2ARWA 4Z6AT 3MLZH 5J4MA 4XPAL 4HK3N 3FN0H 4IBWA 5I18H 2YD4A 1L9RA 5C97A 5J9PB 4UT6H 4B7IA 4N2IA 4BELD 3NUKA 4KKZA 3U0PA 1KXTA 4OCWH 1BQLH 5CN1A 4RSVA 4U2YA 1J88A 5D1ZC 3CH8A 2NMSA 4BCZA 3LJ3A 3O41A 2X89D 3FCUB 1UH2A 4LF3B 2WQRA 1KIRB 2CGZA 4FLRA 1P9MA 3IU3A 2EVHA 4KRMB 1F4YH 1FBIH 4ZUUB 1QBLL 1U8PB 1HZHL 1Y1DA 3L95B 4KKLC 5ID0A 1FPTL 4NC1E 3DECA 1U6AH 1VZHA 1X7SA 4HIIA 1QOKA 2NZ1A 4FXLA 5AAMC 3HUJB 3BEVB 4PRPD 3ULVE 4PTTA 3L3KA 4WI9A 3WIIH 4RZCB 1KF9B 1G6RB 2YFNA 3MLSL 4QHLA 4ELKA 4N9GA 3WAJA 4N1HB 1TFPA 1A4JB 5I5IA 4XNQA 3MRPA 4I5BB 4TULL 4AUUA 3IVKB 3F64A 4AC4A 2OCCB 3BESR 2JKTM 4K9EC 1I3GH 4MD4B 4JO2H 5MHSE 4DKTA 3QA3B 1TOXA 1C7SA 2D8KA 4JPVL 1FI8C 1MCOL 5FHBH 2NY0B 2VKXA 4AUYA 2F0CA 3VACA 3FTWA 3P40A 3U9PH 5A1AA 4IEFB 3BAEH 3OAZH 1FNLA 4H5SB 1CDIA 3GO1L 2J1YA 5D1ZI 3R19A 3BN3B 3DXAE 3Q2CA 3B7TA 5HJ3B 3WFCH 4ECNA 3F12A 3EKCA 2IWEA 4GP5B 1T6VN 1XEUA 4HBCH 5C0FB 2E27H 3BIKB 3D09A 4YSTA 3K6NA 1LE5A 3DWTA 2DEXX 2W65A 3QG7L 4Y16B 4ICWA 3NZSA 2E47A 5I1JH 4PG9B 3VXNA 5KBDA 2X2YA 5ISZB 2FJHB 3ZE1E 2QQQA 1XF1A 3BPCA 3E6HB 4N2HA 4Y0GA 1OQXA 3DROA 1BVOA 4F9PA 4N5UA 4GXVL 2H2PC 2DM4A 1DEEA 2C4FT 4GUQA 1KTJA 1RZQA 2X4QA 1J1PH 5BS0B 1NANH 5E00B 2GT9A 3VH8A 4QYAA 3BH9A 4ZMTA 3B56A 4GO9A 1Q1JH 1E9PB 3WIHL 4OLVH 4J6RL 4X7SL 4CSTA 4RA3A 2JJVA 2H1PH 1FH2A 1RUKL 5EU6E 2NXYC 1UD4A 5FW8A 4FADA 3P4OA 4PFEA 5C3TA 3MGAA 3OMIB 4A6YH 3DK2A 2R8SH 1F6LL 2B15A 1Y18A 3BP4B 3EW3B 4KK8C 4U6YA 3OR6A 1F18A 4R3SA 4FTVA 3MFGB 4Z95H 5DD3H 2RB8A 5TDOB 2B1HL 3MCKB 2PTTB 2Q3ZA 5AQ0A 4XMPL 1BFOB 5IT2H 3BT0A 1N6QH 4P46A 5FUOH 3UMTA 1P84K 1EPFA 1ZY9A 2AMGA 1AI1L 4FQ2L 1Q72H 1J0YA 2VO8A 5DFTA 1IM3B 1FGVL 2X6BA 35C8H 3WSQH 3G5YA 4XAKD 4ZW7A 4JJ5A 5AG8A 1ZVSA 4CVZA 4GG6E 1E7VA 3ARWA 3D2UA 4YR6A 4MCNA 1PVHA 1T21A 2EIBA 2DQGH 2F5BL 2GAZB 1T6BX 4N0CD 3ARDD 3TA3A 3RAJL 4X8JB 2ZX7A 3GKWH 2XTJE 4GAAA 4QJ3B 1MAMH 1T83C 4JO1H 3AT8A 3VH8G 4H44C 4AL8H 5T1LA 5EUOB 2PW2B 2J8UB 2BVOB 3UYPB 5ESQA 1IEBA 4LPVA 3U9UB 5DJCA 4MNGB 1DJIA 4EI5D 1IBHA 2OFQA 4MMZA 1T4KB 5KVDL 5D7SH 1S3RA 1AXTL 4OLZL 1F4HA 5TH2B 1NUGA 1JDDA 43C9A 4OVUA 3QO0A 4U05A 4LEOA 4AEFA 1VFOA 3F7PC 4GRMB 4BRJA 1F4XH 4X6CF 4N24A 1ORSA 4HLZG 4UUJA 2Q86B 4YBQD 3D48R 4N8VA 2UXGA 1J9RA 4IRJA 4H1LH 4Z7QB 1MUJA 2W0KA 3O0LA 4FFYA 3S4SA 3BGMB 1TTAA 1WQVT 3QORB 2YPKA 1IBFA 3VDAA 1WZ1H 1YY8A 5E6RB 5T1KA 1MCHA 1F86A 2Q7YB 1MY7A 4G5ZL 1MCWW 1MQKH 4J4PD 4P3WA 5KTEH 1CFSA 4FQHA 3N9GL 5ICZB 2EXWD 2BZCA 1IO4C 3C08L 4Z0BH 5CBAA 3TV3L 2GEQA 3DPBA 1NCCL 1FNSH 5KSUA 3QFJA 5EU7E 5T1JA 2WSDA 3FSZA 1B0RB 2HX9A 3V0VA 4KROB 5GS1B 4JFEB 5K1VA 4QO1A 3TJHD 5KSBE 5I76B 4Q4IA 5D5ME 3O6MH 2QT6A 3HMXH 3MLZL 5CGTA 1TJIH 3KS0H 5G4MA 3JV6A 5EF0A 3FN0L 4ABVA 5I18L 1FL3A 2YXVA 1H3WM 3GJFB 4PWGA 1AO7A 1S7UA 1ZJAA 5C0IB 4ZUVA 2GK2A 3CFUA 2F53E 1K5NA 3PWNA 3QDJD 4HKJB 4UT6L 5GRYA 5LAXA 3TYGH 2V3DA 1XO8A 3EF4A 4P23A 1S7QA 4HUMB 4W9CC 1JG9A 1WC7A 3RWEA 5LDUA 4LCWB 3WS3A 4OM0H 4IMLB 1ZHKA 4KNUA 3BRGC 5H4YA 1IM9B 3N43F 2A83B 4GKOA 1FNFA 4JB9H 4ZT1A 1AP2B 4M9PA 4XX1E 5TGBA 3CFBB 5IQ9B 2DYPD 2V9TA 3LPPA 4TRPH 1F4YL 1A5FL 1MQ8A 3IETA 4LBEB 3NCCB 4D0BB 2XV2A 1RZ8A 1SVBA 4UBDD 1JTOA 4R90H 2C3VA 5MEOB 2V3FA 4PLKD 1U6AL 3RVXC 5B8CA 2BH0A 4P2RE 1W8NA 3I3BA 4DESA 2XA3A 3FTGA 4H2CA 3QIBC 4WO4A 1LO4H 3GKZA 2H32A 1A1MB 2HG5B 4RMRA 5F88B 1DCEA 2NW2A 1QSEA 2D3LA 4G42B 1A0QH 5M95B 3A22A 4AM0Q 2VMEA 3VMPA 3IK2A 3VSVA 2BFVH 3LY6A 5JW4N 3RWJA 1L9QA 1HHJB 1GC1C 1I3GL 5K9JH 1FC1A 4JO2L 2XVKA 4FNUA 4LMQE 2RACA 4QRUB 1HFUA 3WXVH 4R7VA 5I1EL 5FLVA 3NEOA 2WZ5A 2C4XA 4MZRA 5FHBL 5LCVH 2PO6D 1O5PA 1IV8A 2O30A 4LOEA 1WT5A 3K2UH 3U9PL 4X7TA 4E9XA 3BAEL 1OTSD 4YIQA 2DQEH 1M6UA 4ZK8A 4BZ2L 1M2VA 1UJ3C 1J18A 5F3HB 1RZIB 5I1HH 5DMGC 3WFCL 3GIVB 3ZZQA 1PF3A 4ZTOH 4HJ0C 1KDJA 4HIHA 3D39E 3SDDB 3GMMB 4HBCL 2E27L 3QZOA 3BQUC 1JZFA 3MLWH 2XA8H 1L6ZA 5I1JL 5MI0C 4OD2A 5HHOB 2H47C 4XWOD 2FNBA 1YEDA 3GSOA 4P5TA 1A6VH 4OZIF 3GM8A 3G7TA 3RUGE 3T6QC 1YEGH 2UY7B 2XN9B 3TVMC 4AITA 4N2EA 4HSAC 4L4VB 4OZ4B 1PCXA 6FABH 3PP3H 2Y6TE 1J1PL 1S7TA 3R7QA 4W9EC 4FXGA 3MTRA 3HC2A 2R2BB 1UA3A 4AQAB 3BZFA 2BX5A 2IAND 2N1TE 1Q1JL 3HI1A 3KW7A 3O2WL 4IRSD 4KXDA 5F7NC 2JF1A 4OLVL 3DGDA 2DEWX 4JDTH 4WZ9A 1BF8A 1Z9SA 3QXDA 4AYDC 2H1PL 4RMUA 4X5LA 2P24B 3V5HB 1D2PA 2VNCA 2VR5A 3KLSA 1Q9WA 4JG5A 4B27A 3C8HA 4XC1H 3D18B 5E2WH 1MNUH 2R8SL 4NC2B 5AG9A 5JHMA 3SDXE 4LOFA 3OQ3B 2BFGA 2WSPA 3GXMA 5T3ZD 1P5UB 3OAYH 4L48A 3JVGA 2FZ3B 1QLRA 5DD3L 2F74A 2IDFA 3AW5A 3HR6A 5IT2L 3T4YA 4HD5A 1OGPA 1N6QL 4NQCA 4W6YB 3ULUF 2OSWA 3MFFA 1Q72L 4ZXBA 4I1NB 1H15A 35C8L 2N56A 3WSQL 3QI9C 2D3NA 4HJJH 1VGEH 2VQ1B 5DVNA 2O5ZH 5F9JA 1N70A 1OHQA 5JQ6H 3G6JE 2LR4A 2EKJA 3GSNH 3GZQA 4LASH 5IKCB 2DQGL 4PJCE 4NQSA 5I6MA 1F4AA 1JZDC 4KRNA 3QNZA 4WU7A 5DRNA 5LB1A 4J3OG 2DQMA 4DGUA 5I75C 4NQXB 1RZFH 5KAQF 4IBUA 4P5MB 3TH2T 3ARGC 4ZS6D 1TG8A 4HV8A 5GGQH 1NEPA 3WEBA 1MAML 4BD4A 4JO1L 1FJ1A 3RL2B 1SXCA 3IGKA 3MO1A 1CI3M 4UQ3A 5D1XE 4AL8L 3VB8A 2CKNA 3VWJB 2ZWNA 4K3GA 5K39B 1N5AA 1W72H 2BIQA 4MX7A 2QGDA 4YSDA 1IL1A 1ZLWK 2ARJQ 4S0HA 2PP9A 3ELQA 1F02I 5D7SL 5EC1B 2AEOA 3FZUD 4WI7A 5F71A 1E3FA 4Y4HC 1DUZB 2Q6WA 3LRGA 1T89C 5ENWA 5DK2B 3U82B 3KWUA 5F3BA 3ALPA 4LVEA 1FYTA 3ARBC 3NZ8B 5AZUA 1KIQB 5D71H 5DVKA 3UJTH 1V54B 1XMWA 1F4XL 1PZ5A 4YXKH 3IBOA 1NSNH 1OSZB 3EH3B 3V8CA 1E9QB 3U6XS 3ZPDA 1HESA 3SGDI 5FX3A 5G55A 1MFNA 1WZ1L 4MBRA 3CHXA 3H55A 3HHMA 3UTOA 5JMOC 4UOQA 2WXHA 5BW7C 1S7RB 2A9DA 3KPPA 1MQKL 4HHWA 2Z1PA 3V55A 5KTEL 1GAFH 3T3PF 3T2PA 2GIYA 4PY7A 2R4SH 1YSOA 5FYJD 4Z0BL 5IBTH 5L4FA 3QR1A 2ADGA 2AERT 4GNKB 5HYJD 5LBSH 1JE6A 1BFTA 4AQOA 1FNSL 2ITCA 3P54A 1BIHA 4G43B 1FC2D 1FZJA 3GS4A 4U1MB 2H8PB 1TZHA 1AR2A 1MREH 2CG9X 4XTRC 4Y1AB 3VX1A 1XIWA 3BKMH 2H0FA 2Q0ZX 3F83A 1S6NA 4YSCA 4IHBA 4M43H 4NO5B 5E1AA 3N0PB 4I0PB 4I85A 3WNJA 5F70A 3O6ML 3QCTH 3HMXL 4E5XA 3B1TA 3IAQA 1QHQA 1TJIL 2WTPA 5CINH 4JHBA 5D4IA 1R17A 4KI5C 3DHPA 5KUMA 1GY2A 2NTFB 4U1HA 5KYYA 1X9LA 4P2OC 2IDCA 2W88A 5DS8B 4K3DH 3TYGL 2WNXA 3ZTJH 3QYNA 4QI3A 4MA3A 4Y4FD 4G7QB 2VITA 4QOKB 4X6BB 1G4MA 2X40A 2GJZB 4OM0L 1WE5A 5FO9B 3NSDA 4GG8A 4NS0A 3VRJB 4JFSA 1L0QA 3LKOB 4JB9L 1AXIB 4QHNA 2VZUA 1Z3GH 4PJHA 4R7DA 5HYQB 4TRPL 1ODAA 1SRDA 4F15B 4N6QA 1YJDC 3E0GA 2WM0A 3ATEA 4PPTA 1IZKA 1A6UH 4MKMA 5EOCJ 4R90L 5JHDB 3MRKB 5DF0A 1I7RA 3KPRD 4IRZA 4KO6A 1NGXB 3KH4A 1NIEA 3D8MA 2GTWA 4LDLB 3QIWD 3ILDA 4AT6B 3O6KH 2PXYC 4V1DA 4F8LA 5JPMB 1LO4L 5D7HA 4HKXB 3I75B 1HHIA 4KOBA 1UZ6F 4CVXB 2XBZA 3BFQG 3HS0A 4BSWA 2BSTB 1OF0A 1U8OB 1A0QL 1HL9A 1ID5I 3DX0A 3IDIB 4O2EB 3LIUA 4PBXA 3QEGH 1E5CA 4RAUA 4AM0A 3EYFA 5E6ID 3MGOA 4Q6IC 3L7EB 3QRGH 1ZSDB 2ICEC 3C8DA 3GWJA 4N20A 3WXVL 4B41A 4M8VA 3WUZA 1NBZA 1WD8A 5LCVL 4E5XG 5E1IA 5J6HA 3INOA 5FYLH 1IKNA 4A04A 2DQEL 1JGUH 4NDMA 1PLBA 1VJSA 4R5XA 1DSFL 1S9VA 1XBRA 1U91B 3AY2A 4PRDB 5GXBB 4FNQA 5I1HL 4L5FH 1AD0A 1K2DB 4M3JA 4Z7VA 4JN2B 5GSVA 4ZTOL 3BKCH 4UQDA 5B38B 4NO2A 4BEIA 4JZOA 4LQ1A 3H7LA 1Z3RA 5TDPB 1ADQA 4ANKA 3MLWL 2J1ZA 2XA8L 1UCTA 3RY6C 1NMCB 5GGTH 3WV0A 2F54B 1JNNH 2CRYA 3KM1A 1ZLVK 3OX8B 4DP8X 1A6VL 1FZMB 2X4PA 3EHBC 3LEXA 5D7JC 1PKQA 2FIKA 3SE3A 3PAUA 5LGKA 3PCYA 3V7AE 6FABL 3TT1H 1O7VA 5FO8A 1I1AB 2GEEA 2D7MA 3E2HB 4XN1A 1MLBB 2DWXA 1HCYA 1XF3B 3PHQA 1AKJB 3O3DA 1KT2A 4JO4L 4UDUA 4HK3J 4L29B 5F7YC 1XSOA 4Y7MA 4KKPA 3QCVH 4G8IB 5DDHB 3ES6B 1BZEA 3H3BC 5HGDB 4M1DH 5FA4A 5CJ8A 4HH9B 1M6OB 4JFDE 4JQIH 1EV2E 2D2CC 1A64A 3RTQD 1DE4A 1J8SA 3ECBA 3L3DB 3RNQB 3S3CB 4XC1L 3ZGHA 2YARA 5AW9B 3FUKA 5FYLE 4ZAKC 4BWWA 2WAQA 3DK0A 1K4CA 3TP4A 1E65A 3GJEA 3HS9A 5IK3A 1CD0A 3QPXH 1CLCA 2A99A 3NAAL 4R97B 3WI9A 3C09B 1A22B 1VFMA 5DEZA 1G7MA 1OF2A 4FTDA 3W11D 2B8OT 2UXTA 4X6CE 4WU5A 4G9FA 2IPKB 1PLGH 3UCQA 1JZ4A 3VDBA 1HS6A 2NY4D 3KBHE 2P5WB 3F3HA 3LPFA 3QXAB 5SWZD 1LVEA 1QASA 2WQSA 5JQ6L 3GSNL 4FXKC 1ZT4B 1DBML 4O2FB 3RFZA 1UWXK 3B9KB 3WTYA 5K9KB 4M1CC 2F08A 4HPHA 4GI8A 2Y24A 1UWEH 5FYKH 1JF1B 3TEWA 1RZFL 3EDEA 5CNHA 2WXQA 3T0AA 1GSKA 3LIZA 5GGQL 2WSKA 5SWSE 3S3JA 4NO0D 4HS6A 2DM3A 3CFJA 3VXMB 4WQOA 4LSRH 3KPMB 4ZQKB 1TZGH 1C12B 1W72L 5HPOA 3VI3A 1OXYA 1NPJA 1CG9B 2ZG3A 1KOAA 2QEJA 3ENEA 1AY1H 3CNKA 2W80C 4U1JB 5G4OA 4G8GD 3Q0HA 3BAYA 4BFJA 3BISA 5T5NG 3ZDXF 2YR3A 2MEJB 4AYEC 4GAJH 3F7YA 5BVJB 4P5SA 1CT8B 2ENYA 3OKEB 4Z5RB 3QO1B 5D71L 2YPVA 3UJTL 4YXKL 2EDXA 2VL5B 5C0CE 4XXCC 1R0AH 3O4LD 1S9YA 1NSNL 2XFGB 4NUJA 1EHKB 4UTBA 3Q6GH 1S7SA 1Y0LB 5EH1A 1PEWA 4I9WD 4GLRH 4YHLH 4JGNA 1BQHB 5D2LF 3K2IA 4P48A 2EZ0D 4JAMA 2Q20A 3CFDB 3SKOB 1MNNA 2DJMA 3SZKC 3IMRA 4ZJ9A 2DOCA 4HCGA 4EE2A 1GAFL 3PGCB 3PJNA 3Q3GB 2R4SL 1YUHB 3CJJA 3PHOB 5FYKE 1DJWA 5IBTL 4BH7B 2NY0C 4S1DD 4WW2B 3ZIMA 3UACA 2W95A 2PYED 4DPCX 2CK0H 3DHUA 1ED3B 1MREL 4HS8H 4Y8AA 3DA0A 3HHSA 2R2HA 4K7PX 4X5PA 3QQNA 3BKML 2CO6A 3GXTA 4WI5A 5HYSG 3SJVE 3LNDA 2X9WA 4M43L 1MCWM 43CAB 5GS0C 4NPJA 2JCWA 4OZGF 3QCTL 3O8XD 1LO0H 1ZS2A 4HALA 5CINL 5DJDB 4Y16C 4EN3B 1LO5B 5H37A 2X5PA 2Z0UA 3DC0A 1Q4NX 1E8XA 4BKTC 3DOHA 3UGEA 2VDRH 3KH3A 4K3DL 5A16B 5C0BD 2GBUA 5EF1A 1T5WB 5KS9F 3VX0A 1DYZA 4Z77A 1YYCA 4YFDB 2CO2A 3V7MA 1MI5E 1XGQA 4W4OC 4F1SA 4L8DB 1FO0B 2XWJB 1MAJA 2IDQA 12E8H 3ZRSA 1AC6A 2GSGB 1XQ4A 1Z3GL 5LNDA 1KELL 4NKOA 1FNGB 4Y19D 2ZOWA 2NX5B 2K3TA 3ULUH 1A6UL 3VXPB 5D4JA 2J1WA 4M93B 4PWHA 3AY4C 4XPHH 2Q3AA 4B9GA 2YUXA 3O6KL 1PFOA 4TUOB 3OQRA 4WUUB 4K07A 4LU5H 2EVFA 5IB5B 1H3GA 1NC2D 2VDMH 3C60B 3IGFA 2WYZA 2VXUH 2X4TB 4WHYH 3L9YA 3WGVB 3EJYD 2XICA 3A21A 2ITDA 1QPXA 4L3EA 3IMBA 3HRPA 3QEGL 2X05A 3TO4A 2BIIA 3JTBA 1CDUA 2NUTB 3TNMA 4KKCC 3QRGL 1AYOA 3C6LD 5BRQA 4N0FA 1N7MH 5LNEA 3CPLA 3H6JA 2DWYA 4FEIA 1VB9A 4QEGA 1EDQA 2FATH 4Z0XA 3VD1A 3KPLA 3PV6B 5FYLL 1S7VB 5DJAB 1JGUL 3NN8A 3BD3A 4UCFA 3CVIH 5IG7A 3WELA 4NSKB 3CIAA 4D9RE 4L5FL 1PY4A 4ZTPL 2Z31D 3BKCL 3VFOA 1BYOA 3DETC 4HIEB 2VE6B 1VESA 4YL9A 1P7KA 1R3JB 4RA0C 4JL1A 5GGTL 4PTUA 1JNNL 2DMKA 3ULUE 5CP7B 1HILB 1EGJH 1OE3A 5BRZA 5DK0A 3QYMA 4MRBA 4FQIH 2GITA 3ARFB 5F1IB 2JH2A 3KPNB 2IPUK 4MZ3A 1IQDA 1I31A 3TT1L 3VSUA 3CC5A 3LEVH 5HHVH 2QMJA 1YECL 4ZMLA 3P9LB 3U7YL 1H3TA 1IC5H 3CHRA 5HXMA 1INEH 3F6LA 3DJZA 2YFOA 1SN2A 1MKFA 32C2A 3QUMA 4HWUA 4M1DL 5D8JH 1AQKL 3RRQA 3QJUB 4JQIL 1TFHA 3U4BH 3W9EB 2DQJH 1II4E 3QORC 3LXBA 4GT0A 3VVVA 1I9RH 4F2MB 3U48A 2KLTA 2WQWA 3OKYA 3W3BA 3W56A 5D7IA 4PWIA 2EXYD 4URKA 4MDIB 4WV1B 4MS6A 5FOBB 3IPEA 4AV5A 3K3QA 4ISVA 4XXDA 4DCQA 4X9GA 3QPXL 4N25A 4DK5A 4OF6A 2Z91B 5IF0A 1NTDA 4OFPA 3K6DA 2AXFA 5BO0D 1UACH 3LMJH 4X8GA 4BGLA 2JQMA 2GJ6B 5EZPA 1FG9C 4GXUN 2IQAA 3L4WA 1PLGL 3UTSA 1FVCA 2HKHH 5LNGA 3CTTA 5C0AA 3QWOB 4KMLB 4KROC 3HRZB 1E4XI 1CUOA 5GS1C 4AXWA 3RX7A 1ITBB 3DLQR 1PFCA 1RZJH 3L2NA 1INQB 4BDVB 3LPWA 4Y2OB 5F6IB 3VFRB 3L16A 3AB0B 3T3PE 5CBEA 4AQZA 3HPLB 2Z65C 1DSWA 1I7TB 5BQ7A 1UWEL 4ODXB 5FYKL 2AJVH 2LHAA 2QR0A 2HLAA 4HGKC 3DVNA 4I4WB 4IOFD 3UZEA 1S9XA 1HHKB 1W0YT 3W2DH 3FB5B 4QWWD 3L8QA 4ALAC 1V7NH 1K8DB 3HE7A 1JZJA 1TZGL 1XF5A 2WO2B 4JKMA 4M3HA 1BIIB 4R8WH 4JM4H 1K8IA 1TQCB 3VXUD 1AY1L 1KFGA 3K7UA 4KZEH 3QUXC 4GO6B 4FYSA 4MNQA 1GTNA 1KUMA 4JE4B 4F9LC 1YQVL 1RIVH 3PQYA 5J11B 2LU3A 2VLRB 4GAJL 4XVUD 4PJBA 2C7UB 3RIFK 5CEZD 2ORBH 4HSCX 4LHUA 1CD1A 3FB7A 3N42F 1R0AL 4IU3A 4L4TB 5CCGE 2WKGA 2XWBB 3Q6GL 3CFTA 1K3ZA 1I1FB 4YHLL 3SKNB 3DURB 1NINA 5CJQL 5J0BA 3EOAA 1Q1PA 2XWXA 3BE1H 3UMNA 4KNQA 4IGBA 4DUVA 3VXSB 1T0PB 3A5VA 1IGMH 2P80A 5LXGH 3I50L 3NCXA 1FFNB 4NUGH 1BX2A 3IKKA 4LT7A 3MRDB 9PCYA 1CWVA 3MRNA 4PJAA 3M6DA 1BQSA 5DO8A 5ICUA 1NQBA 2CK0L 3KHQA 1R34A 4HS8L 4HKBA 4ANWA 2WXGA 1SFDA 5EIVA 2VTFA 5CSBA 3UAJA 4I48A 1B6UA 1UZ6E 2IV8A 1Q9OA 2D31B 4KHTH 2H4EA 4QY8A 2C1PB 2BP5M 2WTOA 5GGUA 1FN4B 3TWYA 1D7DA 1RH8A 3SDDC 4XNBA 1LO0L 4AENB 1DVFA 4BXSV 4OJYA 4K5OA 1OE1A 3PWJA 3NCBB 3LNFA 1MH5A 4L2YA 2ZX9A 2JFCA 3SGKC 2APBA 1TVDA 2TRHA 2VDRL 2ATPA 4U3HA 2DM7A 1XZ0A 2JCCF 3TYFA 3T4AA 1CGYA 2OL3B 4I77H 4BGDA 2ZCKH 3VI4A 4AZUA 5ACZB 1NGPH 5DRWA 2HX7A 1JGEA 3US0A 4X9FA 1BLNB 1RKRA 1T0NB 12E8L 4DVRL 2AQPA 4F5CE 2K1MA 5I0YA 5KVEE 2UZIH 1TITA 3IB4A 1R5VA 3L45A 1DJSA 3KVPA 2C26A 3AU0A 5FGCB 3U2SB 1DFXA 4IIQA 1Q9KB 5D72H 1HL5A 3ZHKA 2X6CA 1U8QB 1OSEA 3FT3A 4HDIA 4X9BA 1LEGA 3H6AA 3VM5A 4PYGA 1R24A 3CZGA 4QTHB 4XPHL 4NP9A 3S36X 3UTTA 5DHYA 2A73B 1HYRC 4EPSA 3SB3A 1M57B 4LU5L 1NBYB 3OKKB 4JHWH 1RLBA 4U6XA 1R19A 1E9OB 2VXUL 3C6EA 1P5UC 5ERWA 3S96B 2MCMA 4M8QB 3GBMH 4X5WB 3KEHA 2VDLB 1N7ML 4JM2A 3TBTB 1QLEB 3TGXA 3MAWA 2JVUA 3A23A 1VGKB 3CFKB 2AQ1A 3L3JA 4NGHH 5EIIA 2PTVA 3LN5A 1UC6A 3L3HA 4XNXH 5FW7A 4AKOA 2J8HA 3WNPA 3MRGA 1PZ2A 3CVIL 2IOIA 1YMME 3GEWB 2Z4TA 4LLWA 3DJ9A 2E46A 3WHXB 4LVNB 4OZHF 5EEYA 2Z4QA 4K5MA 3L1EA 1YAIA 4JRXE 2HUHA 4F2FA 2XHNA 3GPSA 4Q9BA 5IROA 4AK2A 2PW1B 1PDKA 1A9VA 2YBGA 3M8OH 3OKMB 4M5ZH 4ZDHB 3UIZA 5AW6B 1EGJL 3VWJC 1W0VB 1W16A 3ISRA 1AIFA 1W9XA 4JFWA 3APDA 4QRPA 5ISZD 1EBAA 3TBVB 5KYUA 2EC9T 3LEVL 5HHVL 3FN3A 3FC8A 4QRTB 4ZMPA 4PN6A 4HBQA 4P46D 2LT9A 1IC5L 2NYYC 2K4AA 1U8CA 3OKNA 1IQWL 2XIDA 3GINA 4MHHI 4ZMNA 1INEL 1IBGH 3QQ9D 2B2XH 5DK3A 5D8JL 1XD0A 4N2NA 3AREA 3T09A 2Q76A 5I0ZA 1A7RH 4AQEB 2DMHA 3D2UD 4PRAB 4L18A 2ITFA 1INDH 2DQJL 1MN4A 2RBLA 4JGJA 2JXMB 3N2JA 2DWEA 3ARYA 3QZWB 2LVCA 3AT9A 3GSVA 3RHWK 3BAKA 4EI0A 5IB2B 2YIHA 5DRXA 3TA3D 4AW4A 1BVLB 1JPSH 3RY4A 3ZDXE 5DD1H 4F37K 1UACL 4W9KC 3Q9PA 1XGPA 5B7MA 1PZSA 2FTAA 3T65B 1OB0A 1DQLH 5T5FH 4X50A 4TLTA 1X4YA 2QSCH 5CIPH 4RGMB 5D4QA 2HKHL 3MROA 3VGBA 1QSFA 1W80A 1MHHA 2YPLA 1ZLVH 1TSHA 4XMZA 5IHWA 3E9TA 3CVCA 4NOBA 1JD7A 1T7YA 5D2LE 3X1GA 4MNHA 4PGDB 4I0PC 1I85A 1U2YA 1KBWA 1RZJL 2XQYG 5E2TL 4F7TB 2FLMA 1GGTA 2QADB 3GHEH 1SOQA 5DHEA 1H0DA 4WEUD 2I5YH 4PCTA 4I7ZC 4ODWB 4HETA 5CD3A 5EBMA 4PB0H 5C9KA 3ZKMC 4N0UB 3ZQXA 2AJVL 3IDMA 1VENA 4IRJD 3W2DL 1QRNA 4O02A 3ET9F 3MV8B 5A7EA 5T1KD 5BXFB 4YUEH 1MHPH 1QO3A 3S36L 4U6TA 3SKMA 2F1AA 4XC3H 4X8CA 1BAFH 4R8WL 3CDZB 1JZEA 1B3IA 3P69A 2MQ3A 4JM4L 4OZGE 3RX8A 5I2IA 2V2WA 2V5YA 3C2SA 1UB5A 2E7CA 1EUTA 1G5AA 1TMCB 3A47A 4KZEL 5FUZL 3KLLA 4F15C 2CSPA 3NSYA 1RIVL 1MCPH 2X42A 4B5ZA 3QFJD 2IFFH 3M1OA 3P9MB 1QQDA 1W91A 2VMCA 1QHOA 2ORBL 1LMIA 3GSQB 5KS9E 2IGFH 3NA9H 3NSCA 1OHZA 3PGDB 1U8IB 5CGMA 2EXWC 2ZAGA 4M48H 2ZOTA 5JPMC 5D1QA 3KYKL 3V4VH 4G6MH 1NEUA 2YQ2A 1F97A 4Z18A 3CVHA 2JQZA 2HMID 4I3GA 2A77H 5DFVC 4TS6A 3BE1L 3DIFA 3MLTA 4XN8A 1RIHH 1JGIA 2MTAA 4FQQA 4BFKA 2HTLD 1QD0A 5JW3H 2HJFB 1ZV9A 1KG0B 2CHDA 1WFJA 5LXGL 5F72S 4DVBA 4W9ZA 4Y4KA 4P23D 5B1KA 4AMKH 4U4IA 2EDHA 3RB5A 3O3BA 5DJXB 3CFNA 1YYLH 3GTVA 4XAWH 4A7QA 3IDUA 2NY3B 1T20A 2CKBA 2I24N 2UZYA 4KHTL 3TH4T 1UWGH 3UTQB 5EF3A 4N5ED 4K9EH 3G6AB 4BH8A 2X0WA 3QC6X 1F4WH 2BSSA 4X6DB 3IYLW 4YGVB 2AJ3B 2WVSA 3G5VB 3UBXG 3SEPA 1NMCC 3VRIB 5CILH 3TBSA 5C0RH 4GBXA 4H13C 2OYPA 3IFOB 4HZ1A 1ZPLA 1QFWI 4HCRA 5FK9A 2G9HA 3K46A 1JZ7A 4PV9B 4WO4D 1MVUA 2WOBA 4QRRD 2ZCKL 4G1EB 2MQCA 1TTUA 1QSED 1I1AC 4A2DA 1NGPL 4UBDC 2Z93A 3E2HC 1M2OA 2HCZX 4N2GA 4XPBH 5A2FA 1NKOA 3NJGA 3QQ4B 4JDVB 4CDHA 2UZIL 2V5TA 2FECL 2QSQA 3ZSSA 4H25B 3SGEI 2EH8H 1MF2H 2ZCLH 5D72L 1VRSA 5DJ8A 3S35X 3ARRA 2I9TB 1HWHB 2OX5B 2AJZB 3EDDA 4EMZA 1OP4A 1VAHA 2C7FA 5E08H 2ZNWA 2H3XC 4WY7H 2Z7YA 4WWKB 5K9QG 2EYTA 2HFTA 4M03A 5A3ID 1QI5A 4P9MH 1LP9B 3BN9D 1QRKA 4JHWL 4XO5A 1YAZA 2FWOB 5T1MA 4YHNA 1SJXA 5IIEB 1B6DA 5L2KB 4R97C 1JPFA 4XVTH 3RVVC 2IFGA 1X9QA 3NPSB 3H0TB 4HFUH 3Q7JA 3C09C 2Q7NA 4ZFFA 4PY8J 2Y5TA 3MV9B 3ZR5A 4P5TD 3N44F 3GBML 3O11A 3UPAA 5C2BH 3PFUA 3F2LA 1I7ZB 2R15A 2HT3C 4LSDA 5J5EA 1QG3A 3ECUA 2EYSA 4Y1SA 4NGHL 3DSNB 4G3YH 3OV6A 5MEPB 5JHBA 2XWCA 4EZMA 2H3NB 3D4YA 1KXVC 4XNXL 4PJ9A 3ZKQD 5GZNA 4XWOC 3D3VE 3W39B 3B9KC 5DHVB 2P7TB 2HRGA 4FMVA 2IADA 3AXLB 3CH1A 5DU7A 4F8PA 4PS4H 1WBYB 5F3FA 4OV5A 3QXVA 5AW1B 2NT1A 4ONOA 5CGYD 4Z3EA 3EBHA 1YA5A 3HE6B 4TL5A 4MA8H 3TBYB 3HZYA 4NZ8A 4R0LB 3CX5J 3V4PB 2ATKA 1DUYA 4M5ZL 5DQJB 1OANA 4GMTH 1UFGA 2FAUA 3O6FC 1SPDA 4ZMAT 4B60A 3W5NA 1KV3A 1WFUA 3HVDA 1B4TA 4BFGA 3RGVB 4M4RA 1PZBA 1ZVHA 4FOMA 3MRMA 2JKJA 5C0NC 1FL6A 3M88A 5B3NA 2PPEA 4MMXB 3SPVA 2JTDA 2R2EA 4NQCD 4Z7UF 2AK4B 2UY6A 2B1AH 2D7OA 5GISL 4ZXBD 1FHGA 1IBGL 1RUMH 1SYSA 3QUYB 4HHGA 5FYJE 4O4YL 1WG3A 5HYJE 5IQNA 4RFEB 5JPNC 2Z9TA 4YE0A 2X4UA 2FQGA 4P9HL 4L9LA 2NQCA 1JPSL 5ILTL 4Y5VA 2O61B 1TT6A 4UM8A 1UUNA 5JIHA 1P1ZB 2GT9B 4NKDA 4LOUD 3PJSA 4WW2C 2YD7A 4XNYH 4NWUL 2FGZA 1DJGA 2X4RA 3HZVA 1KLFA 1NBVH 1KPUB 4UQEA 2B16A 1JRHL 4RQQA 3MN8A 5DJZA 5E9DE 5EOCH 2IF7A 1FYTD 1OTTC 5E2UH 5A2AA 4EN3C 1A9BB 2I5YL 4NT6B 4PB0L 3RZCB 1ZV2A 5INDA 4FTVB 4K8RC 5E24E 4ZZKA 3KPQB 3NIFF 1MFUA 1JVLA 1MHPL 2J25A 4WGKA 4NP4H 2XVLA 4XC3L 1KLUA 1ZXKA 1BAFL 4YNYA 4R96B 4JFPB 4LRNH 2WN2A 3LVTA 1XCXA 3OWEA 1L5GB 1DQQA 3WIHA 4Z1PA 1MCPL 1CO1A 2YGOA 3JZYA 4QRQA 2R0ZH 4YLCA 3K6SA 3G9AB 1ZD6A 3N5AA 2JCCE 3GI8H 4JRYE 4M93C 5G5DB 4HZLB 3G04A 5I5MA 1EZUA 1GGIH 2IGFL 1FZOB 1XIWD 3NA9L 3ZDZF 2WGXA 3BKJH 5IVZB 4PCSA 4JFFA 1QWHA 3V4VL 4G6ML 3QRFM 2MCPH 3C60C 1S2EA 2VDKH 4X4YA 5AZ2H 2A77L 2X28A 1G1CA 4KY2A 1CJYA 5LBVA 3W9DB 3WMPA 4E0RB 5HDLA 2FCBA 1BZ8A 1MHEA 3L1GA 5HDRA 3HPJA 1IMHC 2VLME 5JW3L 1QMUA 2W0FB 1VADB 1BDYA 4HUUB 1T3FB 4GAYA 3ZMNA 2YN5A 4QR7A 4LP4A 4R9HA 2EINB 1WCBA 4AMKL 1WK0A 3FCTB 4EIBA 2V0AA 1UGNA 1QWNA 4CL7A 5FFLA 5IMMB 1IX2A 4XAWL 2FWLB 3EUDA 2EDTA 5JDJA 4C56A 1JSYA 5JNYA 3EGDB 2C3XA 2OP4H 4JK0D 4UIKH 1UWGL 4K9EL 1GC1H 4NZJA 3WS6A 2L7QA 1F4WL 4LDEB 4CBPA 1KPVA 1CE1H 2NCEA 2I07B 3L5HA 1J8HB 3H9SB 5DZAA 5CILL 5C0RL 3MLPA 1WA2X 2OJEB 3QAZC 4PJGE 3AG3B 1G9EA 4PRHA 2F1EA 3HUJF 4V1DD 4NYLA 1KLGB 1XZWA 3BMWA 3HN8A 4L1DA 1A3LH 3P77B 5DGQA 4NQEB 1JYNA 1E2WA 4XPBL 2JE8A 1AXSA 4EXPX 5JR1H 5DS2A 1SJHA 3MV11 4XWGH 4OZHE 2ZOOA 4URTB 3H9HB 4MWFA 3GMRA 2C5DC 2EH8L 3MV7E 1MF2L 1GYUA 3KJ4B 4IJTA 4QOKD 4YHYB 2YD3A 3WJJA 3A4EA 4RFOH 3DNKA 4D0DA 1NCAL 4QRSB 4ZMYA 1U3JA 2CALA 5IHHA 2BP8A 5D7LB 5E08L 2C1OA 4WY7L 2EABA 3ABGA 1HWWA 2YKLH 3BEWB 1CL7I 3LN4A 4P9ML 4WV1C 2CM6A 2EICA 5CZXD 5EU5A 4BIKA 4AEHL 3H56A 4JHZA 1MFEH 2WVTA 1GOFA 2X88A 4E68A 3CK0H 4XVTL 1D7BA 2FJFA 1GW0A 1LLAA 4HFUL 4RMBA 1FZKA 1G7IB 1GGCH 5HGAA 5C2BL 5AVTB 5K9OB 1D7FA 2IH3B 4KKBD 4JFVA 3S3BB 5FS5A 1OPGH 4U1KB 4ANVA 4YPGB 4G3YL 4HS3A 2FDBP 1E50A 1NUNB 3AAZA 3HRZC 3P73B 5GIRA 3EOYG 4HJGB 5B39G 1RHHA 2IOOA 2IQ9H 1D5MA 3FT2B 4AKPA 3TCXA 1WIPA 2F9BT 1I8KA 2Y7QA 5E5MA 1MJJA 3RVWD 2AMUA 4MAYB 2A6KB 3AB0C 4PS4L 4F7PB 2HVKB 1KBKA 1WFTA 3CZUB 4MA8L 3ZHNA 1T7ZA 2R0KH 3SGDH 3EFOA 1EVTC 4UT6A 4G8GE 4NAMA 2AZAA 2ADFH 3SPJA 4GMTL 5DJ2B 2ZYHA 1BZ7B 4HIJB 3RWJB 4XZ4A 5DQ9A 3GT6A 3LNGA 1VEOA 4IM8A 3O4LE 3ZT5A 5FDWB 3SDCB 1C5DA 2WMPA 2PETA 3FQNB 1EXUA 1TQCC 3ATDA 2Y7MA 5B4MC 4I9WE 1PLCA 5J11C 4G9FD 3LKPA 4NJAH 2VT0A 3RVUC 2B1AL 2J73A 1MFBL 4V11A 5EO1B 3TM6A 4BM7A 4DQAA 1AYRA 2WLNA 3WD5H 3ZKXB 4AQ8A 5MENE 1RUML 4PI0A 3POHA 1X6LA 4NI6A 2IALA 4XBGA 2JJSA 4YPJA 1ZCRA 2K4WA 3ARXA 4X83A 2AKRB 4KVCH 3BCFA 4FKEA 4WI0B 1IBDA 3CZFA 4HW6A 4KQ0A 2J56A 1JMXA 2GQHA 4S2SA 1RK0B 5D7KE 2C3GA 2OXGB 2AC0A 4FXGB 3MMEB 5EU6A 3S0PA 4WRLA 5IMOA 5EUOF 3OXRB 5PAZA 3C5JB 1F0LA 2YWYA 3GSWB 2J8UF 1NBVL 3CX5K 1GKEA 2JIXA 5C0BE 5MEQB 2RH0A 2D3JA 4M5TA 5BV7H 5J56B 1A7OH 1A4KB 1ZVNA 1CB4A 4BCYA 5DURD 5EOCL 3F7KA 5HI4D 3O9WB 1TQSA 1BW8A 4R5VA 5ECJE 1KIPA 3FQRA 4Z7QF 1CTNA 1QFPA 4Y19E 4GG6A 5C07B 1OLZA 3FO2A 3D9AL 3V5DA 4G8EA 4JFXB 4TVPH 4AYFB 3UC0L 5I6PA 2JTYA 2VZVA 1EHNA 5DWPA 5EFIB 2OI9C 3BP5B 1HC1A 3IBEA 4LRNL 5IHZA 3KLAA 1XV8A 4L8BB 3K91A 3I3EA 4LPYA 5DI8A 2FEDD 1AGFB 2ZOUA 1JVKA 4TNWK 2BVEA 2GY5A 3VFUA 3CCHB 2R0ZL 5F7UA 4KO5A 4ZSOE 4NQSB 1F6AA 4GIOA 5IJDC 2IWFA 2A9MH 3EYQD 3GI8L 1GGIL 1P0SE 3QDAA 3BKJL 4A6YA 1OGAA 1PTZA 2VMFA 4FG2A 4NPYB 1EEQA 3VGFA 4YDKL 4AWJC 2LLGA 3MJ7A 2NCMA 2MCPL 1EJ8A 4DP2X 4NBZB 2VDKL 5AZ2L 3DKHA 1LEKB 1YJDH 4UIMA 1FVEB 4KAQH 4Q6YA 5GS2D 1N64H 1WWCA 3L17A 1IL1B 5F9AC 5BOPA 1GS6X 4FZEH 5DZOA 5JMRA 4GRWB 2IPUG 3DYPA 4HWEH 5ENWB 4CC0A 2WVVA 3C9NB 5DS1A 3UZQA 2B08A 3FRUB 2CJUH 1T1XA 5IQ7H 3X12A 3D06A 3SQOL 3TBWB 4ELMB 4MJ2A 1A2YA 2X70B 5INCA 2OP4L 1CXLA 4QTFA 2CLZB 4LVNC 1JN6B 4Q0XH 1GC1L 3M1BB 1LQSR 2JKLA 5CS7A 3UTZA 1CE1L 5IMKA 4S11A 3VAEA 4L8SA 3ECWA 3GIZL 3EG9B 3GM0A 2AV7A 3CHQA 5IB4A 2XNAB 1R3KA 3HNSH 5H35B 3V0EA 3W57A 4PY7B 3ZE0F 3D69B 3FXIC 2Q8BH 1JCVA 5DO2D 4YQXL 4Z3JA 2F7QA 1A3LL 5KSBA 2KC0A 3CDGB 3NJXA 1NCTA 4N85A 1H6TA 2XC8A 3TO4D 5JR1L 1E3XA 1ZK5A 4GSUA 4XWGL 5CJ5A 1VFAB