1MZYA

Crystal structure of nitrite reductase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
331
structure length
331
Chain Sequence
LSNLPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLDEDAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPENTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGPMIPWHVVSGMAGCIMVLPRDGLKDHEGKPVRYDTVYYIGESDHYIPKDEDGTYMRFSDPSEGYEDMVAVMDTLIPSHIVFNGAVGALTGEGALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGTAGAALYKFLQPGVYAYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title The High resolution Crystal Structures of Nitrite Reductase and its mutant Met182Thr from Rhodobacter Sphaeroides Reveal a Gating Mechanism for the Electron Transfer to the Type 1 Copper Center
rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 91
structure length 331
sequence length 331
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1mzyA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1mzyA02
1GS8A 1AS6A 2BP0B 3ZIYA 2PCFA 3S8GB 1AZCA 1BXVA 1W6WA 2BW4A 2VM4A 2H3XC 1IC0A 4KOBA 4A2FA 1CURA 4HCIA 1JXDA 2MRYA 2FJSA 4KO5A 1NPJA 3DIVA 2GC4C 2IH9A 3FSAA 3C75A 2BZ7A 5I5IA 1NTDA 3WIAA 3G5WA 2XU9A 2ZWNA 2P80A 1BXUA 4GYBA 5I6NA 2GC7C 1IBZA 2BP8B 1HAWA 1AIZA 4YSSA 2IDUA 5PAZA 3AW5A 3NJKA 4DP0X 3PLYA 1AQ8A 1PMYA 2YAQA 1AAJA 1M9WA 1ZV2A 2FQGA 4G7RB 4GP8B 4HHWA 4YSCA 2GI0A 3T6XA 2XV0A 3FSVA 2X88A 4A2GA 4E9XA 4JHVA 4DPCX 4YSQA 2QPDB 4DP2X 2CAKA 4KNTA 3TA4D 1PZBA 4BWUA 3QJVB 4YSAA 5F7BA 4E9VA 1IBYA 2J55A 2Y69B 4HALA 1A4AA 4DP8X 1BAWA 2WO2B 4UAHA 7PCYA 1XMEB 2EILB 3OM3B 3NSYA 1JZEA 2BW5A 4WKXA 4FAAB 2XXFA 3X1GA 1RKRA 2YAEA 5B7MA 3DTUB 4DP9X 2GHZA 2IDTA 1W6LA 2HX7A 4YSRA 3TBBA 1B3IA 1URIA 3KW7A 4M4RB 3QJUB 4A67A 1BEXA 1PNDA 3WKPA 1GS7A 4A68A 3NJIA 3QJSB 4DP7X 3ZDWA 2PP7A 4F2FA 2AFNA 4UANA 4BDVB 1ETJA 2XX1A 3D12B 4A2HA 1JZFA 5E9NA 2XXGA 1J5DA 1L9QA 1TEFA 1KDIA 2A3TA 1M57B 1SHXA 2AZAA 2X87A 2XUWA 3KW8A 5B7EA 1CC3A 1F56A 1R1CA 5F7AA 3UACA 1SJMA 2DYSB 2BWIA 4P5RA 3T9WA 3X1NA 1PLBA 2QDWA 1AZRA 9PCYA 2OCCB 4DP4X 4F2EA 3N2JA 1JVLA 2DV6A 1KCWA 1E65A 2IDSA 1RCYA 2XX0A 5D4HA 1ZDSA 4CSPA 1BQ5A 2FQDA 2HLEB 2Q9OA 4ZK8A 1NIFA 1ASOA 1BQRA 3FSZA 3EH4B 4DP6X 2CCWA 1GYCA 3EF4A 1YLBB 5PCYA 2PCYA 1L9SA 2IAAC 3UADA 1OE1A 4JHUA 3T71A 1MDAA 1TEGA 1WS8A 2CALA 3GDCA 1NIAA 3IE9A 4BXSV 2DY2A 3PAZA 4HHGA 3ABGA 5AZUA 2N0MA 1J9TA 3OMIB 1N70A 3TU6A 4HIPA 1NIBA 4E9WA 2FQFA 4YSDA 2J5WA 1KDJA 1DYZA 1JOIA 1AG6A 3JT2A 4HCGA 2CJ3A 1A4CA 5B3SB 3FYIB 2GSMB 4CSZA 1M56B 1PLAA 1NWPA 1NWOA 2XV2A 2WO3B 4QLWA 1OCCB 1UATA 1WA2X 4GXFA 4KNUA 2VN3A 3ABLB 4E9QA 1KYAA 3ASNB 1ADWA 4E9SA 1MG2C 3WNIA 1V10A 3CDZB 2BWDA 2VM3A 3WI9A 1N68A 3EH5B 5I6MA 3NJFA 3AG3B 2VMJA 1HAUA 4BWWA 2UX7A 2HRHA 2QPEB 1ASQA 3SBPA 1ZIBA 2AANA 1AS7A 3IN2A 4W1TA 2XYBA 4FA7B 2VW4A 4A66A 2BHFA 4YSPA 2R7EB 3UABA 1DZ0A 2FT6A 3H4HA 4HZ1A 2E86A 1SF3A 2YAHA 4W9ZA 1JVOA 1E5YA 3FU7B 4YVNA 1OCRB 1TKWA 3SBQA 1JXFA 2UXFA 1EHKB 1GS6X 3FPXA 3QPKA 4RH4A 3FSWA 2CBPA 2JKWA 3EHBB 2NRDA 2ZONA 5TK2A 2YQBA 3AG4B 1XB8A 1OE3A 2UX6A 3NSDA 1E5ZA 1AZUA 2HRGA 4BXVA 2EIJB 1PZAA 3CVBA 3QJQB 1AANA 2OJ1A 5I26A 5I6PA 1AZNA 2PPFA 3FS9A 1L9TA 4YL4A 1CUOA 6PAZA 4WTQA 1PAZA 3NT0A 2IWEA 1L9PA 3NJNA 1ZIAA 2HXAA 1FWXA 4Q8BA 5B1JA 4ENZA 3N55A 2GIMA 3CVCA 3S3DB 3EH3B 5I6OA 3ABMB 5B1BB 4AKQA 1JZJA 1NZRA 7PAZA 3CG8A 2JXMA 4AKPA 1IUZA 1SF5A 2LLNA 3H4FA 2WSDA 2FNWA 3MX0B 1NINA 1ZDQA 3ERXA 4KO9A 3TBCA 3DKHA 2FT8A 2EINB 2VSKB 1J9RA 5FC9A 5TK4A 4A2EA 3PPSA 2UXVA 2YAFA 3T6ZA 2AVFA 1OCZB 4HAKA 4TXVB 1I53A 1BXAA 3NJGA 1NICA 2BP0A 3FU9A 4KO6A 1VLXA 1IKOP 2Y1AA 1ID2A 4F7KA 1A8ZA 3H56A 4E9TA 3S3BB 1ET5A 1ILSA 1V54B 4GY4A 4BK5C 5ANHA 2VW7A 5A7EA 2GB2A 2PPAA 3QJTB 3WKQA 3BQVA 3WG7B 2QT6A 1SDDB 2FTAA 2FWLB 1T5KA 2UXGA 3FT0A 2J57A 3FPYA 2I7OA 2UXTA 4AKOA 2YXWA 3SBRA 4HCFA 2XV3A 1L9OA 2DWTA 1NIDA 2BP8A 5B1JC 3IEAA 3HEIB 2I7SA 5LDUA 2HX8A 1V55B 3T6WA 4G70B 3OMAB 1SFDA 3FQ2A 4E9YA 2YAOA 3NJMA 1QNIA 5EHFA 3FQYA 3NJJA 4KNSA 1ASPA 1ZPUA 1E67A 2VSMB 1ILUA 3OD3A 4YSEA 3PAUA 5B7FA 3GXUB 4YSTA 2HZHA 5D4JA 3X1BA 1HFUA 1QHQA 1RZPA 2PP8A 3NJHA 4DP5X 2OV0A 4PCYA 4UF7C 1FFTB 4NAJA 3RYMA 3AG1B 6PCYA 3HB3B 2P80D 1EZLA 1SHWA 2ZOOA 3MBWB 8PAZA 1SNRA 3PAVA 1FA4A 4AX3A 1BYPA 2ZXWB 4DPBX 3S8FB 3NP4A 3ZBMA 1GW0A 1ET8A 3JTBA 3NP3A 3PXLA 4K9JA 3X1EA 2IWFA 3OMNB 3UAAA 3OQRA 1J5CA 3QQXA 4BDVA 1GR7A 1CYXA 3PCYA 1L9RA 3QJRB 3FQ1A 1W8EA 4Q89A 3T6VA 5I28A 1X9RA 5I6LA 3V9EA 2BO0A 1QLEB 4NERA 1PZCA 3SQRA 2FQEA 2VW6A 1RZQA 3NJLA 2YXVA 2YARA 2TSBA 1AS8A 2J56A 4KO7A 1OF0A 3X2QB 1E30A 4G7QB 4BWTA 3GYRA 4X4KA 4AI7A 3BVDB 1XB3A 3L45A 1WA1X 2B3IA 4P5SA 1MZZA 2GBAA 4YVUA 1A65A 5I5JA 2PP9A 3FYEB 1JXGA 1X9UA 1NDTA 1BYOA 2W88A 2CUAA 2H47C 4G72B 1J9SA 3U25A 1GSKA 4E9RA 1PF3A 2YAMA 1SDDA 1PLCA 2H5UA 4MFHA 2XVBA 1A3ZA 1WS7A 1KGYE 2AZUA 5IY5B 1OOWA 2Q5BA 5B1KA 1PCSA 2RACA 5AFAA 2XWZA 3ABKB 4DP1X 2JFCA 1NIEA 1SFHA 1KBVA 4GP5B 2TSAA 4G71B 1PNCA 1MG3C 2YAPA 2W8CA 2IH8A 2HX9A 1A4BA 3IBOA 4GP4B 3AY2A 1XB6A 2BZCA 2B08A 5AKRA 4JKNA 3FU8A 3NSCA 1KV7A 1WAEA 5D4IA 4A2DA 1TU2A 1WA0X 2MTAA 3TASA 1JZHA 2IDFA 5I6KA 1AZBA 3CDZA 3V9CA 4M3HA 3NYKA 3ZX1A 3WNJA 1CYWA 1NPNA 5B1AB 2I85A 3S3CB 2IWKA 3X1FA 3CVDA 1GY1A 4YSOA 2FT7A 4YSUA 5I5MA 1MZYA 4KOCA 1JZGA 1AG0A 2EIMB 1JZIA 4PAZA 4G7SB 1KBWA 2PPEA 3UAEA 1AR1B 2QDVA 2XLLA 1J9QA 1GY2A 2PPCA 3ASOB 2R7EA 1AACA 1OE2A 1KCBA 3AG2B 3NSFA 1BQKA 3AZUA 1AOZA 1OV8A 4DPAX 4EF3A 4AZUA 1OCOB 1ET7A 4L0PB 3FU7A 1JERA 4N4YB 4NB7A 4N8UA 2IDQA 3CZUB 3UGEA 1PY0A 2PLTA 2DYRB 4QKTA 2EIKB 2PPDA 2DWSA 3IN0A
chains in the Genus database with same CATH superfamily
2WKLA 3NAAL 3MN8A 3UTPD 5HHMB 1NBVL 4GG6F 4RFEA 3U1QA 2HVBA 2LVEA 4NT6B 4YPJA 1DQKA 1I7TA 4UUJB 2YIHA 2XZQL 2XG4A 4GKSA 3GSOA 4MNHA 4ZFFA 3LQAH 4DJMA 3J2PA 1A3RH 2ZG2A 4K3EH 4HK3N 1ORSA 2PABA 5CKAA 4JREB 3BVNA 1XF4B 1R3LA 2R1YA 3QEQD 1UXMA 2ZSVA 3T09A 1KGWA 3R7QA 3BZEA 1UJTA 1OSZB 1UQSA 4APXA 5AVSB 4JO4L 3HFML 4YNYB 1S6NA 5KUKA 2MQCA 5F0LB 1LWRA 3KPSE 4JFZH 4QOKD 4NO2B 3RWCA 3HC2A 4OLXL 1ZS8A 5E8PB 1UD5A 3K71A 3TBYB 4YSCA 3NEEA 1RSYA 3LCYA 1IVTA 2IEPA 3EOBB 4XXWC 1PIGA 1I9RL 1NDGB 2JLPA 2XPYA 1JNNL 2IO5A 3B2XA 1B3JA 1NC4B 3FBKA 2F58H 2CAKA 2NLJB 4GG6B 3QS3A 3GJEB 3QEGH 4H7VA 3CXDH 2AAAA 4UOQA 3MBXH 3VFSA 4Z77A 2Y69B 4HALA 5L2KB 2D73A 1OK0A 4F58L 2XT1B 3S4SG 1DJWA 1QLEH 3TO4D 5AVUB 5K9QG 3KJ6H 5AW5B 3DYPA 4MNGE 4YZFF 1L6PA 2SODB 5ELIA 4K7PL 1HOCA 4YQXL 1RK1B 5F0PB 2BXZA 3RDJA 2JB6A 2F74A 3MKGA 4EQ2A 5FUZL 5DQJA 4YWGL 1HL4A 3QEQB 4JPSA 5GJSL 2XX1A 4Z7UA 2CZNA 4F27A 1LO2L 1QQDB 4EZJA 4LSDA 3S88L 4MJ5A 3RDTA 5SX4I 1U2HA 1BIIA 1V3LA 4QRFA 1WJ3A 4C57C 2DD8L 2FB4L 4QOKB 2ZAHA 3LS4H 1QA9B 5I18H 4BUGA 1SM3L 1R1CA 5BO0D 1CZ8H 2QDWA 4LGSB 4HKXB 1QOKA 5EOTA 4ZFGH 3VD0A 4LGRB 1MFMA 5GISL 3QUMB 2DV6A 2CO7B 2WCPA 3APDA 4KHTH 4U6HB 2EXYC 3HPLA 4KX7A 4RGNE 1QP1A 1BQ5A 3NCBB 2YK1L 4M7KL 2CO2A 1YZZA 3BVWA 1W72B 5IJKA 1QACA 1WF5A 4FI7A 5I17A 1F8TL 2AJUL 2VABA 4BGLA 4N2KA 3BPOC 4JKMA 3W11D 3K6SA 5HD8C 1EA9C 2QVIA 1XR9B 2E6QA 1AHKA 1DR9A 4UDUB 5DK2A 1TQCB 2X4SA 2FYYB 1O6VA 3ARPA 3TO4B 4IW4C 4BA8A 5F7MC 3OZLA 3QNZA 2OZ4A 4NPYB 1ZSHA 1DQJB 5ANME 2VAAA 2CALA 2YBGA 2TRYA 3SGJA 2O72A 1XSIA 2GTQA 4OLYH 4XP5H 1CTOA 2P24A 5FA4A 4CVZB 4EI0A 4U6VL 1XR8A 1IJNA 2F19L 1N3NB 1JXJA 2R2HB 2EADA 3V5HB 4H0IA 1VEMA 5FGCB 3S34L 1V27A 1NEZB 5EIVA 2HFFB 3DVGA 3L3KB 5MI0C 5G4MA 3SQOL 2P28B 4TUJB 2ZWYA 3V4LA 3RX7A 1TJHH 1TITA 1EZSA 2KHAA 3N9GH 1JHLH 2NY3D 3GI8H 2NYYD 5BOZG 1DQMH 5ITBL 2CM5A 3KLHC 1Q1JL 4G3YH 3RZWA 1CFNB 4Y0GA 1T5XA 5HVWA 5T5NF 1AO7E 1OT1A 5HHOD 1F97A 1X7QA 3FXIC 1KGJA 3UC2A 2P8PA 4FFYL 5EC1B 5JIDA 2GAZA 2WZAA 4JRXD 1PJWA 3P3UA 4XVSH 2Q1EA 3PP3H 2VLKA 4BWWA 2UX7A 1ASQA 2X4TA 3K8KA 4V2CB 2VN7A 3FT1A 2R0KH 2HFEB 3K91A 4F7TA 5TDPB 1ZGLP 2VE6A 3IU3B 3NCYP 4QXTA 4Z0XA 4I77L 4QD2E 3FU3A 4AZ8A 3QJHA 4C83A 1YCSA 3GHEH 3A4FA 4PGBB 4WWNA 1CTMA 3V4PA 4HA1A 4HG4K 3O2VL 3IKKA 2FJFB 3LKOA 4NC0B 4D3CL 4IDJL 4AWJC 2QV2A 5HYSB 4B97A 4PJ6A 1AHMA 5LGHH 2L7UA 1JVOA 4LKCB 4WUUE 1TPXC 2AQ2A 2W9EH 2WLMA 3P0YL 3ROOA 4DCQB 5E9DE 4BKTC 3SBWA 1U6AH 3ECWA 2BRRL 3IU4L 5H37H 4KVNH 4XOAA 4JDEA 5E24E 3AQXA 2R23B 4K3HA 3T1WA 1M3JA 1PYWA 4P2QE 2Y36L 2NY3B 4Z7VA 4GNKB 2F5BL 1SOKA 1B4TA 2EIJB 2R0WL 5BQDA 4XNDA 1I7TB 5DFVC 4OIIL 5J4MA 5KJRL 1CMOA 2XG4B 4GKSB 3GSOB 3FT2A 3RE0A 5HYJD 5I1AA 1ORSB 5HHOB 4KGJA 3BVNB 1R3LB 2BCKB 4QTHA 5K9KA 1UH3A 3KPSA 3BZEB 5AKSA 1UQSB 3JTSA 4PG2A 1KGIA 3RDTD 1D5IH 3S3DB 1MLBB 3GRGA 1VADA 3MCG1 4QHKJ 3TEXA 3S88H 4WRLA 3RWCB 1TFHA 1NJ9A 1ZS8B 1PCXA 2WLJA 4RWHA 3K71B 1KSRA 3V0FA 1TZHB 2DQIH 4Z7UF 4I0PC 4QHPA 4FI8A 5ERWA 1IQDA 1M42A 4OSUL 2FLMA 3LH2H 2Y6SD 4TVPE 1FE8L 3BSZL 2AVFA 5AW2B 3B9EA 3EYSH 4X6CE 2PR9A 5DUMH 3QJOA 4WKZB 1OAUH 5KSUA 2XXCB 3ATBA 3UTSD 1IKOP 3VFSB 4MNGA 3WJMB 2QHLA 3O41B 4MYPA 4RMTA 3BP5B 4PLKC 4B5EA 2YD7A 1KGCD 2X53A 3KGTA 3QBTB 3U7WL 2EYRA 4FYSA 2WGXA 2YS4A 4NKDA 4GQ9L 5EUOE 1WCBA 1ZLWH 3T3PE 2Y2TA 2UXTA 3ARBA 4ODSL 4X7TA 5FUCE 2G3XA 2D2CC 1S46A 1VZHA 2JB6B 3SBRA 3OJDA 1CS6A 3KBFA 5DQJB 5HYJB 2J43A 5FO9A 2HX8A 4NQUA 3QRGL 2FIKA 5BOJA 4E9YA 1F4WH 4Z7UB 1V7ML 3PREA 3HC4H 4DESA 1S7SB 2WNXA 1J0JA 1LD9A 3LQMA 3RDTB 1JF1A 5F1NB 1YEGL 3WN5A 1BBJA 3THMH 1TQWA 3OD3A 3UBFA 3VX0A 1NL0L 3W57A 3V52L 1KJ2L 2ZOLB 4PWGA 3BSGA 3OSVA 5KW9H 3FT4A 2NY1C 2WKOA 5DFTA 2XN9E 5SWSD 1HEHC 2P5WD 5G2NA 3ZZQA 3HPLB 4MCZA 3KYKL 4MB1A 3IFPB 1KCUH 5IGXL 2BNRE 4WFFE 3BT0A 4LEOA 1AHWA 2VABB 4XMZA 4Y5YC 4MLSA 5CJXA 4DPBX 3K6SB 5ANMA 2I26N 4OCWL 4LCCA 2MIZA 1QBMH 4GXVH 5DK2B 5JXEC 2X4SB 1Z32X 2I5YL 2V6HA 1PZ3A 1BZDA 1FL5A 1WZAA 1T1ZA 1YYLL 2HWZL 3CZSA 2VAAB 3TN0D 2QR0A 3D34A 2BIIA 4X5WA 4PFEA 5FCUH 2BDNH 1OAYL 2EEDA 2P24B 3BHBB 1XR8B 3MLVL 4Q89A 1F4YH 5I9QC 1KPUA 5L7XL 3BEWB 4AYEC 1IVLA 4ODWA 4X4ZA 5B4MC 5IESL 1A0QL 1S3KL 1AKPA 1PU0A 4FLOA 4PBXA 5FYJU 5D7SL 5J12B 1DEDA 3V7AG 5C7ZA 1PPIA 2PCFB 4QTIL 1JZ2A 4XCCH 4ZMTA 1AO7A 4NCC1 4PY7A 4U7SA 4AGMA 2XSKA 1CWVA 1XTMA 2B3IA 4QR7A 3S0PA 2ZKYA 5DS8A 1T5XB 2F1BA 1T3FA 2BSED 3FO9A 4NNPL 1X9UA 4UMSA 2SEBB 2CUAA 3D52A 2X1PA 2OYKA 2OMTB 2P8PB 4XC3L 1HQRA 2GAZB 5B8CC 5EUKB 4I18C 1VSCA 2ITEA 4Z7VF 2C1PA 1IEBA 4BUQA 3BKYH 4FKHA 2OTUB 1CL7H 3LDBB 5AW9B 1FO0L 4I3GA 3TA3A 5FYLD 2X4TB 2G3NA 3IAPA 1PCSA 4R7VA 1I8LC 1BLIA 4GRMA 2VE6B 4TULH 4OUUA 4QXTB 4V2BA 4Z0XB 5KSVA 3MPCA 1YQVH 3QJHB 4NQSA 1XGYL 2XWDA 4G71B 1GIGL 4HBCL 4WUUA 3DX3A 3TN0B 4BFFA 1MF2H 3WIIH 3V4PB 1U8JA 1HT6A 2AJXL 1A4BA 2E8YA 4P2OC 2IGTA 3T2OA 2BSSA 5E9DA 4JQXA 4LASH 4U6XA 4H1LA 4KTEH 4S1DD 4MJ6A 4OKVA 4WTWA 3ROOB 4A2LA 4J2XA 1MAML 3KHOA 2P8LB 3QORC 1CF8L 2IAMA 5EEXA 4JDEB 1TO5A 2NUTA 4P3DA 1PYWB 4WTZG 5I6KA 1UFUA 4Z7VB 1DLFH 3WE6B 4Z3HA 1RJYA 1OGPA 4UT9L 3CSGA 5T5FA 2R15A 3ARBD 4XGZA 4ESKA 1YDPA 4LESA 1BJ1H 3FT2B 2ZYIA 5I1AB 4ADJA 3F7PC 4QTHB 5IROA 4A68A 5K9KB 1JZGA 1P6WA 3MRJB 1CLOL 2O6EA 2HJKA 2QDVA 1VADB 5GS2H 3IFLH 1E8YA 1KC5H 1AACA 2QV4A 3OR6B 5GRVL 3L13A 4RRPG 3VAEA 3NSFA 4YHNB 5BW7A 1NJ9B 1OV8A 2MFNA 2WVTA 1W0WA 1CIDA 2DQDL 2IH1A 5EU6E 3G5YB 4YXKL 4X6CA 3T8MA 1OHQA 3NZSA 3CFJB 5AB9A 1YEFL 2EDLA 3DTXB 5I23A 1EDHA 4FMFA 3M1BA 2AXWA 1JPSH 2ZAIA 1F3DH 3CFEA 3RB7A 3UMTA 5KSUB 3D0AA 2CLVB 3IVKA 4AMKH 2WKOF 2BNQE 2CA4A 4MNGB 3SE8L 1N6VA 5EUOA 5BO1L 5DWPA 1DBKL 2DWEA 5FW8A 3BUBA 4CL7A 2O5NA 2Q2EB 4HPYL 3BT2H 4JL1A 1X44A 2EYRB 3LZLA 1FNSH 3JV0A 3BP7A 1F6FB 5I24A 3PPEA 1IL1B 4GOSA 4HQQL 2XWXA 3O2DH 1OVZA 3ARBB 4X0NA 4X7TB 5GSVA 4G8FA 4TNGA 3KJ4B 2VB5A 1S7RB 3OJDB 3VX1A 3RKPA 2EXWD 3ZRSA 1SHSA 1OB1A 3DVNA 4XVUD 1TTFA 3JVFC 1EO5A 2F8OA 2GJZA 3KPRD 5FO9B 1U91A 3NJKA 1OTTD 2X1OA 5E4EB 2FIKB 4BFRA 4BKLB 4PPTA 5FOJA 5HYQA 1MCNA 4H2AA 1MIML 4E5XB 3DO7A 1LD9B 3DSNA 3C8KA 2E7BA 1BBJB 3UPCA 3TV3H 4MAYD 2XN9A 4LNVA 3RL2B 4C4BA 4A2GA 5LDSA 2VDNB 3SOBL 1GYAA 1TJGH 4YSQA 1OHZA 4PJHE 4U3CA 3W3BA 3N50A 4Z7AA 2VDPH 3FT4B 4UQ3A 1IGIH 1SLVA 3UZQA 1CLZL 2Y7LA 2BNRA 4QTFA 1URLA 1CD0A 1SUHA 3OMZA 4HPOL 1Q8MA 2XWJA 5T3ZD 1LVEA 4MCZB 5BVPH 2XXFA 3T77B 3W56A 3GSNB 3S3PA 1MCBA 4UM9A 2IANE 4XVTL 1AHWB 4O51A 4N2GA 1VGEL 2AXGB 5SX5H 3PWUA 4G80A 4JX0A 5JZ7D 2FH6A 5ANMB 3T4AC 3DX9B 4FQQA 2IC2A 3JWDL 4LCCB 5JR1L 3MUGA 1B6UA 3W9EB 1J8HD 4J6RL 1KFAL 4N0CD 1T1ZB 4WWKC 5CSGA 1FG2A 1ZANH 3BFQG 2QR0B 1TZGH 1S9KC 1AQKH 2AJVL 1LK2A 4DN3H 4LDLB 2W95A 5E9DD 1KPUB 3BGMA 4KQ3H 4YDZA 3KPRB 4ODWB 3BDYL 3T4YA 4P99A 1Z5YD 2HA1A 2J5LB 4NP9A 1WZ1L 2VDML 6FABH 3FCBA 4AYBA 2IAMD 2WAHA 1VEOA 1WITA 3N2JA 4GO8A 4JPQA 5CILL 2K7QA 4MAYB 4Z18A 3H54A 3MA9L 1E65A 1MFNA 5IV2A 1JK8A 1AO7B 3NSXA 4PGCA 4FXGA 4PY7B 1VFMA 5D2NA 4ZMYA 1FQ9C 1UYWL 2F54E 1OQXA 4Y1SA 1LEKA 4Y7OC 3RX9A 1T3FB 3FO9B 4PWIA 5HI3D 4X9IA 4DP6X 4OJFL 3D6GA 4QHLA 1AGFA 1HQRB 1F00I 3HVDA 3UX9B 1NAMH 2C1PB 2WBJD 3L1OH 3MV7D 1XV8A 3MUHL 3L3GA 4HD5A 3WSQH 3VYNA 1TMQA 3TA3B 2FWOB 1N5AA 3V0IA 1RZGB 1JNHA 4KZ0A 3RWGA 4TVPD 1R24A 5D71L 3JVGA 4FN0A 1J8HB 4OUUB 1CBVH 4YIQA 5KSVB 5CWSA 2ZUSA 4M9PA 4XX1E 3TZVC 4LIQE 2JELL 3T8XB 4WUUB 4PJ8D 2Y3AA 2BSSB 5E9DB 4U6XB 4H1LB 1KELL 4MJ6B 2JJVA 4N0YH 4OCXH 2ED8A 5KEZA 3WD5H 3QYMA 1T03H 4I13B 1HI6B 1DJGA 4F1SA 4CVXA 3ZDYF 3O6MH 4OFIA 2N1TE 1U42A 2G60L 2X05A 4LPWA 2IAMB 5AOKA 2C9QA 2NUTB 1ML0A 1MG2C 3MUZ1 4P3DB 2ZZUT 2JH2A 3A6CH 4DN4H 4BFIB 4YBLC 4KXZI 4OI7A 1RJYB 3WI9A 4ZQTA 2YPVA 5JOEA 1S78C 1OP5K 1EFXD 4NZUL 3L5XH 5D1XE 1SDYA 2QJDA 1BZEA 5EUOF 3T3PF 4Y5XC 1FZJB 4BZ1H 3LZPA 1ZIBA 2AANA 1U0QA 2A38A 3IN2A 4K8RH 1ODUA 4N2OA 3WDJA 2DWYA 2WBJB 4K0OA 3SPIA 2YPKA 3K4DA 2Z31C 4XR8C 5EU6A 1NGZA 3WENA 2GFBA 4FI6A 1UH4A 2XN9D 1BOGB 2WM0A 2MPVA 2APWA 4DQAA 3CQQA 1W0WB 2YSSA 3ARFD 4KDTA 1MCOL 1FNFA 1KGUA 1OAKH 2IH1B 4LPTA 4GQRA 4L1TA 2BVEA 3SKJH 1OW0A 2F2HA 3ZDYB 2BNRD 2H1XA 1UG9A 2FEDC 1WHPA 2QSTA 4MVBD 4PJ8B 2W38A 1CI5A 2WO4A 2BNQA 1H3PH 1SYSA 1YY9C 2Y07L 1JP5A 2EQDA 2JE8A 3BH8A 3M1BB 4EXPX 5DQ9A 2G2NA 3EGDA 3H85A 5EORL 1JDDA 3EAKA 4DIXA 4M6OH 4LVNC 3SKOA 4ZAKD 3IVKB 4EI6A 4WV1C 5EUOB 2DWEB 3T3PB 5IMLB 2NT0A 1WO2A 4NKMA 3MRIA 3S4SA 2AEPH 1P4LA 4B7LA 4I3SH 1JNLH 3WXWL 1DCLA 3VRLE 3EYQC 3BP7B 4HWNA 2P42B 5CZVL 5BRPA 1EFXB 3RVTD 3RVWD 5I0WA 4G8FB 1AMXA 4TVUA 1H15A 1OB1B 1JZJA 3DVNB 2JQMA 3DI3B 5GS3A 1U91B 1FI8C 1PSKL 2I9LA 1PX4A 4IOSD 4MQXD 4XE0A 3RY6C 3VDBA 4J4PC 1SF5A 2VR7A 5HYQB 2R2BA 3RIKA 1F6AB 2QFPA 3DO7B 1DBML 3DSNB 4K94H 4PJHA 5DC4B 1QMUA 3C8KB 4ZMAT 1H5BA 4LBEA 4M1CD 2QQKH 2EDHA 3UTTE 2XN9B 3PPSA 3FB7B 1E4WH 3UBXG 1N4XH 4DOHE 3LVEA 4XMUA 4F37F 2X5PA 4UV4H 3QEGL 4BE6A 4PUBL 3CXDL 4D8PA 3MBXL 4UQ3B 5CJBA 2C7UA 3UZQB 2NTSP 4IU2A 2BNRB 2IANA 4OD2A 1LO5A 2FL5A 5EU4A 3NFPB 3RNQA 3S3BB 2XWJB 1K3ZA 1I8KA 2XCMC 4ZMZA 1I1YA 4M7JL 3ULUH 1KWKA 4UM9B 1JPFA 4O51B 12E8L 2OI9B 1Z2KA 4LXFA 4LVHB 4BQBA 4S0TD 2YGVA 3KL3A 1TIUA 4FQQB 1S3RA 4UTBH 2X6VA 2PKDA 3U9UA 4L9DA 1L9OA 3N1GC 4OF5A 2EIBA 3MUGB 2VLLB 1Q72L 2WVUA 4KJPC 1GPOL 1FG2B 2GIYA 2YAOA 4PJ5E 3U30C 2QMJA 1LK2B 3AAZA 4K5OA 5IWLC 4HOZA 5K9OA 1IMHC 4XMLH 1MSPA 2HH0H 3DBXA 3U48A 1KN4H 2IOMA 1T7WA 2ED9A 2H3NA 5C0GA 3BUPA 2E7HA 2D03H 1M53A 3HNVL 2GT9A 2VDQB 1RZPA 5A16B 5EEYA 3BKJL 1WAAF 3F04A 3KBPA 5JNYA 4N24A 2MJWA 2WAQA 3QHZL 4WFED 2EIZA 2F54A 1A7QL 1X5HA 4MXQD 4UF7C 5IV2B 4FZ8H 2CPUA 5F89A 3LRSA 1JK8B 1RZKC 3BP4A 4PGCB 6PCYA 5I71C 2P80D 3K5SA 4FXGB 5EU3A 5D2NB 5FX3A 3BLBA 1LEKB 1JSYA 2XQYG 3V7AE 5D70L 1TO4A 3GMPB 2ZF9A 2D3JA 2AERT 1N2RA 4H8QA 4QHLB 1AGFB 4K4KA 1HJBC 4A37A 2E9IA 3X1EA 3LH9A 2RTTA 2ZNWA 3QZPA 3L3GB 4LAQH 3WEXA 2E4FA 2BRQA 1EAJA 4NX0A 2EVFA 2VTFA 2E8ZA 1JNHB 3QG6A 5DJ6A 3RWGB 4JG9A 4N8PA 1R24B 1OP3K 2QSCL 4W81A 3T6VA 1KJVA 3P3TA 5I1CH 3GSRA 5CWSB 1QO3A 1IFGA 1U8IB 1CK0L 1NFDE 3PJLA 4IEFA 1RZQA 4Z23A 2YXVA 2YARA 4N22A 2Z4QB 2W07B 4N2AA 3ARRA 3N9GL 1JHLL 4U1HA 2B14A 3STBA 3T0AA 3FW6A 3V4VH 4IRSC 4MXVF 1DQML 5LCVL 1KTDB 1JGLL 1G87A 4G9FE 4BM7A 5IFHL 4OV6F 4CVXB 5JW3H 4ALAL 1U4EA 1F86A 5E7FA 2A9BA 2DTMH 5KYWA 2DH2A 3S6CA 1E9QA 1ZY9A 4AOFA 3M8OH 4NN7B 2DQ6A 5D1XA 5FYKD 4XC1H 4TNVF 2XFGB 4I9XA 4M9OA 3NEXA 4UINH 3VGAB 1J0YA 1U33A 2G4GA 1DVTA 4W6WB 3AVEA 3C8HA 4Z3TA 3BIBX 1FP5A 4GFXA 1ZE3H 2GY7B 4WSGA 1GGUA 2DKMA 4U31A 4XPAL 2R0KL 1MPAH 3SGKA 1MUJA 1I9JH 1OCWH 2YPKB 4FA8A 1SFHA 1CFVH 1NGZB 2BHUA 2OXGB 2PWEA 4O02L 4A7SA 2YAPA 4MJ4A 4X8CA 3O4LD 2EE0A 1SXBA 3QXAB 5AENA 2IH3A 1J12A 2GHWB 4AH2B 3N0AA 3WNPA 4YHOH 4JKNA 3GNML 4PWEA 1OPGH 5C6TH 3SDCC 4K23L 4KVNL 5EPMA 4NP4H 5CBEA 4UT7L 1AXIB 2MTAA 2BNQB 1FIGH 4PCKA 5KVFE 4ZX3A 3BH8B 4L4VE 3C60D 3BVUA 1ZHKA 2ZCHL 3EGDB 3PV7A 4MLIA 3SKOB 2JV6A 3BAWA 1T7YA 3ML9A 3MC0A 3QUMH 3RA7H 1COBA 2FZ3A 1KBPA 4TNFA 2VITA 4M7ZC 1NPNA 4NKMB 3MRIB 1RZFH 2DQFA 1RU9H 3CFBA 3MRRA 1MHEA 3WJJA 3DGCR 3TURA 2UZXA 1TTAA 4KOCA 1BX2A 3CMOL 4FZEH 3A4DA 3B2PA 4HIQA 4M5YH 3X13A 1A2YA 3U0WH 2A6IA 3UAJA 1H15B 3I6LE 4L9LC 5HDWA 2ZKHH 2OCFD 2R7EA 3EDKA 4APQC 1LO4H 4S2SB 2I9LB 1T22B 2DWXA 2ATAA 1ZRUA 2N56A 3UTTA 2DQIL 4PJ9D 4PMFA 4WEBL 2WCGA 4N6QA 4L0PB 5FGBC 4ZI8A 2L3BA 4LBEB 1EO8L 3EFDH 3ET9F 3QIWA 2F54D 5KVDL 1YEDB 4S1QH 2PLTA 3EYSL 3R4RA 4JZOB 2R29L 3CUPA 3GMNB 2VN5A 1OAUL 4D8PB 4IMLB 3LQAC 4IU2B 4XB8A 2UZYA 2IANB 4P07A 4OD2B 4Z8FL 1LO5B 1ZOXA 2FL5B 5EU4B 1IGMH 2VXTL 5BRQA 4A2FA 3PP4L 1I8KB 4MJHA 1I1YB 3TJHC 4GS7C 1KTBA 3QQ9C 5CEZL 5I5IA 4HKBA 4NHCL 4AJVA 1XGPA 5CN1A 4PJ5A 4K71B 3WY3A 4C4UA 3U9UB 3PUUA 1EMTH 2ITDB 3GTTA 2P4AB 3FC8A 5C0ND 2E6PA 4WIQA 2C1OA 1M9WA 3WUWG 3AAZB 4NI3A 5K9OB 4F2MB 1BG1A 4BHUI 1AYRA 4FQXA 1KNOA 3DBXB 3T6XA 4JR9L 4KVCH 4Y2DC 2AITA 4ZSOE 4B0MB 3QO1B 5I8CA 3GLZA 2WYZA 5TFSH 1WUZA 5KBPA 4PJ9B 4J3SA 2GT9B 1DQDH 1S8DB 3TPKA 1C9SA 2WB7A 2NW3A 4NQVA 3WFEH 2YA0A 1DSFH 1XCWA 4GXUN 3BPNB 3UC0H 1T89C 3X3FH 2EIZB 2F54B 3CIQA 5D1XD 4HOXA 4TRPH 5A2CA 2E7LA 5F89B 1HILA 3BP4B 3X1GA 5EU3B 2R27A 1MCKA 3T65A 4A7UA 2WTRA 2KZKA 1P7QA 1KLGA 3EYFA 4I1RA 5DD1H 1Q94A 2CLRA 3ZJAA 3G5ZB 4JCLA 4NHUA 3C2SA 3NJIA 3P54A 5FECA 2PP7A 2CIIA 4H26A 3WEXB 4PRHE 4FXLA 2X0WA 4ODVH 2J7LA 3U4EA 1CLVA 3TBVB 2CHZA 3A4EA 2QQNL 4MSWA 3GKWL 3QG6B 1NFDA 5DJ6B 3QUZC 4Z7QF 1AGDB 2HVJA 2YSTA 3GSRB 3QIUC 1OQOA 5GQBA 3DUUA 1M7UA 4K7FA 5D2LE 3E8UL 4IEFB 4EI5A 4D9LL 4G9FA 2DW5A 3V5DA 3NACL 2Q20A 3CMGA 2V2XB 2P5EE 1X5ZA 3ZMRA 4KK6C 4Q14A 4U1HB 4XCCL 5AALA 4UNUA 4ZQKA 2H1LM 1KCWA 15C8L 1IBBA 5CEYA 3VDCA 2Z8VC 4HH8A 3BD3A 3O45A 3UROR 3COOA 4ZW5A 1KPRA 3FSOA 4KJQD 2VXQA 4YDKH 1MFDH 2WBKA 3I2CH 3SO3C 1E9QB 5D1XB 3T04D 2ARJQ 3ZVVA 3DHPA 2NNRA 2CCWA 4HJSA 1OLLA 3V0HA 2XG5B 1GZPA 1Z3RA 2G2RA 3ZN6A 2AABL 4JHUA 3VRLF 2AQNA 1WS8A 3PYCA 4DW2L 4Z7QB 4XAWH 1KB3A 4OLWL 3GRWA 1QLFA 1TCRA 3BAEH 3EFOA 1HDMA 3IF1B 2V2WA 4WY7H 3WIIL 4BV1A 2WBWB 3QIWD 3NA4A 4ANXA 1IGCL 4ZUSA 4OF0A 4CC4A 4NRXA 1P1ZA 3S3JA 5EA0L 2WLHA 4Y4HA 3GS0A 5C3TA 3ULVD 1G7JA 4FFVD 4MKMA 2NZ9C 2Q2LA 1YEWA 5DO2C 4L4VA 2F7OA 1R3KA 1GAFH 3IJSA 3CNKA 1C8QA 1UATA 5EPMB 5IVZA 5CBEB 4FLHA 4AQ1C 3CK0L 4KXDA 5T1DL 5DJAB 1ADWA 2B1OA 5FUOH 3RGHA 1QEWA 1ZHKB 1DLFL 2UVEA 3RI5F 5IBUG 4P3CH 3ULVF 3QR0A 1N68A 1AMYA 2I69A 2CDGA 4JDVA 2FZ3B 3HHRB 3AG3B 1WZKA 3LZFL 4KRPD 3DROA 1RUAH 3NDZE 1HAUA 5I1EL 4JPVL 2DQFB 4IKIA 3KPMA 5T1LA 3CFBB 2H0EA 1MHEB 1RZJH 3MRRB 3SCMA 3U4BH 2UZXB 1PY9A 1BX2B 2H32B 4M43H 4MDJA 5F6IB 3X13B 2FBRA 1A2YB 2FR4B 1G0XA 1V3KA 2A6IB 2BSRA 4I2XE 3SY6A 4EN3D 5ID1A 1RIVL 3OQ3B 1A6PA 2FEJA 1X4YA 4FQXD 1KEMH 4FFTA 3P9MA 2R7EB 3VXRA 5ISZE 3BCFA 3PXHA 2O6PA 4G6AD 4FHKA 4XN4A 2OZ4H 2HJLA 1OALA 1ULVA 5IB4A 4DOHB 4FMVA 1OM9A 2DIAA 2JIXD 4WFHD 2J8UE 5B22A 4ANVA 1BVLA 1IC5H 5DUPH 3NJXA 3QIWB 4K3DH 3FPXA 1T4KA 1JGIA 4JM4H 3B9KA 1R17A 3HE6A 1N7MH 3U9PL 3CUPB 4CUCA 1CFQB 1RZIA 1BJ1J 3DWTA 1GGIH 4J3VA 1QAWA 1E2VA 1QYGL 1ZVHA 2UZYB 4UTAA 2YD3A 4UQIM 4EN2A 3LZQA 1QLRA 1CVSC 1WICA 1KYFA 3JWOH 5E23A 1PG7X 3K6DA 5CGBA 5K33A 3UPAA 1NC2A 3ISWA 5E6ID 3O2DL 5F70A 1ZIAA 5LGYA 1XSOA 4CMHC 3N55A 4WNQB 4L48A 3FQRB 1Q0YL 2BSCA 3IE4A 4FFZL 4Q52A 5I6OA 2WVVA 3PIQA 4KRPB 1MCCA 3CSBA 1JS4A 3CG8A 4JBSA 3V2AR 2HFTA 1A7NH 3ARDA 4ZSOA 4YHML 3FJTA 4LSRL 1E6JH 1TYEB 3ETTA 2PWFA 2C1OB 4EN3B 3C09C 4ES8A 4X6FA 4ZO9A 1BZ7A 3F83A 3TBCA 4FQXB 1KNOB 4R4BA 3L17A 4LAJH 2UUDK 3RZCC 1F3DJ 4JFHE 4ZUTA 2AAVA 3IDNA 5HHVL 2NT1A 1INDH 1HYSC 3OKYA 1IGIL 3L3OC 1R75A 2YKLL 1G7LA 3N1FC 4TXVB 4YAQA 3V4PH 3N43F 1WDAA 4NQVB 5EH1A 5BZWB 1Z9NA 4HFUH 1HN1A 5BVPL 1A7OL 1G6RA 3IPBA 1G7PB 3EYOA 1HILB 2PPAA 5HJ3B 4CVUA 4D0DB 1CT8A 3HJEA 3JYBA 3T65B 2WTRB 2YZ8A 1KLGB 3FT0A 1DUYB 3NCEB 2D3NA 3BI9X 3DXAD 1JGUL 1KN2L 3FPYA 4PRHA 3EYFB 3NZHH 4B3VA 3BWSA 1IBFA 4N5ED 1ZLVK 4JGMA 3CHRA 4JO3H 1GZHC 4Z95H 1ZPLA 4PCSA 3DX7B 2CIIB 4H26B 1TZGL 3ALPA 1NUGA 3U4EB 4DN3L 4RESB 4AJYV 5LN8A 5TF1L 5IP4A 4MSWB 5EHFA 3BPLC 5D2LA 2WUCH 2C7FA 4POZD 4ZW3A 4KQ3L 3MLSH 5AEAA 4H25A 1Q9KA 4Y4HD 2P1YA 1UGNA 2P5EA 4LL1A 4XP6L 3F7RA 1XXFC 3DUUB 3P30L 32C2A 2ADYA 1R5IA 1KCKA 2WKGA 4DKAA 6FABL 4QYAA 3N43B 4G9FB 3V5DB 2PCXA 1SMDA 3GD1C 2YD5A 3ZKXC 4LSTH 4W6XB 3EADA 3ZXAC 3V0DA 4PCYA 4XTRD 4JFWA 2QQQA 4ZQKB 2D7QA 5CEYB 4X9YA 1XEUA 3O45B 5DRZA 3QYNA 1KPRB 2YMXL 1A64A 2MMXA 3HB3B 2I27N 5EB9A 1OAQH 2ZOOA 1D5ZA 3LKRA 4NLHA 1DE4B 5GGTL 5T1LD 3I6LD 2VDOL 2VKXA 3OKKA 3IDIA 4KWUA 3RJOA 2OMZA 1JTPA 2H2PC 4NN5C 1JCKA 4Y2LA 1GZPB 4LP4A 3WSQL 5J89A 4AT6A 5JTWA 2G2RB 4ODXA 4FLSA 3TT3L 5HHQA 3GTVA 4FLQA 4AV5A 4AC4A 3VXRD 4RETB 1G9EA 1Y6KR 2XBDA 3B2UD 3JZ7A 1CBVL 4N8VG 1D5BB 2AK1L 4Q9BA 1QLFB 1TCRB 5IM7B 1HDMB 1ED3A 3QA3B 3V9EA 1H9DA 1W8NA 4P23C 4ZUSB 2OMWA 2P49B 2KH2B 4NRXB 3B9KD 3HE6D 3UAFA 1P1ZB 5F7UA 4N2IA 2VT0A 1MDTA 4NWUH 4OQTA 4OCXL 2W5PA 2YRPA 4Y4HB 4ODHH 2R8SH 2KZWA 1YEHH 3DHUA 1F0LA 4L4VB 3IJSB 2YFOA 1KIPA 1JWSA 5JORB 3HZKB 1X5KA 4TNWF 5IVZB 1O75A 4OGZA 2GBAA 4YS4A 3QNFA 1QEWB 2PP9A 1BQHG 3WNLA 5BQ7A 4ODTH 1C5DA 1NC2D 1BYOA 1E7UA 4HGWA 4HSQA 5CHNA 5TE7H 2Y24A 5BZZA 4BFJA 4JDVB 5C0CE 3U4AA 2YAMA 1SDDA 3MNVA 4ZOBA 1A14H 4AY0A 4I2XA 3IRZA 5T1LB 1E5AA 3KPMB 2F53E 3BQUA 1GVIA 4JUSA 2K7PA 3SCMB 3EGSA 5ISZA 3ARDD 2BVUA 3OVUB 5ID1B 3MRDA 3Q8CA 2BSRB 4PGEA 5KSAA 1MCQA 1E4XH 1XF3A 4FNLL 4IBLT 5FK9A 1PVHA 3P9MB 2K8QA 3VXRB 5AQ0A 4J3TA 4PJEA 1KLUA 3MAWA 2J44A 1IZJA 1OAKL 2HJLB 4GXUM 5MEOA 1Y07A 2VR9A 4PRDA 3SKJL 5IB4B 4Z3JA 5CN2A 1Z3GH 3INOA 5JOPD 3P4LA 3VG0L 2PTUA 3WL9B 3FN3A 4Y9FA 5BZDA 1T4KB 4ZG1A 1H3PL 3B9KB 3HE6B 4GAJH 2CRIA 1HZHL 2E27H 2HLFD 3E3QE 3UIZA 3UBXA 3TEYA 5E1GA 5EC2B 5CU5A 1LYQA 1J18A 1RZIB 2OL3A 3ATAA 4XHJC 2NX5E 3BAJA 3B2DC 4LL9A 1I3GH 2DJMA 1XBRA 1TNNA 3FUHA 4JY5L 1JZDC 2VR3A 2FCBA 3RFZC 4L1BA 1NC2B 1NCNA 3SQBB 2E4TA 5K1VA 1UKQA 1E6OH 3ZQ9A 1IARB 4GIOA 5HVGB 1MFEH 5DA0B 2WYTA 3GI9H 2Z9TA 1XZ0B 5JDSA 5TPWL 2JTYA 3RJDA 1UCBL 1I7ZB 2H26A 1B2WH 3VXUD 4BCYA 3ARDB 4ZSOB 4N2MA 1OCOB 2Q8BL 4X6FB 3FU7A 1BZ7B 3EDDA 5D2LF 4R4BB 1KACB 2Q7AA 1WTGT 2CUIA 2PCPA 5HGBA 3CQPA 4JRFA 4UV4L 4OFVA 4ZUTB 4UI2A 1Z0NA 1WD9A 3IDNB 1NAKH 1FYHB 4GAFB 1JUFA 3T08A 1AY1H 3HLAA 4LRIA 1G7LB 4F3FA 4YAQB 2J88L 2I24N 3L3HA 4GI9A 2WJ7A 4ZS6C 2K4WA 2H3XC 4H1LH 3Q2NA 1WHOA 4XNUH 3TIDA 3ULUL 1G6RB 1CCZA 3EYOB 4XBGA 4KI5E 4L1SA 3V6FA 2GC4C 2WD0A 4S1SL 3F84A 4LLDA 3MJ6A 4JLRA 1CT8B 3AC0A 2WK2A 5KVEE 2W0FA 1RXLA 4UTBL 2XQYA 2WINA 3QUHA 1UTDA 3RVUC 1OL0A 1ZT1B 3EOAB 2XPZA 3T6QC 3IETA 5T5FH 3RRQA 1WWAX 1IAIL 3UJJH 4J3OD 4AENA 1KCLA 3QXDA 4XCFH 4QNPE 1OZTG 1BZQK 2EH7H 1AAJA 3ZMNA 5D2LB 2CRMA 2BFGA 3EJCA 5HHXL 4ORZC 1R5WA 3K4ZA 1Q9KB 4Y19E 2P5EB 2DMCA 5A2LH 5IR1A 3V0VA 3VXUB 1R5IB 3CLWA 3JSSA 2Z34A 2NMSA 5JQHC 1NCWH 4H5SA 1TYJA 3OAWA 1OIOA 4FEMA 4FZ8L 1ANUA 3OAUL 1QUNB 2WO2B 2DLTA 4GQZA 5AUMA 3FCUB 5DHEA 1CFMA 1IFHL 1G7MB 4MMYB 3CC5B 4QKXB 4Z7NE 3TF4A 1D5ZB 4KMTH 3LKRB 3NN8A 1HIMH 4DP9X 2GHZA 3GSVA 4JY6A 3CH8A 3OKKB 4Z0BL 5KANI 1M7IA 3IDIB 3MSPA 2WXLA 2MQGA 1W0YT 4YFLF 3DRQA 3UG5A 5KSAD 4AT6B 3N6YA 5C6WH 2QGDA 1HU8A 4QRSB 4TQ8A 4XPTL 3TBWA 5HHQB 3DK2A 3QWRA 5CR8A 2C34A 5F9JA 3D12B 1XGRB 4UB0H 1BDYA 1T21A 2XXGA 3EOTH 5I1CL 4S1RH 4F9PA 1G0DA 3TJEH 3I6KA 1GXEA 3OPZH 1ED3B 3GPSA 1CC3A 4AIEA 3QUXC 2OMWB 1ZV9A 1MXGA 3KBHE 3LKQA 4PJEF 2K9FB 3C5JA 1OAXL 1MI5E 1GL4B 4GUOA 3FUNA 5H35B 5JW3L 3K7UA 4J3XA 3SDAC 2DTML 1K2DA 3VFOA 1JWSB 4PWKA 5JHLH 4HJGA 4ONHB 5SWZE 4XC1L 4LU5H 4BFOA 3ML8A 5C0CA 5C0FA 1GTFA 3DK0A 1C5DB 4M48L 4QHKI 4ABQA 2XV6B 2A6KB 4HGWB 1GYCA 5CHNB 3UZEC 3MRKA 5IQ7H 3RIFF 5DTFA 4JJ5A 5KZCD 1T1WA 2K3TA 1JDAA 3MNVB 3FO0H 3SYAA 4XAKE 4QRPD 3GDCA 3I84A 2C3VB 5IF0B 2ADFL 3BQUB 4ZXBD 5J1AA 4FNSA 5A6MA 3MLWH 3HHSA 3IJEA 4JFHD 1OCWL 1J5OL 2YJLA 1EEYA 4OD1H 5TDOA 1RERA 1Q9WB 2IMMA 2VISA 3MCKA 1IAMA 5KSAB 5FV2A 4N2HA 1N70A 1XF3B 5J13C 3VWKC 4PJEB 1KLUB 5EF2A 5LQBL 5AVQB 1DYZA 1JOIA 3LZOA 2DWDA 4HCGA 1IRAY 4PRDB 4YHOL 5GZNA 5K1NA 2FDBP 4L23A 2YGNA 1P6AB 1AZZC 1G4MA 5BZDB 1LO0H 2AQQA 2A74C 3H9YA 1FIGL 2XA3A 2NX5A 4GXFA 5KVMC 4UQ9A 1SY6L 4CNIB 1A9EA 3UBXB 5E8DL 3GS4A 4ZOAA 1TOXA 3NCCB 2FATH 5D4QA 1S9VA 4L1LA 4MRCA 2VDQH 2WWOA 5IHLB 3QQ4A 3QUML 2PW1A 3CZKA 3D4YA 5DQDL 1A9BA 2FSEA 4K8RC 2L7JA 2Q6WB 5DHVA 5AAMA 1RZFL 2H1PH 3RY5A 3BH4A 1W72L 3L3JB 2R9HD 4CN6A 3CXHJ 1T7XA 3LHAA 3D8MA 4O5LH 2QPEB 3SYPA 5CLWA 3SBPA 2L8AA 4PRIE 2COQA 2HT3D 2BVTA 5HPOA 4DGUA 1PDKB 2O5YL 5C86A 2BHFA 4QRPB 5FHBL 4ODUA 5G4NA 5JDSB 2ODHA 3VXPA 5EZLA 4ZXBB 2FT6A 1M3IA 2H26B 4U1IA 3SYOA 4DUVA 5I1DA 3TS8A 1CD1A 4OD3H 1CR9H 4PSPA 5DI8B 1EO7A 1KENL 1URZA 1VDGA 3FU7B 4YDIH 3WUWA 2K1MA 2N0KA 4X80H 4DK6A 5HGBB 3DUHA 3QPKA 1RURH 2B39A 2VJ0A 1M1SA 1YPZE 4P0DA 3KPQA 2YGOA 3HLAB 1E90A 4F3FB 3Q5YA 2UX6A 2DS4A 2QPSA 4L4TA 3SZKC 4JFUA 4NZTL 4ZX6A 4FFYA 3HMWL 4Q0XH 4H8HA 5I15H 1U8HB 2FBOJ 3MRPA 3TIDB 2WXQA 1MRCH 2VZUA 2Z1PA 5I6PA 1XH2A 3ZTNH 5DFAA 3VWJC 3V6FB 6PAZA 3HG3A 3CX2A 5ABDE 4LLDB 1J48A 5IJCC 3HAEG 2GJ6E 1TG8A 3N42B 3NJNA 4HUNB 1OD7A 2WINB 3VCLA 5EF3A 4KZEL 4N5UA 3EH3B 2QZ5A 4K94C 4AKQA 4XCYA 2YPVH 4Y4FC 3VFRA 3D69B 5BS0E 2YBRA 3IETB 5D96B 3OG4B 4Y16C 3HBGA 3VXMD 2VL5B 4HPHA 1RVFL 3QXDB 2N4IA 3WDIA 4NDMA 3H4FA 3QC5X 3O0RL 3ZSSA 2DB8A 3P4NB 4IRJC 1MWAB 1IKFL 3M86A 1R5WB 3KPTA 4HU8A 5L0QC 2ZXDA 1J9RA 2CHNA 4IS6B 3DJRA 3HE7C 3P3RA 4HWEH 5SV4A 3V0VB 2ZKXA 1XXDC 4L8CA 1MJ8L 1IX2A 2YA2A 1VHPA 3WFEL 1P7HL 4BA0A 4R2GC 3ULUC 1MJJA 2XI9A 5T3XD 1ID2A 5CR1A 2A4EA 3EBGA 5AUMB 1NBZA 2VOTA 2X6BA 3HRZC 4Q2ZB 3T1FA 4DUXA 5I1IL 2Y5QA 3V5KA 3OGCA 4JO8A 1ZT7A 2DQHH 2DQUL 1DVZA 1K4CA 3GSVB 4RMUA 3CC1A 1M7IB 1X7TA 2NY0B 3TYGH 2CBOA 1K8IA 3DRQB 1THAA 3BUYA 3QI9D 5I76A 5GRVK 4MBRA 3TBWB 3WGUB 2ZF8A 3ABZA 3DX6A 5F9JB 3BZDA 1T21B 1PW3A 4XOCA 1MLCB 5K59E 5LWYH 3WFCH 1AD9A 3AM8A 5JIIA 1E67A 1UT1A 3I6KB 3CV5A 1Z7JA 3LPWA 3VXMB 2HFGH 3B5HA 3BSZA 3CFCH 1BG9A 5J3HC 2WUBH 3ZRCC 2XTJC 1QW8A 2NSMA 2OMYB 3IDYC 3LKQB 2F5AH 4RAUA 5TGBA 3C5JB 3HI1A 1KBKA 3QZMA 2GSIB 3CPUA 4MMZA 2P5PA 4OU3A 4N90E 5SWZA 4G8GD 1AIFA 1FCCA 1YEJH 2AJSH 2WQUA 3SGDH 4KJWC 1K2DB 4FL4B 5D7IF 4ZW7A 1UXLA 5ENWA 1JXKA 1IB5A 3QO0A 2AEOA 4G6FD 4HJGB 4MGXA 4IKKA 5C0FB 5C0CB 4IIQA 4KK8D 2NUPB 4ZD3L 1DN0A 2Y22A 3S8FB 4KK5C 3MRKB 4JREC 1I85A 1EJOL 5DTFB 1T7VA 1MH5A 3MJ9A 5E2UH 4KDVA 2VUYA 3NVQA 1MHPL 5C2BL 4XAWL 2A77H 3JV6B 5J1AB 4FADA 4MJIE 4KTYA 2QPFA 3EYUL 3HHSB 2Z7YA 1MQKH 3IJEB 4ONOA 1EEYB 2MWCA 4WY7L 3FH7A 5I28A 3MCKB 2VISB 4GAGH 3QI9B 2VXVL 1KJ2A 4ZODA 5I6LA 1MFCH 1LE5B 3VH8A 4NKIL 2GTWB 3SQRA 3LNDA 4JN1L 4E9LA 5AVWB 2YA1A 1MQ8A 2DWDB 3LNFA 2X2UA 5F7YC 3CX5J 1RJLB 1MFVA 1PTZA 1PY4A 1ZA3B 2CGYA 2UYLA 4L4TD 5D7IB 3M7OA 4TUOA 3S37H 3KEDA 4XPBL 3ZDXE 1YJDH 4HJ0C 3B9DA 5FUOL 4K2UL 2K45A 1A9EB 1M7DA 5TE4H 2OMVB 4W93A 1ZE3C 1S9VB 4O58H 4G8GB 3QQ4B 1ZSDA 4XN9A 3RL1A 2PW1B 2RFXA 2BP5M 3RAJL 3DX8A 3FB8A 3AB0B 2YLHA 4W70A 4G6FB 4PRIA 1BPVA 1PF3A 1GSMA 2CKBA 1PLCA 5SV3A 1U93B 1U95A 4MFHA 3U4BL 3U36B 3ZIMA 2VJ8A 4M43L 4POUB 3NCMA 2Q5BA 1C5BH 2R56H 3AY4C 3FRUA 4KUZL 5F3HA 3ILQD 3P4OA 1L6XA 5BNXD 1AQHA 3MNWB 3VXPB 5EZLB 1MG3C 5EU5A 4XBEH 2IH8A 3O3DA 3DI2B 4RSVA 1CD1B 4FG6D 2CSPA 3B83A 3RGVD 5D7JC 5KBLA 1YPZA 2B08A 4LIQH 4WFGD 3WUWB 2F7PA 1F2XK 3VTMA 4N2NA 2ADGB 2XYCA 3CFQA 1X5XA 3B3IB 2DLFL 2CLZA 4KMLB 1A25A 2HUHA 2VO5A 4WI2A 4Y2NA 3G7TA 1NGWA 3KPQB 4BSJA 5F71A 4P5TC 5E1QA 2ZXAA 4I0CC 4L4TB 3VRIA 1SN2A 3RKDC 2IBGA 5DJ8A 2ARJA 1GKEA 2Q7YA 1WD8A 2GJ6A 3MV8E 3MJGX 4MNQD 3ME0A 3MRPB 3SKUD 2LOEA 1O5DT 3UYRH 2HAZA 1FO0A 2OX5A 2JJSC 2I85A 1UD6A 1TQCC 2Q76A 4Y88A 3FB5A 3CFDA 3Q6GH 1U3HC 3WOVA 1M2VA 2NY6D 5BS0A 4OV5B 1AG0A 2D3LA 4YZWA 4MA1B 2PPEA 3DMMD 4JE0A 5IBTL 4JO5A 2Y2WA 4DVRH 5KOMC 2XLLA 3DX1A 3WNNA 5E4OA 3DPBB 4ONGH 2YBRB 3FUDA 3PG2A 1E6JL 3FCTA 1AP2A 3AZUA 2D4FA 4X5XB 3N5AA 2PO6D 4NDMB 4XNAA 4X8GA 2VXSH 5FOBA 3FQNA 4N8UA 1D9KA 3KXFD 3TCLA 4PG9A 2EIKB 2NR6C 4OF3A 3VFUB 5C07E 2VR8A 3V4PL 2DWSA 4JKPL 5DLLA 4L8CB 1X6NA 4G7YL 3RGVB 5E08H 1UZ8A 4IOFC 4KUCD 3KR3H 1OSEA 1GS8A 1MJJB 1JI2A 2DQMA 1BF8A 4UT9A 3H9SE 4GRLD 2MOQA 2WLNA 2XN1A 4J3UA 4OBRA 1EAOA 5EN2A 4EVNA 5BVJA 1JRHL 3UO1L 2WOBA 7FABL 1FGVL 3OKOA 3ZDZE 1FZKA 2WQWA 1AI1H 4KUCF 3FUIA 1RUPL 2ZUUA 1FNEB 2A6JA 1DJIA 1K4CB 5EZIH 3HN5A 3P02A 1UKSA 2NY2D 4MNQB 4CILA 4Z95L 2WXRA 1A66A 4PJIE 3EXLA 4U4BA 4LSUH 4UWQB 1K8IB 2CO3A 3BUYB 4R7XA 3AW5A 4AJ0A 2OXHA 3GIZH 5D1QD 5I76B 5JHAA 3MRHA 3DX6B 4OFKA 5LBVA 2YAQA 2RMNA 1WBZB 3F7YB 3MX0A 4PVLA 5D93B 1AD9B 4N8VA 4YHLH 1JF5A 4K15A 1XIWC 1CICA 2ICWA 5FYLL 2PO6B 3MLRL 4LSTL 4HV8B 4RAUB 1XMWA 1T6VN 5TGBB 4E9VA 1QR4A 4I87A 4MMZB 3ZOAA 4AGNA 4AUJA 3KXFB 2VDLH 4FAAB 1WIOA 5A2KH 2KL6A 2MH4A 2NY3C 3F05A 5ENWB 4PRID 3DRTA 2AMUA 2F08A 2YAEA 3BESR 4HVBA 4NNXA 4IIQB 5C8JA 1QTSA 1DN0B 1BQHA 2QHRH 4LSSH 5IBUB 4U0RC 2DMKA 4GPVA 3WKPA 2AF2A 4JJOA 4MJIA 2LAAA 1MH5B 3PQYD 3QJSB 3D2TA 3GDBA 3C5ZA 4F2FA 1GGBH 4PHZA 5EV7A 4HUUB 1SBBA 5E5RB 5E9NA 2NY2B 4QLRA 1P1VA 5IW6B 3HA0A 2R2EA 3L3IA 2M26A 5B7EA 2V5MA 2Z6FA 2HB0A 3NQKA 3QRLA 4B6ZA 3VH8B 1IFRA 3BYYA 4JANA 5F7AA 5CCJA 2BWIA 1PLBA 1Z9OA 3LH8A 2R8SL 9PCYA 4LF3A 3M1CA 5T1MA 4XWOC 2OP4H 1ZT4A 5BRZE 4U1JA 2KC0A 4HHAA 4AIZA 2UYLB 3GZKA 4P9HL 3P11L 4R97C 2K8MA 2GJ6D 2VDNL 1MHCA 3DSFL 2IPUG 2NCMA 4QHNB 2Q9OA 1GGCH 4E42B 3W82A 3GZPA 1ORQA 4DK5A 3RL1B 3V4UH 2RFXB 5BS0D 3DX8B 1A14L 1JPST 1L9SA 4PRIB 3GSNL 2CKBB 1VGKA 3V8CA 5E6ZA 3KD4A 3QAZB 5AD0A 2JVUA 1Z9PA 1DL7L 1H3VA 6TAAA 3PAZA 3ESVF 3WHE0 3B9VA 3FRUB 4ZO8A 4OCRL 4JKKA 4PTTA 3ZHKA 5F3HB 3P4OB 1JZ6A 2FQFA 2ZD0A 5EU5B 1D9KD 3G6DH 1Y7VA 4TTDC 3O3DB 1JZ5A 4AJWA 1QWHA 3BKMH 3QXUA 3TJPA 1ZLUH 2G0KA 3HR5A 5ESQB 1UA6H 3KYMB 2FGZA 1J1PH 1SVCP 2CLZB 5LAXA 3LRMA 2VN3A 4AK1A 1I9IL 3HC3L 1T6BX 3M6DA 1NGWB 3QZBA 2AJ3A 3MV8A 5EWIH 2FO8A 2WLYA 1B0IA 3H3BC 3HZVA 2XICA 3WNIA 1I3GL 2AGJH 3F2LA 2ZT9C 1JE6A 5DJ8B 1RZJC 2ARJB 5G4OA 2ZUXA 1UVQA 2GK0A 3AQDA 2Q7YB 3UTQB 2GJ6B 5I6MA 3FUFA 3ME0B 3OAZH 2KQNA 5D7KD 1Z5LA 4L8BA 4G8IB 5FYJD 2AEIT 1V3JA 2JJTA 2VXQH 3FB5B 3CFDB 1REIA 5BOPA 2VJXA 1M2VB 5BS0B 1AS7A 5JQ6L 3D4GA 1MJUL 1YUHA 3QR1A 3GI9L 5T3ZL 1A6AA 4PSRA 4A66A 4AC2A 3GUTA 3JWNC 2DDQL 5B38B 3C87A 3MJWA 3K6NA 3VXOA 2AW2A 2XOTA 1TQUA 3RUGF 4GW1A 4ICXA 5K59F 3KPNA 3FCTB 4ELKB 1AP2B 4ZW6A 2XIDA 3NTCH 2YQ2A 4J3BA 1YN6B 1E5YA 3LPOA 3FQNB 1TKWA 4QT5A 1GS6X 2HTKC 3GRWH 5C0BD 2CBPA 1D9KB 3TCLB 1U8KA 5J12C 4PG9B 4XPFL 1ZHBA 3H9SA 1KB9J 3OHMB 1EK3A 3GIVA 5JW4N 5L8KB 1UZ8B 3WEAA 1G7QA 3JWOC 2YN5A 5BXFA 3P77B 5L8JB 5E00A 5KVFH 1FL3A 5EN2B 3GSXB 4UV7L 4DKDC 5BVJB 2XRAL 3PP3K 3QRFM 4M5ZL 4MJID 4W9HC 3OKOB 4NZRH 4PJIA 4Q97A 1FZKB 3C5ZD 5CD5D 3K2UH 5ETUB 2CHWA 3GQFA 1YEIL 5I1GH 2OAAA 3L08A 3LNIA 4HWUA 1BP3B 1WSST 2FEEL 2GIMA 2ZX8A 3KNBA 3ABMB 5FO2A 5ECGA 3UJJL 3RUGB 2PW2A 4XCFL 5FHAH 3BMWA 4R0LC 2OXHB 1HINL 2EH7L 2BIOA 4KGLA 3MRHB 1ZAGA 3ZYJA 1FHGA 1UA3A 3MX0B 1RK0A 4XPGH 4LQFH 4OZIF 2ADJA 4X6EB 3S96B 2WMPA 3LVTA 3DKHA 3TEUA 4N8VB 2FD6L 5FC9A 1U8CB 4OF7A 2V8LA 4EBQH 5BMFH 4F8QA 1KOAA 2ICWB 3HMXL 4G6KL 3V95A 2EDEA 3O6KL 4TVPL 5BZXA 3GMQB 1J05B 1KBGL 1I1AD 3FU9A 4NIKB 3SBWC 3ZDXF 2CO1A 1CDGA 1DLHA 2OW6A 5K93A 5CFAA 3ESOA 2BS9A 4PW9A 2UY7A 3AREA 3PRZA 3BN9D 4OBSA 4GMSH 1BW8A 2VW7A 5A7BA 4KMTL 4QXUL 5H4YA 1HIML 1I3RA 4J28A 3G5VA 3DRTB 4P4KC 3S35L 1N6QL 4UIKH 5E6YA 4RRPM 4X42A 2UXGA 4WI7A 3BH9B 3PABA 5BUAA 3FFDA 1YVLA 5GRZA 3NABL 3QCUH 2H2SD 1BQHB 4AKOA 3BIAX 4UTAH 2DWTA 4MJIB 1WPCA 5DRWA 1QBLL 3CZGA 3C5ZB 3CZJA 5LG6A 4UB0L 4XPHL 4X4YB 2EDJA 2KYIA 4PG2C 3C2AL 3FQ2A 4HLZG 4NQEE 4OZIB 4FYRA 4QY8B 4KKQA 3ISYA 3OPZL 1OGSA 4G43A 1P0SE 5KJ4A 2KLRA 1JPTL 5ACLA 3MXWH 5BRZA 1EGJA 2ZAGA 4JANB 1LTXA 1EEQA 4F9LA 2BSTA 3ZDXB 3ZKQD 2V2TA 3K3QA 4LF3B 4WUKL 2OYMA 5GGSA 3II1A 3MV8D 5T1MB 1ZT4B 2D3VA 1WFOA 4U1JB 4HHAB 4AIZB 3BAXA 2ZJSH 4PJAE 1LJMA 4NQDE 1K3IA 2JSFA 1ITBB 1NUDA 2VSCA 1MHCB 3ARUA 4G7VL 4LU5L 3S36L 1P9MA 4H8WL 4KKLC 1I1AB 3MGOA 4LE8A 2EDMA 5CGMA 4BCZA 2CM6A 2CA3A 2ZG1A 5KAQG 1CE1L 1SJHA 2WZ6A 1QW9A 4M6NH 4Q4EA 4FJ6A 5CEZE 1WFTA 3QCTH 3FO0L 1IGTA 1UM6H 4U1KA 5C0IA 4LVOB 2O5ZL 5F9AC 5A2IH 3SGEH 1VZIA 1VGKB 2JMRA 1NFKA 3ARBC 2F7IA 3KJ4C 1BHGA 3TM6A 2PYFA 3LX9A 5T1KA 2XZAH 4AEHH 5IQMA 2Z35A 1EXGA 4I3RH 4K5NA 1S5HA 3LKPA 1KF9B 4G83A 4NWTH 1QSVA 1QFHA 4X98A 4J12A 4PTTB 4L3CA 1W80A 4X7FC 5CJ5A 3WN5C 4WW1A 1FAKT 5TE6H 4HZLB 4HMCA 4XP9L 4AQOA 4JPWL 3OF6A 3X2QB 2DIEA 1AGEA 5CEXB 3HR5B 1M71B 3IMTA 4RGNC 5C09E 2CJTA 4ATTA 4R8WH 3CSYB 3L45A 5LAXB 2FATL 4D0BA 4NSKA 1PZ5A 2AJ3B 2VDQL 3MV8B 5TDNA 1NGXA 3F5WA 4QO1A 1USZA 3HZVB 1FBIH 2YD9A 1VPOH 2Y72A 2BSBA 3GM8A 2B9BA 4W9EC 2QZQA 1UVQB 2GK0B 2H1PL 1J9SA 1GSKA 3N40P 3ZDZF 1Z5LB 5CJXC 4O5LL 4LCVA 1FPTH 1BV8A 2COVD 1JYXA 4IRZA 5IY5B 3GM0A 5EFIA 1DBJL 4Y5VC 3HAEA 4PJIF 5DMGD 3PWLA 2FJHA 2Y0SA 1ACYH 4V1DE 4FEIA 1A6AB 1NGPH 3GSUA 4MXWL 3GUTB 1NMCB 1RZ8A 4FXKA 3VXOB 2J1KA 1KULA 2VGLM 3WEOA 4GW1B 2YMTA 3KPNB 1NCDH 2AQTA 4NJAH 2BZCA 4YDIL 4X0KB 4ZFZB 4KTDH 5LCVA 3HS0A 5B21A 3NCFB 4HDIA 3HC0A 4QT5B 4YO0A 5MERB 5I1KL 4F15B 2MCPH 1UWYA 3ARED 1U8KB 4NBYB 4ZUVB 4NPKA 1I8UA 1ZHBB 1JWUA 3MRGA 3QW9A 3H42H 4KKCD 2A2QT 4ZMWA 4N6RA 3D9AH 3MBEC 5BXFB 2J1WA 4IKJA 3ZDZB 2DLIA 3BX7C 2AJYH 2IGFL 2FWSA 3OV6A 1DQLL 5I19H 1TLMA 3K6FA 4F7MB 1HWWA 4PLNC 5A1AA 3FCGA 1B90A 1HCZA 4G5ZH 3F7LA 1PD0A 3ARVA 2HCZX 2WQRA 3QFJD 1BVZA 1MZYA 5DWUL 1ONQA 3OKNA 3UP1A 1J0ZA 4QRUA 4GAAA 3TA3C 1SHMA 1KIQA 4OFYA 1J9QA 1HS6A 4B9CA 2PW2B 1KTJA 4O02A 2FHBA 4ISVB 1IJ9A 3OB8A 2J8OA 2BERA 2XHNA 2WXIA 4PH8A 4RX4A 1E50A 1RK0B 1BM3H 1D2OA 2ADJB 4BHUA 2WMPB 1X6LA 3ARYA 4WO4D 4ADGA 4JQXC 2OCJA 3O8XA 5AG9A 4GBXD 3WN6A 3DOSB 4C56E 2XXMB 4MA7H 1QFOA 1AS6A 3R0NA 4XMKH 3PDGA 1DLHB 2CE6A 3PWJA 2IAMC 5IREA 1FFOA 2NOYA 2UY7B 3AREB 2HMID 3I02A 3APCA 1L0XA 3DLQR 4XNZB 4M5SA 1BGXH 3TNMA 1I3RB 2DQHL 2NY4B 2Y1VA 2H8PA 4LPUA 3QNYA 1TTGA 1NCBH 4M93C 4E2OA 4XBPA 3PABB 1QVOA 1ZTXE 5T1KD 3CVHA 3CU7A 2OL3H 1JPGB 3M17A 1RLWA 4JFFE 4MJJA 4X6DE 4NQEA 3KM2A 5E2WH 4XH2B 1X9QA 5IROC 3FO1A 4JFQB 5DRWB 5CD3A 3AT9A 4AQ8A 3I6SA 4GLRH 2ZCKH 3QFJB 2IFFH 5FYKL 3HNTH 1U8MA 2FWUA 1YEKH 5DA4A 3WFCL 5TTRA 2KLTA 1T83A 3OC8A 1MY5A 4JZJA 5BW7C 2HFGL 4JFEE 3OF6D 5AAWC 1KPVB 8FABB 1MRDH 2WUBL 1L7TH 2BJMH 2R29A 3DECA 3GMLA 3LQZA 5BRZB 1CL7I 2IGLA 4PJAA 4U1NB 1DBAH 2BSTB 3TA4D 3GZQA 4NQDA 2V2TB 5GGSB 3NPSB 2D31A 3ZL4H 7PCYA 4GBXB 3REVA 5F8QC 4G42B 2WW8A 4OT1L 2WYIA 4QAWA 1HZLA 4L29A 3MGOB 1R0AH 5DZLA 4XNXL 2XQBL 4FJZA 1MNUH 2DLEA 5FUCC 5LNEA 1XAUA 1SJHB 1LEGA 1BCIA 3O3AA 3FULA 2WXJA 3LXBA 4M8VA 4U1KB 1IGTB 1HE8A 1QSFD 2ZXEB 5EIQA 5C0IB 2OJEB 2YWYA 4NLAA 4DZBA 1OTSC 4XOEA 4Q74A 5T1KB 3UTZA 2Z35B 3ILPB 3TFBA 3FHQA 2EDYA 1H8SA 3LKPB 1EX0A 1QKZH 2WQVA 2OSXA 3A5VA 2XUWA 3MTRA 5JW4M 4L3CB 2DQCH 3PWPE 5DSCB 3TFKC 2DLGA 2KERA 5DHYA 3ZKMC 1QFWL 5C09A 1T2QL 1PZ2A 2RCSH 3LJ3A 4OFDA 3NIGE 4YPGA 4AW7A 1JVLA 1RHHA 1OEZW 4E41E 2ERJB 2B4CL 2G9HA 4H8WC 5D4HA 4KH9A 1QRKA 1ZDSA 4EKXA 5ABZA 3SDDD 4JN2A 5DD3H 5I8OH 3OZ9H 4D0BB 4NSKB 4M4PA 1PZ5B 3UPRA 5SX5K 4NN6B 1UOKA 1ASOA 1UM5H 3EH4B 1NBVH 3OR7A 5PCYA 3WNOA 1D7BA 4XNBA 3PHAA 4LVHC 2XZQH 1OE1A 3T71A 4KK9D 4OFYD 1VA9A 2I25N 4RA0C 1R6VA 2R56L 4V1DA 2D7PA 4JFDD 3RTQA 1RFDL 1KXQE 1NIAA 5C71A 5EFIB 1KTCA 4XXWA 3HAEB 5AVYB 2OMNA 3SN6N 5SWQB 3X11B 1JHTA 3KYOA 3PWLB 4JO4H 4KKAC 2XY1A 2J8HA 1QG3A 3VW3L 2A4CA 2X28A 3GSUB 3RVTC 1T04B 2X9YA 1XHHA 2LQRA 2DMHA 4NUGH 5HYSG 1E9OA 4OLXH 1NCIA 4LIQL 4NCDA 3MCLL 4QCIA 1PFCA 1BZ9A 2NYKA 5MENE 2ZWKA 2WP3T 1A4KA 4HDIB 2D0HA 3HC0B 4QWWC 4OZFB 4UQAA 4YO0B 2ZOUA 1I9RH 5T5NG 1I1RA 3RPBA 2WWKT 4MHHI 1A6ZA 3CQFA 4YGAB 2ZX9A 1JWUB 3H2QA 4NZDA 2VLRD 4DSYA 2HG5B 2LHAA 1V10A 4N6RB 5M94B 4FXGC 2IQ9L 3TCXA 2H45A 3TTSA 3MTXA 3OBAA 3UYRL 4Y1AD 4N0RA 3IJHA 4Y8AA 3PWNA 4LMQI 1MAJA 4NQED 4KMQA 2EECA 3CU1A 4F58H 1SPDA 4F91B 3Q6GL 1CDJA 4ZZFA 1BQUA 2C3GA 2AP2A 3VFMA 4IBUA 2YEZB 3ECVA 4W1TA 1EH9A 4K7PH 1DO6A 2Z7WA 4YQXH 3WLWD 4QRUB 2MTPA 1KB5A 2WY3B 4YWGH 4JFDB 3UABA 2BOBA 1G84A 4DKEH 5CCHE 5GJSH 3VU2A 5F1SA 1VF5C 3IDXL 4MX7A 4K55A 3IWUA 5BCAA 1K6QL 4XO5A 2X40A 3FO2B 3VXQB 3FBQA 4YDMA 2YOCA 4I85A 3E7JA 2DD8H 1YAZA 2FB4H 3AADB 2NRDA 3QUYA 3GMMB 1XB8A 1BLNA 2EC9T 5IT2H 1ND0B 2NYZA 3C08H 4FQIL 4PJAF 5DJDA 4FNTA 5GISH 2CCVA 3EKCA 3PWJB 1XAKA 4JE4B 1FFOB 5LXGH 3OKDA 1C08B 1DBBH 1B6DA 1V8HA 3I02B 2OTPA 3L4ZA 1UB5A 4MXQC 1BXXA 2VLRB 2YK1H 4M7KH 4JFFA 4X6DA 3TNMB 4WTQA 3LPPA 2H8PB 3CLEH 3RVVD 1F8TH 4J8RB 4QHMA 2AJUH 1BMGA 3KWTA 4BFEA 1QVOB 3CVHB 1NCAL 3M17B 3R1GL 1MJ7L 1VEPA 4NQCE 4NQEB 4B9PA 1B4LA 3GIZL 4DEPC 3WDHA 5EIIB 3FO1B 1AYOA 1VFAA 2PXYA 5DHVH 3S7GA 3WFHA 5CD3B 4AKPA 1U8MB 3UTOA 4LRNL 3ZPDA 1TQBC 2F19H 4JAMA 3LTVA 1EZUA 5ID0A 3SZ6A 4GINA 2UXVA 4FTDA 2GK2A 4Q9RL 1OW0C 3NK3A 2DQJH 4PJAB 1NICA 3IMBA 1JAEA 4WNSA 1VLXA 2B7DT 5I1HH 4MS8D 1FCGA 4FYQA 3REVB 4ZMXA 3QJTB 1Q1JH 1WRFA 3ULVL 5E8OB 4ZTEA 5JO5B 4V1DD 3RTQD 1MRFH 1LEGB 2GJPA 3O3AB 1MFAH 4FFYH 4CVWA 4DZ8A 3IEAA 3ARTA 5KVEH 4NQXB 4ECNA 2CMRL 4DZBB 5E6RB 4HUMB 3NIDF 3UTZB 3MV9A 3PWPA 3MOAL 1ICTA 1CDCA 3QARA 3W37A 1ZPUA 5GGRA 1QPKA 3LIZA 1TU2B 3B2VL 3ZE0E 4E41A 4YSTA 2HZHA 5ICXA 1H5BC 5DHYB 1QZNA 2BOCA 3O2VH 4D3CH 3BKCL 1LMIA 4QAMB 4IDJH 5AVXB 3AUWB 2H41A 3D5OF 4YPGB 2C3XA 1RHHB 1XX9C 2G9HB 2QTEA 3D0LB 3P0YH 1HL9A 4PB9H 1VFOA 3NH7L 1GGCL 4UQ2A 2ODIA 1TJIH 5E8EA 1B4RA 2VAJA 3UPRB 5ILTL 5HGGS 1NCOA 4R83A 1GJIA 2WTOA 4JFXB 2Y36H 3OR7B 1WH0A 5JPMA 1KXQA 2YN3A 5KJRH 4AQZA 2IVFC 4OIIH 4PRBA 2F8XC 3NIDB 1FNGA 4J6IA 4D9RE 4V1DB 3VNYA 4I0PA 1UENA 3RTQB 1J1XL 1CYXA 1JZ3A 2GIXA 4HJIA 3R8BB 2EXYD 4HK0A 1G5GA 1X9RA 2FJUB 4PI0A 1UGKA 1D7CA 4QRRE 4GUPB 2ED6A 5MENA 2J73A 1YJDC 4N1HB 3SJVA 1E9OB 1TFPA 1WAPA 2A83A 3W1ZA 3V0WH 4AL8L 4QCIB 1HEZA 1BZ9B 2PTTB 1E30A 2WOYA 4NC1E 4GSQA 4B9ZA 3GYRA 4FQJL 1LK3L 4PYGA 3B6SB 4M7LL 3JV5A 4OSUH 3IXAA 1YMMD 3AS3A 1FE8H 1A6ZB 4LKXA 3BSZH 2AGJL 3EJYD 5CZKA 5GGTA 4JFFD 4H40A 3KHQA 1SRDA 4X5RA 5EZPA 5CMAB 2H47C 1BIHA 2F7QA 2JQAA 4EMZA 1D6EB 2FE0A 3PWNB 2UZPA 1OWWA 2VXQL 4ZTPL 5IW1A 5DYOA 3U7WH 2YD1A 2PXYD 4HT1L 3VFMB 2EVJA 4XVJL 3E9TA 4X6DF 2CHDA 4WK4B 5B1KA 2RACA 4GQ9H 5E03A 4CU8A 2PF6A 3WEMA 5EEWA 5ES4B 4ODSH 4GSDL 1KB5B 5I1LB 1VACB 2YD0A 2D7TL 4CC0A 3KLHD 3KLLA 5JIQA 2QVMA 2W8CA 5C2UB 3QRGH 5HGDA 4I9WD 4P46C 2OR9L 5EOQH 4X6BA 1V7MH 1XB6A 3E6HA 4MX7B 3GRWL 5H2BA 1RPUA 4XNQA 2ENPA 1YEGH 1FL6A 3ARWA 1T66D 1NL0H 4NRZA 3V52H 1KJ2H 1J8SA 5ADPL 1BLNB 4JB9L 4J1UA 4LDCA 2IPTL 5DJDB 1HKFA 5KVFL 4ZPTB 4GG6E 1YMMB 3UG4A 5HSFA 2WN3A 3OKDB 5D1XC 3NIFE 1UB5B 1HXYA 2VDRB 3GLDA 4JFFB 4X6DB 5D55A 3LRLA 4NQCA 3VXSD 3X1FA 2B1HH 2GCYB 2VSDA 4XCNA 1C12A 4QHMB 1O9ZA 3DUSB 3DGGA 4W9FC 4M1GL 3MV9D 3RIAF 4F8PA 1KBWA 5BUPA 5FHAL 2C5DC 2I5YH 3FTXA 4L8SA 2YRZA 2PPCA 3MRQB 3F12A 5E2TL 1VFAB 2H6UA 2CGRL 2PXYB 4FG4A 1YYLH 3SGKC 3WFHB 4E5XG 4LQFL 2JI2A 4JS7A 3F7VB 3QEQE 4CBPA 1OAYH 5DMKA 3VA2C 2WIIA 3MLVH 5DFVD 7CGTA 2MNWA 5L7XH 5ID0B 4G5AA 2IDQA 4B9GA 4JM2C 4PJFE 2GBUA 4LCIL 4ERSL 3NIGF 5IESH 1E5UI 4OCYL 1NOFA 4WI5A 3SPHA 3VD4A 4LLQA 2YC1A 4I18A 5ALBL 1CURA 4QTIH 4PEEA 4EDXA 1INEL 3X3GL 4UIKL 4UZGA 1QWUA 5F3BA 4XMPL 3FSAA 1F41A 2XKNA 2VC2B 4ZFQA 2E46A 1F3JA 3QQDA 3ZYOA 3RG1C 4NNPH 4I0PD 4YZFE 2AKRB 4PV8B 3U2SA 4UTAL 4MASA 2EVIA 2ZWZA 4FJYA 1I3VA 4XC3H 3WJJC 4DZ8B 3VXSB 4NFCA 3D1MC 5F6IC 1W2KT 5D72L 3ZZLA 3UAJC 1FO0H 1T4WA 2HP4A 1XF5B 2EC9U 5FDWB 1TPXB 4GKLA 5FIEA 3TOPA 3MV9B 4N1CA 2GEEA 1VJSA 4S10A 3U6XA 4JVPA 4PGJA 5L88L 2AS5M 2K6YA 3HZYB 2GI0A 3L9RB 4U6YA 1TETL 3MXWL 3OAYK 1DVFA 2YHGA 5GGRB 3WBDA 2R39A 4PLKD 3NIGB 4HBCH 4GUCA 5ICXB 2ZOWA 2AJXH 2BOCB 5FGCE 2NXZC 5J5EA 1R3HB 1YYML 3CN0A 2WPGA 2ZPKL 2X4OB 1BD2D 4UAHA 2K6WA 3L48A 4OR1A 3DARA 4PD4K 1EEUA 4UQ2B 2EYSA 3VMOA 1MAMH 3KWXA 3U6RB 4U2ZA 1QD0A 1CF8H 4LSPL 4YSRA 4M6NL 2ZUVA 1WT5A 2VDKB 5FA3A 5T1JA 3GXMA 1PNDA 1G6RL 4UT9H 1U3JA 3FF8A 1CN4A 4PRBB 5JW5A 4ODBD 4AEHL 2OM5A 3MREA 4GRWF 1KUMA 4JJHA 2AFNA 4UANA 4I3RL 4I0PB 2AI0L 2NY1D 3ZE1F 1T7ZA 2OFQA 1XTLA 1M57B 3C9NA 1J9CT 3ZQWA 2FGWL 3BRFA 4HK0B 3DOIA 3PGDA 4R7NA 5MENB 3MROA 5TE6L 4XP1L 3NMEA 4XZ4A 5AOMA 1AZRA 5FR3A 2A83B 2EP6A 4G6AC 2A9ML 2DQDH 1HEZB 2NSXA 1EXUA 3BUDA 4WU7A 1J88A 4G9DA 2O6DA 3L7FB 2JQZA 4R8WL 3QPQC 2UVFA 4ZOCA 3IXAB 4WEMB 3VQLA 3U0PB 4R7DB 4UCFA 3QFDA 4OJAA 1YEFH 3NCWA 3TWCL 1W0VA 5CCGE 2BFVL 1FBIL 1KTLA 3MBWA 4XRCA 3ARXA 4W6YB 5AW6B 1KJMA 2E7LC 1IQWH 1JGEA 1BD2B 3MACL 4OQ1A 3UL4A 4GRWB 5B4MD 1DBKH 4JQIA 3ZE1B 1FC2D 1TEGA 4HPYH 1TZOA 1XF4A 5DEFA 1CJYA 4ZTOL 1QI3A 1OSZA 1QRND 4BXSV 1BVOA 5AW0B 4HQQH 5HHOE 1NGPL 3Q05A 1XF2B 2L7EA 2YJQA 4NO2A 1UWGL 4JRXE 4BK4A 2YXMA 2NY1B 4IBZA 4NJAL 4E9WA 4O9HL 1VIWA 3E1ZA 5J6HA 3TBYA 5HGDB 4X6BB 3E6HB 1MIMH 1RAMA 2J12B 2DM4A 4EI5C 1NDGA 4XNQB 1FL6B 3L4CA 4AMXA 4NRZB 3CX5K 3WKML 1OLZA 3GJEA 3SOBH 5ACZA 4M1DL 4OI9A 1WGOA 4HCRA 4OQTL 1PQZB 5A2JH 3HB3C 2H0JA 5I19L 3A22A 2FBJL 2EH8L 4KQ0A 4KROC 1P7KA 1E9PA 3AXLA 4NQCB 2XZCL 4P2OD 4XVTH