3X1EA

Structure of copper-containing nitrite reductase from geobacillus thermodenitrificans without chloride
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
295
structure length
295
Chain Sequence
b'IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
molecule tags Oxidoreductase
source organism Geobacillus thermodenitrificans ng80-2
publication title Structural evidence of the flexibility of the CuM site
rcsb
total genus 98
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3x1eA00
5E9NA 3H4FA 4YVNA 2VW7A 3EH4B 3DKHA 2PPDA 4YSAA 1OCCB 4NERA 2HX7A 5I5IA 2R7EA 1T5KA 1E5ZA 1JZJA 1A8ZA 3ERXA 4NB7A 5D4HA 1XMEB 2FQFA 3X1GA 1ZPUA 1NIEA 1FFTB 3FPXA 2VW4A 4A2HA 2DWSA 5TK2A 2IAAC 2QT6A 3S3BB 4E9YA 4G71B 3V9EA 1CUOA 4Q89A 2ZONA 3ABLB 2EIJB 2FJSA 2HLEB 6PCYA 4GP5B 1L9RA 3AZUA 1NIBA 2MRYA 4TXVB 1WS7A 2YQBA 4JHVA 1AS6A 4KO9A 3QQXA 4YSSA 2Q9OA 3QJSB 3NJNA 4AKQA 1AOZA 3CVDA 4E9RA 1AQ8A 2GIMA 1GYCA 1NPNA 2PP8A 3CVCA 1BQRA 3CDZB 1AR1B 1SHXA 1KGYE 3PPSA 1BXVA 3PAUA 1PNCA 4YSUA 1OF0A 2J5WA 2X87A 1NZRA 2Y1AA 1AS8A 4AKPA 1WAEA 4A67A 1NDTA 1ZV2A 2GSMB 4DP9X 2GC4C 4L0PB 3WKQA 3PXLA 4DP1X 2H3XC 3WNJA 3DTUB 2QDVA 1AZCA 4A2GA 3D12B 1M57B 4GY4A 1NIAA 1MZZA 1L9SA 1OE3A 1JZHA 3WI9A 1A4CA 3T71A 1TKWA 2HX9A 1E30A 5PCYA 1V54B 4M3HA 3T6ZA 1AG0A 3OMNB 3X2QB 3ABKB 4ZK8A 3UABA 4PCYA 1AZBA 2FT8A 1MG2C 1ASOA 3NSDA 4BDVB 5I6MA 2UX7A 3QJRB 1JVLA 5F7AA 3T6VA 1AG6A 3CVBA 1AZRA 1AZUA 1ET8A 4E9VA 4FAAB 2CCWA 1GS6X 2GC7C 4QLWA 3T6XA 2JKWA 1AACA 3NJIA 4GP4B 5D4IA 3IE9A 3JTBA 3SBQA 4PAZA 1PF3A 2UXTA 1WA2X 2EIMB 2YAQA 4M4RB 2IWFA 2XYBA 1SF5A 4G7SB 3OD3A 2DY2A 4GP8B 4YVUA 3TU6A 4W9ZA 2PP9A 1M56B 3ABMB 3SBPA 2IWKA 1YLBB 2Y69B 4G70B 2BP0B 4G72B 4YSOA 2E86A 3QJQB 2BO0A 4QKTA 2OV0A 5B1JC 5B1JA 3X1FA 2UX6A 2VMJA 3KW8A 4CSZA 3OQRA 4BWTA 1JZFA 3UGEA 4KNUA 1QLEB 1CURA 5I6OA 2N0MA 2DYSB 4JKNA 3NJLA 4EF3A 1NICA 1W8EA 2YAHA 2CALA 4KO5A 1GS8A 3MX0B 1EHKB 2J55A 1HAWA 1WA1X 5B1KA 1V55B 3X1EA 4CSPA 1OOWA 1SJMA 4BK5C 1BYPA 1OCRB 2WO3B 3FQ2A 3NP3A 3V9CA 2CBPA 1NWOA 1IC0A 3AG2B 3BVDB 3G5WA 1WS8A 2GBAA 2H5UA 3FU8A 5I6PA 4E9SA 1HFUA 1IUZA 4HIPA 3FSWA 4P5RA 2FQDA 2Q5BA 2W8CA 4HCGA 2PPEA 4KOBA 1NIDA 1BQKA 4F7KA 3TBCA 3OM3B 1OV8A 2HX8A 5A7EA 2AZAA 4DP7X 3U25A 2J57A 1QNIA 3UAEA 4DPCX 1GY1A 4YSQA 2WSDA 4AKOA 1JZIA 1CYXA 1AS7A 2YXVA 3FQ1A 4DP4X 1ADWA 4HCFA 1FWXA 1IBZA 1SNRA 6PAZA 3FSZA 2YXWA 2X88A 1AAJA 4DP8X 4YSRA 3JT2A 3S3DB 2JXMA 1IKOP 1F56A 2BP0A 2YAOA 1A4AA 4G7QB 2GI0A 1KDIA 2FNWA 1XB6A 1MZYA 1HAUA 2FQEA 1OE2A 1L9TA 1IBYA 1WA0X 4DP5X 4WTQA 4YSPA 4BXSV 3GDCA 1KV7A 4YSTA 1AZNA 4RH4A 3EH5B 4DP6X 2NRDA 1PZCA 3NT0A 1E5YA 1JXFA 4YL4A 1ETJA 2AFNA 1ZDQA 4WKXA 1ET5A 2BP8B 2VM4A 3FS9A 1CC3A 3TA4D 4HHWA 1GR7A 1PY0A 1J5DA 3ZX1A 5TK4A 2XU9A 5FC9A 4N8UA 1SFDA 2XXGA 1PLAA 2I7OA 4P5SA 3TASA 1XB3A 2B08A 8PAZA 3IEAA 1BAWA 1PAZA 1NPJA 4E9TA 1X9UA 1PMYA 2EINB 4GYBA 2UXGA 3IN2A 1PCSA 2AVFA 4UANA 5AKRA 2BZ7A 1JERA 1ILSA 9PCYA 2EILB 1QHQA 1PLBA 4AI7A 1JXGA 1TEGA 1ZDSA 3UAAA 4A66A 1KBWA 3NSFA 1KDJA 1TEFA 2J56A 3ASNB 2XVBA 2FQGA 1JXDA 3HB3B 2BWIA 4NAJA 1B3IA 2VW6A 3KW7A 2AANA 4F2FA 1OE1A 4AX3A 7PCYA 3FYIB 5I28A 3FPYA 2I7SA 1EZLA 3NJFA 4F2EA 4HALA 2VM3A 1SHWA 4DPAX 2ZOOA 5EHFA 1CYWA 5B7EA 3ZBMA 1A3ZA 3AG4B 1PNDA 2BZCA 1V10A 3X1BA 4AZUA 4YSEA 1GSKA 2R7EB 2H47C 1I53A 1A4BA 2XV0A 2XWZA 2B3IA 2VN3A 4JHUA 3IBOA 4HZ1A 2BWDA 3CZUB 1UATA 3AW5A 4BWUA 7PAZA 3FU7B 1NINA 3L45A 3PAZA 3GXUB 2FTAA 1BXAA 2PCYA 4GXFA 1NIFA 1J9RA 3NP4A 4UF7C 2VSKB 3N55A 3BQVA 3NYKA 5B1AB 2PPAA 1RZPA 1KYAA 1KCBA 2EIKB 3C75A 2BW4A 2QDWA 3FYEB 2IDFA 3TBBA 1SDDA 2PPCA 2FT7A 3AG1B 2IDUA 1SF3A 1PZAA 2OJ1A 3QPKA 4BWWA 4E9WA 1SFHA 5I5JA 2UXVA 2QPDB 4W1TA 3AG3B 2DV6A 3ZIYA 4BDVA 3WIAA 3T9WA 5F7BA 2IDSA 3EH3B 4A2EA 2ZXWB 2MTAA 3H4HA 2VSMB 1DZ0A 2UXFA 1NTDA 1RCYA 1BYOA 5I6NA 3AY2A 3S8GB 4G7RB 1VLXA 1L9PA 1NWPA 2IH9A 2XUWA 2YAEA 3DIVA 2GB2A 1PZBA 3FT0A 3NJJA 1J9TA 4KOCA 5B7FA 2XX1A 2XLLA 4KO7A 1BXUA 3ZDWA 4DP0X 3CG8A 3FU7A 1J5CA 2FWLB 1OCOB 3NJHA 2YAPA 2CAKA 4BXVA 3FU9A 3SQRA 3NSCA 3GYRA 1MG3C 3NJGA 5AZUA 4A68A 2CJ3A 5ANHA 5IY5B 1OCZB 3H56A 2HZHA 1A65A 1W6WA 1KBVA 3OMAB 2YAMA 1ASPA 3WNIA 1XB8A 4YSDA 1X9RA 4DPBX 5I6LA 1AIZA 2AZUA 3EF4A 3NJKA 1ASQA 2XXFA 5PAZA 1ZIAA 3NSYA 4X4KA 1MDAA 1J9QA 1ET7A 4N4YB 1SDDB 2FT6A 1W6LA 2YARA 3PLYA 3RYMA 3QJUB 1E67A 3UADA 1DYZA 2HRHA 3FQYA 1BQ5A 5D4JA 2BHFA 5I6KA 1L9QA 2BP8A 2ZWNA 3FSVA 2P80A 1BEXA 5I26A 3EHBB 1JVOA 3ASOB 1L9OA 4KNSA 2GHZA 3ABGA 2IWEA 3PAVA 3WG7B 2PLTA 2CUAA 3NJMA 4ENZA 3SBRA 2JFCA 4E9XA 1R1CA 2TSBA 3S8FB 3S3CB 4Q8BA 3T6WA 4HHGA 4E9QA 2XV2A 2TSAA 1GY2A 2LLNA 1JZGA 5I5MA 2XV3A 1J9SA 1RZQA 4UAHA 5AFAA 2A3TA 4K9JA 4FA7B 1TU2A 1URIA 1PLCA 2YAFA 1FA4A 4A2DA 1AANA 2P80D 1E65A 2PP7A 2IDQA 2HXAA 3N2JA 1JZEA 2IDTA 3PCYA 3OMIB 4HAKA 3WKPA 1GS7A 2DWTA 1ILUA 2IH8A 4DP2X 5B7MA 1N70A 3FSAA 2WO2B 2W88A 1JOIA 1N68A 3X1NA 3IN0A 1GW0A 2BW5A 3QJVB 2DYRB 3CDZA 3UACA 5B3SB 1KCWA 4KO6A 2RACA 5B1BB 2PPFA 4KNTA 2OCCB 2PCFA 4YSCA 2XX0A 2I85A 3HEIB 3QJTB 4A2FA 1ID2A 1M9WA 2QPEB 5LDUA 4MFHA 1RKRA 4HCIA 2HRGA 3MBWB 1ZIBA
chains in the Genus database with same CATH superfamily
2J12B 4POZC 4J3OG 4NZDA 1MNUH 3FU0A 1OAZH 1XXDC 3OGOE 3LH8A 4DO5A 3MV7D 3UC2A 2HX7A 4PW4A 1LE5A 4XNZB 5I5IA 2V3DA 4LLVB 1BF5A 4NUJA 3FBKA 2IQ9H 4YEFA 3W38A 3OKMA 3PIQB 2VW4A 4CADB 3CX5J 4A2HA 1OOAA 1IU1A 3FSOA 2HLEB 1XGRB 1VADA 1WWBX 4YHPB 2MPAL 3CX5K 5AAWA 1U3JA 2HFGH 4WEBH 3KE0A 3IXTB 4U3XA 2YQBA 1G9MC 5E08L 3C87A 1RUKH 1S7TB 2VISA 4ANXA 2XFXA 3Q7JA 2ZKWA 4TLSA 4EI5D 4OZHB 2OJEB 4LLYA 3CDFA 5BS0D 3VG9C 3VGAC 2GIMA 1DBBL 5FHBL 2F74A 3KVPA 3WFZA 1SYVA 1DANT 1MY5A 4K8RL 3BP5A 2AEPL 1WC7B 4HPYL 4ZFFB 5DU7A 3QFJE 5FW8A 1BM3H 5KSBF 1T0MB 1E9QA 4FFZA 2W07A 5CSBA 1I8LA 4Z3FA 2LOEA 1IKFL 5IJDC 4FZ8H 5FKAB 4AGMA 4ZQKB 2F54B 3CZLA 4GT7A 3LQAC 4MLSA 3RTQB 4GAGH 1NCNA 1DVFA 3BIKB 3K1DA 4FI6A 3BW9B 5E6IA 1GCFA 3EJYD 5KBNC 4M8QA 4PGBB 3PHQB 4Z23A 2DI7A 5L4FA 1DBMH 2VLJD 5E9DE 1NOAA 5BOZG 1JZHA 1ZVYA 3U48A 1I9JH 1O9WA 1TKWA 1VFAB 3PGFH 3RDTD 3PV6B 4YDKH 3B3BA 4LGSB 4OW6A 2JIXB 4JG0H 1ZEAL 4UQIM 3WGUB 4B5EA 3ABKB 5A2LH 2BY0A 3UABA 5IWLA 3KCWA 3SCMA 1ULVA 4RRPM 2EYTA 2P5WB 2J2ZA 4AUYA 1DLFH 2BIOA 4U6XB 5B8CC 5L6YL 3GB7A 3VGFA 2FGWL 1V3MA 3P2DA 4A2LA 3IE9A 4AQ1C 3K80A 4XOAA 4R4BA 4GAJL 2HTKC 5ACZA 3VG0H 1HTYA 4BQ9A 4NIKB 4NQXA 5IP4A 1FVEA 4PRPB 2XA3A 1FO0H 1BMWA 4A39A 1GHFH 2BY1A 3B7TA 3EGDA 3OKEB 4HH9A 3G5XA 4PWJA 4LE8A 3RVWC 3VA6A 4A63A 3ABMB 2AMUA 5F1IA 1IAOA 4ISVA 3HRPA 1H8LA 4P5TC 1JZ8A 2B0SH 1TTFA 1N9PA 3W82A 1PS3A 3NRPA 4KVNH 5F9AC 4ZXBD 1W91A 1KCVL 1NFDE 2XNAA 4YHLL 1RZ7L 1O9VA 3PWPA 3S6CA 4KNUA 3C08L 4P23C 3L81A 3QYCA 4JO2L 1DSFL 1PKOA 4XVJL 4PLOB 1TNNA 3IJEA 4ZUUA 4EF3A 2P5EA 4RISH 1A4KA 1OSPL 4N2EA 3PNWB 4YHYC 2WXMA 3RY5A 1EEUA 4KMQA 2WYHA 1OEZW 1DN2A 2CO7A 4ODBD 2LE9A 1DQQA 3VFNB 3KBHE 1CWVA 4ADIA 3BJ91 4MJ6A 1MI5D 4FTVD 1T7ZA 3T2LA 3QIUD 3UBHA 3AT8A 3EH2A 1SJMA 3L2LA 4KKAC 5EIQA 1N10A 1P4UA 5C08E 3S96A 3CXHK 3BUTA 3CVIL 2H3KA 4TUOB 5DTFB 2B39A 3UTTD 2WINB 1OLZA 2Z4TA 3SIKA 1CL7I 2AJUL 3B56A 3QQ3A 2OLDA 4ODUB 2HKAA 3UMTA 4IIZA 1ACYL 2DLTA 4XBGB 4ZMQA 1Q8MA 3EKCA 4S1QH 4N0UB 1EDHA 5ESVB 5C0IA 1J8SA 2AAAA 1XO8A 2G75A 4E9SA 3F7YA 3ESPA 1YEGL 2VWEC 4OFYA 3IDYB 3VXOB 4Z7AA 3WU1A 3O6ML 1ZMYA 1D5BA 4DGVH 2WNGA 1RZGB 5GS1C 2MH4A 3HC4L 4PJ7F 2ESVD 4OSUH 1WUNT 3TONA 5CHNB 3MA9L 1HU8A 2OA9A 2Q2EB 3FUNA 3BWAB 4P5TB 3E3QE 5IOPA 4QJ5B 2XVGA 4LCUB 4DPCX 5FA4A 1QBMH 1KENH 4G8GE 3D85D 2AEWA 4PREB 4GRWH 3HI6H 1X4ZA 5DRZA 5IESH 4EMZA 5HHPA 2VRQA 1R24A 1N0LA 4L3EA 4FQQB 2C7FA 3HS8A 4W9IC 5F7KC 1Z5YD 1TZGL 3ULUL 1XR9A 2R4RL 5EC2B 2AK4E 1IVLA 3Q6GH 5AKVA 1CQKA 2CM6A 1OY3B 4GQPH 3KL5A 3DTXA 2QQKL 4G7QB 4FERA 4LLUA 1T2QL 3TBYA 4OLZH 2W9EH 4ANVA 4K4KA 1HAUA 2RFXA 2PTTA 1HYRC 1A6AB 4LPUA 3GS0A 4ZMAT 4N6RB 3GSQB 2WKLA 5GSRA 2VGLM 3KM2A 1LEIA 4N1HB 2XWXA 3HFMH 4DF9A 5SWQA 4AT6B 9CGTA 4APQC 5IJKA 1N5AB 3CNKA 4P06A 3BWUC 1FZMB 3GMLB 3EBGA 4FFYH 4LAQH 3RFRA 1ZE3C 5KJRL 3SYQA 2NW3A 1KYDA 5L7XL 2NX5A 3O3BA 4MCYB 3B9VA 5D7LB 5FO9A 3BWUF 4CVWA 1U91B 2Y24A 2ED7A 2R4SL 4E2OA 4M6NL 1BAWA 5D72L 1F8TH 1J48A 3SJVA 4MJIA 4ZOCA 5CD5C 3RFZA 1IM3A 3CSPA 3QXVA 3KH4A 3R06A 4GRWE 5DD0L 4LF3A 5DCCA 4M1DL 3DVNB 4DAGH 1AHKA 1PAMA 2BVPA 3NCBB 3CCHB 2JF1A 1UA6H 2BZDA 1R3JB 4S1SH 1OGAA 4TVPH 3PHQA 2A83B 1LO5A 1UT2A 1YEDA 3QUYB 3WFHA 5INCB 3L3HA 1HXMB 3L13A 4OZHA 4B9YA 1I9JL 3FF7A 1ERNA 1ODAA 2ARJA 3VFWA 5IBTL 5ENWB 3FFOA 4NBXB 1ZEAH 3D9AL 5K39B 5B39B 4AH2B 2PYEB 2VH5L 3UTSA 5I19L 3K6SB 3BFQG 3QCUH 2OSLB 2H6OA 3CFJA 2H9GB 3MODH 1TCMA 3GO1H 5E5MA 5FW7A 4X9BA 2CDGA 1ODUA 5E8OB 1NSNL 3MRJB 5EBMA 4FXGC 5D96C 1VCAA 2Y5QA 4O9HL 2ZQKA 2X5PA 4J3UA 4KXZH 4YHIB 4GO8A 4D94A 3MR9A 1A1NB 5SWZD 1DQLL 1NINA 2Y7MA 4G80B 4JANA 1OTTD 2EYSA 1TUPA 1S7QB 3EH1A 1NANI 3O8XD 1S8DB 5FF6B 2EZ0C 5K9JL 4LLVA 1L0XA 1WBYA 3FN9A 3N1GC 4PLNC 2DM7A 1JPFB 1KYAA 3NCFB 4OQ1A 1T66C 1Q0XH 1QTSA 3QXTA 2GY7B 3MJ7A 4KKZA 4TULH 5EZLB 4M7KL 4YDJB 3TF4A 5DMYA 4H8UA 3RU8H 4PFEA 2ZP0T 1XGZA 5I24A 1SLXA 2HP4A 3H55A 2L04A 5IHWA 4ZG1A 3UTSD 4TVPE 4GXUM 2CPCA 2V7NB 1KCVH 2FL5B 5C0BE 3FQRB 2DOCA 4K8RC 1YMMB 3V6OE 3O2WH 3Q5OA 5GS0H 3MZGB 1BVLA 4PVNA 2X05A 1DSFH 2X53A 4JDVA 3FQUB 4PRNB 3L9EA 3D39B 2BOBB 4NO0D 3GJFB 3N42B 1Q0YH 2QQNL 4UU9A 5JHLL 4WKZA 2EQDA 4I0PA 4LCYB 3H9HA 3P11H 4XVUD 2HPTA 2FWLB 5AKTA 1M05B 2DD8L 1G6RA 2CAKA 2Q7AA 4KHXH 3W9DA 5EIIA 3US1A 1OAYH 4PM1A 4G6AC 3QIBA 4OCLC 5A3ID 4XB3A 5JW4M 5EBLB 1MCPL 2EXWD 3EFDH 1HL4A 4N9OB 5B38A 2AERT 3GM8A 4H1LB 1M4KA 3JTTB 1BECA 4IIQB 1XB8A 3AQYA 2VLKB 4JGUA 4PWIA 4H2AA 4YPGA 1BA9A 3D2UB 3BZFB 3ZL4L 4G5ZH 2OJZH 3HC4H 1E6OL 3TC9A 1MDAA 3FF8A 4N0CC 5GS3A 1PIFA 3L5WB 4K8RD 2JB6A 2YARA 2YEVB 5HHPB 1T6BX 2O5ZL 4KK6C 3PLYA 4WI7A 4Z18A 3APNA 1OZTG 1YEEH 4HHAB 3IDNA 3VXMB 1IQDA 1Q38A 3NFSL 2NCMA 1X4XA 3FSVA 4CJ1A 3S3SA 3S4SB 2BSCA 1WBXA 2EH8H 4NYLA 5IJVB 3ASOB 1L9OA 3R0NA 1TVBA 1KIPA 3KWWA 3MRRB 4KNSA 3HC0B 1JNLL 4PGEB 3QEQB 2H6PA 3LEVH 5I18H 1CE6A 2DEYX 2DKSA 4U0RC 2NQCA 2BNQB 3RVXD 5BNXD 1NBYB 5BRZD 2GJPA 4BFKA 2R9HC 5JDSB 4WJ5A 4XZ4A 1JYXA 2Y06L 1A2YB 4GG8A 3HS0C 4M8QB 4NN5B 2EDEA 4PJDA 4Q58C 4XMPL 3VRLF 1I3UA 4WWKB 3F64A 5AW1B 5EG6C 2HLFC 2IFGA 1WCQA 1H5BA 1IB5A 1MFNA 1AJ7H 2CBMA 2W81C 1URIA 1GYVA 3CHPA 5J6HB 2UYLB 4APXA 1L0YA 1AANA 4H40A 4W9EC 5A2CA 2JQZA 3F05A 4HETA 3LQMA 4RAUB 5L7XH 2GEQA 1U3YA 2P5WD 3ARXA 3GSRB 2EACA 3KPQA 4AJYV 1AHWA 1UWXH 3QPQC 4GMTH 4R3SA 1P6AB 3N91A 4NO3A 1QRNE 3HOGA 1I7ZA 1AQDA 1MY7A 1NMCC 1ZHKB 4M6NH 4PIRF 3GXTA 3ZDZF 5CMAA 3VJ6B 1Y7VA 3C60C 5BZXA 2ZKXA 5AVWB 3RBSA 4YSCA 3TXAA 1Z0MA 4LL9A 2I85A 5HHMD 2WMPB 1ZTXE 3TA3D 4F7TB 1EXHA 3BD4A 3HG1E 3QIWA 1BCIA 2B1OA 2ADJA 4K71C 2ICWJ 4JG9A 5TTRA 4NZTL 3MV8D 3OX8B 1WWWX 3KPMB 4JN1H 3ZXAC 2VW7A 4ZRGA 5IIEB 4O5LL 3UROR 2FCBA 3OKEA 4HH9B 4XNXL 4XX1E 1OAUL 2AJVH 3SPCA 4ISVB 1U4EA 5I2IA 4Y4KC 5A2JH 4CKVX 4J2XA 1KT2A 2RMNA 3PIQA 4HYTB 4R83A 5EOCH 1A9VA 4FNLL 1W9XA 3MUHL 4NUGL 1MW1A 3JUYA 3OQ3B 5T1DL 4GB9A 2QT6A 4I8DA 4E9YA 5I8CB 4TL4A 5AB9A 3LN5A 2GFBA 3GO1L 2F19L 4MD5A 3G5ZA 4P4KC 1MFBH 2GITA 3P4OB 4GRWF 4WWKC 1AHMA 2KI6A 4HEPG 1KBBA 2ZWKA 3LKPB 5IVZA 1LO2L 2VABB 2QPSA 4P49A 4Y0GA 1YEJL 2IPKB 4AV4A 2FO1A 2Q9OA 4KTGA 3H9SB 1OAKL 4QHUA 2ESVE 4E9RA 1HH9B 3OR6A 3RA7L 3TS8A 3W37A 1JPTH 3RTLA 4P57A 5FGCE 5DS8B 3MREB 1PNCA 4OLVH 3GBLA 1E9PA 2EDMA 4GSDL 1NGWA 2Y1AA 1KGCE 1U8HA 1JGVH 1PCXA 2Q2LA 3US9A 2QSQA 1TQBB 2VLRD 2AQ1A 1G6RH 5EA0L 1FC2D 5FKAA 3IAGC 4BSJA 3AQDA 4EDXA 3U9UB 1GJUA 2XWJA 2WQXA 4WGWB 4WZ9A 4PTTA 1A9EB 4UQ9A 4WTXA 4MDJB 4AIZA 4J8RA 1BD2B 1I8KB 1OXYA 2WZ0A 3A4DA 1CG9A 1U93B 4KK8D 1A02N 4IBYA 1M9SA 3FFCA 4WKZB 3ZTJH 5ICZB 2ETWA 4PREA 3UP1A 5JHLH 3DUHA 1IFGA 5J9PB 3PREA 3CFQA 1P4LA 2F5BL 3AREA 1AG0A 3IMRA 2VR6A 3X2QB 2A9CA 2BDNH 1UD3A 5JQ6L 2YN3A 1UJ3A 4WCYH 1K9TA 5ILTH 4PCSA 3X13B 3DRTB 4BDVB 4AYGA 1G7PB 2BVOB 3W57A 3V6OA 3QJRB 2X4UA 4I13B 3KXFA 1TU2B 1MCPH 4FHKA 1UACL 1C5CL 3LVTA 2MEJB 4LRIC 4CC1A 4OJFL 1RJYA 3FQUA 1JZ7A 2VLRB 1QZ1A 4AG4H 32C2B 3DJRA 3OHMB 1OSEA 4F8NA 2DY2A 5DHYA 2ORBH 4M7ZC 2C9UA 1SXZA 1RVFH 4I0PD 3LSOB 1R5WB 1FGNH 4G8GD 4IRJD 3VNZA 4CDHA 5DD6B 3NCJH 3GBNH 2FYVA 4N5UA 3VCLB 1OP3H 4NQSA 4MB3A 5DF0A 3ZUNC 1VGEH 3JVFC 4JKLA 4DZ8B 4H8WH 1T1XA 3QJQB 2X28A 1UWYA 3NPZB 4LSTH 2FX7L 2E4TA 4XN5A 1ZA3A 2EDNA 1KY6A 2GJ6E 3ULSA 1KXTB 4PJ8A 4WWOA 3QIWB 5I6OA 5AW2B 2NZ1A 4AMXA 3NJLA 1YEIL 1E3ZA 5KYUB 3GIVA 4ODHL 5E2UL 1Z3GL 2AXWA 3BT2H 4QRRD 4L4TD 2ERJC 5DO2C 3D2UA 4KRNA 1JYNA 5T3ZE 5LXVA 4FQ2H 5TQ0H 5I73C 1FDLL 2BHZA 1QACA 1DBJH 4G6FD 4X80L 1OGAB 4X7EC 4J27A 3QP3A 2YXMA 2I25N 4JG1H 4TUUA 3QA3A 4RGNE 3IMSA 1WZ1L 4NKDB 5C0DA 1N64H 1H9DA 1A8JH 2MOQA 2H0PA 3VXRE 1JWSB 5D7KE 3IJSA 2AXGA 3JVGC 4IGBA 3ZQ9A 3I9GH 5ERWA 5F9JB 3SKNA 2AJSL 3P30H 3PWVB 4XCFL 2UWEF 4IHOB 2G4EA 3EJYC 4AWJC 1UC6A 1NGXB 2VAAA 1MCKA 2DYPB 3O6FC 4RDBA 5A16B 3LKQA 4LLAA 3BWAA 4YHOH 1JHKH 1DL7H 3Q43A 4HJ0D 2XG4A 2WTPA 3SODB 5T1LB 1K4DA 3ESVF 4N90D 3REVB 2EIDA 4DEWA 3V7AE 4EI6B 1FG9C 2FD6L 2D7QA 4WI0B 4PJXE 3O9WA 3BKYH 1BMZA 1LMKA 2FATH 1QATA 1G9ML 3BH8B 4I3RL 3IGLA 2IO5A 3HE6C 1A25A 1PY9A 2H0JA 3JT2A 3IMWA 3MRHA 2CDFB 4NUGH 3G7TA 4P2OD 4AK1A 4EI5C 2BNQE 5JR1H 2C9XA 2DTML 1KDIA 1DUYA 1X5YA 3KPPB 1MFBL 4LSDA 1JZDC 4LHJB 3NACH 4QYAA 3FB6B 3DUUA 2XDHA 1QSED 4FFZH 4ZOAA 1OP3K 5FYKD 3GDCA 1SMOA 2NX5D 1JUFB 3BVTA 1L7TL 5HPMA 3OWEA 1E5YA 2CHXA 3HLAB 3DVIA 2YS4A 1WHPA 2BIHA 2VMDA 5I1CH 1BIHA 1OAKH 4D3CL 3NK4A 5HGDB 2ZYSA 5J13B 2WWKO 5H35B 3AROA 1F2QA 2P24B 2EUWA 1J0ZA 3IEAA 1AP2A 2Y2YA 4MAYA 4OLVL 3WUWG 1ZV5A 2XN9A 4JFOB 4DCQA 4JRLA 5IM7B 1BG1A 1AFVL 1PMYA 4POZD 5EU6D 3IVKB 1LK3L 4OFQA 2UXGA 4MQ7A 3ML8A 5C0EA 1T6WA 1G6RL 4JUSA 4LLWA 1E3FA 5IR1A 2HFEA 1CD8A 1QKZL 1C1EH 1JNNH 3LV3A 1Z9LA 4NRXB 1GZQA 2D0GA 3Q9QA 3CZGA 2WLLA 4BZ1L 5CD3A 1E4XI 3MRDB 5C0FA 4DGUA 2FQGA 3BUQA 4PUBL 1EERB 2ZG3A 3NZUA 1F3JA 2FH6A 1A5FH 4B9CA 2BCKB 3TPUA 4F2EA 5FLVA 4O2EB 4JREB 3FDWA 4J3VA 2AV1B 3ZBMA 1M6OA 2F6AA 4RAVA 1HCYA 3WELA 5FM5O 3MUY1 4FL4B 4R5XA 4O2CA 5JDSA 4JFHD 3ZKQD 3H6AA 1U36A 4LEEA 4X99B 3U2SB 4UQAA 4RGND 1UACH 1C5CH 4A7SA 5HDRA 5LGJB 4MB5A 1RXLA 1H6EA 4OVUA 5CBEB 2PTTB 1F6LL 4AYEC 5JXED 3UGUA 4Z78A 4NDMB 4XPBL 5I1HH 4X4MA 3FYEB 3CFKB 3UJJL 1GIGL 3LEXA 3BO8B 1YZZA 3PRZA 4Z7WB 1SMAA 1A0QH 1FZMA 4G6JH 4BWWA 5AOJA 1N4XH 4HKZA 2UZIH 1YEFH 4JQVA 5CGYC 4R2GC 4ECNA 5ACMA 2VL5A 5F3FA 5MENA 1HILB 3AS2A 2KDYA 1E43A 3TO2A 4JY6A 1WAAF 3EFOB 3D69A 1ECYA 1QYGL 4K94H 5B38G 4OUOA 2FJFB 5IKCB 5EBWA 4BZ1A 2N1KA 4X5XB 3N0PB 1FG2B 2OZ4H 4FQ2L 5TQ0L 4JREC 1MN4A 1MCWM 3WGVB 2E75C 1WTLA 3FU7A 4YBLC 3SKNB 2QKIC 3QR0A 4ES8A 3OB0K 1OM9A 3L95B 3ZZ1A 1G7HB 1RERA 1MJ8H 3DIDA 3MRGB 2P9RA 1BVZA 1NCDL 1X5FA 3BQUB 4PJCB 4XOCA 4YK4C 2JQAA 1JL8A 3UTPD 5HGBA 3VRJB 2CJ3A 5KWYC 2WN2A 3N41F 4LDCA 3BP7A 2AJSH 4HLZH 4MS8C 1A3QA 3E8UH 3NRFA 1UT1A 3C9NA 3DC0A 3QFGA 3VRIA 5SWSE 4HT1L 4LEBA 2DAVA 2AZUA 1EZVX 4IRSD 4KVPA 3UL4A 5FKPA 3CXHJ 4K07A 5IUSA 1KULA 1D2PA 1RK7A 2XWDA 4P59H 3DTDA 1UB5A 4B0MB 4P2CG 5DZJA 3ZN6A 4BZYA 3BZDA 4H1LH 5H35A 3PWPB 2BPBA 4P9HH 4HUUB 5K9OA 5I6KA 4ONFL 3P4NB 5AVVB 4V1DD 5E6ID 5C92A 1T1YB 1HCZA 5I26A 4JO4H 5DZPA 1JVOA 4XMWA 3BKYL 1B6DA 1KXQE 3DROA 4ZI8A 4DQOH 2QV4A 4ONHB 5KS9A 2H1LM 3LXBA 3II2A 3ARDA 3ROLB 5ECGA 2Q76B 4DQAA 1QWUA 1UTDA 3LPFA 2P5EB 4BEIA 3DO3A 3O6FB 4HUCA 1J88A 1BD2A 1G0YR 1I8KA 1SDYA 3KEHA 5HY9A 3HPJA 1GY2A 3RKDD 3BP4B 3WSQL 5DK2B 2PW1A 5D70H 2B1HH 3NJVA 1RZQA 1GGYA 4G8GB 3FMGH 4XO3A 4HK0A 2F8VA 1HI6A 2GT9B 4PJFE 1IGYA 2ZSVB 2YAFA 3K91A 4BBWA 3LS5L 3NSJA 3I6LD 4EBQL 1A7OH 5CGTA 5E0FA 4MQXC 5LJYH 1OTSD 5DUBA 5H2BA 4EI6A 2BSEA 1LM8V 2IH8A 2J5LC 4IOIA 1FLRL 2WO2B 1IBGL 1N8OE 4NZ8A 3MZTA 3QQ4A 3X1NA 2VN6A 4PHZA 4XB7A 5E0QA 1CD9B 3AWGA 4JHAL 4RMVA 3P9WB 4OFDA 3JUZA 4IU2B 2SEBB 1U6AL 4A2FA 1ID2A 1M9WA 3QFDB 3VQ1C 1ZHBA 3RUGA 4MFHA 3E1F1 3BKMH 3EYQC 2X6BA 1NDMB 4JE4B 4WI9A 3NABH 2R69A 4MAUL 5I8KL 4PJFF 4Z7WA 2QGEA 5FW6A 3T3ME 2PCXA 1WFUA 4ZFOL 1UB6A 3FH5A 5LNGA 2Z7YA 1O6TA 2RR3A 3GJEB 5GGRA 4PCKA 4FQLH 1EXUA 1HEZB 2XG5A 1HILA 1FZJA 2X7LA 2COVD 3IM1A 1M6UA 3KWXA 3FBQA 4HU2A 5DEGB 1CUOA 3VXTB 4GFTB 4CW1B 2VUKA 4RAHA 1NCWH 1IKFH 5AOZA 4XNYH 2J8UB 4RGNB 4GAGL 4XCNB 4HOWA 3ZJAA 5KTEL 1N8ZA 2NNAA 3DXAD 2XZAL 1FIGH 4JHVA 4JQIH 3LNDA 3L9YA 1YHPA 5DUPH 4ZXBB 1DQMH 2XIBA 1K8DB 3O2DA 4Z7OE 1NH6A 2AEQH 5I16A 3SCMB 1UFGA 2BINA 2O72A 3RVUC 3GRWH 4OFIA 4XPBH 2Z8VC 2YD1A 2JIXA 3WTTA 2DBLL 1XZWA 4OCRL 3E8VA 5DZ9A 4DNLA 2KHAA 4JG0L 1ONQA 2IGFH 4YFLF 5HVHB 3UDWA 3HG1A 4OAWA 5KOMC 5GS2H 3C5ZA 2J5WA 2R1YA 4IRSA 3L3DA 4NC1E 4Q9QH 2HFFA 5LGKA 1RUAL 1JMZA 2Z6FA 4JS7A 4BFJA 3HBGA 4PWFA 2XTJE 5AL0A 2GC4C 4IK6A 1OT4A 4OD1L 1TCRB 4WHYG 3ZTNL 2VDML 4WNQA 5BOPA 3KWUA 3NIGE 4LOUD 4S1DC 3VD7A 4GOSA 1OHZA 1KEML 1W0VB 4C4UA 5HYJA 4Z76B 4MDRA 2QPUA 3DV4B 2NMSA 4PJIF 3M45A 3C60B 3E6HA 3T71A 4GSQA 1XGPA 3F83A 5PCYA 3RY6C 5ANME 1FFPA 3QJHB 3V0FA 3BAKA 3CFJB 2BVQB 4HWBA 2F1BA 2FT8A 2W65A 4UUJB 1YPZB 4WI5A 5IBUG 3KYKH 3CHSA 3IJEB 2W0FA 4L29B 2OMVA 2DTSA 3T8XB 3T6VA 4IBVA 3D3VA 1DUYB 1NDGA 3RWDA 4HPOH 1CFTB 3C08H 1GS6X 5CJQH 4G2AA 4L9LC 2GC7C 2WXRA 4KKBD 3E8UL 5DFWH 3UXFA 4Z5RB 2BS8A 5GGSA 4CU8A 2VL4A 3LXAA 3QDMA 5LGHH 3TZVB 1MRFL 1GGCL 2DDQH 3O6LL 3UX9B 5HPMB 5F89A 3QUZB 3VFRA 1CCZA 2B16A 1LK2B 1JWUA 2JV6A 1R5WA 3OBAA 2C9VA 3LIZH 2B7DT 5KSBA 3ZE1E 3X3FH 2L7UA 5FYJH 3D87B 1T0NB 2AJUH 5CILL 1NGZB 5ESAA 1NBQA 1PGRB 4IJ3B 4FQHB 4KWUA 4JQIA 3ATBA 5KVFL 1PZUB 1Z9PA 1L9NA 1V5JA 2YRZA 4QKTA 2IXQA 3MDJA 4F9LC 3COOA 4J4PD 4Z8FH 2KQMA 4U1NA 2DLFH 2IDCA 5BO1L 1YEGH 1FSKB 3D39A 1YN6B 1S7WA 2CWRA 3BPNC 2NY7L 3AS3A 1OIOA 2DQIH 3IDMB 1AY1H 2HWZH 4FG2A 2MHAA 5AVQB 3U46A 1MDTA 1TFHA 3MV7E 4MSWA 3FZUC 2H45A 4YPJA 1U8KA 4FP8L 5I5RA 5C0ND 3Q44A 2PN5A 4OBSA 1MWAA 1EXUB 2X38A 1QBML 1OW0C 1TSRA 4UNVA 1IBDA 3FH8A 1ZLSL 1SLUA 3ARGC 1I9IL 4PJGA 1QPKA 2NW2B 1NGPL 3EYOA 1DJZA 5KBDA 2ZD0A 3S37X 3QIBD 1GZPA 2EIZA 4JB9H 4YPGB 1MCSA 1ZGLP 5HJGA 1NFAA 5C0BA 1T80A 1FO0B 1UWGL 2BWQA 1C8QA 2W8CA 2P52A 2Z65C 3MV8A 4JPQA 3I9AA 2L7JA 3U2SA 3F12B 2JI3A 1URZA 5IFJB 4RMWA 3GI8L 4IBWA 3SO3B 5TDPA 4C54A 1AO7E 3PWJB 4HBQA 5SWSA 3WLWC 3L08A 4Z3GA 4JFQB 4BH7B 4NRZA 4U1IB 4RFNB 3RPIB 4K9EL 4NCDA 5AUMA 3QE5A 5GRUH 5KJRH 3K6OA 4X6DE 3VH8B 5BUPA 1T04A 3BPOB 3GXDA 4FRWA 3D1MC 5IHUL 1BMGA 1YMMD 1ETZB 1IAIM 3FO1A 5IB3B 1OVZA 1A6VH 5DQJB 4LLMB 15C8H 1RUPH 1ZS8B 4EXPX 1KCKA 3RJDA 1LNUA 4TVSa 4RQQA 1G9NH 1NCWL 2AF2A 5F71A 1WBZB 2VDLB 3VGGA 4HBCL 4O02L 3SYCA 2AJ3A 2GBUA 4DP6X 4V1DB 4A7GA 2XZAH 1DN0B 4S1SL 1CLOH 2A4ZA 3O8XA 2HRPH 4PB0L 1HHHB 1C16A 3UZQB 4Y5YA 1LO4L 1WYJA 2MOVA 1SHMA 5DJAB 4AJVA 1H19A 2WLHA 4P5SA 4OAWB 43CAA 2IGFL 4KJPC 3AACA 2I07A 4HCRL 2QFRA 4LSSH 1PAZA 3D7PA 2K70A 4KHTL 4HXBL 3LZLA 3ZKMD 3U36A 1U0QA 2EC8A 3TO2B 5JIMA 4OV6F 4N2MA 4I0KA 5BQ7B 9PCYA 1CVSC 2VXVL 2DQCH 1P5UA 4HS6B 1JTTA 1QHQA 3IFOB 4AI7A 2VE6A 5BQDA 1PYWB 3K8KA 1OGSA 2NY5C 2WVVA 1F1DA 2J56A 4QF1A 4BKLB 3CXDH 4NP4H 2NY6D 1LWHA 1KJMB 3MI6A 4PVBA 2ARJB 1KIUA 5T5FH 3O45A 3RTQC 4OFVA 3B6SB 4AX3A 7PCYA 2YUVA 2DWXA 4HFWA 5GGQL 5H37G 2A77H 5GGTA 1EZLA 5E6ZA 2WZ5A 1JYVA 2COQA 3D2UD 2EKSA 2WCPA 3HBPA 3O9WB 5IREA 2H2PD 3C5ZB 1V10A 3KYKL 5GRZA 2IANE 4EN3A 2FEEI 1F0LA 3DX4A 3FTSA 3E1ZA 1HH9A 3OR6B 1C8PA 1AZVA 3WFDL 1ETA1 4Z1PA 3IS0X 5C08D 4PJEF 4MTMA 4F8TA 3L45A 4U6HB 4M7LH 3WIIH 1NIFA 1J9RA 4UF7C 5B1AB 3VFVB 4DFIA 4IHBA 3H9ZA 1KXHA 4G8GA 4M7JH 1YEHH 1CFBA 1SDDA 4K2UL 1DVYA 3FHEA 1Q90A 2APXA 3B8YA 1MUJB 5I71B 1NGZA 5ESAB 4FQQA 4W9HC 3P77B 2D03L 3ZE0B 2K6YA 3DHMA 1O5DT 3LNEA 5I5JA 5D7LE 3SKOA 1JZ6A 4KRPD 2DV6A 3JTTA 3MV9A 4JAMA 1OAYL 5KVFH 3BZ5A 2KDGA 2SEBA 1RURH 3BYYA 1U8IB 5EBLA 2P45B 5I9QB 2VDKH 4Z0BH 2Z64C 3PGCA 4YHKH 4Z8FL 1BAGA 5EOCJ 2DLFL 2UXFA 1ITBB 1F1GA 2EE3A 3LNHA 3IVKA 4NM8L 3SGJA 1S5HA 2JKIS 3V5KB 4WV1B 5IFHL 3NESA 1UJTA 3P40A 2IH9A 3ZL4H 2WCSA 1CICC 1UH4A 2M26A 2XXCB 3GUFA 3TBWA 1SYSA 2C9SA 4G8IA 4X6CF 1KIQA 2FJHB 4YFDB 2WLMA 1QLRB 3VFSA 1H3VA 3MV9E 4Q6IB 5T1MB 4EUPG 2VQ4A 1D7BA 4J3SA 4YX2L 3TYFB 3FXIC 2HRLA 4J3OD 2Z92B 4ZAKC 1ADQH 5AD0B 1B2YA 3QQ4B 2VDRB 2D9CA 4LPVA 3S98A 1BPLB 3P3UA 3RZCD 1IZKA 4H0GA 1IO4C 2P7TB 5ID0B 2NY2B 4DVBA 4JB9L 4XWOC 1M6OB 5E00A 4IK7A 4FGMA 4FNSA 1O7SA 2VLRA 4P2AA 4XB8A 1FZKB 4X5WB 32C2A 2ZX5A 2UYLA 1QFUL 1FAIH 2Y06H 3VXRD 5E2WL 4APXB 3FQNA 2OYPA 4Q6IC 1NCJA 5F1OB 3M46A 4YN3A 4OKVA 4ZMLA 3DJZA 3BIBX 4RESB 2LAGB 4JX0A 5I15L 4PG2C 3ULUC 1WUZA 1BOGA 4KZEH 5EN2B 4HX1B 3JQOB 2NX5B 3O3BB 5D7LA 2ZWZA 3D48R 2OR9H 5F0MB 4QHPA 3EOTH 1RLBA 1U92A 5DT1H 1XH2A 4Y9CA 4M48L 1QBBA 1RSFA 1XGTA 5IHUH 1S78C 3BVNA 1B4JL 1JFHA 4Q74A 3ZE2E 2Y3NA 5F7FA 1MCLA 1EDQA 3KYOA 4M93B 4Y4HC 1A66A 5JW5B 1X5JA 3ZTDC 3T3PF 1H3TA 5HHXH 3LRKA 5FK9B 4M1CD 3H54A 1P7HL 4XP6H 1BF8A 3TZVC 1C9SA 1O5PA 1W0VA 2VXQH 2OTWB 5JOPD 2L7EA 1KGWA 4KDVA 4ABUA 5AFAA 1NGWB 3VE0B 1FA4A 2HCZX 3Q3GB 3V0GA 3TPKA 5HP5A 1RD6A 2YJQA 3IFPA 4C4BA 4F37F 2GJ6A 1T21B 3BH4A 3LPWA 5I76B 5FAAA 1CI3M 1F4HA 1GS7A 1CO1A 3Q6FB 3Q01A 2A6KB 1OARL 4Q9RH 1JOIA 4QXGL 5LG1A 4M62L 3VD3A 1UXWB 2VITB 3CDZA 4HCRH 4U2YA 4HSQA 4I1RA 4RMRA 2DYPA 4F57H 5DVNA 3CLEH 5HYEA 4XMKL 3WDIA 4N2IA 2YA2A 3KBEA 4NPKA 3ARED 2N59A 1MRCH 2F2HA 2PXYD 4DUXA 1FL3A 4OLXL 1JPST 1GVIA 5F6HJ 4PHXA 5CZXD 3RDTB 3AGVA 1HZLA 2XI9A 1PG7X 3TJHD 2DW5A 1E8ZA 3H4FA 1YEJH 3HMXA 3CDGB 3AXHA 5JORB 1MXDA 5KSBB 1ZHLB 3B9EA 1MCWW 3SKMB 3B5TA 5J6SA 3DBSA 3KWVA 1T0NA 5T5FL 5IB1B 3I85A 3L16A 2FEDD 3V4PL 1ZTXL 3FQXB 4MJ6B 4U0RB 4Y9FA 3H0TB 5TDOA 3CV5A 4U1SA 1I1AC 5DA4A 4LLYB 4NNPL 4WEEA 4S2SB 5FGSA 1RZFL 3EDKA 5EA0H 5HYSA 1NDGB 5D2NB 4TM9A 5E5LA 3RWDB 5MI0C 5F0JB 2YQ3A 3AZUA 4QT5A 5T1JA 3P2TA 3W9EA 1KWGA 1EVTC 1WS7A 1SHSA 5GJSH 3IFOA 4QRTB 2PWEA 3FB8B 4YSSA 2YLHA 3TH4T 1CF8H 1KJ3L 4GBXD 3ULVE 5EU7C 1OB1A 2YKKA 4K23H 3FOMA 4Y2DD 4YDVB 5BS0E 5IEHA 2CJTA 2UZPA 3OC5A 4QRPD 4BELD 4R3SB 1PPIA 4KJQC 5L0QB 5EU4B 5C3TA 1I7ZB 2XN9B 1PW3A 1QBLL 3P69A 1AD0B 1I1AD 1N6VA 5EO1B 1I9RH 1NZRA 1U8PA 1RJZB 5DEFA 3V7AG 4FXKC 4PR5B 1VKXA 1RJYB 4X8GA 3RNQB 1RURL 2ITCB 2VNCA 3MV11 3MUGB 2JTDA 3X3GL 3WNJA 4HG4J 3MV8E 4WTZA 5DD6A 3GGWA 3GUTB 5E6IC 5SX4I 1KPUB 4I1NB 1CD1B 4EE2A 1TETH 1VCBC 3EADA 1YCSA 2V17H 4KK5C 3UERA 3QRBA 3K4ZA 4I77L 3PDDA 4MZ3A 4YHNB 3WI9A 1T83A 4MXWH 5M95B 1FZOA 3IDIB 2FUQA 5FFOA 3T6ZA 3TTSA 4WNSA 3GBNL 2V2XB 3DX8B 2PR4H 1KTKE 2ITDA 5DTFA 2P8MA 4PGEA 4XP5L 1X5ZA 2YKLH 3VFPB 3NSDA 4H8WL 3QR1A 1J8HA 1SVCP 3BPCA 5DUML 5I30L 1MF2L 1AZRA 4FA6A 2E9IA 1HHIA 1U91A 2D0HA 4X6BB 1KYUA 1NC2A 5KSAA 5CZRA 3IGUA 1CS6A 3P0VH 2RGSA 2Y5TA 3MV9D 1JF6A 1AXIB 1YEIH 4LLDB 4UTCA 4P2RE 4WSKA 4UZSA 2DQUH 3QA3B 3VSTA 4F7EB 2H1XA 1UG9A 3NFPA 5IQ9A 4YOKA 3HI5H 5I15H 1KJ2B 5EOQH 1T21A 2WBJD 4ONGL 4KMTL 4LVEA 3AITA 1LGVA 3TBVB 3VI3B 4OGZA 4JG1L 3BVNB 4RFOH 2FBOJ 1NAML 5T1KB 1YA5A 5HVWA 3MLVL 2V7HA 3T0XA 5AWNL 3LN4A 4RGMC 1JDAA 4Y4HD 2HB0A 3DUSA 3ILPB 1CFQA 3QHTC 3EOTL 4W9KC 3REWB 5ANMA 3PL6A 5FXCH 3TIDB 1NGXA 2VAAB 4M48H 5B1JA 3X1FA 1JE6A 2UX6A 4C56D 1B4JH 2FE0A 3EBIA 4BFNA 3JV6A 5C2UB 1T0OA 3X14A 4A04A 4V2CB 1IQWH 1ZT7B 4ZODA 5HYJE 1W8EA 2OZNA 2WXGA 1WIPA 3D0VB 3D0LB 3QDME 4NCC1 4A7QA 4W6XB 5IV2A 2ICEB 3VH8G 4WTWA 4TUJB 5KVGH 3C5SA 3FRPG 3QRGH 3DXAB 5GZNC 2K8QA 4HWBH 2DWEA 3SDCD 1PQZB 2H26B 2NZ9D 2XQ0A 3QUZC 4FXTA 4HX1A 2CBPA 4NJ9H 2HTLD 1PJ9A 2WVUA 4Y2OA 4CVXA 3RVVD 1IAIL 3SQOH 5AVSB 1Z0NA 2R1XB 1OARH 5AYTA 2YPKB 1RMFH 4GRWB 1J05B 1B0GB 1CFVL 4FKKA 4OJDH 3IDJA 1HL5A 1EO5A 2F5AH 4JN2A 2H5UA 3FU8A 5T1KD 3QUYC 1TQBC 3IXAA 2V33A 4HIPA 5CUSH 1JP5A 3FSWA 4W9GC 2FX9H 1A4JA 2FQDA 3G04A 5FOJA 5TDNB 1HJCA 2L3BA 2MMXA 1RFDH 4TV3A 3WXWH 3MLRL 2X4RA 4PJHF 3ZU8A 1LP9E 4QRQA 2YBGA 3ZR6A 1BVKB 3F04A 3LRHA 4E42A 3V4UH 2CR3A 3VCLA 4ZZKA 3KPSD 1L7TH 4BFEA 3CC1A 4NHUA 1ZV9A 4OGYH 3RURA 4A6YH 4NWUH 4P3CH 3OJDB 5E8PA 5I1CL 4HCFA 4L4VD 3IPEA 4XNMA 2GG1A 4ZMTA 1IGFH 2E5EA 3X13A 2F53D 5I6XB 4PWKA 4K7PL 4Q2ZA 3SDAD 3OXRB 4YHPA 3VMPA 3BEVB 5KVGE 3RWHB 1RJLB 2E7DA 2JXMB 4BFIB 4S2SA 1YQVH 4C4KO 2D3JA 4KXZI 3T04D 4MNGA 4D0DB 1XXFC 4YXHL 3S37L 3RHWF 5J5EA 5C0FB 5L2KA 4D9RD 2Z4QA 4AIOA 3QUKB 1G7LA 2GVYA 3HE7B 5LLIC 4DP5X 4WTQA 3O11A 3RUGE 4HEMA 5I17A 3D18B 4BZ1H 5DJCB 3OC8A 4C57C 2X4OA 1S2EA 3FRUA 1G7JB 2N4IA 4ZUWB 5SWZA 1U8NB 1ORQA 1QLRA 3VFSB 3ZX1A 3MGAA 2QSCL 3PV7A 1P53A 1XB3A 1KG0B 5ADOL 2FJFA 1ZS2A 5GHWH 2Y72A 3DRTA 5IKCA 3ZLQC 1E9OB 2AKRB 2X9WA 1PSKH 5D7JD 5TE4L 1INEH 4PJ9A 4QYOA 2J1ZA 4KC3B 2J7LA 4AT6A 1UD8A 5SWQB 2CDEA 2WQWA 1JHTA 1PZDA 2VZ3A 5IUCA 3OKOB 3HE6D 3ZO0A 4MNQA 4NZRL 3WMPA 3KPOA 5LBSA 4F92B 3RTQD 1U42A 3KPLA 3BEWB 4L8BA 4YC2C 3WUWB 3CDYA 2HVBA 2NY6C 4DN4H 2F7OA 2VLLB 1KPVB 2KYIA 3DRQB 5KSVB 4JM2D 3D8MA 3WE6B 2Y1YA 3CFKA 4MYWB 4CW1A 1S7SA 1PG7W 4N9GB 2J8HA 4K5MA 5EC2A 1NCCH 1A0QL 1Z5HA 2DJ4A 1X7QB 4G6JL 2EYSB 3QUXC 1E9QB 2Y0SA 3VFPA 2ZWSA 1DQDH 2BZCA 1J1XL 4WFHE 3ROOB 8FABA 1NCAH 4P3DB 2FK9A 3O4LA 1U8CA 5JW5A 3LKRA 4G42B 4Y5XB 3DYPA 2J8UF 5IVOA 2K1MA 4M93C 3MRNA 5CNHA 2CGZA 5D7IF 2VN3A 1J0YA 4PJHB 4JHUA 3BISA 3LKNA 3R4RA 3W2DL 5I1DA 5BCAA 4AYBA 1ECZA 3EDEA 4EUPB 4PY7B 5DD3L 2H6UA 1BD2E 1ACCA 4XN4A 5IMOA 3NP4A 1M7IA 4FEIA 4ADJA 1WH0A 2C9QA 3NYKA 1DFBL 4J28A 4RRPA 3I9PA 3IRCA 4OJAA 4L37A 3FQWA 2G75B 5CS7A 5DO8A 3O4OB 3O3EA 1L6XA 3DDGA 4PRNA 3QZLA 1D5MB 4QOKD 3VDCA 1NAMH 2XWCA 1SF3A 1ZTMA 3L7EA 1V8HA 4L8SC 5JW3L 1YJDC 4P2RD 4MKTA 3GHBL 4OCXL 3G5VA 1N3NB 3N0AA 2DRUA 1D6EA 2H2SC 1NMAH 3DI2B 3PHOB 4G80A 4JANB 4KUCD 3ZIYA 1RUMH 1E3XA 1FORL 3AB0B 3MR9B 1G87A 3CN4A 5DZVA 4EJ1C 2ICEC 3DETD 1UD5A 2ZSVA 3D3VD 1J7VR 1BLNB 1RSYA 4K15A 1QABA 1L9PA 4FQCL 3PUCA 2OCFD 2XKNA 3WLWD 1GGBH 2IC2A 4XVSH 2IIJA 3LDBC 3FK3A 1HX0A 2AK1L 1J1OH 3D85A 3MYZA 4WK0B 2EEBA 4IRJC 2DPKA 4YXKL 4I0PC 5DJYA 2WGXA 3ARPA 2WYTA 1J9TA 5E9AA 1JFQH 4EUPH 1L6PA 2XQBH 3C09B 2YPLE 3DECA 3MLXH 4JEGB 2R2HA 2ZF8A 3HVNA 4YUEL 3WTSA 1B0GA 4UUJA 5KYWB 2Q76A 3HUJF 3A3YB 4K7PY 4YE0A 1WCBB 3BLKA 3UTOA 3H3PH 1MCOH 2EO7A 2VXUH 5TDOB 3RILA 3SGEH 1IAIH 4U31A 1SVZA 3GRGA 3PYCA 3I75B 3QIBC 4DQOL 1U9KA 1RMFL 4HIJA 3T0VA 4N1EA 2F5AL 3P1VA 3IDNB 3QWRA 2JMRA 5I9QC 3T4AC 4B9PA 3RVVC 4PJ5A 1SLWA 3BKJH 4F15C 4H8WC 4GI6A 1E40A 4XC3H 3F3HA 3GS7A 2HTLC 4HF5H 3HKFA 3HC0A 3NSYA 4CSTA 5C0NC 1FL3B 3HZMA 1TF4A 3SDCC 2NLJB 4AEHL 1PLGL 2G9KA 3GIZH 5AB1A 2R2EA 3C8KA 2V5RA 5FUCC 2HRHA 5BV7C 5IQ7H 1I4FB 2P8MB 4TSAL 2RCSH 1UWFA 3UC0L 3MSPA 3RB7A 4POUB 2R1WA 3PQYB 3EHBB 4LF3B 4P9MH 4XE0A 1BYNA 1IGFL 4LCCA 4PJBA 4MSWB 4FXLA 3TWCL 1GXEA 1UD6A 4HKBB 4N28A 5BVPL 5CEYB 35C8H 3OR7A 4ZO8A 4JHAH 4PLJC 4ZXBA 4ZX3A 1A6PA 1BAFH 4D0DA 1OAQH 3VXMA 5I0VA 4XE5B 4I0PB 4LCYA 2A9NH 3HS0A 5CEXB 3H9SE 4D8OA 2XCMC 1LDPL 2V5YA 3NFNA 3SO5A 2AXJA 3NABL 5GZOA 2A3TA 1H5BC 4H2CA 4K9JA 4MAUH 1Q9KB 1C5DB 1Z66A 2V9RA 3A5VA 3R1GH 3PAYA 4PMEA 2VZOA 2WLYA 4QRRE 5I8KH 3IJ9A 1E65A 3RL2B 1IGJB 4PP2B 2PTUA 4DWHA 3G3LA 3GINA 4ZFGH 5C2BH 1H3GA 1WZAA 4MLIA 2DWTA 1AHWC 2ADGA 2VYRE 4YHIA 2XBZA 3II3A 4FG4A 4FYTA 4IMLB 5ADOH 1FYTE 1ZA6A 4XOBA 4UT9A 2ZCZA 1S9VA 1UFUA 1R34A 4KNTA 4OCSH 4O00A 2B20A 3CZFB 3M17B 3HEIB 3PHSA 1CGXA 3QJTB 5F9WC 3MRLB 3CBJB 1PZ5A 5J6HA 1FIGL 3JWNE 3IJHA 4Q56A 4YVNA 2VLJA 1MJUH 4QRRA 5L8JB 5E56A 2AHIA 3JTSA 3VGHA 5MEOB 3G5ZB 5DHMC 2GBVA 3HR6A 5EUKB 1FZOB 3HUJB 1B2WH 1SRDA 2R7EA 4PV8A 3RKPA 2VDLL 4KTDH 1D5IL 3FKUS 3GJFH 4LSQH 4UYPA 4F9PC 3OWRA 4PJCA 3FPXA 5FYLL 3VXME 5ID1B 5E94A 1A47A 4PJHA 1IM3B 1MFEH 3V9EA 3AM8A 2O6CA 2CRIA 4WNQB 3U82B 1VENA 3K2UH 3MRNB 4YS4A 4YLBA 2KC0A 4WWKA 1ZT7A 5IIEA 4X7SL 3ZE2B 4LP5A 5DVKA 1BGXH 2KUTA 1ROWA 4MRBA 2A83A 2NY6B 3BPLB 2FB4L 5G2NA 3W2DH 3OLIA 5IMMB 2QEJA 1M7IB 1KEMH 2DWEB 3APCA 5E8PB 1IGMH 1F4XH 2VERN 3BUYB 3QEHA 3VSQA 2L8AA 4MA8L 5CR1A 1NLDH 4UNIA 1DFBH 2OMTA 4AKQA 2XZCL 4HKXB 5BPPA 2HLFD 2DQTH 3WE6A 5LQBL 4U1KA 3QXDB 1XEDA 5D1QD 4YGVA 4DSYA 4JNXA 5K9QG 5L88L 1UUNA 3QFJA 4F7CA 3KZ8A 1R75A 5DI8A 2GJZB 1PDKA 5HYSG 5I8EA 3V5HB 5FUZL 4AUJA 4UILL 5D7EA 5LBVA 1ZV2A 1RUML 1EIBA 4R4NC 2JI1A 5DD1L 7FABH 3FU5A 3IGAB 4X7DC 3DSNB 5D7IB 5H8DA 4NP9A 1BZEA 2H3XC 2OTUB 4APQB 1R5VB 1HNYA 4UT6L 3Q2VA 2KMWA 4NNYB 5A2AA 1BIIB 1YN7B 2BOCB 2O61A 3EO1A 1KJ2H 1NLBH 5C0JA 2ILLA 2YUZA 1P7KB 4M5ZH 3ZR5A 3MREA 1XIWB 3H1ZA 3U4BL 1J1OL 5CFAA 1NBVL 4X5LA 3UFIA 3VGBA 3PP4L 1GGIH 3LQZA 1RPUA 1XCTB 5EZIH 1U21A 2QGBA 1JG9A 1ZT1A 1E7VA 2WTRB 2YD3A 1UM6L 3AREC 4AQ1B 1QI3A 3EGXB 4CC4A 5FPIA 1KNOB 4R4ND 1D7DA 4J39A 5FYJL 4ZMNA 1S9WB 3MGTB 3TGXA 4NQDE 3MLZL 3R8QA 1MRDL 2MCG1 4ZX6A 1LO3L 1EGJA 3UTTA 4HOMA 2PYEE 4MNGB 2KLSA 2KPNA 2ZXCA 3ECUA 4LHQB 1A3LH 4G6AD 2FGZA 2GK2A 5BO1H 1YJDL 1AACA 1WVZA 1QSFB 3T4YB 4DK5A 4ZOBA 4HISA 4PJ6A 2NQDA 2XWRA 5DJCA 4X8CA 4WRLA 3UBXB 2X40A 3IDXL 1E4XH 3P9LA 3QUMB 1DO6A 2PXYB 5EDSA 1AYOA 4TNWF 5D5MA 2C1PA 1HINL 4HZAA 4CUCA 4LOVA 2HFEB 1TG8A 5DJZA 4CA4A 4QTHB 2ADIA 2KT6A 1GOHA 1YUKB 2KL6A 3IKCB 3MC0A 4NQED 4TSAH 5IOPB 4F24A 2CGYA 2WNWA 5EIIB 3SKJH 3SOTA 2VRAA 1M42A 1N12A 1TQWA 2NUTA 4NQEA 3IDGA 4UQCA 1G4RA 4Q2ZB 5BRPA 1Y1DA 3F6LA 2XTLA 1A14H 1IGIH 5KW9H 1R24B 3ZSTA 5KVDL 1MLCB 35C8L 3O4LE 5EO1A 4AVHA 1K85A 1JMXA 3B43A 1UVQB 5DD5H 1C16B 3UYRL 4I89A 3V52H 3P3RA 4P9HC 3B9KB 4TRPL 1OK8A 4BGLA 2A9NL 3D51A 4HUNB 2YQGA 3HC3L 1HAWA 4B6ZA 5D2NE 5EU3B 1F6FB 4BSVA 3N1FC 4NRYA 3Q8EA 4HULB 5ID0A 4FQXB 2YPLB 3ULSB 1OTTC 3IJ8A 3K71B 1D6EB 1NMBL 5IQOA 3Q1EA 4TSCL 4I18A 2OYLA 5KYYA 2DI9A 3OZKA 2HVKA 2C3VA 4N86A 5B4MC 1J05A 2DQJL 4OKVB 3FC8A 4Y16B 3MBXL 3KYMA 1TJIL 1LQBC 3L3OB 2M83A 2ESVA 2DEWX 5SV4A 4FMVA 3PE9A 2X2IA 4KROB 4YDLB 15C8L 1D5XB 1RUPL 1Z1WA 2DQHH 2PPEA 1G9NL 3OM3B 4F5CE 2DKUA 3GEFA 1G1YA 2OMWB 2J1YA 4QRRB 3V7MA 2CHDA 1F4AA 1KACB 4PB0H 5I16B 2G0LA 1RHHA 3LKSA 1XSJA 3C6LD 5E5RB 2DM4A 3FSZA 3MLWL 3F00A 2YBRB 3O9WC 3CUPB 4PLJD 4UM9A 5TE6H 3RJQB 1UOLA 3HE6A 2ZUQC 4RIRA 2MIZA 43C9A 3HMXL 5IK3B 2HT2C 5FYLH 2AITA 2ALAA 1HKLH 4OZHF 1PU0A 3LN4B 1MFEL 5E8NB 4KRPC 3LQAH 4M8UA 5HGAB 1LXMA 4BZ2H 2CQVA 4ABWA 5L2JB 1IAOB 4MJ2A 1UXSB 2EXTA 1Q9WB 4GW1A 2BNRB 3VI4A 4ZTOH 3FCBA 2GJ6B 2ZT9C 4QNPE 4PMFA 5T8IA 4OTXH 3X12B 1X7TA 1RULH 1ZK9A 5T1LA 3P77A 4FXGB 4L0ZA 4HXAL 2EUVA 5LG6A 4O58H 4Z7QB 4HJ1A 1BZDA 4APQD 4WKXA 1ZLUH 2VM4A 3U79A 4YZFE 2ZUQB 3GB7B 3TEZA 4XGZA 3SE6A 5JNYB 1C08B 1U8HB 2FDBP 4KUZH 5KAQG 5EPMB 4JL2A 5GGVH 4Y8DC 4JGMA 1QR1B 3VWJC 2QSVA 3FTGB 4N3UA 2GIYA 3UTZB 1NAMB 3F7VA 3M1BA 2Q20A 1TITA 3MLUL 3LEYH 2AVFA 4Y5VB 5EBGA 4ODUA 3DX6A 2A9AA 1T5WA 3C8HA 3QQ3B 5FOBB 1ILSA 3LSOA 1N0XL 2QLVB 3OLEA 4N2CA 4YFLI 1I3RA 1CFSA 1QAWA 3LQZB 4PW3A 5JHDA 2N1TE 4NUJB 4L23A 3BSGA 3V95A 1TEGA 5DJ0A 5IHBA 4UB0H 3WAKA 1M2OA 3RRQA 1PX3A 4MMZA 3RIFK 1NBVH 2X9YA 3QQ9D 4YFEA 3KPNB 3KLQA 5E5UB 4K3EL 3DETC 4NGHL 3SYAA 4MAYB 1FN4A 1FIEA 3SYOA 4OD2B 2I7SA 3VMNA 1ES0B 2ZOOA 3L4WA 1CYWA 1E5BA 1ZLUK 1UOKA 1O6SB 2YXFA 2LGNA 3B2VH 1PDKB 4NRXA 3CFBB 3X1BA 2A6JB 3T6QC 2DL9A 4YE4L 3ZHKA 1KC5L 4MJ5B 3IGKA 1QASA 3BI9X 4L1BA 5G5DB 5H4ZA 4B96A 4PJDE 4CRPA 7TAAA 1L7IH 3IJHB 3ESNA 2NXZC 1YMHA 1YJDH 3OAWA 4NM8H 4W4OC 4PEEA 3SO3C 1JGLL 5AVRB 2P47B 3T5WA 5L9DL 4GXFA 4EO5A 4NQUA 2DJSA 3GTNA 3IDXH 3PQYE 4YDMA 4P5MA 5D8JL 5IB5B 4GW5A 1DFXA 5DA0B 3RX8A 2WK2A 3FB7A 4JFYA 1ZGLA 3OTTA 1QVOA 5EF1A 2E7LC 5IW3A 3BAEL 4G9FA 4Y16A 2OYMA 3SN6N 1YNKH 2AW2A 3NDZE 1JI1A 4LLQB 4YXLH 2BLFA 4I2XE 4AEIL 4F20A 2X4UB 1HNFA 1ADQL 4F8PA 4JKWA 2ENQA 4IMKC 1UH3A 3CZFA 2CIKB 1NJ9B 1Q1JH 3N50A 2NXZB 2Z31A 4RMUA 4KZCA 3WDJA 2OYKA 4ZPVB 2QADD 1DZ0A 4JMNA 4QXWA 4QHNB 1KCSH 4PJ9B 4QYOB 4XPFL 4K5OA 5DD5L 2DWDB 3L1FA 3U1SH 3PV6A 3V0VA 1VLXA 3M07A 1YUHB 4D2NA 3LH2L 1QSFA 1NWPA 4JDTL 3QCTH 4JM2C 2JJSA 5AW4B 5TFSH 4MGXA 2J20A 3UGXA 3MCG1 2Y7OA 4KKRA 4GG8B 3C2AH 4DUWA 1FQ9C 5F1SA 2R39A 1FSKC 2OXGB 4NENB 5FUOH 4Z77A 2WO4A 5EIVA 3O6FD 5CM1A 1BZOA 1E4KA 1SDAB 4PY8J 4KMLB 4WO4D 4ZMVA 1X5HA 5F9OH 4EIGB 3BYTA 5D2LF 2OR9L 3GSQA 3ZHNA 2WIIA 4Y8AA 2Q7YB 4HMCA 1NC2D 2ZAIA 1MG3C 4HJJH 1JGDB 2X4TB 2A9ML 3HHSB 4Z7UA 4GW1B 1TJIH 5MEQB 1JK9B 4M3JA 3OMAB 3SB3A 1GOFA 1Z2KA 4PGBA 3OL2A 4A6YB 4PRPA 5E51A 1GPOH 1KGUA 2YUXA 2IVFC 4OZHE 4XBPA 4YSDA 3DJ9A 1X9RA 4F7EA 3BN3B 3T65B 3ARGD 1MI5B 4PS4L 5C0RL 3MLYL 4K3DL 5I1KH 4PV9B 4XP6L 5F7WC 2VXQL 4U1LB 1ET7A 3QEHB 3R4DA 3B5HA 1SDDB 4QRPB 2YBRA 1YYML 1LE9A 3U83A 4R0LA 1DYZA 2PWGA 3HE6B 3N6YA 4FFYA 3LKSB 2EDLA 1D7FA 3NQIA 1G9EA 1JZ5A 1A7PL 4RWHA 3L3KA 3FT3B 5EU6E 3O6KH 3P2BA 3APDA 5F72S 2ZPKH 3INOA 4LPTA 5TE6L 3FUIA 3B5GA 4HS8L 1MJJA 3PAVA 1RIVL 2E47A 2NUPB 4UQ2B 3WFBH 1ZVSB 4XO4A 4M6AA 3MRMB 4YDLC 2CO6A 4NLAA 3NJMA 3TVMA 1LO0H 4LFHD 2WUCL 4HDIB 4OZ4A 3N5AA 3LHPH 4FLHA 4NQDA 2ENSA 1DZBA 3GHPA 4CVXB 4WUKH 1CT8B 2J21A 3JZ7A 4UAHA 1SVBA 5DFVC 5GIRB 3TL5A 4HXAH 1PLCA 2HUHA 4TS6A 5IJCC 3KHQA 3QXUA 4PR5A 2VN7A 3HR5A 2IDTA 1WG3A 3OAZK 2DIBA 1N67A 4LKCB 3ROLA 2P7TA 3FSAA 4NN6B 5CO1A 3EYUL 4OF6A 1BQUA 3RX7A 2A9DA 1HESA 3M1OA 4BJLA 2FBRA 4GUQA 3TA3A 1DDHA 3FO2A 3BLPX 2OP4H 3HZVB 1TJHH 3S2CA 25C8H 2X4RB 4QRTA 4B97A 3LEYL 1RZFH 2P8LA 3CPUA 2ZZUT 4CILA 4Q97A 2QPEB 4ETQA 5DJ8B 5BZDA 4RDQG 1ND0B 5GZND 1N6QL 1CLYL 3ZZSA 4ERSH 4AM0Q 4PI0A 1KPRA 2Q3ZA 1KYOK 4NOBA 1IL1A 5LVEA 1CGVA 1KOAA 2GQHA 4DKEH 1FHGA 4IIQA 2Z0BA 1SN5A 3F7PC 4LOUC 3BSZH 4HAGA 3CCHA 1ZJAA 4NFDA 1UT9A 2ATPA 4JLRB 1QMUA 4XHJD 4XNZC 5IFAL 2FQFA 4UMGA 3TF7C 5LHDA 1QBLH 1RLWA 2P42B 3I2CH 3ALWA 3MNVA 3WKQA 1WRFA 2XPGA 4DGYL 1VACA 4LCCB 2VLRE 2EIJB 4P3WA 5IF0A 1LWJA 2FLMA 5CLXA 4J3TA 2WVSA 1XFPA 4NT6B 3OZ9H 1D9KA 4J1UB 2ZAGA 1FVDA 1IBFA 4FTVB 4X42A 4O51B 3L3DB 3E9UA 4MNHA 4M56A 2ITEA 3STBA 2X4OB 3BGMA 5F8RC 3DVFA 3QARA 1BFVH 3J2PA 5CN1A 1OM3H 1TETL 4TL5A 2ZNWA 4AE1A 3NJNA 3CTTA 4M9OA 1EO8L 1HHJA 3VXTA 4H26A 2JH2A 1MI5E 5FYKE 5BMFL 2W80C 2ZUTA 4JCWA 1NJ9A 2ZXGA 1THAA 5MENB 3BAEH 1KBGL 4AGQA 2RQ8A 4QJ4B 3KPLB 4R5TA 4EAEA 3C5ZC 3VI4F 4F2MB 2C34A 3POHA 3OKOA 2KLTA 3RPKA 3MUGA 4A2MA 4WO4B 3ZPDA 1Q1JL 5DUMH 1H6TA 3CJJA 3MV7B 5HHQA 2B9AA 2OTUA 4HJEA 3VYPA 4ZMXA 1D3CA 3NCWA 3P0VL 4NO2A 1B3JA 4RNRB 1KCSL 4XPFH 5AAMA 3GBDA 5AB0A 3VACA 2HJKB 5FB8A 4D0BB 3AJ7A 3L5IA 4LNVA 2P5EE 3ZT6A 2LLLA 2DQUL 4OCWH 3CQQA 1HOCB 4Y2NA 3K0YA 1QBAA 3EYQD 4LNRA 4TQEH 1F13A 3C6LB 3QEGL 1DHKA 1FPTH 4RFOL 4TQ8A 5BW7A 1PBYA 4OJYA 2BNRE 5DLML 4Y7OC 5JQHC 3MRIB 1DQJA 5ITFB 4WO0A 3U7WH 3T1WA 1CFNA 2G3NA 3L3OA 5CAYB 2A9MH 1WDAA 1HI6B 2GT9A 2GTWB 2N7AA 3ARSA 3CFMA 4JJOA 3ZK0A 1YMME 3R18A 2IPUK 4ZX4A 5FYKH 3O3EB 1IQWL 5JOFA 3QJHA 5DVLA 1KLFA 4FQHA 4MA7L 4B9IA 2HMID 3X3FL 2UXTA 4GBXC 5HHMB 3IFNH 5INDA 5D1XC 5I1KL 4NC0B 2YAQA 1O9ZA 2ZOWA 4Y16D 5KN5B 4AYDC 3IT8D 4HU8A 1MREL 1QLFB 1BFTA 1MCCA 3VXUB 1HCVA 1PG7L 4W9ZA 4NBZB 4WQOA 3V0WH 1Q9OB 1BF2A 2PP9A 4BM7A 5D9SB 1ZVSA 4FLOA 2XRAH 2MCPH 2WXKA 3RKDC 4GNKB 2X4PA 3UEQA 4RMTA 1GL4B 4B9KC 1TENA 1CR9L 4G7VL 4AY0A 1NAMA 2VC2L 5E24E 1TCRA 2QSTA 3FL7A 2ITCA 4XPTL 3RVXC 4LQFH 1BWWA 2E56A 1MLCA 4X9HA 1SXSA 3WN5C 2YRLA 3IXAB 1QLEB 3MXVH 4QT5B 4MXVF 1LO0L 3V55A 2YR3A 1DE4A 3D85B 2CALA 2VDNB 2FJGB 1S5IL 4TNVK 1SEBB 2F8OA 1H3UA 1MVFA 4E42B 2K8MA 4MXQD 1OB1B 1XVSA 4PW9A 2APSA 1OAZL 5AOKA 3X1EA 5DJ0B 5C07B 5K9KB 5JZ7D 2XZZA 2X2JA 4PSRA 4H5SA 1FYHB 2WO3B 1PL3A 3NTCH 3WN5B 4A6YL 2X4NB 1T0PB 1ES0A 2NNCA 2HLAB 3G08A 3RL1B 2X1OA 3SHSA 4IYKA 1AO7A 1C12A 4PRPD 5EDXA 3IDJB 4W93A 2MHAB 5C8JA 3I50H 1S4IA 4PD4K 4JPWH 5B3JF 2GBAA 5L8KB 2C3GA 4MS6A 2YSSA 1JAEA 2NY0B 4ICWA 4YAQB 2Q10A 5E9DA 2VLLA 1AQKL 4MD4A 2Q5BA 4I3GA 1TMCB 5HHVL 4JM4L 4YXHH 3S37H 4KOBA 4JM2B 5HHNA 1YEWA 5D93B 1NUDA 1WFIA 5DS8A 4G9DB 4Z9KB 3ZTCC 1UB6B 3SKUD 5HSFA 4NM4L 3EHBC 3S36H 3UAEA 5CCKH 4UNUA 1GY1A 4NZJA 5C0CD 1EFXA 5ABZA 3OSKA 4OM0L 1DBBH 1RPQA 1MPAL 1WEJH 3LKRB 4G42A 1KG0A 4U1MA 4Y5XA 3GMPB 3WEOA 2K78A 3VFUB 2CD0A 1UOWA 1HZHL 2XY2A 5D7JB 4YSRA 1OGPA 2YZ8A 2JXMA 1KELL 1BM3L 5IROC 2LW3A 1W16A 4QHMA 5DRNB 4QKXB 5GHWL 4ORZC 2HA1A 4NKDA 5EEVA 4WFHD 2IH1A 3I84A 4OH2A 3MNWA 5D6CA 2FNWA 2R29A 1WC7A 3DRQA 5KSVA 3O11B 5AL8A 1G94A 1R3HA 3X12A 1FNLA 3FONB 3QG7L 4QO1B 3KL0A 1F90H 1O7DE 1TVHA 4YSPA 3MNZA 3ULUD 3NFPB 1DVZA 1HDMB 5JA8B 3L7FB 5JQIB 3QDJE 1ZJBA 3T1FA 1WZKA 3O8XC 5EZJA 1JRHL 2OK0L 2RTTA 4JRWA 4J8QA 1MCRA 1IC4H 3B2UD 4Y5YC 4BHUI 1T2JA 5CJBA 1BFOB 3VW3H 4OIIH 3NZ8B 4KZDL 1T6VN 3QULA 4OBRA 4PJXF 4Z78B 5BV7L 5FC9A 5C08B 1B0WA 1PLAA 4AVKA 1KBGH 3EJQA 2ZTBA 2FRGP 2W60B 3GXNA 3EOAA 4QTIH 2TRHA 3BJLA 2O6FA 4ZAKD 1X6NA 1DLFL 1NCAL 1XZ0A 2C3VB 4KZ0A 3IN2A 5BVJB 3D39E 4AJWA 3LZRA 1EMTL 4MQSB 4UANA 1TTBA 1JERA 1GZHA 1SJEA 4QHNA 3ARBC 2XN0A 1QG3A 5MERB 3C5JA 1GYWA 4GAJH 3IS1X 1EEYB 1AKJA 1WPCA 2NY3D 4RAUA 2AABH 3Q8BA 5F7DB 4ZFZB 1G1CA 3AAZA 3CSYA 3WIFA 1RY7B 3MLTA 2CXKA 3TO4A 4F2FA 3VNYA 3KCPA 3PDOB 5AW3B 1EBAA 3Q8AA 2B0SL 2X4SB 3WEXB 2IEPA 5E95B 2VRKA 3FPYA 3FTVA 4HEME 1JZ3A 5GSVA 4GQQA 5CFHA 5C09A 5CD5D 4JY4A 4YLQT 4JO1H 5B7EA 5IT2L 3VD2A 4GUOA 3G6JE 3P73B 1NMAL 2D3VA 3GMRA 2X89D 3ARBB 1CDIA 1FORH 1EUUA 3T0EB 2B3IA 4JPKH 4NQDD 4W6WB 4F7MA 5JHAA 4DCQB 3D0LA 1BVKA 4BWUA 5CSZA 1FGVL 2FTAA 1BXAA 1GGBL 4XVSL 3WL9B 4KITB 1KIRA 4XN9A 2AK1H 1SQ2N 2CA4A 2VZ1A 5D55A 4RMBA 3CVIH 4JFWA 1OT2A 4QY8B 1I85C 5F8QC 3KDPB 2ZSWA 4UIKL 5T3ZL 5IQNA 5C8JB 5D1XE 1GCYA 3V5KA 2O5YL 3T2NL 1JGUH 4KXCA 4OF7A 4XP4L 3EXLA 4E9WA 4UQBA 2A4CA 1DQVA 1SY6A 2JWYA 4M6OH 5D7LD 2EEDA 2R0KL 2CGRL 4NN6C 3LZFH 3L4UA 2WB7A 4WWID 3T9WA 4B95C 3AFLA 3HZYA 3IU3B 2R29L 3ZIMA 1W0YT 5AVYB 2WWOA 3OF6D 2QELA 1EAPA 2MTAA 2KKQA 4JHWH 5HI3C 2WQVA 4EDWL 5CEZE 4P2RB 2APFA 4OLEA 2D2CC 4I1PA 5DRWB 4Y5VA 5JTWA 1XIWD 4GRLB 1EZSA 4L4VE 3AXLA 5DZAA 1ZA3B 1YNLL 5DMJB 2AGJL 1VFBA 4NUPA 4PGCA 4UTAH 5B7FA 1MQKL 2JKRM 3FRUB 4XZUA 5E2TH 4Q9BA 3WKNA 1VADB 2Y1ZA 4WUUD 4BKTC 4X4YA 5IQ7L 4PBWD 3UC0H 3N43B 4XXCA 1S6NA 4CC0A 3N43F 2D4DA 2I5YL 3K5RA 4LU5H 3QORD 2IG2L 1DVFD 2D3LA 4P9ML 1XQ4A 3MRDA 3UOAB 4AQAA 4DEUA 3DARA 3I50L 3KHOA 3NSCA 4KJPD 3RIAK 3N85L 4D7BA 2QQKH 3RNKB 1VPOL 1JD7A 2BIMA 2W9EL 3H56A 1W6WA 2VJ0A 1QZNA 3AUWB 3GSNL 1AQKH 3KPRE 5FHAL 3WNIA 2ZXQA 3IJYB 2IV8A 5I6LA 1EZUA 4ELKB 4JM4H 3TBYB 1U92B 3S34L 4Q6IA 5T1MA 5DHVB 4IOFC 4KI5E 1AP2B 2Q8BL 4PG2A 4L18A 2OXHB 3EG9A 3NSXA 4Z3IA 4WVRA 3FUDA 2P1YA 3BP6A 3IF1B 3QJUB 3WY2A 3R1GL 2P8PA 2OQJA 3U6RA 5E00B 3WE1A 1PIGA 4YQXH 1L9QA 1OP4A 1WWAX 2BP8A 4Y4FB 1K3IA 3WBDA 1ZKAA 2R4SH 4ZFGL 5C2BL 5C70A 2CJUH 3R7QA 3ABGA 3FQNB 3CFDA 5BVJA 5A43C 5C86A 4OZIF 1C5BL 3QZMA 4KJYA 2GPZA 3U4AA 2KBGA 1WBZA 4ENZA 1E2VA 4KQ4H 4PBDA 2H9GA 3G6DH 4CMMB 4M1DH 3CXFA 3GM0A 4G8IB 5AW0B 1G1KA 5HGBB 3C6EA 5J3HC 2XNAB 4NPJA 4GBXB 2ROXA 2LLNA 3CFNA 1BFOA 3J07A 2XV3A 3S3PA 1BBDH 1J9SA 4ODVH 4Y19B 2R69H 2IANB 4ZW6A 1JF1B 1HHKB 3KCPB 3NIDE 1EBPA 5IW6B 1F97A 3FUEA 4U6XA 1N59B 3VXNB 3F58H 3GHEH 3G6JA 1N19A 4Q52A 3CIQA 3DI3B 5E8DH 4Z3HA 1JZEA 3VW3L 5T33H 4DVRH 1A6WL 3IMUA 5BV7H 1T03L 1J0IA 2XBDA 4D8PB 4MMXB 4KVCH 3UP6A 4EKXA 1T89C 2DICA 3KH3A 3UACA 1EHLH 4H0LC 2BHYA 2RACA 5D7SL 4NNXB 1NC4A 1NSNH 2CLRB 4E5XG 3U0PA 1GW6A 4QHKI 5FYJU 5IJBC 4O9HH 4KKPA 2VSDA 4LASH 4X7SH 1XL4A 4CVZB 1DQLH 3EJCA 3F01A 4LKXB 4GKZB 3SPGA 1QTYT 4PY7A 3B6SA 3CU7A 3ZDZE 3DSFH 1OB0A 3SGKC 1MSPA 1UWXK 1BSIA 5HYSB 4YSAA 2AJXH 1UXWA 1NLDL 2VUOA 4M3KB 4TULL 4HCRA 1UCTA 2XZCH 3L1GA 5DHVH 3QUML 4U7SA 4KJWC 5KANI 4HGKC 4PRAA 3RGVB 4NOFA 4PJXB 5I2IB 4ZUVB 5L88H 4IHOA 2R51A 2Y36L 2O4EA 1NIEA 4LAJH 2C3HA 2EDBA 2DWSA 1VESA 2Z7UA 4F7MB 1UXSA 2C9RA 5HTSA 4UILH 1KZYA 3O2WL 3ABLB 5E2JA 4P8QA 1DE4B 2X70B 5JORA 3QDJA 3QWOB 4FOMA 3QFJD 5HI3D 3T8XA 3BWSA 1EFQA 1TSHA 2CZNA 3ARFC 1I1YA 4KO9A 3WL9A 3ZE1B 4X4ZA 3BKCL 5I0XA 4Z6AT 1OT1A 3WS3A 5C07A 1T4WA 4JDVB 3H53A 3Q1SL 3GSUA 5KG9A 4HUWB 3PP4H 2BIIA 3UJTL 1NPNA 4AMKL 3CDZB 1AQHA 1AR1B 4X4ME 5DJXA 1BZ7B 4LBAA 1KGYE 1EEQA 4MX7B 5CHNA 1NGYB 4CAGA 5CU5A 4Y1AD 4EQ2A 4P23B 1Q1PA 5ICXA 3SOBL 4F58H 1ZLVH 3LZFL 2ATKB 1L9MA 4LP4A 1BOGB 1I3GH 2B59A 4UMSA 3RAJH 1CE1L 3IU4H 2ARWA 4FI7A 2NY5H 4PYGA 3BUBA 2CO1A 4EDWH 12E8H 1Q0EA 4GMSL 4XT1C 2ZYIA 2FJHA 1AZCA 3PP3K 3VQMA 4G3YL 1WIOA 1IM9A 4QCIB 4YGAB 1IBBA 2D73A 4EPSA 1WT5A 1AD0A 5EU4A 3RLSA 2NY4C 4S1DD 3TEXA 1YEEL 1AGBA 3NFSH 4UDUB 1KB9J 1MWAL 3GK8L 2MCAA 3LXCA 1E30A 3KYOB 5AD0A 1P4LB 3U4EA 4NWTH 1OF2A 2Z8SA 3CHXA 1XZ0B 3LEVL 2DYPD 4ZSOA 4PP1C 5I18L 3HCVA 4BH8B 1RQ5A 2FIKA 2BNRD 4H0IA 4I2XB 2UX7A 1CFNB 1IEAB 1OGTA 4PQXA 1DSWA 3AT0A 1JBJA 1GH7A 4ATTA 1MHCB 3KYNB 1GGUA 3QORA 1KXVC 2X12A 3UYRH 2CCLA 2VLJE 3OGCA 2F7PA 2EDOA 3BESR 3GD1C 3QQDA 5HVFB 5CEXA 1U30A 5EZJB 5BRZB 4ALAH 3PJLA 1M1SA 1P1ZA 4IKKA 3TV8A 3MNZB 3V4PB 3W39A 1IGTA 4P2OB 1KYFA 1YEKL 4GEIA 5DQDH 4CNIA 3FUJA 1KGJA 3CE1A 4PJDF 5DJDA 1BG9A 3SBPA 2OL3H 3QNZA 3PS6A 4GFXA 4BCZA 1H5BB 1IC7L 4W4NA 2PR9A 4YSOA 5JOEA 1BDYA 2GUOB 2BO0A 5KAQF 3PL6C 2PABA 2OV0A 5AG9A 3CFIC 1U8QA 3ELQA 2B2XH 4OF3A 1NBZA 5F88A 1F6AB 3SE3A 1ONQB 2ZUVA 1PX4A 4MD5B 4WU7B 1XWVA 4DKFH 2HH0L 3EZJB 4XI5D 3FOLA 2VC2B 4ZFOA 5D7HA 1YMMA 3ZHLA 4JFEA 4TTDD 1K5NA 2ZUXA 4O5LH 4XNXH 4HJGA 1OOWA 4PRAB 3G6JB 4N0YH 1DJWA 1OCRB 3FQ2A 1EGJH 1EA9C 1ICTA 4OQTA 2EE9A 3HG4A 1FL5A 5CP7B 5DZOA 3PL6B 4FNLH 3R19A 3MLWH 2X3BA 2FO4A 3DOIA 5T33L 2PW1B 4I4WB 2FUTA 3FCUB 4MJ4A 5F97E 4NO5B 3NIFE 4N2KA 1FC1A 4JR9H 4NO0B 4OI8A