2N3JA

Solution structure of the alpha-crystallin domain from the redox-sensitive chaperone, hspb1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
MQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock protein beta-1
publication title Structure of the alpha-crystallin domain from the redox-sensitive chaperone, HSPB1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 11
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2n3jA00
5LUMA 3Q9QA 4YLCA 2BOLA 3VQMA 1X5MA 2K8QA 4YLBA 2CG9X 4ZJ9A 2JKIS 2WJ5A 3AABA 3L1EA 3N3EA 4PCKA 3QORC 2RH0A 4YL9A 3AACA 3EUDA 3GLAA 2Y1ZA 4I88A 4M5TA 2N0KA 3GUFA 3L1FA 1RL1A 3GT6A 3Q9PA 4RZKA 4YDZA 4PBDA 1WGVA 1WH0A 5DS1A 2XCMC 5DS2A 4MJHA 2KLRA 3IGFA 1WFIA 2N3JA 2Y22A 1SHSA 2Y1YA 3QORD 2MNWA 4YE0A 2O30A 2KMWA 4JUTA 3W1ZA 2WJ7A 4M5SA 3L1GA 4ELDA 3QORA 4FEIA 4JUSA 3J07A 3QORB 3VQLA 1GMEA 1EJFA 2CR0A
chains in the Genus database with same CATH superfamily
2D03H 4GW5B 1DL7L 2A6KA 5JW4R 3HS0A 3Q7JA 4HA1A 3VMOA 2CG9X 4KBPA 4XBGB 2HAZA 1I4FA 1DEEA 2OZ4A 4TTDD 3DURB 1AQHA 4P5SA 1E27A 4L0YA 1KJVB 3FKUS 2APXA 3KJ4C 2EH8H 2GJ6E 2F53D 4RMVA 4I3RL 4ZTPH 1WAAA 4FKKA 2F53B 3IMRA 1E9PB 1JNNH 3GMPB 4Y8AA 4ALAL 2CBOA 1HE7A 2IF7A 1XF2B 5E9AA 2FLRT 3ULVD 2PXYC 3TPKA 1KIRA 2X53A 4XE0A 2FH8A 5E6UB 1QSFD 2Q6WA 2EE9A 3FUNA 3HC0A 1T5WA 4WNQB 3VI4E 3ZT6A 1GSKA 3V8CA 4R4NC 3GLAA 3VJ6B 4QI3A 1JGLH 1IC5L 1N26A 2H32B 4TSBL 4BCYA 1M1SA 1BIIB 5K59E 2DLGA 4MA7L 3H4HA 5IB5B 3C8KA 1U0QA 2QQNH 1FAKT 3D9AL 3G5XA 3OB8A 4A7VA 4CW1A 3DJSA 3FFDA 4J23A 2GAZA 4UT9A 2QLVB 2JKLA 1OAXH 2BHZA 5F1OB 5H2BA 4K7PY 4I5BA 4ZSOB 2VLKA 1GXEA 5IJCC 3NCXA 2EUZA 4FZEH 2A83A 4J2QA 4ATWA 4M7LL 1RZKL 3N43B 5GRUH 4U49A 5KSAC 1AZZC 1NCCH 2B1AH 5DWUH 2EE2A 3FC8A 5K9QG 1TXKA 4UM8A 3SGEI 5DUML 1W0VA 3KPNA 2EO9A 4HD9A 3FTUA 1AQDA 1XWVA 1KGCD 3EJZD 3O2DH 4HUWB 5K9QI 4LSQL 1XTMA 1FNGA 1IJ9A 3DHMA 3MGOA 1VGKB 2QGCA 3NJXA 5D1QC 4AE1A 1CLOL 1YPZA 4IS6A 5EU5B 3G04A 5AAMC 4N6RB 4LP4A 2J5LC 3IAPA 5EBLA 3ULUE 4RMQA 2NXYD 2X6UA 3TJHC 3OX8A 3QO1A 4P9ML 1KTCA 1GGCL 2NXYB 4FFVC 3HVNA 4V11A 5AVUB 4P5MA 3LEYH 4BBWA 3BKJL 1IAIL 3MV9E 3A47A 3WJLC 3UO1H 4UIKH 4KNUA 3OAWA 1BOYA 1FGVH 2WXOA 1WF5A 2X6VA 3O3BB 3IU4H 4HH9A 4JG0L 5T1JA 2Y4SA 3GMOA 2CO6B 1JPFA 1RULH 2D8KA 4RFEB 1NBYA 3IPFA 1KLUA 1BZ9B 4NUJB 3PJSA 4OCWH 5C08E 3M46A 4UAOB 1KLGA 5CCJA 2DLFH 4GBXA 4JO1L 3CJJA 4FFYA 1NFDA 3RB7A 2EXWC 2AK1H 4Q6IB 3L3IA 2XOTA 3CUPA 3NFSH 1VENA 4RWHA 4ZUWA 1OAXL 1OPOA 5HI3D 2YWYA 1JZ3A 5EC1A 4PTUA 2D7NA 2P24A 2CKBH 4HX1A 2XQ0A 3DSNA 1KJMA 1ET8A 3IE9A 2X88A 2MHAA 4P4RA 1CLVA 2GC7C 3P4NA 5ITFB 3MLTB 3UGUA 5DWUL 1BQHA 3HNSL 4NBYB 5B1JC 2X6MA 1WAAF 4N8VG 4RCAA 4BINA 5B38A 3GYRA 5LDUA 1LE5A 4HMDA 3PQYD 3I02A 1D2PA 1X7SA 2EE3A 3U7AA 3P11L 3VQ1C 3U7YH 2CCLA 2G30A 2KERA 3PQYB 5EOTB 2OXHA 4AQAA 1PKQB 2BIIA 2IAAC 2OMUB 2YMOA 1MJ7L 2Z93B 3DIVA 1EO8H 4XMKL 2J55A 4AKQA 4U1LB 4J3BA 3LRSB 1MHPH 2X9YA 3RVTC 1D6EB 2VUYA 5M95B 4NERA 3ECWA 3IRCA 1EUTA 2XICA 3OB0K 3TO4D 2CBMA 1R5IB 3CH8A 4LLQB 1UADC 1C08A 5IF0B 1JFQH 3SYQA 3V0AC 2XWXA 1RI8A 2SEBA 4OZHB 3LEYL 2CGZA 1Y07A 1ZLUK 4X7FC 1NGPL 4PRPD 1XR9B 1MCWM 4UIKL 1FGVL 2WW8A 4PRPB 5FDWA 2JTDA 4CVWA 3P02A 4QHMA 1I85A 2JELL 1W15A 2IAMA 3TN0C 3SGKA 4DUVA 4MAUL 1BEXA 1RULL 3KJ6H 4V1DE 5I8OH 4PJGE 1SBSH 8FABA 4HGMA 4QWWC 1HQRB 1RZGB 4AMWA 2DLFL 4HP5A 3TWYA 3ZDYE 2AKRB 2D7OA 5F7DA 3UTTD 3O3EA 4JO4H 2NCMA 4PTTA 3EBIA 3H53A 1EDHA 1OPGL 3NFSL 3UTTB 3X1EA 3Q3GA 2PETA 1I3RB 4U6VH 4WFFD 1YPZF 1OSYA 4WHDA 2BK8A 3GZOA 4HKJB 2P45B 3AG4B 3H9SD 4NIKB 1L7IH 4OGYH 3G5YB 2X89D 4ZO9A 5ADOH 4NNPL 3H9SB 3QQDB 1URLA 1IUZA 4E41E 2XDHA 3HUJB 3IJEB 2HSIA 4XAKD 5GGUB 4PJDB 4UYQA 3HNTH 2G2RB 5GGRY 3V79C 1TZOA 4ZMTA 3U7YL 2VZ1A 5DFVD 4HEPA 3P2BA 4R5VA 3ULVC 3GDCA 3CVHB 1IARB 3PP3K 2X41A 4NKDB 5TDPA 3WMPA 4QCIA 1NCUA 4NZ8A 3MMEA 5CINH 1AXIB 1JI2A 4E5XG 3ECBB 3ARYA 4KTDH 5DHVB 4GS7B 2YR3A 1QEWB 2Q9OA 4NIYE 2MIZA 2VB5A 1OOWA 4Q56A 2W88A 2BFGA 3ZRSA 4HUVB 1JWSB 1JFQL 2FIRT 4RMTA 3LHAA 3QUZD 3RWJB 2R51A 3QUZB 3DRQB 4WY7L 2WXIA 5MENA 1U8LA 1PZBA 2ZXQA 1ETB1 3GJFB 3WUZA 1OD7A 2IO5A 3KJ6L 5EIIB 1CR9H 1OP5H 3U46B 3ZDXF 2R1XB 3OPUA 4FQPA 3RVVD 5F88B 3D85A 1IM3D 3MPCA 4M9OA 2EYSB 4ABUA 1IM3B 5FUOL 1J5DA 2JJSC 3WEXB 3QULB 3EJZC 5A2CA 1MI5E 3RFZB 4BFFA 5DZPA 3GXDA 1RFDH 3ARZA 5LN8A 1ZDQA 5F7UA 2VDLH 4TL5A 3X2QB 5LCVH 1G7QB 3RHWK 4ZTOL 2E9BA 2EYTA 2PR4L 2NXYC 4OCLC 2PWFA 3CZNA 2DQGH 5CBAB 2RBLA 4X4ME 5DHEA 3U6XA 43CAB 5IMLA 4I3SL 4IEFA 4JBSA 3BZ4A 1AR2A 5DJYA 1QFWL 1LEKB 2O6DA 2ADYA 1MHEB 3DUSB 3MLYL 5F3FA 4WEBL 5KW9H 2A9BA 3ZHDA 1N2RB 3D3VE 5DC4B 3TYGH 5CGMA 3BEVB 3K80A 4LHUG 5TE6H 4JY4B 1B0IA 5CINL 3V8OA 2ZSVB 2I7SA 4XNXH 5ETUA 3L1OH 3L5WA 1DBKL 3N6YA 4UAOC 2GJ6A 2K70A 5C6PB 2IPTH 3GHBL 1LNUA 3DX3A 1LD9A 3L9BA 1A3QA 2X4TB 2YJQA 4Q6IC 1W0WA 5ES4B 1G9EA 3ULVL 5F9JB 2VSMB 1P69B 3LSOA 4AYDC 1TCRA 1MQ8A 2OYKA 3VI4A 4FE9A 2AI0H 1S5HB 5HI3C 3MRBB 1S7VA 1GAFH 2A9CA 3AG3B 3LPWA 3LS5H 5F8RC 1CI3M 2PW2A 2UZIH 3MRLB 5IQLA 3UZQB 4U3SB 2G75A 4NQXA 3I50H 4CU7A 1ERNA 3OKMA 4G8IA 2W80C 2Q8AH 1G4MA 5I8CA 1CF8L 4U7SA 3F7QA 4P2OD 4ZW6A 2J3SA 2VLJE 1AIFA 2WXNA 1PD6A 3C87A 4P2OB 1RFDL 2O61A 1SXZA 5I6PA 4NO2B 3HJ0A 3ILQD 5LCVL 3PWUB 5DHYA 3VA6A 5KVFH 3ARTA 4U4IA 4ZMPA 2D2CC 4PJAB 1FF5A 2VRAA 4NP4L 1WBZA 5C0ND 2YUWA 4JPKH 5KJ7E 5FHAL 2IG2H 2PYEB 3EH2A 4TL4A 1NLBL 3CFDB 4YC2B 3TO4C 3TXAA 3VD3A 3CHQA 3ILDA 1VFOA 3OL2A 3HPJA 4K3GA 5D72H 4WI4A 1OCOB 4JRYE 4Y9CA 4G72B 1Z9LA 3U79A 3SKNA 3TYGL 3BXNB 3NCYP 4F33A 3FONA 3H2WA 4QXWA 2P28B 1GYUA 1V7ML 2F1BA 3V4PA 3RY4A 2BSEA 1JUFB 5E2TL 1AANA 1BFOB 5IR1B 3V5HB 3L1OL 2E6PA 3H7BA 4QXGL 4JDZB 4FQHB 4K3HA 2NW3A 4HSCX 3NJVA 1X9RA 3UPRB 1BZEA 5J6HB 5B7FA 4GMSH 4F92B 1H15B 2F7IA 2IGFH 1BAFL 1CLYH 3QO0A 3E0GA 4LXFA 2DQCH 4AJWA 2BSSA 4KQ3H 4GW4B 4N28A 3BYYA 4Z7UB 4D7BA 4NZJA 3VRIA 2F19H 5IHLB 1F90H 1BHGA 1MCFA 3MJ8A 1Z9SB 2AI0L 5KVGL 2AHIA 2J6EL 1P1VA 3TPUA 5E70A 1XH1A 5T5NG 1QI3A 3ZTCC 5T5FA 4JM2A 4PB0H 3L5XL 2DIJA 4FQQA 4JQIH 2X3BA 3BPNB 2LU3A 1MFMA 1G84A 1PEZA 5JXEA 5LBSH 1BOGB 1FH2A 3GI9L 3QZWA 3MNVA 3MZTA 4OLUL 4YO0A 5F7NC 3PDOA 2A2QT 3LY6A 1NL0L 2UUDH 3MFFA 5HJGA 1IAOA 4HJEA 5DFVC 1OAJA 3KYMB 2QT6A 3E8VA 4PWKA 1NIDA 5DQJA 1XIWA 2B20A 3QHTC 1KTLB 4MNHA 4JQVA 4GS7C 5D7LD 5DMKA 1KMGA 1L9NA 3LPGA 4PD4K 3VMPA 5D7LB 1ESOA 1NEUA 3FT2B 4A6YB 4N0YH 4R2GD 4PBVC 3W3BA 4B95C 2IG2L 3I6KB 4C56E 1E40A 5HY9B 4R2GB 5HYSG 4XODA 1KN4H 1NKRA 5EDSA 3QUZC 4OLWH 3WFCL 3AY2A 1KXTA 1H3WM 3MRHA 2EADA 2ZCZA 2WMPA 4U6HA 2FLMA 1CG9B 3CN1A 3VXOB 3VI4F 1YVLA 3DJZA 4HWUA 3VU1A 4AVKA 3WTXA 1ZJBA 3OVUB 3M17B 1FORH 2VXQA 3B9KA 3X11B 5KVFL 3EF7A 3UZEA 5E1AB 3NA4A 3VGAB 1YN6B 1MNNA 4MA8L 4WU7B 3RVVC 1ITCA 1TVHA 3V5DA 5K59F 1OO2A 1S9VB 3C8HA 2CLRA 3O2WL 2C4FT 1JHKL 4GIAA 4MFHA 4OCYL 1CLYL 4PJEB 5IT2H 1INQA 3RZCD 3EH3B 5SV4A 4KQ3L 3HG2A 1A3LL 3RFZC 2DPKA 3N0PB 3ZDZE 4HZLB 3ESNA 4ODUA 1ZANH 4GO6B 2F19L 4MMZA 3RZCB 1EAPA 4WJKB 4H20L 3QDGE 3VXTA 3QI9D 3U4KA 1ZTXH 3NFPB 3RURA 3VFVA 4LDOB 1JWUA 2EC8A 3S97C 3EDFA 4KNSA 4V1DA 3QI9B 4PB0L 1HH6A 1MLBA 4DQAA 4HOWA 5IFHH 1M9WA 4PGEB 3CQPA 4CDHA 4AW4A 5B1AB 2NY1D 5IEHB 3IMTA 4H1LA 3T3MB 4MXVE 3CDCA 4DT2A 1ZWIA 4XXCC 4MWFA 4DERA 5AW3B 1PBYA 3ESUF 1O7DE 4HUUA 1TEGA 4CBZA 2WCPA 2WSDA 1Q1PA 1NBVH 4AMKL 3CFEA 3MXVH 5C6WH 1KCSH 5BOJA 2G3ZA 1A47A 2IBGA 1NUGA 1OCWH 1WD8A 2AEIT 4GYBA 1AS6A 4PV8B 2LFEA 3X14A 3WL9A 2XN2A 1QZNA 1N10A 2ZUUA 5C3TA 1NKOA 3K6IA 2HRLA 1Q72L 3P9LB 3RWCB 1XR8A 3LN5B 3WIAA 2HWZL 4I0PD 3RUGB 1NEZA 1WD9A 5KZCD 3D0LB 2XY1A 1D6VH 1MJJA 3CVHL 3LTVA 4I0PB 1FVCA 5F9WB 5KZCB 2J1XA 1VGEH 2CGRL 1G0XA 4GRMB 1OAKL 5BVJA 3A6BH 5DD5H 4LNRA 4OTXH 1CD1A 4XNDA 2CKNA 1IT9H 3WY1A 2A7BA 1NGYB 4JM2F 4X6BA 3T0XA 3OKOB 3CZKA 2AK4E 4ZUVA 5L88H 2VQUA 3LNIA 4YSDA 4EPSA 4G7SB 1A1MA 1EH9A 3NK4A 3ZE2E 3IYLW 2OJ1A 3JZYA 4P2OC 3X3GH 4X7TB 4UB0H 3VXNA 4A7TA 3BVTA 3M8OH 3SHSA 1LO2L 2NNAA 1CU4L 4NNYA 3WAKA 2HJFB 3TVMA 3RWDB 4L3CB 1ZTXL 3ILQC 4LEXH 1W72A 5C0BD 4GAGL 5C0NC 2X4OB 4HAGA 4NENA 2HX9A 4YC2C 1B90A 5C0BB 2OMYA 1CUOA 2A9AA 2FJGA 2V9RA 4XBMA 4N1EA 3KPRA 4IRZL 5BOPA 1MVFA 4Z3JA 3MV8E 3Q05A 1ND0B 4HLZG 2AV7A 1CYXA 4WVRA 1MI5A 2PTTB 2Y7OA 1JXFA 3I3DA 4MNGA 3AT0A 1U3HD 1KTDB 3ESPA 3D50A 1MVYA 5F6IB 2P8MB 1DLFH 2BVEA 3H2QA 3IJ7A 1U3HB 5DSCA 1NBVL 3C09B 2DH2A 2ROYA 1OCWL 3QA3A 1BJMA 1SMOA 1T5XB 3OKEB 1DJGA 3IGFA 4MJJA 2VDNB 4QOKD 5FGCE 3MROB 4ATTA 5HYQA 4QOKB 4X4MA 2EDXA 4M5SA 1WIOA 5CJBA 4DW2L 5ICYB 3WFDL 4YHLL 2ATPB 2W1NA 1A21A 4I3GA 2H4EA 5JW4Q 2OBGA 3KPLB 4RGMB 2GSIA 4ZMLA 4MD0A 4AM0A 3JVGA 4L4TD 2IV8A 4BE6A 3EYVA 2FJHA 4YLQT 4Z0XA 5K9JL 1ZV2A 3D3VA 4MQTB 4L4TB 4HZAA 3T0AA 2VMCA 1JL8A 4JKWA 1UH3A 1F1GA 5DD5L 1CI5A 4JZOA 3QJFB 3MUJA 2AJ3B 2CCVA 4X9IA 3CMGA 1MUJA 1J9TA 2Q20A 3BPNC 4PJGF 5BV7B 5IQ9B 3QNYA 1XH0A 5E1QA 4UDTA 5T1KD 1D9KD 2HA1A 2NPLX 1ETA1 3ZDYF 2BM3A 4QGYA 5DEFA 4AIXA 1D9KB 4XX1E 1CDGA 4M5ZL 3ZTJG 1JGDB 2H1LM 3GSQA 3NQKA 1BZ7A 5D2NE 4UB0L 2XQYA 3M8OL 4MKTA 2WUCH 1FZKB 1BW8A 2UY6B 3IDYB 2X2IA 3DBXA 5GGVY 3GTNA 1EHXA 4YJZL 3KLSA 1YEHH 1JRHH 4P5TB 1RJCA 3HR5B 1UACH 4LLMA 1V7NH 4R2GC 1YEIH 2OMTA 3LKSB 5B4MD 4PG2C 5D1XD 3FN9A 2VLJA 4DO5A 4OZIE 5DMJB 3O41B 3LXBA 5DYOA 2HFFB 4X42A 2DMKA 3MJGX 2YWZA 5D1XB 4N2MA 3ULSB 1DLFL 2EDLA 4QHPA 3H42L 2CRYA 3BKCH 1E4XI 4XN1A 1MG2C 1T7XA 1JZ6A 3ZO9A 5DT1H 1TO4A 3VGAC 3P3RA 4HIIB 4K2UH 5C9JA 2ZKWA 2WGXA 1KEGH 1AGFB 3BVWA 1P7QA 3MRDA 2DKSA 1QI4A 4HIJB 5D1ZD 4EUPH 2OYMA 3A4DA 4JRYA 5D1ZB 5BZXA 4FTDA 3RZCC 1OY3B 1FG9C 2XV2A 1NCGA 1AKJB 2ZNXA 3LKRA 4X4KA 3MBWB 1JHLH 3G7TA 1DQVA 3WE6B 4YXKH 3QI9C 4FQCL 4N2BA 4EOWL 3RWIB 2NNRA 2XA3A 4ZUUB 1TO5A 5I8KH 1PQZB 3AT9A 3CN3A 3MNZB 1PAMA 3KPMA 4HQQH 3AZUA 4O5LL 3PHOA 4Q9RH 3NIFE 1KZQA 2ENYA 3QJOA 2EUXA 2Y7QB 1I8MA 1MHCA 2EIZA 3GK8H 1BEYL 2D3JA 1UJ3A 5DA0B 3NOIA 5DK0B 1J9SA 5F7BA 2IWFA 2X70B 1C5CH 1CL7L 3QPXH 5E4EB 1DQQA 3TFKD 5HGHB 4DNLA 4JFHD 4AQEA 4GW1A 1RUMH 1CN4A 4NRZA 1V27A 4HIHA 4CC4C 4AZ8A 1ETJA 1MCKA 1YEHL 4MJIE 4N8VB 3SGJA 3VFMB 1YEIL 4NO3A 1E5YA 3MRKA 4JG1H 3MRQA 3F84A 1WK0A 1JNLL 1Z1WA 4I0PC 1A9BB 5F9WC 3RILA 1ETZB 3DO7B 4CUCA 4EIUA 3TIEB 2X1XR 3QUYD 4PJBE 3BGFB 2E75C 4CBPA 4ZMYA 4HWBA 1JPSL 3DGDA 4PAZA 2BSCA 4TVPH 4OSUL 5CJOH 3O2VL 1CIUA 1F97A 1JV2B 4HJJH 5LGJB 4MRCA 2OTUA 4C56A 4KFZC 4OF6A 3DDFA 1LE9B 4NN6B 4AVHA 1SJEB 1II4E 4G1EB 4X5RA 3RTQA 1BJ1H 3S8GB 4PJ5A 3S4SA 2OMWA 3FULA 3LXUX 1YMME 2R2BB 5BXFA 3LQMA 3MLSL 3BUIA 1Q9LA 1JHLL 1J05B 1A0QL 4YXKL 5L2JB 3VQMA 4TLKA 1GZHA 2YBGA 5T33L 3NSYA 5I8KL 4HQQL 2BVUA 4N2CA 4NN5B 3W0WE 1GVIA 3S37X 5BW7A 4PMEA 3DIFB 2HN7A 3LH8A 2F5AL 3MRCA 3I9GL 4PJCE 3WIFB 2DI7A 4PCSA 5C0DA 2G60L 4UUJA 4CRPA 1F6AB 3OXRA 2BW5A 4HJ0D 5F6IC 3IETA 3FUKA 2XBZA 3OZ9H 4YBLB 4A2LA 4WU5B 4RWYL 3MI6A 1U3HC 3GBDA 3UCQA 1M7XA 4Y4FA 2F7QA 2ARJA 3C09C 3QFDB 4J6RL 2WO2B 1PD0A 3QPXL 4ZFGH 1XX9C 4PGZA 1FGNH 4ORGA 2ZXBA 1LILA 2XBDA 3HG5A 1ED3B 1Q0XL 1GY1A 1JNHB 3FU5A 1UXMA 5F72S 3W37A 3V4UL 1DJWA 1EGJA 1UD6A 2EZ0C 3BFWA 5C0RH 4HH8A 4JG1L 3IXTA 1J8RA 4RGMC 2R8SH 4FMKA 4YUEL 3VFUB 3I3EA 1C7SA 5IQ7H 3UJJH 1NMBH 1XB6A 4M02A 2ZKHH 4L4VE 5F0MB 2ZE0A 4GSUA 2BMKB 1IJNA 4DESA 4E5XB 3ARPA 2UX7A 3KYAA 1XH3B 3ZVVA 3QYCA 4WV1A 4JREB 4OBSA 4HJJL 2EDJA 5BV7C 3FSOA 4ZW8A 5ABAA 2YK1H 5A6MA 1MCEA 1JZ2A 4J3OH 4Y2OA 4D8PA 4QRPD 4OLXH 2NTFA 3DARA 1T1ZB 1TNNA 4NFCA 4B9GA 1D9KC 4QRPB 1QFOA 1EVTC 2O6PA 4JZJA 1XV8A 3MRRB 3K0WA 4IJTA 4K9JA 3FZUD 3QG7L 2J8UB 2B7DT 4PRHE 2BHFA 4H44C 4Z7VE 1RUKL 4FFZA 4OD2A 4ZTEA 3ARXA 3O3AA 1L9OA 1ONQB 4G6MH 3LB6D 2BVQB 4L23A 3MRPA 1U8NB 1HIML 2P1YA 2LLNA 3IDYC 5FUZL 5CEZH 4P57B 2DM4A 4ES9A 3SDXB 5IW1A 1M3IA 2HTLD 4P46A 4RGOH 4YX2H 1OAYH 1BG1A 3PL6D 4HSAC 4P5TC 2R0KH 4WKZA 3K4AA 2AK4A 4GAJL 3EO9L 3PL6B 2Z64C 1XH2A 2UV3A 5E5LA 3SKOB 3FUEA 2WIMA 4GXUM 1NCAL 5JHLL 1K4CA 4RNRB 3KE0A 4PSRA 4UTAA 5B4MC 5D1XC 1J86A 5IVOA 1SUJA 4OUOA 3OZ9L 1RHHB 2B8OT 3LXAA 1QW8A 2MEJB 2IAND 1D3CA 4OZFG 4ZFGL 5D9SA 1YMHA 3GMNA 3JYBA 1H19A 4AG4L 4EQ3A 2IANB 3O9WA 4L1TA 4XOCA 1XCTA 5LBVA 2HMID 5GGTL 5J9PB 2B16A 5E2JA 1LXMA 3TTSA 5GS3A 2C9PA 2YPLD 3IU3B 4AL8H 1F4XL 2BDNL 2IH3B 4LPXA 4YDJB 5C2BH 2YPLB 4AKOA 5D1ZC 2NX5D 5I15H 1WFUA 4LHUD 5J89A 4HK3J 2J1WA 1NJ9B 2ZKHL 4ZO6A 2NX5B 3RJDA 3I6GB 4KY1L 4LHUB 3S7GA 3TBTA 5MERB 1NKGA 2D31B 4PVNA 3BZEB 3OGCB 1GZPA 3I6SA 4NI6A 1I9IH 2EKSA 2VDNL 4HKBB 2WM0A 3C5SB 1GYCA 1QTSA 3RQ3A 1A7QL 1KCKA 2YK1L 3SBWA 5FYKD 4QXUL 5FKPB 2IDQA 3RNKB 4OLXL 2R4SH 3WKYA 1T1WA 1PZ3A 3SPCA 3D1MC 3Q9QA 2XKNB 1D7CA 2X6BA 4IRJA 4U1NA 3R7RA 1BX2A 1I9JH 2FO4B 1L9RA 3ZDZF 3EH4B 3F58L 3HE7D 4G6ML 5E4EC 4P04A 1PLCA 2RQEA 3UP6A 4C4UA 3QEHA 1BM7A 3HE7B 2K1MA 4R96A 3AXLA 4F80A 1YHPA 5ESVB 3TFKC 3U6RA 3E38A 1OAYL 3QHZH 4XN8A 3P9MB 4NCC2 4NPYA 3VGHA 4HS8H 4HZ1A 2H6PB 1H3TA 1IGMH 1SF3A 1ULVA 1U92A 3S34L 1K3ZA 4MXVF 4YAQA 4P9HH 3GBNH 1A7NH 4UIMA 4FNTA 1U9KA 3B3IA 3CX5K 5D2NA 4AYFB 3BGFC 1HDMB 2Y7MA 4ISVB 3IKCB 3QUYC 3MHZA 3O2DA 1DBJH 1HWHB 2OQJB 3WCYA 6FABH 5JPMB 3GT6A 4JO3H 5I71B 2PCPA 5KBNC 2CJ3A 4HALA 3CVCA 1OE1A 3HVDA 1KTRL 2ZXGA 4JKMA 2J6WA 2CHXA 2L04A 4NN6C 4AL8L 4KTYA 1HXMB 4BH7B 2LR4A 4FEIA 5KVFE 3TM6A 3IGUA 2AFNA 4OZIA 3KBHE 1UTDA 3AMLA 4OZHE 4YDVA 5I15L 1RURL 3B3BA 3KYKH 2NSQA 5CF3A 2C1PB 2VLLA 3ISRA 2UUDK 4IOSA 1S7WA 3KDMB 3WTSA 3ASWA 3OKLB 4GQPH 2ARWA 2HT4D 1E4HA 1WH0A 2FX7H 3D69A 2A6DA 2D4FA 1CBVH 4NN5C 5F44A 1ZLSH 1CC3A 4X83A 4NCDA 2EO7A 4XPGL 5JHAA 2R23A 4JFED 1SYSA 1ZVHA 5EUOA 4JM0A 2WQUA 5FO7B 3ZE2F 1WEJL 4LKXB 4N0UB 5E99H 1I9JL 4JFEB 1VEMA 4IYKA 1M6OA 2NR6A 4YBLC 1FA4A 4B9JA 1AHKA 3VTMA 1LP9A 4XMPH 3X12A 5F0LB 4HJ0C 4XC3L 2CO1A 1PYWB 2VN5A 3GIVB 2ERJB 2FX9H 4AX3A 4BEIA 5B1CA 1KCUH 4MXWL 3QHZL 2E59A 4WHTA 2D9QB 4N22A 2CKBA 5DC2A 4KJWD 1IGML 2R27A 3H9SE 1HYSD 3MCLH 2FGWL 4L2LA 3S8FB 2MTAA 5IG7B 5C86A 4P9HL 3U7WL 5I6MA 1A7NL 2YLKA 3H3KA 4XCNA 4OBRA 5KBKA 2FR4A 3V0FA 2VR8A 5BRZD 3Q8BA 3FB6A 3G5VA 1ZT4A 4W68A 1NOAA 5BRZB 2A77H 2WNXA 4JREC 4JO3L 2ZPKL 1X6LA 2CAKA 5GGRB 3V55A 4MJIA 4P5KB 1QTYT 3MOBL 5HYSB 2YD5A 1AMYA 3BDYL 3WUWG 2RCSL 3MODH 1M71B 2Q3AA 4JDEB 2FBOJ 4HJTA 2IQAB 2H1XA 4P0DA 5T1DH 3WDJA 4PI0A 3MLRH 1MCPH 2GUOA 3KYKL 4JO8A 4PJBA 3IDIB 2EINB 3FZUC 4N2KA 3F12B 1U8PA 4R4FL 1ZSDA 1TTBA 2F54E 3LB6C 3O4OB 2EVHA 4WW2B 2EDRA 3P73A 3QXTA 1XAUA 1FL6B 1OANA 1SF5A 2BSDA 2HTLC 2VMJA 4GUQA 3PL6C 2CDFA 1YECL 2H9GA 1VPOH 3AY4A 1ZTXE 3WGUB 4DGWC 1ZLSL 2DIAA 2RQ8A 2WUBH 3QIWD 2IH1B 4PH8A 4PJ9D 3L3OB 2X0WA 3HC3H 3QIWB 2EEFA 1N59A 3ZZ1A 2R56H 4PLKD 2NY5H 2LGNA 4PJ9B 5K9OB 4Y16A 2ZX6A 1NGZB 4XMPL 3CDZA 1JZDC 4FHBD 4XVTH 3TA4D 3T0VA 5KBMA 4JN2B 1NWOA 3K72A 4QDGA 2FX9L 5ELIA 5HYJE 1N67A 1WHOA 1WTLA 1UURA 3GSUB 5ESQB 3E9UA 1KPVA 2OXGA 1NH6A 2HMIC 2JCCE 4Z7OB 1BM3H 5E4AA 2I26N 4KKAD 1JD9A 3CU1A 2AJYH 3PG2A 3UPCA 1CE6B 1F13A 3BZFA 1Z0NA 2O93L 4J3VA 4Z7NF 4FA7B 4YDIL 4OZIF 4JFFB 2XFXB 1O6TA 2V8LA 5F9OL 2WLHA 1NIAA 1DZ0A 1Y18B 3P77A 4WFGD 4OLVH 3PP4L 1ZV5A 5DTFA 1HKLH 2P42B 4W6WB 5EO9B 2QHRL 3QIBD 4RA0C 5JHBA 2GK0A 4LVOB 3QIBB 2BIMA 4OT1H 3BH9A 2NLJA 3RKDD 2G2NA 4OCSL 3J27A 1X6NA 3MODL 5EU6D 1UWGL 1D5BA 5E1HB 5EOQH 5F1IB 1FFNB 3BPCB 5EU6B 3LKQA 1U36A 2BCKB 2R83A 4L4VA 1CQYA 2DDQH 2OMXA 4U6YB 3HFFA 1WCBA 4WFED 4AYBA 4DGIH 3HJEA 3RB5A 3TIDB 3HE7C 1JVKA 3UTSD 3MQIA 4NYLB 3RPKA 2PYFB 3UTSB 4HPYL 5CUSL 4ONHA 1WYJA 4U1IB 4ES8A 2ZUXA 2VNCA 3MV7A 3QS3A 4LCUB 3VFOB 4UOZA 2ED8A 3L9YA 3BDBA 4YSRA 4XVSH 3NIFF 2WUBL 5B3JF 3UERA 5HJ3B 4N9GA 3HC3L 3FFOA 3BPOB 4BSVA 4Z7VA 4PRHA 2R56L 2VL5A 3FQRB 2ZOLB 5GZOA 3H54A 4M7LT 4XVTL 3AROA 4DKEL 5JPMC 1OSPH 1U95A 1PAZA 5I71C 1F2XK 1G0DA 3ZIYA 5JA9A 4EKXA 1JF1B 1QWHA 5D7KE 3L5IA 2QPDB 5IFAH 1H9VA 4J39A 3RDTA 5BRQA 5LCVA 3CZUB 1BM3L 5EV7A 4XO3A 3RU8H 4GRWB 2AJYL 1BVKA 2PYEE 1WC7B 1KV3A 1LDPL 3TYFA 1HHHB 5DK2A 2ZONA 1OE2A 4HT1H 1FFOA 1RUPL 4PJBF 3VE0B 1BXAA 3FQ1A 4J1UA 4OIIL 3DXAD 3O0RH 3IJHB 5TK4A 2Y5QA 2WP3T 5IVZB 1QMUA 2A6IB 1C16A 1FZOA 3DXAB 4JJ5A 1OB1B 3UP1A 4NJAH 2HT4C 5I17B 4G1MA 2P8LA 1MCIA 1U6AH 3HZVB 4P05A 4WZ9A 2F8VA 3GNMH 5LKNA 1JFHA 1BBJB 4OGXH 5EOQL 3ARFA 4LSSL 3N5AA 2XG5A 3FRPA 4L8BA 5K39B 3ZHLA 3AGVA 2P5EA 5DRZB 3SBQA 2ERJC 4TPRL 4DKDC 1ZA3B 1FFPB 4I2XA 3L3KB 4J3WA 1KYAA 1TCMA 4A2DA 1I1AD 4FI8A 4JB9H 3ETBJ 2X05A 3VVWA 2ICCA 3GSRB 4UTBL 4G71B 2ITDB 1I1AB 1P84J 3MREA 4M5YH 1DBAH 1CGXA 4IBSA 5C09D 2I7OA 3M1BA 2NUPB 2A73A 4KJWC 4PJCF 3QJVB 5IB1A 1HYSC 2EKJA 3FQ2A 1XL4A 3ZRCC 2EDOA 5C09B 4EI5D 4I9WD 1J8KA 1I7RA 4ZFOA 3TBCA 5KYYB 3K5RA 3E6HB 4EI5B 4W9HC 3APDA 4JRXD 2WQ8A 2EXSA 2EIBA 1KEML 1UUSA 5G5DA 4JRXB 2MQCA 1BECA 4FGMA 4GAYB 1DVZA 4ZDHB 2J88H 2R69H 4Y1AD 1A6ZA 2QKIB 4PVMA 3RU8L 3CVIH 5DEGB 4FQ1L 4PV9A 4Y1AB 2OFQA 5KVEL 4UOW1 4IIZA 1HZHH 1BREA 2F74A 2ESVE 4KUZH 1UM6L 5AZEL 5CJQL 1RIUL 1R5VB 5DD6A 3O4OC 4N87A 4WW2C 2IPKA 1HAWA 3O0RL 1KENL 2DKMA 5HGBB 3ULVF 2EDBA 1DANT 1J8SA 1BD2D 4NJAL 3IGAB 4DP4X 1KIUA 2X38A 1BD2B 4I0KA 5FGCB 2JI2A 5AB1A 1R9FA 1P5VA 1CURA 1KYFA 5EEZA 2YQGA 3P4MB 3U9PH 3L3OC 3QIWC 4DWHA 3WXVH 3BEWA 1T1YA 3WIIH 4PJ9C 3FB5A 4Z7VF 3ARVA 4KROD 4F9LC 1CFQB 2O5ZL 4PLKC 3O0LA 1E50A 1WITA 2DLIA 3C6LB 4KROB 4CMMA 4IKIA 5D93B 5DRWB 4KRMB 3UACA 1A5FH 1AZUA 1NINA 1TITA 4JZNB 3QORD 4PJHB 4ZFZA 4DKFH 3L3GA 4M5YL 5LGHH 1AE6H 5TF0A 4KKAC 3QORB 2JJVA 4JQIA 3U9UA 4Q97A 2IOOA 4PY7B 4UINH 5LUMA 1QKZH 5LBSA 4NSKA 3T77B 2AEPH 2E7LC 1XGYH 3R4RA 4M43H 4AYGA 3N85H 1SJXA 5ILTL 2YMTA 3ZQWA 4WI0B 5EF0A 5IJKC 4XPTH 5KSBB 2H1PH 1UCBL 4LVOC 1A2YA 3DOSA 3QIBC 5HDRA 4HS3A 3F04A 5J8OA 2HUHA 3WTYA 2DJ4A 3DPDA 4MS8D 3LH2L 4TVPE 4F7MB 1A7PL 3FO1B 1KCVH 1D5XA 1I7TB 1NDMA 3RKDC 3UGXA 3ZOAA 4R26H 1KPRB 1HZHL 5D2LB 5D4HA 5FYKU 2X4QB 2OMVB 3BMVA 1RP8A 4KUZL 4HK0B 3SY0A 5IGXH 4HCIA 5TQ0H 1K3IA 3A22A 3E6FA 4XOBA 2DLEA 4OZ4B 1NWPA 2RD0A 1V05A 4O2CA 5EFIB 5IVXB 3FQNB 4R7XA 3UBXI 3V6FA 1JK9B 1J0KA 4YPJA 2VC2B 3AT8A 4X8XA 1MWAB 3WTWA 3FCSA 3WMSA 5F2FA 4X5WB 1N5AA 1EEZA 2BNQE 3U9PL 4QRUB 3AG2B 3BPOC 3C5JB 5E8PB 3WIIL 3VYPA 1MRDH 3O45B 1KJ2B 3LIZH 2DWDB 4NM4H 5IMKA 2F54A 4N0FB 1MN4A 4PGCA 5F3HB 4BXSV 1JPTH 4UBDD 4X6EB 2LU4A 1J0YA 3V0WH 4KX9A 4R7VA 3WNOA 4K71B 7TAAA 3MLXH 3S5LA 1MQKL 5INCA 1NIEA 4X6FA 1NCDH 1RLWA 4DVRL 3SE4C 2V7HB 2YC1B 2HLAA 3VI3E 3PUCA 1KYOK 5LGHL 4ZPVA 5I1KH 3QNXA 1AE6L 3T2PA 1VSCA 2J2ZA 4QRTB 3CXHK 1NCJA 5IMMB 1CYWA 5K1JA 1QKZL 3K71A 2UY7A 1EIBA 1XGYL 1CLZL 3N85L 1IGJB 1UM5L 4RGNE 4IMLA 5AOZA 4JRLA 4JFPA 2E7CA 2IQ9H 4J4PA 3NRQA 3LDBB 3AU1B 4XPTL 4R0LA 4KV5E 5HYJA 1JXKA 4BUGA 3WJMA 4KO5A 4Y5YA 2D4DA 3TO2A 3TCLB 1Q9WB 4JANB 5T3XD 1ZVSB 4FXKA 2JCCA 4TYUA 3S48A 3WGVB 3LRLA 3ZZSA 4TQIA 1T89A 4XCEB 4AV5A 3G6DH 3MUGB 3QQNA 1KNOB 1UOKA 3BAKA 1A9VA 3G08B 4NJ9H 4OZHF 5E6ZA 1S3KL 3NZUA 3DSFL 4QLWA 3QDME 1H6UA 3DGGA 2VISA 3GJEA 5TQ0L 1PZUB 1QLEB 1T66D 1FN4B 4JPWH 1P4LA 3KLAB 5HHOE 3RNQB 3U36B 5CS7A 3ZIMA 2YKLL 3CFCL 1FL5B 3T04D 2XNAB 1ASOA 1I1AC 2XN0A 2ZXDA 4FZ8H 4YSSA 4PPTA 4GP4B 3CK0L 2ADIB 4JE4B 4PD4J 3OKDA 2IJ0C 4LLVA 1DJZA 3T0WA 5FB8A 5DJXA 4JX0A 3KL5A 2W0FB 5I23A 3VD4A 4Z8FH 1MRDL 4UT6H 1GA2A 4EI5C 3KNBB 3WEOA 1SJVA 1T2QL 4D9QE 4XWOD 2WBKA 2CBTA 2J8OA 3HZYA 2OMBA 1JPTL 3HTLX 4JKKA 3ZE1B 4K0OA 1MFEH 3T65B 1J5OH 4GIPD 4YMPA 1HSBA 4G8FA 4N68A 5FECB 1NCDL 3ARGD 4JKPL 4J8QA 3FCTA 4BQBA 2QKIC 5D6CB 1IBHA 3ARGB 3F7VA 4IGBA 3QXWA 1OW0C 4FG6D 2FB4H 3VXQB 2CLVB 3CDGA 2Q8BH 4HUCA 3PV6B 2ZXEB 2QELA 1NSNH 2JKSA 3MV11 4NUMA 2YEZB 4NAJA 4OZFB 1DDTA 1M7DA 5ID0A 2ZYRA 5KYXA 3OKNB 3MCKA 2X4SB 2V3DA 3MRNB 3PGFL 3HB3D 4LHJB 5KUMA 3VFTA 2LABA 2VDQB 1TUPA 3KHQA 1T7ZA 3HB3B 5H94A 3GGWA 1WGOA 2C3WA 2Z34A 3U0PB 3N91A 1IAKB 5BQ7B 1FUNA 2P5WD 3GMRA 5F8QC 2B0SL 1T0MB 3HRZA 1I1FA 2P5WB 1LWRA 1F86A 1MCCA 5SX5H 1JDCA 4D2NA 1E65A 3EKCA 3T4YB 2BZCA 3C6LC 4KROC 5D93C 2CD0A 1MFCH 3UTOA 1DTUA 4BSWA 1SN0A 4G59C 1IGCH 1B4LA 4XBEH 3EH1A 3GM0A 4NDMA 2A1WH 1BZDA 2DLTA 4M8RA 3KM1A 2XG4A 3LMJL 1A6WH 2BLFA 5CD3B 1C12A 2QLYA 4ZJ9A 4HEPG 5IB3B 4RLDA 2BP8B 1AZVA 4DGUA 3QORC 1MCLA 3M88A 1FO0B 3Q1SL 3KLKA 4WUUD 2IV9A 3CMOL 2OP4L 1IBYA 3O6FA 5JW3H 3VG0L 4Z8FL 4PV1C 1MXDA 4WUUB 3T0DA 1ZLWK 5JOFB 3CFKA 4OF7A 2L7JA 1GC1H 2UZXB 1KG0B 2O5NA 2Y24A 3QWRD 2N0MA 1MFEL 4OLZL 1J5OL 1CFTB 4G8GE 4ZMQA 5EBMA 1P9MC 1U41A 3AGWA 3UTPE 3L9RB 4YGVA 4BK5C 1MRCH 2JCCF 3U25A 4CN1A 5IKCB 1EO7A 2HG5A 1OV8A 3DX8A 1UXSA 1HH9B 2Q2LA 1UD3A 4UQ3B 4O51B 2FB4L 4MS8C 2V5TA 4L3ED 1MFAH 4XWGH 5IBTH 4D9LH 3FTWA 1NSNL 1TTRA 2UWEA 3BO8B 4L3EB 1G9HA 4FHJA 2VXVH 4IKNA 4OB5H 4XXWA 5ICZB 3MR9A 3QISA 3MV01 1P1ZB 3IJYB 4JR9H 1BXXA 3UEZA 1U58B 4GXUN 3KPSB 5TE4H 3NZHL 4G83A 4YE0A 5E56A 4ODWA 4WWKD 4CSPA 4ELDA 5GGSY 2ZCLH 1N5YL 1I8UA 4NQCA 1AD0A 4S1QH 1KZYA 4XHQA 4D0CA 5JA8B 4WWKB 5FS5A 2APSA 1Z9NA 1HJBC 1WISA 3WKMH 4AQZA 5I66B 4D0DB 1CS6A 5TPWH 3GI8L 4LEOA 1HL4A 4NQVA 2CRZA 2Z1PA 4XP9H 1A3RL 1KCRH 4Z3IA 2ESVA 4G9FA 3RIAK 2QR0A 3VCLA 1LO0H 3DVNA 3FT4B 1OWWA 4EUPA 2QQKH 5A2KH 5E5UB 1ANUA 1AKPA 1IGCL 5AKTA 2DJMA 4K71C 1W2KT 1RAMA 4UBDC 2ADFH 2XZAH 3GM8A 3MZGB 2VWEE 2GY7B 3FU7B 3IXAB 4EDWH 3EJRA 1NOFA 4JHZA 2XTJD 1FYTE 4GQ9H 5FHBL 4UZUA 5FKAA 1DUZB 4DPCX 2XTJB 3ARED 5C0FA 5JPNA 5B3NA 5I1HL 4N0RA 5KS9E 4O2FA 3SEPA 2VDOH 3HNVL 1YNLH 3F6IA 3AREB 3GLDA 4ODSH 1GGBL 4PR5B 2CGYA 3ZPDA 3OR6B 3FFCE 1RL1A 1NCTA 2AAAA 1T1XB 3PWVB 3SPVA 3VWKD 1GC1L 3LDBC 3UOAB 4NT6B 1J5CA 3OZKA 4PJIB 1USZA 1H8LA 2G4EA 3VWKB 5K93A 3QHFL 4HF5L 3T2NH 1JYXA 4MLIA 5PCYA 5CMAB 3ATEA 4PRAB 5CJ5A 1MRCL 3NP4A 1HT6A 4ZMOA 2DWYA 1SRDA 4XWGL 4K3DH 1TKWB 1N8ZA 2CDEA 2CLZA 1ZHBB 2E4FA 3APNA 2YXVA 4OFYD 4WWPA 4BK4A 1IE4A 4AH2B 1EFXB 4OB5L 4UQBA 3R0MA 3VSQA 1A9EB 1RJYB 3A4AA 1T66C 2PPFA 4FMVA 1N6VA 2WLIB 5EORH 2OX5A 2ZCLL 5F1NA 3MNDA 3WUWB 5DYFA 2ZOKA 1DVXA 2WWKT 1U8JA 5I8EB 6CGTA 3BRFA 5C0IB 3EGXA 3LD8B 4XP9L 2OM5A 4PWEA 4I8DA 1S7QB 3WBDA 2AEOA 2OKMA 4KOBA 4EVNB 2IALA 4FTVD 1CWVA 3X3FH 1FH5H 4AVJA 4H7VA 5A2LH 3SDCA 1UA7A 2AQ1A 2QQKL 5D55A 4FTVB 2CUAA 3C6SB 4XWOC 3IMVA 5E08L 2GY5A 2BP5M 2AQPA 5I2IB 3TNMA 1E5UI 2VC2L 4RMBA 4Y2LA 1F8TH 4O02H 1MWAL 3WNJA 4FNLL 2CWRA 2PCFA 2XWCA 3BWUF 5IV2B 1TZGH 3ARGC 4EDWL 1X9UA 3L6FB 5ID1A 4GQ9L 3QPQD 1G7MB 2BNQA 4PU2A 3LNEA 2H26A 1KJ2L 4FG6C 3QS2A 1OIOA 4YHMH 3EDDA 2OSLB 5KTEH 2VDOL 3CD4A 4MB4A 1IGYB 4GQQA 1IBDA 1E4KC 4ODSL 3RAJL 1JHTB 5AOMA 3MJ7B 5I6NA 4OCNC 4XC1L 5KOMC 4IMKC 5B3SB 5HHQA 1L0QA 4NHUB 5CN3A 1F4HA 1U21A 3HB3C 1E2VA 3VI3A 3QZBA 4RQQA 2KLRA 5EU4B 5T1MA 2YD8A 4ADGA 5FO9B 3NTCH 1PY9A 2CM6A 1UQSA 4BK8A 3QUXA 1CXKA 2P43B 4E0RA 4YHZL 3Q2NA 2Y5EA 4K5LA 4OFDA 2OMNA 3VQLA 2O5XH 3BT2H 2EE6A 4FAAB 3PWLB 3FT9A 3QFJE 4YHPB 4GMTH 5IWLC 4JHBA 5EORL 1DDHA 1UKSA 2XXCB 2IWGA 1OZUA 2ZCHH 3RX7A 1I3VA 3SDAA 1QQDA 2DBLL 2JIXA 5F9DC 4JJOA 4H26B 3CZLA 5C3IA 5I1EH 3R1GH 2YFOA 3ECVA 2YS4A 4PS7A 4F5CA 2XWTB 1WWBX 4UV4H 3QDMA 1Y6MR 3TA3A 5CBEA 2IBZY 4WEMB 4C54A 4G7QB 5J1AB 4MMYB 4EZKA 3KCPB 4FQIH 2AAVA 5AW0B 4YXHL 5CLZA 2FTAA 1L0PA 4K94C 4GH7B 5HHOA 2WVSA 3ZTEA 4U1HB 2BY0A 1F8TL 2KBGA 2N0KA 4JY6A 1GGIL 5D7EA 3KWWA 4OV5B 2DD8L 1F3JA 1TZGL 2BOBA 3S3SA 2WQAA 5JIDA 3JVFC 2C34A 4TNFA 3FYIB 5IUSA 3NIDE 4OJYA 4F7TA 1DQKA 3VQ2C 3DLQR 1IRAY 5KVEE 3RY6A 4CGTA 4HKXA 4X80H 4OD3L 1IIIA 4NWUH 5INDA 3QNFA 3KWVA 2Y6TE 2I25N 2BP0B 3AG1B 4MS6A 4WWKC 1O9VA 5E0QA 2KH2B 5F3BA 3PAYA 3OJDA 5CZVH 3ZL4H 4IHOA 5ESAA 3Q06A 5IQOA 1J9CT 1I7UA 1SY6L 3TWCH 5DMGD 5JDSB 4HWZB 1V8HA 2DWSA 4NPKA 4LCWA 4PRDA 4AIZA 3W1ZA 3BP4B 5BJTB 5JOPD 3FAWA 4GKZB 5BZDB 1OSZB 4AC4A 1MCNA 4HIPA 2WCGA 1NC4A 3E3QE 3GSXB 4JJHA 2JK5B 2VZTA 4GMTL 3PWJB 5KJ4A 4BIKA 2XWEA 1YC7A 3AWFA 5GGQH 3ZL2A 2J25A 5HHPA 2NY7L 3FBQA 2G5BA 2NXZD 4I13B 4UQ2A 4KRPD 2Q76A 3S96B 3SOBL 3ME0B 4QTIH 4AQ8A 2XTJC 5HHNB 4KRPB 4ANKA 1UXWB 5MEOB 4EDXA 2DH3A 2EVGA 3IDXL 3FO9A 3AREC 4TUJB 1MZYA 3GSNB 4MDIA 2X0VA 3KG5A 8CGTA 2EUVA 4N0UE 3L95B 1A1OA 1VJSA 3GHEH 2GEEA 3VWKC 4LOFA 1OLZA 3QRBA 2HUEA 2F18A 1NFIA 3OLDA 2W9EL 4XMWA 3LPFA 1NEZG 2VOTA 2MJWA 1A8ZA 2B4CC 4XCYA 3VI3F 2AGJH 1FO0L 1X9LA 2AJXH 3CSBA 5EA0H 2GHWB 1K85A 1IFRA 1N0LB 1D5IL 3C9NB 5GRZA 1M1XB 3B2UD 3QQXA 4S2SB 2I07B 1H5BA 2CJTA 3MLUL 3DOIA 3CC5B 1MCOL 2C9XA 3RL2A 2JFCA 4K94L 4GFTB 5C0CD 4HEME 2PTVA 4KV5F 4NWUL 4G8GA 3WMQA 4HYTB 5C0CB 2TSAA 5CM1A 3VXSE 4LAQH 2FRGP 2ICWB 1QTPA 3CFBB 5IROD 3GUTA 1WO2A 2BVOB 4QKXB 2RMNA 2XQBL 1MFNA 2Z1KA 1NMCB 3I3BA 5TFSH 3HI1A 3MUHL 4PHZA 2AJVH 3LD8C 4PW4A 3PABA 4N8PA 4L9LB 3B2DC 2CHWA 4J3OF 1FC1A 5I6OA 1S5IH 1JPST 2W0LA 4XB7A 3E2HB 2W9DH 2VERA 3U83A 4WKXA 2FZ3A 1UKQA 5F7EL 3WIHA 1ZHKB 4B3EA 3UYOD 3O4LD 1KTJA 1YYLH 4U6TA 4Y9EA 3TBYA 3O4LB 2LE9A 2BWDA 5K9KA 1HN1A 4DTGL 2GEQA 3VO0A 2V0AA 4YOKA 4FA6A 1JF5A 2OULB 5F1SA 4ZNCD 4LMQE 4NQQA 2A6KB 2FQGA 3SJVE 1R46A 3HS0B 3MLZL 1S7UA 5GRYA 1DEEB 3DRTA 3TT3H 1SYVA 3GMQA 3QPQC 3N41B 2R0LH 5CSGA 1E27B 3D39E 1AGBA 4BWUA 4LVNB 1HKFA 2QVKA 2DLHA 3V5KA 1A6VL 1E5ZA 4X6DE 3GHEL 1CE1H 1CXIA 2XRAL 1KIRB 4Y1TA 3EZJB 1KPUA 4BGDA 5I28A 2Q6WB 2DQFA 3ALWA 4XP1H 2QDVA 2MCG1 3VFNA 3HC0B 5GS0H 1FYTA 1T5WB 2DQTL 5EA0L 5IB2A 1YEJH 5J56B 2C7FA 3GMLB 4KQ4H 2UX6A 3S6CA 1MW2A 3SE8H 3JQOB 3K2KA 1U8IB 1QSEA 4YHOL 5AVQB 3ZSTA 3RGVD 1TJMA 1N64H 1WA2X 3K91A 4N1CA 3CSPA 1HEZA 3FFCA 3O6LL 3TEWA 3DO4A 4JKNA 3RGVB 2PW1A 4JFFE 4CN6A 2R9HD 4OR1A 4G5AA 3C8KB 3G5XB 1DQLL 1MREH 5A2FA 4CW1B 2FT6A 4WWNA 1XCXA 2GAZB 2VLKD 2DRUA 3PHSA 5H2BB 2WTRA 3EOYG 4JHUA 4HXBH 3ALPA 3LV3A 3VRLE 4C55A 1U4EA 1I9EA 2VLKB 4I5BB 3RWEA 2XQYG 1VFBA 3VNYA 1U3JA 2VZUA 2A83B 5LO7A 4MJ2A 2BY3A 2OAAA 4YSQA 1S5IL 3RZWA 4A04A 3MACL 3OMIB 1TZAA 2A9ML 1I8LA 2W9DL 4DP5X 4UM8B 3WD5H 3B2VH 1W0VB 3KPNB 4FJZA 4OJDH 4PYGA 3WDIA 4HJUA 1JE6A 1YYLL 1FNGB 2XLLA 2VLRE 4N1HB 3MGOB 2YPKA 1YPZB 4IS6B 1YYCA 3N44B 3EYQD 5AVZB 3KLQA 3AMKA 5JQ6H 5EBLB 3TT3L 3O3DA 5SWQA 2E8ZA 3OX8B 1TFPA 2XT1B 3QO1B 1ML0A 5MHSE 1ECZA 1R75A 4X9GA 2X2JA 3WNLA 1PY0A 2XC8A 4FERA 3Q8AA 4P5MB 1DE4A 1HHIA 3C8DA 3SY6A 4O9HL 2ENQA 1CGSH 5CHNA 5EPMA 5FK9A 4ZX4A 4MJ5A 4Q6YA 4XVJH 4XP1L 1ITBB 4HH9B 4RMRA 1XSIA 4X9BA 3GZKA 4KQ4L 1JPFB 1YJDC 3SE8L 1NBYB 4N8CH 5DMGC 1KLUB 3PJSB 1X9QA 1HAUA 4AGLA 2Z65C 3QARA 3SKJL 1KLGB 3JWOH 1WT5C 1HNFA 2BWIA 2OR7A 2C7UA 5E6IA 1JCKA 5FV2A 4XGZB 1YNKL 5ICXA 1NFDB 2BS9A 1ILUA 3W56A 3ZO0A 1MREL 1PCSA 1BQKA 3L3IB 5D6DA 4Z1PA 1AR1D 4ZUWB 5BPPA 1X7QA 1PLGH 3PWPE 5EC1B 1AR1B 4PTUB 3QC6X 2P24B 3CSYA 4KRPC 1INDH 4HX1B 1HSAA 3DSNB 1KJMB 2YA2A 4P4RB 3BRDA 3ZDXB 3P4NB 4N6QA 5T3ZD 1QWNA 2BOLA 5EEXA 1A6UH 5DRXA 4L0ZA 1BQHB 2R39A 2XVKA 5DUJA 4JY5H 3QFJA 4OIBA 4XT1C 3WS6C 5B38B 2Z7YA 4OIAA 4Z3FA 1LE5B 3I02B 2XPGA 2Y1ZA 5CIPA 5DHMC 3SQBA 2OXHB 4AQAB 1NBZA 2BFVL 3TBWA 2K7QA 3FCBA 3FK3A 3DPBA 3U82B 4E9YA 3V0HA 3T2LA 1LK2A 1PS3A 4TV3A 5KS9F 1TR7A 3A0OA 3B2UC 3R18A 5DHDA 4K9EH 1DP0A 3MAWA 1C08B 1BAWA 1XGTA 3ZRFC 1KYDA 1WICA 3KL0A 1PSKH 1OP9A 3OAYK 4I9WE 5SX5K 3EYUL 3DX9A 3S4SG 3UTZA 2IAMD 3PFQA 1MKFA 2APVA 5FDWB 1AYRA 4OKVB 4ACPA 3FQXA 1DR9A 1NMCC 3CXFA 4QHMB 4GG6E 2IAMB 3F6JA 2Y06H 3F3HA 4Y2DA 4L9LC 1KFAL 1QA9A 4N8CL 1HQ4A 1JZIA 2NZIA 3QB7C 3D5OF 3E2HC 3FOLA 1KELH 1G0YR 4FKEA 4HCFA 8FABB 4DEWA 2HKFH 4HXAL 4ZK8A 2CHZA 1B4JH 1SQ2N 3O3EB 4PTTB 3D0AA 2BXZA 1XCQB 3DMMD 2ODHA 1HEJC 4WIQA 3D30A 1H3PH 3CHRA 3H3PH 3Q3GB 3DMMB 3HS0C 4YE4H 1PLGL 4JHWH 4WJ5A 3KW8A 4JRFA 1UD4A 1YJDL 1INDL 1KLFA 4MTMA 4X4XB 3IDUA 3QXVA 4LVNC 1N8OE 3D09A 3TT1H 4RDBA 1OHQA 3CBKB 4G42A 2Y0SA 3APFA 4JY5L 2YAHA 3JBG7 1X7TA 4FNSA 3KEDA 4U2YA 4NM8L 2R4RL 2JH2A 4DIXA 1KXVA 2ENPA 3MLPA 1N4XL 2FATH 2COVD 4F57H 3D08A 5TDPB 4ECNA 3MBXH 3KPQA 3MMEB 4DFHA 3DI3B 2ZWZA 4LF3B 4QRRE 3GSNL 1MFBL 2A0LD 2DS4A 3DHUA 3PHQA 4E36A 4U1KA 1P53A 3GB7A 5E03A 3RGVC 5J12B 3B5TA 2VXSH 3DTXA 4JFYA 2R9HC 1PSKL 5MEND 3FUDA 3T2QA 2CA3A 1XGUA 5KSBE 5MENB 3NJKA 4BH8B 1U8LB 4KO9A 5HI5D 1OGAD 2E4TA 2WZ0A 1WA0X 3DYMA 4PWHA 4G9DB 2NTSP 2FJFB 1X4YA 2DWEA 2R69A 2E5EA 3D85D 1I9RH 4XZUA 1KELL 1XGPA 4FQXA 4B9YA 1IU1A 3D85B 5BS0E 2JKWA 2BVPB 3FB8A 5KSAA 1O9WA 5DF0A 4KZEL 3OF6A 5JXAL 4AV4A 3KVPA 4P2AA 1G6RH 1OVZA 2DL2A 2XWDA 3H3PL 3VXSA 2GJPA 1G5AA 3DTUB 3DV6A 3QG6A 3DUUA 4ZOEA 4YE4L 2D7QA 5B39A 1J0ZA 4XCFH 3X13A 5KYNA 3EYQC 5LXGH 2UXFA 3M6DA 3K8LA 2EYTB 3GBML 1Z3GL 4XPBL 2K9FB 4TNWK 4RSYA 1TMCB 3HC2A 4QPEA 1VADA 3TT1L 4U1GB 1KIQA 2Y2WA 1HNGA 3MA7A 3EF4A 5F97E 4IEFB 3BZ4B 3AAZA 2BCMA 5DJYB 2HFGH 2VM4A 5DUPH 1R3IH 2BNUA 1RV6X 3FXIC 3IFLH 4XN4A 4AT6A 4MKMA 3ISYA 3C08L 2FATL 3SJVA 1E9OA 2XVGA 3WU1A 2OZ4L 4NI3A 4MQ7A 1GGYA 2PKDA 4IU2A 4NKIH 5LB1A 3MBXL 2BNRE 2FJSA 3PJLA 5ETUB 2GJ6D 3D39A 3BESR 3NIDF 3L5WB 4M6OL 3RI5F 5DMIH 2GJ6B 1OP4A 3THML 4R90H 1L6ZA 1IAII 2BY1A 4X6DA 1LNUB 3LCYA 1LD9B 4XMVA 5IHHA 2Y07H 4XHJD 1JZHA 2A3TA 4IDJL 1W0WB 4TQEH 5JHDE 4JM4H 3LSOB 1CIDA 2NY3D 4GFXA 4LL1A 1AR1C 1TCRB 4PM1A 1FBIH 3KH4A 1I1YA 3VI4B 2NY3B 3P3YA 4MD4A 4R7DA 1VLXA 2PPCA 1SXSA 3BSZH 1S7VB 4JN1H 4JRWA 2K78A 4F8OA 4F24A 3ABGA 3GJFK 5EF2A 4P2QE 3CPLA 4D3CL 2G75B 3O6KL 4NQXB 1AP2A 4ZG1A 5IHBA 5I5JA 3OKMB 4G8IB 1ZGLP 5I8CB 5G4OA 1SEQH 5CLTA 5A16A 1PMYA 5FGBA 4KVCH 4XX1G 1AIFB 3BP7A 3LNGA 3D07A 5DFTA 4AYMC 3CFTA 2N1TE 2HRPL 5AVYB 2MOVA 2BJML 5DHYB 2ITEA 3N1QC 4UOQA 2FWOA 5LXGL 1ZPLA 2CO4A 2APWA 1WBZB 1UB5A 2QBWA 4OZGE 2MNJB 4PP1D 4X99A 5L4IA 2GKIA 4XXDA 2GITA 3MYZA 1XEDA 3FUMA 3OAZK 2LVCA 5CFHA 5J4MA 1AOHA 4XP5H 5K1VA 3HPJB 2NSXA 3VH8G 1KXQA 1EMTL 2HFGL 3LIZA 2FWUA 4BHUA 3MX0A 2VLRA 3PIQA 5CEXA 5E4IA 5EBWA 4HC1H 3SKNB 2N7SA 1YUHB 3ULUD 2BSED 4F33B 1I85C 2XYBA 2O6EA 2IAMC 3FONB 2VW6A 4NKIL 3SGKC 3UJTH 3QQ9D 2VZVA 3V4PB 4G5ZH 4U0RB 4BCXA 5I5IA 2FO1A 2X4UA 1S7RB 2QMKA 4FNQA 4G11A 3H7BB 1W8EA 1ZHLA 2NW3B 4K7PH 2V17H 2FHCA 2AXGA 4P3CL 2QZ5A 3VACA 1FVDA 2DTML 3L2MA 5IFJA 3MV9D 3GIZL 4GKNA 4XN9A 3I9AA 2Y07L 3C75A 3C2AH 1V10A 4TQEL 2IIJA 3N50A 4QHUA 5D7JA 1MWOA 2JLLA 3DMMC 4JM4L 2ZCKL 4DCQA 3S98A 4B60A 3MJ8B 4FLSA 5BMFH 2AEQH 5C08D 4JM2D 3VFPB 1L0XA 3BSZL 1R0AH 3U0TA 2D2OA 2J4WH 3HFML 3QEUB 5C08B 4JM2B 1EO5A 4OW6A 4FQQB 3V6ZA 1P7BA 2CO7A 3UBHA 1G9ML 3QZWB 3MNVB 4FFYL 4YO0B 4MX7A 1EANA 1CTMA 3PDOB 3GZPA 5CKAA 3MFFB 4HWEH 1IAOB 2RR3A 5DQDH 5JW5A 2DY2A 2Z91A 2VJ0A 1XIWD 3C12A 5JQHC 3PWPA 1Z6JT 5DQJB 5J0BA 4LLWA 4MA1B 1XIWB 4XNYH 5DMKB 4RAVA 3ZKXB 2ROXA 4HPOL 1QSFA 1OTUD 2AZAA 5GRJH 5T3ZL 1P7HL 5J12C 2GHZA 2RACA 3TF7C 2A0LC 4YWGH 2G4GA 2XJLA 1QZ1A 4Y9FA 5JIPA 3QWQB 2AVGA 4ODHH 4X6DF 4OLYL 1ADQH 4LDEB 3BSGA 4UT6A 1U3ZA 2VXTL 2CO2A 3LN9A 4H8VA 4F8QA 4TM9A 3TBVA 1KXTB 3MRHB 5IB5A 4U6HB 3TEXA 2WMPB 5D7HA 4YSUA 1T0NA 1E5CA 1WA1X 2EJ1A 2NW2B 3GMMA 3OGOE 5HI5C 2DQDH 4H0HB 4A7SA 2V7NA 2WKOA 3B9KB 2D7TH 2WQSA 1UD5A 4ZSOA 3EYSH 3QNZA 4L8SA 4IU3A 3A6CH 1B2WL 3Q2WA 3RA7H 2V17L 4KXAA 4HUXA 5CFAA 2FIKA 3HHRB 1TVHB 1VB9A 1IKFH 3LOWA 1KBVA 2CLRB 3B56A 4JFZH 1AGCA 3FSAA 3W39A 1INQB 4LEEA 2WLKA 1KY6A 5D7SH 3R4DA 1WZAA 3KPSE 1VACA 4ODUB 5CCKL 4N3UA 4MMZB 5DEJA 3IWVA 4DZ8B 1EAPB 3VRLF 2JJSA 2K9UA 4V1DD 3VXTB 5F7AA 4Z7IA 1EJ8A 1P5UA 4IJ3B 1JWUB 1R0AL 4V1DB 5KBPA 2CJUH 1CXHA 2J4WL 1QYGH 4KWUA 5HXMA 1HH6B 1MLBB 3HAEH 4U1GC 5DO2D 1GR7A 3W9DB 5TD4A 5I1JL 2HLFD 4K8RH 5CCKH 5I73B 3CXHJ 3ZDYB 3B6SA 3MLWH 4JS7A 4UTCA 1YY8A 1ZWIB 1SM3L 5H37H 4MWFB 2XTSA 4HWEL 1RZJH 5E2WH 2YD2A 4XPFH 3AB0B 5HHXL 4BUHA 1G5GA 1SQMA 3CFEB 4XNQA 2E76C 1WFMA 4QT5A 3O3BA 3ARQA 3X14B 1KB3A 3UG4A 3WL9B 4JK0D 1JYNA 1E5AA 3BUYA 3NH7L 4AVIA 2XI9A 1QFWI 4RFEA 1IEAA 2C9SA 1XR8B 4Y5XA 2LU7A 4BM7A 2Z7ZA 4OF5A 1ADQL 1NEZB 2BSRB 1JGUH 1E9QA 4XHJC 1FHGA 1MJJB 1FVCB 1ZS2A 3FB7A 2ZJSH 4LSUL 4DJMA 2Z9TA 3QVAA 3F05A 2NY3C 2JKJA 5BVJB 4LNRB 1CD1B 1YC8A 4M48H 2W38A 4L1DA 4DGYL 4GRWF 1KUMA 1LO3L 1L5GA 3WO4B 3LQAH 2YAEA 5EG6C 4X6BB 5AENA 4BJLA 1BLNA 3A6CL 5LBGA 2DMCA 5GSVA 4ZUVB 3RX5A 4KGLA 3VRJA 3JT2A 2AS5M 2CIKB 1A1MB 3TLRA 1BDYA 4LPTA 5I1GH 5E8DL 1AXSA 3VXNB 1JI1A 3DX6A 4JPSA 3TVMD 5AWNH 3II3A 1MW0A 3BVXA 2NNAB 1WCQA 1ZT7A 3KPTA 4JMXA 4NNYB 3TVMB 2Z93A 3LHPH 4PJFE 2Y36L 3RIFK 4G82A 1ZDSA 1NUFA 1W72B 3FO2A 4PJ7E 4U1LA 4UF7C 4WAFA 5FM8A 2EH7H 5I30L 1E0OB 4NENB 3KPRD 4PP1C 5HGDA 4HGKC 4YFLF 5BS0A 2OMYB 4WTXA 2FJGB 2K6YA 2EDYA 2VDPH 3CX2A 3KPRB 1MI5D 3L4TA 3VYOA 2KZKA 3HMWH 1PLAA 2QFRA 1DFBL 2AV7B 2ED6A 4LL9A 1MI5B 3TO4A 2XX1A 2NUTA 3UJIL 4NB7A 3Q2CA 1FG2A 2IADA 5E2WL 2X09A 1EJ6A 4XPFL 3OQRA 4Q2ZA 3IDMB 5DSCB 1M05A 2Q3XA 4U0RC 3WS3A 3ULUC 5DC0A 2WVTA 3QQ9C 3QA3B 1I8KA 2P8PA 2WKOF 1LQBC 3LKPA 4NRXA 5EMYA 4JG5A 4YSOA 1PFOA 2C4FU 2XZQL 1O6SB 3K74B 3ALXA 2F58L 2VUOA 3N1PC 2FT8A 2D73A 2GSIB 2GTWA 1JGUL 4MD0B 1ZHNA 3D3VD 3RWFA 2QV2A 4AM0B 3VXPA 3CZFA 3EYVB 2FJHB 4Z0XB 5CR8A 2J56A 2YEQA 3D3VB 4OFPA 5E7FA 1HHJA 4XH2B 4YZWA 3FRPG 1RIVH 4GG6F 2PCYA 1JYVA 5HHMB 4JZOB 2BNRA 1AGEA 3ECUA 4P23D 5EU3B 4JM2C 1MUJB 2F8IA 5GS1A 2R15A 5FGRA 4P23B 1PZDA 4HKJA 3QNYB 2Y22A 5I26A 4Q7DA 4UDTB 4X7EC 4TULL 5FGSA 4OGQC 1SVBA 1MPAH 4MDJB 3H0TA 4YHNB 2B5IB 5JHDA 4QRQA 5C6TH 4I1RA 1NGXA 3GSQB 4PJDA 3TBBA 1BZ7B 4TOYL 5DA4A 4FX5A 4MA1C 1RZ7L 1XIWC 4PGDA 5T5FH 3Q0HA 4JQVC 3LHPL 1S78D 3ZKXC 1BGXH 2GQHA 1UA6L 1N0XL 1S9KC 4TF4A 2XJKA 2EH7L 3SODB 4LLAA 4P2QA 4PWGA 1OTUC 3VD5A 3JTTB 2XX0A 4LLMB 2APTA 2P9RA 2VLJD 4Z0BH 2OMTB 3MNWA 1YEFH 4XO5A 1QNIA 2XVLA 5AB2A 1P4IH 2VLJB 4RAHA 1LJMA 4L4JA 5DYOB 3PPEA 2YBRA 5TQ2L 3RWJA 4XB3A 4JO5A 3WLWD 4ACTA 4QXTA 1HOCB 4W93A 1RCYA 3T0EE 5HPOA 2CALA 3KM2A 2QADD 3B9KC 4O02A 3CLWA 3UZEC 4OZGA 1KBGH 4A67A 1P7QD 2DQIL 2OCCB 4OF3A 1CFNA 3HN3A 4W9DC 5C9JB 5EIIA 5ECGA 1F4YH 1P7QB 3MRDB 2R1XA 5D96B 4MZRA 3V4LA 3VTTA 4JRYD 2QTEA 1CT8A 3VGEA 3EH5B 1C7TA 4LSVH 4JRYB 1DQJA 3S88H 2EYSA 5KSBF 1T22A 4MMZC 5DJDA 5HYEA 2Y1AA 4N8UA 3V4PL 4APXA 1B2YA 2VH5L 3ULUL 4JQXA 3O8XD 1RIVL 3HHSB 5CLXA 4IJ3C 3HCVB 1TTAA 3BGMA 3O8XB 2VMEA 4NKQB 4NWTL 2CRMA 2P44B 3T4AA 6PCYA 3TC9A 3KPMB 4W9IC 4TTGA 3NCJH 1ZE3H 3PHOB 5DO2C 4OCMC 3ZR5A 5I73C 4LQFH 4HW6A 4X9HA 2HLFC 3EFOA 4EI0A 1I8MB 4CNIA 3X17A 2EIZB 2QJDA 5I75B 4PCYA 5EWIH 1UJ3B 4G6KL 2W60A 1PD1A 3CHOA 5GIRA 3AB0C 3AXIA 5DZAA 1EERB 3FSVA 2Q1EA 2QGEA 2ITCA 4LSRH 3VXRE 5T5FL 1DQQB 1KT2A 1BGXL 3MGTA 3BEVA 4AQEB 1QRNE 4GW1B 1K72A 2K8MA 2YD3A 4NRZB 2ETWA 3HBPA 1P4UA 4AZ8B 1OEZW 4H1LH 3RJOA 4FA8A 2B3RA 3BN3B 4NO3B 3MRKB 1DN0A 1CD9B 2OLDA 1LEIB 3MRQB 1XGRA 2KI6A 3E80A 1ZLUH 2VDRH 1YEFL 3PXJA 2O1AA 1S9XA 3WY2A 1KCBA 2OS7A 3QDJE 2W95A 1K8DA 3PE9A 1CDBA 2YJLA 5GRWA 4FG2A 4DP1X 5AAPA 5J06A 2G9KA 3K2MC 1SFHA 4PHXA 3AM8A 1NIBA 1HILA 3ARSA 4GINA 4Y8DC 3QQ3A 4LHQB 1CDJA 2B3IA 3WO4C 1S5HA 2H3NA 2ZSWA 4TSAH 4C56D 2B39A 2OTUB 4L5FH 4HJGA 4WTZA 3SE9H 4C56B 3NDYE 1HCFX 1A4BA 4PJ5D 5TTRA 2GJJA 3MJWA 1Q0YH 4PJ5B 4LSVL 2MFNA 3S4SB 4GUPA 1Q94A 2OMWB 3KLLA 5FAAA 3U4BL 2QSCL 5BXFB 1SXBA 4FYRA 2EACA 4I87A 3MRJA 5GS2H 2FUTA 2DYSB 5AW9B 1BVZA 2VXQL 5CILH 3TVMC 1Q9LB 4H88H 1QOKA 1RPKA 4Z7AA 3PS6A 1PDKA 2UXGA 1GGTA 1HZLA 3WEMA 4PCKA 2V2XA 4JHVA 3S5LG 4Y2NA 3MA9L 4KMTH 3UMNA 2HN7B 4LQFL 3MRCB 3QWNA 5DGQA 3ZYJA 1E4XH 5C0DB 2WOBA 4UUJB 3V4VH 5HI4D 4I85A 4KXBA 1XB3A 3OXRB 3ZDZB 4Y4FD 3QDGD 2OJZH 5IBUG 2F15A 3IETB 2N3JA 3PP3H 4R6UA 4Y4FB 3QDGB 1KWGA 2ARJB 4NKMA 1UXLA 4UDUA 4R84A 4LSRL 2Q7AA 3T09A 2Y69B 1YDPB 4ORGB 4ODBD 5LWYH 4M9PA 3VFRA 4OZGF 1BLIA 4JVUA 1UWEL 4J27A 2ZKMX 3F65A 3F7YA 3VFSA 5L0QB 4NO5A 4FQHA 3V95A 3IXTB 1A8JH 4WK4B 4CVXA 1AQKH 4Z76A 1XF4A 3B37A 4CDGC 4X9YA 3SQRA 4AM0Q 2BIQA 3CLEH 4W1TA 4FULA 1K5WA 3NSJA 1QNZH 2HFTA 1OT1A 4KO7A 2OJEA 3UMTA 4KUCF 4N2LA 4GJTB 1V3LA 4WV1B 4P23C 5KSUA 4L5FL 3SE9L 1W6LA 3DVFA 1ZLVH 4Y2OB 4EZJA 4EKJA 4OJFL 2NTFB 3L13A 2CMRH 2NY0D 2B5IC 1G7IA 2B08A 5I1AA 1BOGA 5IW6A 4JZJB 2GIXA 2NY0B 4FQ2L 4YDLB 4YDKH 2WN2A 1Q1JL 2EIEA 4OD2B 2EE0A 3O3AB 5K69A 5MEQB 3MRPB 4EF3A 4P46D 1JV5A 5CILL 4X7CC 5IW1B 5ACMA 2KZBA 5KBLA 1UCTA 1ZK9A 4P46B 4PWJA 1S78C 1IGIL 1RH8A 2JXMA 1YYMH 2AK4D 4KU1A 1PG7H 5AZ2H 3WNNA 4WKZB 4N2AA 1OF2A 2YOAA 2AK4B 3BKMH 3S3CB 1X5XA 4KMTL 1IL1A 4A6YA 3SE3A 4IBZA 4CN4A 1HHKA 5F7HA 2DIBA 2UVEA 3S36X 2F8OA 1K4CB 1N7MH 3V4VL 4NBXB 3Q2VA 1TYJA 1E28A 2OJZL 4CSZA 1ZGLA 4BD4A 2VDMH 2TRHA 1DSWA 3WLWC 2Y6SD 3N1FC 1W72L 3O9WD 4PJFA 3DA0A 2CRIA 4GG8A 4UOW0 4XP6L 1ZVNA 5D9SB 1YMHB 3GMNB 4PJ7A 2DW5A 2P3YA 3O9WB 4UNTA 1DUYA 4B50A 5DJ8A 3QJSB 1EAOA 3DJ9A 2RFXB 5KVDH 3MV8D 4C4KO 4M03A 5E1IA 3KS0H 1T20A 5D96C 4APQA 4WUKH 2WY3B 3MV8B 1AQKL 1PY4A 2YZ8A 3F7RA 2QGBA 1F00I 1FDLH 4WGWB 5E2VL 3TBTB 4Z3EA 3NPZB 3QCVH 3QR2A 4J3SA 1QNZL 5E6SB 5C0JB 3RZCA 2J8HA 3O8XC 4QHKI 1RHFA 2LHAA 1X5IA 4R9HA 1GS6X 3NFPA 1JN6A 4ODVH 5I6XB 4IRJD 3OAUH 5DD0L 1T1WB 3LQZA 5I75C 3GSOA 4U1NB 1JTOA 1UJ3C 1W9XA 3FSZA 4IRJB 5L7XH 1BX2B 3S3BB 3PWNA 1O7VA 1NFDE 5FYJL 4AEHH 1F3DH 3BAIA 2XV0A 5HP5A 5E2UH 4KDTA 3QEHB 4R96B 4UNIA 5DJ2A 3P3UA 1XQ4A 1GCFA 3AXLB 4FFTA 4JDVA 4KZCA 3U6RB 1XL6A 1KY7A 2UYLB 4NPYB 3SGJC 4PW9A 2E27L 5MP6L 2DMHA 2F68X 3OMNB 4IDLA 1RK1A 1U92B 1QPKA 1HTYA 1QPPA 1P6AB 1MEXH 3JV5A 4YAQB 3OPZL 2YD7A 1EWHA 1LO5A 4KMLB 4UIMB 1CL7I 5E5RB 3B3IB 4IIQB 2WZ6A 1E8WA 2C3VB 5D2NB 4KJQD 1NMAH 1KB5H 3U30B 3HBQA 1CFSA 2VDML 3ESMA 4XBPA 2VR4A 2BRRH 1FLRL 4G7YH 1R4XA 5KANG 4GRMA 1J8HE 2PCPB 5J3HD 3SZKC 1N3NA 1KTKE 1NM9A 4L1SA 1S2EA 3M1CA 1PGRB 2CUIA 3ILEA 1SN5A 1BQLH 2WNGA 4O58H 3ARDA 5DZNA 2VXUL 4ZMZA 1B0RB 3SOTA 4M61A 4ONFH 2ZIDA 4OZIB 2A4EA 4YDVB 3US9A 4IOSD 5EF3A 2MMXA 4XP4H 2AMGA 3ZZQA 2VLLB 3T0EA 25C8H 3QCVL 1GTNA 3PYCA 1DN2A 2NT1A 1BFSA 1TZHA 4M29A 4X0KB 1A65A 4NZDA 2FUQA 2JI1A 1GOFA 4FQJH 3RWDA 1T2JA 2A6DB 3QK0A 3ZXAC 1IC7L 1S7SA 4ODVL 5GISH 5BW7C 5ADPH 4R8WH 1QFPA 1Z5LA 2Y3AA 2R23B 5EUOB 3I9PA 1SOKA 5GGVH 2NR6D 5CKGA 5J6SA 1U8CA 3L8QA 2VN6A 2P26A 5L7XL 5HI4C 1LP9B 5CWSA 3X12B 4Y4FC 3WG7B 1CYGA 4YVUA 4KVNH 4AEHL 5GJSH 5IB4A 2NCEA 3DX0A 1NBQA 3QGVA 2QVTA 4PJFF 4R7NA 3N0AA 4F3FB 2M26A 2GG1A 1AY1L 2ARJQ 3WEBA 4OI8A 4PJ7F 3PPSA 4NUGH 2P80A 4HFUL 4I48B 2FWLB 3STBA 2VRKA 1NLDH 3N55A 4MD5A 4WHTB 1T5XA 5CJXA 2JB6A 5L0QC 2CKBB 4WLCA 1P4BL 3WYRA 4L37A 5DUBB 4XCNB 2DN7A 2FR4B 1O7DC 4KK9D 3SPIA 3ZHFA 2CZNA 4ZMWA 1NMAL 4KHXL 4L1HA 1KB5L 3FB6B 1A14H 3G5VB 1ZT4B 1BJ8A 2B1OA 1U8MA 2KQNA 4WV1C 1N6QH 4L4TA 4WO4A 2GIYA 4MJID 1R6VA 2A4CA 2BOCB 3LEXA 5FUCE 3QJFA 4MJIB 2VAAA 4HG4J 4ODXA 4F2ME 3JTSA 1HXKA 3BP6A 4JZJC 2I24N 1GPOL 2J73A 2NY0C 1WVZA 3QDJA 4ONFL 4YDLC 3OHXA 1H3VA 2GUOB 5T1KA 3IN0A 4JFTA 4PJBB 4RIRA 2VKWA 4HWBL 3FU3A 3BUTA 3T8XA 4HCGA 1ZSDB 4F1ZA 5HVHB 25C8L 2CK0H 3P73B 3CQFA 4P46C 4TVSa 1KXHA 4LIQH 1T4WA 3IRZA 4H8WC 5DEZA 2CDFB 2H9GB 5GISL 1S6NA 4LPVA 5ADPL 1YMMD 2FNWA 4RISH 5KYWA 4KC3B 4LARH 1ZKAA 1E5BA 4U2ZA 1YMMB 3LKSA 4RZCB 4WHCA 2CU9A 4QAMB 1GSMA 4PS8A 4DK5A 2HFFA 4LPYA 5AL0A 5G2NA 3ROLB 3VFGH 2MOGA 3K72B 3TN0D 2JQZA 2Y6SC 3ULSA 3O9WC 1BQRA 1ZOXA 1FAIH 5FCUH 4NUGL 2J1YA 3GKWH 4H25B 3BLKA 3F64A 3EUDA 4ODTL 1CXFA 1KPVB 2OXGB 4XNMA 1QHPA 4XNZB 4BFRA 4CKQA 2ZXAA 4PJCB 3CFMA 1TJIL 3CE1A 4EZMA 4HIIA 3GXTA 3BZFB 3AS2A 3CQQA 1U8OA 4M4PA 4EE2A 2FD6H 2VQ4A 3P77B 3D06A 3UZVA 3D2UA 3QRGH 1H3UA 4YN3A 4EI6A 1N6QL 2GK0B 2RAMA 1FZJA 1RZPA 3IE4A 1EGJL 3SBWC 4OFKA 3I74A 3MBWA 5AALA 4E42A 3BH9B 2NLJB 1L0YA 2E86A 5B22A 2X9ZA 5I6XC 3RWIA 4ZUUA 9PCYA 1FIEA 4X6CE 1PQZA 3L16A 1BWWA 4BFNA 4IBUA 1D5BB 2A9NH 2JTYA 1VZIA 4IRJC 3E1ZA 3K2UL 4WI6A 4L4VD 4FHKA 3LKQB 2LW3A 1LK3L 2AMUA 3ZX1A 3CFJA 4J3OG 4L4VB 4F91B 2OMXB 1HK6A 3NEEA 4NNXA 5DK0A 1IBGH 1Q9OA 3JYCA 4LLUA 1GS8A 3RBSA 5E00A 4LIQL 2HRHA 4ONHB 5IP4A 3MV7B 3L1EA 4A39A 1NANI 4DQOL 2QV4A 4E9VA 4GKSA 2ZF9A 3NZSA 4PRHD 3EHBD 4N9GB 3VFMA 4IIQC 4FFZL 5EOCL 5D2NC 5GZOD 1AC6A 1CK0H 2OSYA 2Q0ZX 4PRHB 4WNSA 4Z7VB 3EHBB 5I1IL 2VL5B 3DV4A 1A7BA 2WLLA 3U30C 5L6YH 2BRQA 2OR9H 3FTVA 3KW7A 4KJQC 3BISA 1GW0A 2GSGA 3HLAA 5EZOL 1U95B 3VWJA 5IESL 3PNWA 4UQEA 1NAMH 2K3TA 1G6RA 3RDTD 4H8WL 3QUYA 5J3HC 2W81C 2VDLB 1ZTMA 3RDTB 4Z3TA 1BYOA 4NFDA 1TETH 4YHYB 3RX8A 1TZ8A 4GB9A 3UFIA 1BVKB 2K7PA 3V52H 4UTAL 1NAKH 1LGVA 3TYFB 1RUAH 5DK2B 1UVQA 3NESA 2XA8H 4ICWA 1WG3A 1FFOB 2VKXA 1CF1A 1ET5A 1TJHL 4L8CA 3UGEA 3IM1A 4K55A 4J1UB 4JCWA 3CPUA 2FSDA 2O30A 2D03L 1HXYB 3U0WH 1UZGA 7CGTA 2Z31A 4PS4H 1QBMH 1C16B 1M4KA 1W0YT 3DDGA 4JJ5B 1MAMH 2VN4A 3KLHD 1GKEA 4B5EA 1QUPA 4B7IA 4G1MB 2P8LB 4M6AA 1NCBH 1MAJA 3PCYA 2PLTA 3BQUA 2IBZX 2JKIS 1XSOA 3L3DB 2EH8L 3ARFD 4WCYH 2WD0A 5JUEH 5AG8A 2A9NL 4ZTPL 1BVOA 5F0JB 5FYLH 3ARFB 1QUNA 2NR6C 1JNNL 1CGWA 5E8EA 3HZKB 2XG5B 3FRPB 4X50A 1HINH 3GRBA 4L8BB 5CD5D 4YDMA 1SDDA 3OJ2C 2H8PA 5A2IH 4AUJA 1GGUA 4PVLA 1NC2A 4YR6A 4N24A 5D1ZI 4B27A 5CO1A 1E7VA 4JE0A 1LMIA 1NDTA 2R7EA 3BSZA 3MREB 1JGLL 2WK2A 1JNHA 5EEWA 3E9TA 1KC5H 3JWDH 3M1BB 2A73B 4HD5A 4KI5E 5KEZA 1KWKA 1GYAA 2LT9A 1QHQA 2FWSA 5AD0B 1ZIAA 1I7RB 1U33A 4KK9C 2QQNL 4ZFOB 1H8SA 2WKGA 3ILPA 1BQ5A 5DVKA 4UAHA 3VSUA 2OR9L 4KAQH 1MIMH 1JNJA 3CSGA 1S9WA 3STLA 1P6WA 3MSPA 4L8DA 5G5DB 3Q6GH 1KGYE 3T08A 3R0NA 5FPIA 3IGKA 4ZNEE 5FF6A 4FZEL 2EDHA 3J07A 3N41F 5GRUL 1A6ZB 1NCCL 2X4NA 2B1AL 2X1PA 2K6WA 3V52L 2EIDA 3KAAA 4NEHB 1RUAL 2DM7A 1VZGA 2F74B 2XA8L 2C9AA 4A7GA 2D7PA 3O2DL 3IFPA 5HVHC 1S9YA 4LOUD 4U4BA 5DD6B 2IPKB 1J8HA 4P5RA 3TS8A 4FABH 1ZXKA 4HC1A 5SV3A 5DZ9A 2YXFA 1KV7A 1MAML 5AW1B 2Y1VA 3AY4C 1UENA 2C9VA 1KIUB 2KPNA 1OGSA 2E7BA 1P5VB 4LK4A 1KIPA 3N1GC 4QKTA 1HFUA 4KX7A 3PL6A 3LNFA 3DYOA 1IAMA 3BEWB 1T1YB 3HS8A 4XRCA 1INEH 5FYLL 3FB5B 2BIPA 1HINL