2UUDK

Crystal structure of the tepc15-vk45.1 anti-2-phenyl-5-oxazolone nq10- 1.12 scfv in complex with the hapten
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
113
structure length
113
Chain Sequence
QVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPYTFGGGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NQ10-1.12 ANTI-PHOX ANTIBODY
publication title Structural Basis of Affinity Maturation of the Tepc15-Vkappa45.1 Anti-2-Phenyl-5-Oxazolone Antibodies
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 13
structure length 113
sequence length 113
chains with identical sequence L
ec nomenclature
pdb deposition date 2007-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uudK00
3RZCC 5TF0A 1QSEE 15C8H 2PO6B 4JY6A 1CZ8H 2V7NA 1S7SA 2YD6A 3MR9B 4J4PC 3EJZC 5I1KH 1NANI 3BGAA 4UDUB 1HQ4A 3NN8B 5J06A 1EGJH 1VFBB 4TUOA 3E8UL 1ADQA 3ECBA 4OKVB 3QIWC 43CAB 1G7MB 1WK0A 4E5XA 3Q6GL 1NGXB 1JYWA 3GMOB 2DIBA 4XXCA 4OI7A 4U49A 1TNNA 3TPKA 1C12B 4LBEA 5KANI 3D0LA 3HNTH 3QHZH 1GSMA 1QKZH 3S4SG 2CIKB 1LK3H 1FZMB 4K3JL 4OJFL 1YNLH 3HMXA 4RQQA 3FFCD 3K7UA 3WKNA 1WZMA 4L3CB 2ZKHH 4S2SA 3GHEH 1IC4L 3H8NA 1KCKA 3KPTA 2DQEH 4IRJC 3BEVB 1A21A 1MCCA 3HB3C 1PZUB 3D18B 2AV7A 1T7WA 5J0BA 3ESUF 3DNKA 3RUGA 5KSBB 5C7XH 1ZLSL 3FOLB 4JGMA 5EUKB 1RUQL 3WUZA 3TESA 5L0QC 3UEZA 3WNOA 4LVEA 3HR5A 2HFGL 4QRSB 4F7CB 4JFFD 4PJAB 2Q86A 3QZWG 3TVMA 3O9WC 4D9QE 5JW3L 2QADB 5D1XD 1PY9A 5DJXB 2HMIC 1YUHB 1E6JH 3VXME 4NN5C 1QBBA 3U4EA 1OL0A 4KUZH 4HH8A 3RPKA 2JJUA 4XVTL 4P5TB 1KYOK 3MV7A 1TTFA 2XWJB 4JFQB 3V6FA 2CQVA 3VXSB 5BZDA 4NHUA 2FH8A 3P11H 1QBLL 4OZIE 4NM8H 3G5ZA 4RFEA 3VFSA 5ACZA 1DUYA 1FG2A 4WEBH 1XR9B 5D9SA 5IBLC 4C56B 4XCCL 5ESVA 3GSWA 1WIUA 5ACMA 3T2NL 1NAKL 3FO0H 1FIGL 2XZAH 3MJ9A 3WFEH 4Y4HC 4MA7L 3QWOA 2Q76A 3SPVA 1PQZA 1CE6B 4KRLB 2PYEB 3AVEA 1NDGA 2QSQA 1XCTB 4XP1H 4OI8A 4TVPH 4GW5B 4M48H 4ELMB 2CUHA 1EXUB 3EYSH 2OBGA 3PGFH 1INDH 2VR4A 1RHFA 4O9HL 4Q6YA 2JLLA 5C0BA 3F7PC 1JPGA 2GY7B 4FZ8H 2CDGB 5DDHA 3EJYD 5DO2C 4MS8C 3PXHA 1IAKA 5CGYC 3U4AA 1T83C 4LIQE 3O6MH 5CEXB 2ICEA 2EIBA 2BDNH 2JELL 5F3HB 5KSUB 4OLWH 5BV7L 2P5ED 1CICA 2W0PA 4P2RA 3RAJL 4Z76B 2W9EH 4YGVB 2Q3ZA 1MAKA 5K9KB 4BQ8A 3F8UB 1HCFX 1FCGA 1XGQA 4RMVA 1TITA 3LKOA 1S7WA 2VLMD 3DRTB 3KYKL 3L3GB 1VFAB 4PUBH 5E00A 3D3VA 5FHAH 1NL0H 2AQ3A 4X7SL 5JHLL 3WUWG 5SWZB 4PJIB 2R15A 5D8JL 5JW4N 4GH7B 3GIZL 3MCLL 2ZUVA 1ND0B 4LASH 4TNWK 1DTUA 5I6XB 4KMTL 1B0RA 5ALBL 3V7AE 2ATPA 3QWRD 2FHBA 2GTZB 4X5XB 4KUCF 1FL5B 1BVKB 1IAOA 5C08B 5FYLD 2FNBA 5MENB 1M7IA 1DBJL 4M6OL 4Z7WF 5FM5O 1YEEL 3CGTA 5T33L 3ARYA 2AEQH 4E9LA 1REIA 2BY2A 4HXAH 2VRAA 4N8VA 3RY4A 2OZ4L 3S6CA 2QKIA 1N4XL 5KTEH 1QRNA 3T3ME 4ONGH 5DJ0A 5EH1A 4ESKA 3OKNA 2AJVL 2AQ1A 4MX7A 5D1ZA 1MLCB 3MRDB 2D0GA 3PQYB 4Z7OF 3HG1D 2F8XC 4JFDD 1QA9B 5T1MA 4W6YB 3KPPB 4CVXA 4N5UA 4Z7VE 3LKPA 1LWRA 3WIFB 5F7HA 2AJZB 3BGFC 1KCSL 1CXEA 1UZ8B 3DURB 1RZFL 5BRZD 1J86A 1G7HB 5AZ2H 4CVZB 1TQCB 3QPQD 3MBEC 5I17A 3TYGL 3SE9H 5KVFL 1EHAA 1T66D 4Y7MA 4G8EB 4KJWC 6FABL 5IVXE 1FVEB 1T89C 3OGCA 1KLFA 1K4CA 2AEIT 2M26A 1UM6L 4LGPB 2J8HA 5D2LA 4CMHC 1RU9L 4LQFH 4OM0H 1Q1JL 3CDGA 1G7LA 1RAMA 5D7LA 4EXPX 3LIZH 1BQHG 2VN4A 2W60B 4L8SC 1ZTXH 3SGEI 1Q9OA 1UKTA 3ARED 3SKMB 4KKBC 2HLAB 1R5IB 1FNLA 2JCCF 3MRIA 3ARGD 4KVCL 2OL3B 4L3AA 5F88A 4LCUA 3SOBH 3P4NA 2YEZA 3IF1A 3VFPA 4KVNL 2BY3A 1JE6A 1FORL 3AFLA 4OZFH 1X6LA 2MQ3A 4HXBL 4Y5VA 4HUWB 3U7WH 4Q9QL 1FFQA 3BZDA 5GIRA 3BH8B 3G08A 1QSVA 4HPOL 5I1LA 5AWNH 4XZUB 2IANB 4R97C 5AZEL 2PW1A 2VDLL 5GISL 2H26B 4XP9H 4D8PB 4KZDH 3O2VL 5I73B 1C5DB 4P46D 1IGJA 1WCBB 1MJUH 3NCJH 4W68A 4OCLC 1Q72H 4MJ5A 3GBNL 4I0KA 4X7DC 2NCMA 4LCWD 3RWJA 3ETBF 5JXAL 3SO3C 2DMBA 4YHIB 4ZFZB 1P2CB 3QEQB 1JCKA 1CG9B 3OKKB 5DT1L 1A5FH 2AAVA 1NGQH 3QAZB 2FB4H 5FXCH 1V05A 3ZDXE 3MRLB 3RUGE 3ZHLA 4DCQB 2APTA 3AGVA 1TJIH 1JPST 2X4PB 3VWKD 2DM7A 3MOQA 3W0WA 3NZHH 2BP3A 2XKNA 5EO1B 3X13B 3VG9C 4F15B 4L29B 4FQJL 2VH5H 4M43H 5IEKA 3NVQA 2EDTA 2Y1VA 3WFCL 1FFOA 3PF2A 4X6CA 4NRXA 3DRQA 1FV1B 1SY6L 4WUUA 3ULVF 3LKNA 4Q6IC 3S88H 3MV7E 2VDML 4G9DB 1DQML 1P69B 4JG0H 4MSWA 2XQBL 3CMGA 4P9HC 5DJYA 5BS0A 4KY1L 4JDTH 1MCRA 5E8OB 4F9PA 1A6TA 4LEOB 4HD9A 4HKZA 4DAGL 2IFGA 2W9DL 4G8GD 3V2AR 3IB4A 4PTTA 5CSZB 3VD5A 2VL5A 4CMMA 3ZE2E 2X4NA 3S8WA 4PJEB 4PD4J 1OHQA 1EX0A 5FKAA 4Z18A 1N3NB 2BOCA 5J8OA 2ZJSH 3GMMB 1NMBL 5CMAA 4JANB 1CU4H 4ODWA 1QSFA 4HLJA 2FEEL 1U58A 4YX2L 2EIZA 5DMGC 4Y2DC 2AXJA 1U8KA 3S3SA 1DUZB 1NGZA 4G9FB 4LOUD 1G84A 2HT3D 5C0BE 2ORBH 1PX4A 2BXZA 5EBLA 3V0WL 3GMLA 1L7IL 1G7IA 3VA6A 5GRXG 2HAZA 1UM4L 3FQUA 1LO5A 1Z5LB 4MMZC 1T03H 1U3JA 3MRGB 1MFBL 3NPSB 4GRLC 4KPHH 3EO9H 4WW1A 3PDOA 4R2GD 4P2RE 5J6GA 4PRBA 1NCWH 1EFXD 1KTRL 2VXSL 1G9MC 4XB8A 2RHEA 1U8IB 1YEDA 3QDJA 3FQNB 4MNQB 4MD5A 3D3VE 1HH6B 2UY6A 4X6DA 1CFVL 1C5CH 3NAAL 4QRTB 5CIPA 3T0EC 3TC9A 1Z6JT 3VWJB 1U92A 4OIIL 1CI5A 2XZCL 4FQPA 4HK3N 2FL5A 3FZUD 4OV6F 5A2KH 5D71H 5C0EA 3L5XH 4NWUL 4R4NC 4ERSH 2GFBA 4YHNB 1HHJA 1MEXL 7FABH 4UQ2A 1YMHA 2H8PB 1PD6A 1EZVX 3GBMH 4P23D 4W81A 4LHUD 3B2UC 2JF1A 3SDCC 1QRNE 1KJ2A 5DUML 4KQ4H 5ITBL 2EDYA 3QDMB 3GGWA 4LU5H 2Z8RA 4HH9A 3RX8A 1A02N 3BOVA 3VDBA 2JKXA 4WI8A 2J5LB 4M7LT 5HTSA 1Y0LB 3LRGA 2CKBH 4A2LA 4IHOA 5GGTH 5CD5D 1QFOA 5DUPL 6CGTA 3IFOA 1V7NL 4HZAA 1A6WH 4FNLH 3QG7L 4OLUL 5ISZD 1JWMB 5TDOA 3E3QC 5HYJA 5J57B 5KSBF 1FDLH 4Y4FC 4ZYKA 1VADA 1C7TA 2FJHA 3TIEB 3ME0A 4P9HH 1SYSA 4X9FA 1U91A 3ALPA 3GJEA 4NO0A 4M6NH 1RSFA 5JOFB 4M6ML 4NGHH 1ZHLA 5F89A 5ID1A 1KSRA 4LLDB 3ZDYE 4YDVA 3MUY1 3BZ4A 4HIEA 3O6FC 4OAWA 3D48R 4ZUSB 3LKSA 3T3PF 4S1SH 4Y5XB 1U8OB 5FOBB 1CBVH 2CUMA 3WDIA 4DW2H 1LO4L 3K1KC 4LEXL 1TIUA 4WTWA 4WFEE 3JVGA 4XNQA 2ADFL 1JBJA 4LSTL 4CGTA 4EZMA 4HPYL 3N1GC 1BFSA 5B38A 3MGOB 4HKXA 4PJ5A 1MUJA 3TM6A 3G6AA 1P53A 3QNYB 2VZVA 5EWIL 2P49B 3D85A 5CJQH 3TT1L 4ELMF 1HI6B 4JJ5A 4Y16C 5GRUH 5IVNA 3REVA 4O2CA 4RRPA 2Z31A 3J7HA 3KXFB 1GGBH 3L3KA 1G9MH 1ZVSB 1KYOJ 3F6IA 5D1QC 3L3IB 4UT9H 4PJXF 4XP6L 4JDZA 2EICA 3WEXB 2NY3B 4EI5D 4YE4L 3MOAL 5DJAB 2GEEA 2R1YA 4YHPB 1I9RH 3RVUC 4HJJH 4IRSD 4MQXD 5DJ8A 1JK8A 1XF4B 2BVQB 3H42H 2WBKA 4YAQB 3O2DA 4F7MA 3G5XA 3H9HB 3GSVA 3PWVB 4LCYA 3TJHD 3IU3B 4XNMB 4BUGA 3KLHD 4Y4KC 1VFUA 3CIQA 5C0CA 3W0WE 3SJVA 3QUXD 4MDJA 1ZA6B 3LH2L 2DYPB 3ARBA 5EOQL 1WEJL 4MAYD 4HS6B 1X5ZA 2A9MH 2C4XA 2J8UA 4X6CE 4I3RH 12E8H 4MQ7B 1JPFA 3DUUB 3GSXA 1MLBB 4CW1A 1EHLL 1FYTB 4WUUE 4Z8FL 5CZVH 2FSEA 4WRLA 2ZOLB 1BFVH 1VGEH 3IRZA 5BS0E 4JY5H 1FVCA 3QFJB 4PB0L 2YWZA 1MHEA 4LKXB 3I50H 3P30L 4MJIA 4LPCA 5C6TH 2HRLA 2HP4A 2DQUH 2VDPL 3E6HB 3ALXA 1CFQA 4OFIA 3ARDC 1FO0L 2Y23A 5FYJE 3CPLB 5BZWA 4Y1AD 3KJ4C 5JPMA 4QRQA 5FUOH 5TDPB 3ARFA 1JNHB 2DL9A 4N0FB 1FAIL 1A7RL 2F5AL 1EGJA 4NQSB 4JO4H 1I8KB 4RX4A 3VFTB 1S7RA 1MCWM 2OJZH 2BNRD 1JRHL 4HCRA 2AERT 4ODVH 3LV3A 3F5WB 2NPLX 2X7LA 4AEFA 3EZ8A 4PRPA 1LO3L 1W0VB 4XPGH 4GW1B 1FZKB 3D39B 3QDAA 1Z9MA 2AXGB 3D9AH 3CUPB 2FIKA 5JLZB 4P59L 5D5MA 4ZOEA 3VXMD 4M6AA 4OCYL 4KROB 5JTWA 4OLYL 3STBA 4PB9L 1KPVB 1SYVB 4OCWH 1R5WB 2YRPA 4GBXB 3MLWL 1BQLL 1FQ9C 4ENED 2IG2L 1EEYA 2XTJD 1ED3B 1N6QH 1JHKH 1IQWH 1CWVA 4YDKL 3GIVA 3PUCA 5KN5B 1KB5H 4A6YL 2QHRL 4KXZI 3ULVL 3D1MC 2XT1B 5E8NB 4OZ4A 1M6OB 3FQWA 1OAZL 2CO7B 4M8VA 1MQKH 3QDJE 4UU9B 4W4NA 2CRZA 5GS1B 1QEWB 4HUXB 4X6DE 1JF1A 5EUOB 5HD8C 2CUIA 2AKRB 4QF1A 5DRZA 4MD0B 2FD6H 2R0KH 4YUEH 4EBQH 1XGUB 3OKLB 4G80B 1U3HB 1Z3GL 2W65B 4OLZH 3QI9C 3QO0B 3S5LB 5IBUG 2GKIA 5SX5H 1I1YB 4LLQB 2DLIA 5E1HB 4O51B 3OF6D 4NBZB 3RU8L 1NJ9B 1NFIA 1MFDL 4FQ2L 5GGSB 2EECA 4E42A 2NTSP 5IG7B 5I1AB 3TJEH 3K4AA 4WO4C 4MWFB 1HHHB 3PL6D 2NY6C 2Y9RT 1RIVH 1MJ7L 3LN4A 3MRRB 1DBBH 4NUJA 4RAUB 3UPCA 3BKMH 5FCUL 3IXAA 3K8LA 5I8CB 1C08B 5HYJE 1DBKL 5IIEA 4D9LL 2LE9A 4P5MA 5C9JB 5CJ8A 4GLRI 1CDUA 4V2BA 3OAZH 1H8OA 2E8ZA 1KIRA 4HQQH 2VR5A 5DD0H 4Z78B 1ITCA 1ZV5A 1KULA 5FM5M 3DIFA 3KVQA 4EOWL 4QXTB 1FCCA 1SBSL 4YDJA 2BHZA 2WW8A 1QTYT 4NZUL 4TNVF 4PG2A 5BV7C 2HKHH 3TFKC 4J4PA 1TZHB 2EEDA 4P3DB 4S10A 3V95A 3ULUE 3E8UH 1CLCA 5EIIA 1N2RA 3PE9A 5FA4B 3Q6GH 4NO5A 4DEPC 4PJFB 1OPGL 1HKFA 2V5SA 4ZUVB 3BEWB 1S9WA 4GAFB 4Y5YB 4KDVA 5DSCA 4XBGB 1ZT7B 5J6HA 3PWNA 5TE4L 1TLKA 2QV2A 1T7XA 4OUUA 5D96B 3C60A 1BF2A 1DSFL 2J4WL 4PJ5E 4K3JH 5IOPB 4KH2A 5TE6L 5GSVB 4K55A 2KDGA 2WWMD 3E2HB 4P4KA 4JFFB 5K9JL 1YJDC 3RNKB 4FMFA 5AG8A 4KK6C 4WFFD 4X98B 5DQJA 2CR6A 1XGTA 3DPBA 5SWSB 2EDJA 3TZVA 2XPGB 5F9WC 1UVQB 3U46A 1AGCB 4CJ1A 1H3UA 5GZOC 3BPNC 1J8HB 1RUQH 3TCLB 4HEPG 5DS8A 1AD0A 1X3DA 1T21A 2HFEA 4ZXBB 3VI3F 3FB8A 1OT1A 2AJYL 2HVJA 1VGKA 3KYAA 1RZIA 4MDIB 4N8CL 3ORJA 4ONHB 5JW3H 3KG5A 1W0WA 1PVHA 1MHCA 2YD7A 4D0CA 1U8MA 4F58L 3AAZA 5CEZD 5CBEB 4U1SA 4NQDA 1FFRA 4Z77B 4NJAL 1AC6A 4JZJC 1IKFL 2NYYD 3UTPE 2QJDA 3WJJA 5LGJB 3EOBB 3QDGA 4XVTH 4PRIB 3O3AB 4YK4C 1T5WB 3B9AA 4U6TA 1FSKB 2CLVA 3TBTA 1V7ML 3IDIB 3SJVE 3KS0H 2V2TA 4Z0BH 1VDGA 4J3SA 1QBLH 2DLEA 1DFBH 4NT6B 4WY7L 4KAQL 4OUOA 2P8MB 2J8UE 3ARUA 4KKNA 4C55A 5I1GL 5FUCE 4WEUD 4XCCH 4QHKJ 2HN7B 2YBRA 5KOMC 1NAKH 3T2NH 2OS7A 5FUZL 1LEIB 1FIGH 1NBVH 5CP7B 5MEQA 4IIQC 1CT8A 1JUFA 4MA7H 2XQYK 5E1AA 3L5HA 4BH8A 4MJIE 1CFTB 4P2OC 2FHFA 1IGIL 3PV6B 2AEPH 4DUXA 3K1DA 5EPMB 1VEMA 4QHNB 1T2XA 1G7QB 4WHYG 4O9HH 1F2XK 4X5WB 4FP8L 3QUKB 4GFTB 3KPRB 4K7FB 3HE6D 4YHLH 4AENB 5IWLA 4M3JA 1JGUL 5GZNC 4UTBL 3HLAB 4POZD 5T1LB 2JELH 4OF7A 3ET9F 3WO4C 4BSWA 1FPTL 5FKPA 1RUKL 3TA3A 5BV7H 1FL6A 2VLJB 3FO2B 4UTAL 1MWAA 3MLVL 4PRPE 4UIMB 3BUYA 5E5UB 2MNUA 3SDDB 2X05A 3ZT6A 3ZTJG 1Q8MA 2EXYC 1ORQB 1S8DB 3KYKH 5D5ME 1I9JL 3EUUA 5FGSA 5DRNB 3QQ4A 3RGVA 3IDJA 2GCYA 5FECA 4X7SH 5EA0L 2GSIA 5JHLH 4QHUA 3DETD 4LNRB 3NIFF 2CLZA 5D8JH 1FYHB 3MV7D 5BW7C 2W38A 3GIZH 3MCLH 2G5BB 3IYLW 3QUYA 5FA3B 3QCTL 2VDKH 1CGYA 1NKOA 4KMTH 2ZWLT 5ALBH 3V8CA 2DI9A 1VEOA 3OWEA 3UTZA 3JZ7A 1YN6B 4BYHA 3KPNB 3QIUD 2XNAB 4C83A 1U8LB 4LVOC 2HKFL 1BREA 1A7OL 2OMBA 1LD9B 1GAFL 4M6OH 4PJHE 5IB1A 2HFFB 2ICWJ 5IF0B 5T33H 3QQ9D 2OZ4H 3EDKA 1OM3L 1N4XH 5BXFB 5JXEA 4R7NA 3TN0B 2L7UA 1EHNA 5E6IC 2AJVH 2G2RB 1I7ZB 1I1AC 2CPCA 2YN3A 5M94B 5DJDB 2HH0L 1FFPB 2IAMA 4H1LG 4U3HA 4OM1L 1SM3L 4KKCD 4APQA 5INCA 4PJ9A 3BWAA 4JHAL 4NQEA 5HHOA 5DEFA 1KCSH 3ILQC 3LKRB 3WS6C 3TBYA 1RZFH 2WUCL 4IOSD 3SGJA 2PR4L 5CEYA 3BHBB 4K94C 1YMMD 1UXWB 2PTVA 4P2RD 3UBXB 5GGVH 3TYGH 1CXIA 3CSGA 5KVFH 3TBVB 3WFHB 1ACZA 4J23A 3ULSB 3MNVA 6FABH 3U36B 3TWCL 3ARGB 1UM6H 1X7QB 2EXWC 1RU9H 5IQ9B 4JRYA 1Q1JH 3D3VD 3VMPA 3EZJB 2J8OA 3ILPA 4TQEL 4KKAD 1RVFH 4W6WB 5EU3B 3HR6A 4H8WC 4PYHA 1MCNA 4L4JA 1GZPA 5EBGA 4X8JB 3QRFM 1MFAH 1SJEB 3RVWC 3QUZC 1CFNB 4QRUB 5HYIA 2DL2A 2COQA 2J12B 4D94A 4NQCD 5D6CA 3U0TA 4KVNH 4BFBD 1FORH 2X4RA 4UUJB 1I8MB 5I1DA 4P3WA 3AB0C 1ZK9A 4L9LA 1T4KA 5I1EH 4X0KB 1KCRL 4HPOH 3BH9B 4X6FB 1ZS8A 1T5XB 3B8SA 1RI8A 2H2PD 2IQAA 3OJDA 1CLOL 5AZEH 4D9RE 2VDLH 1MFCL 4J3TA 5GISH 3P73A 1KENL 1U8JB 1TFHA 3O2VH 3BO8A 3NIGF 1BMGA 1KTKE 5HJ3B 1OGTB 3BFOA 2PW2B 3GBNH 5JXAH 3ZHKA 4MB4A 3P0YL 5IMKB 2D7OA 4ZD3L 4YIQA 3CVHB 3U0PB 2R56L 4UNVA 3BQUD 1WBYA 5DT1H 4P2QA 2B4CL 4JKKA 3MV9D 1T22A 3M17A 1UKQA 2AEWA 5F9DC 5C8JA 2Y06L 4P4RA 1EAJA 3UO1L 5IV2A 3ZT5A 3QA3A 5TDNA 2MCG1 4LL9A 4Z7UA 2Z92B 5EOCL 3RL2A 2CKBA 4FQJH 4NQDE 5AUMB 2HWZL 3WFCH 3MROA 5C0GB 3WMSA 1UWXK 1IM9B 3P9MB 1S7VA 5EZLA 1DBAL 1W8NA 3P2TA 3DLQR 3QDGE 4WWKD 3CCHA 3I3EA 2VDMH 1DQMH 3VJ6B 2XQBH 3WO3B 4ZUUA 4LVNB 5EUOF 3VFOA 4FZEL 1XZ0B 1P1ZA 1UJ3B 1LE5B 1IGFL 1CIDA 4DAGH 4NQUA 1DQLL 4XCEA 5L2KD 2DWDB 2W9DH 4NIKB 4KWUA 2I9TB 1EO5A 2K7QA 2VWEC 1B4JL 3B9DA 5DTFA 3ARZA 1QNZL 3VGBA 3C6LC 4LARL 3F12B 3GUTB 3V6OC 4PR5A 2WANA 5I66B 4I18C 3RI5K 1NMBH 2NW2A 4JPWL 4YX2H 2Z4QB 4PY7A 3RNQB 1BD2B 4XMLL 3R06A 4R2GB 5I9QB 5JW4R 3G6JA 3GK8L 2HVKB 2XYCA 5I1CL 4JFPB 1A6ZB 3WHXA 3V0WH 3PWUB 4DTGL 1L7IH 1WC7A 4ELKA 2R2EB 4X4XA 1UM4H 5ID0B 2VZTA 3CK0L 4IOIB 4MJ6A 2D31B 4X6BA 4JJHA 1F11A 2DLTA 2FJFA 3S37L 4HUVA 1MFBH 3MRHA 1IEHA 1R3KA 1EEZA 2HT4D 1MJ8L 3VGAB 2WBJB 2OXGA 2VXVH 2ESVB 2ZPKL 2VXSH 4LLMB 4AEHL 2YC1A 2F74B 3VCLA 1YEKL 4I4WB 1GGIL 5FFLA 1RUAL 3IDNB 1J5OL 3QT2A 5T1KB 4BK5A 1CFVH 3NAAH 4U7MA 3MFGB 3ARWA 1A3RL 2BOBA 5BS0D 2C3WA 1F4WH 2A6IA 2NNAB 5DFTA 5T3ZE 3TNMB 4OIIH 4PPTA 3VE0A 1CLYL 2XZCH 1NGWA 1U8PB 5DI8B 4NP4L 1RD6A 5FYJD 1P5UA 3F7RA 4NWUH 3L7FB 2VZSA 3S35L 1QO3A 1FNFA 4ETQA 1MEXH 3VH8G 4X6EA 3PHQB 1G6RB 2Z91B 4UQ3A 5ISZB 4QOKB 2EC9U 4FXKA 1MRCL 4RSVA 4JFEA 5ITBH 5DUMH 2EH7L 4BKLA 4EN3D 1RZJC 1TNMA 3SQOL 2UVEA 4S0TD 3U48A 5IHZA 4KKLC 3WNPA 1E4KC 4EXKA 5A2FA 5DUPH 4JQXA 1G0YR 4WW2A 1V7NH 4OLUH 3QG7H 3UMTA 4FFVC 4KV5F 4NQEE 3RWCB 3TPUB 1AD9B 5HHOE 5JO5B 4GKNB 4JRXD 4YR6B 3QFDA 4LSRL 4FQCL 4FXGB 2QSVA 3MRMB 1CF8L 1WIPA 4MQTB 3RDTA 3C9NB 2DMKA 4M6MH 5DEGA 3HPLB 2AK4D 3E0GA 1JN6A 3KPLA 1AHWA 5FYKL 4NKIL 5IMOA 5B3JE 3V5HA 1XGRA 2CJUL 1BZ7A 4JR9L 4JRYE 1A1OB 4EDXB 1K3ZA 4OZGA 2W59A 5F9OL 3SE8H 2R1WB 2OR9L 3T65B 1F6FB 4ZUTB 1MPAL 5JDSB 4FQIL 2NY1B 3KPSA 4V1DB 2JK5A 2W07A 3EYQC 4JZOA 5E5MB 1J0HA 2J6EH 5D6DA 4ODBD 1LO4H 4R8WL 4LEXH 4NNXA 2ADFH 2CO6B 4LSTH 4RAVB 2FBJL 4HPYH 1UM5L 4ZO8A 1AGBA 3R4DA 4B5EA 2X70B 3DBXB 3LQAL 2OP4L 2DQHL 3ULVC 3FT4A 5EWIH 3TT1H 1UZ6E 3LN9A 1AJ7L 1XEDA 3HKFA 2AI0L 2ZUSA 4TSCL 5FM4A 2GJZA 3CD4A 5JIHA 3PP4L 2KQMA 5EU7E 5MEOB 2BNUA 3WLWD 1CDIA 3KGRA 4LMQI 1KTLB 4XP6H 1QSEB 8FABA 5HYJD 1F2QA 1ZA3B 3LQZA 4YE4H 3MOAH 4LSUL 5CJXC 3OSKA 2XFXB 3QUXB 2BC4B 1KF9B 5FYKU 3REWB 4XNZC 3LS5L 1PW3A 4P2QE 2BSSB 4DUVA 4M8QB 4RA0C 4ZSOE 1S7TA 3TO4C 3VXTB 5DMJB 4EUPA 3B83A 3L5IA 4OLEA 3P4OA 2FO4B 3ULUD 1N5AA 4OQTL 4Z7UE 5JZ7D 5EOQH 3V4PL 1MRDL 2VXQL 2YMXL 2ITDA 1WEJH 1MH5A 2PXYD 2I9LA 3GB7A 5D93B 2ZG2A 3AUVA 4NNYB 4QYOA 3TH3T 5IMMB 2ENYA 4NRYA 4WU7B 1A9EA 1KN4L 3C87A 4CKVX 2WM0A 5D72L 4TPRL 1RK1A 1U2HA 1EHLH 3JWOC 4AL8L 3S4SA 4NKDA 5JW5A 5EBMB 4K7PY 3QCVL 5I1HL 3DI2B 4PB0H 5GRVL 2D4FA 2PO6C 4HWZB 4LKCB 3FB6A 3P30H 3T0VA 1R24B 4M5ZH 1C5BL 5BVPL 2IC2A 3SCMD 3ESVF 1LVEA 1NAMB 1CDBA 1FO0H 5CJ5A 3OKOA 5GS2H 5IJKA 5DJ2A 2P5WA 5DMKA 4DVBB 4I0PD 1FAIH 1A7RH 4F7TB 4FQXD 5I2IB 2CDFB 4DKEL 2Z31D 1HHIA 2A73B 3LEXB 3MBXL 1HSAA 3VXMB 3BN9C 3IAGC 4N90E 4AM0A 1IT9L 3KJ6L 1JRHH 3K0WA 3LSOB 3QZWA 4ZAKA 2HT2C 4ODTL 3QXAA 5TE7L 1V3JA 3G6JE 3KDMB 3I6GB 4MNGA 5FDWB 4P59H 4WV1B 2BSTA 1NBZB 2HJFA 4LCIL 5CINL 4OZIB 3BPLB 4OCYH 5HI4C 5JOPE 4OLYH 3MLSH 4PB9H 3EGSA 3VMNA 1BQLH 2IG2H 1ZT4B 3FOMA 4S1DD 1UEMA 5LQBL 4AH2B 4YDKH 3FCTA 4LRIC 4XVUC 3BIKA 1X5XA 3BP5A 3ARBD 4YWGL 4A6YH 2QHRH 4BSVA 3ULVH 3GMRA 4Z0XB 1AP2A 4M02A 1OAZH 2UWEF 2WIMA 3BZFB 3FQXB 1I8LA 5C0JA 1ZMYA 3DTXB 2QADC 4U1HB 4LVHB 3MLXL 5B4MD 3RIAF 4PTUA 4OV5A 1IGML 4PJEA 4GT7A 2VE6A 1ZE3C 3L7EB 4P5TC 5AYQA 4JY4B 1Z3GH 4UT6L 1OLZA 5IB3B 3DGGA 2F54B 4G6AC 1RZKL 1D5XA 1JZ3A 2PTTA 3WN5A 3RU8H 1MFDH 2VIRA 4FQ2H 5B39G 5L9DL 3ARFD 2IMMA 2VZUA 4L3EA 1BFOA 4HIJB 1HDMB 4OIAA 4GJTB 3QJFB 1QQDB 4JFEE 1FRGH 1IBGL 1KLGA 3OKDB 4LSDA 1CDGA 2Z35A 3MA7B 3QHFL 5GS0L 4QNPF 2R1XA 1S78D 1D5ZB 1MJ7H 4G6FD 5KVDL 1J0KA 4ZG1A 5IKCB 1EAPA 3T4AA 1T1WA 4HWBL 1RHHB 1L0QA 4MNHB 5CZXC 1N8ZB 5DVOA 1ES0B 5BMFL 5FCUH 3PGDA 4WCYL 3PHOA 4C4KO 1LO2L 1MCWW 5F6HJ 1AC0A 1T0MB 3CFBA 1DBKH 3WUWA 2EDXA 4D9LH 1PAMA 1BP3B 1GIGL 2B5IB 1XCQB 4PJBA 1J1PH 5I16B 1EHXA 3MRKB 3GMPB 2NY2D 4MGXA 3K2MC 4YDLB 3OAUL 5DRWA 2BNQB 3HC3L 1EVUA 5I75B 1U41A 2DI8A 3OQ3B 1RJZB 2C7UA 4X7CC 2Y7QA 1SBSH 3STLB 2ZSVB 3VRIB 1R3JB 4NZUH 4ZNCD 4N1HB 2FYYB 4U2ZA 5I76A 2VQUA 4OZGE 1D9KA 1A0QH 1OTTC 2FEDC 2P46B 4J3XA 4Z7VB 8CGTA 4Y8AA 1OPGH 2V7HB 4KI5E 2H1PL 4DWHA 1OTSC 3BKJH 1OF2B 4M61B 3R0MA 4MA3B 4AIZB 5C09A 4IOFD 5I6XC 3B9KA 5IR1B 4U2YA 1E27B 1OW0C 1AGDA 1DSFH 3DXAA 1KJ3H 2J4WH 3ROLB 5IVXB 4WI5A 3GJFA 3K81A 5TE6H 5DK2B 1KEGH 2HYMA 1KIPB 5K9JH 3RWDB 1MCEA 1BPVA 3C6SB 3S9DB 2BVPA 3AU1B 1AXIB 4TUKL 3SN6N 3NABL 4QHLB 1S9XA 1WBZB 4HJ0C 4L4TD 4PJ8A 3DROA 1QLFA 2OZ4A 4JY6B 4ZOCA 2EE3A 1XIWD 2V7NB 1S7SB 3FKUS 5F7DA 1MCLA 4TVPD 1BQHA 2G9HA 2AJYH 3DMMA 3MV8A 4X7TA 5H94A 3O45A 4N8CH 1HQ4B 4PLKD 4F58H 2P1YA 5C0RL 4TUOB 3ECBB 3BYTA 4OFDA 2ZSWA 4E5XB 4YEFA 4NJAH 5DZNA 4ZNEA 5A2LH 2IEPA 4WHYH 1ZGLP 1I1FA 1IKFH 1TQCC 5IESL 4HIIA 2P42B 4D0DA 3RZCD 2IFFL 2LU3A 4LBEB 2XWBA 2Y5EA 1MRFL 3D0LB 1DDHA 5LBSH 1V7MH 4J4PD 3EJZD 5E4EC 3IDYC 2A6DA 3C5JA 1A2YA 3QIWD 4WY7H 1S9KC 1BVLA 4RIRA 5I1GH 2IALA 4RQQB 4C4KT 1XF2A 2MKLC 3ZTJH 4S2SB 4D9RD 3QUML 4OT1L 1R5VA 1QFPA 1A8JH 4OGAC 1QSZA 3EO1A 4PBWD 2W0KA 4XXDA 2AV7B 4RGNE 3CU1A 4LF3A 5D7IE 3RUGB 1IGIH 4DOHE 4XPHL 1CVRA 5IFJA 4R90L 3PXJA 4LSPH 1CFBA 4P4KD 4LFHG 5DMYA 3HR5B 3RQ3A 3QNXA 2V5MA 2P5WE 1JMXA 2WUBL 4H5SA 2Q86B 3HNSH 2XIDA 3TVMB 1O7VA 3NCYS 4TTDC 3TV3L 2VL4A 2MKWA 4ODSH 4HUUA 1KGCE 4IRJD 3HB3D 1KIUA 2DLHA 4UTBH 3U4EB 5KVMC 1WSST 3RVTC 4L4VA 4NRZA 1FPTH 1RUKH 1RULL 3T8XA 4UTAH 1FLRL 1KNOA 5I73C 4KK8C 3DX7A 3MV7B 4N0RA 3EDEA 2C3GA 2XZQL 3V6FB 2ITCA 3RA7L 1AR1C 5BZDB 4NHUB 3O9WD 4LP5A 1JHTA 4MNGE 1I9JH 4H1LH 3X14A 3VFSB 3G5ZB 4RFEB 5ACZB 1DUYB 1FG2B 5DF0A 4HC1H 5EA0H 5D9SB 5ESVB 4QKXB 2DS4A 3GSWB 2IBZY 3QAZC 1YQ2A 3TT3H 4YHZL 4DQOL 1SEBA 5C6PB 4QRPD 3QWOB 3QCTH 2Q76B 3SPVB 1PQZB 5F7NC 5DGQA 2B4CC 1KJVA 1NDGB 4LMQE 4HGWA 3VFVA 1IRAY 1EMTL 2VLRD 3E6HA 2EDRA 4JPKH 5IBLD 4F15C 5I1IL 2HKFH 2VNCA 5C92A 1GAFH 5C0BB 4Y19D 5GGQH 4ZTPL 3D2UA 1JPGB 4Z7NF 4HKJA 5DDHB 3CC5A 4Y4HD 5IROC 1OM3H 4KMLB 1IAKB 2YWYA 2X4QA 3K3QA 1HXMA 1RUML 1WFUA 3LQMA 2ICEB 5AEAA 4Q9CA 4I5BA 4JM4L 3IFNL 1CICB 2HH0H 5JA9A 4P2RB 4OM1H 3WIHL 1I4FA 1SM3H 1FG9C 2R9HC 2R69L 5MI0B 3P77A 1XGQB 4NQVA 1DVFA 1NLBL 1B88A 1DJSA 4L3EE 3LKOB 4PRDA 1S7WB 3BAEH 4JHAH 5D7KE 5DO2D 4MS8D 2WUCH 5E00B 3D3VB 4LLWA 2PR4H 5I0DA 1AXSA 1YN7A 3TA3D 3GM0A 4DKAA 1NEUA 5LAXA 3E1F1 2UYLA 5B3NA 3TWCH 2E9IA 1B0RB 4FG6C 2ATPB 4JM2A 4PJBE 1OP5H 3C5ZA 4TQEH 1IAOB 1M7IB 2ZNXA 1RV6X 1YNKL 4RMRA 5EU6A 4N8VB 3NTCL 1HOCA 1JI1A 3NPSC 4HWNA 2YHGA 2QKIB 1QRNB 5DJ0B 1YYML 1FN4A 1N59A 3OKNB 5GHWH 3LCYA 3WNKA 4MX7B 5D1ZB 3EDFA 3SDYL 5DHVH 1PBYA 3IETA 4GG8A 2LAGB 5T1MB 3K2UL 4JKLA 2UV3A 1EIBA 4CVXB 5KS9A 4LP4A 3DYPA 3B2VL 4OD3L 1F42A 3LKPB 5DMIL 4RWYL 1VCAA 1KCRH 3MRBA 2VABA 2XWTA 5HYQA 1UCTA 1CLOH 4RFNB 3EYVA 1MFCH 3VWJC 2FWOA 1KENH 4OSUL 5GGUA 3KR3L 5C09E 3WHE0 5I17B 3IJSA 1JPSL 5SX4H 2P24A 4RMSA 5E24E 2EZ0C 3DXAE 3SKUD 3KPOA 4PJ9D 4XPBL 3OGCB 3AY4A 3BP6A 5A2IH 4G8FA 1K4CB 5FK9A 2BFVL 5K9QI 5D2LB 4ZD3H 5H35A 3CDGB 5FO9A 1I85A 2R56H 3CFDA 3W9DA 1FNAA 4OCRL 4NQTA 4PREA 1G7LB 2ZG3A 5D7LB 1MF2L 4OTXL 2B4CH 4I0CC 4YHOL 1Q9OB 1S5IL 2KH2B 4KJWD 5DVMA 2Z93A 3MRIB 2J5LC 5F88B 4LAQL 4LCUB 5BJTA 2Y06H 2WSKA 3UO1H 5C0AA 3RVVC 4JRYD 3P4NB 2YEZB 3GSOA 3IF1B 5EDXA 1NQBA 2P47B 1L7TL 3VFPB 5EOCH 1RZ7L 1NBYA 1E4XL 2HWZH 3NFSL 1I9EA 1RZGA 3KHOA 4Y5VB 1DBAH 4KKBD 5ERWA 4JKPL 5GIRB 1YEHL 3G08B 3CJJA 5I1LB 3FFCA 4NYLA 1MSPA 5TQ2L 2PW1B 2ERJB 3DSNA 3NA4A 1IGFH 1MVUA 25C8L 1IGJB 1DQLH 2QBWA 3UTQA 2W91A 4MJ5B 5IM7A 4J2XA 3U0WH 3RWJB 3P9LA 4Y5XC 3S7GA 1B4JH 1QLEL 3O6KL 3QULA 1QNZH 1HWHB 4LARH 1WFNA 3BISA 5JMOC 1I3RA 1B6UA 5D1XA 4JPWH 3C8DA 4AEIL 2MHAA 4OD1L 5GSRA 3HAEG 2J6EA 3WBDA 2YZ1A 1SEQL 3W0WB 3GK8H 5I1CH 2XKNB 3B5HA 4DTGH 1EV2E 2GIYA 5IEKB 4JO3L 1N6UA 3HA0A 3LQAC 5D7JA 1FFOB 3CK0H 3DHJA 1G0DA 4X6CB 1RK0A 4NRXB 3DRQB 2OJEA 4WUUB 3LKNB 1S5HA 5J12B 4U6YA 1JJUA 1IE5A 1MJ8H 4MSWB 5BS0B 5DJYB 2P43B 2ZPKH 2NY3C 1A6TB 4HKZB 3T0DA 1DZBA 1YEKH 1GGIH 5HHVL 3I85A 3I6KA 1RUAH 4XWOC 1J5OH 2VL5B 4C59B 4CMMB 3B3IA 2X4NB 5JQHC 2JB5L 3HCVA 5FKAB 2BOCB 1QBML 2B1AL 4RMWA 1BJ1J 4M7LL 5CMAB 1OAQH 1A14L 1XFPA 4ODWB 1CLYH 1QSFB 4BM7A 1RPQA 1U58B 2EIZB 1R3IL 4NP4H 3BRFA 4WFGE 1G6RL 1U8KB 1NGZB 3I02A 3SE3C 4CN4A 3MC0A 2P5EA 2EDWA 1HXYA 2V2XA 4UBDD 4BQBA 1NLDL 3OKMA 5EBLB 4BUHA 3GMLB 1G7IB 4RMTA 1MRCH 1D6VH 5IVXF 3L3JA 2P8LA 3FQUB 5E2UL 1LO5B 2JJVA 2EH7H 1BVZA 1A6UL 1AXTL 4PBXA 1EFQA 3SQOH 4Y2DD 1Y6MR 4WW1B 3PDOB 2E7LC 3NFNA 5J6GB 4N0YL 4PRBB 4NO3A 1G7PA 5JW4M 2QQLL 1IARB 2CKNA 4JFHD 1IJ9A 1IEBA 3BT2H 1YEDB 3QDJB 4LSRH 4MD5B 4FQCH 3NIDF 3QWRA 5T3XD 4X6DB 1FO0A 1BBDL 4J12A 1CF8H 2ED7A 3HC4L 4U1NA 4CU8A 5CIPB 4K23L 4GAYA 1C16A 5ITFA 4U3CA 3R1GH 5FYKH 4NKIH 4JAMA 1FP5A 1QPXA 2CJUH 1F6LL 2FL5B 4JR9H 1GZQA 5C0EB 3NCFB 3NZ8A 1X9QA 3KHQA 2GFBB 5F9OH 2OR9H 1QYGL 3HG1A 4JFDA 1XAUA 1HHJB 4QGTA 4KROC 4UQ2B 4M4PA 1MPAH 4FQIH 1YMHB 1NFKA 4S1QL 5EU6E 3T0ED 4GBXC 1TETL 1AKJA 4R8WH 1KJ2B 1UENA 3CH1A 1MY5A 3GGWB 3ARRA 4HH9B 1H5BA 4HBQA 4J6RH 5BRZA 2FBJH 4OIBA 4R4ND 1UM5H 4IHOB 3IFOB 3LQAH 2OP4H 2DQHH 5TDOB 4JPVL 5HYJB 3QB7C 5GS1C 4A6YA 1WITA 4JFED 1AJ7H 3B2UD 4HS3A 3A6CL 2FRGP 3IKKA 4TSCH 1H8SA 4ZYKB 1VADB 3W9EA 2FJHB 2ARJQ 3PP4H 1SYSB 2D7PA 1U91B 3GI8L 4AQOA 5HGBA 1U3HC 1SVZA 3GJEB 4NO0B 1ZHLB 5F89B 5ID1B 1UB5A 4UILL 4YDVB 3AREA 4LSUH 2ICWI 1D6EA 5BCAA 3BZ4B 4HIEB 1RZKC 4OAWB 1X5FA 2M8XA 3CX5J 3ZLQC 1JIBA 3LKSB 4KRMB 4Y0GA 3LS5H 3NBNA 2H32H 3L9RA 2V2WA 4YHML 1S7QA 3FQRA 2Z8VC 5GS0C 4RNRA 4XNQB 5C0AE 3ZE2F 1ZGLM 2X4TA 3O6FD 2OQJA 5EBWA 4JHZA 4OQTH 3I2CL 4DN3H 3V4PH 1MRDH 2VXQH 5B38B 4HKXB 4PJ5B 1MUJB 3G6AB 4YLQT 1ZWIA 4P46A 1CQKA 1KN4H 1UH4A 3DVNA 3D85B 1HIML 3I9GL 3VU2A 3JV4A 1TZIA 4H0IA 4TPRH 1WFTA 5D72H 3SE4C 4JJ5B 4LCWA 1U0QA 4AL8H 1D5IL 4XBPA 4PRHE 3REVB 1KBGL 1JZ7A 4O2CB 1MAML 2C1OA 2Z31B 2X2YA 3QCVH 5E94A 5I1HH 3HC0A 1TVHA 1HNGA 3L3KB 1MIML 1IL1A 3FTGA 3X12A 4K8RL 4KQ3L 4KK9C 1C5BH 1PGRB 5BVPH 4JDZB 3SDXA 5JW4Q 3PWPE 3UJJL 1W0YT 3B8YA 2VITA 2VWEE 2R1YB 3GRWL 4U0RB 3ZKNC 3VWKA 4YBLB 2AS5M 3KNBA 5DJ8B 4NN7B 4DKEH 1JK8B 3MBXH 3F7VA 2XACC 4LCCA 4OFKA 4F7MB 3G5XB 4Y5YC 4YXHL 4LPVA 2JJSA 1IT9H 3GSVB 3KJ6H 4LCYB 4PLJC 4ODTH 3ARSA 3EKCA 3PJSA 5TE7H 5D96C 1MCPL 1T7ZA 5C0CB 3SJVB 4MDJB 3RVUD 3ARBB 5KZCB 1BZ9A 1Q94A 3E2HC 4LCIH 4UIKL 3WSQL 2J8UB 4Z7OE 3BP4A 1GGTA 1JPFB 4G8GA 3GSXB 3QO1A 3CZFA 1I1CA 4CW1B 3MV01 1W8OA 5LQBH 2FSEB 4Y4KD 1YQVL 1FVCB 4YWGH 1KC5L 1MHEB 4HSQA 4MJIB 4ZXBC 1J0YA 1FZOA 3UTTE 1CFQB 1V3MA 2ICWA 5C71A 5BZWB 5K9OA 5JPMB 4QRQB 1A4JA 1WBXA 2C4FT 2Q8BL 3ARFB 2AQ2A 2WV3A 2E7BA 4NWTH 1IGMH 2Q8AL 1X5YA 1UGNA 4LRNL 4OLVL 3UP1A 4UT6H 1S7RB 1OARL 5E8EA 4DN4L 4OZHA 1RZKH 1FSKC 4BK4A 3DSFL 1TJHL 3AMLA 3LV3B 2X7LB 3ARDD 4PLNC 4PRPB 2DQDL 1K8DA 1PDKA 5L9DH 4OF6A 1K9TA 2FIKB 1EFXA 5D5MB 3FMGL 3MLTA 3ZDYF 1IBGH 3O8XA 2VLME 3QHFH 5EZIL 2NZIA 5D2LF 4ZAKD 5KVDH 2EIDA 2NY2B 2P8PA 5L7XL 1EEYB 4HWBH 1F58L 3GIVB 2NTFA 5BMFH 2OTPA 4WCYH 1LO2H 4OZ4B 3FQWB 4HMDA 3TP4A 1GIGH 4KJPC 4O58L 3OBAA 3NMEA 1JF1B 2N56A 4K71B 1EA9C 4HW6A 4PJ7A 4F9LA 3OAUH 1CL7L 4H26A 2O61A 4QF1B 1NC4A 5DRZB 2PYFA 5IUSA 5SX5K 5C0NC 4LPWA 3NA9L 2XN9D 4P23A 5CAYB 4K7PL 4LHUA 3FN0L 3SDDC 3ZYJA 3TH4T 2BVTA 1DN0A 5F8QC 5JQ6L 1NCAL 3OKYA 1NFIB 3HG1E 4JFDE 2K3TA 5HD8D 4E42B 2NY0B 4TTGA 1JZ5A 5A2JH 4MJ2A 3JV6A 2H1PH 4U1IA 3OKEA 2X44D 4H1LA 4QHMA 4NC0B 3QI9D 1MIEL 4HAFA 4HC1A 4GRWF 1N0XL 5BRZE 3LN4B 1NFDF 3T1WA 3UYPA 4XHQA 1IC7H 2R8SL 1EJ6A 5EU4A 4NUJB 4P0DA 3IXAB 3OAZK 4P49A 4OCNC 5J1AA 5HHQA 1WWCA 1MJJA 5IIEB 4HLZG 5L8KB 2JJTA 4WO4D 4P5MB 3VD4A 1OGAE 5EFIA 1WUNT 4NDMA 1DQDL 2NY6D 2Y36L 1KIRB 4GAGL 3ZYZA 2YRLA 3FONA 3LPGA 4TUKH 3PNWA 3NABH 3TN0C 3V5KA 1OCWL 5DYOA 1J05A 4CU6A 3DIFB 5IHLB 2E7HA 5HHPA 2CLRA 5TF1L 3L5WA 3MACL 5KSVA 3BRGC 4YDJB 2EYRA 4H88L 1NCBL 4FQ1L 4NBYB 5DRXA 5C0RH 5EIIB 2XKSA 1N2RB 4XX1G 3MSPA 2MFNA 3OGOE 2R2HA 2O93L 2XRAH 4OF8A 4NO5B 3O0RH 1RJYA 5IESH 2B39A 2IFFH 1FVDA 2BVEA 3FT2A 2QR0A 1S9WB 5DSCB 1MRFH 1BIIA 3MUZ1 5J6HB 3PWNB 2VLKA 3RWHA 3TFKD 3ARGC 3HMXL 4OUUB 3HE7A 2CH8A 4JEGB 3C60B 4TRPL 4TN9A 3U79A 1JNLH 5IJVA 4GG6F 3IJYA 4P4KB 4WWID 4EI5A 4LCWE 1NDMA 4G8IA 3QUMH 4OT1H 4PGDA 2P4AB 5DWUL 5DQJB 1LNUA 1XGTB 4IRSA 3B9KD 2IJ0C 3TZVB 1H8NA 4IDLA 4YPGA 4HK3J 3DXAD 3U46B 4F57L 4XPHH 1EERB 3SDXE 4R90H 5CD3A 5DS8B 2NX5A 4ZS6C 1AD0B 1T21B 2HFEB 3GSNA 3RKPA 3FB8B 1P84K 2HVJB 2WUBH 1GJIA 1VGKB 3U7YL 1BHGA 1RZIB 1OWRM 1W0WB 3TV3H 1MHCB 4D0CB 4OLXH 1U8MB 5DHVA 3AAZB 4U1SB 4NQDB 4PG9A 3L3DA 5E7FA 2R39A 4ZFOA 1E28A 4NN5B 5MEPA 4MAYA 4JLRA 3QDGB 2XG5A 5GZOD 4M4RA 1RULH 1FLRH 1NSNH 1VSCA 4IMLA 4W70A 4HBCL 2KQNA 2CLVB 4XH2A 3TBTB 1CLZL 5HYSA 2V2TB 3H3BC 4XAKD 3MZGB 3RIFK 2IGFL 1F13A 4M9OA 2DB8A 4G8GE 1UCBL 3GHBL 3EW3B 2YBRB 3LKQA 4YHZH 5EN2A 2W92A 4Y1AA 5FIEA 5MEQB 1CT8B 1JUFB 3VXUA 1W72H 5E1AB 3B5TA 4BH8B 4K2UL 5B8CA 1PLGL 5E08L 1DEEA 2BNRA 5JHDD 1EMTH 5I1IH 1JTTA 3SQBA 3EHBC 3WDHA 3CDYA 4FABL 2IF7A 4R7DA 4BQ6A 1LO0L 1NCCL 2VUYA 4KFZC 1PSKL 1BOGA 1RUMH 4OZHE 4POYA 2MOVA 5DK0A 4LVNC 3T3PE 2A0LC 4KJYA 4YEEA 1F90L 4BSWB 5FKPB 3TA3B 1FL6B 3GI9H 3IFNH 1UJ3C 2EDFA 1MWAB 3WIHH 3BUTA 5MHSE 3DO7A 3BUYB 1XF1A 2R69H 5J4MA 1L0YA 1NLBH 4U1JA 1GGUA 3ARVA 2EYTA 2ICES 3CZJA 1KPRA 1UA6L 4U1LA 4HV8A 2R4RL 3QQ4B 5GZND 3RGVB 3IDJB 2GCYB 5FECB 3SBWA 1QVOA 5E03A 2GSIB 1X5JA 4QHUB 4YC2B 2CLZB 3G5VA 4AMKH 4HG4K 4YHYB 4M1GL 2GY5A 2HJKA 3TCXA 5ECJE 1TJGL 3QUYB 1WLHA 3OAYH 4HMEA 5J11B 1LHZA 2VZ3A 5DJZA 4ELME 1UB6A 2EXYD 1BJ8A 4X83A 4R2GC 5I9QC 3LB6D 2QLVB 3K80A 2R0LL 3UTZB 4C83B 3H9SD 1S7XA 5KANG 1Z2KA 2QQQA 2L7JA 4PJXE 4PJ7E 3OF6A 3THML 5IB1B 1YNKH 4NC1E 5FGCE 3NTCH 4BZ1L 3ZKMC 1YYMH 4R7NB 4U6HA 4RAHA 3VGAC 2WBJC 4EKXA 4BZ2L 4S11A 3PL6A 1OAYL 4JN2A 4OFYD 3VH8A 3SDYH 4FTVD 4MYWB 4L5FL 2IAMB 1F00I 4R6UA 3QPXL 3ZSSA 3K2UH 3LEVL 3D2UD 4APQB 4GXVL 3B2VH 4OD3H 5INCB 4PJ9B 5DMIH 3BWAB 2YN5A 4NQEB 3L1OL 5HHOB 2I24N 5DEFB 3CXHK 1GOFA 5SWZE 3TBYB 3WXWL 2Y25A 5CEYB 5E6ID 2B2XL 3O41A 1I1AD 4OSUH 3KYNA 1JPSH 4CNIA 3MNVB 3OTTA 4XPBH 2F9BT 4OB5L 1WQVT 3MO1A 5F70A 1ZSDA 2NLJA 2X4UA 4GKSA 5E8PA 2E7CA 5ETUA 3ILQD 4JRYB 4M62L 3CLFL 5CD5C 3CFJA 3VG0L 4Q7DA 1X4XA 3ILPB 2N7AA 3IS0X 2W9LA 3T1FA 4OCRH 1UQSA 5F6IB 3MRQA 3GEWB 1MF2H 2D2OA 4OTXH 1J87A 4YHOH 1GZPB 5DK3A 2FX8L 3G5YA 5IW6A 4LAQH 2J8UF 3R8BB 2XV6B 3SDAA 3PQYE 2AJUL 2V6HA 1J7VR 2EXWD 1T6VN 5F7YC 5IB5A 5GRZA 5LXGL 1TMCB 5D6CB 3U0TB 1L7TH 2WQ8A 1RZ7H 3H7BA 2MPAL 5IK3A 2X4RB 5I1DB 3HAEH 2BHYA 4PJCA 1E4XH 1P7QA 4AT6A 1J0IA 3NFSH 4L9LB 1HKLL 3BXNA 4CVWA 4K9EL 1T4KB 4JKPH 1YEHH 3KYOA 3RVWD 1A7QL 4GMTL 9CGTA 1P6AB 1ZS8B 2EDKA 2OMNA 4XB7A 4U6VL 4RCAA 2DM2A 5TQ2H 2IQAB 3OJDB 3RZWA 2E3VA 3P73B 1IGCL 2VLKE 4MA1B 1T0NA 3BO8B 2PN5A 2RCSH 25C8H 5FV2A 3CSYA 2DBJA 3AM8C 4ZQKA 3SKOA 3Q6FA 1QLEH 3U7AA 1MQ8A 3O6KH 4YIQB 3NFPA 2NY1C 1U8NA 2DQIH 1GH7A 1KFAL 1WBYB 1KEML 4P2QB 3OXSA 4AEIH 1T22B 3HZMA 5GS3A 1WAAA 1QOKA 3M17B 5C8JB 4XVSH 2AXHA 2NX5E 4P4RB 1P4LA 3LY6A 1SEQH 5IV2B 3QA3B 5TDNB 4Z7UB 3RL2B 4X8XA 5D70H 2CKBB 4JO3H 4F37F 3MROB 2AABL 2D0FA 4I13B 1WFOA 1S7VB 5EZLB 3V4UL 4M1CC 3UYRL 4WU5A 1LK2A 4OFPA 3CCHB 5C0AD 3M07A 1T1ZA 5E56A 1JGLL 4ZUUB 3OJ2C 1I9IL 3VFOB 1ACYH 4KDWA 4X7EC 4KDTC 1P1ZB 1TTUA 1I7UA 4NFCA 3SKJL 4XCEB 3BD5A 4KHTL 2JIXA 5HHVH 1FGNL 2VQ1A 3BYYA 2A6JA 3QUXC 4QT5A 3ROOA 1NCNA 3DX9A 4N9GA 3TLRA 3WCYA 3RP1A 5DTFB 2K9UA 4PRHD 1W2KT 2JB5H 4QTIL 4Y1AE 1QBMH 2B1AH 3Q1SL 4PR5B 3FJTA 3VXUE 2NW2B 3HE6A 1A14H 4DK3A 2H32A 1Y18A 4JQVA 1R3IH 1XF3A 4PY7B 4JFOA 5I8KL 3ZYIA 3PWPD 3VRLF 2BNRE 1G6RH 2CRMA 3R06B 1IAII 5F3BA 4GRMA 5D93C 3WYRA 3G6JB 5J1SC 1GGCL 4FN0A 3G9VA 1G9NC 3WHXB 4S1RL 3C6LD 2EKJA 4KTYA 1WC7B 3NCYP 4ELKB 4X4XB 1TQBB 4B41A 5IP4A 3WFZA 4KUCD 1JWUA 4MJ6B 3NCBB 4X6BB 1F11B 3RTQA 1A6UH 1AXTH 2FJFB 2ENSA 4HUVB 4WUKL 2AGJL 3MRHB 1R3KB 2G5RA 2A6KA 3VD7A 1EEZB 1TZGH 4GW4A 2CK0L 5DQ9A 4AZ8A 4N0YH 5EC1A 2QQLH 3FB7A 3X3GL 2YA0A 3S3JA 1CFSA 1HQRA 2XTJE 5HDBE 4YZFE 1HHKA 2C1PA 4K8RC 4ACPA 2YC1B 3VCLB 5D7JD 4MHHG 5A40E 5D2NA 3QIUA 2C3HA 2WZPD 1BBDH 3S36L 2BOBB 4MXWL 3HC4H 4UNUA 2A6IB 4W4OA 4K23H 1KV3A 1F02I 1TCRA 3BD4A 3HRZA 4O00A 4ENEC 4IDJL 3OG6B 3VE0B 3UTTD 1NGWB 1YDPA 5LKNA 3A67L 5IFHL 4OGXL 4WV1C 1QO3B 1QYGH 5I71B 3BPLC 4ETQB 4LLVA 3ZE1E 4M7ZB 3UYOD 4X6EB 4DKFL 4X80L 4NM4L 4UQ3B 4S1QH 4FXKB 1TETH 4JFEB 4N8PA 5J89A 1KLUA 2IBGA 4BKLB 1HE7A 5B39A 4G43A 2R23A 2WP3O 2R4SL 2HTKD 1YMMA 3N50A 4C58B 5IHZB 4PGCA 2GJ6D 4WW2B 3PGCA 4UINL 3VGHA 1QHOA 1JGEA 3UPRA 4JPVH 4LVHC 3T2OA 4MAUL 4PBVC 3D0VA 1GYAA 2GAZA 1I7TA 3A6CH 2UZIH 2YR3A 3QIBA 3QFDB 4PJGF 2BVOA 4HT1L 3FRUA 3B9EA 3KAAA 5DFVC 3RDTB 1JGVL 3PWJA 5DEGB 1JN6B 2FATL 3KPLB 1AHWB 4UILH 1AO7D 1F3DJ 3J8F7 2EEAA 3FN3A 5IMOB 1TPXB 4FFVD 3V5HB 3VDCA 4XC1L 1XGRB 3L95A 1BZ7B 1JTPA 4EI6A 1FNEA 4FQHA 4OZGB 4WNQA 3ZE0F 1IC5H 4NQCA 1YJDL 5GS2D 1JFQL 2K1MA 5GXBB 4QO1A 4MVBC 4OGZA 3KPSB 1K5NA 2JK5B 4P5KA 1IEAA 2LTQB 4JZOB 4YHMH 5ANMA 4NKMA 4G42A 1OY3B 1QP1A 3RJQB 2RFXA 1IKNC 2DM4A 4NNXB 1P4BL 1N64H 1LGVA 4HEME 2XA8L 2FJGA 4RISL 35C8H 5A3ID 1AGBB 5IGXL 5E9DD 4PJCE 2B5IC 1CGUA 2EEBA 4AJ0A 3FT4B 2FHCA 5HGDA 1HIMH 1DLFL 1SBBA 1A3LL 1AKJD 3EYQD 1LEGA 4ONFL 4YDLC 1FNSH 1P7HL 1D5IH 5F96L 2GJZB 4NPYA 5I75C 2IPKA 4F2MA 3FN9A 1MAMH 1P7KA 3KS0J 4PP2A 2BNUB 2DQJL 3BQUA 4WFFE 3CSBA 4KQ3H 2NXZB 1IC1A 4I2XA 2EDQA 8FABB 4QWWC 1AIFA 3RWIA 3ULVD 3LQZB 3MV9A 3QDHA 4OCXH 2X9WA 1OGAD 4AG4L 3EAKA 4Z6AT 4KRPB 2APXA 2WWMC 5B38G 5C0FA 3ZO0A 2KUTA 5CEZE 3UPAA 4BQCA 1F45A 1QFWM 3ELAT 1GOGA 1S7TB 2DQFA 3MOBL 1J8KA 1VHPA 1CXLA 1WAAE 1P9MC 3QHTC 4EUPB 3P4OB 1MCPH 1UKSA 4WWKA 2WP3T 1QR1A 1N5AB 2ITDB 1MH5B 2I9LB 2YUVA 3GB7B 4XHJD 4UIKH 4QYOB 3WSQH 4K3EL 4NRYB 4HGMA 1A9EB 4NQXA 3DJ9A 3SGKA 5L2KA 4ZPVA 3CH8A 3TO4D 1RK1B 3ARXA 3QYCA 3PWLA 3S4SB 1B9ZA 1OD7A 1YQVH 4NKDB 4RMUA 5JW5B 5E6YA 1QZ1A 2NYYC 4KK5C 4IS6A 5E2WL 1KC5H 3FB6B 3HUJA 5FO8A 5TFSL 4RGNB 2EKSA 3INUL 5D7IB 1ZLVH 3OKOB 1UADC 4MB3A 1EGJL 5DJ2B 2P5WB 3SY0A 1ZVHA 4M9PA 2Q8BH 5DMKB 1NC2D 4XXCC 1HHIB 5EZJA 2Q8AH 1HSAB 4HCRL 3H3PH 2X4SA 3WLBA 5F1KC 2PO6D 1OARH 3STZA 4DN4H 3B6SA 4D3CL 4AM0B 4FFZL 1OT2A 3HNTL 1TJHH 2VO5A 1VKXA 3QZWB 4ZAKB 1ZHKA 4ZTOL 2DQDH 3QXAB 1SJHA 1KG0A 4JFZH 2UVFA 3JBG7 1UJTA 3CVIL 4PRNA 4MNGB 3IJHA 2ZUYA 5A16A 2BSTB 2HJFB 3FMGH 4AIXA 4F8TA 3F58L 3BN9D 5EZIH 2O5ZL 2CMRL 2IH3A 5TJWK 3EGSB 3MRPA 4HJGA 4RBPH 4G3YL 5L7XH 1VEPA 3FOMB 4TOYL 2HT2D 1F58H 3MJ8A 3QUMA 3FCTB 4XNXH 4POZC 2C5DC 3BIKB 3BP5B 4BSVB 4JVPA 3GMRB 3DVGA 3UTOA 1AP2B 2APBA 4BELD 4XCYA 2E6QA 4P57A 2GITA 4PLOB 5C0JB 3TVMC 4WI9A 5HI4D 4DZ8A 4O58H 2HJLA 5D2NE 4X99A 1BQUA 3NIGE 1MVFA 4K94L 5CKGA 3T2PA 5DD1H 1CL7H 2DKMA 4HLZH 4PTUB 2Y6SC 4OV5B 4U6XA 5GGVY 1OOAA 3Q2CA 4XVUD 2VE6B 5JUEL 3GFUA 4UV4L 3DGGB 4K7PH 3FN0H 1D5XB 4EN3A 5CHNA 2XI9A 2PTTB 3O6LL 3BKCH 1UG9A 2QADD 3WN5B 5FHBL 1NCAH 2VIRB 3JUYA 3Q3GA 1WZ1H 4L3EB 1BFOB 4M00A 4WEBL 3JWNC 1UC6A 4H8WL 4HWUA 5LWYL 3NCCB 3W5NA 5KG9A 4P5TD 4L9DA 2X89D 5KJRH 1KLGB 2Z35B 1MIEH 1NUDA 2R1XB 4G6AD 1PKQA 4JRXA 4R0LA 5I30L 1RJLA 3VXSD 1N0XH 2ZCKL 5MHSD 1EAPB 3T4AB 1T1WB 1YMME 5CS7A 2R8SH 4UMGA 2C3VA 3PGDB 3PHOB 2MJWA 1FC1A 1W72A 1ZANL 2AK4A 3CFBB 3WUWB 4YHKL 4C56D 3O8XD 4P2YA 2H3NA 3LAFA 4KKCC 5JIKA 5KSAA 4PJBB 4I9WE 5D7SL 3VFMA 1DQDH 1CN4A 2EH8L 2Y36H 1HCVA 4PGJA 5DRWB 4QY8A 1OCWH 3CU7A 5CZXD 4JFYA 1QLRA 4E41A 1KB9K 1I75A 2BRRH 1CICC 4EVNA 4NZJA 2C7UB 2VISA 3MACH 1J9CT 1CQYA 2N7BA 4YGAB 2Y7QB 2ADIA 3MXWH 5MI0C 1NCBH 4FQ1H 5DLML 1K4DA 5I76B 4B7LA 5DR5L 5DXWA 1D9KB 2NR6C 4NQCE 1NC4D 1TTGA 4WI7A 4B53A 3M45A 4P48A 5K59F 3GSRA 2GJJA 5ANME 4DVRL 1BQSA 3MRCA 3BP7A 4OCSL 5C09B 3HMXH 3B9KB 3LZFL 2I07A 1LEKA 1AGDB 1ZLUH 1OTTD 3VGEA 3DXAB 2FEDD 1AQKL 2V17L 1P4IL 3GJFB 5SWZD 3PABA 4G5ZL 1OTSD 3CX2A 1VFOA 2FR4A 5DWUH 2BVPB 2I5YL 3G6JF 2AEQL 2UWEA 4PJAF 1S9XB 2YXMA 5BVJA 3IVKA 4F57H 5D1ZC 2BY0A 2H2PC 1ONQA 3C5SA 4I2XE 4PJ8B 3MX0A 4WJ5A 3WL9A 3DROB 1QLFB 2EC8A 1DP0A 1CR9L 3MV9E 5F7DB 4CL7A 4ZO6A 1BQHB 2DLGA 2G9HB 3DMMB 3MV8B 1A6PA 4LLUA 4X7TB 1B0GA 1J0ZA 5H94B 3O45B 4BJLA 1NEZA 5DZLA 2ZSWB 2D7TH 3M1BA 4R4BA 2XTLA 1S9VA 2PXYA 3BJ91 1B90A 1I1FB 4HJ0D 4RFNC 4HIIB 4D0DB 1A4KA 3X11A 3PQYD 3H9YA 3BZEA 2XWBB 1R3LA 4HBCH 3BSZH 2IMNA 1Q9WA 4LK4A 1DDHB 3RL1A 1CLZH 2E27H 1BECA 2A6DB 3C5JB 3MZTA 3X3FL 1A2YB 4RDQF 4F7EA 5J7CC 1BVLB 4RIRB 2IGFH 2IALB 4CADA 5IB4A 1XF2B 3O3DA 5L2KE 3SCMA 4IEFB 3MUJA 1UCBH 5DUBA 5T3XH 3OB0K 1HH9A 1R5VB 4N1CA 2FGZA 1KJMA 2VLKD 3EO1B 2NY4D 3U2SA 4I0PA 4FQXA 2YSSA 3HUJE 4XXDB 1IZKA 5GGSY 3HE7D 2FGWL 4K2UH 4O02L 4LF3B 1CDCA 1PLGH 5ICYA 1INEL 5IFJB 1NANH 4N5ED 3I6LE 3LRSA 5BO1L 3DUHA 4PV9A 3IGAA 3QNXB 1WVZA 5CWSA 1AGEA 4FABH 4H5SB 3MRJA 4N0CD 4PFEA 4N68A 4Y5VC 4Y2OA 1LO0H 4OGAD 4X9IA 4HUUB 1RUPL 1NCCH 1D5MA 2VAAA 3HAEA 1MWAL 1PSKH 3RPIA 4U4BA 3RBGA 4K9EC 3O2WL 3VXNA 4XT1C 2ERJC 4G7VL 4L4VB 1F90H 4NRZB 5E2VL 5FGBA 2NX5D 3OJMB 3T8XB 4OBSA 1KNOB 3DX7B 4KZDL 1MHHA 5F8RC 2C26A 4UOJA 5FO7A 2ITCB 1WT5A 4PJIF 1MCOH 4CBPA 3NCJL 3BD3A 1JHTB 4TTDD 4NZRL 1UA6H 2EYSA 1QPPA 5E7BA 3X14B 2R4RH 3EO0A 3MYJA 4BQ9A 1JYVA 2IAND 4LGRB 3RVTD 1RZJL 4NOBA 3PIQA 5T3ZL 3CAFA 4OZGF 4KK8D 3TBWA 5I1JL 1NGQL 5DD6A 1SEBB 4XGZA 1NUGA 5AD0A 4QXUL 2DQGL 3P4MA 3IDMA 5EULV 4Z9KB 1KJVB 2C3XA 1SHMA 1IM3A 4NSKA 2R0LH 4HGWB 3VFVB 3QEQD 1A7PL 4YBHA 3JV0A 4WENB 5ESAA 4X5LA 3KPRE 5I15L 5LGHL 3ZL4H 3THMH 3D2UB 3T0XA 4AY0A 3DUSA 5DHXB 4HKJB 3VXUD 3RHWF 3CC5B 1AE6L 4EJ1C 4BZ1H 4GKZA 2X4QB 4ODUA 5J12C 3HI1A 5E8DL 1HXMB 2XG4A 4BZ2H 2RJMA 2VUOA 4I5BB 5HHNA 4F9PC 4M7KL 3EJJX 4L5FH 2O5YL 3NACL 1I4FB 4JKWA 3QPXH 5BOPA 3LEVH 3V52L 2VXTL 3AS0A 4GXVH 1NUFA 3P77B 5TGBA 4NQVB 1GXEA 1DVFB 5CZKA 4KTEL 4PRDB 3P0GB 2XKUA 4QGYA 5H2BA 1QHPA 2NXYB 4ODXA 3WXWH 2DWEA 2GT9A 4LLWB 4S0SD 1AXSB 1T3FA 2B2XH 1YN7B 3GSUA 1PKQE 1ZAGA 4JRXE 2Y5TA 5LAXB 1CGTA 4M93B 3WJLA 4HF5L 2YK1L 5DJ6A 5J9PA 2L4OA 1CD8A 1OP5K 2R9HD 4Z7QF 2UYLB 3ARQA 1WTLA 3QP3A 3JTTA 4ZFFA 2AK4E 3MRFA 5DVLA 4M62H 3CLFH 3BPOB 5M95B 4JM2B 3C5ZB 1BM3L 2QSTA 5TH2A 3UDWA 1I3GL 2NQCA 4PJHA 5EU6B 1AH1A 1KT2A 2QTEA 2FX8H 1HOCB 3VXOA 4E41E 4IMKA 4UZGA 1FN4B 2AJUH 4M7JL 1N59B 3T08A 3N1FC 4G9FD 4FG6D 5LXGH 3BDYL 1K2DA 1MFEH 3U83A 3ES6A 5HHME 3IETB 4GG8B 4LSSL 4R4FL 1T1YA 3DV6A 3U82B 5KS9B 1HKLH 4L8BA 1FNGA 3MRBB 1A7QH 2VABB 1C5CL 2XWTB 4U1GB 4GMTH 5HYQB 1F8TL 2AJSL 1DQJA 4U6VH 4PGZA 3EYVB 2FWOB 5GGUB 3G6DL 1X5AA 3IJSB 4JDVA 2HTLD 2P24B 3T04D 4GRWH 5CJOH 3RGHA 3KPOB 4MNQD 5HYFA 4L4TA 3BP6B 4G8FB 3JUZA 5FK9B 1A6AA 1MCFA 1VENA 1U8QA 2GTWA 5HYEA 5H35B 1XIWA 4P9ML 5FO9B 4EQ2A 3BPCA 3CFDB 3W9DB 3JWOL 5EZOL 4PREB 5JR1L 1KEMH 2UWEE 5KVGL 1UFUA 5DEZA 5I74B 4WVRA 43C9A 1KOAA 5T5NF 4X9BA 4XWGL 2EZ0D 2Z93B 3WKML 1PX3A 5BJTB 3RZCA 4TNVK 5C0AB 3GSOB 1M05A 4Q2ZA 1A6WL 4FNLL 5IEHA 1HZHL 1NBYB 4EEEA 5C70A 2AABH 4LDLB 1RZGB 3QIWA 3V4UH 1ULVA 3UYRH 5I18L 3FO9A 5ERWB 1MCBA 4RWHA 3SDAD 4ZS7L 3FFCB 4NYLB 1H3GA 3TNNA 1QUNA 4PJEF 3SKJH 1MVUB 1P7QD 4UDTA 3UTQB 4QNPE 4WHTA 3TBSA 1HWGB 1P5VA 4F8QA 5IM7B 3P9LB 3ULUC 3HRPA 4OJFH 1ZT1A 2DF3A 1J0JA 3QULB 3SGEH 4LPTA 4QTIH 1U93A 1G6VK 3PV7A 1OAUL 5TPWL 2NW3A 4ZUWA 1CBVL 5BQ7A 1IC4H 3Q1SH 4X4ZA 1I3RB 5D1XB 4NJ9L 3JVGC 5CGMA 3U9UA 4IRJA 2MHAB 5I8KH 2X1XR 5FYKD 5GSRB 1ZLSH 5HGAA 2DMCA 2AJXL 3RWFA 1GGCH 3WNNA 2HFGH 4R96A 4S1RH 3MGTA 3MA9L 1BX2A 3O9WA 5D7JB 1RK0B 1A1NA 2H9GA 2H2SD 3O81A 4FXLA 4WUKH 3JWDL 2Z31C 2OJEB 3MLYL 4YFEA 3QXWA 4PJBF 4I48A 4BFGA 4F3FA 1S5HB 4U6YB 4WHCA 3X3GH 2ZG1A 3HZVA 4EDWL 5ADPL 2MWCA 2ZUUA 4QRPA 4U0RC 1MCIA 3I6KB 4YBLC 1I9RL 5KOVC 5CIPH 3B3IB 4FA8A 2B20A 3S36H 2VLRA 4MXWH 1ZXQA 1CGSL 3HCVB 5DD5L 4FFYL 2CXKA 4L8DA 4Y19A 2NY3D 2JB6A 2GW5A 2D03L 4IDJH 4Y4HA 2JIXD 4DFIA 5GJSL 4J3OC 3A67H 4JG1L 1RZ8A 3ARBC 4OGXH 4XWOD 3I02B 3DO3A 3TO2A 4DZBA 2P5EB 1HXYB 2V2XB 4ORZC 3MGAA 2VSDA 4DKFH 4X80H 3OKMB 4NM4H 5FUCC 5C0IA 1X4ZA 3L3JB 2P8LB 4OZFA 5C07A 1KB9J 1T83A 3MREA 2R4SH 2DYPD 3NFNB 3MUGA 4NO3B 1G7PB 3RAJH 1EUTA 5IFAL 1YPZA 4UINH 3NOIA 4XC3L 2DQUL 4NCC1 3FO1A 5C3TA 2EO9A 4MAUH 2IPUG 1IEBB 5IBTL 3LHPL 4NN6B 1K8IA 3ARFC 3ZTNL 3RTQD 1PJ9A 1FO0B 2A77L 2ADJA 3L6FA 1JGVH 1O0VA 4YDIL 4U1NB 2V5RA 3KLSA 1VACA 4GAYB 1C16B 2FATH 5ITFB 4ODVL 1GOHA 1BJMA 2EDOA 4XC1H 4JAMB 4NCC2 1A47A 4QCIA 2YXFA 1GZQB 3NZ8B 1YJDH 2A74A 2R2BA 3HG1B 4JFDB 1JFQH 5ICXA 3IAQA 1ROWA 3MFFA 4PD4K 1DBJH 4O2EA 1YEEH 4PGEA 3HI5L 2NY2C 1MY7A 1AKJB 4OCWL 3CH1B 2D4DA 1PG7W 1L0XA 5IW1A 1JHKL 1IQWL 1T1XA 3D39D 1P4BH 1H5BB 2F58L 3BJLA 5BRZB 1GCFA 2XA8H 4RISH 5IGXH 3O3BA 2FX9L 1BJ1H 4XP5L 1FZJA 2DQCL 1KELL 3BX7C 1XGPA 4P99A 5T5FL 4A6YB 5JPNA 1DLFH 1A3LH 5CUSL 1NH6A 4K71C 4ONFH 1KTDA 4ZPTA 4GBXD 4HS3B 3FT3A 1I3UA 5F96H 2UUDH 3RWEA 3W9EB 1VESA 4YQXL 1INQA 5HGBB 3KPMA 4MXQC 2DQJH 3ZSTA 4EBQL 5F9JA 4TUJA 3MBEA 1UB5B 4L4TE 3AREB 2FCBA 4IOFC 1D6EB 1T89A 3QIBD 4I9WD 2VXUL 2NY0C 1ORSA 1M71A 1CCZA 4TVPE 2FECI 3MJ7A 3KYMA 4FFWC 2IQ9L 1U3HD 3R0NA 3N1PC 4NFDA 2OL3L 3L9RB 3ZDZF 2V2WB 4L8SA 5MP6L 2X1OA 1S7QB 1RIVL 1IGYA 3FQRB 3CXDL 4KVCH 3MXVL 2O5XL 1OP9A 4RNRB 2X4TB 2RR3A 1GC1L 2OQJB 3CFEA 5EBWB 2APFA 3S97C 2J1KA 2WNGA 2DI7A 5FCSH 1UWGL 1J1XL 3CMOL 3QH3A 4K3EH 1ZWIB 4LHQB 2OSLA 4P46B 3DVNB 4NO2A 5GRVK 3FAWA 3JV4B 4CU7A 1TZIB 4HXBH 4LNVA 3RWGA 4Q9QH 4LCWB 4HQQL 2DLFL 4XBPB 5GS0D 1A9BA 4PJDA 2C1OB 4NKQB 1JPTL 5E2WH 5E94B 5ENWA 1U6AL 3HC0B 1TVHB 3SKNA 1IL1B 4XRCA 3ALWA 5HI5C 3FTGB 5TFSH 5F44A 2VN7A 1LP9A 3INUH 3X12B 1HILA 2R0WL 4PG2C 1TVBA 3SDXB 1KXQE 2HKHL 4BH7A 4QTHA 3WE6A 2VITB 4EUPG 4IBLT 1U3ZA 5GGRA 2E6JA 4NZTL 3VWKB 1MCKA 1I8IA 3KNBB 3SEPA 3WS3A 2SEBA 3F7VB 4HCRH 4BFIA 4JO2L 4LCCB 1T2QL 1YEGL 4D3CH 3L3OA 4FFZH 1CIUA 4KK9D 2LU4A 4ZSOA 3V6ZA 3ZYOA 4A2MA 3H9ZA 3PJSB 3VA2C 4ZTOH 3LMJL 3C60C 3UX9B 3ZKND 3LS4L 1CDYA 3CVIH 4M03A 1BZ9B 1Q94B 3AS3A 4P4KC 2EIEA 2VDQL 2V9TA 1NMAL 1ZHNA 3F58H 7CGTA 5HHXL 2E5EA 5KW9L 3BP4B 5GGTA 4XPTL 2O5ZH 1AFVL 2CMRH 4W6XB 4E0RA 3F7YA 4G8GB 1OP3H 1FLTX 3QO1B 2WLYA 3CZFB 4JM2F 4WHDA 2GQHA 3TZVC 4G3YH 4TOYH 4PLJD 1E6OL 4XCFL 1SY6H 4MJ4A 1H3VA 4XPFL 2RB8A 2C4FU 4Q6IA 1BF8A 4KY1H 3IFLL 2WAHA 1SQ2N 4YBQC 1DQQA 2ZZUT 4QRPE 1F6AA 1FZOB 1C1EL 3K74B 4ZODA 3QRGL 2LQRA 2ICWB 1MOEA 3ZKXB 2JJWA 5K9OB 5SWSD 1A4JB 1WBXB 4K94H 2VLRE 1I7RB 3WJJC 5HPMA 5T5NG 4Y19E 5KS9F 1J8HD 5JUEH 2DD8L 5E8EB 4OZHB 4UV4H 4ZXBD 2B1HL 1UACL 4N0UA 3I6LD 3LN5A 3O6LH 5FHBH 4Y2DA 4Z0BL 1Q9LA 1K8DB 2QL1A 3N85L 2WWKO 1DFBL 3Q0HA 4Q0XL 4K3HA 1PG7L 4LLYA 1EFXB 4H8WH 5LWYH 4PRID 3MLTB 3O8XB 4LFHD 4XMKL 4F33A 2HRPL 5C07E 5FB8A 1LMKA 1NBVL 1XR8A 5I30H 1YEJL 2P8PB 2ZCKH 2ATKA 5EO9A 4JREB 2NTFB 4GRLA 1YPZE 3BW9A 1ZANH 2AEPL 2Q20A 1QD0A 4YHKH 4HGKC 3UAJD 3VD3A 2CIIA 5D7SH 2X1PA 2EH8H 2ICCA 4YHLL 5IWLC 4PJXB 3OZ9L 4O2FA 4PJ7B 3TF7C 4H26B 2O61B 1NC4B 5FGCB 2PYFB 3BWUC 2VLLA 2GYSA 2F54E 3TA3C 1S9YA 1BOYA 4L1HA 1GVIA 3T0EA 4P23B 4PJFF 4LHUB 4K07A 5DLMH 4KJPD 5C0DA 1DN0B 4ZOAA 3AMKA 2OK0L 3KPRD 5DR5H 5EU5A 1QBAA 4TSAL 5INDA 3RGVC 2P48B 3VD9A 3GO1L 5T1LD 3JV6B 3D69A 4YC2C 4U1IB 1EH9A 1CXFA 5C0ND 3OKEB 4RZCA 4YHYC 2VLJD 4DVRH 4H1LB 4QHMB 1DE4A 3BDBA 3SDCA 3QUYC 5EOCJ 4OCSH 3SDDD 3V0VA 5J11C 2FH6A 2RBLA 4KXZH 4R26L 1IGTA 3LZFH 4TSBL 3BDXA 5F1IA 3UZEA 2VDKL 3BGMA 5EU4B 2ADGA 1AGFA 4TNWF 2V17H 1AQKH 4BZYA 4AIOA 1P4IH 2APWA 3S98A 5J1AB 5HHQB 1MJJB 3N9GL 4G5ZH 1H9VA 5IMLA 1EPFA 5EFIB 4NDMB 3U6RA 2HLFC 2BNQE 4HUKB 2VDOL 2GK2A 2I5YH 4Y4FA 4TULL 4HX1A 3FONB 5JXEC 2FBOJ 3PNWB 1YA5A 2I27N 3V5KB 1ZVYA 5DYOB 4KU1A 5L2JA 1J05B 3IXTA 3ARPA 5HHPB 2CLRB 3DYMA 1BLNA 2IAMC 3FRPA 1CR9H 3L5WB 5KSVB 2EYRB 2RGSA 5KSAD 4APQC 4GMSL 3VI4E 4PJ9C 5DRXB 2RIKA 3PP3H 3O4LA 1IQDA 3O6FA 2R2HB 5FF6A 3QJHA 2WWKT 3TN0D 3SGJC 5CP3H 4E41D 1RJYB 2BVUA 3UJIL 1FVDB 3FT2B 1DCLA 2QR0B 1FFNA 5GGVL 3WV0A 1BIIB 1OB1A 4XX1E 5HHMD 2VLKB 3RWHB 2NY4B 2P44B 5F21B 1QG3A 2YRZA 1J12A 5DVNA 3HE7B 5E4EB 3X3FH 3IDYB 2JTDA 2BJML 4UAOB 4YFLI 3ZHDA 4GLRH 5IJVB 3UTSA 5F6IC 3IJYB 5ILTL 1KB5A 4EI5B 1RVFL 1NDMB 1QFWL 4G8IB 5EOTA 4PGDB 3JSSA 4LAJH 4PJDE 4MHHI 4FMKA 4Y16A 1LNUB 3BESR 2BX5A 3EFDL 4IRSB 1MFAL 2YA2A 2FGWH 4YPGB 4O02H 3OHXA 1LP9E 3F7QA 2OM5A 3VGGA 3NIDE 4PS4L 5D1QA 3EDJA 1INEH 3TYFA 2E8YA 5CD3B 2NX5B 5AG9A 5I19L 5BO1H 3GSNB 4H0HB 3W39A 1XF5A 3W11C 1OSPL 4L8CA 4L9LC 2YD8A 4OD2A 5DHVB 2BMKA 3U9PL 3QEUA 5CILL 1RUPH 4PG9B 5I1EL 3L3DB 4FS0A 1MWAH 4ZFOB 1E28B 3O2WH 1D3CA 4AQ1B 5MEPB 4MAYB 4ZDHA 4G7VH 5F1NA 4JLRB 5E2VH 1JVKA 5EU7C 4G7YL 4MA1C 1T80A 4IMLB 4ZS6D 5IVZA 1U8HA 4XH2B 2J2ZA 1HN1A 4Y4KA 5HYSB 4DGVL 1ZHBA 4NZRH 3LH2H 3KWWA 4UOW0 5DHYA 4KHXL 1NFDA 1EJOL 1RZJH 1DEDA 5T3ZH 4HS8L 3LKQB 4MCYA 5EN2B 5I1JH 4Y1AB 4Z8FH 3VXUB 4QXUH 1XT5A 2DQGH 2WINA 3QR2A 5B8CB 1XGYL 1SMAA 2I25N 3QG6A 1DEEB 1M7DA 4XCNA 5D7IA 1A7PH 3S96A 2BNRB 2VDPH 5DQDL 1IAMA 5I15H 5LGHH 3ARDA 3RKDD 3MQIA 4R7DB 3QEGL 3MMEA 1BWMA 1AE6H 2F5AH 2MSPA 1DLHA 1S7UA 4GXUM 5ADOL 5E8DH 1BOGB 4IRZL 3LPWA 3VFRA 3R8QA 5DK0B 1UT9A 4KJYB 4N0UE 5EB9A 3RVXC 4M7KH 2WLZA 3HPJA 2O5YH 3NACH 3VXPA 3DO7B 1NGYA 3MPCA 2OX5A 2VXTH 1PEWA 3EHBD 3V52H 1LO3H 2XTJB 4U1JB 1IM9D 2EYTB 4KTEH 1KPRB 4U1LB 4HV8B 3O4OB 2APVA 3DV4A 4K7PX 4JFHE 3Q48A 3FQTA 4UBDC 1QVOB 3OAYK 2A0LD 4PYGA 2GUOA 3OR6A 1UEYA 3G5VB 3EOAA 5T3XE 2HFTA 4HF5H 3MLWH 1OTUC 2F53A 2HJKB 2YK1H 4GG6A 5DJZB 1UB6B 1NCDL 3C2SA 4KJQC 2XN9A 1BM3H 4H20L 1S7XB 1PYWA 5TQ0L 2YPKA 1TQBC 2QEJA 2QSCL 3RIAK 1WIOA 3MRNA 1QFUL 1GPOL 2IBBA 1HYSC 1I3GH 2BK8A 2VDRL 1A3QA 1BD2D 4U6HB 4M7JH 3T0EE 3VFGL 3JWDC 3PL6B 1JF6A 3BDYH 4JN2B 1EZVY 2VXVL 3VH8B 1CYGA 3QI9A 3BKYL 4LSSH 1IVLA 4R4FH 2YPLA 4GS7B 1IAIM 4K3DL 2XICA 4ZOBA 4QXGL 1FHGA 3C8KA 4TYUA 2WQRA 2MCPL 2BVYA 3DYOA 3SDXF 1JL8A 1KN2L 3ZKMD 1F8TH 2AJSH 4DGIL 2WBJD 1A64A 3MNZA 3O41B 2ESVD 4WO4A 1F4WL 3D5OF 3V8OA 3G6DH 5HY9A 5JOEA 3KYNB 2A1WL 4CNIB 3NCEB 4HFWA 3HZKA 3MO1B 1ZSDB 2NLJB 5T1KD 2X4UB 4GKSB 1E0OB 5E8PB 5I71C 5ETUB 3UC0L 4JZNA 4M7ZC 3CFJB 3E3QE 4P9MH 1LE9A 3VGFA 2XY1A 3S5LG 1C8PA 2QQKL 3CSPA 3T1FB 1UQSB 3JWOH <