3X1EA

Structure of copper-containing nitrite reductase from geobacillus thermodenitrificans without chloride
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
295
structure length
295
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Structural evidence of the flexibility of the CuM site
rcsb
source organism Geobacillus thermodenitrificans ng80-2
molecule tags Oxidoreductase
total genus 98
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3x1eA00
3KW8A 1ZDSA 3NJNA 1JERA 2FNWA 3FPYA 3ABKB 4HZ1A 5AKRA 1WA1X 3GYRA 2BP0A 2GBAA 1EZLA 1PY0A 1MZYA 1IKOP 4PAZA 3T71A 4YL4A 5D4IA 2GHZA 3FQ2A 1KV7A 4HCIA 1E5YA 1KDJA 4YVNA 3IEAA 3PCYA 3IN2A 3DIVA 4AKQA 3OMNB 3CDZB 2JXMA 1BQ5A 2GC7C 2CALA 3FQ1A 3OMAB 4NAJA 4HHWA 3TBCA 5AFAA 2PCYA 1KGYE 1NIAA 1ZIAA 3SQRA 2I7OA 1URIA 1BXVA 1HAWA 1PAZA 4WTQA 3T6WA 2A3TA 2CJ3A 4GXFA 2PP7A 4E9QA 1SDDA 2QPDB 2BP0B 1GS7A 4JHVA 1OCRB 2YQBA 5A7EA 1R1CA 4Q8BA 4YSOA 4UANA 3CVDA 1SHXA 3QJRB 1KDIA 1M56B 2UX6A 2UXFA 4KOCA 3QJVB 1WA2X 2AZUA 4QLWA 1IBZA 1ADWA 1NPJA 4AKPA 2XX1A 1OV8A 5B7FA 3PAUA 1OCZB 2R7EA 2HLEB 1FWXA 1OOWA 3S8FB 3OQRA 1AS8A 1ILSA 4L0PB 1NIFA 5B1JA 3H56A 3OD3A 2YXWA 1PMYA 3DKHA 1L9TA 3X1EA 4KOBA 1ZDQA 1AAJA 1GYCA 2BHFA 1A4AA 2ZONA 3KW7A 3T9WA 1SDDB 1GS8A 3RYMA 3SBPA 4F2FA 2UX7A 1YLBB 3AW5A 4A2GA 3EHBB 3FU7A 5TK4A 1ZIBA 1A8ZA 1E5ZA 1F56A 1KYAA 3V9EA 2YAMA 1FA4A 4DP9X 3EH4B 4F2EA 4AZUA 2J56A 2R7EB 3AG4B 2HX8A 4E9VA 1BXUA 2WO2B 1A65A 5D4JA 1J9SA 4E9XA 4M4RB 4YSAA 3OM3B 1OCCB 4A2HA 2IWFA 1NPNA 1AOZA 2XLLA 1DZ0A 1SHWA 3GDCA 2GSMB 2HRGA 1MG2C 1CC3A 1OCOB 3FSZA 4BXSV 4M3HA 1GSKA 1ET8A 3QJSB 2VW7A 4DPAX 1KBVA 4A2DA 1ET5A 4G70B 1KBWA 3SBRA 3FU7B 1ID2A 4DP8X 1RZQA 1OE1A 3UADA 3JTBA 3X1BA 2B08A 1BEXA 4YVUA 5E9NA 2UXGA 4G7RB 3NJLA 4HCGA 1N68A 3TU6A 3NT0A 2H47C 3AG3B 1M9WA 5B3SB 3QQXA 3CVCA 1JZHA 1V10A 5B7MA 5I6LA 1PZBA 2IDSA 4A2EA 2BW5A 2DY2A 2W88A 5AZUA 4HIPA 1W6WA 3X1NA 2DWTA 3NP4A 5B1AB 3WNIA 4NERA 2H3XC 2FQEA 1TKWA 1VLXA 4YSSA 1MG3C 4A66A 4MFHA 1NZRA 1JVOA 3ABLB 9PCYA 2BP8A 1M57B 4E9YA 2W8CA 4GYBA 3QPKA 4K9JA 3BVDB 1KCWA 2XWZA 2OV0A 2J5WA 4CSPA 5I5MA 4YSCA 2ZOOA 5B1JC 3ZX1A 3WI9A 2YAPA 7PCYA 3S3CB 2I7SA 2YAQA 1RZPA 3NJFA 3D12B 1BYOA 2QDVA 2QDWA 5I6PA 2J55A 2QT6A 4BK5C 3NJIA 3HB3B 5B1BB 6PAZA 2UXTA 3T6ZA 2EINB 4BDVA 2ZWNA 3AY2A 2FT7A 4UF7C 1QHQA 1AR1B 3TA4D 2AZAA 4DP1X 1XB6A 3NJGA 4E9SA 5PAZA 2WSDA 1QNIA 3WG7B 3NJHA 2GC4C 2QPEB 4EF3A 2BP8B 3ABGA 3T6VA 3NSFA 2IDFA 3ZIYA 4AI7A 1JZGA 2FTAA 4BWWA 1TEFA 1ETJA 2DWSA 1ZPUA 1MZZA 2FQDA 1CYXA 3WIAA 3HEIB 4KO6A 4YSQA 5B1KA 1HFUA 3T6XA 1ILUA 1HAUA 1PLAA 2H5UA 1JXFA 2FQGA 4AKOA 4BDVB 4W9ZA 3NSYA 1PLBA 1SNRA 2GIMA 1W6LA 2VSKB 3FSVA 2PPEA 2VN3A 5TK2A 3PAVA 5D4HA 1X9UA 2RACA 1AZRA 4DP6X 4DP7X 1J9TA 4DP0X 4E9WA 2FJSA 4A2FA 1J5CA 3G5WA 2JFCA 3L45A 1OF0A 4YSEA 3GXUB 3NJKA 3X1FA 4G71B 1BQRA 4QKTA 4CSZA 3NYKA 2BWIA 4NB7A 1L9SA 1JXGA 1UATA 1XB8A 2VW4A 2X87A 1N70A 4PCYA 1FFTB 2HRHA 5FC9A 3CZUB 1WAEA 1X9RA 1NDTA 4KNTA 4TXVB 1AS6A 3EH3B 1NICA 2OCCB 2AFNA 2CAKA 1NWPA 1ASQA 4F7KA 2N0MA 3UACA 3CG8A 3TASA 4YSDA 2I85A 2FT8A 4YSUA 4HCFA 3X1GA 1AS7A 2MRYA 1PNCA 4G7SB 4A68A 2XXFA 3PLYA 2X88A 1IUZA 2LLNA 5PCYA 3WNJA 2VMJA 1PLCA 4W1TA 5I6NA 2YAHA 1J9RA 3UABA 5I6MA 3IBOA 3S8GB 1WS8A 1JVLA 1IC0A 3ERXA 2HX9A 2BZ7A 2CUAA 3IN0A 3OMIB 1JZJA 1ZV2A 2DV6A 4ZK8A 4KNUA 1AACA 1L9QA 3ZDWA 4BXVA 1W8EA 2PP9A 4KO5A 2HX7A 2PPCA 3IE9A 3X2QB 1NTDA 2PLTA 4GY4A 4AX3A 2GB2A 1NIDA 2NRDA 1RKRA 3QJUB 3CVBA 3EH5B 1NINA 1I53A 1NIEA 3BQVA 3PXLA 3FT0A 2YXVA 2WO3B 2MTAA 2EIMB 2YAFA 2IAAC 3FSAA 2XYBA 3UGEA 3FPXA 1RCYA 4BWUA 1MDAA 2HZHA 4DP4X 2P80A 1QLEB 3NSDA 3QJTB 4G72B 1JZIA 2Q9OA 4JKNA 2IH8A 4P5RA 3UAAA 4DPCX 1OE2A 2VM3A 4ENZA 1WS7A 1KCBA 2YAEA 2PP8A 1PNDA 2XX0A 5ANHA 4N8UA 4E9TA 1NWOA 2XV3A 3ABMB 3MX0B 2EILB 3FYIB 1SFDA 1PF3A 2BW4A 1EHKB 1GR7A 4GP8B 4KO9A 2DYSB 2FT6A 4FA7B 2IWEA 3FU9A 4G7QB 1GW0A 1AZBA 2Q5BA 3N2JA 2IDTA 3U25A 3SBQA 3EF4A 4E9RA 4GP4B 2XUWA 1A3ZA 4DP2X 2OJ1A 3H4FA 2PPFA 1A4CA 2TSAA 4KNSA 3PAZA 2FQFA 1ET7A 1AZCA 1JZEA 5F7AA 1JZFA 3AG1B 3AZUA 1AIZA 3WKQA 2CCWA 1BYPA 2AANA 4GP5B 1V55B 2YAOA 1L9RA 1ASPA 3NJJA 8PAZA 5I5IA 5LDUA 3QJQB 2IWKA 1SFHA 4UAHA 4HHGA 1AG6A 4DP5X 1AZUA 3NJMA 1BXAA 2VSMB 1BQKA 3UAEA 1BAWA 3PPSA 4HAKA 1B3IA 4N4YB 4RH4A 2VM4A 3NP3A 2EIKB 4DPBX 5EHFA 3WKPA 2B3IA 2GI0A 3V9CA 3ZBMA 7PAZA 1AANA 2DYRB 1PZCA 2BWDA 2PPDA 3ASOB 2IH9A 2Y69B 1SF5A 2TSBA 1JOIA 3AG2B 5I26A 1CYWA 1WA0X 3FQYA 2P80D 1SJMA 1XMEB 3ASNB 1E30A 5B7EA 4A67A 4JHUA 1SF3A 2EIJB 3FU8A 4Q89A 3DTUB 2BZCA 2XU9A 1IBYA 1A4BA 1CUOA 2YARA 5I28A 1NIBA 2XV0A 1E65A 4YSPA 2ZXWB 3TBBA 3S3DB 2PCFA 1XB3A 2XV2A 2Y1AA 1GS6X 2BO0A 2VW6A 1V54B 5I6OA 1J5DA 2XVBA 1L9OA 1DYZA 1PCSA 1AZNA 5I5JA 3NSCA 1J9QA 2AVFA 1T5KA 2XXGA 1AQ8A 1JXDA 4YSRA 2FWLB 3S3BB 4BWTA 3H4HA 4YSTA 1TEGA 2IDQA 3MBWB 4X4KA 3FSWA 1TU2A 4KO7A 1GY2A 4P5SA 2PPAA 2J57A 4WKXA 5IY5B 4FAAB 2IDUA 2CBPA 5I6KA 1PZAA 5F7BA 3N55A 1L9PA 1OE3A 1GY1A 2E86A 3C75A 2JKWA 3CDZA 2HXAA 3FYEB 6PCYA 1CURA 1AG0A 1E67A 3FS9A 3JT2A 2UXVA 1ASOA 4HALA
chains in the Genus database with same CATH superfamily
2RD0A 2GJPA 3NA9H 2OMVB 3SDAC 1JERA 1OQOA 3FFDB 4L4VE 3SY0A 1T3FA 4YMPA 3VVVA 1F1DA 5MP6L 2B1AL 3UBXA 2P26A 3GUTB 2EC9T 2MIZA 2NY1C 1MNNA 1LP9F 2R1XB 5I74C 4KHXH 3O3EA 4MZ2A 5CN1A 2IH1B 3CN0A 2W65A 4S1SL 3RWGB 4UMSA 5IG7A 4NI3A 4PJ8C 2YFNA 3OKNB 3V10A 3I85A 5DI8B 2GJZA 4TS6A 5F0MB 1AD9A 1MREH 2QQKL 3WAKA 5JHBA 3NAAH 2QGDA 5D93C 1AE6H 3RL2A 4L05A 4W6XB 2CZNA 1PS3A 4UT6A 1PQZB 5J5EA 1YMME 3S9DB 2QQLH 4JFZH 4AIEA 3MRNB 3RVVD 2J72A 3S35X 4B50A 3QJHA 1X9QA 2R4RL 3FCTB 4Q4IA 3HG3A 4M9PA 4NQXB 1URIA 3T04D 3SCMD 4UOZA 5KYUB 3C12A 4RMQA 2PP7A 3DX6A 4G8IB 5KYWA 2BP0B 1DSFL 4JHVA 1XR8B 2F53A 4XXWA 4TQIA 4Q8BA 1MHHB 4B3VA 3QORB 2QZ5A 3HUJA 3NCJH 2BNRA 2X2HA 2ZUYA 3HE7B 2K6YA 1VPOL 1UOLA 5CEZD 1U2HA 2GJRA 2R0ZL 2HKAA 4M1CC 3ZGHA 1T0NA 4AQ1C 4Z3IA 4E5XB 2B0SL 3DTXB 3TURA 2HLEB 1MRDL 1GOFA 2YD2A 4NFDA 1ZANH 5HDRA 3O8XA 1FFPB 4XN4A 5DEFA 5AVYB 1F3RB 1KPVB 2YD1A 4OM0L 2TRHA 4ORZC 4HPHA 5INDB 1W0WB 3T9WA 5IFAL 5FUCE 3KPLA 1SUJA 3RE0A 3X11B 5J57B 4HKZA 1N0LB 4JN1H 4XN2A 3G5ZA 4OKVA 3AW5A 3FTGA 2ZUQB 3X17A 4OLZL 3UL4A 5EBWA 3WJLA 4N20A 2EXSA 1E6OH 2LTQC 2R56L 1NGPH 1WFIA 3OKEA 3L4YA 1QW9A 2EDOA 1BQHA 4PJDE 1P4IL 3OWRA 4Q9QH 1CTOA 4AE1A 3MNWB 4NT6A 5IVXB 3B8YA 3E6HB 4X5RA 4GAYB 3SDCB 3DDFA 1J9SA 1B0GB 4FMFA 4WO4C 4OJDH 4YSAA 3B1UA 4AE0A 5ACZB 3TH3T 1UKQA 3SPGA 2FH8A 3GLAA 5MI0B 2XVGA 1P4BH 2RH0A 1U8HA 3DOSA 2VDQL 4RAUB 3ZMNA 3KM2A 5JORA 1H3GA 2EP6A 1UJ3C 3ES6A 1HEJC 5HYJA 2CMRH 2V5MA 2J2ZA 2WLYA 2XTJD 1HI6B 1PFCA 1ID2A 4D9LL 4DP8X 4OD3L 1OE1A 3KWVA 3O6MH 4I0PC 3ROOB 4UM9B 4NQCB 1L7IL 2R4SH 3A47A 3FTUA 3Q2NA 4R26H 5G5DA 4MDJB 5DWUH 1J9CT 2R59A 2J6EL 4MVBC 4PRAB 4Y5VB 3AS1A 3RFZB 1J0YA 1LMKA 1G1KA 4UBDD 5B7MA 2IDSA 2F53D 3TIDB 3MNMA 4AZ8B 1C5BL 3CVIH 3DVGA 3BPCA 4F5CA 3CU7A 4N2IA 3ULUD 1BD2E 3RILA 4TRPH 1MIEL 2DI8A 3RZCC 2WP3T 2BNRD 1MCQA 2W91A 3ARXA 4JZJB 5AW7B 4HGMA 3NZHL 3SKUD 4N0UE 4I3SH 1KTJA 4FNLL 4YHYC 2HKHL 3CCHA 5BZZA 2EVFA 2WD0A 4BZYA 5E08H 4R0LC 1HXYB 9PCYA 4PCKA 2VLMD 1T0PB 4L23A 3BCDA 3O8XD 1D2PA 2HT4C 2YD0A 3QPKA 3D87B 1JNJA 4AEIH 2CBOA 3WEXB 3ZDYE 3SE8H 3SIKA 4PWIA 4Y1SA 4N0CD 1JDAA 1ZHKA 2OQJB 1A0QL 5CGTA 5D8JH 3OPZH 4M62L 3T08A 5IB4B 3ULUF 2ITDA 2W92A 4NO2A 2FYVA 4HD5A 1CD9B 2MOVA 2QDWA 4W9LC 3M1BA 5FO9B 3ELAT 4PJAB 5DYOA 3MLXH 5GRVL 5B1BB 3TZVA 2Q7YB 4OIBA 4M7KL 4NP4H 1FNSH 1KXQE 1BIIA 2HPOA 2ZYIA 2IFFH 3NJGA 1CVSC 1FBIL 1RVFL 3APNA 3ELQA 5D1ZA 1A4JB 1JHKL 4ODHH 5GRJL 5K9OA 4EF3A 1E4XH 2APXA 3T6VA 2QTEA 3IRZA 2HRPL 4JFFA 5EOTA 2DJUA 2XQYA 1OPGH 1R3KA 5D7KE 2BIMA 5D7JB 1GZPB 1FSKB 5ANMA 2OK0L 1ZHLB 2EAEA 1QW8A 2Y23A 4WUUE 4HQQH 5D6DA 3R8QA 2QQNL 1YN7A 3BH4A 1QLRB 3TT3H 1FV1A 4YSQA 5HYJD 1RUPH 1ILUA 2IBGA 43C9B 4GT7A 2VABA 1MH5B 4CC4A 5HPOA 3S48A 3V0WL 5K69A 3NCYS 1FZKB 1YEJH 5GHWH 3W37A 5I8KH 4TPRH 1OGSA 4KRPC 3WIIL 3D9AH 2RACA 3EUDA 1H3WM 3DC0A 5ABDE 1R9FA 1H3PL 3LKOB 2FJSA 4OZFB 3P30H 3VX0A 3KZ8A 1J5CA 5C0BA 1I7RB 1OF2B 2XJLA 2H1XA 3GXUB 1T1YB 4QI3A 4YNYB 1KGCE 1WWBX 4WWID 4EI5C 1UVQA 3O6FA 3IFPB 3ZE1B 3AMKA 1LP9B 5KYXB 3CSFA 3UZEC 1XH1A 1P1VA 1RLWA 2ZXQA 3UMTA 3VFUA 5CMAB 5E03A 1RZIA 5FGRA 4OU3A 2VE6B 3WIHL 3OAUL 4JBSA 1NKGA 4OAWA 4EVNA 2EH8H 3B2UC 4UMGA 3PWPA 5EU6E 1A6AB 3K8KA 1PY4A 1T1WA 1LO5B 1HNFA 1X6LA 4NDMB 4P4RB 2ED9A 3BGAA 3CFCH 5FYJH 1AS7A 4S1DD 5TGBA 3TZVD 4AM0A 1SM3H 3DUHA 4UNTA 2UVFA 4BSVA 3BIBX 3LS4H 4ELMA 2DQTL 4WAFA 2AJXL 3SGDI 4W1TA 2YAHA 1AKJA 3P69A 2F8OA 3CFBB 2DTMH 2V2WB 4RDQG 3E1F1 5D1ZD 4EUPB 5T3XH 1XWVA 1BW8A 4MQXC 1YYML 1W72B 1F45A 4JFFD 2FAUA 4MS8C 5G4NA 3QIWA 4KK6C 3QEQE 3L3JB 4LCWA 3GBEA 5EOCH 1SBBA 1JGEA 1KJMA 1RIHL 2PP9A 3CIQA 4E0RB 1G6RL 2AEIT 2HX7A 1NTDA 5C0RH 4G1EB 2C7FA 3AT9A 5CJXC 3OKMA 5L4JA 1EJ6A 4LL1A 4XVJL 4I1RA 2WXPA 4NC1C 3LIZA 3N1MC 3IDXL 2PW2A 1E50A 3FT0A 3MNVA 3QO0A 4HK0A 3P2BA 2X05A 2YAFA 3VH8G 2I07A 2WN2A 1AQMA 3BC9A 4GIOA 4PJEE 2C1OB 4L8DB 1F4WH 2BZDA 1XCTA 2BDNL 2K7QA 2EVIA 1ZKAA 3UOAB 1EXHA 1AZZC 3S4SB 4FTDA 1Q0YL 4P5RA 2A6KB 3ECVA 4HFUH 5BW7A 2K1MA 5DC2A 5KZCD 4U6YA 5FB8B 4AQ8C 3G5VB 5C0BD 2ZP9A 2M1KA 2R0LL 3O6FD 2C1PA 4Q6YA 1KB9J 1YEHL 3TTSA 4MMXA 2BNUB 3NN8A 1T03L 1IMHC 5FV1L 4ZODA 2X1XR 2FX7L 4BZ1H 3SSGA 1K8DB 3FUJA 2IWEA 2KLSA 3RTQC 5EIIB 1D5MA 1D5ZA 4RGNC 2CKBB 5GRWA 1AZBA 3T3MB 3WGUB 3RX8A 3VD2A 3DXAA 5A2CA 3V4UL 1F4AA 1VJSA 3PWPD 3KPSB 4HXAL 4UNVA 3BKML 5K9KA 2HVJB 1XGPA 3BYTA 4RFNC 3VXOA 1QNZH 2OR7A 3VXQA 4FERA 4NQCE 3T65B 2FSEB 2G0KA 1IGCL 1S9WA 2E6QA 5F7AA 3UBXB 1JZFA 3C60C 4GP5B 3G9VA 3SDAA 3PJNA 5LDUA 4LARH 1RU9L 4C4UA 1T21A 3ROLB 1BLNA 1CXEA 1AKJD 3CHXA 2SEBA 5J06A 3J27A 4QY8A 3RL2B 1RP8A 3VVWA 1U42A 2XTJB 2XY1A 3MRMA 4R83A 5A16B 4PJ8A 4MZRA 5HYSB 3QIWD 1JZ3A 4LCWD 3ZDXB 3PPSA 4LKCA 1Z66A 3S88L 3D1MC 3MUHL 1Y6NR 2CSPA 4LHJB 1G9EA 1ZWIA 1A1MB 1CDCA 4B9FA 4R97B 4GXVH 4ES9A 4P06A 3PDOB 1E9PB 4OBSA 3N42B 4ELMF 1GYVA 2F53B 3GZPA 4P5TC 1F58H 3VXRE 4P2YA 5EZOL 1CDIA 1C12A 4KGJA 2VN6A 1S5HA 2VXUH 3U30B 1NCGA 1JUFA 1ZK9A 2Y07L 2AJYL 2CG9X 2OMWA 3ME0B 1G1CA 4ENED 3V5KA 3FU8A 4RWYH 4AQZA 3HNSL 2XU9A 1BGXH 1WZMA 4P2CG 1UM5L 4IU2B 2R29A 3N0AA 4PH8A 5DEFB 3KDPB 4AQ1A 1QYGL 3TBBA 4HIJB 3C08L 3RPBA 2JB6B 4G8AC 5IJVB 3L4WA 4E5XG 2Y1AA 3A67L 3KPLB 4JQIL 3FOMB 4DEWA 1KENL 4Z78B 5IHHA 1DBKH 5DK3A 3G5ZB 4YDJA 1AZNA 2VZSA 2AVFA 1ANUA 3Q6FA 1QEWB 5FWRA 5E00A 3DXAD 4POYA 4GG6A 2R2EA 1JSYA 5IREA 4XPTL 2DLGA 3EAKA 3QUKA 3MSPA 1E5CA 2CDEA 4FXTA 4UM8A 5GS0L 3IF1A 4MJ6A 2APTA 4P5SA 1MKFA 2FGWL 3NUKA 4R6UA 3W2DH 4V2BA 4EXPX 4JL1A 1QFUL 4ACPA 2AI0L 4QD2E 1EV2E 2YLKA 4J8RA 2CLRA 3SDAD 3II1A 4OFPA 4KJQC 4G8FA 2TRYA 2QHRL 1U8HB 3SBWC 1ZDSA 3AREC 3AXLA 3SYCA 5JORB 3ABKB 2VLJE 2NY1D 4Z7VF 1ZGLA 4WO4A 2ADGB 3N1FC 1QASA 5G2NA 3BO8A 4PJ8D 5CFAA 4GEIA 3CN2A 5D2LA 1MW3A 2G5BA 1MI5E 4HJJH 5EUOA 5G5DB 1UJ3A 4Z23A 1TU2B 3CQFA 4NBXB 5DUBB 5EWIH 1KY6A 3GXFA 3ESMA 3APCA 3PGCA 4I0PA 4KUCD 1NCWH 3TLRA 3DVGB 1C08B 3G08A 1FPTL 3QDJB 4JO2L 5J6GA 3WUWG 3EO1B 4QT5B 3K4DA 4FG4A 4YGVB 3PU7A 3TBCA 2ZUSA 5D4QA 3M88A 1EWHA 1PAZA 4WTQA 3IE4A 1AFVL 4P59H 4QRQA 4JFPA 4E9QA 1Q0EA 3RZCA 2YMXH 3VFMB 5FW6A 3CVDA 3OSKA 4M1CD 4MA3B 2E75C 2AF2A 2NTSP 1NFIA 1WA2X 3OGCA 1A22B 1SXNA 2H2PC 3LV3A 4I5BA 2Q7AA 2OJZL 4WJKB 3EYVA 3MOAH 4R0LA 4J3UA 4YHOL 4NO2B 3HZVB 4KROB 4WV1C 3SOBH 3T1WA 1IGIH 4OZGB 4KXBA 1JV2A 4KRNA 1MY5A 2HG0A 3IDMA 2B3RA 4QHNA 3T2NL 2AQTA 3VM5A 3H56A 1GPOL 1I3VA 1ZY9A 2J71A 3FAXA 4KZDH 3BHBA 5DFTA 3CBRA 4RRPM 3QJZA 3K0YA 1A64A 4U7MA 3DJSA 3U4AA 4JKLA 4PJ9C 3V0GA 1GC1C 4FLOA 1WFJA 5DHDA 5I1IL 4K3DH 5EO1A 3ZW3A 3LMJH 5JUEH 5EOTB 1ADQH 1FNHA 2DM4A 1R3KB 2Y36H 3NDYE 1SYSA 2MNUA 5TDNB 5F1NA 1EZVY 1N5YH 3VE0A 3MUGB 3MV7E 2A4EA 2ZTBA 2YQ3A 3QW9A 3MBWA 3AQYA 3I3EA 4LL9A 1IGFL 1VF5C 5AVTB 1D6VH 3MRHA 5J12C 5D7IA 3PWJA 3WFCL 2RBLA 4WO4D 5KTEL 2AJ3A 4JFEB 2WO2B 1UQSB 4GG6F 2YA1A 3I6GA 1P9MC 1RZGA 4X7SH 1AGFB 1WISA 4IOSA 5CEYA 4Y4FC 3E8VA 4HH8A 5ICUA 1UJTA 4G3YL 3ZQXA 5KEZA 3KDMB 4FTVE 4A2HA 1CFQB 3EH2A 3K91A 3QJXA 4RESB 4LCCC 1VRSA 1OCOB 4Y1AA 1EO8H 2DBLH 5H2BA 2VW7A 5J89A 3T3ME 4I0PD 4C4KO 1PFOA 3CSYB 1NH6A 4OJCA 5E4IA 1WUNT 3LHPL 1JCKA 1KBWA 1UM6H 2WWKT 3DNKA 1X5MA 3LQAL 4LLMA 4MVBD 4MJIB 5C0BB 4JPSA 1IQWH 3R0MA 5JMRA 3QZBA 3C6LB 3KYOA 3TBTA 5JLZB 1UVQB 3O6FB 5C6TH 1T6BX 2V3EA 2EECA 1K6QL 2MTPA 3EYFA 4DEPB 3RZCD 5JIHA 5D2LF 5JHLL 1ZAGA 5EUOF 3CMGA 3LS5L 3QFDA 4EI5A 3MFGB 1EEYB 4B9JA 3GSUA 1QKZL 3D50A 5ILTH 1FN4A 4W9GC 5EO9A 3UZEA 4H20H 1ZXQA 4XI5C 1IKNC 1XGQB 1R75A 1TF4A 4FQJL 3PWPB 3VSUA 1HJCA 1E8ZA 4X7DC 1T1WB 3DX7A 2HT4D 4LP5A 2CNZA 2OPCA 3A4AA 3I6LE 3IRPX 1RHFA 2PWGA 1P6AB 4AM0B 1JF1A 3M45A 3BLKA 1NGZB 2XWZA 1ETB1 5IFAH 1DLFL 4ZX4A 1A7RH 1IBGL 5JR1H 4P57B 4X4XB 3QYMA 2NY6C 4KXAA 2J1WA 4IMLA 3S3JA 3TBSB 3WY4A 4KTDL 2VYRE 2Y5TB 2J55A 4K9EL 3TO2A 6PAZA 3IKCA 1KTDA 1SMDA 4PRHE 2UXTA 3LZPA 2WP3O 3JUZA 4B3EA 1AR1B 3ZZQA 4EUPG 1XB6A 1UWFA 1UG9A 1MIMH 2VDOH 4TQEH 1YPZE 3ABGA 2EEBA 4J3OC 2NNCA 5GRVK 4IOSD 3B2VL 1JRHL 3MNVB 4K7FA 2X53A 1EVUA 2X1WL 4N8VB 1TJIL 5CJXA 1MZZA 2DQCH 5KYYA 2R51A 1CYXA 2QGEA 3ZVVA 4Y1AD 3GTVA 5F6IC 1CI5A 4WDIA 4O02A 1HFUA 4AVHA 3MKGA 4F24A 4U6YB 1KTLB 3QG7L 3C5ZC 3L3IB 5AD0B 3QQ3B 3QRGL 2J6EH 4KRPD 2I24N 4LLQB 1PLBA 4W9ZA 1SNRA 3OB0K 3L95A 4AG4L 2AABL 5D7IF 2PR4H 4F33A 2VDLL 2C1PB 5TK2A 3MO1B 3QUZB 4JFQA 4WY7L 3S4SG 1MVUA 4AQ8A 4DP6X 1TYRA 4HMEA 4DP7X 2P28B 2DM2A 4GAGL 2HJFB 3SE4C 2A4ZA 2CBQA 5JOPD 4EI5D 2APFA 5A7BA 3B43A 4Q2ZB 4Z7VB 4AQEB 3G6AA 4PW3A 4FNLH 4YE4H 4EKJA 2I9LB 3TXAA 4XNYH 3MXVH 4U6XA 3HS9A 4MBRA 1VCBC 2AEQH 5H37G 1J1OL 3QJOA 2VLKE 5I15H 1XGPB 2WXFA 3OAYK 3RTQA 2NY4C 4Y4HC 5FC9A 1NJ9A 4ILDA 2BOCA 5F7KC 3S97C 5EIIG 4NSKA 4EOWH 3B2UD 1X9RA 1MWAB 4MMZA 2MH4A 2Z93A 3TV3L 3GLZA 3VA6A 5MERA 2AVGA 1QACA 4H8VA 35C8L 3PE9A 1ZT4A 5G4MA 3Q9PA 4QY8B 4JHAH 3C60A 4L1HA 4L9LB 3WTVA 1O9VA 2JELH 5HHPB 3D52A 5K9JL 4PJ8B 4LMQE 1UACL 3CIAA 5T5NG 5I1EH 3EOBA 3NPZB 3WNJA 1LK3H 4MQXD 1LXMA 3WYRA 5D93B 2YEZB 1WCBA 2LQRA 2PWDA 4HBCL 4HX1A 4J1UA 1OAJA 2DOCA 4MS8D 1IC0A 2HRPH 3HZ3A 1M2OA 4GIPD 1HIML 1NCJA 1AGDA 4KK6D 5DZNA 4UTAA 3W9DB 1Y18B 3IDJA 1VFBA 1BV8A 2DQFA 4ZK8A 4KNUA 3EFOA 1AACA 4JGUA 3RGBA 2UYLA 4OZGE 2Q8AH 5K59E 5KJRH 2AK1H 4P5TA 2LLGA 2LR4A 1QI5A 1O5DT 2OMWB 3K4AA 3QJUB 4KPHL 4NO0A 4WNJA 1OP3K 1NSNH 1S7SB 4L0ZA 4DIXA 1TZGH 4W9KC 2A4CA 1HILA 3M86A 1K3IA 2AJSH 3WIIH 3VFSB 1JHLL 1H3PH 5JNYA 3DSNB 3UCQA 1SVBA 4UQCA 4L8BB 2KDGA 3FF7A 1LEIA 3WKYA 1NEZA 1BM7A 4F20A 4Z3TA 3Q6FB 5D72L 2VM3A 3CFMA 1J05B 4QCIA 5GGUA 5JQ6L 4P99A 1I8KA 4S0HA 4DVRH 1DBMH 2QQQA 2OMTB 2R2EB 2CO1A 4U1IA 4FFWC 3I9AA 1A6ZB 4QRSB 2VUOA 3HHMA 3QUKB 1X5GA 2CDEB 5ABZA 3RTQD 3IF1B 2WBWB 4RGND 5KBLA 3IWVA 3QUMH 4NRXA 4JB9H 1EHKB 5EBMA 2FT6A 4AENA 1AD0B 1AQKL 2IGFL 1D5XA 3K6FA 3B9VA 3PWNA 1JN6A 4PRIE 3SDDC 2WTRB 4ZX5A 4N0FB 1YEFH 2D9CA 1IC5H 4N2HA 1O7DC 3AABA 4LEOA 4NZUH 5E94A 1F41A 4Y4KC 2F5BL 1CT8B 1SEQH 4MJIE 2HCZX 3C60D 4WO4B 4TUJB 3T4YB 1G1OA 3NIFF 3DO4A 4HS6A 4HUXB 3HVDA 4OLEA 3STZA 4AITA 5HHQA 1IFRA 1AIZA 1DL7L 5EU5B 1AVAA 2CCWA 1URLA 3F84A 2X28A 4XT1C 1V55B 2VZUA 3SBWA 3AREA 5EUOB 2HLAB 3QJQB 1CLVA 5F96H 4FQCH 4MWFB 2AV1B 3HC4L 4UAHA 1Z5LA 3FCSA 1GCYA 4G43B 4WFHD 5DSCB 5ICYA 3PGCB 4ETYA 3WDJA 3EADA 3NJMA 2DLTA 3U4BL 2YEVB 3NFSH 1SXSA 1J8SA 5D1QE 5D7LE 4P9MH 3R1GH 2EO1A 2ZX8A 3BISA 4P5TD 3TL5A 5HJ3A 2E9IA 1IT9H 4QRQB 5GGTH 4NO0D 4DPBX 1ZVNA 5DVPA 1EAJA 1JDDA 4AGMA 5C86A 2CXKA 3SQBB 5JHDA 4G7YL 5IZ7A 1ZLDA 5FR3A 1TZIB 5CJQH 2FBJL 4Z5RA 2FO1A 1S7RB 4KFMA 1JI1A 3ZR5A 4HISA 1RPKA 5GXBB 4FD0A 1P7QB 5FHAL 3FQYA 2ZKHH 5EZPA 2Z7ZA 3CZLA 4IDJL 2YZ8A 1GYUA 5A43C 5KVGH 1XGYH 3PP3H 5DQ9A 2EDEA 3IDMB 2R0LH 5L8KB 1MFUA 1FRGL 5C3TA 1U8NA 1B6UA 5I28A 1NIBA 5IQLA 3P40A 1AMXA 2EYRB 1NFDB 4M56A 4WV1A 3BHBB 2BMKA 4TSCH 3UPAA 3GHEL 4LEXH 5JZ7C 2W80C 1BZ7B 1V54B 3GS7A 4X7TA 3L3HA 2VLRE 2FHBA 5EO1B 1N6VA 1Q9LA 4HWZB 2O6DA 3EYUL 3GJFB 3V6OC 2JLLA 5F1NB 2XKNA 4PJ9A 5HHOE 2KYIA 3U48A 2E7DA 2ZYHA 3MBWB 4MXVF 3IFNL 5JIKA 5I0WA 5I1LB 4ABWA 3MRHB 4I3RL 3ET9F 3DROB 3QQ4A 5IF0A 4OFVA 2IADB 4G7VL 3SD5A 4E41A 1F8TH 5TQ2H 5AW8B 1CD0A 1RZGB 4KJQD 1I8IA 4JM4L 3UP6A 6PCYA 2CLVB 5CEYB 4LASL 3ARED 3BLPX 12E8L 3TEWA 2BERA 2CGYA 5J7CC 4R96A 2B1HH 4G8GA 4Y1AB 1P9MA 3DRTA 4GG8A 5H2BB 4UQBA 3RTLA 4G6FD 4ZFFA 1H8NA 4QGTA 4Y4FA 2GBAA 3LNEA 3O4LA 4LLMB 4OD1H 3T09A 4FNUA 2Z91B 4LCCA 4HWEH 1D7CA 2F54B 4RMSA 2CRMA 4NM8H 4C56A 4WK2B 4Z0XA 5EO0A 1FFNA 1MJ8L 4Y19A 2AQRA 4YVNA 1CWVA 1P4UA 1OEZW 4FQ1H 2X9YA 3EYFB 4HC1H 3X13A 3TWYA 1H6UA 3A21A 5I75B 2WSKA 3FUMA 4XR8C 5HDWA 2Y5QA 3N04A 2DIJA 1Q72L 5JHDD 2GC7C 3M7FB 3GSUB 3OMAB 3VW3H 5EO9B 4B7LA 4H2CA 3FRPA 1CGSH 3GKWL 4AC2A 1ZIAA 1KEML 3NABL 1DBJL 3C5JB 1NBQA 3I2CL 3SKJL 3CLFH 4BH8A 2PYEB 1YYLH 2A77H 3BXNB 1E28A 5SX5H 1N59A 5HVGB 2EKJA 5GISH 1FVCB 3CLEH 4XMPL 4MSWA 1IKNA 2H2PD 3LKNA 4FXKB 3LY6A 1R5WA 2FX8L 2OR9H 4XP1H 5FGCE 2JKIS 4KY2A 4CMHC 1BYNA 3DV6A 1NQBA 3HC2A 3INUL 5JIPA 1NPJA 3D69A 4L0YA 1DEEA 1MCJA 4O2EB 4RSVA 5KG9A 4IMLB 1S7XA 3U46A 2APBA 3S8FB 4H40A 2XBDA 4H26A 3GNMH 4BUGA 4OZIE 3QAZC 1Q9KA 1YN6B 3U1PA 3FO9B 5I1GH 3MJ8A 4OZHE 4PJ9D 4XX1E 2G0LA 1U9KA 3US9A 1ZDQA 4RLDA 4U1SB 4P9HH 3T0DA 5DZ9A 4ZO6A 2A74C 1MHPH 2G3MA 1TT6A 2WUCH 4P3DA 1VEPA 5ADOL 1YSOA 4FQXC 5GS1C 4E41D 3UTSA 4A2GA 4XOEA 3O4OB 3IB4A 4PD4J 4PP2A 2BJMH 4HIXH 5E6ZA 5ESVA 3V4PA 3L9BA 2FECL 1YQVH 4K7FB 5C09E 3TN0A 5L4MA 4S0SD 3SGEI 2F19H 1XR9B 3V0VB 1N6QL 1CL7I 3GXPA 5IMMA 2VN4A 4G8GD 4L8CA 3N41F 3BSGA 1CDGA 3MI6A 2XIBA 4IRZH 3VFRA 5EV7A 2HX8A 1KV3A 4O02B 4WFFE 4Y4FD 1HT6A 1N18A 3O4LD 2BP3A 3BFOA 4MQ7A 4B9IA 1T7XA 4YWGH 1SQ2N 3KR3L 4JG5A 5IWLC 2H32A 3K3QA 1W2KT 3L95B 4V1DB 1AOZA 4C56D 5IW1B 2XLLA 4JCMA 4Z7UA 4BSWA 1K5NA 4Y19D 3NIGF 3HI6L 4I7ZC 4BXSV 4H0IA 4XMLH 3C5ZA 4XP6L 4GBXC 3TM6A 1JP5A 3GSXA 3RP1A 3RWCA 4MCZB 2IAMB 4FL4B 1HSAB 1JRHI 5C3IA 1QBMH 3ARBC 4ALAH 3VI3F 4S11A 3NIFB 4BKSC 2B15A 2FJUB 4U6XB 2FEEL 2L04A 3SE4A 3T2PA 5I16A 3QQXA 2ODIA 3U36B 2EICA 1XF2B 1ACZA 4D0CA 2HPTA 4PW4A 2OTUA 1NJ9B 1VACB 4LIQL 2Y1ZA 4XI5D 7FABH 3HS8A 4FEMA 5JW4M 2W60B 1PZUB 4HIPA 5LGHH 2DWTA 4PJFB 2YSTA 4IS6A 2D31B 3EHBC 2F1EA 2X4PA 2G60H 1I4FB 2A1WH 2CHNA 2X38A 4Y4HA 5EEWA 3QJFA 1ZT4B 3DETC 4MKTA 5EOQL 3VWJB 1VIWA 2EDWA 1RUKL 3GSRA 4G11A 2NSMA 4OT1H 3UC2A 1OIOA 4NKQB 1DFBH 4NQSB 4ZQKA 1YUKB 3LPFA 2WWKO 4LIQE 1S6NA 2NY6D 1A8JH 2ICES 1UENA 2VKXA 1CK0L 2WXMA 2Z8SA 1JMXA 3P4NB 5FCUH 5IUSA 4MS6A 5TJWK 3WI9A 4TNVF 2G3NA 3K6SB 1ETZA 2COVD 1QSEA 3MLWL 3F3HA 1RJLA 3UTSD 1FORH 1P2CA 4JZNA 5F1IA 4BK5C 4URTB 2NYZA 4OLWL 2GVYA 4JFOB 4RZCA 5MEQA 3RVTC 3SPHA 1PLGH 4WSJA 4G6AC 3TN0D 4BZ1A 2FL5A 4ZUSB 4KTGA 3UCRA 5BQ7A 2EIZA 1KN2H 5KTEH 3RVXC 3C6EA 4UQ3B 5DWPA 1RZ7H 3AAZA 4J3OD 4GI6A 3TCLB 1PEZA 4XNAA 4M1DH 4NWUL 1CLOH 2JK5A 1KCRL 2EYSA 3CVHB 5FYJD 2QELA 4K3EL 2Y7MA 2FQDA 2D2CC 2X3BA 4W9FC 4IYKA 4X42A 4NNYB 2N7BA 1LE5B 4P2RA 4F3FA 3C5ZD 4HPYH 3BWAA 4KO6A 1ND0A 3QE5A 1NEZB 1QLEL 4XH2A 1OOAA 1AY1H 3SODB 1Z9MA 2PTTA 3DX9B 5IOPA 3NSYA 5GGUB 4YEEA 4J3OF 5EEUA 2D4DA 3FSVA 3MGOB 3PAYA 1P7KB 2WLJA 5F7WC 5AVSB 5FYJU 3RWEA 4CA4A 4QXGL 2H1PL 2G2PA 2ZQKA 3EFDL 4LVNC 3WXWL 2FO4A 3D48R 1BAFH 4Z7UF 5EBLB 1JTPA 1OF0A 1N4XH 3KE0A 4NKOB 2C3XA 4NQTA 1YEEH 2BIOA 3RGHA 5AVUB 2NY4D 1FVDA 3NYKA 4Y4HD 5CIPH 3MV8A 4L3CB 4LEOB 4D0BB 4IBQA 1S7TA 4O4YH 3CX2A 1ZE3H 4ZUWB 2F54E 1MQKH 3SDDA 3DHJA 2YQ2A 5CNHA 2XA3A 4LL4A 3ZYOA 2B9BA 1DR9A 1HSBB 1XF4B 3A0OA 3KHQA 1YMHA 4NKIL 4PJBE 4C57C 1HCFX 3PNWA 4TXVB 4H13C 2C3WA 4HIHA 1N8OE 1FHNA 3IDNA 5IBTH 1ZK5A 4Y4KA 5FPIA 5AVRB 5CCKH 1R0AL 2E9BA 3W5NA 4K9EH 4YSDA 1Z5LB 4JJOA 1QSED 5JHAA 2Y6SC 3Q6GH 4G6FB 1VAHA 5DJAA 5F9WC 4I2XB 1PZSA 1MCWW 5B3JE 1PNCA 4XC3L 1YJDL 4HJEA 5I1HH 2LFGA 1J5IA 4K3JL 4MD5A 2N4IA 4ZUTA 2F5AL 1A6VL 1L0QA 5K9QG 3VMPA 2WLLB 5F3HA 3TOPA 3ERXA 5BMFL 3QCUH 3VDAA 2CUMA 2E27L 3JV0A 3FQUB 2ZOWA 5G55A 4AXWA 3U4EA 3WTSA 3AC0A 5HHNB 2E74C 2L7JA 3MLUL 1NMAH 1ICTA 1IC4L 4M48L 2APWA 2EUVA 4P2QB 1USZA 4B5EA 3FFOA 4V2CB 4ZTPH 2DM7A 3O2DH 4P2RD 2PLTA 4PRNB 1QTYT 4KKLC 5JDSA 3IMVA 1RKRA 4OF7A 3EH5B 1CDJA 3VJ6B 2WOBA 4YDIH 5DQ9B 2HWZL 1F42A 1INQB 2P8LB 2XXCB 3PXLA 4H0HB 3BP6B 5I8EB 4ETQB 3QG6A 4LB8A 1KLUA 5BS0A 5ID1B 2HFEA 4MLIA 2XN9E 5LQBL 4WV1B 1WC7A 3WNLA 2O6CA 5DGQA 3BSZL 4HPOL 1YAZA 4LSUH 3G6DL 1F3JA 4WNSA 1GH7A 1UA7A 4K23L 3VO0A 1LNUA 1Q9LB 2A6DB 2AEPH 4HJSA 1HZKA 1X3DA 4FFWD 1HHJB 1EHLH 3GSNH 3OJDA 3FU0A 1M7IB 4K3GA 1OLLA 3BVVA 4PJ9B 2ZSVA 4OF3A 4U1MA 1PNDA 5AYTA 5FUOL 3U6XS 1U3YA 2WTPA 1NWOA 1QP1A 3MV8D 5I1JL 3RFRA 1NC2A 2X4QA 1SFDA 3X12A 4IBVA 3GXTA 2BW4A 2YPLE 3VYOA 3V6OA 5CGYC 3SDDD 1G4MA 4V1DE 3MJ9A 1M7XA 3E7JA 2ADJA 2ED8A 3NIGB 4MCMA 1Z9PA 2QVTA 1I8IB 4GKZB 35C8H 4N8PA 1VFOA 5CUSL 1KCUL 2RTTA 4Y4KD 2L7EA 4HS8L 5EC1A 1G7QA 4LOVA 3QWNA 1DUYA 1UUSA 3T0XA 2F7OA 2OMUA 3VI3B 1PSKH 2PPFA 5FA3A 5K9JH 4GG8B 1ZLVK 3QNZA 3VD4A 2XWTA 4OR1A 1JZEA 1JD7A 4U1JA 2XKSA 3W11C 4IGBC 4F57L 4WHDA 4LCCB 1SEBB 5GRUL 2R23A 1ASPA 2NR6C 4ODTH 5CCGE 1NA8A 2IDCA 4Z0XB 3FB5B 3O3BA 1FFNB 3QFJE 4FHBD 4NC2B 5E8DH 2XV6B 2ZOUA 4B9CA 4QF1A 3LEVH 5HGAA 3MCLL 4MNHB 4ACTA 2O72A 5F6HI 3IXTA 2LAGB 1TDQA 2AAVA 2BS71 1ZGLM 1L0YA 2X6UA 4IU3A 5L6YL 3DMMB 4KPHH 1P0SE 3PS6A 2EVGA 1OSPL 3HLAA 3NA4A 8CGTA 4N6RA 4OZ4A 2W0KA 2DQIH 3TFKC 1BWMA 1M7UA 2DLFL 3QXDA 1MCEA 4N2FA 2DYRB 4MTMA 1PZCA 5BS0D 3IS1X 3ASOB 2IH9A 1JGUL 1NCBH 5DJ8A 3ZE0F 3DV6B 3GI9L 5I76A 1XQ4A 2VERN 4ZD3L 2V2XB 5C6WH 1T20B 2YWZA 3L7EB 5MHSE 4YDLC 4IEFB 4WK0B 1S7XB 3A6BL 1IBYA 4ZAKA 2BVQA 3ARDB 3OWEA 2VR3A 3Q8EA 3MJ8B 3QULB 2BSEA 4LQFH 5ISZA 5BRZB 5JZ7D 1AOHA 5IB5B 3SPJA 3FN9A 1WBZB 1NC2D 2BXYA 3RWFA 3FQRB 4HUCA 4XMKH 1UYWL 5ADPH 4GXUM 3GSOA 3VQ1C 4HJGA 2R1WA 1PCSA 5D96C 4DQAA 1X6NA 3DSFH 2WXLA 3V4PB 3BGMA 1OTUC 4R4NC 3LSOA 2WC7A 4IBZA 2K4WA 3WHXA 4U3SB 4FQXA 5GS1A 3U0WH 3VXSA 4NEHB 1VEOA 3G6JE 1SOSA 4WHYH 3VFRB 2B8OT 4YBLB 1CBJA 3ISRA 4W9JC 4MZ3A 3IGLA 1DANU 3C75A 4GMTL 4MQ7B 3V95A 2FCBA 3OKLA 2P47B 1CURA 3DI3B 2ZNWA 3FU5A 1LK2A 1QPXA 1PX3A 3HI1B 2V3FA 2G9HA 3KPQA 4QHMA 1KC5L 4QOKE 3IYLW 3P0VH 1MJUH 3ARGC 4Z7UB 3SN6N 1RY7B 1A66A 2EADA 4LPTA 3C5ZB 2CHDA 2VXQL 2W38A 3GSXB 3RWCB 5IWLA 3HPJB 5IT2H 2QBWA 4JO3L 4IBWA 2FECI 5JYMA 3KXFB 2GHZA 4JDEB 1MCDA 1OL0A 5DDHB 1H15A 4HCIA 4QLRA 4WFGE 1T80A 4FA8A 1H5BC 4GBXA 2Q3XA 2W0FA 1KIUA 4L37B 4Q74A 2NXZB 3NACH 3V0WH 5I16B 4DUVA 3H7BB 4OLVH 5SWSA 3UBGA 3ARBA 1INEL 3T0VA 1TZ8A 5CD5C 4G7YH 3DIVA 2A0LD 1MHCA 3O2WL 3FONB 4B9KC 5I8CA 2OMZB 1J0JA 2BSSA 3FB7A 4UT9L 3ZGIA 1JWUB 2JV6A 3GEWB 4YX2L 4E42A 3GK8L 4IS6B 4DFHA 2NY4B 1NIAA 1AHKA 4Y4HB 1CFNA 3QJFB 3WJMB 2A73A 3GRWH 5MENA 1BQLH 5ALBH 1PBYA 1WAAE 3MA7A 5DEZA 1NEUA 4ZAKD 4X6DA 5BZDA 4ZQKB 2NW3A 2QSTA 4XMUA 5CWSB 2BSED 3B4NA 5ISZD 4F7EA 2FEEI 1YO4A 4J3WA 1QLFA 2BIQA 2N0KA 4NJAL 4AKPA 3UO1H 2JCCA 1Z1WA 1G7PA 1DQMH 1OV8A 4HIIB 4ALAC 1ETZB 1QSEB 3QZOA 3AB0C 3K2UL 3GJEA 3X14B 5F1IB 4JFWA 1S7VA 2PTUA 2GT9A 4JRYA 4JO1H 4XB3A 4G82A 1RPQA 5BQ7B 4WK4B 3TNNA 3DKHA 2XPZA 4FQXD 4RWHA 3VXSD 3P4OB 4BK5A 3VG9C 1U93A 2D3NA 3PHQA 1YC7A 4HIEA 4JM4H 4OIFA 4LRNL 3M1OA 3QSKB 12E8H 2JK5B 2LV4A 2WXKA 3VXPB 3OX8A 4B0MB 2G3ZA 1KYAA 2L3BA 3T4AA 4OGYL 3CDYA 1MN4A 4MLSA 3MV9B 3EH4B 4F2EA 3KYNA 1KCSL 3IJHB 1NAKH 4AZUA 1I3RB 2ZOLA 3FH5A 4BK4A 1A6TA 1BFVH 43CAA 2BSBA 2MHAA 3K2KA 1JHTA 2PTTB 3GBNH 3B6SA 5BZWB 1KCVL 2UZYA 3ZTNH 1OT4A 5A3IC 4GBXD 1JWSA 3GB7A 2CLZB 4Z7QF 4AGOA 1PG7H 2O5ZL 2QZQA 1BEYH 5SWSD 2YSSA 4M6ML 3X3FL 4DPAX 3ARBD 4AYDC 3ESPA 1THCA 1V7ML 3K8MA 3VXME 4NHCL 4Y89A 5DGRA 3FH8A 3IPBA 3FW6A 1N3NB 4U4BA 4DCQA 4G7RB 4F37F 3NJLA 4BH7A 4OJEH 3WFDL 1FVDB 4K7PH 3MV8B 1UT9A 3PGFL 5MEND 4XOBA 3UEZA 1S7TB 2KH2B 4BRJA 5HI3C 5GGSA 3FFCA 2HAZA 2YUWA 3MLRL 1I1YB 1RK0B 2GQHA 2NX5A 1U21A 2DY2A 3EHBD 4XCNA 1KFAL 2CHZA 2DQEH 3MRDA 3DETD 4I77H 4JO5A 4ODBD 2P5PA 3IDNB 4ODUB 1IEBB 2H3XC 5DS1A 4F7PA 3PQYA 4NO5B 3S2AA 3ESUF 1TKWA 4YHMH 4X5XA 4CADA 2FLMA 4Z7WE 2OCFD 1BREA 1I9RH 2WLMA 1ORQA 2EVJA 2P24A 3N91A 4PJ7E 4B7IA 3KYKL 2IF7A 5TDOA 4JPKH 4XZ4A 4JRYD 5JW5A 2XBZA 1JPSL 5I5MA 4JREC 4WLCA 4JRXA 1CF8L 5DRNB 3UYRL 5EEYA 4AMKL 4I1PA 3BP5A 1FIGL 3EDJA 4J2XA 5E2JA 1NCAH 3DECA 5IQOA 3D12B 3QK0A 3RVTD 1NMBH 2YPVL 4G6AD 1FL5A 1WD8A 4KVNH 2K70A 3CWGA 4N2NA 4YDZA 5F9JA 3TJHC 3ZE0B 5F89B 5EEZA 1RJYA 4JDTL 1GXEA 3RVXD 4OLYL 1J88A 4O5LH 5EUKB 1E5BA 2JCCF 4H8HA 2ZJSL 1I7ZA 1AKPA 1Z2KA 1KLFB 1X5XA 4HT1H 4AV5A 1ZVSA 4LZKA 5AENA 4YHIA 3AQXA 3CHPA 2W9EH 4Z95L 4EPSA 3S35H 2GAZB 2CRZA 4X6EA 4MAYB 2DN7A 4HUUA 2ROYA 2XWBA 5E56A 5EN3A 1OP5K 5GGVH 2FTAA 3GMMA 2Y9RT 3OXRA 2VDKH 1GGUA 5GS3A 5BS0B 1TEFA 2X89A 2QR0A 3QZWG 3PP4L 5EF0A 1TG8A 3GJFK 1VKXA 3ZKSD 2AERT 3RUGE 5B38G 1JIBA 4DZ8B 1X5ZA 2A6IA 2JE8A 4FQIL 4Y5YB 3HG4A 3NH7L 1U92B 1F3JB 1K8IA 2A9NL 3D5OF 1UGNA 5GGSY 5AWNL 3G9AB 1TJGH 3OJDB 3TIEB 1NFAA 4OIIL 4ODSH 2IPUG 4OCSL 2AQSA 3MODL 3QDME 2I60L 1U8IB 2O93L 2X4QB 1E90A 4LGPB 1AZRA 4TTGA 4QXWA 3FFCD 1K3ZA 3WNPA 4LSVH 2VNCA 4ZFGL 2NX5D 3Q05A 1UD3A 4HJIA 1FNFA 2ICWB 2IIJA 4GI9A 1DVFC 1FP5A 3PQYD 4N3TA 3HB3C 2VZTA 1RUKH 1NUDA 2X4TB 4HUNB 1XB8A 4CSTA 4RRPG 5FA3B 4NUQA 4G9FB 4NZRH 1QRNB 3KLKA 1VGKA 2A9BA 4S10A 1S2EA 3WEAA 1P5UC 2JKJA 4PG9A 4NQDE 4X6BA 2Q3AA 4I4WA 2OCCB 2X3AA 3Q3GA 1MSPA 1CG9B 4JG9A 4JRXD 2Y6SD 3HKZA 4QWWC 2X2JA 4ZTOH 3S3SA 4ABUA 1HOCB 1C5CL 3V0JA 1AXSA 1CI3M 1RZKC 4IGBA 2XICA 5HGAB 1XGTB 1ZLSL 4D0DB 3UTQB 5T5FA 1AH1A 3CFDB 2NR6A 4IKLA 3VGDA 1IGML 4MQTB 1AI1L 4G5AA 1QR1B 1JPST 1QD0A 4WW1A 1PLCA 1XAUA 1XCQB 2Z9TA 4GAJH 5I6MA 2Y1YA 3H0TA 3S8GB 3T8MA 1WS8A 3KGSA 4N6RB 4OZ4B 1RUQL 4TNWF 4X5LA 2VAJA 5DMJB 2J88L 1MCKA 4AIOA 3LHAA 3PFQA 4X5PA 3KPNB 2HT3C 4QO1A 1XF5A 3ILPA 3HE6C 2ENJA 2XC8A 1ZV2A 2X89D 5CINL 3TYGH 1UB6B 5IFHL 4KKLD 2HTLC 3CH1B 1IEAA 3RURA 4BXVA 4KO5A 3N44F 4AYSA 3KVDD 1LO0L 5I76B 5T33H 2AJUH 3TJHD 2K6ZA 1OAZH 4FMVA 2B39A 3SQOH 2WWMC 5KBKA 1H6EA 5BVPL 1N7ML 3BQVA 1NGWB 3U2IA 5AW0B 5DJ6A 2H1PH 3LRMA 4QRTA 3FPXA 3R0NA 2DDQH 4LLVA 4S2SB 3VFOA 4FKKA 3JBG7 3WJJC 4KDVA 3NSDA 3QJTB 4RZKA 1JNHA 3VNYA 3RGVB 5F3BB 4HJGB 4JCLA 1BVLA 2C7UA 3EOYG 3O3DA 4HC1A 1UOVA 1BZ9A 3D30A 3KG5A 1DQTA 4UQ2A 1WS7A 1PIFA 2A74B 3SPIA 3EJSA 5CGYD 5ANHA 1AGBB 3WHXB 3MX0B 5LWYL 4KXCA 4NKIH 1F3DJ 4Z7QB 2BOBA 1A1OA 4PLKC 3IS0X 1RIUH 4N2GA 2O5YH 4GSDL 2V7NB 4X99A 2O61A 4DPRA 2O5NA 4FE9A 3U25A 3K2MC 1C1EH 1W0VA 3AVEA 1F1AA 1MQ8A 1KY7A 1A14L 1XD1A 4IGBD 3TONA 3FT4A 4MCNA 4XBGB 3W11D 2AQ1A 3IMUA 1E4HA 1R3LB 3HPLA 2BSTB 4D7BA 4DNLA 1MW0A 4JK0D 2NR6D 2ATKB 2Z35B 1A6VH 1E5AA 1M7DB 3ARGA 4QXTA 1H15B 3LZLA 3PL6A 1KN4L 8PAZA 1RZJH 5KS9F 3X3GH 3QO1A 4Z0BH 3VD0A 2W0FB 3HNVL 3LZFH 1RURH 3ARBB 2A9CA 4WJ5A 5E99L 3HZMA 1AZUA 4NNXA 1WVZA 1MHCB 4HLJA 1FDLH 1H5BA 2W0LA 5ERWA 2WINB 1BQKA 1XGZA 2H26A 2IO5A 2OL3H 4ECNA 2WYHA 4CNIA 3WTXA 3TFKD 4BZ2L 5K5YA 3BH8B 3MGAA 2XPYA 4QTFA 5E2VL 3WGVB 2HWZH 3IGFA 4WTZG 1IAOA 3D85A 4ZO9A 2R69L 4LBEA 1Q8MA 4PS7A 3V9CA 5LAPA 3EBIA 1JNLL 4IRZA 3N50A 1TQWA 3LNDA 2ZUWA 4RVBA 4Q9RH 4XE5B 2NW3B 3ZRCC 1KLGB 5HI5C 4FXLA 5F71A 2GUOB 1WPCA 1RJZA 1G4RA 1KWKA 4MZIA 5AOZA 3L5JA 1FGNL 1QLFB 2ENQA 4KH2A 2V8LA 5CLYA 2FX9H 2JCCB 2NZIA 1OALA 1G7PB 4U1KB 5B39B 1KBGH 2YMTA 3M1CA 4F2MA 2FYYA 3NMEA 3FT1A 5DU7A 3BDBA 4Q89A 1I7UB 3P3RA 2V9UA 1CN4A 3QR1A 4UT6L 2GT9B 3H2PA 5MEOA 3BKYL 1E65A 3C6SB 3TNNB 5DD3H 3H3KA 1NBCA 3HZYA 4KKNA 1J87A 1PZ5A 2VW6A 3IAQA 1U93B 1MFMA 4PY7A 1OTUD 4R4ND 1L0XA 2FHCA 2OZNA 1B2YA 2WK2A 5I2IB 3GBDA 3O11B 2ZXEB 1NLDH 3K6OA 1DQJA 1CVRA 4G6JL 2EXWD 1FQ9C 4A7GA 3N40F 1ZT1A 3ULUL 4YSRA 2H1LM 1IGJB 2GYSA 3MRBA 4YXLH 4MJHA 4DK3A 4HDIB 1CFBA 4LQ1A 3BZ4B 2ENPA 5SX4H 5I1AA 3KYNB 2O26U 5D2NB 3UTTA 1KTKE 4NN5C 3SKMB 1WDAA 3BEVA 4C54A 4WKXA 3Q2WA 4QEGA 1A6TB 1OGPA 3TWCH 5LBVA 1UXSA 4QAMB 1DJIA 1S9XA 2WPGA 5DUMH 1KTBA 3H8NA 3ARGD 4P2AA 3PL6D 4KQ3L 4YUEH 5T1KB 3KPOA 2PCFB 3GB7B 4HALA 3EH1A 2CM6A 4F58H 4KBPA 3HUJE 3ULUE 3GBMH 4ZNEA 1DJZA 3NJNA 2BNRE 1M6UA 2K3HA 2M83A 4ADGA 1IKOP 5F6HJ 4YL4A 4I85A 4AQAA 4I9WD 5CD5D 4UZUA 1COBA 1L6XA 5IQ9B 3D85D 5HDOA 3TH2T 4HKJB 1JGUH 2ZCHL 3CZJA 5EFIB 3IVKA 1OHZA 3MRDB 4OF8A 1S3KH 1X7QB 3UTZA 5D71H 3QDAA 1F4YH 1KGYE 2A9ML 4L5FE 4F7PB 3SQRA 4NGHL 3HIZA 2J12B 5SWZA 4X5XB 4CADB 5DHVH 1SDDA 4PJCE 4D9RD 1HH9B 2VXVH 2ZCLL 4JL2A 2ESVE 2EXYC 1CFSB 3MRGB 3TA3C 1WEJH 3F7YA 5F0JB 3LQMA 3PWVB 3CHRA 4S0TD 1SHXA 3V0HA 4DZBA 3LKQB 5JW5B 2UX6A 2BWQA 3SE9H 4M7JH 2QPFA 1XSIA 3A3YB 4GAAA 3BP5B 4CU6A 1X5LA 3BE1L 5FA4A 1XX9C 1DE4B 1T1ZB 4QHKI 5HGDA 5CKGA 2R7EA 3N44B 2E6PA 2DIEA 5F9JB 4O2CA 2GCYB 2CUIA 4AVKA 3MBEC 4BQBA 5E4EB 2C9PA 3MRJB 5HYJE 1N9PA 2OXHA 5FYLD 3F58H 3TEZA 4I48B 5F7MC 3MROB 3HJ0A 3UTTD 5I0VA 1A3LL 3MACH 1TVHB 2QPUA 4PRPB 3V7MA 4TLTA 4AGPA 4BGDA 4RMRA 4HUUB 1LO3H 2XWBB 2PR9A 4GS7C 5I73C 1ZIBA 4KMQA 4DGIL 4F7MB 4XHJC 3GMMB 5DHEA 3UIYA 3OXRB 1G9MC 3QRBA 2BY1A 3FB6B 2QR0B 3O2VL 3VTTA 5DD0H 4F5CE 3RDTC 4OV6F 1J1XL 3U0PB 4RQQB 3DX3A 4FJZA 1CO1A 3BAIA 4E9VA 4A7GF 5L8LB 2ZXBA 5L7XL 4PVNA 4U6VL 1V3JA 4PV1C 1ZLWK 4AEFA 5A3ID 2NT0A 4QRRA 5EU4A 2DD8H 4P3CH 4LSQL 4NFBA 4XNMA 4Q14A 1NBYA 2RQEA 1NCIA 1G0YR 3RAJL 3WDIA 1T7VA 1KB5B 1YEIL 2WIMA 4ZYKA 2NCMA 2XPGA 3EG9B 5KSUA 2GTQA 1MPAL 4NZTL 1VERA 3L3OB 4W4NA 3EDEA 2EDDA 1QWUA 1UWGH 3L3DA 2ETWA 5IHUL 1T6VN 4PCSA 2J73A 3U7WH 4K71B 1H0DA 3FQNA 4QJ5B 5HI3D 2QSQA 4WEUD 1U3JA 5SWZD 1M9WA 3EXLA 4NX0A 2HJKA 3B5GA 4JQXC 3TT1L 1WK0A 3MCKB 4IHOB 5KS9B 3O2DA 1G9NH 1DVFA 2HFFA 5EPMB 2BW5A 4XBEL 5GRYA 2MJWA 4PG9B 3RJDA 3OAYH 1W6WA 4WI4A 3RKPA 3X1NA 1IGTB 4R7DB 4JG1H 4M6OH 1LDPL 4JFFE 4UV7H 3K2UH 5ANME 4M1GL 3H6JA 3LEYH 2H0FA 1CBVL 1P5UA 5AG9A 1DSWA 1V3KA 4GNKB 5FO7A 4CVXA 3JYBA 3T1FA 4KVCH 4BFFA 3DJRA 1M6OB 4JFYA 4ZFZA 3HFFA 4GKOA 4WWOA 1J8HA 2MPAH 3BX7C 3S3CB 1FVEA 4XNXL 4KY1H 3N1PC 4X8CA 2P8PB 4J4PC 4H8WL 3F83A 3QYNA 2KERA 4NYLA 2ENSA 5E8PB 4F15B 1IIIA 2ZCZA 1BQHG 3EOTL 3ZKXC 5IP4A 2NY5L 5D1XA 4XNQB 5J1AA 1I1AC 3OZ9H 2G4GA 4ONHA 1S7UB 2AKRA 5IHWA 5GGRB 2Z4TA 3HE6A 5F7YC 4F8NA 5E6SB 3VFPB 1AO7A 2BP8B 1ESOA 1FLRL 2BCKA 3OKOA 4QRRD 5GSRA 2BVPA 1KNOA 1O7VA 2BNQB 3HN8A 1LEKA 3UTPE 1KGWA 4OSUH 5C7XH 1UD2A 3MDJA 3DARA 4EBQH 1WWAX 4QRTB 4YDLB 3NCYP 3F62A 4FLHA 5C0DA 3VFOB 4BUQA 4ZTEA 1JNHB 1JPGB 4HUMB 2DQHH 3IAGC 2NY0B 1AXIB 2CR6A 3O3DB 4TLUA 4BDVB 3BMWA 2GSGA 4FABL 1QSZA 3CC5B 5D2NE 1K5WA 2NZ1A 3WJJA 4JPQA 2MKLC 3VD5A 3JWNH 4JPWH 1D6EA 3PAVA 4OV5A 3MLRH 2V9QA 2NY3C 2MCPL 4ELME 4NQEB 5TQ0H 1KFAH 1A7QH 1PDKA 1J9TA 4FJYA 3BKJL 3I02B 1DVFD 4XMVA 1A1OB 3JWDL 3T0EB 3HB3D 1U91A 4BK8A 4OFYA 1LWHA 4H0LC 2WN3A 2DF3A 4FEIA 5C08B 4X4ZA 4B53A 3PREA 4BJLA 1N64L 3COOA 1L9SA 3ESOA 4YR6A 4LCWE 2H0PA 4XRCA 3RY5A 5HXMA 1REIA 3FRUB 4XBMA 4ES8A 1JZ2A 4ODWA 4TVPH 4HBQA 1FFTB 5HHVH 3P73A 4CKQA 1USQA 4QWWD 3PWLB 3L9RA 2GY5A 4QXTB 1JPTH 1AS6A 2E3VA 3EJJX 1BLIA 2J4WH 1NGYA 4Y2OB 3H3PH 2CK0L 2YGNA 2Y06L 4QTIL 1B4JL 1J8HD 4IMKC 3OXSA 4Q56A 1LE9B 2A6JA 4M5ZL 4XO3A 5EU7E 3ZR6A 4ELDA 3VNZA 3MBXH 4P0DA 4NQQA 1L3NA 1UKSA 1ZS8B 1TSRA 2JKNA 1ZTMA 1I31A 3IDYB 4DOHB 4GRWB 5D1XD 4Z95H 3SPVA 4A7UA 1NAMA 3OB8A 4A6YL 1L5GA 1MVYA 4CNIB 1T6WA 4TTDC 2BVYA 2JVUA 3TBWB 5BVJA 2HT3D 3HE6D 4GRMA 4NLHA 4PWJA 5E1AA 1FH5L 3RPKA 4UYQA 1AO7D 5BO1L 2H2SC 3QCVH 5HY9A 1UH2A 1FI8C 2HTLD 1L0PA 3LPPA 4L8SC 3QC6X 3AU1A 1F4HA 5DJDA 2DV6A 4PLOB 3MUJA 1QA9A 2I5YH 5DK2B 5GZOC 1R3IH 2VH5H 3H9SE 1F02I 2PPCA 2WWMD 4LP8A 4TUKL 1FO0A 4N6QA 3DXAE 1MHEB 4WWKB 5C0EB 4FP8H 3FK3A 3KNBA 4C47A 2FYYB 4J12A 4TLSA 1RZJC 4JDZB 4RX4A 4BYHA 4RIRB 3VG0H 1A9EB 3AB0B 4XXCC 4YGAB 3A6CL 1KJVB 4AUYA 3IDGB 4X7FC 1R3HB 1L7TH 4HJ1A 5LUMA 1BG1A 2C3VB 3GSWA 3WTUA 5FM5M 4DPCX 2K7PA 1OM3H 4JHWH 4YK4B 4OFYD 5DCCA 2XFXA 4OLXL 4H88H 4TQHA 4UIMA 2WXOA 3MRBB 1JFQH 1M9SA 4P2OB 1IL1A 4L4TA 2XQBH 3NZSA 5FKAA 1XGRA 1DBBH 2WSPA 1K4DB 4LSRL 4PLKD 5ITFB 1GR7A 1Z5HA 4FA7B 4QTHA 3ZUCA 3HG1A 4XAWL 1SDYA 5T3ZH 4A7QA 3D3VB 3ARYA 5KBMA 3L08A 4YO0B 1YHPA 1ZPLA 4R8WL 2R29L 4IDLA 4LLYB 5LGYA 2OMXA 4RAVA 2YK1H 3Q48A 4J8QA 3OTTA 1MRCH 3REWA 2D7TL 3CFJA 5AKVA 4M8QA 4OZFH 2BIIA 5AW3B 2IANB 1U58A 3H55A 3EYOA 2CCVA 3PHAA 1KYFA 1PKQE 3UG3A 1R5VA 1UB5A 2ADFH 3TTYA 3SKOA 3DOIA 3KH3A 5A2JH 1GJWA 1L9RA 3F04A 4KZEL 2XCMC 2Y2YA 3B1TA 2AK4B 1RUQH 4YHPA 1KGXA 2MQCA 4NXKA 4KNQA 2FATH 3W39A 1I3GL 5BPPA 1W15A 1P1ZA 3RA7L 1OD9A 3B7SA 2J25A 2WXQA 5JXAL 1X5IA 3UG5A 5D70L 4PW9A 2VMFA 2FNBA 3HAEA 3UAEA 2IGTA 1BAWA 1BP3B 1YY8A 3L4UA 4R7NA 2AQ2A 2PXYC 3B7RL 2QGBA 3RI5F 3KS0H 1ZMYA 1OAKL 1WH0A 4DTGL 4N1HB 1A3RL 1CZ8H 1E8WA 4PP1C 4GG6E 2FZ3A 3VQ2C 3EYSH 1IBHA 5HI5D 3UG4A 4U0RB 4H4NA 4JG0H 1HEHC 1YDPB 4RX4D 3Q2LA 1IM3A 4QKXB 5IVNA 2ZT9C 3S37H 4UDTB 3OR7A 1ZT7A 1W72H 3TA3A 2J6WA 3EIFA 4JRWA 4FZEH 5JPNC 3MRQA 1RD6A 2EIJB 4GPVA 4O2CB 4XBPA 4PUBH 2D9QB 5D6CA 1EMTH 5DA4A 3BEWA 1B9KA 1UZ8A 4OM1H 2J5LC 4HCRA 4PGEA 4Z77A 2R8SH 4FFTA 4L4TD 1KBPA 2WLHA 3U1SL 5D2LE 5I23A 3EBAA 3GGWA 4M7LT 4WCYL 3HG1D 4AYEC 1AQ8A 5JOFB 5DC0A 3OBAA 4ZPTB 2ICCA 5FIEA 5CEZH 1OVZA 4LT7A 4JE0A 1UXMA 5J6SA 3FSWA 5HVHC 1QFWH 2QFRA 4PGZA 4XB7A 3C9NB 3RWHB 5L2JB 2EH7L 5DC4B 3L5IA 4Z6AT 1CFVL 1TYEB 4FFYA 5K1JA 1X4ZA 2UY6A 1KIRA 3CDZA 3RDTA 4GKNA 2Z1KA 4OBRA 3P3YA 1QFPA 3FS9A 4FMKA 4MJ4A 4KQ4L 4R4BA 1SN5A 2GTWA 1TO5A 4N1EA 4X9BA 1XEUA 4JGNA 1LEGB 2EDKA 3HTLX 2CKBH 1JGDB 1T5WB 1WFUA 1WO2A 1U95B 1JGVL 4BZ2H 3L3DB 4UOJA 3D4ZA 4XO4A 2ATPB 4KDWA 4ZDHA 3U7YL 1YUHA 4QYAA 5C07B 2DAVA 1E5YA 2ZWZA 2ZICA 3I6KA 3MR9B 1RSYA 1B3JA 3SB3A 2HJKB 3QUGA 4Z7NE 4JANA 5J0BA 5DZVA 2IPTH 2WQXA 1RIVL 5F9OH 2OSWA 2BVUA 4F7TA 1DVFB 2HFFB 1PG7W 3B3BA 2WBJC 4J2QA 1S9YB 3EW3B 3BZEB 1IM3D 5CEXB 4KKAC 2VC2B 2WNWA 5AFAA 2Q8BL 5KBNC 3K5SA 4JQXA 4EO5A 2EXYD 2ADYA 3B7UX 5TE6L 1MJ7H 3TA3D 5KW9L 5EF3A 2P9RA 4UT6H 1FE8H 5I6XC 1P5UB 1OCRB 3RNKB 3T3PF 4K7PY 4JY6A 5FO7B 5AOIA 4JPVH 2XZAH 3BQUB 4KX7A 3VFGH 5D7IE 5HYIA 2X1QA 4PREB 4W81A 5DURD 4OB5L 3VU1A 1Z3GL 2IGLA 4ATTA 4G5ZL 4LSSH 1QI3A 4QNPE 3THMH 3TJEL 1FVEB 2LOEA 1P6FA 3PAUA 2WBKA 1CFTA 4JFDE 5IMLB 3ECBA 3ULUH 2P5WE 2ERJC 1AHWB 5CR1A 4P05A 5H35A 3CDGA 3NQIA 2ZWKA 1U8CB 4AYID 4HU2A 1INDL 2XIDA 4LU5H 2CO6A 1IJNA 2P43B 3VGBA 4UIKL 1VFAA 2VDPL 2WNKA 5FOBA 1N12A 2YXWA 3Q8BA 5J1AB 1NBVL 1AGCB 2P5EA 4J4PA 4N0YL 1G9NC 4R3SB 1QFHA 2AKRB 4KQ0A 4HV8A 4G9DB 5KSVB 1OGAA 3HE6B 4N2CA 1T0MA 4ZUVA 4XHJD 1QTPA 1CL7H 3OJMB 4FQPA 3RDTD 1JYWA 1HZHL 5GSRB 5HGBB 2BVPB 1I1AA 3KLSA 3V4VA 3MRRA 1LEKB 1DTUA 5KAQG 3L4ZA 3GMOA 3ZN6A 2FEDC 2BY3A 2JSFA 5F7NC 1MJJA 5JOPE 5D9SA 4HFWB 2NZ9C 3NIDB 1BX2A 1KCKA 2FJFB 3D39A 4AT6B 2HJLA 5TFSL 3T5WA 1ROWA 2GTZA 5TE4L 5L9DH 1FL3A 2Q20A 1A7PH 3N85H 1O6VA 4L5FH 5D4JA 3DVNA 2XWJA 4AJ0A 1FNGA 3OM3B 1OCCB 1UD5A 4OFIA 4UINH 1Y1DA 4FXGC 5KBDA 5J1TC 4MGXA 2YRBA 3QORC 1A5FL 1D6EB 4PJGB 5GGVY 3Q1SH 1ZVYA 3VWKB 1G7HB 2N7SA 3M17A 3MMEB 2OSXA 3ZZSA 2WQVA 3FCBA 1RZQA 4O2FB 4PTTB 5IV2B 1BEXA 4OCRH 4HCGA 1JK8B 3GMLA 3O0RH 4DQOL 5LG6A 2WQWA 5B3SB 4XRCB 2WCGA 3VXNB 2EO9A 4ODWB 4QYOB 2WLNA 2OZ4A 1FC2D 3VFTA 1H8OA 1HS6A 3L9RB 2DJ4A 1P84K 2FEJA 2ZUQC 1NGYB 2JJSC 2DQJH 4UDUB 3NEXA 5T1JA 5GZNC 4YQXH 4YHNA 4NN6B 2A6JB 2IQ9L 2ZXAA 1KT2B 3RX9A 1F6AA 4TSAL 4NWTH 1NC4A 5CLTA 2FD6L 1EHXA 1AC6A 3JWNC 5IESL 4APXA 2FIRT 4OW6A 3PJSB 1AXTH 2YWYA 4IMKA 3LRLA 3SDCC 1A3LH 2V4LA 1CQKA 3CQPA 2J20A 3SPVB 1NAMB 2ZOOA 5FM4A 1UCBH 4ISVA 2P5ED 4J4PD 4QAWA 1OGAD 5IEKB 1GGIH 3EGXA 5E1AB 1UZ6E 2QDVA 4DGIH 3HMWL 4GQPH 5T8IA 5L4FA 1TJHH 1VZIA 2A9DA 3KEHA 3NJIA 3KJ4B 4JKPL 4EIBA 1I1AD 5DJDB 2X09A 3RPIB 1R3JA 4MNQB 4XNDA 3CLWA 1JAEA 4HXBL 5ESQA 2OSLA 2E7LC 1BFOA 1FO0B 2P45B 3D39D 3SKNA 4FLSA 4L8SA 1WD9A 2JQAA 2WSDA 3WFEL 5ETUB 3KNBB 1SXZA 3APFA 4Y5VC 3E6FB 3OKDA 3GM0A 3WCYA 3RFZC 5DJCA 5GZOA 3IJEA 4XE0A 2VQ1A 1HXMA 3SD2A 3WMSA 5GJTH 4O58L 3II3A 1XZ0A 3VYNA 1FAIL 2G2NA 1JBJA 3PIQB 1Q9WA 4X2UA 4DGVH 1SY6H 3GSWB 4ZS6C 4UTAL 1S9KC 4M8RA 2XFXB 3ZE2F 1V5JA 2XZQH 4XXCA 3WEBA 2NY3D 3EJZC 4NRZB 4UIMB 3P3UA 3WFHA 2E9GA 3TT1H 4JN2B 3JWOL 2F58H 5B3NA 3MREA 2OL3A 4QIRA 4WHTA 5D4HA 3QXVA 1VGEH 3UAJC 5DHYA 2F6AA 4CN4A 3NA9L 4X50A 2CU9A 1LDPH 2JFCA 1NDMB 1RULH 3L45A 4L2LA 5CBEA 5EF2A 4XX5A 1JFHA 3IRCA 2R2BB 2BVOB 1JWMB 1XDTT 3ZDZF 1BQRA 1F3DH 2CJUL 4B9PA 4CSZA 3REWB 4KHXL 3MJ6A 4Q9CA 4BE6A 2Q3ZA 1I9IH 3ZOAA 1EAPA 3OJ2C 3TPKA 1NC4D 1X9LA 3EYOB 5L8JB 3NAAL 4ANKA 3LRSA 1AE6L 4KNTA 3SKOB 1ZLVH 3QZMA 5TF1H 3DK0A 3T8XA 1Y07A 4XZUB 4PJXA 5D7JC 3T2OA 1KFGA 1FSKC 2QQLL 4JFZL 3W39B 1ZTXH 1KPRB 1XSOA 4WU5A 1QUNB 3LH2H 1OP4A 3KPRB 4L3EA 4ELKB 4J6IA 4TTDD 3BKCH 1CGUA 1UWXK 5PCYA 3LH8A 2VITA 4R7NB 3T3PB 3WDHA 4CAGA 3JV4A 5AKTA 4K94H 2EUXA 2FR4B 5IEHB 2H2SD 2UWEE 3NCJL 3DOHA 4PGCB 1X4XA 1YRKA 4NC0B 5B1CA 1I7TA 4OY9A 4XNUH 2V33A 4MX7B 4N22A 5DHMC 1X5AA 2RHEA 4YDVA 4PJDA 5GZOD 2PXYA 3IFLH 4OCLC 1R46A 3GMQA 3DYOA 1DJHA 5CXPA 1W8EA 3L2MA 3ZMEA 1TO4A 2I9TB 1ZANL 2VTFA 4AEHL 3DGGA 5IB2A 3F7VA 3MRLA 1U33A 3FHEA 5GS0C 2ZYRA 4FABH 4K3HA 3GMNB 2EE2A 3MRQB 5D6CB 1G43A 3TJPA 3IJ9A 5IIEA 1GGBH 4JN1L 2OLDA 1IE4A 4YFLI 2XYBA 3MLTA 2B2XH 4ANWA 2CE6A 1F18A 4NKDB 4HS3B 3V5HA 1LWJA 1E6OL 3F6JA 3RG1C 3LIZH 3MBEB 2XHNA 1OT1A 4H1LB 2P3YA 4Q9QL 1SDAB 1QSFE 3ETSA 2FDBP 2EIBA 5CJ5A 3NIDE 2ZAGA 1Z9SA 1CLYL 3WE6B 2G4EA 2NYYC 2V5TA 2Q1EA 2XX0A 1DQDL 4DN3H 5BV7B 3FYIB 4S1RH 2RGSA 1PF3A 1CU4L 3HBZA 2R39A 5DF0A 4RFEA 4PJIA 1P4BL 3CU1A 4N0UA 3GO1H 5DHVA 1KJ2B 1OGTA 4JDVB 3E80A 4PJGE 2B7DT 2CMRL 2Q5BA 1FYTA 3QA3A 2IDTA 5A2LH 3QNXA 2VGLM 4IOIA 2L4OA 1A3ZA 1D5IH 3O45A 4R4BB 5JHDE 1PX8A 2R4SL 2QVMA 5DWUL 4FNPA 2YN3A 3E3QC 1AZCA 5EC2B 25C8H 3U6RA 5FLVA 4L3ED 4YIQA 4WUKL 3AJ7A 2VDNB 4TN9A 3S6CA 2A83A 1ZJBA 2YAOA 4QRUA 4MYWB 2Y7LA 3CVIL 4F93B 1QFOA 1E2WA 1RZFH 5FLUA 3L1FA 5LCVA 4TRPL 3PY9A 4MDIA 3VH8A 2JJUA 2OTPA 3GS0A 1Q0XH 5DRXA 1GZHC 3FU3A 1MWAH 4I3SL 5HDBE 3AFLA 3FUIA 3P4MA 4P4KB 3UX9B 2PXYD 5E2UH 4F7TB 4PJXF 3BH9A 4NN7B 1DLHB 4F92B 1FZJB 3MFFA 3NK3A 5HD8C 5E08L 4KJWC 4J6RH 6TAAA 5LGJA 2P49B 4PP1D 1CGWA 2X1OA 3V0EA 1PY9A 1J18A 4AEIL 4M61A 3SE8L 2WBJA 4PGBA 4WUUA 5D5MB 1IO4C 1XFPA 2DKSA 4NIKB 1PX4A 5D8JL 3OPZL 4RMUA 5F44A 3AMLA 3WKMH 2MQ3A 3EGSA 2PPDA 2WUBL 4E41E 3D2UA 1EA9C 3MLXL 4LCYA 4M7LH 4PJDF 4F8TA 4NP4L 1FNSL 1XMEB 3ECBB 4G42B 3O3UN 2IFFL 2LFEA 2XG4B 4GUPB 5AKSA 5L88H 4G8GE 2V5YA 1NGXB 4JUTA 4LCIH 4ODHL 3CZFB 1E4XL 1VFAB 3O4LE 4LSRH 4OTXH 4TUOA 1OPGL 1AIFB 2WB1A 3W9EA 3D0AA 2OMVA 1U8JB 1SJHB 4HQQL 4XAWH 4C56E 2Y3NA 3CXHK 4UT7H 1J9QA 3EDDA 3P0GB 4R8WH 4Y19E 3TT3L 3CV5A 4G6KH 3GUTA 3V4VB 4TQPA 1I1AB 3V52H 3WMPA 2R1XA 1FYTD 2FWLB 1RUPL 2IH1A 4MJ2A 4PGJA 3OKNA 3F00A 2XN2A 3ZE2B 5C2BH 5DI8A 5KSBF 3D39B 3CGTA 1YEJL 5GHWL 4FAAB 1OQXA 5I8KL 4TPRL 3UTOA 1UD8A 2NNRA 4IBLT 1T1XB 1GY1A 2R0KH 1PQZA 3FYEB 1SN0A 3RBSA 4JRFA 3MRNA 2ICWJ 1L9NA 2YS4A 3NG5A 4PJIF 3P30L 1CXIA 1E7VA 2UXVA 4RDQF 3FCTA 1TQBC 1IGYA 3QAQA 4L1TA 5E6RB 5HYQB 2VUYA 4LRIC 3V0DA 4M7ZB 2W59A 5KYUA 3V6ZB 3NEOA 3ZDZB 3ESVF 5H4YA 4AK2A 2BP0A 2PMZA 3BW9B 1EZLA 1XR8A 3WIHA 2QV4A 1MHHA 4FXGA 2X9ZA 3FQ2A 3QORA 2DQUH 3ZDYF 5JW3H 1S5IH 3H3BC 3AM8C 3C8KB 3GMLB 1ZJAA 3FTVA 4DO5A 3LYRA 5AB1A 2HFGH 3QEQA 4DW2H 2WBJD 3BZFA 4WUUD 2EH8L 4ZT1A 2OTWB 2B77A 4E5XA 4KZ0A 1OSZB 3DTXA 4XODA 1B6DA 4D7PA 1FFPA 3CFCL 5FYJL 2D7QA 3D2UD 2EEFA 3UTSE 1ZLUK 2MMXA 4Z3HA 1SM3L 5INDA 1W0WA 2YKLH 4IQHA 3LS4L 4GXFA 3X11A 5E5LA 4L4JA 4OLUH 1N0LA 1NC4B 2DTML 4MAUH 5E7BA 2WY3B 3FU6A 5DJYB 5T3XL 2JJSA 2ZAIA 3IMWA 5HJGA 1G6RA 2JB5H 5GZNA 4X4MA 5HJDA 4ISVB 2OMYA 4W70A 2YD4A 2OJEB 5FYJE 2APVA 1BQSA 3V6FB 2YQGA 5EOCL 1X7TA 5B7FA 5IVXA 5JO5A 1WGOA 3EGXB 1KGCD 5AAPA 2VR7A 1FWXA 4HGKC 4YHKH 3E6HA 4GAYA 3SDCA 4XWGH 3UP1A 5C0RL 4N2AA 2CR3A 1B0GA 3BUBA 5ACZA 4W9HC 4AH2A 1EJ8A 1VHPA 1PMYA 3LCYA 4JX0A 4LSDA 1OHQA 2BRRH 1BFOB 4RAUA 1MCLA 4N87A 2Y2TA 3QDHA 4C8XA 4NPYB 3KBFA 1F4WL 3NZ8B 5IKCB 5KVMC 2FEDD 2RAMA 1HI6A 2NZ9D 2R1YA 2BIPA 3LOWA 4L4VB 4UM9A 3ROOA 2E7LA 4HFUL 1ZEAH 2YC1A 4NQCA 3WUWA 3T77A 1ZA6B 3ESNA 3LKSB 2VN5A 4MDJA 4DP9X 4BM7A 1GKOA 3CFNA 2YO3A 4Y5VA 4WWPA 3RFZA 4LXFA 2C9UA 1XZ0B 4MXQC 3RRQA 1A65A 3GJFH 3QPQC 3AUWB 1EDYA 1TITA 4AZ8A 1G7LB 3AT8A 5D55A 3QORD 5BUGA 2CIKB 1II4E 4HLZH 5GIRB 4BZ1L 4LPUA 1FH2A 2D8KA 5CZXC 4NENB 3K8LA 1YMMB 1RIVH 1IX2A 3NOIA 4WHTB 4PS8A 3QEQD 1BMWA 3F7QA 5DD1H 2ADIB 5DHYB 1CF1A 1TETH 3F05A 1GCFA 3HZKA 5DVKA 2GUYA 4KROC 1QNZL 5CBEB 4FKHA 2X2IA 3WEXA 4TNGA 3UAJA 2EDXA 4YL9A 3VXRA 4L18A 2OQJA 5DTFA 4JHZA 5I6LA 3L16A 1T4WA 5IB4A 1PZBA 2BCMA 2WVVB 4LARL 1E3ZA 4WSGA 5FECA 1WYJA 1I9JH 5F1KC 5F7UA 2IMNA 4HK3N 1HCYA 1P84J 2AITA 1ZVHA 4FZ8H 5GZND 3WXVH 2QJDA 1KEGH 3BP4A 2QVKA 3HRZC 3BT2H 5DRWB 4YSSA 5JYLA 3I3BA 3MYJB 4WFED 4TM9A 1A4JA 4I18B 5JIMA 3ABLB 3SDCD 2WQAA 2KBGA 3VSVA 4P2RE 1M1XB 2W8CA 5L2KE 2PW1A 1BJ8A 3L3KA 4N0YH 1GZPA 5D7JA 2OV0A 2Q2LA 1ZHLA 3O6LH 3JV4B 3D2TA 4Y9FA 3KCWA 1TUPA 1IBBA 1PIGA 1HNGA 1I7TB 2VXUL 1XH2A 5FV2A 3KBPA 2J1YA 1BYOA 2YZ1A 1EVTC 4PJDB 3Q7JA 2PXYB 43C9A 1FZMB 4TVPD 4UZSA 1U30A 4UM9D 1J5OH 3GMQB 1MH5A 4NQCD 2X6MA 4J3OG 1EFQA 4HD9A 5IVXF 1CICB 3E9TA 4RWYL 1FZKA 4RMTA 2AZAA 2XA8H 1BGXL 3KBEA 3L48A 5CSZB 2DL2A 4UI2A 4PB9H 2OMBA