1MZYA

Crystal structure of nitrite reductase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
331
structure length
331
Chain Sequence
LSNLPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLDEDAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPENTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGPMIPWHVVSGMAGCIMVLPRDGLKDHEGKPVRYDTVYYIGESDHYIPKDEDGTYMRFSDPSEGYEDMVAVMDTLIPSHIVFNGAVGALTGEGALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGTAGAALYKFLQPGVYAYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
publication title The High resolution Crystal Structures of Nitrite Reductase and its mutant Met182Thr from Rhodobacter Sphaeroides Reveal a Gating Mechanism for the Electron Transfer to the Type 1 Copper Center
rcsb
source organism Rhodobacter sphaeroides
total genus 91
structure length 331
sequence length 331
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1mzyA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1mzyA02
1R1CA 2VM4A 3CDZB 4GP5B 4FAAB 1JZGA 3FPXA 1ADWA 1KBVA 5I28A 2N0MA 2EIKB 3FU9A 1MDAA 1OE2A 1AZRA 3V9EA 1RZQA 3CVBA 3FU7B 1PLAA 2AZAA 7PCYA 1XMEB 4DP9X 1ET7A 2VN3A 1WS8A 3WNJA 1HAWA 3NJNA 1JZFA 1PNCA 1A4CA 2TSAA 1V10A 3QJRB 3ABLB 1E65A 4UAHA 1GSKA 4HAKA 1FFTB 1ZIBA 1BQ5A 2VW7A 2Y69B 5ANHA 2XVBA 1FWXA 5I6LA 3X1EA 5B1JA 1BQRA 4AX3A 4BWTA 3AG1B 3FU8A 3QJUB 4BDVA 3NJKA 2I85A 4BWWA 1SJMA 3ABMB 4YSUA 2DWSA 4G70B 1L9OA 1IBYA 5B7FA 3CZUB 4JHUA 4GP8B 5I5IA 1AG0A 2ZONA 1M57B 4YSTA 1SDDB 3IN2A 3QJVB 3FSZA 2XV0A 1DZ0A 3FPYA 3JT2A 1NIDA 1NINA 2HX9A 4RH4A 2CCWA 2H5UA 2YXWA 1BAWA 3NJIA 2XWZA 3FSAA 1EZLA 4KOBA 4DP2X 2PPDA 2FNWA 3GYRA 2BO0A 2PP8A 4ENZA 4P5RA 1CUOA 4E9TA 2AVFA 3S3DB 1JVOA 2DY2A 3X1GA 5A7EA 2FQFA 1AAJA 2Q5BA 3DIVA 1JERA 1SFDA 2IH8A 1FA4A 2P80D 2WO3B 1J9RA 1L9SA 1J5CA 3NJGA 2WSDA 5EHFA 1AOZA 5PCYA 1NIBA 2AFNA 2XX0A 4HCFA 1ZIAA 4Q8BA 4HCIA 2OV0A 2B08A 4DP1X 3NSFA 5E9NA 1E67A 1ZDQA 1MZYA 2HRGA 2IWEA 2YAOA 2XX1A 3UAAA 4BWUA 1AIZA 1GS7A 3N55A 1KCWA 4A2GA 2QT6A 1NZRA 2VW4A 2XXFA 3ABKB 4UF7C 2IDUA 5I5JA 2IDFA 5I6OA 2CJ3A 1CC3A 3EF4A 4L0PB 1PMYA 1PY0A 1BYOA 3G5WA 1PNDA 2HXAA 3HB3B 2EIJB 2PPEA 3FSWA 4G7RB 4E9WA 3NT0A 2LLNA 5IY5B 1A4AA 2BW4A 3NSDA 2BWDA 3T6VA 3V9CA 1JZIA 4E9XA 3PAUA 1URIA 3QJSB 2XYBA 5F7AA 1E30A 2FTAA 3AW5A 1HFUA 1KGYE 6PAZA 1JXFA 2FT6A 1WA0X 2BWIA 2IDTA 1L9TA 1JVLA 2VMJA 3T9WA 3OMNB 1HAUA 5I6KA 2YAPA 2YAEA 2IDQA 3QJQB 1TEFA 4HHGA 2PPAA 4DP6X 1QHQA 2UXGA 1JXDA 3NJHA 2YAMA 2E86A 4A68A 2BZCA 4WKXA 4DPCX 1V55B 3N2JA 1PZAA 4JKNA 3EH3B 3FU7A 5FC9A 1EHKB 3NSCA 4A67A 4AZUA 6PCYA 2PLTA 3NJJA 3S3CB 3ZBMA 3AG2B 2CALA 3UABA 2BP0B 4KNUA 1BXAA 3FQYA 1SHXA 3S8FB 4X4KA 3KW8A 1ZV2A 2W88A 4YSQA 1ZPUA 2UX6A 2XLLA 3CG8A 4DP5X 1BXVA 2VSKB 1GW0A 4BXSV 2Q9OA 1IBZA 3ASNB 4PAZA 2YQBA 1L9QA 1OF0A 2ZWNA 2W8CA 3GDCA 1SF3A 3PXLA 2TSBA 1E5YA 1F56A 1IKOP 4E9RA 3OMIB 2OJ1A 1NICA 3NJLA 1AS7A 1IUZA 1SHWA 1XB3A 2GHZA 9PCYA 2YAFA 3WI9A 4YSOA 2GIMA 4DPBX 1NIFA 1OCRB 2UXFA 1M9WA 1ID2A 2B3IA 1KBWA 1OE1A 2FT8A 2BHFA 1SNRA 2OCCB 4NAJA 2XV2A 2HX7A 4AKQA 2HZHA 5TK2A 1JOIA 3TBCA 4YL4A 1WAEA 2PCYA 3DTUB 1BEXA 2YAHA 1CYXA 1NIEA 2GC7C 2UXVA 1J9SA 2PPCA 4A2HA 1E5ZA 1ET5A 4HALA 2YAQA 3WKQA 1AS8A 3SBPA 2IWFA 1GY1A 1QLEB 4GP4B 4KO7A 1NWOA 4E9VA 1V54B 3IN0A 1M56B 3T6ZA 3TBBA 2FQEA 2XU9A 4W9ZA 1AQ8A 4YSRA 1ET8A 1T5KA 5B1BB 2BP8B 3X2QB 1N70A 4YSSA 4YSCA 4DP7X 4GXFA 3H4HA 1W6LA 2FT7A 1AZCA 1OV8A 3EH5B 2WO2B 2UX7A 5B1KA 1KYAA 4MFHA 3SBRA 1L9RA 4HZ1A 1JZHA 4G72B 2PPFA 3PAZA 2FJSA 2JKWA 2ZXWB 3OMAB 2PCFA 3X1NA 3NJFA 4HHWA 1DYZA 1JZJA 1AZNA 3FSVA 1MG2C 4JHVA 3ASOB 4KNTA 5I6PA 1A4BA 2XUWA 3TASA 2JXMA 2R7EB 3WNIA 1NPJA 2X88A 1AZBA 2J57A 3MBWB 4DP4X 1AACA 3T6WA 3RYMA 3ZX1A 2I7OA 3KW7A 3CVDA 2RACA 1OOWA 3SQRA 1MZZA 2QDWA 1OCOB 3OQRA 4G7QB 2YXVA 1PLCA 4A66A 3CDZA 2GBAA 2IAAC 1WA2X 3EHBB 4N4YB 1YLBB 3NJMA 4CSZA 5I6MA 4DP8X 1OCCB 5AZUA 1B3IA 2IWKA 2MTAA 3DKHA 3UACA 2EINB 4AI7A 4G71B 1GS8A 1KV7A 3WKPA 1SF5A 1AR1B 2BP0A 3ABGA 4HIPA 4DPAX 1RZPA 2VW6A 3AY2A 2X87A 5I5MA 4TXVB 3H56A 4YSAA 3FQ2A 2HX8A 2CBPA 4GY4A 1A65A 3JTBA 1AANA 3NP3A 1W6WA 3PLYA 5D4HA 1MG3C 3PPSA 1N68A 2DYSB 1L9PA 2GB2A 3SBQA 2FQDA 2A3TA 4E9SA 1WA1X 1BYPA 2CUAA 4A2DA 1ILUA 2YARA 4CSPA 3TA4D 4AKOA 1GR7A 4EF3A 4FA7B 3GXUB 4YSEA 1ASPA 2VM3A 4AKPA 2PP7A 2BW5A 1NPNA 4BK5C 3AZUA 2JFCA 1NDTA 5AKRA 3IEAA 1PZBA 3PAVA 2VSMB 2NRDA 1ASQA 2GSMB 4YSDA 1SDDA 2QPDB 5I26A 4QKTA 4KO9A 5B3SB 4M4RB 2J55A 3S3BB 5AFAA 5B7MA 4YVNA 4F2EA 2I7SA 1GYCA 3FYIB 3NYKA 5D4IA 5D4JA 1NTDA 4NB7A 7PAZA 3OD3A 1JZEA 4DP0X 3IE9A 4BDVB 1IC0A 2J5WA 2DWTA 1X9UA 2GC4C 3FYEB 3UAEA 1NWPA 1ASOA 1XB6A 2CAKA 2DYRB 1AS6A 3UGEA 3AG4B 1J5DA 4NERA 1A3ZA 2MRYA 4WTQA 3X1FA 1I53A 4HCGA 1OCZB 1WS7A 3ZIYA 3FS9A 4A2FA 4QLWA 2UXTA 2QPEB 2XV3A 3X1BA 3BVDB 1NIAA 4GYBA 3U25A 4BXVA 2QDVA 3UADA 4W1TA 2FWLB 2BP8A 2EILB 2DV6A 1ETJA 5F7BA 1GY2A 5TK4A 2FQGA 1J9QA 2H3XC 3ERXA 1A8ZA 4KOCA 1PZCA 1XB8A 3ZDWA 3IBOA 1GS6X 3WIAA 2HRHA 3T6XA 4ZK8A 1X9RA 1ILSA 4K9JA 1OE3A 3L45A 4KO6A 1AZUA 1PLBA 1CURA 2Y1AA 4YSPA 2EIMB 3T71A 3MX0B 1RCYA 1SFHA 4A2EA 1QNIA 4YVUA 2R7EA 2P80A 4M3HA 4UANA 5PAZA 5B1JC 3WG7B 3C75A 8PAZA 3NP4A 3TU6A 1TKWA 2H47C 4E9QA 3FT0A 1RKRA 1UATA 3HEIB 3QPKA 3D12B 5LDUA 1KCBA 4F2FA 2AANA 4KNSA 4Q89A 3QJTB 3OM3B 1BXUA 1AG6A 1J9TA 3FQ1A 5B1AB 3S8GB 1JXGA 2XXGA 3AG3B 5B7EA 4PCYA 2ZOOA 3BQVA 1PF3A 1TEGA 1W8EA 1PAZA 2HLEB 4G7SB 4N8UA 4P5SA 1PCSA 1KDIA 3QQXA 2IH9A 2GI0A 3NSYA 3PCYA 2BZ7A 1KDJA 1VLXA 5I6NA 1CYWA 4KO5A 2J56A 1TU2A 1BQKA 2AZUA 3CVCA 4F7KA 4E9YA 1ZDSA 3H4FA 3EH4B 2PP9A 2IDSA
chains in the Genus database with same CATH superfamily
3BPLB 1PLGH 3G08A 4GUPA 4YDJB 3T3MF 1IKFH 4YUEL 4LFHD 4K3JL 2Y5QA 4QYOB 2YXFA 1H0DB 5I1AA 4E5XA 1TYJA 4K9EC 4PJCA 1S3KL 4K3GA 5K1NA 2H3KA 2FUQA 1BZ9A 2PN5A 2L8AA 2MNJB 4HV8B 1RUKH 4OZHA 4QRRB 3MMEA 4XO3A 3BDYH 3WNJA 5FX3A 4LEXL 5TFSL 1KPVA 1JZFA 3MUGB 4JDVA 1DEDA 4TVPD 5DHVB 3EOTH 2ALAA 4C56B 5J1SC 1GSKA 1WEJL 2QPSA 2IPTL 4GS7B 4MD0A 2GKIA 3GTNA 4JPQA 1H8OA 2P24A 3VFMB 1SDYA 2XHNA 3C5SB 5ACZA 5DURD 3GUTB 1QTPA 2I85A 3T1FA 1M71B 1MH5A 3LS5L 1AHKA 2ZP0T 1IGTB 4BBWA 4OD3L 3WTSA 1VENA 2NNXA 2P48B 3CZUB 2YFNA 4YLQT 1JN6B 3HLAB 3ZO0A 4HXBH 4N87A 1I75A 4LGRB 5IB2B 3PGFH 3OKEA 3FSZA 2GJPA 4QDGA 2QQNH 1N59B 1J0JA 4G8IB 4OLYH 2ICWJ 5SWSD 4RH4A 2QGDA 3T4YB 3AXIA 2DLFL 1M1XB 4YGVA 3TBYA 1JGIA 3WO4B 5DMYA 1YYLL 3IPFA 3BJLA 4C8XA 4ODUA 5ESVB 1MHHA 4Q9RL 4ZOAA 2QV4A 1OPGH 1TPXC 1JWSA 3ZE1E 4AQZA 2ZKMX 3BXNB 4UINH 4LLAA 2F2HA 3A5VA 5DURB 4XC3H 5CCKH 4WJ5A 1DVZA 3SEPA 4PBVC 3IYLW 4QCIB 4QHUB 1J5CA 3BRFA 1WZMA 3O8XA 4GAAA 5G4NA 3DSNB 3TO4D 3KHOA 2GQHA 3OJDB 3VI4A 2BFGA 4LSQH 2VLKA 3TS8A 3RY6A 3ZKXC 4E0RB 5KVEE 3LKOB 4EUPH 1H8NA 3G6AB 1KEGL 2FIKB 3FU0A 2IADA 4UTAL 3CFMA 3V4UL 1X5FA 3ZK0A 4XN2A 4F15C 3MRJB 2DQDL 1LE5A 4M93C 3MLTB 3V5KB 1F6AB 2FJGA 3LHAA 5IWLA 2J7LA 3TEUA 2HWZL 2QT6A 4A2GA 3IT8D 1MFAL 1MJ7L 1R4XA 3ABKB 4Y5VA 3LNIA 4G6AD 5FO9A 1AKJB 3P77B 5BRZD 2OBGA 2BXZA 3KWUA 3BQUC 1JPGA 4B27A 1MVFA 3IDIA 1PY0A 1UZ6F 5ANME 1I7UB 5F89A 1E6OH 4KJPD 3U7YL 2L04A 5JZ7D 3VYOA 1BQLL 4ELMA 1WTLA 4HGWA 3C12A 1AHWC 2JKIS 3CHPA 2DMBA 3SB3A 4I48A 2XYBA 3KXFB 2RAMA 5EU5B 3QCVL 1QLEL 5AD0B 5EO1B 1ITBB 3AT8A 2FRGP 2Y07H 1P84K 3RWEA 5DA0B 5IVZA 2ZPKL 3GSRA 1D7BA 4RA0C 2QHRH 4POYA 1DN0B 5D2LB 2LTQB 5TD4A 4YL9A 4WY7H 5KG9B 3WAKA 1V7MH 1YEIL 2XFXA 3MLPA 4ZAKD 1A9BA 3C8KB 2UZIH 3F7KA 3DECA 3QNZB 4N9GB 4HS3B 4XMPH 3EJSA 4HJSA 3MRHB 3NBNA 2OJZL 1UXSA 6PCYA 8CGTA 4NN6C 5E4EC 3R8QA 4XB8A 3K81A 4FXTA 4YIQB 5KVEH 4NP4L 1G43A 1FGNL 1HHGB 4HSQA 4NNPL 1ETZA 3VXQA 3VFWB 5JNYB 1FHGA 4NAQA 2CDGB 3P2DA 2G2NA 1EERB 1FZKB 2QMJA 1ZPUA 2E7LA 2OQJA 3O45A 1ZPLA 1IBZA 3FCGA 4OGYL 5A2LH 3QDHA 5CU9A 1T6VN 1RLBA 2X10A 3IKKA 3FO9A 4D3CL 5DZOA 3TH4T 1MY7A 4D9LL 3NFPB 1OF0A 1QYGH 1KJ3L 2DIEA 3GNML 3QISA 3MCKA 1CGWA 5CLXA 4AH2B 3PV6B 5I9QC 2ZNXA 4AL8C 2FGWL 2F74B 1MCQA 3JV6B 4LLUB 4MNQE 3TEZA 1UOLA 1M7IB 1AQHA 5E5MB 4ADGA 1P1VA 4KTDH 2MPVA 4LHUG 5FGSA 3QFJA 1LVEA 4GQRA 3CZGA 1HSAA 1NLDL 1A66A 2M8XA 4WUUA 1UM6H 4Z9KB 5HDRA 2OMTA 4KV5F 1U8KA 2JCCB 4ODHH 5JMRA 4A6YL 2FEDD 2YN5A 4QRPE 4XVJH 3CN3A 2J6WA 4OFVA 1ORSB 2DQGH 4JRFA 1GVIA 2D3NA 4UUJB 4DTGH 3O2WL 2KS0A 2PPCA 2HTLC 2W80C 4JM0A 4Y4FA 3FTZA 2AC0A 3VO0A 3I3DA 4QRTA 4IS6A 2LAAA 5C0CE 2YD9A 1WWAX 3P1VA 1V54B 3IN0A 3U7WL 5EF0A 2D9QB 4QTFA 4GT7A 4P23D 1FZMA 1E3XA 1ET8A 3F2LA 4H26A 5K9OA 2X5PA 1S9WB 2XZQH 2Z31C 5FIEA 4A7TA 1ZXQA 3IDGB 3X2QB 3QG6A 4PW4A 2HUEA 1INEL 4OB5H 1VIWA 5LN4A 2E46A 1CE6A 2A38A 3PWLB 3RAJH 4GXFA 1J8HA 4ENED 1CGVA 1KJVB 5C6TL 2Y6SD 3AVEA 1JPSL 2C9XA 1N3NB 1LJMA 2UYLB 5E99H 3RWDA 5F7HA 1KBGL 4XN5A 4UB0H 3WHE1 2UUDH 2WZ5A 1FAKT 4NOFA 4UNVA 2I9LA 4Z7WE 1BHGA 3BH9A 4TSBL 3FL7A 3C6SB 3VVWA 1KTLA 1QSVA 2K45A 5DHXB 2PCFA 1LWJA 1R3LB 3DBXB 5LXGH 4K73A 2OL3A 4NBYB 4PP2B 3AAZA 4MSWA 2X4QB 1HHJA 3DARA 3RVWC 4NC2B 3CFEA 1LO4H 2UVFA 3N1MC 3X3GL 1GMIA 3HS0B 4UV7H 5AUMB 1H19A 2J4WL 2NOYA 3MBWB 4WI4A 3RA7L 1CGTA 4I3SL 4P23B 4Q9CA 1QA9B 3DV6B 3U1SL 5DMGC 4X4YA 1D9KA 4LF3A 2VDOB 1XQ4A 2UY6B 1QUNA 4FI8A 4OCMC 4PVNA 2X4OB 3H2WA 3VAEA 2XN9A 4JCLA 4J28A 2NW2B 2BP5M 5C3LD 1L7IH 5DJ6A 3QDJA 4IBVA 1IJ9A 4LB8A 4L8BB 1U3ZA 2DDQL 5DQJB 4AQ8A 5CR8A 1XSOA 3MRCA 2ZQKA 2DMCA 3ZHDA 4XP5H 2C7UB 5MEND 1LEIA 3LVEA 1A7OH 4ZT1A 1KLGA 2BP0A 3CGTA 4I9WD 3SQBA 2HVKB 3ZE0E 3FH7A 3RNKB 5HGBB 3EBIA 1JPEA 5F70A 1FZOA 4IK7A 4R26L 3S35L 3H85A 5IMMA 4FLOA 3MRRB 1NDMB 3M88A 4ZFOL 3BFWA 5D1XA 2EC9T 3O9WC 5DRXB 3PPSA 2GB2A 4H1LA 3P9MA 1O6SA 2A3TA 4E9SA 5J89A 3IAGC 3OKNA 4XZUA 3TONA 2W91A 2CHXA 4RBPK 4J4PA 4UQ2A 3EUUA 1Q72H 2E7MA 3IU3B 2BOBA 3FO0L 4EI5C 1GCYA 1G0XA 2V2WB 1NDGA 4PLKC 4QXUL 3U0TA 4S1QH 5L88L 1HC1A 3DX0A 4F7PB 3MREA 1QPKA 3BP5B 3HMXH 1WFMA 4JUTA 2ZYRA 5ID1A 5F9OH 2BC4B 4B5EA 5BS0E 2GJ6D 2VMEA 2VR4A 2WXLA 2J55A 1EJ8A 5MENB 4NKOB 2NNRA 3DGGA 4P5TD 3QNFA 1NAMA 2ODIA 4WNQB 5AZ2H 3QZMA 2AXFA 3BT2L 3CN1A 4AEHL 1J1XH 1KIPB 2ESVD 4MXQC 2YJLA 1HNYA 1A6WL 1FNSL 1T4WA 2HWZH 1GKOA 4N2OA 5F9WB 4N0CC 2J1WA 1XBRA 3SD2A 5IZ7A 1ZHNB 2DICA 4JHWL 2PWGA 1E28A 4LU5L 4OJFH 4XNYH 1NC2A 1YNLH 1FNEB 4W9KC 1A6AB 4PRHE 3S8WA 3ZZSA 5ERWA 1FIEA 2XV3A 4XE5B 4LLDA 3GLEA 1T1XA 1B88A 3X1BA 4OI7A 3LZLA 5TE7L 4ELKB 1XCQA 5JHDD 3RVTD 1O75A 4N8VB 2OCFD 5IW6A 4BXVA 5J13C 4S1SL 1U3YA 3WY2A 4CILA 3WFCL 1DTUA 1IAIM 3HUJF 4HS8L 3VXMD 1ZTXE 4G8FA 1HEJC 2GJ6B 4OZIF 1ZT1A 1WHOA 5JORB 1XV8A 1A4KA 5KSBA 1IGML 4YHPA 2JB5H 1P5VB 4P5TB 4M1GL 4TVSa 2RQEA 1CFSA 1SYVB 1DSFH 5EU7E 1DL7L 3KYAA 4B53A 2VC2H 4P0DA 3SKUD 3L45A 5I19L 1SRDA 1N64L 2HG5A 5HHVL 2OTUA 4N24A 2VDMH 3CFDA 1WE5A 4U1SB 4YZFF 2O5NA 3GBDA 3HC4H 1OSEA 3AU1A 3QC6X 4JKPL 4OQTA 4XNZC 2EKJA 1B3JA 1QSEB 3QO0A 4UQIM 1TFHA 4LSRL 43CAB 3M07A 5KSUA 4N2FA 4EAEA 2LHAA 4MCYA 4MX7A 3VXMB 4F2FA 3DRTB 5D70H 4N22A 4G6KH 4GSXA 1PZ5A 4UOJA 2E56A 1OGTA 4FXGB 3T65B 1LEGB 3UTQA 3ML8A 4TVPL 3QDGE 2J20A 3QNXA 1G87A 3LKQB 3DDGA 3CZFB 3EGSA 4N8UA 3NPSB 2C1OB 1XF3A 1IC7H 1P9MC 4F58H 4CC1A 3V6FA 1HOCB 1A5FL 3MV9A 1Z5LB 3L4WA 3N0PB 5HDBF 1FFRA 1ZTXH 1DSWA 2VMCA 1JV5B 3HRZC 3M17A 4MMZA 1XCTB 4PJ7B 2Y22A 2ZYHA 5KVDL 2IDCA 2R2EA 4NKIH 1BQKA 1L9NA 3I6LE 4N0FA 4QY8B 1CFQB 1TSHA 3D4YA 2ZAHA 3CFKA 1XZ0B 2HFEB 4HJGB 5C0BA 1OQOA 3K2MC 3TFBA 1KB5A 2Z7YA 4AJ0A 2YRZA 1ROWA 3ZDXE 2IPUG 2LE9A 3O2WH 1NGYB 5EBWA 3BQUD 4JN1L 5D71H 1PEWA 5GJTH 3TO2A 3B7SA 4PJ9C 4YAQB 4RX4D 4WO4A 2EDEA 4L3EE 4NBXB 5CP7B 4XVSH 1K8DB 1CXFA 2LU3A 3UJIL 5KW9H 1QW8A 3WELA 4F1ZA 1IVTA 4WHTB 5FECB 1ZV9A 5JPNC 3MYJB 1ZGLP 1D7FA 2ADJA 3NRFA 4JANB 4RMQA 2VABA 5KJ7E 3JTSA 5I1GL 1I9IH 1JWMB 3G04A 4JDZB 5IGXL 5KYXB 1WO2A 1UVQA 4X5PA 2Y1VA 3CMOL 4YDLC 3F62A 4OUUA 4X4XB 4U1HA 3V4PA 4HKZA 1HYRC 4JZNA 4HKJA 4AWJC 2SEBB 4QF1B 3FUNA 4FYQA 4U3HA 5T1MA 1OSPL 3BQUB 3ZT7A 1FRGH 5D72L 5F0PB 1AD0A 4U1IB 1KY7A 1KTRL 4OZFH 2GY5A 3F84A 4JE4B 4JZJC 5I17B 1T5WB 3ZTJG 5HGAB 2H32A 1USQA 5MEPA 1QR1A 5DMJB 1QASA 5D9SB 3RFZB 2HLFD 2WWMD 3KLLA 3NJIA 4BRJA 3IFNH 2F18A 3VGDA 3ZDZB 1HDMA 2HH0L 3B2MA 1EHLL 2HJKB 3UTSE 3L48A 1CBVL 1U8QA 2CKBH 2V2TB 3SDYL 5H35B 4EKJA 4F7EB 1OK0A 2D7NA 1U91A 2W0FB 3VI3E 2YRBA 1U8LA 2A9MH 5KS9A 3RHWK 1IM9D 1W0WA 5D7LA 2HVBA 4OFQA 3MNZB 2P5EE 1TXKA 3DVGB 4FJZA 5FKAB 3V0WH 5E4AA 5E4EB 3Q5YA 1NCDH 5AVYB 1E67A 1GGBH 2FO1A 2WC7A 3PFQA 1NJ9A 3L2NA 4CW1A 1GS7A 3KVQA 4AG4L 4V1DD 1FORL 4AQ1C 4JRYA 4QWWC 1CDHA 1OF2A 2DEWX 2F8OA 3KH3A 3ARBC 5DJAA 1DQIA 3KPSD 3RZCA 1MCNA 4M8UA 3G5WA 1IFHH 3QEQD 1D2PA 1ZLDA 1RHHB 2M83A 3ARGC 5I9QB 4F7CA 5CJOL 2AK1H 1CN4A 4ODTH 5FO7A 3IJ8A 1XGRA 2OPCA 4IOFC 5JW5B 1TJIL 3CFNA 2QFRA 3B2XA 2GSGB 2ZAIA 2IBZY 1IM9B 4U6VH 2G9HB 5HHQA 3WIHA 3F6LA 4HG4K 4GNKB 1NBQA 2MH4A 3GTVA 2COQA 2Q8AH 1COBA 3FAXA 2EICA 3CC1A 2OYKA 4ZOEA 4YO0B 2Y36L 1L9TA 3FTGB 2W92A 2YOCA 2D9CA 4UM9D 2BIQA 2BFVH 2ZCHH 3ARRA 1TZAA 2CLRA 3K6IA 1NCAH 3QEHB 4WQOA 1NEZG 1F1AA 3S98A 4JHAH 5DGRA 1U8NB 4AGMA 3MO1B 2GPZA 4OCWH 1ZK9A 1FJ1B 1A9VA 1R47A 2ZWSA 1S78C 1KIUA 3PP4H 1FVCA 2XTSA 4OFYD 3DUUB 4PCSA 5CEYB 5A7BA 3EH3B 3FU7A 3QZOA 2XPGA 3BOVA 1UWEL 4Y9FA 5EC2B 3S2AA 3AG2B 4RMRA 4AMKH 3A6CH 3UG4A 3OGOE 3QEQB 2ED6A 4GMTL 3CHRA 5IJVB 1P7QA 1V3KA 3DSFH 4PB9H 3AGVA 2WUBH 2JKRM 3O41B 3TVMD 3RJDA 5HHMD 2H1LM 4NPKA 4NN7B 1S46A 5DMGD 5HGDA 1L6XA 1MFNA 3QDMB 4WVRA 4DKAA 1U3NA 3W11D 3Q48A 3DOSA 1E4JA 1N4XL 1ZA3B 5D2NE 3S0PA 3L3DB 4UM9B 4UCFA 4R97C 1GIGL 2IO5A 5DI8B 1QP1A 3HI6H 1Z3GH 3C9NB 1JJUA 3F6IA 4JUSA 4WWKC 1XH3B 3RWJB 2MCPH 1FFPA 1IUZA 2AW2A 4LVNC 5EIVA 5EU7C 2Y7QB 3IJHB 2BSCA 4YSOA 4AMXA 5FR3A 3ZMRA 1NIFA 1J1OL 5D6DC 1KBWA 2FT8A 4HWUA 2IGFH 5KAQG 4NENB 2WWOA 1J5OL 1CT8A 4R5XA 2W07A 5DK2B 3EG9B 3NIGE 5IQOA 3WS3A 1XEUA 2D0GA 4IMKC 3ZU8A 1UZGA 4IKJA 3IWVA 2EH7L 3AWGA 1ZA6B 4QXTB 5HHMB 4P49A 3OZ9L 3D87B 1PKQE 1T2JA 1RZFL 2NDGA 4Y5XC 3SPGA 2CIIA 1U8OB 4A2HA 1GYWA 5L9DH 1ZT7A 3HI1B 4WV1C 2DJUA 2UVEA 2JTDA 5EF1A 4MYPA 1NWOA 5TPWH 1K9TA 3BUPA 4PLKD 1YCSA 4YPGB 5FHAL 5TDOB 3SE4C 4EUPB 4ZD3H 1BD2A 3BVTA 4NHUB 3P3UA 1AQ8A 4YSRA 2Y72A 1RK1B 1ECZA 2PXYC 1SY6A 3S3SA 4IOSD 3ESVF 4DZ8B 5DQ9A 1N70A 1FVDB 2X2YA 4YSSA 3FU6A 2GITA 3CVHH 1AE6L 4JZOB 4L4JA 2WXJA 1DBKL 3P54A 5CU5A 4MXQD 2B8OT 1KYAA 4MFHA 3T4AB 2FATH 3IKCB 2NSXA 3MROA 1IEBA 4X6CE 4ZUUA 4XMLH 2FWOA 2YGPA 1MQKH 3LEYL 3WO3B 3VG0L 3BZEA 1ZLVH 1DYZA 3ZVVA 1DJYA 2RCSH 1U3HA 1CXEA 1MFEL 2AGJH 2PR9A 2CGRH 5BVJB 3FQWB 4ZYKB 5K9QG 2K3TA 1MAML 4KROC 1UA7A 3LIZL 3AQYA 3OZKA 2R8SL 2AQSA 2NZ1A 2FECL 3TIEA 2OYMA 4AJYV 1WJ3A 5HHPA 2XKNA 4NRYA 1HWGB 4ACTA 5B21A 1JFQH 3CVDA 4PWFA 5IB5A 3Q2NA 1MZZA 1SJHB 3B2UC 1E4XL 1Z2KA 3OKOA 1WVZA 6CGTA 4EMZA 3DXAE 1DQJB 2ZF9A 5FDWB 2EE0A 3ZKSD 2ZOTA 5HSFA 2QV2A 1NBZA 2BVPB 1X5GA 2EINB 4ZUTA 1CD1A 3D07A 4QT5A 5F88B 2Q7YA 2BJML 4MNGA 1GGIL 3BZFB 5D93C 3FCUB 3GMRB 1SOSA 2YGOA 5KBMA 1H6TA 4QTHA 2PR4L 2AK4A 2G5RA 4FP8L 4I89A 4NT6A 3I9GH 1G9MH 4DSYA 3US0A 3I3BA 2WZ6A 3NZSA 1AY1H 4EZKA 5ANMA 4YSAA 4HSCX 2HX8A 2K6ZA 1NSNL 2P42B 2VDRL 4L5FE 1R24A 1U6AH 3ATFA 3C8HA 1CG9A 2DYSB 3VFVA 5L8LB 5F3HA 2XN0A 1EHLH 1JPFB 4IQHA 4J3OF 3DROA 1QBLL 4FYTA 5I8KH 3TPUA 4FA7B 1A7NL 1OARH 4QXWA 4DN4L 1OIOA 3F7YA 2ZCKL 4YHNA 5DC2A 4BK5C 3WXWL 4NQSB 1MCFA 5IEKB 2ADYA 2OJEB 2FECI 1RV6X 4MJIA 2JJWA 4G3YH 2YMXH 4I3RL 5AVZB 3P30L 4NKMA 4XNZB 4GEJA 4LL9A 2MKLC 5HYIA 1BPLB 2AJXH 4PRDB 3NVQA 3FYIB 1TQBB 2E75C 3UYPB 1KWGA 2O5ZH 1HWWA 3TCXA 2WBXA 5F3BA 1ONQB 4GSRA 5C09E 1IAMA 5KVGL 2VDKL 4LBEB 3FRPA 1HHIA 1X9UA 1Q38A 4JFQB 1I9EA 3AADB 4QRFA 4JX0A 2CAKA 4B96A 1IGJB 1TTBA 3PG2A 1A3ZA 1WCQA 2YUZA 4M61B 43C9B 5IREA 4HCGA 4YGAB 2H8PA 4LLWA 1XGPA 1Q9LB 4M5YH 1MJUH 2VERA 5GGUB 3VCLA 1BFOA 5CJOH 3GTTA 1IAOA 4QRPD 4L2YA 3VXTA 2WBWB 2ZOKA 3R1GH 5C0DA 1R3JB 3HVNA 2BP8A 3Q01A 5E4IA 1UYWH 1ETJA 2DQCL 4LOEA 4M7JH 4BM7A 5F7BA 2IEPA 3H9HA 3K4DA 4L5FH 2GAZB 1CDYA 2IBZX 4XRCB 5GGSA 4M43H 1GPOL 5AOMA 5J9PA 3KCWA 4BH7B 5A2BA 3HRZB 4MNQB 3BUYA 5DMKB 4HJJH 4KK9C 3UZVA 2KQMA 3EJUA 2PCPB 3U0WL 3DURB 3QJHA 4M5ZL 3TEYA 5KBDA 3CZKA 4XCCH 3VE0B 2NYYD 2FHCA 4IGBC 2JE8A 1Z3RA 4JHBA 2GJJA 1G84A 1J11A 2A2QT 2ARWA 4O5LH 3DJSA 3ARDA 3VXRA 1GKEA 1PG7W 4A2EA 1KZYA 3BD4A 2R7EA 1BEYH 2P80A 1SM3H 3O3BA 5E8NB 3FQXA 4Y2DC 4QRPB 3MOAH 2VDQH 5D8JL 4KDTA 1ACZA 4FQ1H 4QD2E 3D12B 4MAYD 1IJNA 4UTBL 4X4ME 4I3GA 4KQ3L 1M42A 5ETUA 3RTQA 1EZVY 3B43A 1A7PL 1K72A 5C0CB 4LPUA 1HKLH 4I2XE 5EBLB 3AMKA 1ZXKA 2LR4A 3AXLA 3QWRA 2FCBA 5D5MF 1A1OA 3X12A 3C60C 3NN8A 2X4SA 2FX7H 5I1DA 4QHKI 2DZEA 2QPUA 1JXGA 4HU8A 1GIGH 2B1AL 4IIQA 4Z7VF 1PAZA 4DF9A 4FQXC 4E42B 5GZOA 1EV2E 1PCSA 5CSGA 4YDLB 5D2NC 2EXTA 1CDBA 3OJMB 1A6VH 4I18A 3RX9A 2AEQH 1UOWA 1MCHA 2QVMA 2VR5A 3V10A 1R5VA 4D9QD 2R59A 4AGNA 3D0LB 4KO5A 3HAEA 4Z7WB 2J88H 5E8EA 2QVFB 4JZJB 1PBYA 2AXGB 3HBPA 4L4VE 2H2PD 3QWNA 4MAYB 4ES8A 1AGBB 4N20A 1PCXA 3PWJB 3GUFA 3K2UL 4RWYH 4RAUA 3LN4A 3RKPA 1F97A 5CD3B 3BZ4B 3EYFB 3NZUA 4FQHA 3MKKA 1J48A 1SHSA 4U1KA 1OHQA 3AT9A 1UZ6E 1T4KB 1ULVA 2R29H 1I9JH 2AZAA 2QZ5A 3M8OH 2B2XH 4KXBA 5CIPH 7CGTA 3KVDD 2D7PA 1M7DA 3ARGD 4UTAA 4PLJC 4LNRA 4YHLL 3H3BC 3IFPA 2IQAA 1A3QA 3QJZA 1UH4A 2MCG1 4XP4H 1MCBA 5I6XC 2AKRA 4RDQF 1BQHA 4ZX3A 4NUPA 5B1JA 4GBXD 3NCYS 2W9DH 1SXAA 5C2BL 5I75C 3BAXA 2ZOLB 4KMLB 4JY5L 4GAGL 4JPVL 4WFGD 4ZUWB 5BZDA 2WXMA 3N5AA 4F9LC 5DS8A 4IRSC 4S11A 3TIDA 5DC9B 3X3FL 3WEOA 1K8IB 4PYGA 3DOIA 3OMZA 3BWSA 3ZE0B 4AQ1B 5I1HL 4GP8B 3JWNE 3T0AA 3O2DL 4AZ8A 1E42A 3LKRA 2NXYC 3FN9A 1NFIB 2WUCH 3KGUA 5FYKU 3ARBB 2B3RA 3MGTB 4PRPE 4FQQB 4Z18A 4H0GA 1Y18B 4IRJD 4KKRA 3B6SA 3ARGB 2KHAA 4FZEL 4P5MB 4XPFL 5IQ9A 3X13A 1FAIL 3FB5B 3SBWA 2YXWA 3UG5A 1MCWW 2E8ZA 4DHLA 5H4ZA 2VC2B 3D08A 3ZHFA 5DD3L 2MSPA 4KK5D 4OGAC 2YEZB 3GYRA 4OFIA 3ZQWA 3BLPX 1DBJH 2JH2A 1AGDA 1HI6B 4GBXB 3BGFB 1JS4A 4H8VA 2IMMA 3ILQD 2IH8A 3ISYA 1DE4B 5KVGE 5IJKC 3DRQB 2ITCA 3IDNB 1UKTA 1AMXA 2NY7H 5HYJE 4MB1A 2CKNA 4XP1L 1OANA 3A6BL 3OAZH 1ZGLA 4MCZB 3EO1A 1P1ZB 2YWYA 4A7VA 1RUQL 3NSFA 2F8IA 4CNIA 3K6SB 1DP0A 2HRGA 4IRJB 4CN4A 3EHBD 3UAAA 3Q8CA 1JZ8A 1NFAA 2R1WA 3R4DA 3CH8A 2IAMD 1AJ7H 1G7HA 3CQPA 3QFDB 1JPTH 3L3GA 4KV5E 3QRLA 1KZQA 3FTWA 3HG0A 5INDA 3JWNH 4FFZL 1SN5A 3VNZA 3FDWA 4APXB 5ECGA 1PNDA 2G2RA 3GSOB 4WW1A 2RTTA 2EIJB 3LPWA 4BQ6A 2D2CC 4OTXL 1FFOB 1FCCA 3NJXA 2LLNA 4YH6A 1RY7B 4R90L 2F0CA 4Z5RA 4ETYA 4LDOB 4R97B 2JXMB 5CN3A 4L8SB 1HH6B 5CLZA 1NKGA 1HK6A 1HESA 2X42A 3KR3L 4WWKB 2ZX9A 4A6YA 4LVNB 6PAZA 5IB1A 2APWA 1BVLB 2AV1A 2Y0SA 2UWEF 3WGUB 5HDQL 4OAWA 4QIRA 2A4EA 3CDGB 1EJFA 4YHOH 2HLAB 3VSVA 1T03H 2HPTA 3TA3A 1MHCB 2HRPH 4WU5A 2YAEA 3MBXH 2G5UA 4B7LA 5DD5L 3FOMA 3TJHC 4CC4C 1P4BH 2X6CA 4HUNB 2K7PA 3WLBA 2IAMB 2RA1A 5IMKB 2F08A 3GKZA 4GXVL 2OR8A 4JY4A 4WI6A 5GGVY 4A68A 2BZCA 4XXDA 3Q6FB 1OAQL 2QJDA 4AGPA 5EOTB 4PJDB 1UZ8B 3MV11 1IVLA 1MCPH 3C08H 3MLRL 4XNQA 1LO2L 4WV1B 3DMMA 5K39A 4NI6A 3CUPB 3RIAF 4PWGA 3MCG1 2XLLA 4NDMA 3P73A 1FLTX 5IOPB 25C8H 3VG9C 4WK4B 2N7BA 4BXSV 3CBRA 2PXYB 3KJ4C 4GO8A 4JKKA 4DAGH 2A6IA 1ZWIA 4RMUA 5JA8B 3VYNA 4AYSA 3FZUC 1XXDC 4N90D 5DJXA 2WKOA 1SF3A 2DMHA 1I8LC 4PJAA 4L1BA 4TM9A 1U8MB 2J8UA 3BAJA 2WD0A 4ZRGA 3VH8A 2OSLA 1OB0A 4QHMB 4E9RA 4XN1A 1WLHA 3DJRA 5BQ7A 4L05A 1NGQL 1SXZA 4JRWA 4NQVA 4XCNA 2P8LB 1UH2A 3MRLB 5IKCB 5CZVL 3QW9A 2XWTB 2AJZA 3G6JA 2N7AA 1ID2A 4QAMB 1QBML 4XX1E 1HYSC 1F4HA 5DD6A 3H3PL 4FC3E 4F33A 4KVNH 3ROOA 2P1YA 4APQD 1DJZA 1II4E 4NNXB 1QFWL 1A3LH 2ZWZA 3ZDXB 4YNYA 2HFTA 4K94H 5CHNB 5L4IA 2CKBB 3OB8A 3AUVA 1F2QA 1G7LA 3LXUX 1B0RB 3TF4A 1TJGL 1I1AC 4AIXA 2OSXA 4DUXA 1S5HA 2P9RA 1EZVX 4L3EB 3SKNA 4HEMA 2JJTA 1IM3D 4XOBA 4JQIL 3TTSA 3DDFA 5FYLL 1UM4L 4KO7A 1W72H 2ICEC 2WN2A 1LEKA 2FJUB 5JOPE 1XT5A 2Q2LA 4ZFOA 1AGCA 1KBKA 1P5UC 1VGEH 5D93B 3UFIA 2HSIA 3FRPG 3NA9L 5E6ID 5IV2B 5I18L 2HKFL 2OXGB 5ICZA 4LCCA 2JIXD 3GXFA 2C3VB 1GTNA 2WO2B 1NGPH 1U41A 1P7BA 1A4JB 2EVFA 4Y1AD 1QNZH 5DUBA 2AJYL 1L5GB 4WTZA 3TT3H 5DFVC 4BZ2L 5D6CA 5B3NA 1IKNA 1PSKL 2IOIA 6FABH 3SPVA 1BBJA 1EAJA 4MJ5A 3IDUA 4O58H 4NZ8A 3Q5OA 1IM3B 1NCBL 4FQJL 3ASOB 3QJFA 2ZUSA 3I75A 4FULA 3FK3A 4G1MA 4Y19E 2D4DA 1QFWI 2WLLB 5HPMB 2OK0L 2OMXA 4KUCF 4KQ0A 1A2YA 1MNUH 1DEEA 1FI8C 2F7QA 1FFQA 1TKWB 3O2VH 5MEQA 4Y7MA 3HUJE 4JFHE 4B97A 3ZX1A 4CKQA 3VDBA 1OP5H 4OZIE 1XEDA 4JO3L 3C5ZC 3VI3B 3OQRA 5IMLA 4C4KT 2JIXB 5FUOL 3EJTA 1JHKH 4KK9D 1KN2H 1I7ZB 1U4FA 5I6MA 1FNGA 2DB8A 2OXHA 4I5BB 3TH2T 2NPLX 4Y1AB 3VFRA 2VERN 1KG0B 2DAVA 4FCAA 4NQDE 4IGBD 5GHWL 1QUPA 3RZWA 4F7TB 2V17L 4YZFE 3NZHH 5BQDA 4H2AA 5TE4H 1DDHB 1FPTL 4P2OD 1YEDA 2R4RL 2A4CA 4DPAX 5LAPA 3MXVH 3VJ6A 3MBED 1CDCA 4P59H 4XO5A 3SDAC 4Y2DD 1TU2B 3O11B 3FKUS 1DVUA 3JBG7 1IGYB 1I85C 3LV3B 3Q5TA 3VFMA 4HZLA 4LPTA 5C0AE 2CRYA 4WEUD 3K1DA 1C7SA 1DQML 1R5IB 2R69H 4LARL 3IMRA 2BSSB 2VISB 4M1DH 4PJXB 5JW3H 3GUTA 1ILUA 3KLSA 3TA4D 5GISL 4IRZH 4RFEB 3C60D 4JDEB 3U7AA 3DJZA 4R4BB 1SBSH 5LO7A 4RA3A 5FWQA 3PL6C 9CGTA 4KJWD 5JLZA 1JN6A 3HLAA 5AKRA 3G3LA 3IPEA 3FUFA 4UU9B 5IB2A 4IGBB 5B39A 3BVXA 1L4IA 4HVBA 3PHSA 5HDBE 1CI5A 4G8IA 1HH9B 2I7SA 5EOQL 2CIKB 3MBEB 4NB7A 3L3OB 4Y2DB 2VKXA 1RZ7L 1QPXA 4W93A 3WXVL 5A43C 2FH6A 4MJ6B 4N2EA 4YHYC 1JXKA 5ESVA 2FYYB 3NFSL 1RERA 5JPMC 4RAVB 4BSVB 1K4CB 5FOBB 3I3EA 4MB5A 1IBGH 2HFGL 4GW5B 4U6HB 3FRUB 3X1FA 1G1CA 2VITB 3ESUF 5I82A 3SE3C 2MHAB 1UD8A 4QHUA 3C60B 3BVDB 1NAKH 3IMSA 3MA9L 1H3WM 1A9EA 1GZPA 3DSNA 2EEBA 4TF4A 3CVHB 1WG3A 4FQXB 1MVYA 4E0RA 3ULUF 4RFOL 1FFNB 2CR0A 4ZX6A 4NJAH 2FIKA 1Z9LA 5D2NB 2OW7A 2FQGA 3OJ2C 3HE7A 4LKCA 5HVWA 3MRJA 5EIIB 5SWSA 1K6QH 1GS6X 1T7ZA 4H88H 3LS4H 4MDRA 1B6DA 3QZWG 3QUMH 2RQ8A 3EFDL 3FB6B 2DQJL 2PO6C 2F7RA 4IRSD 4GB9A 3P77A 1UXMA 2DM3A 5I1CL 2X4TA 1S7TA 3IAQA 3BE1L 4K94C 4L9LB 3UBXG 4PJ5D 3WDJA 1PTZA 5MERA 3BO8B 1UB6B 4UANA 3FF7A 4XNUH 4MA8H 4QHLB 4KI1A 4G11A 1IBHA 2XPZA 2NR6C 1RKRA 3TO4A 2GIYA 5EU5A 5AD0A 5A6LA 5EO1A 3NDZE 5BXFB 3A4EA 3UERA 1Q0EA 5CGMA 2V9QA 2Z92A 3PQYE 3K6OA 4P3CL 1WF5A 4X7TA 1FIGH 4DT2A 5IB4B 1D3CA 1X7QA 1XCWA 4OGAD 1KIQB 5I1JH 4PJHB 3LNDA 5DFWH 1BM3H 3GRWL 3QEGL 1EHNA 3C8KA 4NWUL 5I75B 1T89A 3QNZA 5KJRH 5B7EA 4FG6C 1Q9KA 1PF3A 2M2DA 1OSZA 3GMQB 3HNTL 4G7SB 4IRSB 3BEVB 2D03L 2WLKA 4H44C 5BRZA 2EXWD 2PABA 5BV7B 5C92A 4PTUB 3P40A 3B1UA 2VRKA 4YIQA 2IPKA 3P4OB 12E8H 1HHGA 2BZ7A 3P4NA 3QORD 1VLXA 4LOFA 4ERSL 5JNYA 3VFWA 2W9EL 4LP5A 4F27A 1H3PH 1MCSA 3RVXC 4X6CB 1XH2A 4E9YA 5CO1A 5F1IA 1UT9A 3QXDB 1KPUB 3NESA 4H0HB 4RGOL 4GG6F 2BOCB 2WLJA 4MB3A 1N8OE 4I4WA 1VFUA 3PWVB 1S2EA 4AH2A 3B5GA 4NN5B 2J2ZB 4YBLC 2DKSA 2F74A 1PLAA 1KYOK 2G30A 2NDFA 2VR8A 3AS1A 3P4LA 4Y16C 4ZAKA 1G5AA 1XF4A 5I1KL 2WQXA 1M7IA 5E5MA 5D7SL 1HAWA 4BUHA 2Y6TE 1KJ2H 4NUJB 1CICC 3RQ3A 3HPJA 1TETL 2F5AH 4HAKA 3PUUA 5FGBC 1CZ8H 4JL1A 2F9BT 5F0MB 4LKXB 5D55A 2Y24A 2OLDA 4BWTA 1T7YA 4KUCD 1GYAA 5EEZA 3FO1B 1JHLH 2DM7A 4J12A 1SGKA 3TJHD 3ABMB 4AV4A 4BWWA 1ORSA 4R4FL 2J1XA 5EBGA 4BZ2H 4UUJA 1IBYA 4F9PC 5JHBA 3EH2A 3T3PF 1ND0A 5IFAL 2XQ0A 2IIJA 5G4OA 5LKNA 4XOEA 1TVHA 1JL8A 4FZ8H 4R7VA 4Z7QF 1SDDB 2A9NH 5C09D 5DHYB 3VD4A 2W60A 1DZ0A 4Z7UA 4AUJA 2YEQA 2HX9A 1NCWL 2FO4A 4YX2H 15C8H 4WENB 5JDSA 4OLEA 4BFBD 4HLZH 1N5YH 1RURH 2VR7A 4YR6A 4H20L 1S9WA 2H5UA 4GAYB 1ITCA 2MQ3A 4KVPA 3STZA 1JG9A 1TZIA 3IJYA 4XBPB 5CUSH 4D0CB 3PWLA 1Q0YL 4R7LA 3IGKA 1E5BA 4GAJH 2UYLA 4G8EA 4RISL 5JIKA 1I8IB 2FVNA 3DIVA 5FFLA 1SFDA 1ZLWH 4CSTA 2X53A 1JGLL 3OX8B 2VWEE 2AEPH 2JI1A 3WJJA 1FL3B 1Q94A 2WSDA 2PTTA 1AOZA 1RZJL 4XN4A 2VLRA 3NABH 4AEEA 2WWNA 3EYVB 4ZUSA 3CFJB 2P7TB 2H0FA 5EU3A 2B08A 5C09B 3QUZD 4PBDA 1EGJL 4D8OA 2GJRA 1N6QH 5AUMA 5LVEA 1E7UA 2ZWLT 1QTYT 3MBWA 4GT0A 4JO1H 3VXNB 3WHE0 4P23A 4I13B 1WH0A 1EFXD 4KJQC 4OVVA 3OLEA 3MXWL 4BK8A 1Y07A 2J3SA 5DJZA 5I8EB 1Q9WB 1FN4B 1CIUA 5DSCA 3Q8AA 4MGXA 2NW2A 3U9WA 3EUDA 3QRFM 5IIEA 2X3BA 4L8BA 1MJ8L 2QSQA 2I07A 5IY5B 2WYTA 4FFWD 4I77L 5FUCE 1PL3A 1QFUH 4GW1B 3H1ZA 4KKBD 3AY4A 4X8CA 1JNNL 2DQUL 2BSEA 2UUDK 4HIXH 5DRWB 2PW2B 1HFUA 1JWUB 1JXFA 2Q6WB 4LPVA 4Q7DA 5LCVH 5C70A 2IDTA 3G9VA 3OMNB 3QUZB 3MRRA 1NDMA 4KKQA 4NZUL 3RUGF 5CM1A 3EBHA 3QJQB 1S7UB 5BZXA 2Y5TA 2AJSH 3OWRA 2ENYA 5B3JF 5CIPB 5DFVD 1F5WA 3FBKA 3W0WD 7FABL 3T0DA 4JQVA 4LLMB 3E2HC 1D6EB 4F7PA 3B9KC 4BFEA 2GY7B 1D7CA 2ETWA 4DCQB 3L9RA 4JKWA 4YBQC 1UC6A 4I2XB 3U83A 5MENA 4NKOA 1YNKL 5D7IF 3WKML 4E41D 3GMMB 2ARJQ 2KQNA 3I2CL 4S1DD 5C0EB 3GI9L 1IFRA 2OULB 5B8CA 1P5UB 2H0JA 4LK4A 3UJJL 2K78A 3C5ZD 3ISRA 1H3UA 2D2OA 1KACB 2IG2H 1KJMA 2TSBA 1FYTD 2FIRT 3PE9A 5K9JL 1RU9H 3Q3GA 4JKMA 2FB4L 3CD4A 5GRUL 4ZMYA 1WSST 1C16B 2EIZB 1B2YA 2FWUA 5ABDE 5FCUH 1JZ2A 4CMHC 2OJ1A 1AOHA 1FNEA 1AS7A 3LIZA 5F7YC 1A6AA 1INQB 5DLLA 1JGVH 3CFBA 3W0WB 1WAAE 4LVOB 4WI0B 4DPBX 2M26A 4J1UB 2QTVA 3BHBA 3G6DL 4LSDA 2H6UA 4RRPM 1ETB1 4JFWA 3CSTA 4UQEA 1YRKA 4ABQA 4PUBL 1H5BA 1GGCH 3J07A 4NQTA 3VGEA 3U9UB 1P5VA 2DLEA 4IBSA 4P5TA 4E41B 4MVBC 1EVTC 1NIEA 4WJKB 4HG4J 2F7PA 2DQEH 2ATKB 1P7KB 1QEWA 1XO8A 3C5ZB 4J3WA 3SBPA 2ESVA 1FYTB 1KOAA 1NFDB 5KSAD 2JJSA 1FH5L 5HI4D 1NLBL 4TLKA 1BMZA 1YEHH 4U1SA 2O5YL 2XU9A 4NZRH 4EDWL 2WPGA 3V7AG 3NK3A 4FADA 1L6ZA 3ZJAA 4ZI8A 3GI8H 2Q7NA 3PUCA 4YS4A 5ADOL 4OCXL 4OZHF 1ODAA 3AUWB 3I50L 3HI5H 4BQ9A 43CAA 1WCBB 1CFBA 4OM0L 4Q0XL 4YSCA 1VZGA 5BOPA 1IC1A 3LXCA 5JHDA 1W6LA 3KLDA 1QRNE 3ESPA 3SDAB 3B9EA 4KHTH 3VXMA 4D8PB 3SGEI 3DRTA 3HZVA 3SGDI 2W5PA 1CJYA 1M6UA 3BLBA 5AWNH 1A7RH 1NGZB 4PRPB 4UDUB 4FXGA 1VF5C 3T65A 1LEGA 2EH8H 4TV3A 1GHFH 2Z35B 4WW2C 3F7PC 5GRVL 2OYPA 5JW4Q 4LRNH 4PY7B 3RX7A 3LKQA 1JZJA 5CBEA 5HYSB 3JZ7A 1AZNA 3TWCH 4JHVA 5T33L 1AGFA 4ZSOE 1A4BA 2AV7B 4KPHH 3BGMA 2YD7A 3JSSA 2ZJSL 4GKZA 3LNHA 4A1RA 1G7QB 3OF6A 2GTWB 3SOBL 2AJUH 4N0UE 4BKTC 3FFDB 1RUPL 3FTUA 5I23A 1JV5A 3VFPB 2C4XA 4PJ7A 5L6YL 1EJ6A 1MHPH 3G5XA 1YQVL 4KXDA 5C1MB 4QY8A 5I71C 3GKWL 2AEIT 5T1KD 4ZS6D 3S5LA 4HJGA 4UV4L 1T6WA 3OKKB 2Y7SA 5E8OA 4KK6D 1E8ZA 3ULVD 3PYCA 4HPYL 4N4YB 1WBXB 3T2NH 1AHMA 1SXSA 3JWDL 5GGVL 4JY6B 2PO6D 4YHYB 3VFUB 3DKHA 1IQWL 1NGYA 2WN3A 1IGCL 1LO5B 4A38A 4MZ3A 5JPMB 4LHUD 4AV0A 3ZT6A 8FABB 1KV7A 1AQKL 4UBDC 4AK2A 1PJ9A 4DZBA 2VW6A 5E0QA 5I1LB 2X87A 2GTZB 5CP7A 4LVHB 1K8DA 4UI2A 2X6BA 1OAYL 3FQ2A 3APNA 1JTTA 2OCJA 5FECA 3KPRD 5FB8B 1MFMA 4PBXA 1OEZW 1WQVT 2OMBA 3RRQA 3QIBC 3HZKB 5J1AB 2Q7AA 5LLIC 1JWMA 5CLTA 1UACL 1B0GB 5HHOD 1WZ1L 2WLMA 5T1KB 3US1A 3Q1SH 2XQYA 3ZE2F 4F8NA 1ADQL 2VM3A 5D5ME 4KVCH 5B4MC 4YEFA 2A77H 3LY6A 3SKOA 4ACPA 1D5BB 2VR9A 4BIKA 2PO6B 3DX1A 5D7JD 2SEBA 1ID5I 2XWBB 2DQTH 4NNYB 2QPDB 3W9DB 3OWEA 4UTBA 2IQ9L 4HFWB 4LHUB 5C0JB 5B3SB 1T2XA 2QKSA 2QKIA 4U1IA 3ZXAC 2VWEC 4LDEB 4RX4A 4KJYA 3KYKL 1GYCA 1T5WA 2UZYB 5BV7L 2JK5A 4PCTA 3NH7L 1N19A 3RVXD 4RGMB 5D9SA 3T0EE 5KBLA 3RFZA 1U95A 4YXHH 1JZEA 3IE9A 4BDVB 3ETBF 2FX9H 3SE6A 1ESOA 2ADIB 3D4CA 1DLHB 3KPRB 3MA7B 1DVFC 3LZRA 1J8KA 1GJIA 3N44B 1W72B 2V37A 3AG4B 2V2TA 2CHDA 4NERA 4X5XB 4G6JH 5H35A 5HHOB 1CCZA 5JHLL 4GUCA 3BESR 2QPEB 2W0FA 5I30H 2YPKB 3REVA 3U30B 3OV6A 4MJHA 3P3YA 5FAAA 4OJDH 1OALA 2NNAB 3DVGA 4OF8A 3V6OE 5FKAA 4JPKH 3RL1B 4ZBJA 5ABAA 4EOWH 5FUCC 2XWCA 1PZCA 3ZDWA 4O02L 1E4HA 4P2RD 2Z3FA 3WLWD 5BVPH 1XBDA 1Z9MA 3PDGA 5DZLA 3U1PA 3F12B 4OJEH 3EYSL 3WNOA 1U93B 3QAZB 1HNGA 3G9AB 1CURA 4LT7A 2QGBA 4PR5B 3ULSB 5F1NB 5GS2D 3TCLB 1MRDL 2YGQA 1T2QL 1KGUA 4XPAL 1CXHA 1QNIA 3B2PA 1BFSA 3LKSA 5IHUH 2X1OA 1V7NL 4I8DA 3GIVA 4YBLB 5C6PB 2P5WE 5JW5A 2Q6WA 4JCWA 1HOEA 3OKYA 3BAEH 5LNEA 3ZTNH 2BVQB 2BSRB 4QAWA 5ENWB 5IFJB 3ET9F 2CA4A 2NTFB 3CFTA 3JZYA 3TV3L 3NQKA 1EDYA 2VKWA 1NMAH 4YO0A 1R5WB 3FTGA 3O3AB 3D2UD 5L2KD 4JFDE 1FG2A 3O2DA 4HBCL 2EUVA 5GSRA 2VQUA 3DGDA 4X4ZA 3BUIA 5J57B 1CU4H 3VNYA 1FO0H 1TCRB 1U8NA 2K6YA 3H8NA 3MO1A 4V1DA 3DETD 3ZYZA 3SGEH 3UTTD 1FJ1A 1W8EA 3GBNL 3U4KA 3SGDH 5CEYA 2JMRA 4LLYA 5I2IA 2Z1PA 3DUUA 1ACCA 2H3NA 3DVNB 5EC2A 3KPSA 2A6JB 4G7YH 5IQMA 5FGCE 1H3GA 1O7SA 3QEQA 1MLBB 1MCJA 4M62L 1P2CA 5ILTL 5IJVA 1E5CA 1I3RA 2EDRA 4KXCA 4XP9H 1NCTA 1MPAH 3CSBA 2G3ZA 3WDIA 4NRZB 3O41A 3BDXA 3UDWC 3EYQC 2VXVL 1MCRA 4XGZB 3DTXB 1JZGA 3O3UN 3BGAA 2X6UA 4Y19A 3VSTA 3HBZA 4QO1A 2P49B 1MEXL 5L2KB 1LQSR 3D2UB 4J2QA 2XA8L 3BPCB 3L3DA 3VDCA 4XMXA 3BDBA 4Q9BA 4JFEA 3CPUA 5DI8A 3PJNA 4F20A 4PJEF 4OM1L 4R4NC 4DGYH 2MOGA 3C9NA 3G5ZB 4XPGL 3UTTB 3CNKA 3FTVA 2Y7QA 2NY5C 4OFYA 4LSVH 4P57A 1PYWA 4XPBH 5J6HB 3PWPE 4HGMA 3EH1A 2YK1H 2V3FA 1NA8A 1BQ5A 4HJ1A 4B9KC 3FQNB 3HNVL 3GMPA 3QI9C 2UWEE 4FFZA 4FG4A 4K71C 4NI3A 4ODWA 4EI6B 2J44A 3TVMA 2NLJB 1EXHA 1SJMA 1ZA6A 1ODUA 5F6IC 4MS8C 3LHPL 3QJOA 1BJ1H 4LDCA 4BA0A 5ELIA 4WRLA 4GRMB 1U8OA 3TNMA 3QZBA 4NHCH 1MFCL 3HI1A 4BH8B 1ZSDB 1HXYB 5TDOA 4EQ2A 1I8MB 4NSKB 2ZSVA 3HZMB 4NHUA 5C0AB 4KFZC 2VDNH 3RG1C 4XN9A 1CFVH 2X3CA 3GXIA 4Q6IC 3HMWL 1C8QA 4CMMB 3QUMB 4OLZL 2FBOJ 4CADB 1B2WL 2FNWA 2AS5M 4GW4B 2FD6L 2APXA 2ED9A 4BFFA 1QLRB 3S3DB 2HVJB 3D69A 4QGYA 3T4AA 3X1GA 5KAQF 3BSZL 3TZVC 1RJYB 4NXKA 4OF6A 5CINL 4L3FA 5ISZE 3W39B 3B2VL 4K2UH 1ZANL 4P46C 4N8VG 1BF8A 4UT9H 1EZSA 1OD9A 4UAOC 1S6NA 2Z6FA 2VLME 2AFNA 1BIHA 3AS0A 1QRKA 2HMIC 1ORQA 2AQRA 4HH9A 1VAHA 3TT1L 3ULUL 1PD0A 5DJ0B 5DK3A 3FQWA 4ZYKA 5E9NA 3ME0B 1E50A 1ZDQA 1FDLL 4N6QA 4W9CC 1JHTA 2J21A 4OQ1A 1CDUA 5E7FA 4MA1C 4G9FD 4O9HL 5DD1H 1N26A 3EZ8A 1B9ZA 4UILL 2HJFB 2D7TL 1XIWC 4BCXA 3C6LC 4IOSA 3CQFA 3V0GA 4KKNA 5EBMB 5J3HD 1EUTA 2IDFA 2WINB 1E8WA 4R7NB 1D6VL 5DHDA 5DWUL 5EN2B 3FN3A 4MVBD 1YECH 4ATTA 1RQ5A 3P9LA 4L0PB 2LFGA 4UM8A 1DQJA 1VCBC 1Q8MA 4UT6H 4YDVA 1XWVA 1KCSH 4JRLA 4NZTL 3CBKB 5EUKA 2BVPA 3G5YA 3PQYD 4JFUA 2A9AA 1BVNT 2Z8VC 3GRGA 4IM8A 5F88A 1I7RB 1D5XA 3BZFA 1JZIA 3CLFL 3PAUA 1MLCB 4CMHB 1UUSA 2YD1A 2VE6B 3MJ9H 3KWTA 1KELH 4KTEL 35C8H 1SJXA 2I69A 4R84A 4GMSH 1CGSL 4QRUB 1BAFH 2LAGB 2JJVA 4EPSA 5I6KA 5FM8A 3PGDB 3FB7A 4JQIA 4HHGA 5KSBF 4G9FB 4IHOB 5D1ZD 3NEEA 4DESA 5IBTH 3TJEL 2YWZA 3V5DA 1QLFA 2WNGA 3MLVL 5FDYA 1JPFA 2YAMA 1O7DE 3ZSSA 3T0EC 1MWAH 1F1GA 3CZLA 5AB9A 4TSCH 2D4FA 1KJ2B 3HN3A 5E08H 1DQDH 1RL1A 1UD2A 1VSCA 4GRWE 3N42F 5AB1A 4P8QA 2IANE 4MASA 1C12B 3AQXA 5BJTA 4ZXBD 5IEKA 1SN0A 1W0YT 3PQYB 3L54A 4KAQL 3T77A 2D0FA 3VXSE 3ZKND 2EO7A 1XL6A 3OXSB 2L4OA 2ENQA 5INCB 1AXTH 4G80B 1YVLA 1I3GL 3AMLA 4NWTH 2R56L 4BZ2A 1BFVH 2C4FU 4JG1H 3VMOA 3D6GA 4KH2A 1Q1JH 4M5TA 5FYJD 3SQOH 1KULA 4JFFD 3N41B 4YBHA 3V6OC 1IKOP 3DI2B 4JLRA 4LBEA 4LLVB 4XOAA 3VM7A 5BNXD 5C7XL 4JFQA 4HOMA 5D1ZB 1R17A 1U92B 3L3KB 1IGJA 3P2BA 1SEQL 4W9GC 4C59B 2YMOA 4C57C 3LEXB 4M61A 4W9LC 43C9A 4NBZB 5BOZG 4IIZA 5DZNA 3V55A 4ZW5A 1Q9LA 4WW2B 2P28B 1DLFH 1J88A 4UBDD 3S37H 2DTML 4Z0BL 1R3JA 1TEYA 3ATBA 5EU6D 5AB2A 2HZHA 4ZXBB 3GB7B 4I1RA 3P11L 5FK9B 2NQDA 5I1EL 3RNQB 4FTDA 5BW7A 3IFLL 1NCCH 2BIIA 2I60H 3QIBD 1TMCB 1CDGA 4UNIA 1J9SA 2JKXA 1G1KA 5F7LB 4ZPTB 4KMTH 5LUMA 3GHEH 4L8DB 1CFMA 3OAYK 3QEUB 3DURA 4JFFB 4PGEB 3QHTC 3MAWA 1UFUA 4GRWH 1LO3L 2FSDA 5B4MD 2G60H 4BJLA 1CQYA 3TBBA 2DF3A 5TQ2L 2GJZA 3QUXD 1A64A 1UFGA 1WBYB 4Z78A 4FEIA 5LBGA 3TBVB 1KTJA 3FCSB 3ULVL 1LP9E 1PFOA 4FCHA 2J73A 5DRNB 2OZ4H 4DP7X 4XBGA 1CWVA 1M7UA 5BUGA 4TNGA 3OPZH 4Z7OF 1AZCA 2OI9B 4GG8B 2BX5A 1U8JA 3MRFB 2F58H 5EU6B 1OTUC 2YS4A 1X6NA 3D05A 3GGWB 5E9DE 4NUGH 3MODL 1H9DA 1LK2B 4ELDA 1F8TH 3TEWA 3QIBB 3MZTA 3A67H 3OMAB 5AW3B 3X1NA 1HHKB 3N06B 4QHPA 3LSOB 1YC7A 4XVOA 3P0YH 3BKJL 1UJ3C 2EE2A 1R3KB 1MI5D 3KPQB 1PDKA 4GLRH 4OIIH 5CILL 4ABUA 3WMSA 3PNWB 2E7DA 1BQSA 4JVUA 2NX5E 4NRXB 4X50A 1VADB 3QUXB 3NK4A 4DP4X 1C08B 1J0ZA 2JKNA 3AQDA 3QXWA 5C08D 5E2VL 5M7QA 1NGXB 3AC0A 3QQNA 3HPLB 3BIKB 4ZG1A 4G8GE 2FX8L 1TITA 4ZFFB 2AXGA 5F7KC 4XCEA 3S4SG 4MAYA 5I15L 4L4TE 2PNDA 1NEZB 5EMYA 1JAEA 5AZUA 2JB6B 4MXWL 1DJSA 1TG8A 3PWJA 3UACA 1RJLA 4BZ1H 3GM0A 2HPOA 5CD3A 3V0EA 3BZ4A 4QHKJ 4XBEL 1KIRB 4BZYA 1T4KA 3RX5A 4AIZB 5GSVB 1GZQB 2DQIL 5KVMC 4X99B 1FE8L 5KS9F 1Q0XH 4JFOB 5E5UB 4WEBH 2JTYA 3VU1A 4HMEA 4PJGB 2HJLA 1MI5B 1SOXA 5AVVB 3FCTA 2YPLA 3L5XL 4NYLB 2CBPA 2V0AA 2ENJA 1R3HA 1ZVSA 3Q6GL 4OLZH 5C08B 2ZXCA 3MGAA 2WAQA 2BY1A 2ZOLA 4FNRA 1E27B 5AVTB 3VYPA 4L1SA 1VACA 1WD9A 4WI8A 4ATWA 2WJ5A 3RGHA 2WXPA 4KY1H 3PU7A 4XWGH 3V8OA 2OAAA 3H9SD 3QIWD 3EFOA 4TNFA 3MLSH 1NFIA 4ZMZA 5ADPL 2XETA 4M4RB 3MGTA 4FQQA 4GQQA 1Y18A 4HIHA 4DW2L 5B38G 4C83B 5AW5B 3L3JB 4P5MA 4RNRB 1PIFA 3FB5A 5D4JA 4ZFZA 1TCMA 3GRWA 1FLRH 4GQ9H 5JIHA 3EOAB 2Z93B 3D4ZA 4UILH 1JYXA 5CD5D 1RZGB 4MKTA 4J6IA 5EH1A 5LGHL 4DVRL 1ASOA 1HI6A 5I1IL 1Z9SA 3AABA 3MRMA 4GBXA 4X8JB 3MACL 3ZGHA 3GSNB 1AR1C 4F92B 1DZBA 1A6PA 1MW3A 3ZIYA 5GPRA 3DRQA 4P4KC 4WDIB 2MEJB 4P3DB 4NLHA 4UZUA 1NCGA 3D33A 4R4ND 1VHPA 5EV7A 3I9IA 1X9LA 4ZDHB 2XI9A 4L8CB 4ZO6A 3QIWB 3SDXB 3MRBA 2KI6A 1QVOA 1P1ZA 1JZ4A 3FONA 1NH6A 3ZHLA 3LEVL 1CFNA 4NFDA 3K6SA 2H1PH 3FT4A 4IRJA 3GBMH 4KOCA 1WIPA 4JVPA 4ICWA 3MVSA 1BPVA 1OWWA 4ANXA 3UC0H 3OHXA 4KGLA 3NCWA 3VFGL 4K9JA 1T0MB 1G9HA 3M1CA 4LQFH 5EFIB 4EUPG 1HXMB 3RGVA 4JG0L 3SIKA 3GSOA 3T3PE 3T71A 5KYWA 1SFHA 2JELL 3C6EA 3UJTL 4PGDB 4ZTOH 4Z7QE 1AQDA 3EJZC 4FQCH 1O7DC 3VRJB 4YFLF 4B5ZA 3C75A 2Q8BL 1LGVA 4B7IA 2XZAH 4DETA 4L8SA 1HH6A 1JK9A 3QT2A 4HJIA 5ESQB 3MU3A 3FT0A 4V33A 5G5DA 4E9QA 4MQXC 3R06B 3SCMD 5KYYA 3T6QC 1A7BA 3F64A 2BNRA 4R0LB 5EDXA 4X8XA 3MNDA 1CPUA 2HKHH 2R1XB 4ODXB 1L0XA 5ITFB 3AGWA 1OGAD 3FMGL 1F3DJ 1HQRA 1L7TL 5AYUH 2IAMA 4BFIB 5IMKA 3TZVD 1IEAB 4NM4H 1NGWB 3WFDH 4P46D 3Q6FA 5EOCL 5F6IB 1KDIA 5DHEA 4PJDA 5EOTA 1N7MH 1UZ8A 5EIQA 4M6NH 3VACA 5E8PB 1BX2B 1QRNB 4TQEL 1U8CA 2HMID 2AQNA 4HX1A 3ILPB 3CUPA 5KN5B 3UCQA 3BW9B 3LZPA 4TYUA 5IOPA 4KRLB 2KERA 3UXFA 1QO3B 5DLMH 3EH4B 3IJEA 2XACC 1U8PB 1YY9C 4GRLD 5GGRB 4Z7NF 2WAHA 2PYFB 1KCKA 4PB0L 4E2OA 1MF2H 4JB9H 3CH1B 1HILB 2ZD0A 4Q6IB 4TOYL 4P04A 1YO4A 5FA3B 5E70A 3X14A 1AZRA 1G7PA 1AC0A 4EIGB 4YXLL 2KZ1B 4NFBA 1XZWA 2JKJA 1OGAB 5DJ2B 1MRCH 1QACA 4NQEA 1CF8H 1EGJA 3TZVB 5H4YA 5DYOB 4LBAA 4HJEA 3MRLA 5IKCA 1X6LA 5AW4B 3I9AA 4P46B 3IDMB 4PJIF 1Z0MA 4OCSH 1XR9A 2FR4B 3MPCA 3ABLB 1G7JA 3VMNA 4UAOB 1YEJH 2OX5B 1IMHC 3CSYB 1NM9A 2Y69B 5HD8C 2P8MB 5AAWA 4OD1H 4PH8A 5EB9A 4TUOB 4RRPG 3VFNB 5JIIA 3CLEL 2X4RB 3KYMB 5IG7B 5CHNA 3E0GA 3ARSA 1XXFC 3QC5X 1HEZA 1B0RA 1IC5L 4N26A 1ZS8B 1Z9NA 3J2PA 1VGKA 4GRLB 3QUYC 3T8XA 1F4WL 3GXNA 3H54A 1HINH 3N9GL 5I5RA 3KWXA 2LFEA 4P2YA 3S36X 1R3IL 2AABH 3BVVA 4LEOB 3LTVA 3LKNB 1GGTA 3BKJH 1NIDA 1NINA 3O4LD 1HL8A 4M48H 4YLCA 1P0SE 5HJ3A 1D5MB 2CCWA 4JFTA 1MCCA 3TP4A 5C8JB 2GI7A 4S1RH 4QRQB 1X5AA 1UH3A 5IV2A 4UOW1 5IMOB 5D7IE 5D5MB 2EYTB 3OXRA 4Z7VA 4AM0Q 4APQA 4P2QD 3B9VA 5DQDH 4FTVD 1TTAA 1A4JA 2CUHA 2DY2A 3L4YA 4JDTL 1IT9H 2XTJE 4LP8A 3L5IA 3KBPA 1BGXL 4K07A 5EZLB 1CLYL 1ZHBA 2DL2A 2FEJA 2R0ZL 3NJGA 5C2UB 2YD0A 2MWCA 4PTTA 4RETB 3OR7B 3NACH 2EDFA 2XX0A 1IM3A 5GS1B 3GK8H 3ZSTA 3WTYA 5DTFB 2OV0A 5DFTA 5SWQB 3COOA 4MTMA 1S9XA 4H4NA 2WLLA 5HPMA 2IFGA 3BH8B 1MZYA 1YPZE 3QWOB 3O4LB 1RIHH 1KYOJ 5DCCA 1T66C 4BWUA 1TSRA 1JNLL 2ATPB 2DBJA 5LHDA 2P5WD 5E6IA 2IDUA 4X5QA 4YDIL 3M7OA 1UTDA 3N43F 5FO8B 2JIXA 3QPXL 3Q44A 1QZ1A 4M7LL 3PJSB 4AYMC 4KQ4L 3CMGA 2PF6A 4XAKD 4P2QB 3MUUA 1X5XA 1O6VA 2IV9A 3PV7A 4FTVB 5A16A 4M7KH 4I5BA 4RGNE 3O6FD 3IXAA 1KG0A 2CG9X 5ALCH 4YE4H 2ZYSA 2A73B 1F58L 1FNAA 2NCEA 5E1AB 3GO1H 1JVKA 4PJCE 5FYJL 1KXVC 1QSFD 4X6EB 1DDHA 4WHYH 4A7UA 1DFBL 1S5IH 3WFBH 2DIAA 4OZHE 1RUML 4ZS7L 1JGEB 1H15B 5CJQH 4XMTA 2OFQA 1U8HB 3HJEA 3Q05A 3H7BA 4Y89A 3KDPB 1IGYA 3LV3A 1TZGH 3FC8A 4F57L 5ITBH 4XZ4A 4DP6X 2VH5L 5BCAA 2VISA 4PJXA 5I1IH 5JW4N 3GIZH 1M6OB 2Y25A 2P5WB 4FFYH 5L2JA 4HCRL 4DPCX 5KBNC 3GS0A 4JKNA 4ZO8A 4A67A 4DGIH 4ZMWA 4JDEA 4R4BA 3V52L 2AXJA 4DH2A 3KJ6H 4N8CH 3TBTB 3CXDL 1F4YH 3MYZA 3IDJB 4Y4HD 1OLLA 3KDMB 3O6FB 5G2NA 3V79C 4UU9A 3PWNB 1MIEL 4H25A 3FT2A 5I0XA 5GGTL 2UX6A 3M45A 2WVVB 1VFOA 2OMYA 5KTEH 4KITB 3OKLA 1QSFB 4HWBH 1IB5A 4FD0A 4P2OA 3VA6A 3SJVD 4MAZA 2V9TA 4YHIA 1UA6H 2CIKA 5SX5K 3MBEA 1BIIB 3D4GA 1LM8V 3L3OA 2F19H 4MDJB 1HNFA 3VB9A 3OAUH 1WIUA 1KN4H 5I0WA 2WLZA 5IK3A 3VWKD 4ZPVB 4TTDC 1WRFA 3HE6D 2BIPA 3HG4A 1DUYA 2CCVA 5FOBA 4KGJA 3AREC 3OMIB 2Z64C 1QW9A 4EN3C 3DO7A 1AMYA 1A0QH 2BDNH 4U6HA 1LE9A 1KC5L 2K6WA 4JGMA 4EVNA 4PS3A 9PCYA 2MHAA 1I9RL 4KKPA 2CO7B 2X4NB 3ZL2A 2J5LC 1OCRB 2VDPB 4RQQB 4AMWA 3MJ7B 1SNRA 2OCCB 4NAJA 1YUKB 2Q8BH 1EMTL 4AKQA 4Y4HB 3VW3L 5GRJH 1UJ3B 1AYOA 3VI4E 4MD5A 2VLKE 4HIQA 5IR1A 1MCKA 2C9QA 2LLGA 3T0VA 3UGXA 4OKVA 3DTUB 4DKTA 4TTGA 1RK7A 2W0KA 1J7VR 1KCUH 2EXYD 4WTWA 4AIOA 2VZUA 3VWJD 5TH2B 3IVKB 1N6VA 4EJ1C 3JTTB 3HC3H 1URZA 5I0YA 2JLPA 3FB6A 4YXKH 4L3AA 5I74C 1EEZA 4PGBB 3X11B 3PWPB 2J8OA 3ZE2E 3F65A 3LNFA 2PWFA 3HE6B 2FQEA 2G75B 4L9LA 2B4CL 5M95B 2UWEB 1J0KA 3MFFB 1B4JL 3MC0A 3E7JA 2A99A 3PHQB 4UQ3A 1QKZL 3GMOA 3WNNA 4OZGF 2GUOA 4TULL 4D7BA 4ANVA 4PGCB 2APFA 1HCVA 3ALXA 1I82A 1K5NB 4POUB 4XCYA 2ATAA 5BXFA 2IFFL 1ADQA 2WBJD 5B1KA 2NSMA 3RB5A 1EO7A 1HU8A 2XJLA 4FKHA 4DKFL 1PY4A 2PPFA 1WHPA 5TDPB 2K4WA 4NUQA 4PJHA 2VCOA 4ORGA 1CDIA 4WUKH 1AR1D 3VWJB 4YC2C 4MZRA 4HHWA 1MFVA 1OCWL 3S88L 1ZTMA 3GMQA 4MZIA 4N1HB 1MG2C 5ALBL 5ESAB 3WN5B 1WP6A 4Z3TA 3BEVA 4LSPL 4JPSA 1Y6MR 1NPJA 3GSNL 2ICCA 4GUQA 4Q2ZA 1NPUA 4LL4A 3P4OA 4PJ8C 1UQSB 4PJ5A 2K9FB 3WDHA 5JXEC 2N0KA 1SUJA 4PWIA 4CUCA 2I7OA 1E9OB 2RMNA 3GEWB 4L1DA 4WFFE 3SQRA 4BGLA 4BFGA 4QUOA 4H8QA 4FABL 1JI2A 4ZMXA 1OCOB 5FKPB 3LNGA 4AQEB 1WC7A 4HD9A 4JFZL 5JHLA 1MWAB 1E3FA 4IEFB 2X40A 2WBJB 1SBBA 2A1WL 2BOCA 2ALWA 4FQLL 2OZNA 4RCAA 3TBWB 4O4YH 2JQAA 2A74A 2YC1B 2I9TB 3CE1A 1OLZA 3W2DH 2V7HB 4U6XB 2C8NA 4WU7B 1FP5A 2J2ZA 2XVLA 5KYUB 5HY9B 4M6AA 5JOFA 3IRZA 1AR1B 4B0MB 4RZCA 4K3EL 1RZPA 4XE0A 1T1YB 4M3JA 2HT4D 3WIIL 4HW6A 4O02A 4ANUA 3P0GB 4N5EC 4UQAA 1YNTB 4TPRH 1C1EL 3H56A 4EEEA 1JF1A 3EJQA 2QADD 4KKCD 1IE4A 3D9AH 3QFJE 2XZCL 3ATAA 5DMIL 3QORA 1MG3C 1KMGA 1CR9L 4LKXA 3ES6A 4N2HA 3LCYA 2MIZA 3LQZA 1LO0L 1P4LB 4WUUE 3CIAA 1A22B 5GJSL 1KCLA 2GBUA 4TQIA 5CJXC 2NY5L 3STLA 4KI5F 3UAJA 1AGEA 1P53A 3L4UA 3NIDB 4LSUL 1UCBH 5DEZA 4M56A 4KHXL 3ZL4H 1MREH 3ABZA 1R0AH 1EEYB 2NW3B 2GSMB 5CFAA 4YOKA 2LV4A 3FUHA 1SDDA 4JE0A 1NUFA 5GQBA 2XTJC 4JGNA 1OZTG 3OJVC 3WFHA 1URLA 3D39D 4QXGH 5IFHL 1YJDH 4N6RB 4Q52A 4HUWB 4TKWA 7PAZA 3C2AH 3GJFB 3QR0A 1IC0A 2IANA 2QADB 3O6LL 2OMUB 2ZKHH 4GRWB 4G82A 1XB6A 4HDIB 1J8HE 4OZFG 1I7TB 4DQOL 5FYKL 4CU6A 1J5DA 5IHHA 1I8IA 3VXSB 1ERNA 1OAJA 3FS9A 5E2UH 1W80A 4G1EA 4MMYB 3UPRA 2ICWB 1FL3A 2IGTA 1DJWA 1ZHKB 4PJEE 2XRAL 4U1GC 2QDVA 1PZ2A 1T0NA 4PLNC 4YQXH 3S5YA 3CFJA 5FCSH 5EORH 4RGNC 2V3DA 3ELAT 3KWVA 5DUPH 2V5MA 5K9QI 3MLUL 3OR6B 2JKSA 3LQMA 5MEOB 1J9QA 2I26N 4HHAB 5SX4H 3RHWF 4X98B 1MRFH 2DLGA 3D39B 4X6DF 4CJ0A 3VXNA 5EUOB 3WIAA 3L9EA 1H8LA 2V6HA 3K6FA 3ZW3A 1TOXA 1Q9WA 1FN4A 3QUYD 2ZTBA 4PJAF 1U9KA 2J8UF 4LPXA 5F7DB 2XN9E 1TZHA 3MLZH 2W1NA 3L1OH 3MX0B 1DQLL 1RCYA 1UHVA 2G3NA 3QDJE 5DO2C 4JJOA 4Z77B 1Q9OB 2XG4A 1WV7T 3TFKC 1A7QL 1XR8B 2DTSA 3NQIA 4MA3B 4A2LA 1AC6A 2B1HH 4RMTA 3IF1B 5DRWA 3G6JF 2PW2A 3EGDA 1CI3M 1TQWA 3F3HA 4TLUA 4XVTH 5DT1L 5FA4B 1ZLWK 4AC4A 3PNRB 4CU7A 3IDXH 1S7QB 1NBVL 3QUZA 2LW3A 4M7ZC 4YWGH 3LAFA 3MLYL 3WE6B 1HIML 4M02A 1S7UA 1YG9A 3KGTA 4C47A 3F85A 5D1XE 3BUQA 3JQOB 1NMCC 4B3VA 3LQAL 1TVBA 1EFXA 5E8DH 5EZIH 2WNXA 3RX8A 3V6BR 1LP9B 1OAUL 3TV8A 2XKUA 5IVXB 3QUYB 1YEGH 4LLMA 3E8UL 4MB4A 1S7XA 5JQHC 2HP4A 2OL3H 2AEWA 3I02B 4J6RL 4I9XA 1INDH 1WITA 2ORBH 1EXUA 1ZRUA 4QRSB 5AVXB 3GXMA 1I4FA 2AZUA 2X9XA 2AF2A 3H4FA 3BISA 3BSZA 2YN3A 4ZUVA 2IH1A 2VM4A 2ZOUA 2NXZD 3WENA 5C0EA 2AERT 2XYCA 3RFRA 4JM2D 3IFOA 4F2MA 4UIKL 2NUPB 3O8XC 2WYHA 2R0LH 1WIOA 2F54A 3RY6C 3KPLB 4D0BA 3LRMA 4CN1A 2H9GA 3C5JA 4NKDA 1JFHA 5TTRA 2VT0A 4FNLL 2X3AA 3NJNA 1KSRA 1HQ4A 3QO1B 4G8GA 4XO9A 5AAMA 2X0UA 3WKYA 4U7KA 1A4CA 2WQVA 5IWLC 2FBJH 1V05A 3W0WA 1RHFA 4GKSA 4WI0A 1FV1B 4J1UA 2KYIA 4Y5VC 3V0IA 3JWOH 5ANHA 4XTRC 4WCYH 5E24E 1LD9B 4TULH 4ZW3A 1T0OA 1T1ZA 3V6ZA 3E8VA 3SHSA 3QJUB 3THMH 1G9NH 3RDTA 4RESB 2W65B 1TTUA 1UM5L 3W1ZA 3LRKA 4S2SB 4Z23A 2NXZB 5KSBE 1KLFB 3LZFL 4H1LH 1UWGH 4JM2B 2R4SL 4HAGA 4X7FC 1DCLA 3NRPA 5BUAA 2EP6A 1FYTA 2YBGA 1NFDA 4GXUM 1GAFH 1D5ZB 1RMFL 2MPAL 3GSQB 3DX9B 2C3XA 4XPHH 4BD4A 1BZDA 5J6GB 1XGQA 4P4RA 4EXPX 5M94B 5CEZD 1LWRA 4TQHA 3WUWB 1KLUB 1OM3H 1WCBA 4OGXL 3MCLL 4OLXH 4M8QA 2DI9A 3MHZA 2C9SA 1J1PL 1L0QA 4Z95H 1NAMH 3D0VB 3ROLB 2ZG1A 4M00A 1JV2B 1IBFA 4CBPA 1RIVL 3ISWA 5K1JA 3DX6A 5HHNA 3UPCA 1YJDC 1QSZA 4JPWH 2Q86A 1NGZA 1CLCA 4AOFA 3ARED 2Z35A 5FYKE 3RVUD 5IQ7H 3UBXB 2HUHA 1NIBA 3DIFA 3P0VL 4PY7A 4ALAH 2E7LC 5HYSA 1K85A 1ZEAH 4DO4A 2AV7A 1IIKA 4KI5D 2DYPA 2VJ0A 5KSAA 2HN7B 1X7TA 1G7QA 2GTWA 3EIFA 2XWJA 2BVOA 4U2ZA 4A55A 4GG6A 1SQ2N 2IWEA 4PV9B 5EIIG 1ML0A 1XF1A 1EJOL 3MV9E 5BPPA 1S9YB 1V27A 4PD4K 2E5EA 3BZDA 5CZXC 2VDPL 3FW6A 2XTLA 3L4CA 2OTPA 4Y4KD 3QQ9C 5SWZA 3UH8A 1UB5B 1UGKA 1EVUA 2RJMA 1TQCC 1BBDH 1WBXA 2HXAA 5C0BE 3EYUH 3W3BA 4Z8FH 2XQBH 2O5XL 3BVNA 2YKLH 3FSWA 1A4AA 3KL3A 3IU4H 2YD3A 2CRIA 2NT1A 3V9CA 3AREB 2CM6A 4OQTH 3U4EA 2CU9A 1MIMH 3BT0A 2CJSA 2J43A 1JGDB 1Q4NX 2DI7A 1E40A 2GTZA 1IQDA 3AROA 3QPQC 2P46B 3A23A 3K7UA 3D25B 4R8WH 2J5LB 1BM7A 1Z66A 1HAUA 3BN9C 4Y4FC 2B0SL 1KBBA 4YHML 3HR5B 4HT1H 5HVGB 5FB8A 2BS8A 4A63A 4ABWA 5TQ0H 2PPAA 5J1AA 4ONOA 3SDCD 4IOIA 5AG9A 4KU1A 4EI0A 1B0GA 3FT3A 5DR5H 4Y9GA 3CHSA 2N56A 1T83A 2HTKC 3ZBMA 5C0RL 3Q2CA 1D5BA 5EU4A 5CFHA 2CO3A 1TZ8A 2EDJA 4NNYA 1S4IA 1JRHH 1JPST 5E6YA 1JD7A 4HFWA 4LHUA 5EWIL 5JXAL 2ZUUA 5EZJA 3QCTH 3BUTA 5JXED 3MOBH 4OW6A 4P9HL 1I1FA 3D3VE 2UZYA 4K7PY 3K1KC 5HGHB 3I84A 5BRQA 3LRSB 2ZWNA 3V8CA 4HFUH 4RLDA 2AP2A 4AEIH 1E5YA 3HC0A 1CK0H 3S36H 2ADIA 1QEXA 2XIBA 2QSVA 3MA7A 2QGEA 1KB5H 1YN6B 5D2LF 4KNQA 1KYUA 2FYVA 4W9HC 4YFLI 1GSMA 3SDCB 3NAAH 5E1IA 3NTCL 1XGYL 2Y5EA 3ECBB 4JM4L 5L0QC 2CBTA 4PI2A 3WI9A 2Z0UA 4C4BA 1D9KC 1SEBB 2WM0A 2YPKA<