1MZYA

Crystal structure of nitrite reductase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
331
structure length
331
Chain Sequence
LSNLPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLDEDAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPENTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGPMIPWHVVSGMAGCIMVLPRDGLKDHEGKPVRYDTVYYIGESDHYIPKDEDGTYMRFSDPSEGYEDMVAVMDTLIPSHIVFNGAVGALTGEGALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGTAGAALYKFLQPGVYAYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title The High resolution Crystal Structures of Nitrite Reductase and its mutant Met182Thr from Rhodobacter Sphaeroides Reveal a Gating Mechanism for the Electron Transfer to the Type 1 Copper Center
rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 91
structure length 331
sequence length 331
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1mzyA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1mzyA02
2ZXWB 2PCFA 3UABA 1KDJA 1TKWA 3CDZB 3CVCA 2RACA 1GS6X 1IBYA 3FSZA 3WKQA 2E86A 1L9TA 1NIDA 1GR7A 3OMNB 4E9RA 3NJIA 3PAUA 3SBPA 2GB2A 1BYOA 3IN0A 4E9XA 1CUOA 3KW8A 3N55A 1W8EA 5I5MA 4BDVB 1HFUA 1AS8A 5PCYA 1OCCB 1OCOB 7PCYA 2CUAA 2GHZA 1IUZA 3TU6A 4A68A 2XXFA 1ILUA 2YARA 1WA2X 2FQGA 2UX6A 4P5SA 5I5JA 4AKOA 5E9NA 4BK5C 1JZEA 3U25A 1L9PA 2XLLA 2EIMB 2HX9A 1SFDA 2VM3A 5B1JA 3S8GB 2BO0A 5PAZA 4A2FA 4N8UA 1W6LA 3ZIYA 2GI0A 5I26A 3EH5B 3GXUB 5B7EA 1ILSA 1I53A 1WA0X 2CALA 2VSMB 3GDCA 1M9WA 2R7EB 4BXSV 6PCYA 2DYSB 1PNCA 5I6PA 2I7OA 1AZRA 4YSRA 3NJMA 4QLWA 2YAEA 2EILB 1ET5A 1ZDQA 4YSUA 3H4HA 4ENZA 4K9JA 2PLTA 2J57A 5AKRA 3ASOB 4KO5A 4W9ZA 4Q89A 2VW7A 1JZIA 1ASPA 1BYPA 2CJ3A 4MFHA 1KCWA 1IBZA 4KOBA 4DPBX 3FU9A 1URIA 2DV6A 3QQXA 4FAAB 2XX1A 1NIEA 2IDUA 1W6WA 3PPSA 1KBVA 3NP3A 2UXFA 3KW7A 1AZNA 2XYBA 4PAZA 4W1TA 3X1NA 4A2DA 1PAZA 2AFNA 4DP5X 1RCYA 4E9WA 1YLBB 2I85A 1N70A 2XU9A 3T6VA 4KO6A 4YSEA 1QHQA 1ADWA 2WO3B 5I5IA 2QT6A 1SDDB 2VM4A 1ZPUA 2Q5BA 4KO7A 4DP6X 4WKXA 4AI7A 3QJSB 2YQBA 2PCYA 3CDZA 4GP5B 2DWTA 1AOZA 3UADA 1A8ZA 4GP4B 5B1KA 2PP9A 3T9WA 2GC4C 3RYMA 1M57B 3S8FB 4NAJA 3EHBB 1E30A 3PAZA 4CSPA 2PP7A 4BDVA 4DP2X 3DIVA 2CBPA 1XB3A 1PLAA 2QPEB 2IAAC 3NSFA 4WTQA 4E9SA 2YAHA 4JHUA 3T6ZA 2VSKB 1NPJA 1A3ZA 5FC9A 4QKTA 4M4RB 5D4HA 1MZYA 3FPYA 3X1GA 1RKRA 2BWIA 1J9RA 2X87A 3X1FA 4BXVA 1FWXA 2WO2B 4KNSA 3QJUB 1AS6A 2FT7A 2MTAA 3NJGA 1NIAA 2R7EA 4ZK8A 2NRDA 2QPDB 2OCCB 5I6NA 3TA4D 3JTBA 4FA7B 2UXGA 1AZBA 4KO9A 4E9TA 2JXMA 2IWKA 1SF3A 2DY2A 2PPCA 2TSAA 3TASA 1GY2A 2BW4A 1N68A 1ET7A 2YXWA 4N4YB 5I6KA 4DP7X 1V55B 1SHWA 2HRHA 2PPFA 4KNTA 4G7RB 2FNWA 4YVNA 1GYCA 2J56A 2GSMB 3FSVA 1MZZA 1J9SA 1L9RA 1J9QA 1RZQA 4GY4A 3H56A 2YAQA 4A2HA 5F7BA 3V9EA 4YSAA 8PAZA 5TK4A 1AQ8A 3QJQB 2ZOOA 1KCBA 2YAPA 4X4KA 1X9RA 1CURA 1ID2A 5D4IA 1BQKA 4KOCA 1ASOA 2VN3A 3PCYA 4YSCA 1PNDA 1IKOP 2TSBA 2ZWNA 4Q8BA 3WNJA 2HXAA 1JOIA 2HRGA 3AW5A 4YVUA 9PCYA 2B08A 4YSTA 1SDDA 1J5CA 3DTUB 1AG6A 1EZLA 3FQYA 2BW5A 3WG7B 1B3IA 1JERA 1KBWA 3BVDB 1JXFA 3OMIB 4G7SB 1VLXA 3TBCA 2IWFA 2BWDA 1TEGA 1MG3C 4UF7C 1GW0A 1PZCA 4HCGA 4JKNA 2AANA 3CZUB 3SBRA 4YL4A 3T6XA 1WA1X 1ZV2A 2JKWA 3FSWA 1DZ0A 4UANA 4AKPA 3IN2A 1OF0A 1KV7A 2VMJA 4YSDA 4DP0X 2B3IA 4CSZA 1NIFA 4E9YA 3PAVA 1E67A 1HAWA 1L9QA 1XB6A 3C75A 1NDTA 5B7MA 2VW4A 3AG3B 5D4JA 1RZPA 4KNUA 4BWTA 4BWWA 3ABGA 2Q9OA 3AG2B 3NJNA 1OOWA 1NICA 4HHGA 4E9QA 5I6MA 1NIBA 1CYXA 1NWOA 1OCZB 4TXVB 5B1JC 2EINB 3ABMB 2DYRB 1L9SA 4A67A 2BZ7A 2HZHA 1SF5A 1CC3A 1NINA 2UXVA 4DP9X 3AY2A 3JT2A 3SQRA 2YAFA 2EIKB 1OV8A 2FQDA 3QJVB 3ZX1A 3G5WA 2AVFA 3PXLA 1EHKB 1PMYA 1QLEB 3ERXA 5I6OA 2Y1AA 1OE1A 1BXUA 1E5ZA 1IC0A 2LLNA 2QDVA 4RH4A 3MBWB 2XUWA 3IE9A 1A4AA 1ZIAA 5I6LA 3S3CB 2BZCA 1E5YA 3EH4B 4G71B 4YSSA 2BP0B 1J5DA 3FS9A 1PLCA 2GC7C 3MX0B 1TEFA 1MDAA 3NP4A 1L9OA 4A2EA 1WS8A 3WNIA 1NZRA 1XB8A 1AG0A 1UATA 2H5UA 4HCIA 2XV2A 1F56A 3NJFA 4A2GA 1JZHA 4A66A 1V54B 4EF3A 6PAZA 2W88A 2P80D 1AIZA 3TBBA 3UAAA 2IH8A 4AZUA 3AG1B 1GY1A 3HB3B 3EH3B 1XMEB 5TK2A 3ZBMA 4F2FA 1AR1B 2WSDA 1TU2A 1CYWA 4G7QB 3IBOA 3OD3A 1QNIA 5LDUA 4E9VA 4F2EA 5B3SB 1A4BA 1V10A 1BXAA 3QJRB 2J55A 3AZUA 3CG8A 3FYEB 2XVBA 3FYIB 1MG2C 2IDQA 2BHFA 1OE2A 4F7KA 2YXVA 4DP4X 2FQFA 3ABKB 3H4FA 4JHVA 3OM3B 5EHFA 2Y69B 1T5KA 1NPNA 3T71A 3GYRA 4YSOA 3CVDA 2H3XC 2HLEB 3S3DB 3AG4B 4GYBA 2BP8A 1ZDSA 4AKQA 1NWPA 3V9CA 5IY5B 1FA4A 1ASQA 5AZUA 2XV3A 1JXDA 4P5RA 2FJSA 2H47C 4G70B 2P80A 1AZUA 3NJLA 3X2QB 3UGEA 1JVOA 2VW6A 4YSQA 3FQ1A 1PF3A 3NSYA 3WIAA 3QJTB 5I28A 1KYAA 3OQRA 3NJHA 2W8CA 1PY0A 1BEXA 4NB7A 4AX3A 2PPAA 3NSDA 4DP1X 2IDFA 3X1BA 4DP8X 1AANA 1BQRA 1DYZA 1SFHA 3PLYA 5B1AB 1NTDA 2OJ1A 2EIJB 3X1EA 1BXVA 2N0MA 2BP8B 4UAHA 2BP0A 4BWUA 1PLBA 3SBQA 1GS8A 2HX8A 3T6WA 5A7EA 2XXGA 1KDIA 1PZBA 1ZIBA 3IEAA 3WI9A 3FQ2A 1OCRB 1HAUA 4GXFA 1KGYE 3DKHA 3OMAB 1ETJA 4HALA 3ZDWA 2OV0A 1FFTB 2X88A 2PPEA 3FPXA 2GIMA 4HZ1A 4HHWA 3FSAA 1BQ5A 3S3BB 5F7AA 3L45A 2JFCA 5B7FA 3NYKA 1PZAA 1A65A 1SJMA 2IDTA 2PP8A 3WKPA 2FQEA 2GBAA 4PCYA 2PPDA 1JZGA 2IWEA 3QPKA 5B1BB 1PCSA 2FT6A 2CAKA 3FU7A 3NSCA 1AS7A 2FT8A 1BAWA 3UACA 3FU8A 4GP8B 3N2JA 1SNRA 4DPCX 3HEIB 4DPAX 4NERA 2IH9A 2QDWA 3NJJA 4HIPA 1M56B 1AAJA 2I7SA 3FT0A 3ABLB 2CCWA 4HAKA 2YAMA 3BQVA 1AACA 1JXGA 5AFAA 1JZJA 3NJKA 1JVLA 4L0PB 4M3HA 2AZUA 2FTAA 2YAOA 2DWSA 2IDSA 2AZAA 2ZONA 3ASNB 3NT0A 1E65A 1R1CA 2XV0A 4HCFA 2UXTA 2MRYA 2J5WA 1A4CA 1SHXA 1AZCA 4YSPA 2HX7A 1J9TA 1GS7A 1OE3A 3CVBA 1ET8A 3EF4A 4G72B 2XWZA 1JZFA 7PAZA 3D12B 3UAEA 2XX0A 1WAEA 2A3TA 2UX7A 5ANHA 1GSKA 1WS7A 3FU7B 1X9UA 2FWLB
chains in the Genus database with same CATH superfamily
1I9RL 3DX9B 4MMZB 4N8VB 2IANE 3RWFB 4JRYB 4OFIA 2R1WA 1IILE 1WAAF 4QXVA 4GW5B 4Z3EA 5L2JB 3QQ9D 3QZWG 2ZOKB 1IBYA 1F4WH 3CHRA 1TZGH 3MV7A 2RCSH 1L9TA 1I1AB 3CBKB 5IEKA 3U9WA 1LQBC 1FGVL 4MNGB 1JZ8A 1LO3H 3MBEC 1SOKA 1PVHA 2GB2A 3HMXA 1A9EA 2AJUH 4ZPVB 3Q8FA 5FM5M 1O7SA 3FQRA 1KBGH 1IKNA 4OTXL 3COOA 4YO0B 5DYFA 3P11L 3VRIB 2FEJA 3PWNB 5MEPA 2J73A 2WQAA 3P4MA 1MW3A 1DVYA 1TVHA 4Z7OF 2FWOB 2BWQA 1CS6A 2XC8A 3RNKA 1F11B 2WM0A 4AJ0A 4EZJA 2Y07L 1AI1H 4M1DH 4PV1C 4ATWA 1E42A 1AGEA 3KYOB 1DVFB 5C2BL 2ZUQB 1KTJA 5DD1H 4CADB 4N8UA 4JHZA 4YGVA 1PZ5B 5TFSH 3EH5B 5FGSA 3L5IA 4LARL 5EZJB 1J0HA 4EI5C 5GRXG 5H8DA 2GW5A 3RKDC 1CB4A 1J18A 3C60B 2DYSB 4JQVA 5I6PA 4L8SA 4Z7WB 5BJTB 5C7XL 1WT5A 2BNRB 1AZRA 3MRGB 5I18L 3D3VE 3MMEB 4O5LL 1OLLA 5TPWL 4AIZA 4YSUA 2UZIH 3ATDA 2EC8A 4QCIA 2C4XA 2RFXB 3H9HB 4K9JA 4OLYL 3TZVB 3MRCB 3GMNB 4AYGA 5IB2B 5F72S 1D5IH 2CR6A 4KO5A 3VNZA 1X5GA 2I26N 3PGCA 4Q89A 1LEIA 3R0MA 4XR8C 1J0JA 4DAGL 5MHSD 3SE9L 3FB7B 5EUOB 1NEZA 1UACH 3LNFA 2R8SH 3BP7A 3CPLB 3MOBH 2BSDA 1T5WA 3FCBA 4ZUWA 4J3TA 1RMFH 1A4KA 4FG0A 4QXTA 4S1QH 4TUKH 4LLDA 4AQ8A 5FYJD 2ZKXA 4FQQB 1YNTB 1KBVA 4FLQA 3X12A 2VQUA 5HYJE 4NUGL 3OKNA 4PW9A 4PJBE 4JG5A 4G6FB 3H54A 4PRDA 4RGNE 2ZTBA 1XF1A 5E6IB 4FQHB 2XA8H 2ED8A 1KJ2A 2PW1A 4JFXA 5ALCL 4BSVB 4Z3HA 3QBTB 4PJHE 1NCHA 2SEBB 1TCRB 4AQOA 1P5UC 2YD5A 3VWKC 2F1EA 2F8VA 4PREB 3ULVH 2QVIA 3CDZA 3GHEH 5AW3B 2ZNXA 3IJYA 4GI8A 4TULH 1G84A 1ZHKB 1INEH 4F1ZA 4KQ4L 3RAJL 1NCBL 2UZXA 2R2EB 4G82A 3QIBC 3OG6B 3H2QA 4E0RB 2EYRB 1RUKL 2F7RA 3REVB 3CVHB 4AC4A 4UT9A 3DURB 2BY1A 5I1IL 3SKMA 1WVZA 4BDVA 1OM9A 4Z78B 1M2OA 2BVQA 2CBPA 4NQCB 2ROYA 2YD1A 3RZCB 1XXDC 2IAAC 3CFBA 3JWDH 4F5CA 4P4KB 1HEHC 3QFJB 1I1FB 4I88A 1F2QA 4WTQA 3BAEL 3B5GA 1DLFH 1PD0A 5JIPA 4L18A 3HZKA 4NN5C 4WEBL 3T2LA 1ZTMA 1GGCL 4GW4A 2AEWA 5CZXD 5BW7A 1AZZC 1EAPA 1A6AB 1MWAH 3F7PC 3DMMB 4H8WL 4XMTA 1BD2B 5CGTA 1T89C 2R1YB 2EO7A 3GSOA 5EBLA 1NCIA 4NM8L 2HT4C 3ZSSA 3B2DC 2MTAA 3EGXB 3OAUH 1FV1A 3HN3A 2D9CA 2UZYA 4OF0A 5D1XE 5KVFL 2BIOA 2G0LA 5B39B 1MCWM 1NLDH 3II3A 3Q13A 4BFGA 2UXGA 4Y5VA 1WGOA 1GYUA 5C0DA 4JDZA 3Q2WA 2QPFA 5J1AB 1E3FA 2TSAA 4J3UA 2O6FA 4FL4C 4WUUD 3JTTB 4I8DA 4FQCH 3F7VA 5AW5B 2BY0A 1V55B 2QVKA 3O6MH 1U4FA 5EA0L 4W81A 3GMOA 3TCLB 1UA6H 2ICEB 4URTB 2O5XH 2AXGB 5FO9B 5EORH 2DOCA 5E95B 3CPUA 1RZQA 1FVDB 2DJMA 3RL1B 4GY4A 3H56A 2YBRA 1VKXA 4MS8D 4XP4H 3VFNB 1QA9A 4PJFB 4A2HA 1JGUL 1UWXH 2FO1A 4KRPC 4Y88A 2YFOA 4FTVE 3WFCL 2HKAA 3ZHKA 2GJ6E 4KOCA 2I9LB 4OVVA 5KW9H 3KPLA 5F1NB 4YSCA 2FBOJ 1ZGLM 2CGZA 2V37A 4Q0XL 4A7SA 5EU4B 1RZIA 4KJPD 5HGDB 4MX7A 4GRMA 4KX9A 3RHWF 3KPOB 2MCPL 1HXYB 1EZLA 2H0PA 2W0PA 5JOPE 4WJ5B 3HS0B 2RALA 3MRRA 5JXAL 1M4KA 2BNQA 5L88H 4MNGE 3VB9A 1S3KH 3ZYOA 1KEGL 1AP2B 2JCCE 3QUXD 3V0GA 5I74B 1BREA 5DZPA 3IFOB 5K1NA 4YHZH 2QMJA 3DGCR 4IIQB 5ABAA 4MXVF 1YO4A 2FEEL 1V3KA 1YVLA 2WQSA 2XKSA 4NDMA 4U1KA 4UV7H 3DJTA 1JZ6A 4XXWC 1Q94B 2F19H 4HUNB 1E9QB 2V6HA 2XPZA 1WC7B 4LLUA 4HIJA 2F15A 3L7FA 3LRSA 1PKOA 3RGVB 3A3YB 1E50A 3PAVA 5E2WL 2XRAL 5EU7E 3WLBA 1W72L 4PJEA 3DGDA 1S7VA 4LOEA 4LPCA 3SE8L 3WTXA 5LB1A 2ZXEB 1CK0H 4TXVB 3VX0A 3RG1C 4RISH 4N2KA 3ABMB 2JKIS 4DT2A 4IBWA 4LHUD 1KTDB 1L9SA 1T03L 3L2MA 2BZ7A 1FE8H 1YEGL 3QDAA 4ZFZB 2A0LD 4Z7WE 4N2IA 2XZCL 3OLGA 1CGSH 3FN3A 4HHAB 1TDQA 3QUZD 4QTIL 3RA7L 3HVNA 4A6YH 1J5HA 1UZ6F 3IKCA 2KBGA 4TSCH 4UTAL 3KWWA 4NQTA 3X11A 2QFRA 5FO8B 5I1KL 5T3ZL 2R4RH 1QACA 5CN2A 3GSXB 1GKEA 3JXAA 4BHUA 2UUDK 3FU3A 3OXSA 3CFJB 4A37A 5EUOE 3ORJA 3TFBA 1JPFA 4JFFD 1IE4A 3QZNA 1D7DA 2QADC 4Q97A 2OMWA 5F3BB 4JHBA 4RA0C 2G75A 5LAXA 4XE0A 4GG6A 4I2XB 1TEFA 2EEBA 1MKFA 3QNXA 3MUGA 4O58L 1M7XA 3TOPA 3WNIA 1NZRA 2VNCA 3BW9B 4NNYA 3Q8CA 1J8KA 3U46A 2NW2B 4ZFOA 4JFOA 1U8CA 4P5TD 4NI3A 4OU3A 1RUQL 3DRQA 4LQ1A 6PAZA 4DGVL 1ZSDB 1A14H 1AMXA 4QHKJ 4X7EC 2BPBA 1P84K 3TYGH 3UAAA 5IG7A 4TVPE 3ARRA 3D25B 2EEXA 4HW6A 4JO5A 1P6AB 2AJYH 2EXTA 3FTWA 1O5PA 3K46A 2XXMB 2DQGL 3WIHH 1NMCC 2K7QA 3BP4A 3TN0B 2QBWA 3ZBMA 2V2TA 3FUJA 3VMPA 3NJVA 4JO1H 4U1HB 1LMKA 4F7CB 5I1CL 2OR9L 1USZA 5DMIH 4CVXA 5BZDB 5JZ7D 4LPYA 3FO0H 1ECZA 5DJ2A 3V2AR 5HJ3A 1LXMA 3AWGA 3GRWH 4ELMF 3V4VA 2LGNA 3MJ8B 2VMCA 3WEOA 1U8QA 5HHOB 2A73B 4WKZB 3KH3A 4JY6B 2WJ5A 1Y07A 4JKWA 4NAMA 1P9MA 4DQAA 4G9DA 3QHZH 4NQCE 1M2VB 3GYRA 3VI3B 3AJ7A 5EU5A 4HJIA 1G9NC 1OANA 4LCIL 5E9DD 3LNEA 5ID1B 3QFJE 5TE7H 5J6GB 1HNYA 4YHNB 5IB3B 5IBUG 1OAQH 2VDPB 4BHUI 2AQSA 4BUHA 1KIPB 1K4CB 2P80A 3MODH 4FXTA 4UM9D 3QUYD 1BD2E 1S7SA 1AQKH 2X1WL 1IGIL 3RDTA 3L9RA 2VW6A 1E5BA 3E6FA 3RVVC 2G2RA 2WNGA 4YSQA 4OQTH 2YGOA 4U1MB 1U3NA 1J1OH 2ESVD 1MCKA 3QK0A 1NBZA 1UOLA 3B5TA 3QSKB 4OFKA 5E8OA 4HULB 3NZ8A 3NAAH 3FT2A 1Y0LB 3EYUL 5E8DH 4IMLA 1OARH 2VQ1B 5C0BD 1RZKL 5SX4H 1IQWH 1K2DA 1TQVA 2XZAL 3IMSA 4DQOL 1A6TB 2X5PA 1A7QH 3PLYA 5D1QD 4K5MA 2ZP0T 1RZ7L 4NKMB 3U82B 3ILPB 5C08A 2TRHA 2DQEL 1EEYB 2N0MA 4WFGE 4UAHA 3A6CH 4IIZA 1RJCA 2LFGA 2WTOA 5AKTA 4KVNL 4JDVA 1IAKB 5KVEH 4MCZA 1FIGL 1T20B 1R3IH 3B9KD 4X6DA 3CJJA 1BZDA 2E6QA 2BDNL 3AAZB 3MUUA 5L2KA 2VZ1A 5TE6L 2VRQA 3FT4A 1IC7L 3L2LA 2YR3A 1GPOL 2EDNA 1QLFA 2YD6A 1F02I 3WMSA 2I5YL 2NY4C 3BZFB 3S7GA 4BZ2L 3RILA 4M29A 2DWDA 3NABH 2VC2B 5B1BB 1CDIA 3BSZH 1IFHL 4JY5L 3FU7A 5H4ZA 4CJ0A 2AQTA 4B60A 4W9GC 2J2ZB 3L4XA 2X6UA 3VFMB 2DMGA 2D3LA 3JWOL 4NPKA 4UOZA 2VLKA 3T0ED 3B56A 2ILLA 3N2JA 3FFOA 3OR7B 5C8JB 3TA3B 3TNNB 1Q1JL 2NT1A 4MA7H 5HHQA 2I32A 5JTWA 3FT0A 4EI6A 3QO1A 3VMOA 3L3HB 5C0RL 2CLRA 4D9QE 4NUMA 1JF5A 5BCAA 3VXUB 1KLUA 3RNQB 4RIRB 4GKZA 3O6KH 3HC0A 4DIXA 1OP5K 2CA4A 1EAOA 2YEVB 1R1CA 3LKNB 4EIGB 3WMQA 3NCWA 3K6DA 4JN2A 1AZCA 1AGCB 1EA9C 1AY1H 2HX7A 1ZT1A 1JNLL 4O02B 2BRRL 4JO3L 4KZ0A 3P4NB 3ZHLA 5FYKL 3BQUA 4GFXA 1NCDL 4WO4A 1C1EH 5EZIL 5I73C 2BS71 2R1XB 4GG6F 5IJKA 4D0BA 1X7SA 3P3RA 4EZMA 1NLBL 4NSKA 3EGSA 3VI4B 4F91B 3VE0A 5GS2D 3HKFA 1HQ4B 4P23C 3KYMB 1OSPL 1NEPA 3K0WA 3SKJH 3UERA 1KTLB 1HC1A 1MIEL 2A4EA 5HHPA 3GMLA 1FBIL 5T1DH 4MMYB 3F7YA 4AGOA 1SHMA 4LHQB 3ILQD 3K2UH 4GI6A 1JK8B 4LIQH 3EFOB 4WW2B 2PW2B 5ALBL 4DHLA 5TDOB 2QTVA 5ECGA 3ZR5A 4IU2A 4I2XE 3TO4D 4EN3A 1NAML 5D9SB 5IW6A 4R8WH 2Y6SD 1JV2B 1HOCA 4MAYD 1H3XA 3PGDB 1CFVH 2XOTA 2RAMA 5E8NA 3WEBA 2NY6C 3SE6A 1HEZA 5GRWA 3MGAA 3DXAA 5ADOH 1ZWIB 2FO8A 4J3OH 1R3HB 3KXFD 3WFZA 2HT2C 5C9JA 2VM3A 5IFAH 2EVGA 4FNQA 5IQOA 4MXQD 5FCSH 1YDPA 1GYWA 1CL7H 4X7SL 1T0OA 2NX5A 1QKZL 3H6AA 3LSOB 1MLBA 4YN3A 4X6BA 4AEHL 4NNPH 3OWEA 7CGTA 3GJEB 3HG0A 2I24N 4QLWA 4JM2C 5J12C 4CN4A 2YD8A 1Q4NX 4K5PA 4Y1AD 4HXBL 4QDGA 2PLTA 4KTGA 5HHOE 4F58L 2GSGA 5B38G 1G43A 4R7XA 1CI5A 5KVDE 5AZEH 2KT6A 4W9ZA 2IGLA 3S5LA 1JS4A 3TVMB 3VI3E 3CE1A 1YEHL 4DTGH 3P4MB 1TCMA 4G80B 3GUTA 1FNHA 4R4FH 3WHXB 1OQXA 2N01B 3RNKB 4FMFA 3BDYH 1B0WA 4NKIL 4HC1H 4V1DA 1R24A 2GHWB 3GZOA 1EV2E 3Q9QA 3ULUD 1EGJA 3WHE0 1A8JH 2B4CH 5IVXF 4A38A 3GS7A 1KXVC 5LGYA 4NO0D 3NP3A 4W9FC 3BT0A 1PZ2A 5I1HL 4XPAL 4ZTEA 4M6NH 4I13B 3X1NA 2DMHA 2J12B 3H0TB 4LCVA 4KK9C 4PWGA 1MJ7L 3JZ7A 3MN8A 1J1PH 1J11A 3ARDB 4XMLL 3P3YA 3IU4L 5BV7H 4X6DF 3X14B 5BQ7B 3V4PL 4AIZB 2A77L 1YMMD 1EO8H 3K8MA 1U8KB 4EIZC 2WXQA 1FZOA 2LVCA 1LEIB 3T4AC 3NCJH 1OVZA 4KXZI 4MB4A 3RE0A 5C0IB 3UAJC 1NEZB 1M57B 2ERJC 3HE6C 3S8FB 4G6ML 3DSFL 5GGRY 4ZUWB 2YA0A 1EH9A 4PY8J 3BSHA 4EUPB 5AUMB 2BCMA 3KZ8A 4J6RH 2Z31A 2A6IA 4P2OC 5EO0B 4HG4K 1P4LA 4GPVA 2BMKA 5E2JA 3D8MA 1FYTD 2WCSA 5KN5A 4GAFB 1JCKA 1P4IH 3ZXAC 2OK0H 4PJCB 6CGTA 2AEQL 5BXFA 4J8QA 4L23A 4RBPH 3TBYA 3DVNB 4KTDH 5I1JL 3N41F 1T3FB 1Z32X 3HCVA 1IM3A 2EXYC 3RB5A 5HP5A 1HT6A 2QGEA 4UTBH 3UPRB 4DUWA 1OK8A 2W1NA 4XN7A 3TS8A 3P2DA 4XGZA 3IJYB 2BNUB 3Q2LA 4PRNB 2NRDA 5I8CA 1E4WL 1M71B 3TA4D 2J6EA 4M8RA 1XDTT 4WNQB 1L0YA 1G0YR 2DTSA 5JHLH 1F3DH 1R46A 2ODHA 3RBGA 3GI8L 2J1WA 2ZD0A 4PJ9C 4Y8AA 4F7TB 5JHDB 3KYKL 1IGTA 1XGRB 3MBEB 3OPUA 2BW4A 3N1FC 3SO3C 5BUGA 3I6GA 4BZYA 3ZT5A 5DURD 3PXHA 1SHWA 2BVPA 2IJ0C 3BMWA 4XOBA 3VXUE 4L3AA 3HJ0A 3B2PA 2YIHA 4WWKA 2VLME 4OJDH 5MERA 4Z77B 1BM3H 3HZKB 3BISA 1TLKA 2YFNA 3DIDA 4AXWB 3TCXA 2YAQA 4WFFE 3ZTNH 4X9BA 4XVSH 4MHHI 25C8L 5JNYB 1KCBA 2RA1A 1E8YA 4KI5F 4FRWA 4L9DA 4YWGL 3QI9C 1ID2A 3IVKA 4TV3A 1QPPA 2YUXA 2OI9C 2RQEA 2DBLL 3VI4E 3L4WA 3E9UA 4XB3A 1QTPA 3HE7A 1SLVA 4XCFL 2X4QB 3PL6C 5T33L 2QHRL 2XXCB 5DZ9A 1BLNB 4EI5B 5T3XE 1XIWD 4POUB 1J5CA 4TUOA 3AMLA 3F62A 3V6OC 3N6YA 1Z0NA 2BW5A 5BZWA 1B0GB 1B3IA 1F58L 4FFWD 3F7VB 3OB0H 1F3DJ 2L3BA 4G7SB 1XGYH 1ZT4A 1BSIA 3DHMA 1C12A 3GMOB 4MVBD 4Y4FA 2W0KA 2X2UA 3G3LA 1LO0H 1T1XA 2Z64C 4XMZA 1NUGA 2FJGB 3LKRA 4F15B 5AB1A 2Z0BA 3RPIA 4TTGA 4HD9A 5AZ2H 1ZV2A 4MDRA 4MD0A 4KQ3L 1CDGA 1QA9B 4HETA 4IKKA 1C5CH 3IXAA 2WUCH 4M5YL 3HMXH 4G3YL 2DJSA 3A23A 3KJ6L 5HPMA 1GSMA 1HS6A 2JB5L 4U1IB 1HAWA 2G3XA 3C75A 1LEKB 2V2WA 3KPLB 3AG3B 4JREC 4OT1L 5DJAB 3H3BC 4Y0GA 3IPBA 4DKAA 3U7WH 1A3RH 1RZIB 2X44D 4IOFC 5IHBA 1RHFA 1KPUA 1N19A 4GRMB 3BO8A 5IBLC 1MAKA 5KBMA 5MENA 1P5UB 3MRRB 1SF5A 4K3DH 1KTBA 1N9PA 4P49A 3H2WA 3QQ9C 1I3UA 3GT6A 3MR9A 4DGUA 2Q0ZX 1AGFB 5B1CA 1SUHA 2AVFA 3SO5A 1FLRH 2FHCA 3CQQA 1J8HD 3QNZA 4B9IA 5KYYA 1AQDB 3NA9L 1U42A 5FPIA 5I17B 3UPCA 4W9KC 5I16A 2XWTB 4XZ4A 4ZUTA 5I66A 1QLRA 3WELA 5GISH 3V0VB 2WMPB 4LLUB 1TJIH 3D39A 4HIJB 4A7UA 2BP0B 3QWNA 1J5DA 2GUYA 3PWUB 4G8FB 3N40P 2JI3A 4HFWB 4PJEB 5D2NC 3JVGC 4LSUL 1X5KA 1KJVA 3EO1B 5JYMA 2WK2A 3ABZA 4HCIA 4I7ZC 4NN5B 5LVEA 1NC4B 1Z5YD 2P4AB 5C3LD 3AXHA 1K5NA 2LU3A 2IIJA 3BGFC 2CSPA 2WP3T 4KKRA 1UWEH 1IFRA 1I8AA 3GIZH 4CNIA 2PCPA 1WP6A 4H5SB 2YA2A 2VO8A 2Z8SA 3PPEA 3SE3C 3S37X 3LEYL 4O9HH 2QLVB 3SPVB 3X11B 4OF3A 1XSJA 2VH5L 2ZWYA 3H55A 4L8DA 2GFBB 2J4WH 5FUZH 1FGNH 3VU1A 1KJ2H 4PJBF 1I1CA 3WENA 1B90A 3CFTA 4M56A 1VGKB 3PJSA 3CLEL 3KPSA 2XVBA 5F7FA 1KB3A 5CIPB 1MG2C 2OMWB 3BWUC 5DVOA 5LAXB 3OSVA 5G55A 4DESA 4C8XA 2I9TB 2IBZY 4PJ8A 1KNOA 5I76A 5EEWA 4WF7A 3T71A 1WLHA 1OPOA 2ZG3A 1JBJA 4ZFOB 1ZHNA 1L9NA 1MFEL 2Y7MA 2BC4A 5LHDA 3WS3B 4PJCE 1M1SA 3SDAD 1YN7B 4XZUB 4BQ8A 1U4EA 2BP8A 4YHKH 1ZDSA 5CCHE 2Z0UA 2IOMA 2VJXA 1E3XA 3N91A 1A3QA 1ASQA 4UT9H 2CQVA 4LOUD 1TYJA 3GBEA 4KRPB 5DJ8B 2EUXA 4OZIF 4EN2A 3DPBA 5IG7B 3RX9A 1R75A 3QEGH 4M02A 1P6FA 2B0SH 1OM3L 2V2TB 4NRZA 3EFFA 4OUOA 2EE2A 5GZOA 4JZJC 5KAQG 5C0EB 4FABH 4LDCA 4I87A 3GJFA 2BVUA 4ODWB 3WFHB 1AR1D 2CWRA 2DD8L 3RI5K 4YBQD 2IPKA 2EE0A 1REIA 2HSIA 3GPSA 1VAHA 1HHIA 4Q6YA 4WJKB 3DVGB 1N8ZB 3RWJA 1IMHC 1U8QB 5JHDE 4K3JL 2OKMA 1TFHA 3MGTB 4N28A 1YEFL 4HS6B 2OJ1A 4FA6A 3D2TA 3WXWH 2CIKA 2NOYA 1NDGB 4PY7A 1BXVA 1LWHA 4OJEH 4NPYA 5INCA 1HNFA 2HLFD 2YPLD 4P46A 4A04A 1S3RA 1MRDH 3RWDB 4WW1A 1C08A 2X9XA 4KAQH 5EFIA 3CFNA 2AQ1A 2VLLA 4BRJA 5CEZL 1SUJA 1UA7A 2WJ7A 5FAAA 1UZ8B 4ZTPH 4RGOH 1OWRM 1S7SB 3NCXA 3L9RB 3E6HA 4HJTA 4JR9L 1A7BA 1FFTB 2BX5A 2OV0A 5CZXC 4AL8L 2YMTA 3DBSA 3LRKA 4OCXH 3NQIA 4Y16A 2AABL 2X6CA 1QEWA 4BINA 3B2XA 4F8TA 4I5BA 3NZ8B 1A65A 1PX3A 4IMLB 1T2JA 4LAQH 3AADB 5DVNA 3U9PH 1CQYA 3ZT6A 5CINH 1JZGA 1K2DB 2FX8L 5CM1A 5GJSH 3WMPA 4GH7B 2VKXA 1ID5I 4FLSA 5AB9A 2XJLA 1XGPA 1U3JA 1GL4B 2ZG1A 2VE6A 3CQFA 4DK6A 2FATH 3T6QC 2K78A 5C08B 3QA3A 1BV8A 5ANMB 3S88H 1SNRA 3GNMH 2I07A 3CAFA 4K15A 4QKXB 3AACA 5GJTL 3I6KA 5FKAB 1PJWA 2R69A 3UOAB 3BP6A 4G6KH 4YXLL 1CT8A 3EDEA 4RFEA 3ZUNC 2C7FA 1AACA 2E8YA 3QRBA 4LLYA 5KYWB 3UC0L 2FHBA 2ZXAA 2VAJA 1DFXA 2JCCF 2FTAA 1F1GA 4MS8C 2FRGP 3A21A 3ZZLA 1JYNA 2XV0A 3EG9B 3RFZA 4R2GD 3BRFA 4HGWB 3JWNC 1QLFB 1RSFA 1A4CA 2NZIA 3IDYC 2X4RA 4LSSH 1JRHL 3KVPA 5L6YL 2BERA 3WE6B 2EDLA 3DOIA 2DWDB 4NZUH 1IAII 4IBYA 1WAEA 3QDMA 5H35B 5TDPA 4DO6A 3L3JB 4ISVA 4DZBA 3FU7B 5DLMH 4KJPC 3C5ZA 3RJDA 2AVGA 5DEZA 3WY1A 3UABA 3GSQA 4Q9BA 3MFGB 4D8PB 3W0WA 2RACA 3QZMA 4PS4H 4PWEA 5HHQB 3ZDYF 4QJ4B 1JZ3A 2B8OT 3QUXC 43CAA 3GEFA 3B2VH 1X44A 3I75B 4B6ZA 2JIXA 1Q9LB 3OMNB 3QHFL 5DK2A 3NJIA 4WRLA 3B7YA 5KZCD 1MXDA 1XGQA 1U6AH 2R4SL 1Z5LA 3B34A 1K8DB 5DS8A 3M7OA 4GKZB 2ZWLT 1J5IA 5C0GB 4K8RD 2NLJB 5FHBL 1H8NA 5IHZA 1JNNH 1HKLH 1BWMA 3BP5A 3VXNB 1OCOB 3IS0X 2XWRA 5JPMC 1ZT1B 3MXVH 4N2DA 1N2RA 2CUAA 2HAZA 3VGHA 5LWYH 4P07A 1VADA 4RFOH 4LK4A 1JYVA 3BEWB 4OLUH 4J23A 3PHQA 5IJCC 3LEXB 3FT1A 4D0BB 3U25A 4XVJL 1NFAA 1SRDA 1WEJL 3BKMH 3DO3A 2IC2A 1BQLH 4L8CB 4XBEL 4TM9A 1DL7H 3B9AA 5FYLH 5I26A 3BWZA 5EBGA 1GGBL 2A0LC 3I2CL 4FZEH 2IH3A 4MBRA 1IC4H 3QQ4B 2AEIT 5F96L 1S7WA 4FNPA 3QUZC 3F7YB 3I84A 1CG9A 5C7ZA 4KVPA 5ILTH 2EE9A 1QR4A 4YDIH 3W9EB 4OM1L 5EO9A 4F8PA 1TZIB 2KI6A 4MJ6A 4K5NA 4OLWL 1XF2A 3SDXB 5I0ZA 3QFGA 1JI2A 2G5BB 1ASPA 3I02A 1RURL 2FGWL 3V4VH 3GSVB 3MLRL 5D2LA 4KTEL 1KG0A 5ESVA 3DXAB 1S7UA 5GSVB 4UINL 2FCBA 3AU1B 1N5AA 1RZFL 2ZUYA 2NCEA 4PJ5B 1IKFL 4P5TC 5EZLB 5KVGH 4I3RL 1WUNT 5IIEB 3NUKA 4RMSA 5SWSA 2OXGA 2YRZA 1KWGA 1JTOA 1YDPB 1VGEL 5L4FA 4UUJA 1KTKE 5LBSL 1H8LA 4KO6A 1B88A 4DKFH 1GH7A 3L9YA 5E4OA 3SCMA 2X1QA 2PCYA 2WHVA 2Q3ZA 2GSGB 4E2OA 4S1SL 1LO5B 5JZ7C 1TFPA 3S5LB 3GPEA 4UOJA 3APFA 1ZVHA 4LFHD 1V7NL 1EUUA 1JFHA 1BZ7B 4AVKA 1MAMH 2X53A 1Q0XL 2HG5B 1RU9H 5AOZA 2BSCA 4H25B 2NT0A 1R24B 1ZMYA 1HH6B 4MCYA 3VGAB 3AS2A 2J3SA 3PWPA 4JO8A 2OL3L 1AD0A 2GTZB 4M43H 4OY9A 4TNWF 4FKEA 4XODA 4CVWA 1A1OA 2WGNB 1RIVH 3BGMB 3QZLA 1MN4A 5H94A 3IPFA 1A3LL 1XSIA 5FB8B 1VFAB 5F2FA 3MLXL 2VISA 3QUYC 5I73B 1NGWB 3L54A 3HRZC 5DD3H 1E4XH 2D7QA 5DVMA 4FQLL 4XPTL 5ESAA 2WB7A 1C5BL 5JW3H 5D1ZD 5GGTH 1HL4A 1UD3A 2QSCL 3BH4A 2RB8A 1IO4C 4P23B 3F5WA 3WGVB 4V11A 1XEDA 4JB9L 2YMXL 1OAUL 5ANME 3O4LA 5EOCH 1DJWA 1VZHA 2K6YA 2IWKA 3CBRA 5BO1H 4LP5A 5CXPA 1SOQA 2JMRA 1YNKH 5D1QC 5D7IE 3W2DL 3ZE0B 3OBAA 1LDPL 2YXWA 1PG7L 4PRID 1B2WL 5D7JA 4CMHC 1P4LB 5D71L 1IQDA 2BMKB 3KNBA 3V0JA 1VFUA 2ADFL 2Y7QA 1MVYA 3H7BA 1DJYA 2Q86B 3SKUD 4IGBD 2GTWA 4U7MA 4HS3A 1DBKH 2B39A 1X4YA 3FSVA 5CCKH 1ITBB 4GBXD 3FO2A 4PJGE 2FX7L 1D6VL 1VEOA 1A7RL 3B9KC 2BOBA 4LU5L 1CGYA 4ZPTB 1MI5A 3U2SA 1RPQA 1KIUA 2WWKO 4G9FD 4APQD 1QD0A 3HCVB 1Z66A 2X3CA 1AQ8A 3QJQB 4R0LC 3VRJA 2QELA 3CXHJ 2Y5QA 3P2BA 3WFDH 3O6LL 1JGDB 2VDNB 4GB9A 1E6OL 1F3JB 1QSEA 2F53B 4QXGL 2YGQA 2DM2A 5F9AC 4BQ9A 2OTPA 3QQDA 1PD1A 3KE0A 2B1AH 9PCYA 4KKNA 2ODIA 4PCTA 3IDMB 1AHMA 1VPOH 4G8EB 4RETB 1SY6L 2W9EH 3Q6GH 3QZWB 3APCA 5CZKA 4XCYB 4S2SA 2JQZA 1MIMH 3FXIC 4JM2B 5EOCJ 5GRVK 5J12B 3BVDB 1W72A 3C5JB 3I6GB 3T0EC 1CGVA 4N0RA 1YHPA 4N3TA 4B9ZA 3WY4A 2P42B 2VAAA 4HXAH 4KUCF 1A6ZA 2BP3A 3GLDA 4WY7H 4QRPD 4JFZH 5K5YA 1DQKA 2X0UA 5GRZA 4U6XB 4JG0H 5B22A 5B38A 2AJSH 1XH3A 3S6CA 4KQ0A 2CHWA 2IMMA 3OKMB 4JPKH 3HZYB 4UANA 4M7LL 5TQ2L 4AKPA 3GSNH 2EDJA 5IB4A 2I60H 1AGDA 3ZO9A 1Y6MR 1I7UB 4UTAA 3PQYB 1DFBL 3FQXB 3F6JA 1T0NA 4BWWA 3ABGA 1LYQA 3HE7B 1OOWA 3ALXA 3CX5K 3KDPB 3LPGA 1CYXA 3FULA 1UM6L 3DTXA 4W9JC 4HSQA 3ZDXF 3HVDA 2BOLA 4PV8A 5DYOB 3MFFB 1T5XA 2B59A 4TSAL 3BUIA 4KXZH 5BZWB 3Q43A 1D9KD 2UXVA 3HI1A 4HFUL 4U7SA 4YLBA 2KDYA 5ACZA 6TAAA 2DQHH 3ML8A 3QFDB 1MVUA 3KPRA 2OSYA 3FMGL 4BELD 4QHUB 1EHKB 2LAAA 3R06A 3T4AB 1T1XB 1KYOJ 3CSBA 2YD9A 4DKDC 1M6UA 5IOPA 4I0CC 2A83A 3RPIB 4BRVA 5DLLA 3SDXE 4WWPA 2HVBA 2ERJB 2FEEI 2HH0L 3MKGA 1OIOA 5HJDA 2AHIA 2HFGH 2A6DA 1MHHB 3IXAB 4L37B 5MP6L 2P45B 3U4EB 1EJFA 2H45A 3TO4C 1R19A 2NDFA 4K7PY 4TL5A 2Y6SC 2YKLL 3DXAE 4HKJB 4P2OB 1UUNA 1KPVA 4MAYC 4PJ5E 2WXIA 5FW7A 2V4LA 1SQMA 4X5RA 1HZHH 3BJ91 1UATA 3Q6FA 4WFHE 2X05A 4AGQA 5A2FA 2WYZA 2ED7A 1KPUB 3N85L 4A66A 2WQWA 1SBSH 3BIAX 3QS3A 4QY8A 1GCYA 1EGJH 2NXZD 1CVSC 4LCYB 5EC1A 4XX1E 3AFLA 2IH8A 3PF2A 4PRBA 3B1UA 3MR9B 3MA9H 4KV5E 3RJOA 5T5NF 3SQBA 2L8AA 5KYYB 1NAKL 4G6JH 3WOVA 5K9OA 3CDFA 1KZYA 1SJEA 3D69A 2A74C 4NQDD 1MJ8H 1NGPH 1H6TA 4R9HA 1RXLA 1I1YB 3JYCA 4LFHG 4ZUTB 4X6CA 1QLRB 5CD5D 3D39B 4FXGA 1I8KA 1KN4L 3ME0A 1LE5A 4KX8A 5GRUH 4OV5A 1KJVB 5FX3A 3I9GL 1G4RA 4XVTL 4DVRL 5G2NA 4FXKB 4W9LC 4UV4L 5TF1H 5CEXA 5BQDA 4GYBA 5GIRA 3VSQA 4R7NB 5I8KH 2J43A 1O7VA 5IMMA 3FOMA 3ULUC 1N5YL 1P7QA 5DZJA 4N0UE 4JHAH 3KLKA 1KIQA 4NLHA 2DH2A 3DLQR 2H47C 2BS8A 3QI9B 4PGCA 2PR9A 1A9BA 1LK2A 2OI9B 4HMDA 3FOLA 3UJTH 1JVOA 1PZSA 3BKJL 2J71A 3MLUH 1CD9B 1J0KA 3PIQB 2DQIH 2X4OB 3PL6B 3QJTB 5I28A 3DUHA 3BFWA 3RWHB 1WQVT 3DUUB 5EO1B 3DX7A 4FA8A 2J44A 1RJLA 1E6JH 3KPSB 4J6IA 4L1HA 2G2PA 4P06A 4MNQB 4LASH 5C0AD 4HUUA 2VXTL 2PPAA 2DQ6A 5SV3A 3FUKA 3DETC 2F7PA 3KM1A 1IRAY 1OW0A 1CTNA 1MCJA 4PJ8B 3ZE0E 2W60B 5D6DC 5LN4A 4CGTA 2J6EH 3GIVA 4DZ8A 5IMKA 3NFPB 1ZHNB 2IQ9H 1XX9C 3EBGA 2O6CA 2H0JA 1G7PA 2BP8B 4BZ2A 4EIBA 4QI3A 4OCWL 3SBQA 1IGYA 2YMOA 3WAJA 2ID5A 3SY6A 4BFIA 1OAKL 2XKNA 1FH5H 1ZOXA 2H4EA 3WI9A 1OCRB 3IMUA 4JREB 3OMAB 4F33A 3EFFB 5AOKA 1U8MB 4NQVB 2F53E 1A21A 1HILA 2O5YL 5EWIH 4U1NA 4L3ED 2ITDA 2W5PA 4ICXA 2NQDA 1A66A 4DGIL 1PGRB 4JKMA 4H26B 2IDTA 3ZTDC 1C9SA 2VO5A 3MNVA 3N44B 2OSLA 5DHYA 2WBXA 1MFDH 3IXTB 1CF8H 3CK0H 2FB4L 1P5VB 1W80A 3H9YA 4XNAA 3HC4H 5T5FL 4HIXH 4JMXA 4GAJL 2HWZL 3ZKQD 1WBYA 5D7LD 4AQEA 4CBPA 2NR6D 1PTZA 1Q9KA 1IBBA 1Y18B 1G7QB 1JDAA 4JANA 1I31A 4TTDD 4F8QA 1GIGH 4P46B 5IGXH 1SPDA 2ADIA 3NJJA 4RLDA 4WW1B 3SY0B 5KJRL 5EFIB 3KPQB 4YHIA 1MH5A 3QUMH 3V6BR 4BCXA 5ISZB 2WQ8A 5DQ9A 5G4MA 3C6LD 3G6JA 3GBNL 3UO1L 2YEQA 3NJKA 3IMRA 4Q7DA 5D2NB 5K33A 3WJLC 2QMKA 2ZCKL 3ZHDA 2YD7A 3PQYE 1A7OL 2P5WD 4NQED 5LNDA 4UYQA 1VEPA 1IEHA 1JPGA 3QDJD 3G5ZB 3T65B 4K94L 4P4RA 4LSVL 1ZLDA 3HBGA 5GGQL 1U3HA 2CIIA 4X7FC 3V0WH 4EVNB 4UOQA 4GUQA 4Z95H 4AMXA 1YEJH 2VZTA 3KLAB 3D0VA 3TWCL 1JP5A 2OJEA 1NAMA 2Z9TA 2WLIA 5F44A 1XIWC 1L9PA 1DJIA 2BY3A 4W68A 2GI7A 2C7UA 3MAWA 2Q76B 1TKWA 3MRJA 4F9LA 2H2PD 3BT2L 4LKXA 2I07B 4FFWC 1DBAL 1YECL 5T1LD 4J28A 4A1RA 1JFQL 3WLWD 5D70H 3HZMA 1GR7A 1U58B 4OB5L 4LLYB 1IM9D 1HDMA 3PAUA 1A6VL 5IHWA 2X7LA 3V5KB 2R56L 1BZ9B 4KBPA 4AV4A 3NK3A 4YBLC 1HHKA 3RFZB 1KCUH 3N55A 5HDBF 5DUPH 3W39A 3N42F 2X4RB 2CLZB 3IETB 1FNFA 2PWEA 4KWUA 5LDSA 3CVIL 4X6CF 2VDML 5K39B 3TU6A 4PI0A 3O8XA 1JMZA 4S0SD 1YYML 3ZZSA 3TL5A 3MACL 4WCYH 5CUSL 5HYSG 2ED6A 3QDMB 4QF1A 4AJVA 5LJYH 5FYKU 1JZEA 4HQQH 4MWFB 4JHWH 3RPKA 4LRIA 3RIAF 1V27A 2UZPA 2A4ZA 5HJBA 2R2CA 1WITA 5JPNC 4CSSA 1IEAA 1NOAA 1RULH 3NIFF 2BHUA 2ZOUA 5CGBA 3H1ZA 4HZLB 4U2ZA 5FW6A 5E08L 3OAYH 1QUPA 5F70A 1MLCB 2R7EB 3OX8A 4NHCL 3M8OH 5CILL 43CAB 5IROD 4IBLT 2JIXB 2AXHA 3QIBA 4YSRA 5JMRA 4ODHH 1XGQB 3D39E 3RZWA 1EMTH 4HSAC 4ENZA 1B4JL 3ARZA 3L1FA 4OLVH 1SXCA 2IQAB 3HG1D 4G43B 4H13C 4L1LA 4Z0BH 1HX0A 5DRZA 3L3GA 1MCPH 3B3IB 1N2RB 1GJIA 1VADB 1W0WB 3ARFD 2H0FA 5IFHL 1KCWA 4BK4A 4NFDA 3V4PA 1BGXL 4X8CA 2DTMH 1R5IA 4IDJL 3D1MC 3AB0C 4JFUA 4RZKA 5IBUB 3PWLA 1HHGA 4FAAB 3GK8H 3OVUB 3U48A 3RU8L 4O00A 5F6HI 4TNVK 4C4KT 1E0OB 4LSTH 3ELAT 2OMVA 3QZPA 1XD1A 2IADB 1GZQB 4JUTA 3NPSC 2IH3B 3DTDA 2C5DC 1S7WB 2NNXA 1O0VA 1CG9B 3LPPA 2CK0L 1ORSB 2B14A 2BY2A 1EBPA 2PYFA 3HAEG 3ECVA 7FABH 2D7OA 4MNQE 2CO3A 5BNXD 2XY1A 1CBVH 4XC3L 1AXTL 1A0QL 3NRQA 3D0LA 5DT1L 1F4HA 3I50L 4LEBA 1YCSA 4MJ6B 4MQ7B 4Y5XB 3SYCA 4EE2A 1WFMA 3WKNA 3GJFH 4PUBL 1RLBA 1VEMA 4ZQKB 3I02B 3HLAB 4JFSA 3QWOB 1GGIH 2WXPA 3MJ9H 3SJVD 5J3HC 5D2LB 3QEUA 4IBSA 3VWJA 1KG0B 3QYNA 4X2UA 5ESVB 4JRLA 5E5MA 1WBXB 1K6QH 3VFSA 3N43B 4AIEA 3SDAC 3VD9A 1DQQB 5CS7A 3VD0A 5SWSB 2EDTA 1IAIH 5KTEL 4LOUC 4KKQA 2WCGA 1RERA 3IDYB 3QCUL 4OD2B 4YS4A 1OSYA 1LO3L 4WV1C 1I8MA 3QXVA 2Z92B 2OLDA 3LD8B 5BVPH 3QUKB 4M4RB 3G6JF 4OJYA 3SCMB 2ZZUT 1OQOA 1ZTXH 3QWRA 3BEVA 4JFED 5CGYD 2FUTA 3K8LA 2ZF9A 3AWEA 1AR1C 1CLOL 1WFTA 1XBDA 1T2QH 2WXJA 3KR3H 4R26L 4YBQC 2APVA 2ZJSL 2Q7YA 4Q6KA 1C16B 5FFGA 2P26A 4QJ5B 1AI1L 5GSRA 3TT3H 3EJTA 1BOGA 4YAQB 1NSNH 4NIYE 4Y9CA 1OAXH 4DOHB 2O5NA 5DWUL 5ISZE 4PP1D 3L9EA 5DD1L 4MYPA 3ZE1F 3ZMRA 4DP7X 4XP6H 5F88A 1CFBA 2QVMA 2HLFC 1W0VA 3P3TA 4ZW7A 5TFSL 3B7SA 1A1OB 4B9JA 4DKEL 5D2NE 4G7RB 4I48B 1EZSA 2JF1A 5H94B 3IRCA 2J56A 2Y2YA 3MRQA 3THMH 2D2CC 4NJ9H 2R69H 2NY5H 1WZ1H 3IDGA 4HGKC 4HK0B 4NCC2 5JPMB 5LGKA 4XNBA 3KH4A 2E47A 2XVGA 3TWCH 1F4YH 1QW8A 2UZIL 4KDWA 4LCCC 1I9RH 1JUFB 4YSAA 1DN0B 1OT4A 1AYOA 1X9RA 4O4YL 4JO4H 4QRTB 1ASOA 3BPNC 4R97C 3FTYA 4LHUB 5J57B 4Y1TA 1UACL 4PB0L 3ZL2A 1KGWA 3DA0A 3CXDL 3EYVA 3K2MC 2ZX7A 3MDJA 3BPCB 1PZUB 1Z2KA 1JGEA 5E70A 3RY6A 1AG6A 1E2WA 4S1QL 2UY6A 3CSGA 3H9SD 1ODUA 4FQXA 4RAUA 5I0VA 1JMXA 3AREA 4L9LC 5GS3A 4BQBA 5D7JB 5D96B 1N0LB 3KNBB 3P11H 1VLXA 5MHSE 3IMBA 1TPXB 2Y7QB 1A6PA 1ZCRA 3H3PL 4NQSB 4AM0Q 3WDJA 1JPEA 2GTWB 4HCGA 4HS3B 2GY5A 2XA8L 5E1GA 3B9EA 1LMIA 4FI7A 5C86A 2Y07H 4MA8L 3D3VD 5KAQF 4FHJA 2OCJA 4IRSA 4OFYA 5DJZB 3ULVL 5C0CA 4LNVA 1KIUB 5FYJE 1DCEA 1RPUA 1FL5A 1JL8A 4PRHD 4FJYA 2ZF8A 4P5TB 3QDME 3QXAA 3KL3A 4TULL 1NKRA 1L0QA 3BZEA 4LARH 2VW4A 1JV5B 4B7LA 2Q9OA 3QQDB 2CM5A 2YS4A 2OMTA 1OCZB 5I18H 4O5LH 5TPWH 4XT1C 2FO4B 3QARA 4OLYH 4JJ5A 3D6GA 4HU2A 2A2QT 4L05A 2ZT9C 2WCPA 4JRWA 3QXDA 4MZRA 5HXMA 3TJEL 4ZW5A 5ABZA 2EIKB 4DAGH 1TQUA 3P9LB 2VAAB 3FT3B 3GRBA 4CBZA 1P4UA 2ZXCA 2JJWA 1B0RB 1RK1A 5B38B 1KB9K 1XH3B 4GEIA 4UQAA 4ERSH 1DVZA 3W5MA 3I9PA 3OMZA 3IE9A 3UGUA 1NGXA 3CFDA 1NGYB 4K8RC 4O51B 3BN3B 1F6AB 1RVFL 1U8PB 4NUGH 4FHBD 1QBLH 3OAUL 5E9DB 4ABQA 4YHLL 4U0QB 5AOJA 3E80A 1DJGA 2AGJL 3CHPA 4ODUB 5J5EA 3LRHA 3VXMB 1QRND 5E4EB 1I9EA 3BYTA 1ZT7A 5DC2A 4PV8B 3CH1B 4UM9B 3QUYB 2WGXA 4MB1A 2B59B 3RVTD 3ZK0A 3HUJB 3HI1B 3HRZB 3K2IA 3AG1B 1UA6L 4OGXL 4QNPF 3HB3B 1MVUB 4H8QA 1JN6B 4KQ4H 1NCBH 3PDGA 5EORL 3PUCA 3RDJA 3E7JA 2UYLB 4P57A 4W4OA 5C0BB 5ABDE 1DQML 3BHBB 1JHTB 2DI8A 4FYTA 1KELL 4OBRA 3VQ2C 3FSOA 3T3MB 4Q14A 2W94A 1A4BA 4F7EA 5I1IH 1OOAA 5ICXA 4TYUA 1IAIM 5D2LE 3UCRA 2HUHA 5D1QB 5HGBB 2CDEA 4HH8A 4HUXB 1UG9A 5KW9L 4LL4A 4RNRA 5AKVA 4OKDA 4WEBH 2YUWA 1GGCH 3P1VA 5HPOA 4LO9A 3MRLA 4PJ8D 4W9HC 3IKKA 1EBAA 5F3HB 1K8IB 2FBJL 3AG4B 3JWNE 1YPZB 3EBAA 5BZZA 4D0DB 5DUJA 3DARA 5CMAA 1PAMA 1S3KL 1U2YA 1AD9A 1KCRL 5DK0B 3U7AA 3VD7A 5HTSA 2XV3A 1ZD6A 3O6FD 3QPQC 4MCNA 4PRBB 2OR7A 4YHZL 4U3CA 5KVFH 5FCUL 3UGEA 3VXSD 4KC3B 3DX8B 5A40E 4DK3A 2Q10A 4NQQA 2VMDA 3KWUA 4IHOA 3P0YH 5K9OB 1SJEB 4L1SA 3RRQA 1UWYA 3WUZA 4Y9BA 1NBYA 3KGUA 3R7QA 1YEIL 4FTVD 3PGFL 1BIIA 3E38A 1HTYA 2D4FA 3V8OA 5I8OL 4L8BA 4NB7A 3T0EB 2FGZA 1CXIA 4FKKA 1K72A 4WI6A 5CHNB 5F1IA 5C3TA 4DOHE 2EZ0D 4JRYD 2V7HA 5FOJA 5K9KB 1T22B 3FB8A 1CK0L 5JOFA 1UXWA 2WLMA 4C59B 5A1AA 2EIJB 1F2XK 1CFNA 5CEXB 1JGUH 2EUZA 4NO5B 1UVQA 4LLVA 4YXKL 3FOMB 4M93C 5DHEA 1FE8L 2J1KA 3NJXA 3N1QC 1CICC 3IS1X 5BO0D 3OKKB 4OW6A 4TSCL 5D7IF 1IBFA 4C83B 3GF8A 4IOIA 4WO0A 1F3RB 3OF6A 5LCVL 4LB8A 4OD3L 4FLRA 4BGDA 3UTSA 4XWOD 2MCG1 2WXMA 3GBDA 4GQQA 5H37H 1JPTH 4U1SB 2RD0A 1S5HA 3PABA 4PJGF 3DX7B 4C56D 5J6SA 1RJLB 5ESQA 3W82A 5D1ZC 1NGZB 1FLTX 2E9WA 3U0PA 3ISRA 3JSSA 4TQIA 3CLFL 1SYSA 4QRSA 3X13B 5B4MD 3RB7A 5AVSB 4OLXL 5C6WH 3PUUA 2YEZB 1IV8A 1OTUD 5AW1B 3MV8A 3L3IA 1BLIA 4U6TA 3WL9A 4JFFE 3RGBA 4NXKA 4AIOA 5TGBB 1RZGA 3C60D 3GC3A 2F8IA 4HIPA 4YHYC 1IGYB 2BNRD 2DM7A 5E2WH 4E42A 2CCWA 4XP5L 2AJYL 4ZFQA 2YSTA 3TBTA 4IGBC 2YGVA 4P3DB 3VVWA 1JGVH 3HA0A 4P2AA 1KGCE 1PEWA 4MAYB 4AM0A 1AO7D 2FECL 4GBXC 1XF4A 5FW8A 2BIMA 4RMRA 5LG1A 4WHYH 1DJSA 5DRXA 3HPLB 4MJ5A 1SJXA 1HILB 3PS6A 4APQC 4U1NB 1T03H 2WNXA 4JRFA 2ITDB 1YEGH 3B8YA 2X9WA 3KXFB 2XZCH 1OE3A 1TMCB 4N2OA 2VLJA 5I0XA 3NFSH 2WIMA 3RA7H 1UKQA 4U2YA 2OSLB 1EVTC 4UTAH 1A1NA 2XX0A 5IB1A 1F90L 2CHXA 5T3ZH 5I1KH 3NQKA 3IGLA 5TDNA 5DTFA 1HKFA 2WQXA 3V7AG 2AITA 3QCVL 2XBTA 1WBYB 3PWJB 4AQEB 5AW4B 5TE7L 4RDQG 1Q9KB 2FHFA 3DVFA 3MRIA 4G6FD 4ZS7H 2BSTB 2A74B 1JHKL 2NYZA 2WLNA 2YPKB 4HWZB 1EEQA 4J4PA 4JANB 4JM4L 5T3XH 4N2HA 4Y1AB 3APNA 5IFJA 3KCPA 4HOZA 4O58H 4NWUL 1AQKL 5DRWB 4JY4A 2P44B 2J72A 2VITB 4AIXA 4ECNA 2OCFD 4OQTL 1BYOA 4P3CH 2DQMA 2DJUA 1T2XA 4FS0A 1G9ML 4OZHA 4XPGL 1RUQH 5E9DE 3S96B 3WXVH 3H9ZA 4KDVA 4DGVH 5HGHB 3NAAL 1AS8A 2VLRD 3VXME 5LXGH 2C9VA 1OARL 4J12A 2VMFA 3NCBB 5IF0B 3SKOA 2CIIB 1IQWL 4O2FB 2DWXA 2XXFA 4LF3A 3D2UD 1L4IA 2DQGH 2UX6A 3KLQA 2JB6A 4K3HA 4XBGB 4GQZA 4WI5A 5EZOL 3HUJE 3BCDA 2WIIB 4NQCD 1NAMB 3S5YA 5I1CH 1SFDA 2ESVE 2OR9H 1M6OA 1U95B 2C7UB 1SQ2N 2FSDA 3DO7A 4KKCD 2UY7B 5INDA 5JORA 1D9KC 2R0WL 2KZ1B 2XN9A 3MXWL 3QDGA 5C0BE 1HHHB 1FFQA 5KVEL 5BS0A 1YMMB 1GC1C 2MCMA 1AKJD 1R3IL 1H19A 3T3ME 2EKSA 1QSFD 3HE6A 1DEDA 5D1QE 4GG8A 4I18C 4LCIH 3UYPA 2X7LB 5EOTA 5LQBH 5F89A 2KKQA 3F12B 4Z3IA 1SM3L 2QVFB 1J88A 4LXFA 5LBSA 4AV0A 4QXWA 3LYRA 4NCC1 3GMQB 5ENWB 1YPZE 3JQOB 3O8XB 3NABL 4PYGA 4HIIA 1IGIH 1C7SA 3EJZD 5H2BA 3RWIB 4CU8A 4HOXA 3ZYIA 3ARSA 3HZ3A 2YC1A 5EDXA 1RZJC 2DKUA 3A22A 3MV9A 5AW0B 3FO1A 4H44C 4WGVB 1NANI 1R3KA 2UXFA 1F97A 1I9IL 1IEAB 2EXWC 3CZNA 4HV8B 5F1OB 4AE1A 1NFDA 1U3ZA 2NXZC 4YHPB 4XN8A 4E9WA 2OW7A 1ORQA 3OX8B 4DQOH 5LN8A 1HHJA 1A4JA 1ODAA 2Z91B 5DJXA 3CSFA 4FLOA 4BKLB 1CFTB 1RZ7H 3KBHE 3QJSB 2OL3A 5F3FA 2NUTB 2DQEH 4P2RA 1GMIA 2X4PA 4GP5B 3T0EE 1EO5A 3IGAA 3IDJB 4MDJA 1T04B 4Y2NA 3UADA 1M3IA 5MI0C 5AQ0A 5CD5C 4TVUA 3L3GB 2XWDA 1FIGH 2J1ZA 3WE1A 5D5MA 1P7KA 5DURB 3OJDB 4B0MM 1PCXA 5TE6H 4HUVA 2FLMA 1IC7H 3BUTA 3US1A 3PWLB 3AT8A 5FA3A 4ZUUA 3ELQA 1FL3B 4AGNA 4UIKL 1O75A 3NFNA 3LB6D 1TYEB 2V5YA 3MRDA 2B9BA 2YSSB 2AQNA 4KXCA 3K2UL 4E9SA 4LIQL 4KX7A 2EABA 1IFHH 4OUUB 1A3ZA 3CSPA 3GLZA 1DUZA 1ESOA 1LP9B 4IKJA 5E6YA 1CBJA 1CLCA 4X6FB 3JWOH 1FWXA 3L48A 5CWSB 1Q1JH 4WFED 5C0FA 1OF2B 5C0JB 2XQYG 1ACZA 4WDIB 2ZX9A 4F7MA 1X6NA 4FA7B 4RZCA 1YA5A 4M5ZL 5ADOL 2NNAB 1GW6A 2XFXB 2WZPD 1H3VA 3V52L 1R5VA 2PPCA 2BINA 3UTTA 3PDOA 2EDMA 3JUYA 5IFAL 3AQDA 1PG7X 5SX5K 4XN9A 3ZQ9A 3DI2B 3RWEA 1FNGA 4N0YL 3PU7A 1KENL 4YBLB 1JNLH 3B6SA 1WK0A 2BRRH 3LNGA 4P9HL 4QOKD 4TRPL 3NGBC 4L4TD 2MNJB 2Q20A 5LGHL 4NNPL 3FCTB 5EZIH 1SY6A 2IDCA 2WO4A 4YFDB 2ARJQ 2BOCA 1I8IA 1MFMA 1NLBH 3KXFE 3L5XL 1O5DT 5EU3A 5GZNA 3KPTA 4X99A 5AZEL 4OZHF 4FZ8H 4AUJA 1JHLL 4JPVH 4LVNB 4TF4A 4WHTB 2E9GA 3JV5A 5KJ7E 1MIEH 4DTGL 1IKOP 5JPNB 3V79C 1FBIH 2C3GA 3IU3B 4YVUA 1FFNA 2Q7YB 2B08A 2EH8L 2GIXA 4YSTA 5ALBH 1EWHA 2DLFL 3RIFF 1W9XA 5KVMC 1YN6B 2WSKA 2VL5B 4I1RA 3L3DA 4FADA 1L3NA 4Y1AE 4U6YB 1J8HB 4OH2A 2NR6C 2Z65C 2F54A 3VAEA 4B9KC 1D7BA 5F88B 4TTDC 1SYVA 1WO2A 2NY1D 1W0VB 2F5BL 5AWNH 4M6NL 4FEIA 3VFGH 1HI6A 4XO3A 2QLYA 5E6SB 3ULSA 3WUWA 4UF7C 4B9FA 3OV6A 1KXTA 5DCCA 1I3VA 3JVGA 3NCMA 3C6LC 4XE5B 1O6TA 3MRKB 5BV7L 3L95B 1G1YA 5J0BA 3ULUE 2H1PL 3MJ7A 3QP3A 1VJSA 5I8EA 3F04A 2ZSVA 4EQ2A 3UGXA 4DP0X 1XR8A 4G8AC 4X7SH 4J3OD 4E9YA 3KJ4C 3NCJL 3MBXL 1X5ZA 5TH2A 4UDUB 3FH7A 4LCWD 4AEHH 1XEUA 3NPSB 2Y1ZA 2IOIA 3Q5TA 3KM2A 1S7QA 2WAHA 2MQ0A 3IF1B 1YMME 4HXBH 4YC2C 1E27B 5GS0L 1C8QA 2NSQA 1CD8A 1EK3A 4GAYA 4MZ2A 2G4GA 1YEHH 5MEOB 5DJCA 3G5WA 3HAEA 2EIDA 2QV4A 2CRIA 4EKJA 2MJWA 1NFDF 5I6OA 4ZXBC 1KXHA 1IC0A 4Y2OA 3SSGA 4PR5A 3BIBX 4ORZC 3TX4A 4IRSB 3ZDZF 4X4MA 1PEZA 2FZ3B 1ITCA 2NY0B 4HIEB 5EUKA 5C0CB 3OR6A 1YUHA 3PV7A 4XN5A 1FL5B 3LZRA 5E2VH 1FYTE 2WBJD 3L7EA 5F6HJ 4NGHL 5I1HH 3CC1A 5DMGD 5B3NA 5F7HA 3PWVA 4FQIL 3SDAB 1AGBA 1M7DA 1KLGA 3D08A 3D06A 3FQ4A 3L4CA 3PRZA 3NP4A 1KTCA 5GPRA 4OD1L 3VFWA 1MJ7H 2MHAA 2F74A 2YZ1A 2R51A 3N9GL 2Z4QB 2SODB 3V4PH 2OMZA 4JZJA 4GRLD 1MY5A 5CBEA 5CLXA 1NM4A 3D7PA 3OKLA 1E4HA 5K59F 2DWEB 1UKSA 1H3TA 4X98A 4LEEA 5B21A 5E8EB 2BVOA 1AR1B 5HHNA 4G6MH 1PW3A 4K3GA 5IROC 4UDTA 2Q7NA 1RK1B 3BUPA 5CF3A 2F6AA 2O1AA 4AMKL 1GZHC 1PLGL 4OCRH 4XVSL 4Z7UA 4AT6A 2N7AA 2QZQA 4QMEA 2QQKL 4E9VA 1NGXB 5IUCA 5I15L 2V9TA 3G04B 5E7BA 3ZPDA 3CFKB 2Y22A 4DP4X 3TEWA 3VSTA 2AEQH 5C2UB 1NPNA 1RUAL 3ARFC 3B2UD 3P69A 5L8KB 2X2HA 2H3XC 3S3DB 4PLJD 5I1JH 3KVDD 3EJPA 2BSRB 4AE0A 1G94A 5EBMB 3STZA 2E59A 1LILA 3BD3A 4LCCB 3IFPB 4UTCA 1XGYL 1DBMH 3BUYA 1WHOA 5HHXL 1LP9E 3PE9A 5FA4A 3ZVVA 4KXAA 4TQHA 3IDNA 3QEQD 3HBPA 1LO0L 4PRPA 1L0XA 4R97B 4H4NA 3DX6A 2H8PB 5AZ2L 3C2SA 3GI8H 4WFFD 1MFCL 3TNMA 1C5CL 1FZKB 1JDDA 2XKUA 1X9QA 3IK2A 3KYKH 3MNZB 3ZYZA 3R18A 4F7EB 3ROLB 4Z7QF 1XH2A 5ACMA 4PTTA 3QNYA 1CFMA 4NBZB 5LGJA 1HYRC 3RQ3A 2XTJD 4RNRB 1ZLSL 5D7SH 5C3IA 4D2NA 1JPSL 1A3RL 1FO0B 2GBUA 3U7WL 4BSWA 1SHSA 5DC4B 3MBWA 2R2BA 3MRLB 1NTDA 3ATFA 4Z7NB 3X1EA 4IU3B 1HQRA 2ZWKA 5GQBA 3WTUA 3TEZA 2AKRA 25C8H 2ZG2A 2XTSA 5EU6A 4BWUA 4U1GC 5EIIG 4YWGH 5CMAB 1HOEA 1EXUB 1U3YA 3RWGB 2CPCA 1NBQA 2FVNA 4XCCL 4R2GB 1VFMA 4TLKA 2GBVA 4XCFH 1XGTA 5T5FA 1ACCA 3N0PB 4O2CA 3MRFA 2HMID 3DKHA 3IBEA 2JQAA 4KITB 3ATAA 5KYUA 1TTRA 1UH3A 2HVKA 4HALA 4YFLI 2PPEA 4IEFA 2EDRA 2GIMA 3DRTB 5GISL 2W59A 1NBYB 3M1CA 5I0WA 4L3CA 4Q6IA 3C5SA 3V6FB 5CGYC 3GSUA 4XO8A 2X38A 2G9HA 4J8RA 3TGXA 3WKPA 4B5EA 4L8BB 1J8HE 1KFAL 3E0GA 2XACC 3I3DA 2X10A 2V7HB 1WSST 1CFSA 2V2XA 3S98A 4KQ3H 4XAWL 3MV7D 4QLRA 4ZOCA 3GZPA 4CMMB 1T7VA 4LLVB 5KZCB 4PP1C 1S9WB 4OLEA 3TBSB 1UWEL 3BH8A 3KJ6H 1ZV5A 1TVBA 1YJDL 3LV3A 2WYTA 2JB5H 5CD3B 1E9PA 3ABLB 3MRMB 1HCFX 3MTXA 4TSBL 4OT1H 1WRFA 1O9WA 2VDLB 1W16A 1L6ZA 5AFAA 1TQTA 2CHZA 4IOIB 3BWUF 1CD0A 1OGTA 1FGNL 5DVPA 3SYPA 1MJJA 4J3OG 2QPUA 3G5VB 1KMGA 1E65A 3S4SA 2H6PA 3BXNA 4NI6A 3FCGA 3RGHA 4DUXA 2MRYA 2OMBA 1R3JA 3PABB 2IF7A 2LU4A 3MO1B 4KK6D 4U6HB 4GMSL 7PAZA 4NFBA 5F7KC 2VIRA 1T83A 3S9DB 3QUZA 3AC0A 1OT2A 35C8L 1WS7A 2ICWB 2W9DH 1VDGA 1R5WB 3DHPA 3L3IB 5EBWB 5IK3B 1FVCB 3F6IA 1KDJA 2YXMA 3Q3GA 3WL9B 3BKYH 1YC7A 3DDGA 4RAVA 4ZMOA 5FF6A 3SE4C 3OHXC 2VDQL 3ZUCA 2VQTA 2Y1YA 1UWXK 1VENA 4LSUH 2C4FT 5C0CE 1RJZB 4LCUA 4WENB 3HPJB 3WY2A 2OX5A 3VYNA 1GMEA 4JGNA 2Z3FA 2NTFA 5DRXB 4UQ3B 3IFNL 4MJ5B 4HU8A 1GGUA 4S10A 3FFDA 4IM8A 5DJ0A 1BX2A 1BQHG 1M05A 2OMUB 3UJJL 1G9NH 4KDTC 5A6LA 4Z7UF 1NJ9A 1FFOB 7PCYA 1T7ZA 3AS0A 1IUZA 1XXFC 2AQRA 2HFEA 2AJXL 4PH8A 3LEYH 4YFLF 2FQGA 3FC8A 2XQYK 5C6TL 5EPMA 2EVIA 4L5FL 1SMDA 4XHJD 1XTMA 3JV4B 4L1BA 4JKLA 5DTFB 3S8GB 1O7DC 4AQAA 5AOLA 5EEUA 1NCAL 1VSCA 3QO0A 1RZJL 2LW3A 3QH3A 4UZGA 4KAQL 4UILH 5IZ7A 2VDKB 4IHBA 4BFKA 5HSFA 2Y0SA 5DI8B 3C08L 2YUVA 4QYOA 5EZPA 4KJYA 3NJMA 4IRJC 1ZLWH 1MQKH 1MFEH 1M9SA 4AYDC 1WBZA 3FH5A 4OCXL 2YPLE 1S9YA 1UOKA 3PY9A 3G5XB 4U4BA 2VW7A 1D2OA 4HKBA 1QO3A 3SZKC 3UZEA 4LMQI 2MH4A 4M93B 2L7JA 3T8XA 1BYPA 3TJPA 1G1KA 1OM3H 1WJ3A 3NZHL 5G5DA 1LE9B 4U1JA 2GUOB 5AW9B 2QKIC 3GBLA 1SDAB 5L4MA 1I9JL 2XX1A 3LJ3A 4TNEA 5E2UL 1M6OB 1OZTG 2Y5TB 2X6VA 1S78D 1AIFA 1ND0A 3RVTC 1H3PL 5JORB 2XN9B 4JRXA 1PZ3A 1MREH 2AFNA 3GSRB 1QFUH 1YLBB 2XU9A 4AK1A 4K3JH 3OJVC 4FEMA 4N8PA 5KSVA 1FP5A 1LJMA 4DP6X 4WKXA 2A9NL 4NZDA 1ZS8B 2DWTA 5EOTB 4XNZB 3U30B 2GY7B 4B97A 5HGGS 3EO0B 3O3BB 2H6UA 4PG2C 2A6JA 4W6XB 2BVEA 1CXFA 4LDEB 4QT5B 1D5XA 4MMXC 2AW2A 5CEZH 3MZGB 4PBVC 4YHYB 1U33A 2P7TB 4NAJA 5IESL 1ONQB 1D6EA 4LGRB 2HJFA 5H2BB 5KBKA 3TPUA 2VR4A 3B9KA 2E9JA 3BC9A 2YC1B 3JWDC 4JR9H 5KEZA 5KWYC 4GSDH 4AL8H 3FO1B 4PVNA 4ESKA 4M03A 2AABH 3CHSA 4R0LA 1INQA 2PTUA 1T1ZB 4PS4L 1JCVA 2ZUTA 4APQB 4XO4A 2VN7A 2JCWA 1MCOL 3B2VL 1LD9A 3O6FC 4YEFA 2FX8H 1CGWA 4F7PB 3FK3A 2ADJA 5CSBA 3MREB 1KEML 2DICA 1HHJB 1A4JB 5DJXB 5J6HA 2OYPA 5FWQA 5KYNA 3LDBB 4YDJB 5J89A 3FFCA 1OTSD 2ENPA 3DSNA 1PX8A 3IGAB 4PLNC 4XRCB 1Q0EA 5DS2A 4ACTA 2VSCA 2FT7A 5GJTH 4QO1B 5FGBA 3FH8A 2O61A 3KVQA 1KV3A 4HWEH 5E23A 1QTYT 4YXLH 4RFOL 5IMLA 1COBA 4OLUL 5D5MB 1P7KB 3PJNA 3UC0H 4F8NA 5KS9E 3BN9D 2EZ0C 4MMZC 2BNQD 4HUVB 1YMHA 1TZ8A 3KLDA 3BKML 4QRPB 1X5MA 1ET7A 1BQLL 1ZANH 4R96A 4GUOA 3C8KB 2PR4L 4RVBA 5FYLL 2VRKA 2EEFA 5L6YH 3LQAL 3ZRFC 5DJ6B 2HRPL 1KFGA 2LE9A 4OLZL 2ZOWA 1VFOA 1U30A 4OIFA 1QFWH 5JO5B 2VXVL 4XPBL 3RURA 4AEIH 3EYSH 3LHAA 1HXMA 1CMOA 3WIFB 1ZE3H 5JHMA 1F6LL 5JW5B 4XWOC 3C8HA 2YAPA 2CDFA 4FMKA 4WQOA 4GKLA 1AHWA 2Z8WC 5DEFA 1UJ3A 2TSBA 3G5YA 4PJAA 2ZP9A 4K9EC 1D9KB 2K6ZA 4F7MB 1TEYA 4GRWE 3UYRL 5B4MC 4Y2LA 2R4SH 1ZEAH 1NOLA 4ODTL 3MROA 3UO8B 5EF2A 1J05A 4UNIA 3U6XA 1OTUC 5IR1B 3P54A 2GG1A 3M1BA 3TO4A 3RWEB 1FNGB 2P48B 1GOHA 3C60C 2IWFA 4ZSOA 1MG3C 3B6SB 1GW0A 1H5BC 4KJWC 5JDJA 1RHHB 4LQFL 2A5UA 4DKFL 1D5RA 1NANH 1UQSB 4HUMB 3LQZA 1TO5A 2BOCB 3HHRB 1WEJH 4FG6D 4HEME 8FABA 2E7HA 3DJ9A 1UH4A 3MYJA 4XBEH 4YSDA 3MRNA 4X99B 5FOBA 3GXDA 2X6BA 5HYSB 3F7LA 1GGBH 1NDTA 3ATEA 4PI2A 1YY8B 4FERA 5E6RB 5F96H 1QBAA 4CAGA 4NOFA 3AG2B 1MAML 2NXZB 1FFNB 4GOSA 2PO6A 1NIBA 1N4XH 1PQZA 3ARBA 5DFTA 3QJHB 1PDKB 3L3DB 4Y5YC 2VZSA 1PX4A 1X6LA 3E3QC 4L3FA 4M43L 4MDIB 15C8L 2C9UA 3IDIB 3QG6A 1BEYH 2YAFA 3ZHFA 1SYVB 1R34A 4NQDB 3V95A 1BW8A 2A9CA 3ULSB 1RURH 3RY5A 3MLRH 4KKPA 5MI0B 3RUGB 3UBXB 3VDCA 4POYA 1TT6A 1JE6A 1KN2H 1QOKA 1E5ZA 1XR9A 4NQXA 4AG4L 3TIDB 4RH4A 1RZFH 4FG4A 1GKOA 1IKFH 4HOMA 3QPXL 4IJ3B 4I3RH 1TUPA 1U92B 1E4XL 3MJ7B 1NCCH 4J3BA 5KSUA 1E5YA 5JW3L 4QR7A 1UYWL 5GGTL 3BWAA 2GC7C 1VGEH 5HDWA 4N90D 1MDAA 5LBSH 1H15A 3F2LA 3N50A 2ICCA 3DO4A 5TH2B 4WK2B 4UIMB 2W0FA 4PGDA 3NJFA 5E7FA 4DVBA 4Y19A 4P5MB 4HCRL 1YNKL 4BK5A 1SXAA 4LP8A 2AK4A 4EF3A 1E2VA 1EEZA 5C07A 5I1EL 4S1SH 2P80D 5KG9A 2EE6A 3T1FA 1WAPA 4KKCC 3MOAL 3RDTD 4GAYB 1GY1A 1JTTA 1MDTA 3HAEB 1DBKL 1PKQA 3DBXA 5D4QA 4KK8D 3CMOH 5TK2A 1KB5L 5JUEL 3WDHA 4NOBA 3QXWA 1Q0XH 3LN5A 5DD5L 5C0AB 1VFBA 2Z8VC 3NEEA 4G8GA 5CCGE 4Y2OB 4CJ1A 4PRIE 2XQYA 3GQFA 3QJRB 2OL3H 2N4IA 2NYYD 1DQVA 1W8NA 2CBMA 5SWZA 3KD4A 1LNUA 1AGBB 1T1WA 1OL0A 3UXFA 5C08D 3MLXH 3VVVA 1BF8A 4OCMC 1HEJC 4X4XA 2XNAB 1FNSL 3FONB 4YR6B 4ALAC 2E7LA 3NGBB 2F74B 1VPOL 3EJZC 4JS7A 1UURA 2W9EL 3Q6GL 4G9FE 3AM8C 3UG3A 4AVJA 5A16A 1ZXKA 4RWYL 2OMZB 4PTUB 1KPRA 4KXDA 1MIML 3N06B 1Q9WA 4FQLH 3UP6A 2ICEC 1UTDA 1C5BH 2V3DA 3WNLA 2QSCH 5L2KD 2LAGB 3FT9A 2FJSA 3MI6A 4G70B 1AZUA 2P5PA 4JFZL 4JB9H 3A4EA 3NH7H 2VB5A 2BVOB 1NCWL 4GXUN 3FQ1A 4UDTB 1NFIA 2G3MA 4JPKL 2WWNA 3L1GA 4ZFFA 3W2DH 3GSNL 1LDPH 3NJHA 5AW8B 4PLOB 1B2WH 4LLMB 5D5ME 2I60L 5ERWA 5IVZB 1OAYH 3IGKA 2C3VA 2YPVL 3MYZA 1A7NL 4U3SB 3B8SA 2GJZB 1QFWM 5LCVA 4QRPE 2ITFA 2QQLL 2X6AA 1L5GB 1D6VH 2VLKD 3D4GA 3HS0C 1A7RH 3OC8A 3Q9PA 4PJAF 2VDRB 1PYWA 4PP2B 5BRZA 4B95C 4M61A 2AXFB 1JF6A 4XOCA 3C6LB 3MRBA 3Q2CA 4Q9RL 5J9PB 1ECYA 3O6LH 4IIQC 1WZKA 4ZOAA 1E6OH 4PJXB 2XZZA 2P5WB 4NQEB 4MJIA 3BJLA 2DQHL 2P5EA 3REWA 1U91A 3LB6C 1PZBA 4LBEA 4PIRF 3T0XA 3QDJB 3ESVF 5J13C 3HKZA 1J9CT 3KJ4B 4PRPB 2ZE0A 3JYBA 2Z1KA 3ZZQA 1DSWA 1KBKA 3SDCA 1NH6A 1XO8A 1OK0A 3DV6A 1ZXQA 2AV7B 4IBVA 3L5WB 3U1QA 3BAYA 1XIWA 2MWCA 3BZ5A 3LH9A 4P5KA 3VDAA 5B7FA 3BQUD 1OGSA 1SJMA 3CFEA 4PTTB 4YC2B 3QNYB 2QTEA 1F18A 2Z7ZA 3F83A 3VI3F 1CDHA 1AKPA 4NRYA 5AW6B 4RFNC 3A4DA 5TQ0L 3C87A 1FAIL 4Z0XA 5T1LB 4P04A 1OHQA 2VR8A 1S8DA 4L4VA 2DZEA 1E9OA 1Z3GL 3IRPX 2QEJA 1SBSL 4M7LH 5TQ2H 1HQRB 4B53A 1X5YA 3EW3B 3EFDH 3ZKNC 4RBPK 1IBGL 5EU6B 2XZQL 3IT8D 3LNIA 4NO2A 2I7SA 5E5LA 4NRXB 1DFBH 3BQVA 4J5VA 4KI5D 1G6RB 4YMPA 4EN3D 1XGTB 2XWEA 4JX0A 5DUBB 3JV0A 4NUPA 3QIWA 5BUAA 1BAFL 2X4UB 3HFFA 4OFQA 3U79A 2XWJA 4M9PA 1AC6A 1NC2A 2ZONA 3GSWA 2E5EA 2OMNA 3U36B 5KYUB 1FC1A 3K72A 3QR0A 4YPGA 4ZFGH 2ARJB 4TSAH 4YHOL 4XMVA 1ED3A 4ZDHB 3WJJA 1JDCA 1OSZB 4Q6IB 4LLAA 5FK9A 1GS7A 3DXAD 3TH4T 4PJIB 1NKGA 1TZAA 2X42A 2BCKB 3FMGH 4LZKA 1N67A 4OF6A 4OQTA 5GRUL 5D6CA 5CJXA 1UXSB 3ZMNA 1GTFA 5BZXA 1TQCB 1NGQH 4WFHD 5TF1L 1NM9A 1G7MB 1DLHB 2HH0H 4NQDE 4A63A 3D4ZA 2NX5D 3OC5A 2QGDA 5MP6H 1EAJA 2KC0A 3FU6A 1KXQE 3RUGE 2A7BA 1UJTA 1ZA6A 2YKLH 4PGJA 3WKQA 2E86A 3PAYA 3TN0C 2NY1C 1NIDA 3WGUB 3C2AL 3LTVA 5BMFL 4XN1A 3U9UA 3DHUA 3VFRA 3OKDA 4TS6A 3WNMA 2VDOL 4PD4K 1MHCB 3IN0A 4AUUA 3B37A 3IJEB 2Y2TA 1IGJA 1CUOA 4WJG3 3HN5A 3HMWH 2K70A 4OZFB 3WO3B 4X4YA 1R3JB 2DQCH 4W70A 2HN7B 2RQ8A 4LASL 5GGRB 4J3OC 4V1DD 5FYJH 1YEKL 1NDMA 2VIRB 3FUHA 3OB0K 5I5JA 1CXKA 4JG1H 1ZV9A 1G7IA 3Q1SL 3VFUA 5B1JA 4WU7A 1BECA 1MNUL 4M6OL 1QHOA 5CBAA 3WTYA 3GFUA 4FQ2L 4GSXA 1E3ZA 4RAVB 3FCSB 2VDMB 5C0AE 3TIEA 1KN4H 2O4EA 1NL0H 1I53A 2VSMB 4XP9L 3TTSA 1FH5L 2CUIA 2JKTM 3L5JA 1OZUA 3I9GH 3UDWC 4XVTH 2CO7A 1W2KT 4UV4H 2NW3B 1NUDA 3L3OA 4EJ1C 3SJVB 12E8L 1N5YH 5D7KD 3ASOB 3A4FA 3RHWK 2N7SA 1M05B 4PN6A 1NJ9B 1F45A 2WBJC 3OKYA 4X5WB 3CHXA 3QORA 2DBJA 5DMGC 1E2ZA 1MFDL 3ES6B 3CK0L 4L0YA 1IBZA 3EYQD 4HAFA 4WV1A 1T4KA 3T4YA 2BJML 1HH9A 3O9WA 1CE6A 4FCAA 1JZDC 4JFYA 5HYIA 2O93L 1O9ZA 1WHPA 5EMYA 1RSYA 1GIGL 4GRLC 4IYKA 3D52A 5IGXL 1JF1A 4PAZA 4I1NB 1E4KC 3QUML 4NHUB 4QTHB 2FJFB 2VXTH 3V8CA 2P8MB 4ZUSA 1N70A 5F0LB 4JFEB 2P28B 3VSUA 3ZKXB 3R0NA 1IM3D 2ATPB 2MKLC 3E8UL 4GUPA 2JJTC 3R8BB 2QT6A 5KUKA 4KJYB