2UUDK

Crystal structure of the tepc15-vk45.1 anti-2-phenyl-5-oxazolone nq10- 1.12 scfv in complex with the hapten
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
113
structure length
113
Chain Sequence
QVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPYTFGGGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords NQ10-1.12 ANTI-PHOX ANTIBODY
publication title Structural Basis of Affinity Maturation of the Tepc15-Vkappa45.1 Anti-2-Phenyl-5-Oxazolone Antibodies
pubmed doi rcsb
source organism Mus musculus
total genus 13
structure length 113
sequence length 113
chains with identical sequence L
ec nomenclature
pdb deposition date 2007-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uudK00
3MRQB 5B8CB 1AGCB 2XA8L 1C12B 1G0YR 1LDPH 2XQYK 3BSZH 2EXYC 3LMJL 2BJML 5D72L 3WLBB 1M7IA 4KUZL 2BHZA 4RAVA 1BFVL 1J1OH 5ALBL 4Z9KB 1BWMA 3U6RA 1YZZA 2VZ3A 4X99A 1RK0B 5I1IH 4AQOA 4K55A 5DD5L 5J6HB 3RI5K 1L6ZA 1Y0LB 2WM0A 3WFBL 5I15H 2FIKA 4MJID 1Z3GH 1X5HA 2H32H 5GRYA 4NP4L 5GS2D 3AXLA 4OAWB 4EXPX 1S9WB 3HG1A 5FO8A 2Y06H 1QSFD 2YD2A 4PJ5B 1U3HD 3E6HB 4IRSB 5GGSY 4KRMB 3QFDA 3HG1E 3REWA 5BRZA 3HE7D 1LGVA 3O9WC 1H8SA 2F5BL 3DO7A 4ZOCA 5BRZE 1PYWB 4OLEA 4KZEL 5KAQG 3TJHD 4ZO6A 2LABA 3D0LB 1IGIH 4O4YL 5DGQA 3CIQA 4PRPD 4F3FB 1T7WA 2VR9A 3KPSD 5D7KD 5EUOA 1S7QA 1KT2B 5CSZA 2DF3A 2W92A 3JV4A 5DD3H 1ZHBB 2VIRA 5EUOE 5K9QI 1HHJA 4N9GB 5EZJB 2DI7A 5ITFB 4EUPH 4NZRL 4PJXA 5AUMA 2Z4QB 1HWHB 3GIZH 1I85C 3M8OH 4PJXE 2CLZB 4L8BA 2RFXA 3DWTA 4L3CA 4NOFA 4H1LA 1UENA 1MUJB 5EU3B 1H3GA 4KQ4H 2IPKB 15C8L 3Q6FA 5T1DL 3FHQA 43C9A 2LVCA 3KPNA 5CJ5A 1FG9C 2FCBA 3G5VA 4XVUC 2Q3ZA 3TZVB 3VJ6B 2YPVH 3NZHL 4Z7WF 3MNZB 2R23A 4KMTL 1U8IB 3FN9A 4CADB 4M61B 3D6GA 3JTTA 3LMJH 1LHZA 2BJMH 1LK2A 5D72H 5T3XL 1QRKA 1TJGL 4KUZH 1BFVH 2VC2H 5ALBH 5E6ZA 5FUOL 4BK4A 1CXIA 1IJ9A 2X4OA 5HD8C 2NY4C 5DD5H 4X9HA 1ZGLB 5IB4A 1MHEB 4E5XB 3UJTL 3WFBH 4GBXC 3MV8D 4M5YL 4I18B 4NP4H 3PG2A 4R97B 4QRUB 5DD6A 5ETUB 3CDGA 2AV1B 1I7UB 4EJ1C 2EZ0D 3WFEL 3N50A 3T0EA 1MRDL 1OAQL 4RQQA 3T3PE 2VXTL 3QEUB 3EDDA 2F5BH 2X40A 3T0EE 1EEQA 3QIWD 1R0AL 3OGOE 1XIWD 4LFHD 3JTSA 3OX8B 5MP6L 1NFIA 4KZEH 4W6YB 4JFQB 5CWSB 4O4YH 2O5ZL 1CCZA 1W0VA 2A9ML 1MCKA 2WANA 4OB5L 1EEYB 2WIIA 5JIIA 2BHYA 1NUDA 2BC4B 3RHWK 3SCMB 4N0FA 1PY9A 3PGCA 3ZE1E 1JE6A 4NZRH 1KXVC 4QO1A 2VERN 3LVEA 3QXTA 1XFPA 2PW2A 3C6SB 4RMSA 4ODWA 5L2JB 4Y4FB 2DM4A 5GJSL 2LFGA 4XTRD 5F97E 3N1QC 4L4VA 1Z9MA 4HLZH 5I9QC 3MLUL 1A4JB 4L4VE 15C8H 5DRXB 1O5DT 1QKZH 5SV4A 3IVKB 3RGHA 1AQDB 1CXFA 3RZCB 1CLZL 4XX1E 4BQCA 3O0RL 5DTFB 1B4RA 4PJCF 3NZHH 4UIMB 4MS8C 4KK6C 3CC5B 4HIHB 4AT6A 2W60B 2OTWB 4KMTH 3T1FB 5HPMA 4Q9QL 4HKBA 2EXWC 1ZA6A 1ZT7B 1QBML 5T3XH 3MRGA 2E7BA 1G7HA 3KYAA 5FUOH 3ABZA 3L3JB 1ETZB 3UYOD 2PCPB 3RX8A 1CWVA 1YYML 3PV7A 2YBRB 4MLIA 4PLJC 3V6OC 4M5YH 5EO0A 5FM4A 3VWKC 4BUGA 4CVUA 1NAKL 3KPLA 1NGPL 4XMPL 3CPLA 3HTLX 4FXGA 4J3TA 5BMFL 3OKEA 3WFEH 4NO0B 1MRDH 1OAQH 2FH8A 3WUWB 3MRKB 3I3EA 1T21B 1R3HA 4PGCB 2VXTH 5ADOL 4EN3A 1KLGB 5I2IA 4CN1A 2JJUA 3RWJA 4EQ2A 4GKSA 4FG6D 2QSTA 4CGTA 5JW3L 4M00A 1UYWL 2O5ZH 3WUZA 1LO2L 5DJAA 4QGTA 1NSNH 3UCRA 2NLJB 4BQBA 2A9MH 4OB5H 4I48A 2G5BB 2WBJA 2VR4A 2ICWB 2P5WA 3RTQC 1N0LA 1FO0B 4RMQA 2P5WE 2EICA 1FL5A 2ESVD 1T7YA 1WTGT 2YR3A 12E8L 3KXFA 2YN5A 2B0SL 3RVUD 3QXDB 4HFWA 2F8VA 5GGSB 4ZUVA 1YJDL 3KXFE 5GXBB 2P5ED 5F7MC 2IMNA 5T1LA 3P4MA 4H0IA 4KK5D 4LLDA 5KVDL 3MLUH 4NQDB 3T3MF 3UYRL 1HILB 1YMMD 3U83A 4U1NA 1V8HA 3O0RH 4XGZA 5FB8A 5IMLA 1FVDB 3UJJL 4KVCL 4PGEA 2YS4A 4EI6B 5HDBE 3PIQB 4EXKA 4ODUA 4YGVB 4MD5A 5GPRA 2J4WL 1TPXC 1JZ6A 2DTSA 1DBML 3DGGA 2Z8WC 2RAMA 3BE1H 3UEZA 1QBMH 3MLVL 5J7CC 1E27B 1S9KC 3DX9B 2BY3A 3BWAA 5JXEC 2P5EA 1XT5A 4F7TA 2HT3D 5KTEL 3OKMA 1YYMH 3OTTA 3SKJL 2P5EE 4LCYA 5EO9A 3HZYA 1X4ZA 2EDBA 5CS7A 5B38B 1WF5A 4YEEA 4YGAB 1UGNA 2NX5D 4MNHA 1NAKH 2X7LB 1NGPH 1YMMA 2M8XA 4XMPH 3JV6B 2KPNA 5GISL 5BMFH 3F7VB 4GRWH 1R3LB 4C55A 1QFWM 4NUGL 1YMME 2V5RA 1QA9A 5ADOH 1GCFA 4BZ1L 4X6CA 1YN6A 2VNCA 2FEDD 4OQTA 4BSWA 1FVCB 5D2LA 3E3QE 4P2OD 1A6TA 3MZGB 4DZBB 4YR6A 5CGMA 4X6CE 2C3VB 4C56B 3HKFA 2VDRL 5C0AB 2CMRH 2B8OT 1IARB 2IALB 2V2WA 1A64A 1UYWH 5D2LE 1LO2H 4KXZH 5JW3H 2V2TA 3I2CH 1VFUA 3RWGA 2VSDA 4DVBA 2Q8BL 4D9QD 4LEOA 4L4TD 1MIML 1XEDA 1U3HC 2JJSA 3TBSA 5T5FL 4M1GL 3D39B 4MAYA 5CEXA 1OT2A 4CN6A 1IC5L 5D93C 2B0SH 4O2FB 2FWOA 1MI5B 5F3BA 2OTPA 1FE8L 1YJDH 1YEKH 1PZ5B 4Y5YA 3ZT6A 3TJHC 3IKCA 5F21B 4P2OA 2JE8A 5K33A 2R0ZL 3CFKA 4L9LB 4LCCB 1JNLL 3FAWA 1BREA 1PW3A 3UYRH 1DL7L 3OV6A 4P57B 1WUNT 1WZMA 4F7EA 4K8RD 2ZOLA 3LN5A 2Q7YB 5AD0A 1CTOA 1RIUL 3UJJH 3EHBD 3GK8L 1T0NA 4OGYL 4R7DA 2R69L 5CMAA 4DK3A 2J4WH 2JB6B 3RP1A 4NQXB 3DETD 1DBMH 2ICWJ 1GGYA 1NL0H 1KPUB 3F6LA 5INDA 5CSBA 3MNWB 2IH1A 3MLVH 2BRQA 4UT6L 2AV7B 4OLVL 1CFSB 5KTEH 2D2OA 1SM3L 1ZT4B 4Z7WB 2E6QA 3DARA 5KS9F 2GITB 4HWUA 3RU8L 2MQCA 5T5NG 4EUPG 4DUWA 2XACC 1JPTL 4X5XA 2XICA 4U2ZA 5CSGA 4PJEF 1ZHNB 5I74C 1ZHKB 4NUGH 4D9RD 2JCCA 4GRLB 1ZEAH 2M2DA 4BZ1H 3DUUA 3N1MC 5D6DC 4LASL 3TF7C 3QR2A 2DLGA 3B6SB 2P1YA 2JCCE 1EXUA 4MVBD 2MTPA 1Q9OB 2VDRH 4LSDA 1OTTD 4HKZB 3K2UL 4YHIB 4QWWD 5C9JB 1QLEL 4UILL 1UH2A 4NO5B 4RBPH 2Q8BH 4MCYB 1MIMH 4M48H 2C5DC 2EZ0C 2X4TB 5F89B 1IL1B 4N0YL 3FQXA 3RPIA 5E95B 2ZUQC 5DA0B 3FO2B 4M9PA 4WJ5A 1IC5H 2F53B 2NQCA 1LO3L 4PG9B 4WHYH 3S4SG 2G5RA 3QIWC 3PNWA 5ACLA 1XIWC 4HEME 1FE8H 3I6GB 1J0ZA 1BFSA 1R5WB 4MJ5A 4D9RE 4ZPTB 5KG9B 2R0ZH 5HY9B 1JNLH 3REVB 4EBQL 2I5YL 3CFBA 3MLRL 3ARED 5I18L 4OF7A 2IBGA 2DM3A 1DL7H 3EFDH 4RDQG 4H5SA 1P2CB 3IRZA 1VADB 4N8CH 2XKNB 4U1HA 1E6JH 2XWJB 5B39B 1RIUH 2AERT 3WO3B 1P9MC 1JWUB 1OF2A 3GK8H 4OGYH 2R69H 1AE6H 2ATPA 2BNUA 4N9OB 3WFDL 3EOTL 2LQRA 4EDXA 2DWEA 4F37F 3MRHB 4OUOA 4CMHB 4UT6H 2EC9T 2Y6SD 4G8EA 3VFPA 4XVSL 5IB3A 1JUFA 5IV2A 3DHJA 3WDIA 1SM3H 2BHUA 5D2NB 5E00B 2NY6D 3RWDB 4P5TB 1MPAL 4O02L 3AREA 1CDGA 3PDOB 4JY6B 5DMGD 3RU8H 3W39B 1JP5A 3F7RA 4X80L 3QUXD 1JPTH 1A47A 4FA8A 4G43A 3U36B 3BKCL 2BOBB 1SYSB 4LLAA 5GRVK 4IM8A 3GMOB 4XZUB 4HLZG 2X4PA 1ZTXL 3V4UL 3NABL 5EBLB 1BOYA 4HFUL 1AGBB 5E4EB 2NY2D 3NH7L 3QCTL 4WO4B 5IMMA 1GVIA 2YEZA 5DLML 3INUH 5C0BD 1X44A 3K2UH 5GRJH 1QVOA 4LL9A 4HAGA 3JWDL 1QLEH 4UILH 4U6XB 4ODHL 2D31B 1ONQA 3L95A 5TDPB 3ZT5A 3SO3B 5MI0B 4NRYB 5ANMA 4XPGL 4FZEL 3W9EB 3EYQD 1FO0L 4RSVA 4JFHD 5FDWB 1DVFB 3IU3A 1LO3H 5ANME 2OCFD 5DVLA 4P0DA 3K74B 4R0LC 4WGVB 1BQUA 5EWIL 1WFOA 2D7TL 4FG6C 4ZS6D 2X5PA 5F7KC 2DM7A 3FB6A 3QPXL 3KJ4B 1N59B 4MD4B 4WUUB 2FL5B 1MELA 4EBQH 2I5YH 3MLRH 2BSED 4HCRH 5C8JB 5I18H 4Z7VA 3MV9B 5CLWA 5EU4B 3OHXB 3IDGB 5JO5A 4LGSB 3OAYK 4Z7VE 5EOQL 3SKOB 4PJAA 5C1MB 3VFOB 2FJFA 3O81A 3QJFA 3KAAA 3M07A 2HKHH 1KSRA 3RWCA 3MRRA 4PJAE 4YBLB 3EOTH 4JHWL 3UP1A 1DQJB 2GEEA 3FFDB 3EUUA 4BZ2H 4XVSH 4KK5C 5K9KA 5C71A 3TBTB 3HFML 4ZTPH 1MJJA 2I9TA 5GRXG 1O7SA 1NLBH 4GQ9L 5I73B 5L0QC 4HF5H 4O02H 2EYSB 4L3ED 2GIYA 4PTUA 4X80H 1OSZB 4PJGA 1EO7A 5E8OB 1QLFA 2OI9B 4RX4A 3E3QC 3BKCH 5F8RC 1U8HA 2E7MA 4HS6A 4PJGE 2H9GA 3QDAA 2XN9B 1ZTXH 5FUCE 4Z78A 2VDKL 3C8KA 3GMMA 4BSJA 3V4UH 3NABH 3LIZL 4LLQB 3WMSA 4EOWL 3MRBB 3NH7H 2HT3C 4Y5VC 4EI5A 3CVHB 3NPSB 3SDXF 3ZDXF 5DLMH 3QFJA 4KGJA 1AR1D 4OM1L 4JM2A 2XTJB 2MCG1 2JJSC 4ODHH 1QSEB 1GOGA 3QFJE 1S9VA 2YC1B 4L3EA 5D7SL 4GAJL 3UTSB 4DJMA 3HCVA 1Z9LA 2H32A 4XPGH 4D0DB 1F02I 5I1DB 4FZEH 4M43L 3HNSL 5H2BA 1FO0H 4L3EE 5HJ3A 1LWRA 1QR1A 1BX2B 4LBEA 2FEDC 4P5KA 3IF1A 2FATL 3VH8G 4P2OC 2UYLA 2VITB 3PDGA 5EWIH 1IGTB 1MCPL 5IB5B 1QOKA 3FB5A 3QPXH 3R06A 3VFVB 2RB8A 3TO4B 4FQ2L 4P5MB 1PFCA 4W4OA 5IEKA 3TIDA 1VFBA 1G9NH 2OQJA 4X4MA 5EOQH 2Q86A 1IM9D 3A6CH 1NEUA 1KTKE 1VFMA 2ICEB 4O2EB 4X4ME 1G0DA 1MCEA 4GKZB 3H6JA 4EUPA 4S0SD 1M05B 3K8LA 4JHWH 3RIFK 4F80A 1DEEB 1MJUL 5DR5L 2BFVL 1JN6B 1P4LA 2HFEA 5E5MB 4XWGL 5E5UB 1YPZA 4OGAD 1BQLH 1WAAF 2AJVH 3HFMH 4JRXD 3C5ZB 5IFAH 4YXLH 4GQ9H 1YPZE 5DC4B 4AIZB 1JZ2A 5FA3B 3U4EB 4K8RC 4H0GA 2B20A 3ARZA 3EHBC 1JHTA 2SEBB 4NO2A 1ZHLA 2J3SA 5C0FB 5F9AC 1IM9A 4GLRH 3QAZB 2ADGA 3KDMB 4HT1H 3H42L 1G7PA 2VDKH 3LIZH 3ZYIA 2P48B 1DN0B 3MGTA 4Y16B 4YNYA 5SV3A 3LS4L 1EJOL 5C0GA 5FO7A 4CU6A 2DKUA 2YUWA 4PJEB 2BVTA 2BVPA 3S4SA 4OCLC 1F00I 3QO0A 4OM1H 2P7TA 1U92B 4X6BB 2ARWA 2DM2A 2X1PA 2FJGB 3RUGF 3FTGB 2Y7QB 3NZ8A 4PPTA 5D7SH 4GAJH 4KI1A 3AAZA 4PV9A 5E24E 2OBGA 1YNKL 3QH3B 3VDCA 4M43H 3HNSH 5F8QC 3TCXA 4HBQA 1P69B 2VSCA 4L8CA 4PREA 2EDXA 3I3DA 3PWPA 2FATH 4DQOL 3SPVA 5DQJA 4OIIL 4MVBC 4FHBD 2A6JB 5F9JA 1MCPH 3PWPE 4PGDB 1OTTC 2J12B 4QRSA 4WW1B 2ZUSA 4QWWC 3CZFA 5IOPB 1NC2B 1T6VN 1YMHA 3ARFD 3WNKA 4OLUL 3EOYG 2VLLB 5IROA 3OKYA 4PTTA 4UNUA 1WWWX 5HYQB 3T65A 4UV7L 4DW2L 3CFJB 3IETB 3GSWA 1I7ZB 1IKFH 1ZSDB 3EJYD 4MJ2A 5DXWA 1MJUH 1AIFB 1TNNA 2BFVH 2PNDA 5T3XD 5LAXB 2YKLL 5ABDE 3LRSB 3TVMB 4G8IB 3EYSL 3ISWA 3SDDB 3AREC 3LCYA 4QXGL 3WNMA 1I1AB 1KTLB 5EC1A 1FNLA 1OARL 5CJ8A 2WUBL 1AGFA 1CLOL 2JK5A 1WT5A 3ZKSD 1J0KA 4PYHA 4LLUA 1A21A 4JZOB 5FKAB 2KUTA 4WHYG 4PY8I 4OLYL 3GSNB 4RFOL 1QO3A 5ESAA 1C16A 3BYTA 1R5VA 5E4IA 3H42H 2XTLA 1BD2B 2OZ4A 1KPRB 4LVNC 2Y6SC 4ETQB 1R5IA 1NPUA 3LS4H 5E8PB 2XKSA 4WW2F 3U7AA 1JPFA 2KZ1B 2JIXA 3S3SA 2NY6C 4X5WA 3LV3A 2IPTL 4PBVC 2C1OA 3I75A 3RNQA 5DMGC 3IDJA 5T3XE 3SGKA 3DO3A 2FIRT 3C60B 1QFHA 4FMKA 5EU6B 1BVLB 4NUJA 4ZSOB 1YNKH 4YXHL 3HPLA 1KNOA 5HGHB 1NKOA 3HNVL 5GGRY 3V95A 5IJKC 1I4FA 1CTNA 5TE6L 2QADB 3JWOL 4DQOH 4DGVL 4OIIH 2NY2C 1F3RB 4OUUA 4BA8A 3BUTA 3GM0A 1CT8A 2Y36L 4Q6IA 4YC2C 5AEAA 4L3AA 4E0RB 4MB5A 1EAPA 2V7NA 5CBEA 1YQ2A 1VKXA 4PJFA 3BH8B 1UZ6F 5F6HJ 4WV1B 1EGJL 1W2KT 1GRWA 4OLUH 2J7LA 4RNRA 2NXYC 5DRNA 3R8BB 3CFCL 3QDJA 3G9VA 1TJIL 3QT2A 4WFHD 3EYQC 4PJFE 3U4AA 5A40E 5IGXL 5JPMA 2QSCH 5EZOL 5DUPL 2VXQL 3G5ZB 4UV7H 3QDJE 4DW2H 3O3AA 3T4YA 1CFBA 4Y4KD 1FL6A 3P77B 4ZS6C 1EVTC 3FT2A 4P23D 3OXSB 4GS7C 1C8PA 2YKLH 4M7KL 3ARBB 4UQ3B 4YZFE 4KKLC 3EYSH 4QXGH 1LEKA 5I8OL 5A2IH 1ZT1B 3LN4B 5DHVH 2WUBH 3MLZL 2DQUL 2VDOH 4WHTB 3U1SL 4H26B 1OD7A 2XY2A 5C3TA 3T4AB 5IB1A 3OJDB 2X9YA 3VXTB 3PWLA 4OLYH 4RFOH 4JG1L 1I8MB 4WFHE 4OFPA 4ZDHB 1PEZA 4E9LA 3V7AG 1K4CB 3L3IB 5FGRA 4F7CA 4YE4L 1A1NA 1UACL 1G1YA 3CGTA 3H7LA 5EOTA 1VA9A 2EE3A 2IPTH 1E28B 3CVHL 1G7LB 4UT9L 1FPTL 1YEIL 4XPTL 1BEYL 1W72B 4FQQB 4ZOAA 4MD0B 5D1QB 3MROB 5IG7B 3SE4C 3MJ8A 2IANB 4YXHH 3UTZA 2A83A 3VRLE 5IHUL 1NFDF 4OZHA 3QIUA 5H94A 2A73A 3HNVH 3SDXB 3FCTB 1ORQA 5TE6H 1UQSA 3VXMB 3JWOH 4OZHE 4XRCA 4DGVH 4NIKB 1XMWA 3VI4E 1Z6JT 4HK0B 1MFBL 3THML 3UDWA 1U3YA 3SJVA 2XXCB 4GRWE 2OYPA 5DK2B 4PIRF 1L0XA 4NQSB 5BW7A 5DJDA 1X6LA 2DLTA 2Y36H 2GSIB 3X13B 3SJVE 4HWZB 1FIGL 1A6PA 5D6CB 3UBXB 2P43B 3LOWA 1NBZA 5SX5K 2V5YA 2VLMD 3T2OA 3IXTB 1DJSA 3ES6A 1EGJH 3ZDZE 5DI8A 2WMPA 3CFCH 1TJIH 3IDIB 4GAYB 3GSXB 4KKCD 5IGXH 5EZOH 3O45B 5DUPH 2VXQH 3WUWG 5BO1L 4P4RB 2P8MA 4AEIL 2EIZB 1BVKA 4NKDB 4BH7A 1JF1B 3DV6B 3D0VB 3BH9A 4LLMB 4KRLB 1TTFA 4UTAL 3L3GA 1UM4L 1Q8MA 4M7KH 2D4DA 5HHOD 3FB7B 3D2UD 4P48A 5I8OH 1JTTA 1YEDB 4IIQA 1FFPB 1BOGA 1XGQB 3BD5A 3MLZH 5EIIB 5TPWH 2DQUH 2J1KA 3U1SH 1PX3A 3QHZH 3OXRB 1I7RB 2HRPL 1IM3B 2VQ1B 4YFEA 2VLME 3DRQA 3I6KB 4JG1H 4B7IA 3ARPA 4N0RA 4KJQD 4WDIA 3D3VB 3IAPA 1JYVA 4D0CA 2Q6WB 4WWID 3WHXA 4PBWD 2BVYA 2R2HA 4Y1AB 4LSPL 1EX0A 3MRQA 1X7QB 1NKRA 1AGCA 1KB5L 4OGAC 4QRRD 5B8CA 4RA0C 4M03A 3V79C 5GJTL 4YE4H 1UACH 1MCRA 4RGOH 4CJ1A 1FV1B 3GUTB 3WLBA 5F1NB 3IRPX 1NQBA 4WI9A 1F4WL 1FIEA 4XPTH 4HUVB 2BSSB 1BEYH 2NY5L 3V9FA 1RK0A 1J5OL 1JHLL 5J6HA 5FAAA 2UUDH 2NY1D 3SBWA 1Y0LA 5IHUH 4FZ8L 4GH7B 2FO4B 1WGOA 4OAWA 2X1QA 2XZZA 1BHGA 1S9WA 3P4OA 5JIPA 3ALPA 1I9RH 3E6HA 4IRSA 1MFBH 3CSYA 1D6VL 4U7SA 1FFNB 1J87A 3N0PB 1KB9J 4QRRA 4U6VL 1OAUL 1BZ7A 1PYWA 3TBYA 5FYJU 4QRRE 5M94B 1F6AB 2YHGA 1ORSB 1RFDL 3MYJB 3WSQL 3D0LA 1YN7B 5GS0H 4LVHB 4F3FA 4XCFL 3E6FB 4YX2H 1KT2A 4WTWA 5BO1H 4R6UA 5IHLB 3SGDI 4JN2A 1I3UA 4N9GA 3HZKB 5GGRB 5EZJA 4HGMA 3VXQB 4UTAH 3MUGB 3WL9B 1NCBL 4MHHI 1UM4H 2DQCL 2Z4QA 1FCCA 5AYUH 3DPBA 4K7PY 3NIGF 3F8UB 1WZ1L 3VGBA 1AO7D 2CLZA 1TJHL 5JHDB 1WT5C 4NKIL 5D7IF 4NC1C 5E70A 3OKLA 2UZIL 1FYTB 4A2MA 1MUJA 5EU3A 5D96B 2XWTB 4AYFA 1IILE 2PYFB 3VMNA 2IPKA 1J10A 2HRPH 4HX1B 3PJSB 2FHFA 1I8LC 2D0HA 3BPCB 3EJYC 2XZQL 2W0LA 1KIPB 4R9HA 3TZVA 3VJ6A 3AU1B 4CBPA 3MUJA 4LSPH 3MNZA 1N6QL 1KB5H 2VAJA 4Y4HD 5GJTH 1U8IA 4CADA 4NZUL 4WHDA 4DKAA 4M61A 3SGKC 2JJTC 3OAZK 3QG6B 4ISVB 5C70A 3ILQD 1AO7A 1F4WH 2YRPA 4QTIL 3ZKND 2NY5H 4CU7A 1AO7E 2DD8L 1JHLH 1ZGLA 4YXKL 1CN4A 1MHEA 3NCEB 4E5XA 3GSRB 5CFHA 1N4XL 1JGVL 2ZWLT 4I18A 5JA8B 2CH8A 4FFZL 4QRUA 4YAQB 5ETUA 1TZIB 5GGVY 2AV1A 1I7UA 4QOKB 3EW3B 3C5JB 4RAHA 4PRHD 1D6VH 5IB2B 3H0TB 3QEUA 4U6VH 4JHAH 1A6VH 1OAUH 3C6LD 4RRPG 1S78C 4Q9RL 5CJOL 2APTA 2Z8RA 4L4JA 3H7BB 3P3YA 1GC1L 2JF1A 1MCBA 2Y07L 4JFQA 3WSQH 2P46B 5CWSA 1KIQB 4XCFH 3IDNB 3QEQB 2D9CA 1EEYA 3SCMA 2BC4A 3E1F1 3QNZB 5SX4H 3MMEB 1ZGLP 3B3IA 4ZFFB 1NCBH 2DQCH 1NMCC 2C4FT 43CAB 1MEXL 1MCQA 4AQ1B 5I6XC 3I84A 1U8OB 3C6SA 1WZ1H 1HWGB 1U2CA 1TZHA 4NKIH 4X9BA 4Y4FA 3V4VL 3KHOA 2UZIH 3O4OB 2DLHA 4OCRL 4FQHB 4G8GD 1HNGA 4UZGA 3V7AE 1A4JA 3VFTB 5DRXA 1B2WL 1VERA 3SDCD 3IVKA 4WHCA 3QXWA 1AQDA 2L4OA 1CDYA 4GXVL 4JFFB 2GTZB 1N6VA 1B6DA 4Y19D 2XZQH 5DTFA 5CILL 4P23C 4KI5D 4UIMA 4XWOD 3CC5A 1N6QH 3Q48A 4HIHA 3LY6A 4E42A 2W60A 2OTWA 3MLPA 1OAZL 3T1FA 5C6WH 4NZUH 4KV5F 1KELL 3OKDB 4M7LH 4PGBB 1ZT7A 2VN7A 3VFWB 4OGZA 5KVGL 4PJXF 3RY4A 4QTIH 3L3JA 1ETZA 4BH8A 2DD8H 5B39G 2PCPA 5FF6B 2CLVB 3LZFH 4OFYD 2RHEA 3L5XL 2YBRA 3IJHB 1W72L 3QUZD 1EBPA 1N4XH 5FECB 1JGVH 4MA3B 3OKOB 3SDCA 2FX9L 3VG0L 3BO8B 4ODSL 5BS0B 4FFZH 3UDWC 4XBEL 1V7NH 3BZDA 3UTOA 4IEFB 3B9KB 1FQ9C 4NO0A 4N8VG 1UWXK 3WUWA 3ESUF 3QQ3B 1T21A 1I7TB 4KROB 4PGCA 4FQLL 3RDTD 5I66B 1KLGA 5DQDH 5F9DC 1NFDB 4XPAL 5HI5D 1OW0C 4OD1H 1BIIB 2X9WA 3BW9B 4Q9RH 1X5FA 5CJOH 2PTVA 2EC8A 4KKAD 1BQHB 1GC1H 4NQDD 4F7MB 2IBZY 2Y07H 3D85B 1T1WB 4ZODA 5DJ2B 5EZIH 4M9OA 2NLJA 3WYRA 2Z91B 2G5BA 4NQCD 2AP2A 1XGUB 1SJVA 4M6ML 2ICWA 4UNVA 5T33L 3IDMB 3BQUD 1FO0A 1YJDC 5CHNB 1MEXH 1NCNA 4IIQC 1TETH 4L9DA 3QXDA 1F4YL 4HSQA 5FXCH 5GGSA 1CDHA 4TUJB 2ITDB 3V4VH 3T3PF 2X42A 5IR1A 1T7XA 3MRFB 4OT1L 2BY2A 3BIBX 4OCRH 1S7VB 1ZE3C 5J9PB 1JZ7A 1CGVA 4KKCC 3SE9H 4NQDA 4YHZL 1B2WH 2HRLA 2FBOJ 4XP5L 5IWLA 5HYFA 1HILA 4UTBL 4NQDE 1Z0NA 1BJMA 3NVQA 3OGCA 3K8MA 4GXVH 5I1CL 1RZGB 2J5LB 1NUFA 1JYNA 5B8CC 5BVPH 5CILH 1FVDA 3SO5A 4ZUSB 4EI6A 2YD3A 1HSAB 3PIQA 1AXSA 4KTDH 3VXRB 2R2EB 3QXAB 4YGVA 2XOTA 1OAZH 2EIDA 3R0NA 5FGCE 2R8SL 2EDKA 2OL3L 4AM0B 3MRMB 5KVGH 1G6VK 4OBSA 3DX9A 4M02A 2A6DB 2V5SA 3UZQA 2WQ8A 5EIQA 3ZZ1A 3OG6B 3MGOB 2GJJA 1OP3K 4X9GA 3L5XH 1W72H 4KJQC 4HEPG 3VG0H 4ODSH 5B38A 4FABH 1TQBB 2X7LA 5EOCJ 1XF5B 3NMEA 3JV6A 5GSRB 5K93A 3F7VA 1R3LA 2EC9U 2V2XB 3WIFB 3UJIL 4P2RB 4OV6F 3ARWA 3NACL 3BIAX 4RMUA 3VFSB 2R4RL 4FQLH 5LG1A 3LDBB 4XPAH 4ZOEA 1MOEA 4IHOB 2VN4A 1P7QB 1FVCA 3CLFL 3TNMB 4DZBA 2NYYD 4NWUL 4ZO7A 2C3VA 4C56A 4P2QB 5C0AA 5KSAD 3L3KB 2IALA 1NCAL 2WP3O 2NY1C 5ENWB 4C56E 5C0AE 1IFHL 3PHOB 4M6MH 5T33H 1OSPH 4YO0B 1DBKH 1CZ8L 1WVZA 2Z35B 3QHTC 1X5XA 3D39A 1ZVYA 2WP3T 5E2JA 4QRPD 4UOW0 4XAKD 3RKPA 3G6DL 3D39E 4DTGH 4LMQE 4O2FA 1MI5A 3FQRB 4FXLA 3DIFB 4MB3A 1PZ5A 3AVEA 4OT1H 4MQTB 4NN7C 5HHMB 4IOIB 1YYLL 2W0FB 4RIRB 4J7RA 1MI5E 4L9LA 2A6IB 1RD6A 3TP4A 4LCCA 3WLWD 1V3MA 1F5WA 1OTSD 4YHZH 1OLZA 1J11A 3CFIC 1OWRM 4XP5H 3H3KA 4P57A 4JGUA 3TZVC 4UTBH 3HZMB 5D7IB 4UMGA 5K9JH 2HT2D 2Q7YA 2YZ8A 5EFIB 2KQNA 3DSNA 1X5GA 1K2DA 3VRJB 3ARVA 2R8SH 2JB6A 5CGTA 3SGJA 4NQXA 2OL3H 2AXGB 1I1YB 1A7QL 1H15B 1KPUA 2Y4SA 3MNWA 5IKCB 3WIIL 3I6LD 1EO8L 3X14B 3PL6B 3N9GL 3BMVA 3NFNB 1CFSA 5HHXL 3TH2T 3M1BA 1H8OA 1ZT4A 2BSTB 4Z7WA 4R97C 5KVMC 5B4MD 2GITA 3BP4B 3WNNA 4Z7WE 4NDMB 3TA3B 5IESL 5H35B 5JXAL 5JUEL 5I8KL 1AHWB 5FYKD 3SHSA 4NNXA 3O3BB 1ZHNA 1ZHKA 1ZLWK 4Y4HC 3UJIH 1GH7A 3NACH 4GRLA 3UX9B 5HDBF 3HA0A 3ILQC 5FDYA 3V7MA 2I9LA 3CLFH 4NWUH 3MV11 4RISL 4XP4L 3ZKNC 1CVRA 2LU4A 1Q9OA 4XMLL 2BY1A 5HDQL 1NCAH 4HKZA 5C0ND 4D94A 1P5UA 5I1GH 5C9JA 5F1IB 4DCQA 4NO5A 1CBVL 1XF4B 4MCYA 4Y8AA 1D5XB 1CZ8H 5EU7E 2X4TA 3I02B 1IL1A 5F89A 4LVOB 4U1IB 1TQCB 5C6PB 1T2XA 1KCSL 3A67L 4Y4FC 2DAVA 4PG9A 3JXAA 2CGRL 4RFNB 1U95B 3I6GA 2F53E 1R5WA 3ARGB 5KG9A 1YYLH 2VDLH 5HY9A 5DMIL 2HJFB 3REVA 1K8DB 2IAMB 4UNTA 2R56L 1QP1A 5KANI 5AG8A 1P2CA 1WQVT 1YEHL 1VADA 3RVTD 2CDGB 2R1WA 2XKNA 2GTWA 2FJHA 5LJYH 5B39A 2AEIT 4FMFA 4QGYA 4OBRA 1JWUA 4WI3A 1VEMA 4Z0BL 4XC3L 4YEFA 2HTLD 2NY3D 5F88B 1G7MB 3VG9B 3ULSA 2QQNH 3WFCL 2YD4A 3KS0J 3MRHA 3WIIH 3BESR 1EO8H 3W2DL 3N9GH 5HHXH 1CF8H 5T3ZD 5D1XB 3S36L 5D5MB 3QUYD 3SDCC 5D2NA 3QNXB 5E00A 3RWDA 4P5TA 4NC0B 5ID0B 4HHAB 3UTQB 3PDOA 2OMBA 4JY6A 3W39A 4LCWB 5KSBF 5D2NE 3P9WB 4WWKB 5IESH 1D5MB 2JELH 4KI5C 5I8KH 3C2SA 1H5BC 3GEWB 3WO4B 1DVFD 2ITCB 3K81A 3ZSSA 5HHNB 4F9LA 4XPHL 1SYSA 3E8UL 4BFIB 1OM3L 3GMOA 4D3CL 4P46D 4XZUA 1NEZB 4C4KT 4U1JB 3ESVF 5EBLA 1LP9B 3GBLA 4RISH 1AGBA 5IM7B 4XP4H 4WUUD 3C8DA 1YUHB 4WO4A 4XMLH 4ZS7L 3ROOB 3V6ZB 5HDQH 1JI1A 3MV9D 3QUZC 3QUYA 1MCSA 4ZMAT 4L8SA 4OLZL 5E1AB 1CBVH 2D31A 5TDPA 4LLVB 4NRYA 3VGAC 4NKOB 3W9EA 4LOUD 5FDWA 2OR9L 1DVFA 3GKZA 4NHUB 3MOBH 1KCSH 3CCHB 1T0PB 2CGRH 1LVEA 5HVHB 5HI5C 1OP9A 4J12A 5I17B 2CQVA 4KKAC 3TPUB 1QPXA 4FQXB 1G9NC 5IWLC 5DMIH 4MD4A 4WUUA 2FL5A 4M6OL 1EGJA 3U9PL 1JI2A 5EOCH 2R56H 4M8QB 2E5EA 3MV9A 5DFTA 3KR3L 1YEHH 4WUUE 4F2MA 3BQUC 5EU4A 3OHXA 4K3DH 3MV9E 1GGCL 3LEXA 1T1ZA 3VFOA 2PR4L 2NCMA 3JV5A 4Z0BH 1J12A 4QCIB 5TFSL 4MA8L 5F7UA 2DL2A 5C2BL 2Y1VA 3FFDA 2KKQA 1I8KB 2G9HB 3WFCH 4I2XB 5J1TC 3T3ME 2E9JA 3W2DH 2DN7A 2AK4B 2UVFA 1CFTB 4K7PL 3TBTA 3S36H 5JOFB 3MV7B 1T04B 3HNTL 1MWAH 5SWSB 4H25B 4G6KL 4KDWA 3IAGC 2EYSA 2VLJD 3UTSD 4G5ZL 4MZ3A 2PXYB 1IQDB 4GMTL 1OSZA 3MFGB 3VWJB 5E8OA 4X8JB 3ZE2F 5FA4B 4XPHH 3L5JA 3QEHB 1QPPA 3E8UH 3ZMRA 4YJZL 1OM3H 3OB0K 4X83A 4D3CH 4HQQL 2DJUA 2XN9A 3L1OL 1TVHB 1BP3B 1U8PB 4LLQA 2FECI 4BQ6A 2XN9E 3BPOB 3MRBA 4ZAKB 4ZS7H 3CVHA 4B5EA 3TO4D 4X9IA 5KN5A 2OK0L 2AVGA 5GS0D 1RJZA 4OTXL 1A8JH 3EJZD 3O6KL 1T66D 5TDOA 3TH3T 1QSEA 2YC1A 3BISA 2E9BA 3UTSA 3PGFL 3WN5C 2XTJE 4DGYL 5HVFB 5I1DA 3BP6B 4HJJL 1QSEE 2CUMA 4ONOA 3CH8A 2OR9H 3UTSE 3QQNA 5DDHB 3UO1H 1BX2A 1UXWA 4JY5H 4HS8L 5GGVL 2VITA 2NYYC 1C08B 4L9LC 1IGTA 2NMSA 4I13B 4Z5RB 5KSAC 2EDQA 5IB5A 5C08D 1GXEA 1J0IA 3LKSA 2QV2A 4M6OH 4PJHF 3VFVA 1CD0A 3PWJB 3CZJA 3TO4A 5EA0L 3U9PH 5DC9B 5HYJD 3KR3H 4P5MA 4JFOB 3WKMH 1U8NB 1N0XL 2YD9A 2AKRB 1GGCH 3BZFB 1IEHA 5JQ6L 1WBXB 1TXKA 2PR4H 4NQEB 4O2EA 4Z77B 4GFTB 1MHHB 3OJVC 1EK3A 4LSQH 5DVMA 5TFSH 4MA8H 3B9DA 5C2BH 1M05A 5F7LB 2AQ2A 2NNAB 4FFVD 1TCRA 4RZCB 3UBXG 5I1KL 1JN6A 3LD8B 5E5MA 4AMKL 4YDVB 4K7PH 1X9QA 3FOMB 3WLWC 3LKOB 1OTSC 1AR2A 1HHGB 3RRQA 3HNTH 1PG7W 3C5ZA 5DJCB 2FHBA 4G6KH 1XF3B 2LTQB 3CJJA 4AIZA 2GJ6B 1ZLSL 4AH2B 5FA3A 4JFEB 3U4EA 5C9KA 5DJ6A 4G5ZH 2HT2C 1XCQB 4GMTH 3DX8B 2SEBA 4HIEB 2BVQA 5C0FA 1JF6A 2E3VA 4Z7VF 1RUKL 4ORGB 4PLKD 4U1MB 2DMKA 3DMMB 3KDMA 5BOZG 4HQQH 2BNQB 5LGKA 2YUZA 2KDGA 3L1OH 5KS9A 3EO9H 4LRNL 4PJAF 3ULUF 2PW1B 2Z92B 1HQRB 1DN0A 4Y16A 5KS9E 1NGZB 5HYSB 3IFNL 2R15A 4PJEA 2OK0H 4RGND 5B4MC 5A1AA 3QG7H 1KIRB 1U92A 4OTXH 4X6BA 4PJEE 4TOYL 3O6KH 2FJGA 2Y7QA 3QIBD 3PGFH 4K71C 3BKML 1L7TL 3V6FB 3QH3A 2NY0D 4ZD3L 4HJJH 3VFRB 3KS0H 1S5IL 1DQDL 4M3JA 4QT5B 4NSKA 4HS8H 4TQEL 5DF0A 3S97C 5HPOA 2WIMA 3LSOB 3GI9H 3AMLA 3GMNB 3HS0B 2A6JA 3PWUA 4PGDA 4JZJB 5KSUB 1I1AD 4Q9CA 2P4AB 5C0NC 1ZLUH 2F9BT 2NZ9D 3LKNB 4F33B 1D5ZB 4WW1A 5EA0H 5IOPA 1NC2A 2H45A 4JN1L 5CIPB 3DXAD 4RFEB 2VLLA 1N0XH 5E56A 5ICXB 2F5AL 5HYQA 1NBVL 4JM2F 5TF1H 5K9QG 1HINL 3CFJA 3EDJA 3IETA 3QP3A 2CIIB 1I7ZA 4U2YA 1ZSDA 3DX6B 3ULVL 4RWYL 4X7FC 5H37H 5B21A 4RWHA 5JOPE 3MA9L 5C07B 4LNRA 1AIFA 5I1KH 2IG2H 4U6YB 5LAXA 5IHZA 4AMKH 3LRSA 4G8IA 5JW4Q 4P5TC 2PYED 3SDDA 1I1AA 2AK1L 1HZHL 1J8KA 4S1SH 3TESA 1G0XA 1ZLSH 3RVTC 5EU6D 1P84K 5FKAA 4JZOA 4QRTB 5J3HD 5M95B 1JYXA 3MZTA 1U8JB 1QD0A 4J3XA 2ZUVA 2HTLC 2X4SB 1MCJA 4X7CC 1MVUB 1OGTA 4IS6B 2QHRL 4N90D 1BD2A 2CR6A 3MYZA 3ZKQD 4ETQA 5E8PA 1FORL 1BD2E 4IMLB 3QUYC 3CFDB 4PRDB 4L8SC 1F97A 3S5LG 4MAUL 3GHBH 3HUJB 4TOYH 3C60A 1YPZF 5EU6A 5E5RB 1BVLA 1DVFC 3BKMH 1L7TH 3JWOC 4ZD3H 5HGHA 1UCBL 5EU6E 2YN3A 4WVRA 1S5IH 1DQDH 4P46C 5ESQB 8FABB 4TQEH 2DYPD 1DCLA 1PAMA 3TC9A 5CD3B 4Z7OE 5DO2D 3MRPB 4G8FB 1D9KB 3LRHA 3Q1SL 4KDVA 4E0RA 1W0WB 4KHTL 3BH8A 1JGLL 4WV1A 2VWEE 1QHPA 2WK2A 3T8XA 3CSBA 5E6IB 3TM6A 4Z8FL 2F5AH 4YBLC 2GYSA 1NBVH 4GKNB 3BP5B 1HQ4B 1HINH 1PBYA 5HDOA 4OF5A 3EYOB 4RWYH 1ES0B 3P77A 3MA9H 3OXSA 1CE6B 4LARH 3ARBA 1J0YA 1SVZA 4UQ3A 5I73C 3QI9D 3D48R 2CJUL 4G6JL 2AK1H 1KJ3H 1HZHH 2GFBB 4K2UL 5TF0A 5A3ID 1RZJL 3LN4A 5DVNA 1HHKB 4P2YA 4WHTA 2PO6D 4QRQB 5D1QD 4H26A 1UC6A 2IAND 3FFCD 5J13B 1EDQA 1CL7I 3OWEA 3T4AA 3VA2C 3BXNB 3VXTA 4YDJB 4P4KB 1CICB 1HKFA 1I8MA 1CLYL 1OGAB 3IKKA 3O2WL 3VXMD 4TNWF 1WFNA 2QHRH 5CEZL 4ZDHA 1FVEB 4MB4A 3HB3D 1K4CA 5TE4L 1FBIL 3L3IA 2CO7B 2WBWB 1FORH 3FKUS 3MTRA 4WI6A 1N64L 4X6FB 2G60L 1BECA 4URTB 4CKVX 1UJTA 4MAUH 1E28A 4OFIA 3FO1B 1JHKH 1G7LA 1S7XB 4YHYC 1W72A 2KL6A 4MD0A 5D1QA 5IG7A 1MCDA 2IANA 4IJ3C 3MCLH 1UCBH 4JRYB 4JJHA 3SDXA 2IANE 1B0RA 3FCTA 4JZNB 3S34L 3VXMA 3MR9B 1PLGL 3SDXE 4HK0A 3K2MC 3BJ91 3VDAA 3TPKA 4NQSA 5IBTH 3VXME 4Q74A 3TO4C 4FXKA 3MLYL 4KDTC 1XGRB 5DS8B 5GS0C 2GSIA 3X13A 2EO1A 3Q1SH 4HWZA 2A77L 3UBXA 4KHTH 5D6CA 3U0TB 5FFLA 3EJZC 1IC7L 3IXTA 4NM4L 1JGLH 1RZ7H 2VZTA 3VXSB 4Y2DD 3V0WL 4LSVL 4S1DD 4TTGA 2HLAB 4HPOH 1TDQA 3IDIA 4GAYA 3GSXA 1J8HD 3FQTB 1WIOA 4Z8FH 3BN9D 3O45A 2E27L 4CVZB 3HMXL 4P4RA 4PJHB 4UUJB 2EIZA 4JY4A 4G6AD 2R0KH 2FYYB 4NKDA 4Y1AD 3DV6A 4NO3B 3D0VA 4KQ3L 4LLMA 4CVXB 1C1EL 4QHKI 1BQHG 3KHQA 3KNBB 1B3JA 1B6UA 4G6JH 3FB7A 3B43A 3ZE0F 1YEDA 4K2UH 1RZJH 1FFPA 1XGQA 2D03L 1JV5B 5EO1B 2A6KB 1PG7L 3W0WB 3C9NA 1I7RA 4BQ9A 1JVKA 4POZD 1IM3A 2VQ1A 4JKLA 3I6KA 1CLYH 1WAAA 3N1FC 2C4FU 3GKWH 3MREB 4PJFF 3O2WH 3D3VA 4QXUH 4FFVC 5KZCB 4Y16C 5CEZH 4HMEA 1WAAE 5FCUL 3MCKB 5GHWL 4OD2B 1B90A 4Y1AA 5TE4H 1FBIH 3D3VE 2OL3A 2O5XL 4WI2A 3UC0L 1X7QA 4C57C 3FRUB 2N7AA 1EBAA 1RSFA 1N64H 4JKMA 2G60H 4Y1AE 5D7LB 1FV1A 3GUTA 5HGGS 3IFOB 4ONGL 4QYOB 5F1NA 4Q0XL 5B3JF 1MFCL 2Z31B 4HUVA 1HH9B 1VPOL 2BSSA 1EHLL 5L2KD 1I8IB 2OXHA 5BV7H 4IOSD 1WIPA 2G75B 5CEYB 3RBGA 4PLKC 4BM7A 5CP3H 1G9MC 4N0CD 2VDNL 1NGQL 1GZQB 3MRNB 2FO4A 3S34H 2VLRD 1FH5L 1NGXA 4LNVA 3DI3B 3STZB 1P7HL 5D1ZD 5SWZB 4Z6AT 3O6FB 1JRHL 4XNMB 1FFNA 5IW6B 3MLYH 1SYVB 4KHXL 1M71B 4OCMC 1FYTD 4PJ7F 2A77H 3S37L 4HXBH 3VD9A 1F6AA 4YPGB 1IC7H 1ORSA 1XR9B 2X1XR 3MYJA 3QIBC 3DJ9A 4NM4H 5F7HA 1MH5B 3V0WH 1LEGB 4HUWB 1YN7A 4LSVH 1WWBX 2NY0C 4DWHA 3OKKB 3E6FA 3GJFB 1NCDL 4POUB 3LQAL 2E27H 3NGBC 3HMXH 5HVGB 4K94C 1E4XH 1VDGA 3KPOB 1CGXA 3UROR 3UTTD 3VRLF 5FCSH 3HZKA 5GGRA 3WXWL 4KQ3H 4ELKB 3VXQA 3WL9A 1C1EH 1JTPA 1I1AC 4G6FB 1ZS8B 1HH6B 2F19L 1L0QA 1LO5B 3MBEB 3WEXA 5JHDA 3P0VL 2I26N 2D03H 1FYTA 2XWTA 5JHDE 3Q0HA 2E7CA 5C6TL 2PYFA 1FYTE 1X4YA 4MDIA 3S5LA 4HX1A 2E8ZA 3PJSA 3MLTB 4WCYL 1T22B 2YWZA 3BPCA 2V7HB 4QOKD 5GHWH 3AU1A 5FCUH 4PJ9B 4WEBL 3UC0H 2O5XH 1A6UH 3RGVD 2OR7A 3AB0B 1MREL 1S7UB 2GT9B 3IYLW 3QG6A 3I9GL 1V3KA 4ONGH 4XNZC 4JFDB 1SJHB 4J4PD 4Q0XH 5DHYB 2DOCA 3DYOA 4R90L 1MFCH 1VPOH 5J3HC 1EHLH 1KTDB 4PRIB 3VMPA 3BGMB 1X3DA 2Q1EA 4UV4L 3KGRA 2JLLA 3GSRA 2FGWL 3JBG7 4WW2A 5H37G 3P0GB 4WU5A 4YAQA 3UMTA 1ZVSA 5FYLL 1TZIA 4KJYB 4PJBB 2DQEL 1T5XB 1FH5H 3JUYA 5AAMA 4QOKA 5HDLA 5I19L 2QSVA 3C5JA 2VWEC 1JRHH 3GGWA 4J3UA 1JPGB 3H0TA 4DKDC 5IB2A 4QOKE 4KHXH 4R3SB 3LB6D 2FNBA 3H3PL 3S37H 1PKQB 1JTOA 2VRAA 1BJ8A 1LDSA 3EYUH 1KIQA 4AZ8A 5CIPH 5ISZB 3IDNA 3QEQA 4TSBL 1NCDH 3RY5A 1R24A 2ADJB 5C0DB 3IAQA 3QNZA 3QEQE 3MMEA 1LE5B 3B2VL 1BWWA 4P3CH 3WXWH 5BXFB 5DO2C 1WCQA 4ZFFA 2IADB 2BK8A 5I0DA 2YMXL 43CAA 4IRJB 3O9WB 1U8OA 1MFDL 1UZ6E 3HAEB 1EO5A 5GS1A 2J6EL 3EO0B 3P0VH 4HUNB 5GIRA 4R96B 1JFQL 2EE2A 3DSFL 3GMQB 5C6TH 5D7JD 1GOFA 3VFTA 3ZHDA 3OF6A 2YXFA 4JFFA 4I5BB 2GTZA 3CXHK 4HKXB 1AFVL 5JIKA 4Q97A 2CK0L 4JFFE 3F7YA 4KROD 3RPKA 3QI9C 1N8ZB 3GMLB 1IEBB 5E2UL 1MREH 4HD9A 3OKDA 2GSGA 5IFJB 5A3IC 1CYGA 3BVNB 4PGBA 3RWIA 3I9GH 3VFWA 1FNSL 2PO6C 5D1QC 2E7LA 1T2QL 1T6WA 1E4KA 4K3GA 2CLVA 4UV4H 4R26L 2ERJC 1X5KA 2H2SD 5HSFA 1KPVB 3IJHA 4I8DA 2FGWH 2K7QA 5FECA 4MA3A 2EDRA 3OKOA 3BO8A 5BS0A 5LGJB 1EFXB 3CNKA 5D71H 5FYLH 1P6AB 4GG6B 3HB3C 3B9KA 2FEEL 5BS0E 4OF3A 1UEMA 4U1GC 5I19H 1EZVY 1I7TA 5I66A 1QSVA 3CLEL 2YZ1A 4HH9B 1NFDA 5FHBL 1KEML 3H3PH 1BIIA 2Q76A 2VO5A 3MBXH 3BW9A 3W81A 2QQLL 1BQHA 1NFDE 4F7MA 2HJKB 3D85A 2NY4B 1T1WA 1KCLA 5DJ2A 5J06A 4DKFL 3RJQB 3U0WH 1UM5L 4TSBH 4GBXB 2Z91A 35C8L 1YECL 1J9CT 1XGUA 2DIAA 3IDMA 1MCLA 1OPGL 1NEZG 4FQPA 3CXDL 1UH3A 3B2VH 3RIAF 2Y9RT 5CHNA 2YMXH 4GAGL 1MFDH 1NMAL 4LPXA 4TUJA 2ITDA 5EB9A 1T03H 2J6EH 4TNVF 3MRFA 4Y2DC 1JFQH 1S7VA 5EC2B 4S1DC 5J9PA 4CMMB 3DSFH 2D7PA 3BN9C 2F54D 4LHUB 4Y88A 4LAJH 4G6AC 3PHQB 2XYCA 1AFVH 2XI9A 3QBTB 4ZUSA 2CK0H 2QTEA 1JGEB 3DI2B 1T83C 1HSAA 3VXRA 1QYGL 2R2EA 3QXAA 3S35L 3ZSTA 4UQ2A 1RK1B 5E2UH 1B4JL 4JFYB 3VXRE 5FOBB 3NAAL 4AM0A 3MRMA 1N5AB 1KYOJ 5I9QB 4Z95L 1T2QH 2A6DA 5E2TL 3BZEA 3MGOA 4LLWB 1E0OB 5JIHA 4POZC 4R26H 1MHPL 5C0CD 2V9QA 3ULUL 4HXAL 1GPOL 1MJ7L 4ONFL 3G6AB 3X12B 3BP7B 1XF5A 4QXTB 1PKOA 1F2QA 1G6RB 5GSRA 2V2XA 4KK6D 3BT2L 3WIFA 4P2RA 5T1KB 2KZWA 3VFSA 2GI7A 3CLEH 1ODAA 1AC0A 4NBZB 5FHBH 2EXWD 1KEMH 3FHAA 4IHOA 4P2RE 5DURB 1P7QA 5DWUL 5HHMD 4A6YB 3EYFB 4PJ8D 3TNMA 2C4XA 2OMNA 2YPLB 1KULA 1KBGL 5DC0A 2QQLH 4P2QA 2R1YB 4LPCA 6FABH 3C08L 3L3KA 3CX5J 2MCPL 3TH4T 1FFQA 4FQIL 5ENWA 4D9LL 4DKFH 5FGBC 1UM5H 4P2QE 2B5IB 4I9WD 3PHOA 4N0CC 3BI9X 1AXTL 1A0QL 4YO0A 1OPGH 4PJ7B 2Z35A 3CXDH 5D1ZC 1WZLA 5IMOB 7FABL 3HRPA 3QA3A 4XNUL 4GAGH 1NMAH 1S3KL 3QDGB 3H9YA 5D96C 3FQRA 4HIIB 3DIFA 2XG5A 3G5XB 4XCYB 4IOIA 2W0FA 4RIRA 3KPRD 2A6IA 2AJ3B 3H9SD 2VOTA 2K9UA 5HHME 1YEFL 1IE5A 3TA3D 4U3HA 3HZMA 3RTQB 3VFMB 3ETBF 1EIBA 3FB8B 5D7IA 1GGUA 5EFIA 3EIFA 3NIGE 1L9MA 4I9WE 1OL0A 3QHFL 1BFTA 2XZAL 5D7IE 1G7JB 3S35H 2X05A 2YK1L 4GQPH 4W68A 1B4JH 2AXGA 1I1YA 4J8RB 1H15A 3NAAH 4JANB 5IKCA 2E6PA 3X14A 1FN4B 4Z95H 3U79A 5E2TH 3NFNA 4YDLC 4JDVB 5DT1L 2Q3AA 1WBZB 3BPNB 4WW2C 2BSTA 5J11B 1MHPH 1UM6L 1A2YB 3SE3C 3BP4A 3ULUH 1GPOH 5D70L 4G80B 1MJ7H 4ONFH 3TA3A 5CBAB 5H35A 3STLB 1AHWA 3O3BA 3QWRA 1F45A 4DVRL 4X98B 1JZ5A 3BT2H 2BX5A 1M7IB 1HCFX 1HI6B 4CN4A 4WGWB 3SGDH 2L7JA 5DA4A 4LPUA 4J4PC 5DWUH 5IK3B 1T1YB 3MRIB 1II4E 1F3DJ 4X99B 5IVZB 1KBGH 2APWA 5GGTL 5DZLA 3C08H 2FIKB 1I9JH 3EKCA 4MQSB 2MCPH 2X4UB 3FAXA 4FQIH 3WFZA 4D9LH 3GFUA 2VZVA 2ICCA 5F1IA 5HYIA 1AXTH 1A0QH 4KTEH 3W11C 1XF4A 3GJFH 1D5XA 2ARJB 3NCJL 3I02A 5BRZD 4FNLL 1FG2B 7FABH 1YC8A 2EDTA 5GS1C 4XP6L 4XNUH 5C09B 4NN5C 4OGXL 3LB6C 1S3KH 4ODTL 1U95A 5KSVB 3KYKL 5D1XD 5GQBA 3WDJA 2AXJA 3MLXL 3F5WB 3D18A 2HJFA 1RUAL 4MJIB 1K8DA 2IAMA 4LCWD 1YEFH 3IT8D 1HHJB 1MCIA 1AP2B 4NRZB 1DDHB 2XRAL 2CDGA 1SJEB 4UBDD 1QSFB 1J1PL 3KLAB 4H8WH 1U3HB 4S0TD 3R8QA 3QHFH 2XZAH 3HE7B 4UAOC 1ED3B 3OB8A 3RY6C 2YK1H 1G7MA 4KC3B 5HHQB 4JB9L 3ULVE 3HLAB 3JZ7A 2DQGL 5GRUH 3HR5A 1F2XK 4MJ4A 4PRPB 43C9B 3M17B 5D1XA 5D7JC 3KPSB 5EBGA 5A43C 5D5MA 3QNXA 1HDMA 2BNRB 4BYHA 4HHAA 4XH2B 3UTQA 1B9ZA 1UM6H 2VL5A 5D5ME 5D70H 4LCWA 5E8EB 4WWKA 4X5LA 1D5MA 4KV5E 4LCWE 4KROC 5HHNA 4YUEL 4DVRH 1G7QA 5ILTL 3MXWH 4BFIA 1IGMH 3PP3H 3S98A 1NEZA 3PXJA 1T5WB 3LHPL 4U1JA 1LP9A 3WV0A 4F9PA 5GGTH 4YDKL 5IM7A 5E2VL 1YUHA 4FN0A 1Y6MR 3V6ZA 3QZWB 1LP9E 1A14H 2H2SC 4UT7L 3KPMB 2CUIA 1LMKA 3BHBB 3BD3A 1BBJB 4HMCA 3EOAB 5E1AA 3DYMA 4LLVA 3T0ED 3NCJH 4NKOA 5BZWB 4FNLH 2OZ4L 4G42B 2XA8H 2XA3A 4B53A 4NHUA 4XP6H 3CCHA 3QEGL 4OGXH 2HYMA 2QBWA 1FP5A 5DZOA 4CL7A 4U33A 4ODTH 5I17A 3GNML 4KPHL 1A9BB 4YQXL 3TPUA 1MRCL 1X5ZA 3MACL 2GK0B 3MLXH 4FQXA 5SWSD 1GOHA 1WFTA 3GBNL 3MV8B 2CDEA 2J5LC 4M8QA 2PXYD 3LKRB 5GGQL 2XRAH 4UU9B 5E8NB 2AQ1A 3QNYB 4MXQD 1NBYB 1J1PH 2IH3B 4QLRA 4M93B 3WJLA 4AG4L 1JF5A 4QCIA 1U0QA 3QIWB 1XIWB 4JB9H 4L4VD 1JPST 1XCTB 1I8KA 2G9HA 5I1JL 4RMWA 2AJUL 4FTVB 2AK4A 4OCWL 2N7BA 1CFTA 3ZTJH 5JOFA 3MV7A 1T04A 2VABB 5FYJL 4F8TA 5SWSA 4H25A 2AK4E 3V0VB 3BX7C 2IQ9L 5FV2A 3MV7E 1T80A 2XT1B 4TUKL 5FYKU 5SWSE 5JQHC 2PXYA 4YFLF 3SOBL 3VWJA 1EUUA 5LQBL 1U8QB 2ZG1A 4X8JA 5IT2L 5FA4A 2R0WL 1UWEL 3K1KC 4M7ZB 3QEHA 5ILTH 3BMWA 4K23L 5CEZE 3VD4A 3IB4A 3LHPH 3PE9A 1TVHA 4S1RL 1U8PA 1A1MB 1MHCB 2K7PA 4LIQL 5E2VH 4ZAKA 2WAHA 4A6YL 1J05B 3O6LL 5EO0B 3BGFB 5T1DH 4XHJD 4UT7H 1U8LA 1R3IL 4OF0A 4U31A 5ESVB 3OKEB 4AL8L 1T1XB 3ZT7A 5CP3A 4WY7L 2OLDA 3BP6A 2MKLC 4EN3D 4RGMB 2OZ4H 1A6ZB 5DDHA 3RBSA 5C0RL 3QEGH 4GKSB 4XPFL 4PJ8C 1FNEB 1TJGH 1C08A 2X4QA 3E2HC 4KPHH 4YQXH 4BJLA 4OLWL 4Z5RA 1LK3L 1MRCH 3FRPG 3MACH 4NNYB 1AD0A 2XPGB 2YA2A 4J1UB 1EA9C 2HVJB 3MSPA 2CUHA 2WBJD 3GBNH 3PWJA 3TWCL 2P5WD 3UJTH 4XT1C 2EKSA 4NZTL 5C86A 5EN2A 4JFOA 2NTFB 3TIEB 4M62L 1U8NA 2C26A 2JKXA 3HMXA 2AKRA 3BZFA 1WBXA 1ADQL 3KXFD 4HFWB 4ESKA 4NQEA 5HVWA 1AQKL 4Z77A 3GSQB 1F3DH 2BNQD 2R1XA 1MHHA 4AG4H 3HC4L 4NQEE 2VR5A 2NNAA 4R0LB 1R0AH 5T1LD 3UTPD 1CVSC 4EIGB 4MSWB 5I1JH 2AJUH 5TE7L 5MP6H 4OCWH 3WBDA 4YDVA 4PYGA 3TT1L 1K6QL 1RVFL 3FOMA 2C1PB 3LKOA 3DGCR 1HHGA 2H6PB 4C58B 5FYJH 1KV3A 4IOFD 5DJCA 3PF2A 1XF3A 5HBBA 3TA3C 2IQ9H 2GJ6A 4AH2A 1UB5A 5BVJB 4JFEA 2XKUA 3B9VA 4MXWL 4TUKH 1U8KB 1XCQA 4UOJA 5LQBH 2GJ6E 3DX8A 4P9ML 2ESVB 4HIEA 4JFEE 4PRBB 1NFKA 1NC4D 5IT2H 2R0WH 1UWEH 4ORGA 4U1MA 3FQUB 3SEPA 2LAGB 3DMMA 4K23H 2BNQA 5GJSH 2IQAA 3NN8B 4S1RH 2APFA 5DEFB 3OKMB 2Z92A 4RBPK 1HQRA 4W81A 5EZLB 1UXSB 4TVPL 2BNQE 3ZDYF 5FM5O 1NGZA 5HYSA 4A6YH 3O6LH 4HIJB 3G04B 3UTPE 4N5UA 1R3IH 1KIRA 2EH8L 3FO0L 5L0QB 1E4JA 3DUSB 2V9RA 1KXQE 3Q5TA 3T08A 5DFWH 1CLZH 4JPIB 4AL8H 1ZA3B 3BD4A 2YPKB 5CCKL 4WY7H 3V6FA 2LV4A 5F7EL 3X11A 4HUUB 4NJ9L 1YN6B 2ZUWA 3VFRA 3HR6A 1NC4A 4XXCA 3L5WB 5C0RH 3CSGA 4Q9QH 4QT5A 1EHAA 1HYRC 3QJHB 1DLHB 3GMNA 3HS0A 4J3OC 4OLWH 1GIGL 4Y5VB 1JWSB 4ZO8A 5KSUA 3HZVB 4HIXL 1NUNB 4GLRI 1U2HA 1B88A 3HRZA 4F33A 3LKNA 1D5ZA 3TWCH 1EEUA 2IC2A 4FFWD 4NZTH 2MPAL 2NX5B 5CIPA 4RFEA 5JR1L 3KYOB 4NT6B 4M62H 1BM3L 1J0JA 4MAYD 3DLQR 4FQCL 5ICXA 3IDYB 3VG9C 1AQKH 3NFSL 4U7MA 1IKNA 1WEJL 2H2PD 2R29L 2CIIA 5E7FA 3HC4H 3DX6A 4LSRL 5C07A 5D1XC 5TE7H 3QO1A 4U6YA 1KN2L 1MF2L 3N1PC 3TT1H 1K6QH 1RVFH 5C07E 1A5FL 1UG9A 5AZEL 4LMQI 5IQ9B 5TDNB 5EDXA 4L5FL 4L4TB 4MXWH 3PQYB 4UBDC 5DFVD 5A16B 2X1WL 1T0NB 2BERA 5F71A 1CE1L 4OKVB 3ARUA 3FT3B 4P9MH 4YK4B 1U8JA 4C83A 3OR6B 2X4SA 12E8H 3VD7A 1IAOB 1MVUA 2IH1B 3WNPA 2ENSA 5CZKA 4TSCL 4F9PC 4WRLA 2X89A 1DFBL 1WWCA 5KSBA 1U93A 2X4RB 4TVPH 1KUMA 3MCG1 5KVDH 3CFDA 5KSBE 1INQB 1Y18B 4PRDA 3IS0X 3FO0H 3HUJA 3L3HB 2DLEA 3UAJD 4ZG1A 1FLRL 2EYTB 4KVCH 5CCKH 3HUJE 5F7EH 1EEZB 4NJ9H 1B0GB 1QFUL 1FZKB 3VFUB 5HVHC 5EU5B 3Q3GB 5ESQA 8FABA 4MQXD 5FYLE 5KBNC 5CD3A 5I1EL 1A3LL 1GIGH 1SBBA 3IDUA 3MRPA 4G8FA 2QSQA 1D9KA 4S1QL 3VU2A 1VEOA 3H9ZA 3SKJH 1E6OL 3ZYZA 1W0WA 2X70B 2DQDL 2MPAH 5J1AB 5JR1H 4R2GB 1BM3H 4B7LA 3T0EC 1I3RB 4K7FB 4WJ5B 5GISH 4FQCH 5E6IA 2CPCA 2H1PL 3C5SB 3WXVL 3AY4A 1RV6X 4KKBD 4GKNA 3NFSH 3BP5A 1HQ4A 1TVBA 1V3JA 4TVSa 2R29H 1H0DB 4KRPB 1RJYB 2FX8L 3EYOA 5SWQB 1ES0A 4LSRH 2HH0L 1RZJC 2MQ0A 4D8PB 4N0UB 1CE6A 1KN2H 1MF2H 5DJYB 2J6EA 3VGGA 4KWUA 1AXIB 2HFGL 3VMOA 2GFBA 3LQZB 2YD1A 2PXYC 1MAJA 2CDFB 4GUPB 5HHPB 1HHKA 3VWJC 4XHQA 4L5FH 5A2LH 4MXQC 4QRQA 2J8OA 1C5DB 1CE1H 3BXNA 1NCWL 1T4KB 5T5FH 4M1GH 1UKQA 4P4KA 1CICA 4XNQB 1OGAA 2DWEB 4ELMB 5GS3A 4TSCH 4JG0L 3MPCA 2BOCB 1OGAE 1EMTL 1NH6A 1DFBH 1FVEA 1PD6A 2CRYA 2I25N 4ZAKC 4JREB 1S7TB 2OTUB 4O51B 1PJ9A 3HI5L 2VMFA 3RI5F 1FGNL 2ZUXA 4XBPA 4X6FA 3D5OF 5BV7C 3TBVB 2EDFA 1WSST 3FO1A 3ZE2E 4G43B 1S7XA 3LPWA 3FRPA 3Q2CA 1FLRH 1QFUH 3TV3L 1SY6L 2Y5TA 4CU8A 4JZNA 4LVNB 1MJ8L 3MR9A 3ZTJG 2NXZD 4OLVH 3T77B 4OCNC 1A3LH 3DOSA 3NPZB 3OKNB 4WFFD 4XHJC 4ERSL 4S1QH 1XGRA 1E6OH 1EUTA 3HN3A 2IF7A 3U0TA 3QDHA 2IPUG 3ECBB 3QUXB 1I3VA 5EBMB 2A74B 3VXSA 2VDQL 3IU3B 4HG4J 1P4IL 1JNNL 4EN3C 3FQTA 3MJ6A 2H1PH 4NQUA 1NJ9B 3VXSE 3WXVH 4CVZA 4X7TB 4PJHA 4UUJA 2BZDA 3BAEL 3GI8L 5CJXA 4LASH 3O3UN 2E7HA 2FYYA 4J2XA 2FX8H 2HH0H 4NO3A 4PJHE 2NY2B 3JVGA 5IMKA 5JPNB 5L9DL 3NBNA 2KBGA 3AM8A 5C0BB 3WHE0 3K4DA 4EEEA 4YC2B 1UB6B 3CUPB 4Z7OF 3WJJA 1MCWM 2WBJC 2HFGH 4KKNA 1UKTA 3B2UD 4ZFZB 3V52L 1U6AL 4DOHB 1D6EB 4AENA 1RIVL 1VACB 1JV5A 5EO1A 2AJSL 2A6KA 4WFFE 3W0WA 4LQFL 4UDUB 2NXYD 2DQTL 4N0YH 5FV1L 4HPYL 3W0WE 1T0MA 3C09C 3MREA 1OAYL 3NA4A 3BKYL 3T0XA 1EMTH 1G1CA 3MCKA 3TJEL 4XCEA 4GS7B 3O6FD 3JSSA 3HI5H 3ZKXC 1FGNH 3FRUA 4KKLD 1IAKA 4EDWL 4IOFC 5I8EB 5JDSB 4HKJB 4WFED 1LO0L 5D7LA 1DUZB 2UY6A 4QYOA 5BZDB 4HS3A 1Q94B 2Z31A 4RX4D 5D7LE 1HH9A 4LPWA 1SMAA 3X17A 2H9GB 4BFGA 1VFAB 1F58L 3S9DB 4X7EC 4XC1L 1A1OB 2VJXA 2G75A 1SY6H 5CEYA 3CAFA 3TV3H 3TN0B 2UY7A 3WFDH 3ULUE 5T1MB 1GZQA 3MRNA 3BIKB 2DI9A 4Z7QE 1KIUA 1NDMB 4V2CB 3K3QA 5LBSL 1MJ8H 2VZ1A 4EI5D 3STZA 5E9DD 5SWZA 3FL7A 3O6FA 4WU7B 5HI4D 3QFJD 1RI8A 1A6AB 4LRIA 4XNMA 5IW6A 4JM2D 4ERSH 4OKDA 2A0LD 1LQSR 1SYVA 2ICES 1M71A 5SWZE 3T0WA 3RHWF 1MPAH 1QBBA 1Z0MA 4KU1A 3HCVB 1TFHA 3NIDF 2EDJA 4YPGA 5F44A 1XR9A 1L4IA 1MH5A 2DLFL 2VDQH 1KGCE 3FT4B 4ZQKB 1LEGA 4HUWA 3LQMA 3FONB 3QQ4B 2W0PA 1JNNH 4WFEE 3OKKA 1JGUL 5I30L 1IKNC 5IVXF 1KFAL 3RL2B 3GJFA 3UPCA 1HXYB 3T0AA 3BAEH 3GI8H 5JORB 3BN3B 5GSVB 4EQ3A 4ELKA 1KG0A 4HFUH 3HHRB 4JVWA 1FNHA 5JNYB 5JMOC 3QCTH 5L9DH 4AEHL 1ZS8A 4JQXA 5E9DA 1HH6A 3IJYB 4J6RL 2Z93B 1LO5A 4FFWC 3IU4L 3ORJA 3JWDH 3V52H 5E9DE 1U6AH 1YEGL 5F3HB 2BVOB 1FL3B 2DS4A 2AJSH 2AJZB 4MAYC 4LQFH 4X6EB 2DQTH 2HJLB 1ACYL 2DKMA 4QHKJ 4O00A 1JGDB 1DQLL 2H2PC 3MLTA 1T22A 3JUZA 1T3FB 4Y5YC 1M6OB 1OAYH 4MNQB 4K9EL 2J2ZA 2EECA 3TJEH 1RZKL 4PJ9A 2D7TH 1NLDL 4JGJA 1H3WM 2YD6A 1AKJB 4EDWH 1S7UA 2GT9A 1T20B 1VENA 1LO0H 3CSPA 3Q6GL 4JFDA 1SJHA 5ACZB 5DHYA 2QHLA 5DFVC 5HHVL 5ISZD 2YSSB 4F7PB 1U3ZA 1KTDA 4PRIA 4JFDE 1IQWL 3BGMA 1J88A 4K8RL 3R0MA 5E1HB 4HW6A 4PRNB 2I60L 4MYWB 5FIEA 4PRIE 3QSKB 2V6HA 4KJYA 5C0GB 4PJBA 1T5XA 4BSVB 3B9AA 5AWNL 4OSUL 1S7SB 4JRWA 4JRXB 2R0LL 2OXGA 4PJBE 4FOMA 1CR9L 3UYPA 1JPGA 2DL9A 2ADIB 1BF8A 5EUKB 5GGTA 4R3SA 2HG5B 5C0IB 1PKQA 5E7BA 3UAJC 5E6IC 4POYA 1UZ8A 2DLFH 4JVUA 3AY4C 3W82A 1PKQE 4GW1B 4PREB 5ISZA 1JGUH 2V5TA 5F6HI 5I30H 2OJEB 3QPQD 2J8UF 5E94B 3PWPD 2XFXB 4MQXC 5FO9B 2ADJA 5C0DA 5ISZE 1NMBL 3QWOB 5ICYB 1LE5A 2DIJA 2Y23A 1CL7L 1CS6A 4JFPB 2WBKA 4JFZL 4QRSB 5BXFA 2IADA 4EOWH 3D25B 4AEHH 4IRJA 3O9WA 4JM4L 4MZ2A 3HAEA 2H41A 4R4FL 4HGWB 5EORL 1CD1A 3EO0A 3IU4H 1QSZA 5J13C 2FR4B 4NCC1 1IT9L 4R96A 1YEGH 2GW5A 4PTTB 3O3DB 1DSFL 1OP5H 3N1GC 4P4KC 1G7IB 4BUHA 3GMQA 4O9HL 5HGBB 5FUZL 4QXWA 4KKBC 1ACYH 2BXZA 1DQLH 4I5BA 1BFOB 4HKXA 3AC0A 4K9EH 5FKPB 1RZKH 5DJXB 4WNQB 1NLDH 4P99A 5CZVL 1I85A 1N8ZA 3GMLA 1JZ8A 3MV01 3D69A 4NN6C 5IFJA 4J3WA 3BVNA 3ARFB 5DYOA 4FQ2H 5SX4I 3Q6GH 4JDZB 5HHVH 1HXMB 1S7RB 1IQWH 2OJZL 5I75B 3DURB 4MCZB 5HI3D 4JDTL 2RQ8A 5TQ0L 3PWVB 5LGJA 1CGSL 1EFXA 1FRGL 1HN1A 3G08B 1T7ZA 5ERWA 4GG6A 4P9HL 3M45A 3MUY1 1PGRB 5DR5H 5EBWB 5AWNH 2PKDA 4NC2B 4XWGH 2JIXD 3GSVB 4GG6E 2R0LH 4X4XB 3IGAB 4K3HA 2B4CL 3ARTA 4HH9A 2ZKHL 3H2WA 1LEIB 1TITA 2X6MA 1X6NA 1KNOB 2HJKA 1VFOA 4GBXA 3ET9F 4K3JL 1CXEA 1NMBH 3JVGC 2NXZC 4JFZH 5F7DB 4XBGB 1BJ1J 2RCSL 3WJJC 1BZ9A 1EJOH 5JZ7D 1EAPB 5CBEB 3QZWG 4JM4H 4DEPC 3KPPB 4R4FH 4P59L 4LCUB 1Y6KR 1IT9H 1S78D 2LU7A 3QDJD 1DSFH 2EKJA 4CMMA 5ITBL 5FUZH 5J57B 1PVHA 3O3AB 3QUKB 4U4BA 2YUVA 3QDMD 1RU9L 3PHQA 1ZMYA 5TH2B 4Q2ZB 1T89A 1JGEA 5T1KD 2C3XA 5F93C 5CZVH 3ZE0E 1NMCB 2VZUA 2HKFL 4GSDL 2UUDK 1MCWW 1MCOL 4K3EL 5KOMC 3B2UC 4JFYA 1HOCB 2YPLD 5FOBA 1MLBB 1OHQA 1N5AA 2EIEA 1EJ6A 3ULUC 3SQOL 5MEQB 5JW4N 5F7WC 2WW8A 4LLWA 2AJYL 2OJZH 5FYJE 2WZPD 3VGFA 4JDTH 1MRFL 5TQ0H 4Y4KB 1R3JB 1CGSH 1FRGH 3G6AA 3QDMA 3X12A 1I1FB 3BP7A 4P23B 3VXNB 3O6FC 4P9HH 4QXTA 4XCNB 4LRIC 1G6RA 2NW3B 3V6BR 4U0QB 3QDME 3KJ6L 2D3VA 2MHAB 3VH8B 5T1KA 4KMLB 5B3JE 2C3HA 3QDGD 2B4CH 2ZKHH 1OARH 3CMGA 4A6YA 3EYFA 4OV5B 1CLOH 2YPLA 1F8TL 3BDXA 2XXMB 2R1YA 1ZLVH 4LIQE 1QFPA 5FUCC 5ICZB 2A73B 2YPLE 1F4HA 3QIUD 5GRZA 2ED8A 2YRZA 1FSKC 4JR9L 1F4AA 1N2RB 4K3JH 1TTUA 4GKOA 4PY7B 5F1OB 3KYNB 2GJZA 3MC0A 4PJ7A 1ND0B 3EDEA 3SJVD 4TSAL 4EI5C 1CFNB 4JQXC 5IVNA 1L9NA 5HI4C 3A6BL 4PJ7E 3X3FL 4JM2C 4WEUD 2H3NB 4ZUUB 2A0LC 4N1HB 3GMRB 3BPLC 4XB7A 2P8PB 5IVXB 3QDGA 5K59F 4WFGE 4HIIA 3HC0B 5LKNA 3G5XA 4XCYA 3VA6A 3QDGE 2X4NB 4H8WC 2AJ3A 5ITBH 5DD3L 3RVWD 4BH7B 1OCWL 1RU9H 1ADQA 2B7DT 3RTQA 3VFMA 1G9EA 1QFWL 3FB8A 3GIZL 1CU4L 1S9YB 4M5ZL 1G7JA 1QNZL 2HKFH 4TVPD 1BOGB 1CI5A 4GSDH 1MCOH 4W4OC 3ALXA 4J8RA 4YHKL 4JANA 4XXDB 1HCVA 1BAFL 1FN4A 2N56A 5CP7B 4JDVA 4XP9L 1WBZA 2AJYH 2AAVA 2C3GA 1MRFH 1NANH 4HV8B 1A2YA 4ZTOL 4PGJA 2HTKD 4G80A 5CBAA 3BDYL 3F7QA 3STLA 4JHZA 4ZUWB 4X98A 5C09D 3KJ6H 5HHOB 3D2UB 4DK6A 5C0EB 1HI6A 3K0WA 5DRWB 2VC2L 1ITBB 5IK3A 4N1EA 1T1YA 3MRIA 4LPYA 5IVZA 4KK8D 1F8TH 4TVPE 5JXEA 4B41A 2X4UA 3QUMB 4JR9H 2FZ3B 3P4OB 3BDBA 4F8QA 3RWFB 2BCKB 4GW5B 3CSYB 1BVZA 4PJ5D 4IRSD 1J86A 2ARJA 4TSAH 4IRJC 2NPLX 4QRRB 3RX5A 1FG2A 2YD8A 4D2NA 3VCLB 1C12A 1BZ7B 1ROWA 3A6BH 3X3FH 5C09A 3TBYB 2VQTA 1U36A 2IFGA 4C54A 4WIQA 4F37K 2J8UB 5KSVA 3CVHH 4YBHA 5C09E 5J6GB 4UT9H 1FPTH 1YEIH 3DRTB 3KYMB 3F5WA 1ZAGA 2NY1B 4EVNB 2BNRD 2ZUUA 3QPQC 2FGZA 4MJIA 4ALAL 4JN2B 4J3SA 1FFOB 1OCWH 2UVEA 1AP2A 4NRZA 5F96L 1JYWA 1DDHA 2BSRB 3LKPB 4MJIE 1SJEA 1QFWH 4O2CB 1QSFA 3KLAA 1S9XB 1U3HA 1FZOB 4PJ5A 1CU4H 5F7FA 3VDBA 3THMH 4M5ZH 2VDML 1FNFA 3HE7A 1QNZH 1QSFE 4XVJL 2AABL 1ED3A 2EO9A 2VTFA 3OKLB 4PJ5E 1ZVHA 5HHQA 1FIGH 4YHKH 3HLAA 1YC7A 1IMHC 2GCYB 1IGYB 5IROC 4IMKA 4APQB 5B38G 4NN7B 2CR3A 1BAFH 1QKZL 5A2KH 3B4NA 4PRPA 4XP9H 4NNPL 5J12B 3M17A 3KPSA 4JPKL 3F7PC 2BNRA 4PRPE 4XH2A 4ZTOH 3KPSE 5D7KE 4AEIH 2FX7L 3TZVD 1ZHBA 1BJ1H 5E8EA 5D9SB 3MODL 3BDYH 2BNRE 3H8NA 4AIOA 3RWHB 5ITFA 4MDJB 3MJ9L 1P53A 1AO7B 2QEJA 4S11A 3J8F7 3WNLA 2QQKL 3BKJL 1T5WA 3MRDB 4IRZL 2VZOA 1UJ3B 3L9RB 1ACZA 3KLHD 3DROB 3MUHL 4X8XA 4KZDL 3QZWA 1XGYL 5HI3C 1P7KB 3KPMA 2NW2B 3BHBA 4KAQL 1F13A 4PB9L 1BBJA 3EOAA 3FQNB 1RHFA 3RNKB 3GSNL 2MFNA 2AS5M 1FC2D 4HZLB 4PV8B 1ERNA 5BZWA 4Y4HB 4G42A 4LQ1A 1MNUL 5D6DA 2GKIA 4TYUA 4ZOBA 4FTVD 5DJZB 1BBDL 2EEAA 1N5YL 1A9BA 4YPJA 1NSNL 2DDQL 2EEDA 3PUCA 1JMXA 2GK0A 1KB9K 1J5OH 4XNXL 2IJ0C 4YDIL 4TUOB 4ALAH 3AS1A 3MV8A 4FZ8H 3SCMD 3LKRA 5F96H 3B3IB 3L5IA 2BVUA 4WI8A 1XGTB 1T89C 4UU9A 5E8NA 3RIFF 1JK8B 3BRDA 1VB9A 3MV8E 3QNYA 1NBYA 3KLDA 3L7EB 2VLKB 2IH3A 3P9MB 2VB5A 4MGXA 5FGSA 4XNYL 2VDMH 2D7OA 2XG4A 4PRHB 4Q6IC 5JZ7C 1TZHB 4XVJH 2AABH 3S6CA 5IHBA 4Y4FD 5CKAA 2D9QB 3QIWA 3C6LB 1XIWA 1XCTA 2AJXL 3K4ZA 4PR5B 3OX8A 3U46B 4FTVA 1RFDH 3F6IA 1NCTA 1ZANL 3GRWL 4NNPH 2P47B 2VABA 4FTVE 4JPKH 4DN3L 3RZCD 3GSUB 3V0VA 3L3DB 2NY7L 1NCCL 2FX7H 5L6YL 2YXMA 3MODH 2P42B 4E42B 1U8QA 1P9MA 2F74B 1GSMA 1XGPB 3MJ9H 3BE1L 3EDKA 1K5NB 3QB7C 1TJHH 2QQKH 3GHEL 5F9OL 5L2JA 3BKJH 1HNFA 2ZZUT 3K8KA 4BH8B 4IRZH 1A1MA 4G8GB 1MQKL 1MHCA 5HXMA 3ULVF 1DE4B 2B5IC 1J05A 3SDCB 4KZDH 1XGYH 3T04D 5TGBB 4KAQH 4PB9H 4P2CG 3RZCA 4Y19B 5ESVA 3GSNH 1T1XA 4L29B 1SY6A 2B2XL 2W07A 4NO0D 5TQ2L 1H5BB 3F12B 5D5MF 4YBQD 1A6ZA 4PJIF 1MNUH 4LF3B 2CLRB 3T2PA 4MMXC 3MA7B 3LPFA 1FNEA 2CMRL 1BBDH 3NCYP 1N5YH 5CUSL 3I2CL 2DDQH 4NNYA 1DR9A 2XPGA 4J1UA 1A3RL 4XI5D 3QIUC 2HVJA 3ZLQC 4XNXH 3QXVA 3V5KB 3QUZB 4Q6YA 4YXKH 4YDIH 4NZJA 2E9IA 4LKXB 3D1MC 1LP9F 2NTFA 3TIEA 3G5YB 4R7NB 1TNMA 3VGAB 5BW7C 1QR4A 4XNYH 4QNPE 1LNUB 1FZJB 4GG8B 3MRKA 3EZJB 3RDTB 4NQVB 3GSQA 5IR1B 1YEKL 4YHML 4U7KA 1XR8B 4R0LA 3NA9L 2AJXH 1KLUB 3MJ7B 4MSWA 4U0RB 3BPNC 2Z9TA 4OFVA 3AROA 5FEBA 5J11C 1ZANH 3GRWH 4FQJL 4LDLB 4X0KB 4OZIF 3HE6B 2C1PA 4ZNEA 5JHLL 2H6PA 2WINB 3RVWC 3DBXB 3ZHKA 3OGCB 5L8JB 4DN3H 4NQCB 4V2BA 3L5HA 4I3SL 5DRZB 3PABB 2NY7H 4ZNEE 5FGCB 3VXUB 5BVJA 1NCCH 4M1DL 3BQUB 4J3VA 5L6YH 1AGEB 1U8KA 3EYVB 1M7XA 1AXSB 3AS3A 3J7HA 1FZMB 4BKLB 4PRBA 2ESVA 2R2BB 4BELD 1NL0L 1ZOXA 3FQUA 2ESVE 1QACA 2DQIL 1Q9WB 1QTYT 3GHEH 5F9OH 1P1ZB 3NN8A 4CJ0A 4PP2B 5DEFA 5EZLA 1MQKH 1UXSA 4JGMA 2L7UA 1GGIL 1A7PL 4HIJA 3WFHB 4AY0A 4KUCF 3G04A 1SMOA 3OQ3B 2HTKC 2W65B 3DUSA 3QUML 4OZFB 3S7GA 3ZL4L 4JPIA 5E03A 1ZA3A 1N3NB 5EPMB 1REIA 2B2XH 2V5MA 2YPKA 5TQ2H 3MLSL 3VRIB 3S8WA 3BRFA 1ZEAL 4HUUA 4ENED 3CDCA 3L5WA 1OB1B 1KELH 2D0FA 4GOSA 6CGTA 3K46A 3QJHA 4U1LB 4Z0XB 1DLHA 4C56D 1W8OA 1E27A 4KK8C 5C0AD 1X5YA 1ZWIB 5CUSH 4Y5VA 3SBWC 1JWSA 1RJLB 3BRGC 3HZVA 1A3RH 2DIBA 5DD0L 3QCUL 1TMCB 3P4LA 1IAII 2LAAA 4M48L 3PQYD 2FX9H 2NX5A 3T2QA 3KYOA 4IRSC 4NT6A 2EYRB 4XBEH 3WN5B 3D39D 3HE7C 3DVGB 3P2TA 2NX5E 3WS3B 1MI5D 4YHMH 1EERB 4IMKC 3VFNB 4BZYA 3RX7A 3I3BA 3NA9H 1KF9B 3TNNB 5KSAB 4FQJH 4Y89A 3EFDL 4DN4L 5JHLH 1U58B 4W4NA 3L3OB 1V7ML 1DQTA 4N8CL 5IQ9A 5TDNA 4I3SH 1E6JL 3IFPB 2LU3A 7CGTA 2MQ3A 4M1DH 4L4TA 3PQYA 1K2DB 5A16A 4IBLT 3DVNB 1AE6L 4OKVA 3FT3A 4D9QE 1D5IL 1NGWB 4MA1B 4ZXBB 4L4TE 3PQYE 2K3TA 4QRPB 3OR6A 1IAOA 1INDL 1F4YH 4QHUB 2DQIH 1TLKA 2P44B 1INEL 2CIKB 4CUCA 5MENB 1Q9LB 3M1BB 5CZXD 2ED7A 2HA1A 2X4RA 1PSKL 2HN7B 1URLA 1GGIH 3H9HB 4PG2A 1A7PH 1INQA 1Y18A 1WCBB 3MRJB 2ZNXA 4J23A 4TRPL 3ZKMD 2UWEF 3ARXA 1T2JA 4R2GD 3GB7B 4NNXB 3L3HA 3QUMH 5I1CH 3ZL4H 1UKSA 1PQZB 2O93L 2EYTA 3MLSH 3IDXL 3CFEB 4K07A 1EEZA 3NIFF 1B0GA 4GRLD 4HULB 1FZKA 3VFUA 1A4KB 4KRPD 5EU5A 2I9LB 1PEWA 3Q3GA