2UUDK

Crystal structure of the tepc15-vk45.1 anti-2-phenyl-5-oxazolone nq10- 1.12 scfv in complex with the hapten
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
113
structure length
113
Chain Sequence
QVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPYTFGGGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NQ10-1.12 ANTI-PHOX ANTIBODY
publication title Structural Basis of Affinity Maturation of the Tepc15-Vkappa45.1 Anti-2-Phenyl-5-Oxazolone Antibodies
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 13
structure length 113
sequence length 113
chains with identical sequence L
ec nomenclature
pdb deposition date 2007-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uudK00
3LS5H 1L9NA 1TZIA 3ET9F 3ILPB 5DZOA 1YPZB 3IU4H 1EGJA 1YYLH 3AAZB 4F15B 1MVUB 3IETB 4HX1A 2X9XA 4QOKB 1KPVA 1RUKH 4PGEB 4LOUD 4GSDH 2ORBL 5CJQH 1AKJA 4DVBA 1V05A 4N0YL 3C6LC 5H37G 5D6DC 3V6OC 1SMAA 3RWDA 4ELME 1OARH 3ARRA 1A7PL 3MRBB 4YDLB 5H2BB 3FQUB 3MCLL 2KZ1B 4NZDA 4S1SL 4N5ED 4O4YH 1P7KB 3E8UH 5DJ0B 5KVFH 3MJ7B 2V9QA 2A1WH 5IFJB 4DTGH 1S7QB 2IADB 3MODH 4Z7UF 1MNUL 1OOAA 4OZGA 2DLHA 1MJ8H 1H3WM 5GIRA 2HVKB 4ZTPH 1EBAA 5IF0A 1PY9A 4OFYA 5GGTA 3NCYP 4O02L 5F96L 4X0KA 4Z7OF 1MHCA 1TXKA 2AXHA 5CSBA 1FLRH 3BPOB 3UTZA 1LILA 3DMMC 4XPGL 1Q9KA 2QBWA 2QKIB 2X6MA 3RZCD 3PV6B 5J56B 1QZ1A 2VE6B 5IMOA 4YHML 3U9UA 3IXAB 1R5VA 2W59A 4I9WD 3RY5A 1EPFA 1BX2B 2IALB 2HFEA 2Y1VA 4U1HB 4LHUD 1CIDA 3KR3L 1RMFL 2BRQA 1JNNL 5HXMA 3OB0K 4QKXB 4G6ML 5GJSH 3V5HA 5ID1B 4ZD3L 3O6ML 3MLRH 5CSZB 4DKFL 5C0IB 4MQSB 5GRYA 4MNHA 1J8HB 4NQCE 1X5YA 4HIIA 2CUIA 4YWGH 5EBLA 1WZMA 3ARDD 5KSAC 2ADIB 3D85D 1IZJA 4R4FH 4DK3A 4KKCC 2RCSH 3O8XB 5L88H 4R6UA 2P7TA 2VN7A 5IJKC 4LMQE 4NZRL 1CF8L 1JGVL 3DURB 1NMCB 1OP3K 2BNQD 1CD8A 4OZFB 5CILH 5JHDA 5DD5H 1QFUL 3Q3GA 4G43B 3IKKA 2DQTL 4FXKA 5C0EA 4OF7A 1H3GA 1N6VA 3CFJB 1NCUA 3S3JA 1A1NB 4M6OL 1HQRB 1F11B 3H3PL 2Z35B 3DRQA 4P2RE 4WU7A 4ZUSB 2IH1A 2QHRL 3MCG1 2D0HA 5BQ7A 5FYKL 2J8UA 4U1MB 1ZLUH 1L7TL 4KKCD 2VLMD 3WUZA 1ZWIA 4IRJA 3OGOE 2HP4A 5BRZB 4TTGA 3KHQA 5J4MA 5I76A 1T1XB 3PQYE 4LSVL 5LXGH 2EDOA 4OZIF 1T21A 4ODVL 1A7OL 2AI0H 4F9LC 1G7MB 4X9GA 3HZYA 1QUNA 3QQ9C 4DCQA 4ZFFA 3IS0X 5C0ND 3O4LE 2DQJH 3WDHA 3ZYZA 4KDTC 3MRIB 5DJZB 2NNAB 4YNYB 3UJJH 1J18A 4JHWL 7CGTA 5SX4H 4PY7B 4UDUA 2HRPH 2VDNH 2CLVB 3RY6C 2YMXL 2XN9D 5TDOA 5FYLE 3KYNA 1FYTA 2VLKB 5I75B 2APBA 2B5IB 3HMXL 2L7JA 2WWKT 5EIQA 2V7HA 1LGVA 3P11L 5HYSA 1A9EA 3QNXA 3RU8L 1CTNA 1BQSA 1WITA 2H32B 1IL1B 3HTLX 3S4SA 1OM3H 3LDBB 1SY6H 1BREA 3OKYA 4JREC 2EKSA 3NCEB 3BKCH 3GMRA 2YZ1A 1T03H 1EVUA 4YK4C 4RISH 1N26A 4GW5A 5KVMC 3LN5A 2N7BA 3SE4C 4YZFF 4MXVE 3PWPD 4RZCA 4ZMAT 3U4EA 5MI0B 1YYLL 3OJVC 3LQAC 2RGSA 1RUKL 5FYKD 3NBNA 4GSDL 1FFPA 4LKCA 3QHFH 3CSPA 4PGBB 5HGAA 2EDXA 4HJJH 4WUKH 5DUBA 3V0VB 5BVJB 3MLZH 1TCRA 2R29L 1OARL 4LCUB 3RQ3A 3R06B 3MLTA 4W70A 3LPFA 1NPUA 3O6FD 3QDJE 5CLTA 4O4YL 3E8UL 1F5WA 2NY3B 2MFNA 2OL3B 3WHE0 4OFYD 3REVB 2JJTA 3IFOA 1RFDH 3PWUB 2R0KH 4UTBL 2VQ1A 3BRFA 4OUOA 3L3GA 4PRHA 4NRYA 4QHNB 3QIUB 4DAGH 4MDJB 5HGHA 5FGCE 1MJ8L 3VD3A 3DX9A 2X2YA 1CICC 2YRPA 4ZTPL 2EDRA 1JZ2A 5I1GH 3WHXA 3LQZB 1JI2A 1QSEB 2A6IB 4HGMA 3WN5B 2PUQT 1MF2H 3EYQC 1INDH 4LLYB 5C6PB 3K2UL 4NWUH 1YPZF 4PJFA 3IU3B 3G9AB 1KTLA 3TV3H 2C26A 5F7DB 2D2OA 5AG9A 1NLDH 4Y5XA 3F7YB 1RULH 2DOCA 5J3HC 5MEND 2FX7H 1WBYB 1D6EB 3VXRB 5FDYA 1G84A 2PYED 5DWUH 1ZVSB 1P4BH 4QY8B 5KSBE 1NFDE 4K3GA 3O11B 1HHIA 1E4KC 3WCYA 5J6HA 4KVCH 2QSCH 3V4VH 5IK3B 4K7FA 4P4KA 4YWGL 5C0BE 1X5JA 2ZCKH 2IC2A 4ZPVA 2IF7A 3MCKA 1QEWB 1KTDA 4R4FL 2BX5A 5FUOH 2F5AH 4LCIH 1CGUA 2HVJA 4HUWA 1DQQA 4Z7VA 5L88L 1MIMH 2P1YA 4APQC 4QRUB 3FL7A 3TYFA 4U33A 4MVBC 3GMQA 2HJLA 2VIRA 4U0RC 5CILL 5J3HD 3PWJB 2I07B 4HIHA 5DD5L 1JF5A 1NJ9B 2IAMB 2NYYC 4PJEB 2WM0A 4V1DD 3BQUB 4URTB 3MRPA 4PG9B 1LDPH 3G6JE 3VWJA 1HHKA 3VXPB 2XWTB 2VZ1A 2P5EE 3OB8A 2WUBH 2GT9A 5ACZB 2MCG1 4F33A 3BH9B 2E6QA 1MREH 5I2IB 1TQCB 5GGRB 3U79A 1BGXH 1G9NH 5GGSY 1CK0H 4ZODA 3VGFA 4HG4J 2P8PA 3MRKA 3QDGE 4NNYB 3FRPA 3SE3A 1HCVA 2YPLE 4K3EH 2X4RA 2NCMA 3BGFC 3C08H 3FTGA 3C60C 4GKSA 3GIZH 4APQD 1T22B 3GSXB 4IDJH 3U0WH 1RZJH 4S1DC 1KNOA 2VXUH 4ONHB 2B8OT 2F5BH 4RGNB 3RNQB 3LKOA 2ERJB 5F7HA 5LXGL 2NYYD 3ZE0E 4XRCB 4NQSB 5GZND 1I9JL 2WLYA 3IDJA 1G1YA 5J1TC 2XPGB 2X70A 3DXAB 4HWBA 1ZV5A 5EZJA 3BHBA 3MUHL 2YD9A 1AXIB 3EYVA 2AJYL 2DQJL 5E03A 4KU1A 4Y2DA 3PG2A 1FH5H 3UJJL 4MAYB 2CIIA 2FR4B 1T1YB 5CCKH 2HRPL 1MIEL 3FB8A 2DMCA 4Z7NF 1K9TA 5HHXH 3T2PA 4L8SA 1LNUA 4WFGE 1VGKA 5LAXB 3QXTA 1AGEB 3ARGC 3BISA 2R2HB 4U1NB 1AXSA 3ZDZE 3EJYC 3UTPD 1QBML 4DN4H 2OR9L 1WAAE 5JIIA 1VACA 5IM7B 4I13B 4LGPB 4YQXH 4NN6C 4GW4B 3O45B 4YR6A 2JTDA 1B0GA 1SY6L 4NQCA 2YSSB 3L3IB 4J1UA 1PG7X 4U7MA 1QFPA 2ARJA 4F57H 3BWAB 1CXHA 4OCYH 1T03L 1ZA3B 3T0WA 4RCAA 3ROOB 3CFKA 4P2YA 4U1KB 5AD0A 3MLYH 2GYSA 1LP9E 1A3LH 1G7QB 5GS1C 3RDTC 4NN7B 4KGLA 2EH8H 1CFTB 1U8HB 3BFOA 4BUGA 4MD4A 1M7DB 3P4NB 4CVXB 3QHFL 4U7SA 4HFWB 4TQEH 3ARGD 4HJJL 4IHOB 4WUKL 1WFNA 1UENA 3EJYD 1UJ3A 4Z0XA 4NNXB 1EVTC 1KIUA 2W0LA 4JGJA 1E4XL 4XHJC 4AG4H 1UACH 2DB8A 3P4MA 5F93C 3RGVA 2E7LA 1C16B 3D3VE 4P2RA 4R4BA 1RFDL 3VCLA 3MRJB 3UC0H 2R0KL 3L5XL 1INQA 5LKNA 4IOFD 3SE8L 4XXDA 1XGQB 5EU3B 1IZKA 2PXYB 1HN1A 2Y36L 4DAGL 3S88L 1HDMB 2ZSVA 3T4AB 4LRNH 5GGUB 1SYVB 2JIXA 3ULVE 4X7DC 3RDTD 2C9AA 3TPUB 5I1GL 3BEVB 5TF1L 3QUXA 3NGBC 2FX8L 2X4UB 3PHOA 4WO4A 3O3DA 3SPVB 2AGJH 1MF2L 1X9QA 1INDL 3C5ZC 1MLCA 4BZ1L 4NWUL 4XBGB 1H3TA 3OGCB 3G6AB 1FNEB 2QADD 4GKZB 3SJVB 3TV3L 1KPUA 4GRLB 3O4LA 4I3RH 1DBMH 4JHZA 1LO4H 2VZOA 5TDNB 1ZT7B 3PL6C 5DWUL 2VISB 3K8LA 4MLIA 3MLXH 3NCJH 1B6DA 1W8NA 1NCDH 1FAIL 4XNUL 1PKOA 1NKRA 4KVCL 1W0YT 5EU5A 2QSCL 2R0ZH 1FN4B 1FQ9C 2YUWA 3VFVB 1QR4A 4W4OC 2ZCKL 1HI6B 5HHQA 2X7LB 2XTJB 1IAIL 3F8UB 4NKMB 1T89C 3OF6D 1KB9J 5FUOL 2F5AL 4LCIL 3STLA 4A6YB 3PP3K 3JVGA 1JFQH 2R1XA 3BH8B 1F2QA 5D93B 4N1EA 5DHYA 2VITB 3U83A 1J1OH 1DSFL 1YNLH 3QHTC 5IQ9A 4O9HL 1BPVA 3OG4B 3WIFB 1AO7B 3W0WE 1F4WH 1XFPA 4N8VB 5IMKA 3QUMH 1UCBH 4J3OC 1LDPL 3F12A 4JZJB 4YDKH 2VDOL 1V7NH 1TITA 2ICWI 4M93C 2MCPL 5E7BA 1I1RA 1DLHA 4P23A 4F7CB 2WUBL 2DLFH 5EPMA 4KRLB 5FKPB 2RAMA 1MREL 2WIIA 1C12A 1BGXL 1G9NL 4F7EA 1CK0L 1YEIH 4YEFA 1VEOA 1QLRB 1P5UA 4UT7H 3GSNB 1T6WA 2AK4B 2A83A 4K3EL 4PG2A 4GH7B 3QDJA 1JV5A 5KZCD 5I6XC 4PTTA 2PNDA 3C08L 3GIZL 5K59F 5KN5A 4YXHH 2Q86A 3CPLB 5C0JA 3SO3C 3U0WL 1RZJL 4L3CB 2VXUL 1DBAL 4U6HA 2F5BL 5F7FA 4Y2DD 1P7HL 3GSUA 5CJXC 2I9TA 2YD6A 3ECBB 4PJ9C 3G04B 5IFHL 3OKLB 4NO3A 1ED3A 4PJEF 1IAMA 1IC4H 1FNGB 4FQPA 1FH5L 5D1QD 4PRPB 4W6WB 4RAHA 4HMDA 4X6BB 2VZ3A 5LGJB 1J88A 1JMXA 1CGTA 2Q7YB 3B5TA 4EDWL 3T2NH 3QR2A 1D5XA 3JV4A 1G9NC 5HHXL 1GAFH 1WBZB 3EOTH 1HNGA 5C0AB 4M7LT 3QDMB 1U92B 4DN4L 1KSRA 3MO1A 3QO1B 4R0LC 1WLHA 2FJHA 3GSWB 4WFFD 5KSBA 5IW6B 1K2DB 1NFDA 3FB7A 3UCRA 5TFSL 1I1AA 3LKNB 4I3SL 3EOAB 1S7UA 3MV7B 2PTVA 4PGJA 2LV4A 5JXEA 2Z4QB 4BK4A 3IDIB 4OCYL 5IHLB 5C2UB 2FGWH 3HPLA 5EOTA 5ANME 1JI1A 1A3LL 5CD5D 4H26B 1DZBA 3WEXB 2XKNA 1G0DA 4B50A 3ULSB 3MRQA 2EH8L 4JHBA 3SKJH 2GY7B 1JZ6A 1D5BA 3G6DH 3K81A 3GSOA 4TQEL 3H0TA 2XQBH 4P2RD 43C9A 2ZCHH 2ZUVA 4G6AD 3DVGA 4ELMB 5GRJL 3G6JA 4XTRD 4HC1H 1FFRA 4AG4L 1UACL 3F5WA 2JIXD 1E0OB 2P5EA 4NO0A 1KB5H 3QPXH 2UYLA 4Q7DA 5CD3B 3QUXD 4XVUC 5D1ZD 2R2BB 4EN3A 5EC1B 2C1PB 4JFFE 1TVDA 5FOBA 2R15A 1LO5A 2BSTB 4HMEA 3QT2A 5FO7A 2NX5B 3L9RA 3QDGA 4CBPA 2CLZA 5IKCB 4LRNL 2G5BB 2GAZB 2YPLA 1XAUA 3CXHK 4OAWB 4WDIA 3X3FL 3QAZB 5TDPA 1XCTA 2AXFB 5GRZA 1BEYH 3TA3A 1YY8A 1SM3H 5C0FB 4U6XA 4EOWL 2WBJB 1YEHH 4GKOA 4L5FL 3S5LB 3CZJA 3QO0A 1UB6B 3KPMA 3ZKXC 1ORQB 2BCKB 3ULUF 4P2OA 4HUXA 4ZYKA 2FGZA 5DTFB 4FQIH 2AVGA 4I3RL 4I1NB 4I8DA 1LO4L 1EX0A 1RZ8A 2D03H 4XVUD 1A14H 1TTUA 4M8VA 2J8UF 3MLXL 1FBIH 2FZ3A 3UTTD 4ENEC 1G7HB 2AAVA 5B3JF 2XFXB 5KSVA 2R0ZL 3BUYA 4N0FB 3SE9L 4G8GB 3LHPH 4ZQKA 2G9HB 4RRPA 4DZ8B 1MFBH 3TBSB 2K7PA 4FN0A 7FABH 1WAAA 3EUUA 3LRSA 1MPAH 3HI5L 3TVMD 3U46A 4ISVB 1I9EA 4PBVC 3HZMA 5C08E 1JFQL 1DANU 1J1OL 4QHUB 1MCOH 1GRWA 5CJ5A 1NL0H 5E6IC 1IC1A 1IM9A 4UB0H 4KKLC 3IF1A 5C6WH 1F4WL 3TJHC 3QUML 4YDKL 4DKAA 5DJXA 5IV2B 4JDZA 1LP9A 1V7NL 4PLKC 3U48A 1B6UA 4NHUB 2WUCH 5T5NF 4B7LA 3QDJD 3VXSE 2DLFL 5ETUA 2DQGH 4XVJH 1P69B 2V5YA 3KLAB 3PHSA 4HLZH 1YEIL 4FP8H 4KK5D 3HC3H 4BYHA 5L7XH 1B90A 3I3BA 3RWGA 3HNTL 4U05A 3FB5B 3T77B 4YXHL 4KUCD 5TQ2H 2GIYA 2PYFB 4PRNA 5BJTB 3UJIH 3PQYB 1EJ6A 5CMAA 2IPTH 4OLZL 1F3DJ 1CDGA 1RU9H 1TMCB 4P46C 2CKBA 3PP4H 3MV9E 1A21A 3VFRA 4JFEA 3GBMH 1YNTB 3AREB 4Z7WE 1ORSA 4EXPX 4XAWH 1C7TA 1IC4L 1IEBA 3HPJA 3DUUA 4CW1B 3FRUB 5CSGA 1H5BA 1DVFC 3JZ7A 3T2NL 4FNLH 4WW2A 1GAFL 1U3HC 4O58L 2FEEI 4U2ZA 5JDSA 3PJSB 4F7PB 2DWEB 5JORB 4IMKA 3EOTL 4MB5A 5EZLB 1U8IB 3DPBA 3ZDYF 1F13A 5JXED 1QVOA 2XKSA 2APFA 1YQVH 4FA8A 4P5TD 4HPOH 5T1KD 3Q5TA 4OM0H 1HHHB 5JNYA 4P46D 4XMLH 3QPQC 4M7LH 4L8CA 4H0IA 5AUMB 3GMLB 1NEZG 4L4JA 4PJFF 4J2XA 5F88A 1BECA 1U8LA 3OAZH 4AQ1B 4HV8B 3QA3B 2A38A 4RSVA 2VLJD 5DJCA 4XP1H 2DQUH 3SKJL 3UPCA 1U3HD 5D2NB 2ICEA 2I60H 3VRJA 3G6DL 1DBJH 2W9LA 5BV7B 5JR1H 5DQ9B 2VTFA 2XQBL 4M43L 1JF1A 3W0WA 4EN3D 2ZCHL 1WUNT 4QYOA 3VFNB 4WGVB 4HC1L 3U30C 1FVCA 3VWKB 1K8DB 3QDGD 3GHEH 3VU2A 3QJFA 1KB5L 3QPXL 3C6LA 1S78C 3KPSD 4MA7H 1O7VA 2IFFH 5CUSH 3SGKC 3SGDI 4E5XB 3VMNA 3U2SB 4JM2B 3TA3D 3BPLC 2R0WH 2NQCA 3V2AR 4MA3A 4Z7VF 1GOGA 5DK0A 2Y6SC 4P2OD 5T3ZH 4KZEH 1MCHA 1XR9A 2CJUH 3OXSA 2R23A 5HYIA 5JHLH 4PJHE 3WXVL 1BEYL 3Q6FB 1R3HA 1SM3L 3LEVH 4ZO6A 3WFDH 1YEHL 4D9LH 3MRRA 1VGEL 3ELAT 3OX8A 4DGIH 3TZVB 3QUYA 4KY1H 2DRUA 1OF2B 3LSOB 1T20A 4IIQC 2EC9U 3QEQB 4UZGA 2CLRB 3X12B 3DMMA 2D03L 1QLFA 1H0DB 1KIQB 2OSLB 5DD0H 1A14L 2XZAH 3FQTB 3VFOB 2MTPA 2IWGA 3NPSC 4NQEB 3BKYL 4OLYH 1FBIL 3TWCH 1IGYB 5ILTH 5FK9A 2B1AH 3SKUD 2ATKA 4U2YA 4U6TA 5E8EB 2Y6SD 1BF8A 3ZKMD 2VDQH 3R8QA 3LHPL 1GJIA 3O3BA 4PD4J 1MFBL 4BSWB 1KLGB 3ARBC 1IM9D 5C0BB 7FABL 3U4BH 4UT9H 1T5XA 5CBEB 4CADB 1MPAL 1DJSA 4C56E 4X4YB 3FFCD 2AV7A 3A6CH 5DRZA 3RL2A 5HVHB 5J13C 3LRHA 5DZLA 4JRYD 1ZGLP 2HH0H 2EYTA 1E28B 1T6VN 5I1CH 3WUWA 3EYOA 1IGTB 1MCOL 1NL0L 2L7UA 3UMTA 4ZAKB 2OMNA 2GK0A 4UB0L 2G75B 5DHVA 2VDKH 5F3BB 4LSDA 5C3LD 3SGDH 2GJ6D 2M2DA 3OKEB 5F7WC 5I66B 1QTYT 3QNYB 4JFDB 3KNBA 3I50L 1T2XA 2JCCE 1M05B 2WUCL 1UQSA 3I3EA 1RHHA 3X11A 3UBXA 3ZO0A 4G7VL 1AD9A 1Q38A 4P2QB 5F3HB 2DQGL 4XVJL 3MRDB 4HHAA 4MX7B 3ARBD 1I1FA 1UWGH 5D5MB 5L7XL 5KBNC 3T0DA 4WV1B 2C1OA 5F72S 4G6FB 1SBBA 3ULVD 4JFED 3ZHLA 1W2KT 1DBKH 5TQ2L 4AENB 4XX1G 5SV4A 5KW9H 3GGWB 1KCVH 1DUYB 2J5LB 1U41A 4LASH 3VH8G 2NY1C 4QRRE 1UFUA 4JFFA 3UJIL 4I5BB 1A2YA 2IPTL 3B2UD 3L7EB 4Z76A 1RU9L 3TNNB 2CUHA 3PP4L 3IFLH 1R24A 1T1WA 4WENB 5DRXB 1A6UL 4XNXH 4XAWL 3PABB 3VFPA 5JQ6H 1ZHBB 1EEUA 2ZG3A 3AMLA 4FNLL 4HXBH 3D69B 1EHNA 3GO1H 4RIRB 4Y4FB 5BZWB 4WU5A 2LQRA 5DJYA 2DJSA 1HSAB 1FSKB 2GFBB 4RWYL 1SJHB 5E4EB 1EEQA 5DDHA 3RY6A 4HPOL 4Y89A 3F62A 4OM0L 2E7CA 1DQJB 1MFNA 1OTUD 2CDEA 1FO0H 2X1WL 4NQXB 1XF1A 5HPMA 4O5LH 1NAMH 4M7LL 5EWIH 3RUGE 1D3CA 4EBQH 4HF5H 4ZXBB 2J8HA 4S0TD 5TQ0H 3UDWC 3CD4A 1FG2A 2DM4A 1E4JA 1F6AB 3TO2A 3L3JB 4Z0BL 3HMWL 3LKSA 5C08A 3MLSH 2DQUL 4HK3J 3KXFD 5C9JB 4X7TB 2I60L 4LEXL 1DBJL 3P9LA 1X5ZA 5JR1L 2Q6WA 1L7IL 1JNHB 5K9OB 1CLOH 1TTFA 1OD7A 1QYGH 1XZ0B 4HXAH 4QTHA 3WNMA 2NY6B 4OZFG 3OKDA 2P8MB 4PR5B 4J3TA 1LEGB 1D5IH 5GISH 3GHEL 4C4KO 3FT3A 3VFUA 2JB6B 3GUTA 2CO6B 1OAZH 2Y72A 5IB2B 3D3VB 4Q6IB 4MA7L 4AT6A 4PRAB 2IFFL 2Z31C 3CLFH 2XKUA 1N8ZA 2H2SD 2R0WL 4P2CG 1XIWC 2NTFB 1WFTA 5I8CB 4BKLB 5EOCH 5F44A 4YJZL 4GUPA 5GGQH 2FEEL 2CJUL 1TZHA 3VXUE 1JF6A 5JHLL 1AC6A 4LVHB 4YHZH 3LEVL 1YA5A 1JHKH 2ADFH 2JB5H 3WFDL 1HKFA 2Q76A 3N06B 4D9LL 1A5FL 1DUZB 4OFPA 4L29B 4JCLA 3VXTA 4DGIL 1CFQA 1SHMA 2EYSA 1PQZB 2AXGA 2QSQA 3MV9A 4PLJD 3M07A 4TVPH 5CWSA 1AFVH 2DYPA 1HIMH 3VJ6B 5DD0L 1X44A 3CFIC 4OLYL 4CRPA 2X9WA 3TWCL 2FO4A 3IYLW 3QZWB 4AH2B 2X05A 2B1AL 4ZDHB 2APWA 3TBWA 1CZ8H 1FL3B 2VDQL 3BKMH 4XC1L 1MWAB 3QWQB 1X7QA 4JM2F 1FLTX 4GKNB 5D72H 1BZ9B 3EFFB 1IGMH 3U4BL 4UT9L 3GSRA 3DROA 1VFBB 2XA3A 4GAJH 5FIEA 1T2QL 4Y7MA 4YHNA 3BX7C 3VGAC 1TJIH 2HT3C 4WVRA 1FE8L 4XCEB 2HH0L 2E6JA 2FD6H 5I1CL 1WZ1L 3E2HB 4UDTB 2OS7A 2X4TB 4LGRB 3FQXB 4M6MH 5F7UA 2LAAA 2GW5A 2VDKL 4DZBB 4PB9H 2EDEA 5T1LA 1KN4L 3MV8A 4TRPL 3CSYB 3TCXA 4XB8A 4BSJA 2NW2A 3BPCA 4YHYB 1UT9A 2X42A 4K7PX 4HKBA 5F7YC 4M7JH 2FLRT 4PJ5E 3FAWA 1KJVB 2H9GB 2FWOB 1UYWL 4Q2ZA 3IGAA 2QQNH 1DDHA 4ZO8A 4Z9KB 4EKXA 1IGJB 3ZSTA 5KSBF 3H8NA 3WKNA 1FNFA 3X14B 5E2TH 1D5MB 1UWGL 2QLVB 5DHXB 5FKAA 3STZB 3KPRD 2EXWC 3ESVF 1E27B 4M61A 4LHUB 1T3FA 1DBKL 5A2IH 1DN2A 4HQQH 1G1CA 1KCVL 4JKWA 4S1QL 5DD6B 4LASL 4XMPH 4E41D 1NDMA 3ARWA 3VD5A 5H37H 1FL5B 4ODWB 5D2LB 3DX6A 3HR5B 1P4LB 2JE8A 4L4TA 4LSQH 4YHPB 2YA0A 3IFLL 5H94A 5CEXA 3ES6A 3ARDB 4ZSOB 2Y07H 1UKSA 3D85B 1CE6B 2OJEA 5A3ID 4PJHA 3TN0A 5E2VH 5B8CC 4RX4A 4H5SA 1YMHA 5IB5A 4HXBL 1VHPA 2BNQB 3GO1L 1SEQH 1ACZA 4M1CC 3CH1B 1JGUL 2DJ4A 3SBWA 1FDLL 3WD5H 2H8PB 2JJVA 1LQSR 4EQ2A 3BKJH 1WC7A 5D5MF 4OLUH 3OHXB 1MEXH 5MERB 1U8OB 5IESH 4L4VB 5EBMA 2QJDA 4MJ6B 1FO0L 1YEFH 4O5LL 5KSAB 1NAML 2BMKB 5EWIL 3KYOA 1C5DA 4LBEA 5FDWB 5IVXE 4EBQL 2VYRE 3ZE0F 1CGVA 3KPLA 5TQ0L 4WTWA 5ANMB 3MRNA 4JKPH 4OQ1A 5HTSA 1RZKH 2VR5A 1I3RA 4C56A 5D7JC 5I1AA 4PJAA 4R3SB 4IRSC 3MLSL 3FT4A 3DVNA 4P4RA 2YD1A 1ZLVK 3GEWB 3V4PL 1C08B 1QRNB 3A6OA 2FH8A 2VNCA 4Z7QE 3RWCB 1QYGL 3BI9X 2G2RB 3ZKND 2N56A 3M1BA 3NZHH 1D5IL 2JCCA 5GISL 1ZLUK 3ZDZF 1HWHB 3B3IA 1OAZL 2IBZX 3TBYA 4LFHD 1MCSA 3UAJD 3MTRA 4FQXC 3CLFL 2XN9B 2FSEB 2B1HH 1Q9LB 3KPOA 5EUKB 5HY9A 3HE6C 3QIBC 4Y5VC 5D7JD 5EOCL 4OBRA 1WVZA 4QGTA 4I18A 3O41A 2DYPD 2DDQH 4GW1A 4YHZL 1JHKL 2ADFL 2JB5L 4QRRA 4OFVA 2J2ZA 4LPTA 4QXTA 3WBDA 1PEZA 1X4ZA 1F3JA 5E8OB 2X4QA 2IG2H 4HWEH 1DQLH 2W0FA 4TVPL 4M02A 1AFVL 1MRFH 1A6ZB 1HIML 5DF0A 2BVPB 1WIOA 1JGEA 2VOTA 1MCKA 4XH2B 2GTWB 5FYJU 1F4YH 3SCMC 2FHFA 4OQTA 3PWPB 4PJGB 1M1SA 3FO0H 2X4OA 4QGYA 5BOPA 3TBTB 5C09E 4WI8A 4HIEA 2ADGB 3F6IA 2DN7A 3DRTB 4KPHL 3LV3A 2NR6C 5ISZD 3BKML 3QCVH 3HE6D 1OP5H 2FEDD 4MYWB 4NQDE 5D72L 1IGML 4JGMA 3O6FB 1HILA 4GAJL 4NYLA 1QA9B 3MV8D 4WWID 3MSPA 3U6RB 4JREB 1P5VA 3H9SD 5IHZB 1CTOA 1WK0A 2FD6L 2G5RA 2VLLA 4F9PC 4Z8FH 3OZ9H 2X4NB 1B4JH 2X1OA 1R3KB 4M6ML 4YK4B 5TGBB 5ERWA 3LH2L 1NCWH 3BP4B 3SCMD 4PB9L 3GSQA 4WW2F 3FOLB 4LLWB 3L3KB 4UIMB 5F9JA 5EZOH 3VXOA 2VZTA 3MGTA 1Q0YL 1AGFA 3N1PC 4HS3A 5GRVL 1D9KA 4MQ7B 1BBDH 5GGSB 3Q6GH 4N8CH 1KYOJ 5F1OB 4M7ZC 4UUJA 3VXSB 5DQJB 2QQNL 2OQJB 2H26A 3P0GB 5FO9B 1MLBB 4AEIH 3QUZA 1S5HB 4XPAL 5EZIL 4KXZI 3MXVH 5E2TL 3CFEA 5MENB 2EDBA 4L4TD 2R4RL 1X5GA 5J6GB 1IGCH 3D0LA 5L2JA 3MRCB 3SDDC 1P1ZA 2PYEB 4HQQL 4NSKA 4U1SA 5TF0A 4LVEA 4LRIC 3TN0D 1MSPA 3PWNB 4TVPD 5IHBA 3ZHDA 1MCPH 4PYHA 4LSQL 1CICB 2HN7A 3HLAB 4DGYL 2V2WA 4Z7WB 3RGHA 4HH9A 1RHFA 5DLML 3WFBH 3QSKB 5CJXA 3S7GA 3OG6B 5E2VL 3U82B 4BM7A 4K94H 1R5WB 4PJ7B 1KT2A 3UJTH 5IOPA 4PJ9A 4LEOB 32C2A 4UOW0 3DLQR 5DVOA 1AQDB 1SEQL 3WNKA 3OSKA 5EUOB 3B9DA 4POZC 4V1DB 2EDWA 5HYJB 1J05B 4ZTOL 3ILQD 1QPXA 5DURD 5DEGB 3WD5L 3BAEH 3BPOC 4OLUL 3MACH 5D71H 5DSCA 4AM0B 5I1KH 4C56D 5HYSG 5IESL 2YOCA 1R3JB 1YEFL 1CDCA 4I48B 2OTPA 5FEBA 2MOVA 3VE0B 3DETC 3T3MF 1G7LB 4D9QE 2VLRE 3EO0A 1TLKA 3OJDB 1HNFA 1BFTA 1HOCB 2ZG1A 3MRFB 3EZ8A 4LIQL 5FYKU 4APQB 4WUUE 4ZNCD 4X8JB 5I8EB 4KXZH 1S7RA 3MA7A 4YDVA 1XGTA 4HCRA 1YC8A 4FQLH 3JWDL 2V2XB 3IDMB 2K7QA 3C87A 5CEYA 4KAQH 3DSFH 1K8IB 5D7SH 5EU4B 3WNPA 2BVUA 1BFVH 5J9PB 5J1SC 2FYYA 3BGAA 2EIBA 2R56H 3NZHL 3S37H 1GGIH 4H1LA 3HAEH 3AS0A 3LCYA 1DLFH 3HI1B 4KKAD 4PJ5A 1TJGH 2XZCH 3L3HA 1GGTA 5FV1L 4XC3H 3TIDA 2BNRE 3DETD 4N0UB 5DRWB 1OGAA 1CXIA 1A6PA 2B1HL 5IVZB 3BGFB 4MHHI 4PTUB 4EI5C 3C60B 4E0RA 3BD5A 5T3XL 5HHNB 1DANT 1RZKC 5F6HJ 4IMLA 1IILE 1AP2B 5ACLA 2BSSA 2ADJB 2VWEE 1Z5LA 3QWRA 3MBEC 5E9DD 4ELMF 2W92A 3GMOB 1LEKA 5ADOH 5FUCC 4KUZH 5HGDB 4LCCC 1MCBA 2YBRB 3ARFC 3BZ4A 1M6OB 1ZHLA 5TPWH 3ROLA 1IT9H 2IG2L 3SDAA 3GRWH 3MX0A 5F6IC 4HWEL 1CGWA 1EO8H 1MRFL 3DX8A 4M03A 1OT1A 1F4YL 4X4ZA 3T4YB 3O3AB 1WISA 2DQDL 3K46A 3HZKB 3T09A 5I16A 1OW0C 2XWBB 2BY1A 4TN9A 2H2PC 2CUMA 3RTQA 3ARGB 4M3KB 4PJIB 3X13A 3QCVL 4FQQA 1FFNA 3AY4C 4O00A 4ZUVB 3UO1H 1JRHL 4RMQA 5FGSA 3MUGB 5AG8A 2LU7A 4P3DB 5IBTL 1T0NB 1JZ7A 3ARFD 4PS4L 3BD4A 5KVGH 4AQOA 2BVYA 1G0XA 3PF2A 2P8LA 3O9WC 3DWTA 5I75C 3BZFA 4Z8FL 2B5IC 5ENWA 1B4JL 1GZPB 5IVXA 5E5MB 1NCWL 1NUNB 3VDCA 1NGWA 3IKCB 1PZUB 4Z95H 5GS1B 3RDTB 3QUZD 5D4QA 4R90H 5HDOA 5EZOL 3WIIH 2VRAA 1YMMD 4QRSB 3Q6GL 5ABDE 4N8CL 1U8QB 2GTZB 5E6IA 3MRLA 4JN2A 4LCYB 1JN6A 3RL1A 2HMID 3CVHA 5ID0B 1JPGB 1A1MA 4MJ5B 4NPYB 1O7SA 2QADB 5T3XD 2VABB 4AEIL 3AC0A 1ONQA 1I85A 3NVQA 2BOCB 3K2MC 3MXVL 1ADQH 3IDGB 3QRGL 4QXUH 1AHWA 1GVIA 1MI5E 1UM5H 1FVDB 2O5ZH 1IGCL 5LJYH 5MI0C 2J88H 5ICYB 5GSRA 2GY5A 1OB1B 2DIAA 3EGSA 1MCIA 1NH6A 1H8SA 2AJZB 1NFKA 4R26H 1MCPL 3VFWA 5FA4A 3HUJA 4G8IB 3PWVA 1OAYH 1JK8B 2NPLX 3IDXL 1GC1C 3NGBB 4JKKA 2MHAB 4KJYB 5JZ7C 1RIUH 3PGFH 4HLJA 1P53A 2NY3C 4FHBD 1EXUB 2F74A 5DJ2A 3WFBL 3C5ZB 5HGBA 2VXTH 4K94L 2BHZA 4KH2A 3FQRB 5CIPH 1YN6A 4EDXB 3CZFA 4NP4H 5E6ZA 3O3EA 2A6DA 3WXWH 4MQXC 1JNLH 4BA8A 3BZEB 2DD8L 4KJQD 2OZ4A 3UPAA 3PL6B 4A2LA 4AEFA 4KHXL 5D9SB 5E2UH 4AEHH 2HTKC 4JFHE 4L3ED 5BW7C 1EJOL 1S7WB 3BAEL 4J3UA 3BP6A 5KJRH 3QEUB 3MACL 5D71L 1KIRA 5I1KL 3BIAX 4X7SL 5C09A 4R7NA 4J8RA 4PPTA 5B4MC 5T3ZE 1KLUB 3NZ8A 2MMXA 5T1MA 4NZUH 4YHOH 1RZ7L 3V6ZA 4ELKA 2R1YA 1N3NA 5INDB 3RUGB 4R7DB 3VG0H 3VD7A 5SWZE 2NLJB 2F53E 4JGUA 2LFGA 5KZCB 3AFLA 4IEFB 1MCCA 1I7RB 2HTLC 1SBSH 4XPTL 5IEHB 2HFFA 1GHFH 5FGBC 4Z7WF 1NC4A 3HRZA 3L6FB 5A16B 2EC9T 1FNHA 3P4LA 1NGZA 4JQVA 4S2SA 4YGVA 4ZUWB 4MQXD 1Q72H 2FJGB 5JLZA 1GIGH 3ARPA 4FQLL 5DYOB 3GSVB 4NJ9H 3KPPB 4M93B 4KAQL 2HTKD 3DSFL 1X4XA 5D7SL 2B0SH 4NCDA 2WBWB 4Z7UE 1BFVL 1OGAD 1FFOA 5C0DA 2R56L 1H3XA 5C70A 1HEZA 5EUOF 1GGIL 4J3WA 3S37L 5D1QB 3T65A 1INEH 4UQ2B 5CINH 1HCFX 3ALWA 1TJGL 2XZCL 5LQBL 2FO1A 3WLWC 3HG1E 1HHJA 4XC3L 3QWRD 3ARQA 4Z7OE 2ESVE 4KQ3H 4DUVA 4GG6E 1Z9LA 3C5SB 2O5YL 2EO9A 4UNVA 3D39E 1VERA 3SDAD 5TJWK 5H8DA 4X98B 3SGKA 3ABZA 4J4PC 4YAQB 4LSRH 3GJFH 3VXUB 2J6EA 1QR1A 4XCNB 5ADOL 4BFIA 5FM5M 2FJFA 1U8KA 4N0RA 4JDVA 5TPWL 3ZTJG 4HSQA 2OBGA 4ZFOL 1MCRA 4TSBH 3CX5K 4BQ8A 3GRWL 4HUUB 4PJBB 2JK5A 4RMUA 3RTQD 2CO7B 4GXVL 5CJOH 2PTTB 3MA9H 3AU1A 5IB3A 1AR1D 3PNWA 1UG9A 1BLNB 2X89D 2ZUQC 1H8OA 2YHGA 1Q9OA 1RUMH 4Y4KC 5EO0B 3TYGH 3PWLB 5EU7C 5BMFH 2YN5A 4CU8A 1UKTA 3KPQB 4MCZB 4WIQA 2AKRB 1P6FA 2YUZA 3UO1L 4R0LB 3TIEA 2PO6C 4J4PD 5DO2D 4N90D 1H15A 4I3GA 3QFDB 1P9MA 4MB4A 3B6SB 5D1ZB 2DQEH 1PZ5A 1LDSA 2R4SH 4LLQA 1Q9WB 3LKRA 1CS6A 4X5XA 1IC7L 4JZNA 5HI5C 3E0GA 2VLRA 4QHLB 4PV8A 5IMMB 4Z95L 4D94A 4LLDB 3MLWH 5C0CE 3WIIL 4WUUA 4KZDH 3N9GH 1LD9A 4Y4KD 2H6PA 4MWFB 4DKEH 4JJ5B 3HNSH 1T7YA 3KJ4C 1Q94A 1JYNA 2X41A 3OR6A 1ADQL 1OQOA 4HD9A 1WEJL 2H3NA 4QXUL 4HG4K 4PJIF 4R96A 1CXFA 1KJ2A 4GG8A 1KCRH 4TNWK 2Z92A 2NMSA 2J88L 4MGXA 4WHYG 5IBUB 1A1OB 4JFOB 5I1DB 3S8WA 5LWYH 2IPUK 1XGRB 3UTTB 3BZDA 1RSFA 3GBLA 3QQ3B 4RAUB 1RJZB 4NHCH 5DD1H 4UNTA 5EFIA 5F1IB 4R26L 5GHWH 1LO2H 1CR9H 3OBAA 5D8JH 4F80A 5IW1A 1IBGL 1T5WA 1OAYL 2OR7A 1EERB 4LHJB 4M4PA 1G6RA 1I7UA 3FFDB 1KCLA 1OSZB 1RIUL 2DTMH 3PGFL 4ORGB 2N1KA 3BMVA 3GMNB 4X6EA 3MFFA 3TVMB 1GOFA 4F7TA 3MROB 4G8EA 3GI8H 3IT8D 4NO5A 3ZKXB 5IEKA 4NP4L 1IAIM 3Q5OA 5DFVD 2BC4A 3IJHB 1KCSH 5C09D 1UWXH 3WXWL 1JNLL 1RD6A 2D7PA 4GFTB 2ATPA 1N0XH 1WJ3A 3GI9L 4JFXB 5J1AA 1U8NA 3H3KA 5F9DC 3FQWB 4AEHL 4YDJA 5D6CB 2Z8VC 3FN3A 3FO1A 3T0EA 3RVWD 1ZLWK 2F54A 1MCJA 3JV6B 2ED7A 2IANE 1ZT4B 2R2EB 2YUVA 1NC4D 2W0PA 3UEZA 1L0YA 1ROWA 4OIIH 4NZUL 4YHOL 3LIZL 2NW3A 1JE6A 2A9MH 3TEUA 1SVCP 1JMZA 1U9KA 3HE7C 3NABH 5IHUL 1VPOH 3U0TA 3PDOA 1QSFE 2QQKH 4X6FB 5FO8A 1SBSL 2YN3A 1GXEA 1GHFL 5ITBH 4WJ5A 3TO4D 4YE4L 3G5YB 1Q72L 4F2MB 2X4SB 2FH6A 1GIGL 1P4IH 2DM7A 4JY6B 1NSNH 2ZG2A 5HVGB 1BD2E 4NJ9L 2CDFB 5B39B 1A6TA 1Y18B 5HVWA 2VZVA 3QQ4B 2Q7NA 5ITFA 2B0SL 4HIXL 3P4OA 4JFPB 1FGVH 3KYAA 5I1LA 3GMPB 4WW1B 2XQYK 3O2DA 3C2AL 1DN0B 4I0KA 1INEL 4G9FA 5TH2B 3CCHA 1N2RB 4Y1AE 4FABH 4P9HC 5GS2D 4G9DA 4JPWH 1RJYB 1KJ2L 1YPZE 3HE7D 2FBJH 1IKFH 4UMGA 3DV4B 1R3LB 1LE5B 1BZ7A 1XF5A 2P24A 3RX8A 4Y8AA 4QOKE 5JOPD 1MI5A 5F8RC 2BSRB 3RUGF 4AIZA 1QKZH 2Z31A 1UXSA 2R1WB 1W0VB 4LSRL 4ZS7H 2O61B 4GBXD 4BQ9A 3RPKA 4BQBA 4P5TB 4LCWE 5T1KB 3QB7C 4F37K 1G6RL 4P46B 3QUMB 4O2EB 3RRQA 4CNIA 3G08B 4TSBL 4UILH 1DQMH 5GSVB 4U1JB 1XR8A 4QNPE 4MJ4A 1QBAA 3D2UA 5IB1B 1LO3H 4PV9B 4XBEL 1C7SA 1DVFB 3P77A 1I7TA 2H41A 2VLJB 1U3HB 3CVIH 1BQLL 5L8JB 1AR2A 4HWZA 3AXLB 3D25B 4P5MB 3DI3B 3TYGL 1CT8B 1MHEB 5BMFL 1Z0NA 3J8F7 1KIPB 2DQFB 4NQUA 4NQDB 1BJ1J 5ICXB 4GAGH 4Y16C 8FABB 1TNMA 3LN4A 3C2SA 4V2BA 3KS0H 1X5HA 5L0QB 1IAKB 5EO9B 3CSBA 4FFZL 4KMTH 4JLRB 1EEZB 4KKBD 4Y5YA 4LNRB 5F9AC 3KPSB 4OCXH 2DQEL 2UV3A 2R4SL 3NN8B 5CAYB 5D1XA 1NGYA 2NY4C 3UZEA 4CUCA 5DGQA 4X7CC 2ZJSH 5SWZA 2DLTA 2F53A 4HKXA 5C9KA 1WBXB 1IQDB 2FCBA 2ZSWB 5CGYD 2WNGA 1HZHL 3LS4H 2Z93B 4ODBD 4N0CC 1J8HE 3FT2B 4HZLB 5AYQA 3LKPA 4D0BA 5DJ6A 4IRZH 4M1GH 4DKEL 2CRYA 3GZKA 1PBYA 3EIFA 5E95B 3HNSL 4KQ4H 1LWRA 1XF4A 3OAUL 5MEOA 1MAJA 5DJDA 4LPVA 4ODXB 2FBOJ 4ZFZA 3U30B 4WFHE 3DO7A 2ZZUT 4E42A 1IM3B 4Z7UA 5DMKA 2EE2A 1KCRL 5DFTA 2C7UA 1T66D 2ICWB 5LWYL 2BVQB 4MAUH 5E94A 1KPRB 3BPLB 5E2WH 3HG1A 5H35A 5DUPL 1KENL 2ESVA 4NHCL 5DD1L 1CFNA 2D7OA 4EIZC 4GG6A 5GHWL 1U8JA 3B9KD 4X6CB 5D8JL 1F90L 1CVSC 2NXYD 3D39A 1NAKH 1NFIB 4TVSa 4D8PA 1NBZB 5DVKA 3B9EA 4Z5RB 4N0CD 3I9GL 4Y4HC 4KKNA 4PREA 2DTML 4RDQF 4KRPC 4X5LA 4WGWB 1PX3A 2EDFA 1PDKA 4ETQB 3FFCB 4JFQA 1T1ZB 2UUDK 4JRYB 4KI5C 3X3GH 4KRMB 4DJMA 3RVXC 2O5XH 1DEEA 3T0ED 5EBWA 2F54D 4MZ3A 4IIQB 1U95B 1T83C 5L2KD 5SWSB 3ZHKA 5JPNA 3IAQA 1N0XL 1CD1B 4QO1A 1KB5B 2GJ6B 3GJEB 3NPSB 2MKLC 4JR9H 4KHTH 3LMJH 4NUJA 3FO9B 2CIKB 3PDGA 5DK3A 4YGAB 1J7VR 3QFJE 3ZDXE 2BOBA 3QZWG 4OIIL 4WI6A 3ARBB 4YO0A 4Y4HD 1JWMB 3GMMA 5IWLA 1I8LA 4DOHB 2VAJA 4KRPD 1WCBA 4OSUH 2A9ML 3NABL 5J13B 5FOJA 1NDGA 2QQKL 2X09A 1S7VA 4QRPB 3BIKA 4ONFH 5GRWA 4Z77A 3M45A 5ITBL 1YZZA 3KPNA 4YIQB 5TE7H 2VLKE 1Z6JT 2V17H 5HYFA 3TFKD 3E3QE 5SWQB 4X99A 5CP7A 4G9FD 1P4IL 1JWSA 1RJLA 3VI4E 4RMTA 1BIIA 1X5AA 4LK4A 2GCYA 1UGNA 3D5OF 5C6TL 2DQIH 1JVKA 3MNZA 5C0CA 1FZJA 3MREA 4IRSA 4EI6B 1FGVL 2GJZA 1R0AH 2AV1B 3G5VA 3MZGB 4LLUB 3QXDA 1MUJA 4FTVB 3F7VB 5K9KB 5MEQA 5E99H 2DWDA 2ZPKH 3JTSB 1VFUA 1FZKB 4BH8B 1CD0A 3QUKA 4E9LA 2QSVA 1S3KH 3MLVH 5I18H 2BNRB 2GITA 4NFBA 4MS8C 5EN2A 1IKFL 4EUPH 1VFAA 3GHBL 1D6VH 2GSGB 2DMKA 5IVXF 4U4BA 2NY1B 5F1NB 4ZS7L 2AERT 2I25N 3HCVA 5F7LB 2JJUA 5F9WC 1W72A 4J12A 2E27H 4KROC 1YEDA 5CEZE 5EIIA 3RWIA 3HN3A 2BY2A 3QIBA 4LAQH 1HK6A 1DQML 1CXLA 25C8H 1XF2B 1P84J 5HHOB 1FVEB 1ZHKA 1LO3L 2IFGA 3QNZA 2N7AA 2OTWB 3T8XB 1H9VA 4Y19A 4L8BA 3OKKA 1UADC 4RA3A 2BDNL 5D7LA 4RQQA 3CU7A 4XAKE 3N1MC 3KXFB 3OKMA 3BP7B 1QSEE 4HUVB 4G6JH 3H7BB 3VFMB 2H1PL 2MJWA 2FRGP 4GAGL 1VADB 5SWZD 2LAGB 3CFBA 4LQFH 4L9DA 3RWHB 4H8WH 3DBXA 1YN7A 5HJ3A 1ZHNB 1NGXA 1LE9B 4MNGB 3HB3C 2IANA 4OCXL 4WWKC 5J11B 1T2JA 1G7IA 1CWVA 3VXRE 1OQXA 2HJKA 3E6FA 4U3XA 2ZJSL 4XNQA 1ZGLA 4EVNA 2OJZH 3WUWG 1EAPA 1QSFA 2C4FU 4RBPK 3LS4L 4XCYA 2HLAB 2OR8A 2XWJB 4OIAA 1DBBH 4IRZL 4M1GL 2QR0B 4O51B 2P4AB 1QQDB 4KQ4L 1BD2A 3UBXG 4GRMB 1HXMB 4O2FB 3PGDA 1BWWA 4YFEA 2D31A 3IJSB 3FO2A 4NJAH 2ZKHH 5E1AA 3EDKA 4O2CB 1A9BA 3HB3D 2A73B 1MHHB 4WWKD 4Y1AA 1E6JH 4PJEE 4MAUL 5E2WL 1FZOA 3QHZH 1XIWB 4BJLA 1N64H 1RK0B 3MJ8B 3QJHB 1ZANH 3NH7H 4H20H 3ILPA 1B0WA 3RBSA 3HI6H 1T0MB 4ZUUB 5BXFB 1YPZA 5JIPA 3AAZA 1MVUA 3IETA 1ACYH 4PYGA 4QOKA 4P5KB 1OLLA 2FHBA 4PGEA 4LRIA 5IVNA 2FECI 3IDYC 3UPRB 2FX9H 2DM3A 3LKQB 1UCTA 4K3HA 4RMSA 3LVEA 3MRBA 2O5XL 5ESQB 3FQUA 5GS3A 5H2BA 4NM4H 3RA7H 4OZHB 2YA2A 5DMGD 3FAXA 1U2HA 1P7KA 3MMEB 2AQ3A 5DJ0A 1HYRC 3MJ7A 3H42L 1ZXQA 4RGNE 1QHOA 2WWMD 5IFJA 1UA6H 3AS3A 4HPYH 5EG6C 1S7QA 3H9HB 4XNMB 2IADA 4JR9L 1A22B 4KHTL 2CMRH 1BOYA 3LMJL 3ZE2E 4JPKH 4HDIB 3QDHA 4K9EH 5EU7E 4JG1H 3MR9B 3DXAE 2HVKA 4I77H 3BDBA 3TNMB 2DM2A 4LLVB 3O2VH 3W9EB 1DP0A 4JAMB 4LP5A 3KPRB 4OSUL 4MD0B 2YUXA 4X6CF 2QKIA 1FCCA 3PV6A 3VGAB 2LVCA 4GLRI 3P9MB 5FB8B 2VE6A 3GM8A 4ONFL 1BFOB 4R97C 1S8DB 4X7EC 4WI3A 5TE7L 2V17L 3IXAA 3V6FB 4E41B 4FQ2H 4MJID 3VDBA 2RJMA 1BX2A 2IALA 3CFCH 3HR6A 4JQXC 4U1HA 2VUOA 4KK8D 4I2XB 3Q48A 3IVKB 4Y0GA 5JQHC 5ID1A 2FL5B 4PJ8C 5CSZA 5C0IA 5CJBA 1J8HA 4IOIB 1R0AL 1HQ4B 3T08A 4GRWH 5FYJH 3VD4A 4TTDC 5E99L 2ADIA 2ZPKL 2A0LD 3NOIA 1CQYA 2ESVB 1S3KL 3MLVL 2LU3A 3NIDF 4HBQA 1K4CB 2RFXB 1MFEH 2P5WD 3I6KB 3O8XA 4TNWF 3N1FC 1D6VL 3DURA 4OZFA 3BD3A 4N0YH 4MXQC 4G43A 4Y19D 2E27L 3U7YH 1A7PH 4H25B 5D7LD 2EIZB 3DGGB 3CFJA 4LAQL 4S1SH 25C8L 3BIBX 1A1NA 2KKQA 4WV1C 1HQRA 5JIKA 3WIHA 5B3JE 1F11A 4LF3B 2Z35A 4RGMC 4JVPA 3ARTA 4ZUSA 1L0XA 5B8CB 4C83B 3RBGA 4TTDD 3I6GB 3HKFA 4LPXA 2B7DT 3QI9C 1NGPL 2BVTA 2WQ8A 3NIGF 3DIFB 4HS8H 2AJUH 3F7QA 4U1MA 2BNUB 2IMMA 5CP3H 4GLRH 4CGTA 4POUB 4G6JL 3W5MA 2F19H 1RK1B 4O02H 3L1OL 5F96H 2YR3A 5BRZA 1AI1H 1VESA 4PD4K 4XP4L 4XWOD 1T1XA 4LQFL 4MA8L 1FC2D 1EZVX 4NO2B 4W6YB 3SJVE 1G7JB 1G7MA 2Q87A 5I0DA 4CVZB 1TFHA 2EXYC 4P0DA 3KDMB 3V4UH 4Y4FC 4DFIA 2VL4A 3MRIA 1RUPH 5DJZA 1KV3A 2NNAA 5KTEH 3WFCL 4YNYA 5EULV 3KR3H 2ZWLT 4PY7A 2Y4SA 4QHKJ 5D7JB 4CDHA 2ZOLB 2CLVA 4DKFH 2ZUWA 2VLKA 1KACB 1JNJA 3WJLA 1DBBL 1UEYA 4V2CB 1BQHB 2XTJE 4YH6A 4OF0A 1J0YA 4OUUB 2H32A 4MSWB 3SDCC 1IL1A 1MCWM 2ZKHL 4CMMB 4H8WC 2DKUA 4QOKD 1CF8H 1JGVH 1CDJA 1FO0B 4HBCH 1E6JL 4OZ4B 1AO7E 1BAFH 4FQXB 3QHZL 1NAMB 1BJMA 1EGJH 1KELH 1N64L 4FQJH 1MELA 1ZANL 3NH7L 2E3VA 4H20L 5DJ8B 1C8PA 3HI6L 4NDMB 5GZOC 2DJUA 4LVNC 5ISZB 3HE6B 4Y5VB 5FECB 1CXKA 1BVLB 1ACYL 4M6OH 5IIEB 2W60B 1FIGH 4OJFH 4PGBA 5DI8B 4MNQE 5EU6E 3ZDYE 4G7YH 4F37F 3V0VA 5BVJA 2GSIB 4LCUA 3R06A 3H9SB 5FYKH 5BS0D 4K8RH 2AK4E 1Z9MA 4JFYB 1T7XA 5IBLC 2AK1H 4YFDB 4NM4L 3RA7L 1MJ7L 1TVHB 3OMZA 5DUMH 1U0QA 4OGYH 2OL3A 2VZSA 1S7TB 3SCMB 3BJ91 3REVA 2RHEA 3OB0H 3WJJC 3PWUA 1UA6L 4HPYL 1YJDH 1UWEL 4LVHC 2CMRL 4QHNA 3QIUA 4JPKL 2AS5M 5GGTH 4MDJA 4JG1L 4I77L 3NCCB 4AJ0A 3LQZA 2V5TA 1QSEA 2A6IA 1VA9A 4I4WB 5FA3B 3WN5A 2XACC 3O2VL 3RIFK 4PRPE 4TULH 5BW7A 4LLYA 3S6CA 4PGZA 1NC2D 4MD5B 4MZ2A 3IU3A 3IAPA 5FCSH 3WDJA 5F7DA 4OV5B 3F7YA 4LOUC 4NRZB 5C0AE 3QDME 1WBYA 1D6EA 3VXRA 1X5FA 4OD3H 3VXMB 1ZVSA 3R0MA 3RU8H 4QY8A 1I9IL 3S35H 3O11A 3UTSD 2VDRL 2P47B 2VXVH 5IK3A 1O0VA 3BN9C 4K9EC 2OTUB 3RVTC 5FYJL 4DQOH 3SHSA 4X6DB 1QEWA 5I1JH 1IKNA 1MFEL 4K23L 1QFWL 4KC3B 3WS3B 4YHYC 4QRUA 3SDDB 3ZL4H 5DURB 4PJXB 4G8FB 5JUEL 3PWJA 2I07A 1NJ9A 2IAMA 4PJEA 5I19L 3BQUA 1ZKAA 3RZCC 4LCWB 3C9NB 3ULUH 4PG9A 1CGYA 2R9HC 2R29H 1A6AB 1KXQE 3U7YL 3VXPA 4NM8L 2D7NA 2XWTA 5HSFA 2FNBA 3EDJA 3TT3H 3VGBA 1JYVA 2OI9C 3QQNA 1CIUA 5ACZA 4LSUH 3BH9A 1XMWA 3BN9D 4KVNH 5I2IA 1HYSC 1P2CB 3HC0B 3RVTD 4KI5E 1KEMH 4FQHB 5GGRA 5BRZD 4UTBH 2DIBA 2KDGA 3QG6B 5ESVB 1NQBA 1QFOA 2OL3L 4M6AA 2NX5E 4HS8L 2AJUL 4NNYA 3NTCL 3V6BR 4HWNA 1WV7T 4WI2A 3U36B 2UZIH 3NFSL 4UINH 2UWEB 2F19L 1T22A 3GSXA 1QNZL 3ARDC 5DC9B 2ITDB 3FCTB 4ONHA 5HHMD 1FYHB 3DOSA 5LBSH 3RNQA 1AI1L 4LNVA 1L6XA 2ZCLH 4F3FB 3K2UH 4GG6F 4XRCA 4NQSA 1UB5B 5I1IH 2R9HD 1J87A 1RIVL 1NCTA 4GO6B 1EV2E 4JRXD 2XPGA 3DXAA 2Q20A 1QPPA 2VAAB 3V4UL 3CDGB 3RWEB 3BE1L 4OI7A 1RUPL 5KTEL 3UTOA 4Z78B 1HYSD 4MAYA 2FR4A 1T1YA 2EEBA 5FYJD 2GUOB 2AJVH 1CXEA 5LAXA 2A74B 5E9DB 4G8GE 4QRTB 1AGEA 4I0PD 2R2HA 4NQVB 4U1NA 5DVMA 5SX4I 5IM7A 4D0DB 3RZWA 2Q8AL 4L8DB 3MNWB 3P30H 4XNZC 2E7MA 4GW4A 4LPYA 4Q9QH 3O45A 3HA0A 3JTTB 2YSSA 3L3IA 3F6LA 3Q2CA 3NAAL 4HEPG 4M5ZL 3BWAA 2UVFA 4HBCL 1YQ2A 1BAFL 1ZA3A 3VRIB 3MJ9A 4QHKI 1EGJL 1KELL 3ROOA 3SQOH 4U1KA 4FQJL 4K2UH 4X4XB 3RPIB 1G7QA 4EI5B 4ESKA 3KLHD 5CEZD 5C0NC 1SJEB 3WSQH 3D18B 1CFTA 1U8HA 4WTXA 1M7DA 3P4NA 3QIWC 3T0VA 3MBEB 1FIGL 4CVXA 4OJFL 1HHGB 4HFWA 2FB4L 4IHOA 4LCCB 3ARFB 4G7YL 2PW2B 3C5JB 1H3VA 1URLA 4NNXA 4D9RD 1DL7H 4K8RL 2VDPH 2AK1L 5F6IB 2E5EA 5DUML 2EDJA 5MHSD 4OGYL 3BJLA 1C16A 4NOBA 1VKXB 3MRJA 1P7QD 1YJDL 1YMMB 4BELD 1XGQA 5EU3A 5FF6B 1E4XI 5FM5O 2PXYA 2Y5TB 2DMBA 3RHWK 1HDMA 5GGTL 1I9JH 4PGDB 3T4AA 2V9RA 1V7ML 5GGUA 1SYVA 1UH2A 1AQKH 3TPUA 1U6AH 4ZO7A 3EO1B 1BFSA 5A2LH 1GZQB 3BEVA 5F70A 3QFJB 2UZXB 3BUTA 2AJYH 2X4UA 3SPVA 4XT1C 3A0OA 3QIWD 4TULL 1D7FA 4XBGA 3OGCA 3G6AA 1FNEA 1MIEH 4GKZA 3SJVA 4LLAA 3ME0A 3O9WB 4K8RC 4GRLA 2C3XA 3SDXB 4BQ6A 5TE6H 1BVKB 4TUJB 1QBMH 5TDNA 2OR9H 3I6LD 1ZT7A 3CX2A 4OD3L 2YEZB 2VISA 4S0SD 4MA1C 4QRQB 4ODHH 4JEGB 3O6FC 2V7NB 5IROC 1QO3B 2HLFD 3S35L 3FJTA 3CFDB 4RDQG 1BHGA 4DWHA 1IGIH 4P57B 2VXVL 1FN4A 1V5JA 3P73B 5HI4D 3VFVA 4DQOL 1VCAA 3MJGX 1HI6A 1AKJD 2X7LA 4U6VH 1OCWH 4H1LG 1ZA6B 2IAMD 4NKMA 5DA0B 3LD8C 5I1JL 3BQUD 4HWUA 1Y0LB 3S36L 3DX7B 5AWNH 4A6YA 2KZWA 3BH8A 3T0AA 3ZL4L 5D2NE 4G42B 2VITA 1B9ZA 1EHLH 3ZKQD 4L3EB 1OAQH 1HINH 1IAII 4K8RD 4HS6B 3QH3B 4UOW1 3WIFA 3BPNB 1AO7A 2XNAB 4N8VA 4WHCA 3ZKSD 3ULUL 2YXMA 4JZJA 5IBUG 1JGLH 4LKXB 3TT3L 2IBBA 2W38A 1E4XH 1V8HA 4RFEB 5F1SA 4F7CA 4LSUL 5FKPA 4KVNL 3L5XH 3CC5B 1KEML 1HE7A 1AD0B 4LMQI 4RGND 4W68A 4ACPA 2C3VB 3BVNB 2JKXA 3SE8H 5DMJB 2PTUA 3QULB 1QLRA 2Y36H 3GSNA 3S88H 2AK4A 2VSDA 4XVSH 3FN0H 1F4XH 2UZIL 4UINL 4P3CH 5TF1H 1T7VA 3CPLA 2FX8H 4X6DF 1HSBB 4L3CA 5LBSL 2A6JB 4QWWD 5BZDB 2ZCLL 3ALXA 3K7UA 4HWBH 2KPNA 4BZ1H 4BSVB 1ZK9A 3CX5J 3ECBA 4OKVB 5I1IL 1RZIB 3G04A 3OKLA 5INCB 1K4DB 4NOFA 3QEQE 2M1KA 3EHBC 4D0CB 2AJSH 3NFPB 4X4ME 4OD2B 5GRUH 2DF3A 2FIKB 1FNGA 5E5RB 4PRPA 3UYRH 2O93L 3W11C 3KWWB 4NQEE 4HIJB 4X6BA 2WINB 5LGJA 3VG9C 2E7BA 2Q7YA 1FAIH 4XNUH 4QNPF 2NY5H 2AJVL 1WBZA 2ICWJ 2VH5H 4NT6B 1AE6H 3EOYG 2XV6B 2JLLA 4IRJC 2P46B 5C0AA 5DEFB 3QDMA 1U92A 1KYOK 5M95B 5JHDD 2ITCB 1IAIH 2IQ9H 3QO1A 3P30L 3GSWA 5I17B 5IW6A 1K2DA 1PKQB 1QBLH 1U8PB 1HXYB 1PYWB 3LKNA 3PE9A 4Q9QL 2PF6A 3AGVA 2UWEF 2J1KA 3EOAA 5E70A 3MV7A 3ULUD 1DSFH 3HZVB 2Z4QA 3EHBD 4O9HH 1NANI 1RY7B 3IDIA 2F9BT 3SQBA 4A6YL 1RUQL 3GJFK 3SQOL 4K2UL 5GZNC 3TESA 3W11D 4H26A 5E00B 2VDOH 3WEXA 4PJDB 4JFDE 2MCPH 2W0KA 3ULSA 3WSQL 2A6KB 4X5WB 1KGCE 1KXTB 4P2QE 3RVUD 5T33H 4IRJD 3IFPB 4C59B 1DE4B 1IAOB 5DRNB 4XP6H 3ARUA 1MCDA 5K33A 4ELMA 1KG0B 1DL7L 5D5ME 2VDPL 3V0WL 4RAVB 2YXFA 3L7FB 1L0QA 5KVDH 3L95B 3HAEB 5CD3A 5GXBB 1DBAH 2R2BA 3GSNL 5EC1A 2C1PA 4TUOB 2ZUQB 1JHLH 2BSTA 4PBXA 2XZQH 5HHPB 1EFXB 4JKLA 4ZFGL 2NX5A 3OPZH 4Y4KB 4JFZH 5IKCA 2G5BA 2GAZA 1AQKL 4OAWA 1U6AL 3GIVB 4LSTH 4NNPH 5IFHH 1OGTB 1FYTD 1R5IB 2AXFA 2IQAB 4XP9H 3OKOB 1GL4B 5C0FA 2PO6B 2WBJA 4OLWH 1J1PH 2WP3T 3PP3H 3S5LA 4EDWH 1UB6A 1ORQA 2BCKA 2X5PA 3ZYJA 2WWKO 1IMHC 3G5ZB 1J0HA 5IT2L 3GB7B 4ZFOB 4UAOB 5DTFA 3SKNB 5TE6L 5KS9B 3EFDH 1AGDB 5I71C 1NANH 2MNUA 4ODHL 5FYLH 1KJ3H 3C8KB 2UVEA 5CHNB 5TFSH 1G7HA 3ZE1F 4I3SH 5E08L 2XFXA 1IGIL 1OD9A 3KHOA 5J0BA 3EYFB 1V3KA 4N0FA 5DS8B 4JY4B 4G8GA 2G9HA 4DZ8A 1NLBL 3TBSA 3KJ4B 4IOFC 4U6VL 1OCWL 4IDLA 1AO7D 3C09C 3IJYB 1W0WB 1KCUL 5CBAB 2DKSA 2PW1B 3WYRA 4ISVA 3ZMRA 4NCC2 5AWNL 3MOBL 2VMFA 4Y5XC 2F58L 1M7IB 3ZDXF 1CBVH 1T04B 2ICCA 4U1LB 1MFAH 1EHLL 1BM3H 4QHUA 1OAQL 1EH9A 1HINL 2YD8A 5F7EH 3CXDL 3V5DB 3DJ9A 4J6RL 1J12A 4WFEE 2QADC 3CAFA 5IV2A 2HG5B 4OGXH 1UH4A 2C4FT 2VL5B 4PRHD 5EC2B 5GRJH 1JGLL 5IJVB 2CRZA 5ICZB 2Y06L 1N7MH 4NHUA 3W81A 4RA0C 3WKML 4P4KC 3BW9B 1MCEA 4EEEA 3SGEI 4WHYH 3VI4F 3KLAA 4QT5B 2V5SA 1EEYB 5C0GB 4FFVC 5C71A 3TO4B 4NRXB 4XVSL 1N59B 3FN0L 5F7NC 1F4XL 3FB5A 3OXRB 5F8QC 3T77A 3PIQB 4P3CL 3X3FH 3THMH 2PYFA 5D7IB 4EOWH 1EUTA 5BJTA 1G9EA 4L5FH 4HWBL 3PQYA 3VWJC 4XZUB 4U1IB 1JUFB 5IMLB 3I75B 4PJCB 1X6NA 3V7MA 1YNTA 3AREA 1WF5A 3RIFF 2AJSL 3EOBB 1YY9C 3WS6A 4P4KD 5GRUL 3O4OC 3L3DB 4CW1A 1U8MB 3UYRL 3FRUA 3HE7B 3FONB 1FL6B 3BGMB 1TQBB 1I8MB 3SE3C 5CIPB 3GFUA 4FFVD 4FZEH 2NY5L 3OAYK 3PJSA 2DWEA 2IPUG 2VH5L 4LP4A 1LK3H 4F7PA 5HI3D 5JORA 4GBXB 1AE6L 5EZLA 3L5WB 1U8IA 3SE9H 3MV7D 3IXTB 2B4CH 5EO1B 2DLIA 2IQ9L 3C6SB 3HI5H 1N6QL 1QBLL 3VWJD 2BERA 1AGBB 1HHHA 3QYCA 4K3JL 5I30L 2P44B 2DL9A 2X4PB 4FQCH 5MEPB 1U36A 2IPKB 4Y2DC 5AUMA 5J8OA 3GMLA 1YY9D 1KEGH 1YUHB 5AZ2H 3SGEH 4M5YH 1AIFB 4FZ8H 5EOQH 4LPWA 3OKNB 2HT2C 4L8SC 3RWJB 4HV8A 1I8KB 1S9VB 3QA3A 4P49A 5D2NA 1ES0B 2DTSA 2ID5A 5D1QC 3CJJA 2NY5C 3V6OE 5T33L 5DQ9A 4GQPH 1BOGB 3VXQB 4MNQB 5EU6B 4XP6L 4XPFL 1JTPA 3VFNA 1XGUB 1I8IB 1U91B 1K8DA 1MJJB 2LU4A 3HNTH 1JHTB 3VWKA 3QEHB 1M71B 1KJMB 3NCBB 4P9MH 5KVDL 2DBLH 1Q1JL 4E5XA 3U2SA 4JM2A 1UVQB 1A02N 2WBJD 4LDEB 3T3ME 5D2LE 1JHLL 2XZQL 4OLZH 1DTUA 3OPZL 4P48A 4JFZL 2PN5A 2AEPH 5KSUB 2HT2D 5HDQL 4LSTL 1FJ1B 2WP3O 4NNPL 4ZSOE 4XP9L 1RI8A 3V9FA 3Q6FA 3MGOB 2E8YA 4Y16B 1ZSDB 2ZNWA 1UJ3C 2XQYG 3WO4C 4OLWL 5CD5C 1J1PL 3GJFB 1FG9C 3U4AA 1FHGA 1I4FB 2BNQE 3TZVA 3EYSL 4O58H 1N5AB 1OF2A 3LSOA 2E7LC 1MRCH 2NY4B 3QEQA 4NQCD 3O81A 4ZPTB 3B83A 2CLRA 3X12A 5FFLA 4X4MA 2BFVL 3EFDL 2OSLA 4G6AC 1H0DA 1KIQA 3VFOA 3FQTA 3B9KB 2DICA 3TCLB 4XTRC 4NQEA 1RZJC 1UXWB 2ARJQ 2WLZA 4EZMA 5FYLL 2EECA 1IGYA 1OAXH 1FV1B 1A3QA 1KJ3L 4R8WL 4XWGL 4NUGL 4L4VE 4QHMB 2GI7A 3DYOA 5E8EA 1QD0A 3QUXC 3R0NA 5D1ZC 3G5XB 1U93B 1LEIB 4BSWA 1KLGA 5C0BA 4RNRB 4L1DA 4U6YB 5CBEA 3ZE2F 4NQTA 4CADA 2VLME 4XMKH 4CDGC 4X4YA 5L2KB 1VB9A 2HT4D 2VXQL 1EHXA 1CBVL 2M26A 5JA8B 3QXUA 4YBQD 5K9JH 1E28A 1MFAL 4MDIB 1BM3L 1IGTA 3TT1H 3RGVD 4ZAKA 1QRNE 5F7EL 3H3BC 4M43H 2G75A 2RR3A 3I02B 5F3BA 4OGXL 5ALBL 3HNVL 3OKEA 5I66A 3QNYA 4JFDA 2F8OA 1N7ML 4CN6A 4AEEA 1M05A 1WTGT 4Y4HB 3DI2B 4KRPB 5KS9F 4P2QA 3K1DA 5F3HA 1U58B 3MRDA 2DQCL 4WO4D 3QWOB 1G7PB 3U7AA 4MX7A 3CU1A 2VERN 3JWOH 2XN9E 4GAYB 4M7KL 3PQYD 4JE4B 4JPVH 3O0RH 5D5MA 3T04D 3V5KB 4WI5A 4WV1A 1K6QH 1BP3B 3VFSB 3THML 4AENA 1MAKA 3GGWA 3O4LD 4LQ1A 5E2JA 1DUYA 4ZOCA 5GRXG 3WXVH 5JTWA 4UQ3B 2YC1B 2CKBH 5E8NB 3NACL 3TVMC 5CGTA 3RHWF 4I5BA 3ULVH 3L7EA 4P59H 4M9OA 1VGEH 1WQVT 3TNNA 5JW5B 4P23C 5DRXA 2C3WA 1IFHL 5FYLD 3WE6B 3U0PB 3PABA 1X5IA 5SV3A 3PWPE 4PJGE 2YPKB 2LVEA 1CFSB 2OM5A 1ZHBA 5FM8A 3TH4T 3VMOA 3BKYH 1I3GH 5HBBA 4PG2C 3D69A 4FZEL 4RFNC 2EDQA 4RIRA 1LK3L 4Y4FA 1YEGH 5BZWA 3TJEL 2B4CL 3MUZ1 5DK2B 4KV5E 1HSAA 2GFBA 4OZGE 1SJHA 4KK5C 4Q58C 1MCLA 2D7TH 3UYPA 1DQJA 4PGCB 3ZT7A 5D70H 4FQCL 1V3LA 2Z91B 4NQXA 4P23D 2AXJA 4HT1H 4TUKL 4ZXBA 1KEGL 5AZ2L 4M5YL 3W39B 4FZ8L 5EOQL 1EFQA 3N85H 4KJWD 4QF1B 1F6AA 4PJCF 3X17A 4IOSD 3I50H 3L3JA 2NY7H 3W9DB 3VWKD 5KOVC 5C9JA 3SGJC 2QSTA 4X7TA 2I24N 4G7VH 5F9WB 1IARB 4NKQB 3P0YH 4AIOA 1JNHA 4R4ND 5K9OA 4CN4A 2EKJA 4JM2D 3K3QA 4KROB 2B4CC 4A2MA 1XZ0A 5T5FL 1RZGB 3BXNB 1RURH 5MENE 2P8MA 4PR5A 1I1AC 1LEGA 3RIAK 5EOCJ 4P9ML 2JB6A 1PG7H 2PYEE 5JXEC 5IB2A 2I27N 2DBLL 1I1YB 1XCQB 3D3VA 4Q6IA 4NZTH 1ETZB 4PRAA 3UBXI 5C86A 4DEPC 3OL2A 4F8QA 4P5TC 1ULVA 3BO8B 4TYUA 2NTFA 4OLEA 5I8CA 4BKLA 2AEPL 3LEXB 3MNVB 2R0LH 3VXNB 1A6UH 5J06A 3WJJA 3EZJB 2YD7A 5IR1B 4YHIB 2VKXA 1E6OH 4LPCA 3TF7C 3NA4A 1SYSB 4PJ7E 1S9XB 1DUZA 1SEBB 2QQLH 4L29A 4WWKB 1PQZA 1K3IA 1I1AD 4NCC1 1MRCL 5EUOE 4V1DE 1IRAY 5HYJE 4EN3C 4XP5H 3VJ6A 3WLBB 2DBJA 5C0BD 4RWYH 3SY0B 1OAXL 3QZWA 4AH2A 3QXVA 3RI5K 4ZDHA 2D3VA 5L0QC 4NKOB 4OLXH 1IGFL 3R4DA 3KYKH 4HK3N 3REWB 1FL3A 1ZS8B 1MWAA 3TA3C 4GKNA 3L5JA 4G5ZL 1BZ9A 1NCAH 3EFFA 4XNYL 1VFBA 4PRIB 3EJJX 4HK0B 4XMKL 4P2OC 3VA2C 5L9DH 1BQHG 3FB6B 3CLEH 3CMOL 4Z0BH 3HMWH 2CR6A 4XCEA 4QCIB 5B3NA 5DHVH 3TP4A 4BUHA 5K9JL 5DQDL 4H88H 4NO0D 2P5ED 4UDTA 2X4TA 4LEXH 3TT1L 3FQXA 1L7IH 1PG7W 2E7HA 4DZBA 2YKLH 5CLWA 4IJ3B 4YPGB 3T0XA 2IGFH 3CSYA 3BP5B 4KTEL 6FABL 4LLMB 1NBYB 5C8JB 3LB6D 2YPLD 3T1FB 5B38B 1IE5A 3O3UN 1KJVA 2H9GA 2FWOA 5D6DA 3V6OA 3IDYB 1IGJA 2J4WH 3JWOL 4N0UE 5HYQB 5EBGA 3X14A 2NZ9C 4JPVL 3O0RL 1D5MA 1NEZB 3STZA 4ODSL 3NMEA 4MJIB 3K8MA 3UTPE 1K6QL 3UXFA 3ZKMC 1E27A 4LHUA 2PCPB 4ZS6D 5FM4A 4UIKH 1MH5B 5DD6A 3VFTB 2CKBL 5E8PB 3VFGL 1GSMA 2XOTA 4JQIL 3ULVL 1A5FH 1FL5A 4OZIB 4ODWA 4RMWA 3HR5A 4P59L 4WHDA 3E6HB 5D2LA 2DI7A 3AVEA 4AY0A 1P4LA 1KTKE 5M7QA 4YHPA 4B7IA 1ODAA 4M6NH 3AB0B 1Q0XH 3ARDA 2ZUUA 1K5NB 4ZSOA 3D85A 4WFGD 1CE6A 1A4JB 5FHBH 2P5WB 4HW6A 1CFVL 3DUSB 4ODUB 1JZ8A 1XGPB 4BH7B 1TZGL 3L3OB 4OCNC 1I3GL 2D4DA 1LO0H 2GEEA 4UNUA 4R97B 3KYMB 2AJ3B 3JWOC 3MQIA 2NZ9D 2A9NH 2BNQA 4PJIE 1YEGL 2XICA 5DA4A 3CH1A 4XC1H 3WFHB 4KI5F 3SKMB 3SOBH 5M94B 2H8PA 1A4KB 1T2QH 3OHXA 4PJ8B 5MERA 1WSST 1H3UA 1ND0B 5FUZH 1B3JA 1U8OA 4PP1C 2D7TL 3ULVC 4L4VA 4XB7A 1FE8H 2BVOB 4MJ6A 5D70L 1WZ1H 5DR5L 3IDNB 4HT1L 5KSAA 2BMKA 5FDWA 3MRGB 5JO5B 3B2UC 3CIQA 4IS6B 5ANMA 4WFED 1KN4H 3N85L 4TRPH 5AYUL 5IJKA 2NY7L 2C5DC 4IMKC 4R3SA 5F89B 3UTQB 3M17B 5CKGA 3GDBA 1NEUA 5DMYA 3WDIA 2YZ8A 1C08A 1QRNA 1UYWH 3P0YL 3D3VD 2NZIA 3CUPB 4U1GC 3RWCA 1QP1A 2EO1A 3UP1A 1RURL 2G2RA 1MCWW 4YHLH 3MUJA 5DJAB 1BBJB 4TSCH 4NKDB 5LG1A 4PP1D 4RGMB 3SKOB 1PG7L 4R2GC 5C2BH 2W1NA 2BHYA 4NZTL 4S1QH 3DVFA 4MMXC 3QI9B 2XN9A 2FSEA 2OXGA 4XGZB 1OTSC 2Y9RT 1OTUC 1Q9LA 5C07B 2R0LL 5EUKA 4EUPB 3QBTB 1TVBB 5JMRA 1E6OL 4PRBB 1LK2B 3QXAB 5FGRA 3STBA 2QQLL 4F9LA 1JZ5A 2Y7QB 5E8OA 1Z2KA 1NUDA 1AY1L 5ESAB 4KDTA 1A6ZA 2DI9A 2BVPA 3K8KA 1TENA 1JGUH 4XH2A 2GTWA 4XP5L 5KG9B 4R2GD 1S5IL 3MYJB 1FDLH 3PWPA 4PJGA 2BRRH 4YBHA 3S34H 1DR9A 3VH8B 1A7QH 2XT1B 1TJHH 3Q0HA 1TPXB 4JANB 3TBTA 4HGWB 2ADGA 1OTSD 4OLXL 3EDFA 3KYKL 3DRTA 3DTXB 4KTDH 3OTTA 3HS0B 3AROA 5J11C 5F71A 5IG7B 2H2SC 5BS0B 1NCAL 4YUEH 3O6FA 2VDML 2W9EH 5IROA 3W0WD 3SDCB 1UZ8B 1F58H 5L9DL 1QA9A 3CLEL 2IEPA 3QUYC 2E8ZA 3U6RA 1BJ8A 5IHZA 1I3VA 4NN5C 4H88L 3QG7H 2A2QT 4L9LB 3VW3H 4FRWA 3V4PH 2X4NA 1R3KA 4TSAH 3C6LD 5KANI 5TGBA 3BP4A 3SE4A 1A6VL 2YKLL 1NCBL 3FOLA 4LLWA 2IGFL 3L3KA 4LVNB 4UIMA 2OYPA 4YBLC 4PLJC 4WNQB 5E7FA 1UZ6F 4MQ7A 3SO5A 5GGSA 2Y5EA 5JOEA 2XA8H 3VXSA 1NC2B 5DQJA 1P84K 1I9RH 2V2TB 1FZMB 3BEWB 3HMXA 2OQJA 1CDBA 3P0VL 5FO9A 1FORH 2J4WL 1MLBA 2EEAA 3WL9B 1S5HA 5MENA 1T7WA 4LARH 1TETH 2VQUA 5J6GA 3NFNB 3QUYD 2XRAH 4WI4A 3PHQB 3RP1A 3MRCA 2PYEA 4HJGB 1B0RB 4UIKL 4WFFE 4WHTB 4YFLI 4ZOAA 1ZGLM 3UTSB 3DMMD 5J57B 4XCFL 3RNKB 3PWNA 1L4IA 1P6AB 1CICA 4JPIB 4PJBE 1F3RB 3TBVB 4M6NL 3HLAA 1Q0XL 1JGDB 4OB5H 4Z7WA 5GQBA 2HKHH 2R39A 1N5YH 5FHBL 2Z8WC 1S9YB 3BWUC 5F1KC 1R5WA 2I9LB 4PJ7A 4PP2B 1S7SB 4LEOA 1LO0L 1ZLVH 5C7XL 1S9WB 3DV6B 2HWZH 2A9NL 3KGRA 1RQ5A 1AQDA 4L4VD 2HJFB 3KG5A 4KPHH 5EUOA 4V1DA 5CZVL 1QHPA 3P2TA 5KSAD 1J05A 1I7ZB 5HYJA 3SOBL 1ZLSH 5DEGA 1OTTC 3NIFF 3T3PF 1T4KB 1E4KA 4AM0A 4CMHC 4N9GB 1IQWL 5FUZL 4B0MM 2GK2A 2SEBB 1R3JA 2CXKA 3VA6A 3MRHB 3GM0A 1JWUB 2BVEA 5JOFB 1CLYH 4I48A 3IAGC 3BT2H 3NA9L 3VE0A 4F7MB 1G7LA 1QRND 3LH2H 4UU9B 3OJDA 4PRDB 1HH9B 3P9WB 1HOCA 1QG3A 5E6YA 3MRFA 4APQA 4X8JA 1Q0YH 4FQ1H 2AJXL 5I8EA 1CG9B 2NY2C 5HHMB 1MFCL 3FQNB 5A3IC 5DEZA 1ITBB 3RZCB 2V2XA 1F2XK 3IDMA 5DXWA 2WAHA 3LQAL 4JRXB 43CAB 4XPAH 3U7WH 1K8IA 1OTTD 1MAMH 4JFFD 5EU4A 5EZIH 2FLBT 3VGHA 5J9PA 3RWFB 2MWCA 4YHLL 2R4RH 2OI9B 3OR7B 3U1SH 4TSCL 3HI1A 3A6BH 5C2BL 4GRWB 1JPFB 1CDIA 3S9DB 3UTTE 3V8OA 2AQ1A 4N0UA 3JBG7 4XBPB 5DMIH 5DRWA 1CL7I 1XH3B 4OT1H 5IVZA 1D5ZB 3QQ9D 4PTUA 3C60A 4I0PB 5HHNA 2KQNA 4DGYH 2NY2D 1AP2A 5C92A 5BVPH 5DLMH 2ADJA 1AJ7L 4FXGB 2W9DH 1LVEA 3GMOA 4U3HA 3LS5L 5HGDA 4ZUTB 1XF3B 3D1MC 2YBRA 3IU4L 1M6OA 2CDGB 4W6XB 2EYRB 2EH7H 3MGAA 4OQTH 5CJQL 1CGXA 1UH3A 4HKZB 2GJJA 2ZUXA 4XI5C 4ZTOH 2ZOKB 3T4YA 2BRRL 3O3AA 4DGVH 3S34L 3ZKNC 5IB4B 5JXAH 3HZKA 1A7QL 1TJHL 1YDPB 2XWBA 3D0VB 5KVFL 3KLSA 3ARGA 4PJIA 5C08D 4KTDL 3ALPA 2A1WL 1AGCB 4DTGL 3MODL 3UAJC 4ZUVA 4OFDA 3RFZC 4YUEL 4XNZB 1NBQA 3MUGA 2W9EL 2D0FA 1F58L 4P3DA 1T0NA 3TLRA 4LIQH 3TPKA 1P7QB 5JPMB 2EDNA 1MQKH 2W65B 2EICA 3QG7L 1FLRL 1JRHI 3VW3L 4Q0XH 2IH3B 3VXSD 3JWDH 1GZPA 1IEAB 4TSAL 1YECH 5E5MA 4XI5D 3S96B 3IKCA 1HH6B 1S7XB 5GS1A 3RDTA 4M8QB 2Z8RA 1K85A 2XTLA 3TC9A 1CL7H 3O6KH 4QRSA 3P40A 3QIWB 1U8QA 2GTZA 5HHVH 4Q9RH 4LCYA 2ILLA 1QLEH 2XA8L 1I9RL 5ID0A 1JPGA 4MJ5A 4NPYA 3K80A 4F8TA 1FORL 2VABA 5GJSL 4OF5A 3MLRL 2BOCA 1YEEH 3MRMB 3IDGA 4IM8A 3RIAF 3T0BA 1CICD 1FRGH 1TETL 2VXSH 4HKJB 1FVDA 4LARL 5T3XH 4NBXB 4Q6YA 4JZOB 2XRAL 3MV9D 5HPOA 2FEDC 3BYYA 1SY6A 4G80B 3FOMB 4NWTH 4WY7H 5ICYA 3W5NA 1ZT1B 4MQTB 4PBWD 3EYQD 1OB1A 1W8OA 2AJZA 1TZIB 2RCSL 3HAEG 4KFZC 4HX1B 1KPVB 4G8IA 1JK8A 2P43B 3ZTNH 4OB5L 1AKJB 4DVBB 2MHAA 4KJYA 4ALAH 1KF9B 2AP2A 3PDDA 3HC4H 3OF6A 2HKHL 1EXUA 3RWDB 3C5ZA 4XHQA 1N5YL 5HYJD 1KFAH 3SDYH 2XZZA 1U3YA 2VLJE 3FQRA 2AW2A 2DQDH 4EDXA 1OHQA 2HWZL 2JF1A 3BZEA 3BSZH 2EEDA 1QFWM 3PL6A 4XVTH 5D9SA 4MA1B 1ZLSL 1JRHH 4OIBA 1S7WA 4OZGB 3ZLQC 3QEUA 3RI5F 5GIRB 5IBTH 5T1LD 4PS4H 5IF0B 3KPSE 3JSSA 1KLUA 4MVBD 4X0KB 1MHCB 4W4OA 3I3DA 1CLYL 3BT2L 3UTZB 1BIHA 4OF8A 3TN0C 5E5UB 5INDA 3RUGA 4R7DA 1Q9KB 3LD8B 1T89A 2NLJA 4WEMB 1MJUH 1B2WH 2AI0L 3B9AA 1Q8MA 5IMOB 4HCRH 1I7RA 3U9UB 3OV6A 5IEHA 4FQ1L 3L6FA 5A16A 1R5VB 2EE3A 4DN3H 2Z9TA 4ZUWA 2HFEB 2FJGA 3SBWC 5DYOA 3GSVA 2VDNL 5AZEH 1MCFA 3KPPA 3V5HB 4H1LH 3U7WL 4Z18A 1MAML 4MNHB 3QRGH 3C8HA 4HIIB 3FKUS 3U1SL 3C60D 5D1QA 4WI7A 4MCYA 5EBLB 4UQ2A 4RGOH 5DD3H 4YXKH 4S1DD 3A6BL 2UZYB 3ILQC 3CK0H 5E56A 5JMOC 1J9CT 3HHRB 5DMIL 1OM3L 4MHHG 4RX4D 2P7TB 3C5SA 4X6CE 4OT1L 3CDFA 3K1KC 4HJ0C 3IDXH 3BKCL 1OAUH 5JHDB 4X98A 1AXTH 5BVPL 3Q3GB 1JZ4A 2Z0BA 3V7AE 3VXUA 4YAQA 1KTRL 2W9DL 1J11A 4RISL 4XCNA 3FFCE 3WNOA 1FNSH 2R8SH 4FXKB 5C0EB 4JRYE 4NBZB 3H7LA 1F4HA 1X5LA 2EH7L 4HUUA 1NUFA 4PJBA 3DRQB 5SWSE 4OQTL 4WU7B <