2N3JA

Solution structure of the alpha-crystallin domain from the redox-sensitive chaperone, hspb1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
MQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the alpha-crystallin domain from the redox-sensitive chaperone, HSPB1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Heat shock protein beta-1
total genus 11
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2n3jA00
2WJ5A 3Q9PA 4M5SA 4FEIA 1WGVA 1WFIA 3Q9QA 5DS1A 5DS2A 2KLRA 2Y1ZA 3QORD 5LUMA 1SHSA 2K8QA 2BOLA 1WH0A 4YDZA 3QORB 4PBDA 4MJHA 4ZJ9A 3GT6A 2CR0A 2KMWA 3L1GA 4JUSA 2Y1YA 3GUFA 3QORA 1EJFA 2XCMC 2WJ7A 2O30A 4YLBA 4YE0A 4RZKA 3AABA 3N3EA 4YL9A 3VQLA 3GLAA 4YLCA 3L1EA 1GMEA 2RH0A 3J07A 2CG9X 1X5MA 4ELDA 2N3JA 4PCKA 3W1ZA 2JKIS 3EUDA 4M5TA 3L1FA 2N0KA 4JUTA 2Y22A 3IGFA 3QORC 1RL1A 2MNWA 3AACA 3VQMA 4I88A
chains in the Genus database with same CATH superfamily
2OMYB 1OV8A 4YSPA 2CR3A 4GI9A 4QIRA 1P69B 2CHDA 1A6PA 5DT1L 4E0RA 4MA7H 1WICA 2I07B 2CALA 2XIDA 1DR9A 3NP3A 4DKDC 3GSWA 2R23B 4CA4A 3MRKB 3NFPB 4R97C 4KQ3H 3WO3B 3BWUF 4QLWA 3DGDA 1DFBL 4U1IA 5JXEA 2BP5M 4GRLD 1E3FA 1BOGA 3BAIA 3BO8A 1OWWA 1YYCA 2CLVA 3ARFA 3O3AA 4KMQA 4N6QA 3UAJA 1IM3D 5C0EB 1IC5L 4NHCH 1KJ3H 4QOKE 3Q01A 3L3HA 1TMCB 1OTTD 2YD2A 3D85A 4OGYH 3FQXB 4PIBA 3CHPA 4BSJA 1IC1A 5E9DD 4QRTB 1BD2D 3U6XA 3ZX1A 3WHXB 4HH8A 3KPOB 3MUGB 4TSAL 5FX3A 4AYDC 3TNNB 3IXAA 3KXFA 4B7IA 3S97C 5ICUA 3P4NB 2BZDA 3BO8B 3NCMA 5AWNH 1DQLL 1P4LA 1RUQL 1MI5B 3B34A 3ALPA 2QDWA 3GSNH 5A2FA 5DD1H 3CCHA 3KLLA 5I19H 5K9QG 4JFEE 5EU4B 1C5CL 2PYEB 3KPPA 3MUJA 3OC5A 4UNUA 3RY5A 2EXWC 3ZDYE 4AG4L 3S8WA 3E8UH 4E68A 1PYWB 1A6TA 2DL9A 5CZXC 3CDFA 3VFGH 2XWXA 3GO1L 3IXTA 3WJJC 3U2SB 1A6AA 1C7TA 4WI0B 4BH7B 5DK3A 5B7FA 1WK0A 4RZKA 3WTYA 1MHCB 2M83A 4P9MH 3CUPA 4LMQE 1LP9A 1BG1A 3MA7A 3QQ9C 3RP1A 4V11A 3O6LL 4UDUA 4D8PA 1QBLL 2OJEB 4IJ3C 1HZKA 3BFOA 5A7BA 1DLFH 1JNLH 2BERA 4D3CH 3K6DA 1WAAE 2XRAL 3NJJA 4AVJA 2VR5A 5TDNB 4F57H 2R7EA 4UV4L 3BAXA 4FXKB 4FP8H 3C6SB 3ULUC 5FHBL 4OW6A 5HGAB 1NBZA 5GS2D 4EUPA 4WUUA 1FH5L 4RMWA 5I66A 3AZUA 1DBJH 5GJSH 3HCVA 1D3CA 2OMZB 3ARDC 2AS5M 1PCSA 1UM6L 3OG6B 2DQHL 3O9WB 4N1CA 5C07B 2J43A 3BH9A 1P4LB 1BFSA 1F4YL 1NIEA 4OZ4A 4WFHE 5GGTH 3BQUB 4C8XA 3S5LB 5AW6B 3ZYOA 2NY6C 1X5YA 1R3HA 2YD8A 2XZCH 3EH4B 4LSDA 4RAVA 3N06B 5IT2L 4OV5B 4WUUD 4PVLA 2BSSA 1T83A 1YZZA 2WD0A 1H5BC 1UM5L 1IT9L 2VDML 4HIEA 3SDCA 4UAOC 5KTEH 2E7LC 3GI8L 3APMA 3OLDA 4ENZA 2XWCA 3B3IA 4XNDA 4FTDA 3Q5TA 3C2SA 5FS5A 1ZTXE 5FFOA 5B38G 1O9WA 4ANUA 3UAJC 4Z95H 1FVCB 5CP3A 5JUEH 4UOQA 4HCRH 4PRAB 4NM4H 4AZUA 3ESPA 4DVRH 1VKXB 1Z0NA 5CIPB 4PGEA 5MI0C 2QQKH 1VADB 1KFAL 1F3DJ 1OAZL 2GI0A 2BP0A 2PP9A 2G4EA 3IDXL 4RGMB 3FSWA 4YN3A 1OPGL 1QOKA 5T33H 3ZZLA 1D7CA 1I1AC 5KSVA 3WJJA 3TV3H 2CK0H 4TVPH 3US0A 4DESA 4KMLB 1TZGH 5FA3B 5DHVB 5HYIA 1DDTA 1WFJA 4HDIB 5JOFA 4G5AA 1OEZW 1D5XB 1B9KA 2NR6C 4POZC 4A2HA 5F1NA 5GZOD 2ITEA 2Q2EB 2DH3A 1P5VA 1T4KB 3QORD 4YHIB 3UPCA 3QUZB 1KLUA 3KXFE 3QZOA 3HMXH 1CDJA 2VN7A 3NAAL 3OBAA 4XMVA 2MPVA 5AOLA 3DO4A 5LCVA 2YBRA 3BE1L 4PJXA 1DUYA 4O5LL 1E27A 5KVDL 2Z4TA 4IRJA 4F8QA 1N64H 4HOZA 1UB6A 4PJ7B 5F93C 1OAKH 4L8SA 1L7IH 2ARJB 1HWGB 1NGWA 1IO4C 4P9HL 4NNPH 2ADFL 5D7EA 3ARGB 3B2VH 4H13C 3BH8A 4LDOB 1UA7A 1UXWA 2WXMA 5AVTB 3CPUA 1V7MH 2V2TB 3DRQB 3JUYA 2ODHA 1RIVH 2BOLA 4AM0B 3DKHA 4MJ6A 1XF5B 5IQ7H 4X6DE 1MDAA 1T2QL 4NJAL 3BZ5A 1QWNA 4PN6A 1XBRA 2KI6A 3JT0A 3EXJA 4WDIB 3UH8A 3LXCA 2HSIA 4KXAA 2EJ1A 5E8OB 3OTTA 1QBBA 4GKNA 1QRNA 4WI4A 4OH2A 4Z18A 3BGAA 2R0KL 2ZAHA 1LQBC 3C5ZA 4NKMB 3V6OE 1OZTG 5FUOH 4GJTB 3MBEC 4H1LB 4P2OB 3ZTDC 2VLMD 4EJ1C 1S7QA 4TULH 3QBTB 1HDMA 2FR4A 3ECUA 3O81A 3GIZL 2RIKA 4M7LT 4K3EH 4J2XA 2GHZA 2MTPA 3QEHA 4ONFH 1PKQB 3LS5H 5SWSD 3TTYA 3F6LA 4RIRA 4HWEL 5CHNA 1TQBC 1EGJA 3FUIA 3S3JA 3BAWA 3HRZB 3VXQA 3N44B 3H2PA 1G7JA 1S7XB 3MRMA 3WCYA 2C9RA 3RKDC 5AOZA 2Y6TE 3D9AH 2AQ3A 3CSYA 4NQDB 1CXHA 3CXFA 4JCMA 2XX0A 1CLVA 4MMXA 1TTGA 2FJUB 4XVUD 3WD5H 3PL6B 5BQ7A 3QDJA 1AR1C 2ICWB 3LB6C 1SN5A 1GZHA 2CHXA 5DEGB 3U46B 5DJ0B 4BFIA 1MW0A 1S9VA 1CK0H 1WFOA 4S0TD 2APBA 4JPKH 4XI5C 3C5SA 2DM2A 4EBQL 3QQ9D 3FQYA 2CUMA 2HT4C 4U1LA 5K9JH 3UTSD 4JHVA 4JQVA 4XNUL 4XX5A 4HUUB 3WE1A 5MENA 1OT4A 3LJ3A 1RK0A 1WFTA 3LIUA 1HINL 5HHOE 4UI2A 3C9NA 3VRJA 3DROA 3F00A 1KT2A 1E4KC 3FCTA 5ILTL 4HALA 4OCNC 2XKNB 2AW2A 2WQSA 1VACB 5EF0A 1IL1B 1SM3H 3RUGA 3ZKXB 4YJZL 5AG8A 1LILA 3PGDA 2VISA 5AZUA 1ZVYA 1CD1B 1OO2A 1F4XH 4L8BB 5IF0B 1XWVA 2EXTA 3GTTA 2ZWLT 3OHMB 5T3ZH 1I7TB 2YHGA 3EHBC 4PJ9B 5TF1H 1BA9A 3KJ6L 2FZ3B 1M7IB 3V4VL 1UEMA 1CYGA 5I8KL 5I8CA 3L17A 1BXAA 4XOBA 1KN4L 2DJSA 3JWDL 4K8RD 1HZLA 2EH8H 3FTYA 4K2UL 3EG9B 5T8IA 3ZE2E 4ZFOA 1GGBL 3J8F7 3S8FB 1ZGLB 2BNRE 4NAQA 3ZE2B 4QRRE 2WCSA 2DYPD 1IM9A 3GHEL 3OKNA 2YA1A 5E2TL 2IPTH 2X3CA 3GXIA 2FO4A 1VHPA 1SLWA 3LRMA 1ZK9A 2QQNL 3TWCL 1I53A 3OX8A 4KKAD 1BZ9B 2EDXA 1N19A 3FBKA 4QRFA 4TUKH 5JORA 1EAQA 1NAMB 4XVTH 4X4MA 2YQBA 3EO1B 4TQIA 4XN8A 5T5FH 3ELAT 4I85A 1X9RA 3A0OA 1BEXA 2J56A 2YAFA 3HBGA 3G6DL 4X9GA 2ICWJ 3UPRA 3NABL 4RNRA 2VSDA 4Y1AD 3RWFA 3KPQB 1T89A 2X05A 4FNQA 3C2AL 4CDHA 5HHVH 3ULVC 1NKRA 2WTPA 3IDJB 2AV1B 4P5RA 3GI9H 4HSAC 2JCCA 1KB5B 3EZ8A 3NP4A 4PP1D 3S98A 1KIUA 2R9HD 3SY6A 4X7FC 3JUZA 4PUBL 2AQNA 2UYLA 1NAMH 1MXGA 4WWPA 4BCYA 1FL3B 1XD1A 2HZHA 4FZ8L 3KPNA 2A3TA 3FT2A 2R0ZL 4W9LC 3EBIA 1EEYB 3WAJA 5CR8A 2JJUA 2WXRA 3K7UA 1MH5B 4DUVA 1ZT4B 2YEZB 4LLQB 5I8CB 4FL4C 1Q1JL 3G08A 2FWLB 2ZX9A 3BUIA 3DTXA 3GMPB 3ILPA 2ERJB 1NAML 2WYTA 4XC3L 1ADQA 1GZQA 2ZXGA 2BM3A 1IV8A 1I3RA 4OZFB 5GGVL 1GXEA 1XV8A 2WZ5A 2DRUA 2BOCA 3TC9A 4R2GD 3R19A 3OKMA 5CLXA 4HETA 3N85H 5DA0B 4LESA 1YCSA 2VITA 3QCVH 4YOKA 5KOMC 2F8XC 1ACYH 4M7JL 4Y9EA 4P2RD 1FFQA 5DD6B 2V3DA 5EFIB 1UOVA 2CO3A 4TLTA 3ZT6A 1O6VA 1YECL 1HWHB 1JTTA 2XVBA 1OPOA 1K72A 2VMDA 2ZOTA 4LOFA 4GKZB 1OIOA 3MCKA 4TRPL 2Y7QA 4P5SA 4KK5D 3IPBA 2YZ8A 2VLKD 2ZWSA 5GRJL 4MDJB 1IJNA 5FK9B 1OSEA 1IVLA 4FFZL 4OJEH 1MCSA 2KDGA 5A40E 2ZOLB 1HOCA 1MFEL 2HLEB 4KDTC 4HZ1A 3BKJH 4BEIA 4Z0BL 4M3JA 4PHZA 3DMMB 1KUMA 1BVLA 4P2QB 5AZEL 1MJJA 4WY7L 1DQDL 4EQ2A 1J0KA 3HZVA 4F8PA 3X2QB 2PTUA 4NQVB 4WHTA 2ETWA 1XIWC 2ZOKA 3EBAA 4OY9A 4Z0XA 2PP8A 1IFHL 3KPSD 4AV5A 3UXFA 2Z64C 3QR0A 3JT2A 1AO7E 2ZUVA 4OAWB 2YGQA 4M03A 5BRZD 4EF3A 4KOCA 2NTSP 1YYLL 3V4PA 2G0KA 4JQIA 4QR7A 4E41D 3IBOA 3IYLW 1DJXA 1KB9K 3MV9A 4X7TB 3BFQG 3HKFA 1KY7A 3C60C 3KVDD 3SGJC 1YYLH 2XQYA 2N0KA 4PRPB 5CGBA 4B3EA 1TSRA 1NUFA 3EOTH 3CXHJ 1S7RB 4NWTH 4YX2H 4TOYH 5E2VL 2NQDA 2VDRH 1T04A 5E0QA 2WBWB 3DOSA 5GGVY 2EC9U 1ROWA 2XJKA 3D0LA 4FFZA 3MMEB 1KJ3L 2X42A 3HLAB 3MJ9H 1MW1A 3LZFH 4HWBL 5DRZB 1NOFA 1G5GA 3L3IA 4HUNB 3EADA 5BRPA 4NWTL 4BKLB 2ATAA 3D18A 1FJ1B 2H0PA 4UDTA 1RSFA 4Z7IA 1HNGA 2H9GA 2QSCL 3M86A 2UZIH 5IFAH 4J3TA 5FGSA 2JKJA 4XH2A 1XB3A 3KLAA 2LTQC 3S2AA 1FGNL 2CIKB 1G5AA 1LE9A 4A7GF 4Z76B 3K4DA 3UIZA 4HMEA 4WW2F 3TF7C 4A39A 3DO7B 4AJWA 5JHLA 1EJOL 3QFJA 2D7QA 1MPAL 5FYKE 1WS7A 2L7EA 3FF8A 4JFXB 3N44F 4DN4L 1ZPLA 2JELL 2VSCA 2LU5A 2PCPB 3ESVF 3V7AE 2PYFA 3PRZA 4HUKB 2Z31A 4AC4A 3EKCA 2W0FB 2X70A 1IC4L 5E2WH 4ZNCD 4KKRA 4NWUL 1D6VL 1XZWA 2EXYD 3EJJX 3BHBB 4U1JA 1CBVH 3F04A 1T1ZA 1CDHA 2IMNA 2FSDA 1BQUA 2YAPA 5JIPA 5FR3A 2XIBA 3FT4B 1Y18A 1X5ZA 4HZAA 3WIIL 4X6CB 5HJGA 2EICA 1CF8L 3WHE0 3GXNA 3KBFA 1S9YB 4HEPA 2HRGA 1NINA 1UZ6E 3OX8B 4MMZB 3GS7A 4KV5F 1A1NA 3I6GA 3ZDYF 4L4TE 5G4OA 2Z8SA 4HHGA 4X7SL 4E5XB 3BC9A 4N87A 2P45B 2V9UA 1H9VA 4UM9A 1U8OA 3RUGE 2YLHA 4G3YL 2PWEA 1AS6A 3HS0B 2IAMC 4QRRD 1GMEA 1P0SE 4NNPL 1TETH 1V8HA 5HHOA 5FYJE 1FIEA 2WZ6A 2WLIB 1DBJL 4GAAA 5EO0A 4M9PA 3NEOA 3HE7A 3UTTA 1XF1A 3EJYC 5EUOE 5FF6A 3C6LB 3UCRA 5K9JL 2HX7A 4L1TA 3BUDA 4RFOL 4O2FB 5EOQH 3ME0A 3HHSB 2NYYC 1P84K 3EDKA 1SXBA 2C1OB 4GSQA 3UBXI 4BZ1L 1UT9A 4B95C 4HUWA 4PREA 1EUUA 1GC1L 2NY3D 1FC2D 4X0NA 4D7PA 4EDWL 4KI5F 3CBJB 3R8BB 1ZHBA 3DK0A 3QT2A 1G4MA 1KENL 2P80D 3Q5YA 4DH2A 1GY1A 1BEYL 3VTMA 4AJVA 3EOBB 3Q5OA 1I1AA 4DSYA 3S4SG 3LKPB 4XZ4A 1RZ8B 3JV5A 3GMNB 4HKZA 3X1EA 1W6WA 2HFGH 4YHPB 5ISZE 4BH8A 4HK3J 1KLFA 2ATPA 4FS0A 2VKXA 1KJ2L 4PJDB 2HLFD 2NY1B 5BW7A 1FIGH 1T1XA 2E0PA 3VFOB 1WAEA 4BRJA 3I84A 4YGAB 3FFOA 1LNUA 3ARFD 4FFYA 1QR1A 1J1XL 3BE1H 2NY4D 2X3BA 2A9CA 3L4ZA 4OD2A 1I1YA 2X0VA 2YMOA 1D9KB 2A7BA 3FQNB 5FOBB 3AITA 5C9KA 4DP8X 2WLIA 2I69A 3R1GH 2E9JA 1OHQA 3EJZC 3L5XL 4Z3TA 4NUJB 3P40A 4JJ5B 5I6MA 2ITCB 5HHME 2F53D 1RZ7H 4PRHD 4PJXE 1II4E 4OFVA 4UQIM 5SWSE 3T3MF 3TA4D 3CVBA 5FYLL 1ORSB 5DVMA 2QPUA 1U21A 3WTSA 5IIEB 1IM9D 4WSGA 1IGTA 2O26U 4GP4B 1FO0L 4Y16C 3QUML 1F5WA 2ZX5A 5F7UA 5KBKA 3SO5A 4NNXA 4FJ6A 1X9LA 3N0AA 3AACA 2ZX8A 4LCUB 3RIFK 2BVQA 1ASOA 2NCEA 4PJIE 2NSXA 5KWYC 1EAJA 4GBXB 4IYKA 2G2PA 4AITA 3TNNA 4OBSA 3POCA 1TFHA 1U95B 4Y4HB 4YHLL 3HB3C 2OQJA 4MNQA 4QTIH 3REWB 4MJ2A 2DQMA 4KWUA 4ZXBB 1WZ1H 3V0IA 1ZAGA 4I0PA 5ANMB 3KYKH 4TNGA 3ROOB 2AK1L 4ZW5A 3CK0H 4KO9A 2FD6L 3PGCB 4JFOA 3OKDB 4GW5B 2DM7A 3F01A 5F3FA 4C54A 1LLAA 3V6FA 3LNFA 4PB9L 4Y4FD 2COQA 3QUXB 3EH2A 3AS1A 3K72A 4C55A 4ESKA 3HB3D 3LPOA 2WJ5A 4MMYB 5AW2B 3FRUA 1O7DC 4GRLA 2NY6D 1CGVA 3QUHA 3TBTA 3UAFA 4X6DF 1S3RA 4HJEA 4YHML 1JNNH 2PO6D 4PJAE 5AKVA 1EO7A 4X7DC 1KDJA 1WZMA 4X42A 3RE0A 3WD5L 4C83A 4U4IA 4A7UA 1ZLUK 3WTTA 3EYQD 1WS8A 1YUKB 4RAUB 5KOVC 4IIQA 3ZUNC 5IB2B 2QZ5A 3SPVB 3S48A 4U6VH 5I1EL 4L8CB 3IRPX 5HDOA 2JXMA 3R0NA 3FUHA 1AO7B 1IAIM 2NY2D 3VVVA 2KZWA 5CJ8A 4N24A 3ATBA 4I2XB 4PSPA 4ZZFA 5L8LB 4ABWA 4IBUA 4ODWB 3VB9A 1YNKH 2DJUA 2W0PA 4WSJA 4MA3A 3EFDH 4QXVA 2XXMB 1FVDB 4PGBB 4OZGB 1WWAX 4F1SA 3EBGA 4FQHA 1GPOH 4OJCA 3N9GL 5TQ2H 4Z7OE 6FABH 3BSGA 1DDHB 2A9NL 3U0TB 5EORH 1YY8B 4BFOA 1KJVA 3DURA 5CBEB 3WTWA 4KDVA 1X5FA 4NN7C 1XSKA 3NSJA 2ED6A 4RA3A 3SPCA 3O2VL 3AQYA 2AABL 3HKZA 5TF0A 4FJYA 3U6XS 4WUUE 1LQSR 4YX2L 4ZJ9A 4QHKJ 4YNYB 3CZJA 1N68A 3UJIH 4J1UA 3K6FA 5CJOH 2Y07H 3QUGA 5DYOA 3P2TA 1A9VA 2I32A 1D5ZA 1PEWA 1EBAA 4AMKL 2E8ZA 5T1MA 3BISA 2HTKD 2AV7B 4U1IB 4MB4A 3SGEI 4LSQL 1JZGA 1AS8A 1G7LA 1KFGA 3MU3A 5D2NA 1LEGA 2H41A 3QI9A 3O11B 3PWJA 1ZLSH 4LQFH 4Y89A 3MTRA 2MHAA 1DUZB 2IQAA 2VDQL 3FB8A 2VR4A 3H53A 4PJ6A 3T9WA 2WM0A 3DX3A 4IOFC 3Q6GH 3ULSA 2XZZA 5L4FA 2XT1B 5F7LB 4ZMZA 3LKQA 3V9EA 5HYSB 3EJPA 4UTAH 3O6FA 4DQOH 3L08A 2FJHB 1TVDA 2X6AA 4BKTC 1ZT4A 5DZNA 4NWUH 2P43B 4ZG1A 1QI4A 4GKSB 2VQ1B 5F1OB 1OF2A 4C4UA 2XC8A 3TV3L 5DMYA 1FE8H 3ARDA 4ZO6A 1T5KA 5GGUB 2HLFC 3SGKA 1FNHA 3JV4B 1YPZE 2XX1A 3V4PL 3QNZB 2R0WL 3L2NA 3ARFC 4RZCB 3D05A 5A16B 5JHBA 4HX1A 2BY3A 2PPEA 3IDYC 2OW7A 4R8WL 4FQXB 4Z95L 2K3TA 3X14A 3BVDB 4HEME 3WFZA 5D5MB 5C0CA 2EIDA 1QNIA 2P52A 4P5TC 1GIGL 4XPHH 2VDRL 3AG3B 3KXFB 5DZLA 3WLBA 2MCAA 2CGRL 3T3PB 1IKFL 3ULUE 5JPMA 3RWDB 3C6EA 3IFLH 5E9DE 1K6QH 3NH7L 4M6NH 3HRPA 4G7QB 2HVKB 2WQRA 4WEUD 4AZ8A 4YL9A 1AY1L 4AUUA 1GHFH 5IHWA 2OL3L 1ZGLA 3LVEA 2UXFA 5EEUA 1U36A 4R7NB 1U8NB 4PJBB 5DJ6A 1JN6B 3WXWL 5EULV 1NGYB 2FHFA 5DHYA 1XMWA 2WQXA 5FUCE 3VQMA 3PL6C 1WBZA 3V7MA 4WDIA 4ORGA 2L7JA 4ODTL 2AXFB 2X38A 2FT7A 3DUSB 4YDVA 3F7VB 4L37A 2JH2A 3MBEA 1KC5H 2G2RB 2HVJA 3CDYA 2NTFB 5DMKA 1CE1H 4PRDB 4GUPB 4I4WB 3UZQA 5C0BA 1IAOA 4DIXA 5IKCB 4UTCA 1QSEA 1A21A 2AJYL 3CN0A 2H6PB 4MX7A 4K55A 4LP5A 1HYSD 1T5XB 5BVPH 4ZFOB 5F96H 4KX9A 1I3UA 1JPGB 3BMWA 3ZIMA 4QHUB 1FFRA 3MZGB 5ID0A 4B97A 5D72H 2WSKA 5AZEH 4IGBA 3AS3A 2OXGA 3LPWA 3WYRA 2BLFA 3L3JA 2AJYH 4ES8A 3L45A 5IBUB 5ACMA 2J72A 5E2VH 5DC4B 1E6OH 5FUZH 3VH8B 4ZFGL 1U3HC 4C59B 1KPVA 4JFYB 4R7DB 4HIXL 5B21A 3ZKQD 4RRPA 5E1HB 2RH0A 1PS3A 4CJ0A 1JRHL 5TFSL 5D4HA 4NQDA 4N90D 3RWEB 1MG2C 4IGBD 1J11A 3IGAB 1TQTA 4RGNC 3U7WL 3P2BA 5AVWB 4ZK8A 4DOHE 1KBGL 1JGLL 1BDYA 3L48A 4MJ4A 4XE5B 1C7SA 5IW3A 1S7WB 1TZ8A 3ARGC 1IKNA 5E8PB 3BUPA 3OAUL 1RERA 3VU1A 5IW6B 4OLEA 3CHXA 2A1WH 2I25N 2CLZA 4ACPA 5ICXB 1FL6B 2GTWB 5FC9A 5I8EB 2WCGA 4GINA 1DEEB 2FLRT 1QZNA 3HE7B 2AK1H 3CNKA 1IC0A 1DJWA 5D7IB 3VYPA 4XO4A 3AXIA 1Q94B 1UA6L 3ZR5A 4LB8A 2Q7YB 5H2BB 3VXMD 5DHVA 1FBIH 3I6SA 2Z93A 1HXMA 3HC0A 4KPHH 4JHZA 1QLEL 5HHNA 1L9PA 1ZDQA 4ZO7A 4WI6A 4PBWD 2B3RA 3IJHB 3D4CA 4JO4H 4KNTA 2YXMA 4E5XA 2A6JA 2NQ3A 4MJ6B 1XSIA 2GTZA 2GIYA 4MYPA 3V0HA 3W39A 3ILEA 4OLZL 4Q6IA 3VDAA 2VXQL 1UKQA 1WITA 2YD5A 3L95B 2CRMA 2Q5BA 3JVGC 3QIBC 4KPHL 1E4XL 1L6ZA 3EOBA 4S1RH 1EXUA 4XPBH 3T0ED 3D08A 1VGKA 2A83A 2A99A 2ISDA 2A4CA 3PWVB 4LVHB 4ZNEA 4XMKL 1TJIL 1FDLH 1YMHA 3DWTA 3JWOH 3QG7H 4HX1B 5DTFB 1I85A 3UBXG 2AITA 1XMEB 4NERA 1BX2B 3BVWA 1EH9A 2HKFL 5ESVB 1I8LC 4ZTEA 3S3SA 2LAGB 3LQAC 2CK2A 4HOMA 1Q0XL 1ZHKB 2CKBA 4BZ1H 5CFAA 1AQKH 4J4PD 2OTWB 2EYTA 3QEUA 3QUMA 1JNHA 3WMSA 3MNZB 3SGEH 4M1DL 5JW5B 1NFIA 1VGKB 3ZRSA 1E2ZA 4XP1L 3FT0A 1JHKL 3GTNA 1A4AA 3ZKMD 2WLHA 3D7PA 1IC7H 3M45A 2A4ZA 3TZVD 5I1JL 4X6BB 3E6FB 4M7LH 2VYRE 1MIML 3F2LA 3CXDL 3HI6L 1X5JA 4MHHI 4PJHF 2V2XB 1XCTB 3LMJH 1SEQH 5E8DL 1RLWA 4AEEA 4IOIB 4LLMB 3GBMH 3FSVA 1XH2A 5IQ9A 1A4KA 3LEVH 3TJHD 3WN5A 1J8HB 3TZVC 3BVNB 4GXFA 3MRDA 4OCRL 4H0GA 4KQ4L 3X1FA 5BO0D 5CGMA 3CHSA 5GGQH 4OLVL 4U6YA 5DGRA 2EC8A 4F7PA 5EV7A 1Q9OB 5J0BA 1YEFH 3ZE1F 4LRIC 3L5XH 2GIMA 3NA9L 4OVVA 3U82B 5C0BB 4BIKA 1M53A 1A7QH 1ZXQA 2AVFA 4J4PA 3KCPB 3DLQR 3GT6A 3EO9L 4K7PL 1FZOB 1HL4A 5DK0A 1UD4A 4LEOA 5M7QA 4G8GA 3DO3A 4B0MB 1LP9E 3O2DA 5JR1H 1T22B 2PCYA 2RFXA 4G7VH 2GJZA 5EU4A 4X99A 3Q1SH 2BHYA 1U8QA 5HDQL 2J1KA 4P46A 3MRIB 4IRZL 3W0WD 4JPVL 3N85L 4B9JA 5L4JA 2BNRA 2IH9A 4K94C 4XGZA 2ENJA 1JK8B 2JLLA 2KERA 3ALXA 4L29B 3TA3B 3DX6A 4JFPB 3WS6A 5E9NA 2IDCA 1DO6A 5ISZA 3DUUB 1DZ0A 1O75A 3MJWA 5D7SL 3QA3A 3GGWA 4KROB 1WFNA 2BNUA 4U7SA 2FIRT 3EDJA 5ENWA 3MFGB 1QFUH 3QQ3B 4R9HA 2BC4B 3ZDYB 2PYEE 1Q72H 2OBGA 1LEIB 3MV8D 3NQKA 5HDRA 3M1BA 1MQKH 1A0QL 4PGZA 4RSVA 5LBVA 4MZ2A 1ZLUH 1QSEE 1A7BA 2E27H 1G1KA 4KNQA 2DBJA 2OFQA 4OUUB 1YG9A 5EZJB 5EC2A 1NJ9B 2YAOA 5HGBA 4QTIL 1ACCA 5E51A 1LXMA 1Q0YL 1ZVHA 4B5ZA 5F1IA 3IAGC 3H9SB 4P5MB 2DLFH 1U92A 1YPZF 1Q90A 3O4LD 3MJ9L 2DI7A 1R0AL 1BFOB 3KW7A 3UO1H 2I60H 2ERJC 4MBOA 3TTSA 3ZW3A 1W0VA 2EVFA 3KPOA 3MUGA 3RB7A 3OL2A 5TH2B 3NFNB 1S9KC 5EBGA 3ZL1A 3O8XD 5HVHB 2H4EA 1J1OL 4HAKA 1U8MA 4L3CA 2OTUB 2WYZA 2ZPKH 3VQLA 2EH8L 2CO7B 5HVGB 3VRLF 2XVKA 3NN8B 2E6JA 3W1ZA 1U92B 5LXGL 1TYEB 2DMCA 4HW6A 1YY8A 5KS9B 1FF5A 3P3TA 3O2DH 2DS4A 1NMCC 1FSKB 2VXQA 1OE2A 4ODBD 1E90A 1AG0A 2CHZA 5F7DA 1FNSL 2RA1A 4M7KL 4IOFD 4O2CB 4ZMQA 1BREA 3QDGE 2VZOA 2IV9A 4HUXB 4AENA 4ZXBA 2DF3A 2QSCH 1T6BX 1ADWA 2UZYA 5EOCH 3V55A 2ZOLA 4JFSA 4UQ9A 1Z9PA 1EEQA 3FQXA 1LK3L 4MAYD 5EIVA 1N4XH 4GBXA 3QIUC 3F8UB 4TNWF 5L4MA 3OKOA 4S1QL 1A1MB 1YEKL 3PGFL 2HRLA 3H9SA 3U4BH 1T0MB 1I1FA 3PCYA 3N40P 4LEXL 4P5MA 4PD4J 5D7LE 1IKFH 1M2VB 5EIIG 1U91A 2R2HA 4PWEA 1XR8B 4AUJA 3RFZC 1SYVB 3MNWA 4LLMA 2EABA 25C8H 4YC2B 3HNTH 4YHZH 1QEWB 4WV1A 3JZYA 5GRYA 3RNQB 1GGUA 3DVGB 5EO9A 2G3ZA 1D6VH 3PWPA 1YEIH 1QX1A 1VZGA 2VXTL 1G7PB 3FRUB 4LPVA 2DPKA 4CSZA 5BS0D 3L3GB 4WI8A 3ECQA 4PJ5B 4G8GE 4L2LA 1ZLVH 1KTKE 4ZODA 4OBRA 5I1IL 4TLSA 5EU3A 2G75B 3GSNB 5IESH 2R39A 4Z5RB 3HC3L 5EEXA 3VWKD 4TUUA 5TE6H 3NCJH 2DYPB 4JFQA 1WGOA 3ZMNA 1QUNA 1M57B 1R75A 1AYOA 4M8RA 4X98B 4HOXA 3MRCA 1KIUB 4Z23A 5JUEL 1YRKA 3ARYA 3I74A 4L4VB 2QGCA 1HS6A 4XVJH 4YHIA 5CM1A 5KBPA 1X4YA 3K6IA 1J9QA 3R8QA 1LGVA 5JTWA 5HI5C 2EDLA 3MRPB 3QWQB 1BIIA 4JW3A 43C9B 1BG9A 2YD4A 1KCUH 1AAJA 3FHQA 3QEQB 1ZA6A 1VJSA 2EEXA 1AYRA 3M1CA 5TK4A 5CD5C 3VG0L 2H45A 2KLRA 4ANWA 2CU9A 4LEOB 4WEMB 2VDRB 2YPLB 4DW2H 3B4NA 4PEEA 2CR0A 2BP8B 3NSFA 2AAAA 3KR3H 5EPMA 1K8IA 3KGRA 1KFAH 1E8XA 3G5ZB 1PD0A 1AO7A 5C8JA 4JJ5A 3BDBA 3FPYA 1Z5HA 2OMUB 2EXYC 3CFTA 1QSFE 1RZKC 2M2DA 2VIRB 4PW9A 5E5UB 5EC1B 1NGYA 2XN2A 1MJ8H 3K0YA 2P26A 3ARRA 3MBWA 2OL3A 1N10A 2FX7H 4GKNB 1U58B 3VGDA 1S9WA 3ZOAA 2XOTA 1CJYA 4MKTA 4QI3A 1UD8A 1H3TA 4LSSH 3EF7A 1WUZA 4R2GB 3GSOA 3GZOA 4IEFB 4N2KA 4AEFA 1SY6L 1CS6A 3HE7C 3D3VB 4ODHL 4HPOL 4OJYA 5FW7A 4OI8A 5IG7A 2ZNXA 1KYOJ 1N8OE 1RJYB 1HHIA 3L3KA 1RK0B 1BP3B 1N3NA 3HVDA 2H47C 4ZX6A 4F7MA 4IK6A 1IAMA 2DLTA 3L16A 3UZEA 4EI6A 2YXVA 3BD4A 1MUJA 5GRZA 1CICA 4N0UA 5FKPB 1SXCA 5GRUH 2HPTA 1MCJA 4BKSC 3RFZA 3ARED 4ATWA 1C16A 4PV9B 1IGYB 5ISZD 3AY4C 1XF3A 4YGVB 3CU7A 3UDWC 4Q0XH 3HPLA 3BIAX 3HHSA 2VH5H 3KGUA 5GGRA 2PW1A 3A6BL 1GJUA 1K2DB 3ZZ1A 4RESB 1MSPA 3BXNB 4JFHD 4BCXA 4ZFGH 3JV6B 1OF2B 4JB9L 2PR9A 1QQDA 4BQCA 5CKAA 2CDGA 3ARDD 3IU4H 5A2AA 1W72L 1UD6A 3O6KL 2VIRA 3VU2A 1DJSA 3F62A 3CZEA 3FS9A 2GEQA 2ICEA 3PUCA 5BRZB 4XN4A 1QVOB 5T3ZE 1JGUH 4F7KA 4OKDA 3B9DA 3NA4A 1J88A 1NUNB 3SE6A 3I6LE 4JPWH 3DJTA 2PWGA 4X6CF 1IB5A 3BD3A 3QEHB 4HYTB 1XSOA 1IGJB 3UEQA 4F2EA 5LQBL 5DUML 2PKDA 4WWKB 2GSIA 4N26A 2LABA 1RKRA 2O61B 3NZHH 1E9PA 3V0VA 3I6LD 2C34A 1QLEB 2HYMA 4OIFA 3FUFA 3RL1B 3QXVA 5CEYB 5I5IA 4UT7L 5LXVA 5I8OL 2BVEA 4TOYL 3QPQD 3GXUB 4W9FC 2DL2A 3VD3A 4AI7A 2AEQH 4H88H 4DEUA 1FL5B 4LHUA 4XPGL 4XNUH 2KQMA 1FBIL 3WHXA 3D39D 4JFXA 4K3DH 4LFHG 4NT6A 2PCPA 2Y1YA 4JFEA 4LCVA 4OTXL 3X1BA 1J5DA 5I6XC 5DJAA 1M7DA 5B39B 1NPUA 1Y6NR 4JFQB 1ID2A 5E6IB 5SWZE 1B6UA 4KVNL 2G3MA 4QHUA 3KL0A 4ZSOE 4N20A 3GBDA 5D1QE 3ZU8A 1COBA 2WXGA 5C71A 1EX0A 1QHPA 2BSDA 4YDIH 3SBQA 4ADJA 2DWEA 4KAQL 2M8XA 1DQKA 4G6AC 1QBML 5FGCE 1N8ZA 3WKQA 4M43H 3QGVA 4JKPL 4JJOA 3D4YA 3K8MA 4KVNH 3UO1L 2IALB 4JZOB 3UDWA 3WIAA 3TA3C 3NVQA 1ETZB 3X3GL 4PG9A 5B4MC 3LH8A 2V2WB 4E9TA 5KYXA 3Q1SL 5E8NB 3T6ZA 1T3FA 3T2QA 4KRPC 2FCBA 4AE1A 1IZKA 4AT6A 1EO8L 2X6UA 4U7MA 4CUCA 5HYJE 3NPSC 2WQ8A 4TL5A 4IRSC 3CX5K 3CC5B 5EZIH 5FM8A 1QTSA 3T8XB 3MQIA 2DD8H 3WIHA 7TAAA 4TN9A 5IGXL 2H2PC 3FUKA 1HH6B 4OCWH 5FKAB 2H7WA 1FV1B 3CVIH 4YXHL 3TH3T 2NTFA 3HC2A 4AKPA 1NDGB 1IQDB 4XX1G 1WPCA 3OWEA 3TN0D 4Y19A 3ZRCC 3TFKC 3FTVA 3TCLA 5E4EB 3LNGA 1RHHA 1UUSA 1PSKH 4OZFA 1RFDL 3GO1H 3VI4A 4HKBB 2N4IA 4BA0A 2VXUH 1XGUB 3GBML 2EO1A 1VLXA 15C8L 2F5BH 3HTLX 4NZJA 5AW3B 4CRPA 4EZJA 1LE5B 3CZUB 1N4XL 4ONHB 4W9HC 4UNIA 4KUZL 4ZFFA 5D1QB 1AXSA 2GTQA 4DF9A 4S1DC 3IDXH 1SZNA 1TTFA 3NOIA 1G6RL 4RQQA 3UAEA 2UX7A 1FRGH 4I5BB 4H25B 3V79C 2J8UE 1KBBA 2BVOB 3SODB 1MFMA 4OZHB 2IGTA 4JFDE 1INDL 2HG5A 4MCYA 3HNSH 1HE7A 1ID5I 1DLHB 2E5EA 2G60L 3FU5A 4J6RL 3P0YH 3T0DA 4B0MM 3MUY1 1G94A 4R5XA 2EIZA 3WLBB 1M7UA 2F1EA 1RZPA 2JFCA 4MFHA 5KVFE 2QV4A 3K91A 3QJFB 3QNXA 4WGVB 4CAGA 5T5NF 4NI3A 5D1XC 5DMIH 3WXVL 1BVLB 4P2QA 2XA3A 3NAAH 3O3DA 2V5YA 3G5YA 3SO3B 3CIQA 1CFVH 5EC2B 1NL0H 1PX4A 3MLSL 1L7TH 5E95B 5IJBC 1AIFA 4KZEH 1VACA 4Z7QB 3AABA 5GS3A 1MJ7H 2P47B 4P2RE 4UT6A 5LWYH 3LKSB 3IJ8A 1QVOA 1RV6X 2JIXD 4F7TB 4KO5A 4HQQL 1CT8B 1V5JA 3FCSB 4BK4A 2JNZA 1UKSA 4LL9A 3KPNB 1KGXA 3HS8A 3CE1A 5FYJL 5IQ7L 3ARXA 2OTWA 2CA4A 2CCVA 3D30A 1XDTT 4POUB 4XBGA 4PRDA 2APTA 1TVHA 2PW1B 1C12A 2BS71 4FG6C 3VRIA 3ABLB 3IRCA 3IVKB 2FQDA 5B8CB 2YQ3A 3MUHL 3KMDA 1YO4A 1DUZA 3FB8B 2E27L 2OI9C 2XVLA 1K3ZA 1QBLH 3NCFB 4YDNA 4TTDD 3S37L 2CJ3A 3P3UA 4ZUSB 2QQLH 3GSRA 5C7XH 1IIIA 3E3QC 1HE8A 2FWOB 2QPFA 1PZBA 3NCEB 3QUXA 4GAJL 5DEFA 1A8JH 2YSTA 4KKBC 1S9XB 3ZMEA 2ORBH 2ARWA 1QHQA 4HF5L 3QRGL 5JIKA 4MA8L 1D5ZB 1TPXB 1WV7T 1EFXB 5EU5A 5A3ID 2IGFH 1WP6A 1N5AA 1XH3B 2MQGA 3TVMD 1GPOL 2Z34A 3ZXAC 1KXQE 4BRVA 2E75C 4GI8A 3FYIB 5AVZB 3U7YL 1JDDA 1KSRA 4OQTL 3OKNB 3K46A 3BIKB 4MQ7A 1R3IL 5GGTL 1SOKA 1C8QA 5D71H 3KYNA 1S9XA 2Z8WC 3QXWA 1A6WL 2IO5A 1I3GH 3HB3B 5F3HB 1YJDL 5MEQB 2VDKB 4NC0B 3S0PA 3ZE0B 5FW8A 2AAVA 2W91A 5D5MA 5C0CB 3IGLA 2AJZA 1TNNA 3DARA 2XWBA 3CGTA 3C8KA 3VMPA 1GCFA 4YH6A 4ZUTA 2V2WA 1I4FB 3BEVA 4FXGA 1T22A 2NY0C 2ZOWA 5FHBH 5IROA 2X4OB 3DVGA 5EO9B 2JTYA 3II1A 5E08L 2TRYA 3TPKA 3ZLQC 3KNBA 1RIHL 5HD8C 1FI8C 2QSQA 4LK4A 4QHLA 5J13B 1N5YH 2W07A 4TVUA 1KOAA 2X6VA 3OMNB 1XCXA 3X1GA 4BUQA 2X1XR 3VFTA 1UOLA 2KT6A 1WC7A 3QQ3A 4LQFL 1A1MA 3CFDB 2GK2A 2R0KH 3WUWB 4H26A 5TDOA 2J2ZA 2AGJL 5CCKL 4DVBB 4OFYA 5KBDA 3JSSA 3MLVL 4ALAC 3HJEA 1RP8A 1CBVL 5F9OH 3RWCA 2VN4A 3TEXA 3HZMB 5TGBB 4Y1TA 5DJ0A 2WIMA 3SPHA 4GFXA 2M1KA 3NBNA 1WZKA 4R7LA 4JAMA 3OJDB 5DRWB 3E8UL 5C09A 4WEBH 3KHQA 4DGIL 3GLZA 3BN9D 2XWTA 2IXQA 4UT9H 2UWEB 4NP4H 2NY3C 2OKMA 4MSWB 1KN2L 1NWPA 1Z9OA 3ERXA 4PJEF 5G55A 1M6OA 4RBPH 4BZYA 3SY0B 4Z7NB 4HHAA 4X6EB 1Q0XH 3W0WE 3B2UC 1IGTB 2OSLB 1AXTL 2YPKA 4TF4A 4LDCA 2B2XL 1PAMA 1R5WB 2SEBA 5I23A 4JRFA 2E59A 4QCIA 1UEYA 3QDHA 4XHJD 1N18A 4NFDA 3FSAA 1T0NA 1ZGLM 5FF6B 4B9PA 3TU6A 5ECGA 2GQHA 2WMPB 2QPSA 3QPKA 2F18A 4XVJL 1F2QA 1JXDA 4FFTA 4H20H 2VGLM 4PG2A 3BEWB 4ANVA 2EDEA 1EFQA 4GW4A 4S1DD 3UYRL 3OC8A 4Y4HC 2FJGA 2XNAB 1QW9A 2JCCF 3HRZA 4Q9BA 3RB5A 5I15L 5LLIC 3GRWH 2NMSA 5IB4A 4ZPTA 5GQBA 4DPRA 2LHAA 3NCJL 3A6BH 3ULVH 4XNXH 1B88A 1CLYH 3IMTA 3HZ3A 3U9PL 4E9WA 2P9RA 1P2CA 1TLMA 3QEGH 3PNWA 1Y1UA 4OQTA 1BOYA 4E0RB 4PM1A 2R8SL 1LDSA 3V0WL 3GMNA 2B16A 3DV4B 5EEZA 5HGHA 1MUJB 4DWHA 3U2IA 1FLTX 3HG1D 5DK2B 4ZT1A 3I50H 3TASA 5KS9E 4ZFOL 4RDQF 4UV7H 1U42A 2L04A 2B14A 3CDCA 3L4VA 3NMEA 1KCUL 4LCCC 4B9GA 5ETUA 2WQVA 4KKLC 4KI1A 3QFDB 4FCAA 5BVPL 5T5NG 4NLAA 4MJIA 4OB5H 1UGNA 1OE3A 4UQCA 5CUSH 2DZEA 2CR6A 3KWVA 5T1LA 4NSKB 3ESOA 4KJWD 2LGNA 1MREL 2FHCA 4HJUA 1WIOA 3D51A 1O7DE 4Y5VA 5T1KD 1X5KA 3FU9A 4TRPH 2F74B 2OJEA 2AXJA 4EI6B 5EWIH 4A04A 4U1KB 2OYKA 3JTSA 4KI5C 5LBGA 1AZZC 2C9QA 1ZHBB 2VLRA 1GS7A 4Y16A 2X89D 1QRKA 2OMNA 4HSCX 4QWWC 2VITB 4YDVB 3M17B 2OP4H 3GLEA 1A1NB 2HT4D 2VMJA 3D69A 1ZS2A 2AP2A 5K9OA 2EE2A 2DQEL 3BN3B 3QHZL 3QIUB 4PS7A 5D2NB 4DZ8B 3GUTB 5AW7B 1DP0A 1J8KA 2OPCA 2FEDC 3KVQA 1XR8A 4ZMVA 4I89A 3C5JB 4TV3A 5DVLA 3FN0L 4QF1A 3L9EA 3WN6A 2J1WA 3NJHA 4R90L 4NNXB 3ZKMC 4D8PB 4W68A 3QXAB 1FO0H 1XGQB 4LNVA 5DJ8A 1VAHA 1UVQA 3U36B 1JMXA 1HN1A 2VR6A 1QRNE 5ICZA 3CVDA 3GSQB 5KSAB 2Z8RA 3FHEA 2KMWA 3EHBD 5IMMA 2DTML 1PKOA 1XF5A 4LPTA 1NEUA 1AHWC 1BPLB 1D7BA 2DLFL 2H6UA 2I7SA 3V4VH 2W9EL 2BSRA 2IANE 4AVIA 1F00I 1KGYE 4LVHC 4IM8A 3UL4A 4CGUB 5B8CC 4OI7A 3RWIA 3UAJD 1Q1PA 2J8UF 1L9NA 3QISA 2HJLB 3U4AA 2Z92B 1HFUA 4NDMB 4YBHA 3VGAB 3A6OA 5K9KB 1WCQA 3EJCA 1N0LB 1C5DA 1NCDL 1T20A 2QSVA 4UT7H 4F33A 4N2IA 3NJGA 4R4FL 1P7QB 3MJGX 1AGFB 3OR7A 4G7SB 4NQEA 3SYPA 5KW9H 1T21A 4KHXL 1PY4A 2HX9A 3TBWB 2DJ4A 5AW9B 5A1AA 2F5BL 5B4MD 3LTVA 4X9BA 5D7JB 3P4LA 2DQTH 3FFCB 1SHWA 5A2BA 4H1LG 3SOTA 2QFPA 3VGAC 1DVUA 5F0PB 2C5DC 1E7UA 5DHEA 2YLKA 2K3HA 2WPGA 2YWZA 3TO4D 4EVNA 2IDFA 5JPNB 3WL9A 5KYYA 3MCLL 4H8HA 1Y6KR 2A9MH 1A4KB 3QO1B 4LOVA 4NYLA 3D25B 1IBHA 3HE6A 5AVYB 2WQWA 3RI5F 3AY2A 2FQEA 4F5CA 4KZCA 1KYUA 2X4SB 4JRLA 5DRZA 3QSKB 1XF4B 4JN1H 4PTTB 4WKXA 4ZMAT 1KB9J 2X4PB 3GM0A 1EDYA 4TSCH 4XP1H 1M05B 1ZSDB 5DS8B 2D9QB 2BVUA 4F8TA 1ZD6A 3LD8B 1IGCL 3O2WL 5LBSA 3O11A 2XNAA 2Z0BA 4G8EA 5GSVA 4WU5A 3U1QA 3V2AR 2X2JA 3P9MB 4JPSA 4N5EC 4WLCA 1GAFL 4A37A 4TQ8A 4GQRA 2VW4A 1BMWA 5GGVH 5IJVA 3VFUB 4Y4FA 4TNVF 3MGAA 3FO1A 3O6ML 2NXZB 5IHZA 3ZKND 4C56E 1CDYA 4W9DC 4BH7A 3UJJL 5EORL 5JYLA 3MRJA 3NIFF 3AUVA 2Q7NA 4MNHA 1H0DA 1TOXA 3EDDA 3CFJA 2X6MA 2NDGA 4FNLH 4S1QH 1OAYL 3PL6A 4FG4A 5IVNA 4Z7NE 3GXPA 3VXRB 1XCQA 5F2FA 2VDKH 2Y7QB 1OSZA 5CZRA 1RIHH 1N5YL 4UILL 3KYMA 4DT2A 4IK7A 1OTUC 5E5MA 1E4HA 1E9PB 3V0VB 1WHOA 1NFDA 3KJ6H 4LARH 5F1IB 3C8HA 2IG2H 3QHFL 3RQ3A 2Y69B 1KTDB 1I8KA 2K4WA 4FJZA 4LRNH 4R6UA 5C09E 3LN4A 3ZYZA 1NMCB 3EYFB 4MAUL 3ATFA 3BIBX 3EJSA 2VXTH 4K5LA 2D3LA 1SY6A 4QHNA 5IVXE 3CFJB 3QCVL 3QZPA 2PPCA 2X4QA 5LNGA 2G5RA 1MPAH 2FO4B 4Q9CA 5F9OL 2WXJA 1JK9B 4IIZA 4YE0A 5I6NA 2E7CA 2HFEA 2HXAA 1XVSA 1SFDA 5D1ZB 1JXKA 4GKSA 5L8JB 7PCYA 2HT3C 1PL3A 3HEIB 4ZS6D 4J3WA 4HF5H 4FMFA 3SYAA 1BM3H 2QADD 2FL5A 1E3XA 4XHQA 1XTLA 1J05A 3NTCL 3KDPB 1SOSA 3MPCA 3T1FA 1EMTH 3GDCA 3B9KB 3S8GB 3BGFB 4XPHL 5CWSA 1BLNA 1WBXB 4N2GA 2OK0L 3SOBH 3FAXA 4PU2A 2QHRL 3T6VA 3BLBA 4BFGA 3ULUL 3BAYA 3CVHA 4NQSA 3QI9B 2GT9A 4CMMA 2P8MB 4K23H 4B6ZA 1CTOA 2HCZX 2JSFA 2DWEB 5JZ7C 3ECVA 4PCKA 1TKWB 4I48B 5MP6L 1OAXH 1U8QB 1OAUH 1SYSB 2Q7AA 3I02B 4GLRI 4P5TB 2AQPA 5K33A 4LCYA 3O3EB 4TQHA 5CP7A 1AR1B 1S78C 5D1XB 2HVKA 2VSKB 1KJMA 2BX5A 3W3BA 1PF3A 1WH0A 3PWUB 5MP6H 1NOAA 4C58B 3N1QC 2O72A 4L29A 5JZ7D 1CIUA 2DM4A 1INQA 2X4QB 3MLUL 4W9IC 3LQAL 4APQB 1FHNA 4K7PY 4Y4KD 1KGCD 2MCG1 1SVCP 4PRIA 3DNKA 3QIBB 3GD1C 4OLYL 6CGTA 2B4CC 4I87A 5I6LA 4KV5E 1SXAA 5FYKD 2VN5A 3QK0A 2XQ0A 4HJGA 3CFUA 4NRXB 3BQVA 1CFMA 4KK9C 1X4XA 4AXWB 4XNQB 1FC1A 2XXCB 5AYUL 1RUKL 5I16A 1IGJA 4BJLA 3IE9A 5D1QC 4Z3JA 4HPOH 1Z7JA 3T6XA 4YDLB 2HG0A 1QSED 1PIGA 3TA3D 1HHJB 4QHLB 1ZHNA 4Y8DC 4FFZH 2X53A 4MB1A 4KK8D 1T0OA 2E7HA 1VFMA 2AJSH 5DVNA 2VLKA 1J0IA 2CBMA 3LOWA 4ODTH 2ICEB 3SDYH 3SN6N 3T2LA 3T8XA 3UEZA 3LRSB 2P48B 5I1DA 5DEJA 2IH3A 3MV8B 4M7KH 4XB7A 3EO0A 2IBGA 4MXQC 2HTKC 4NENA 4K0OA 1M7IA 4P2RA 1A6WH 4OU3A 3SE8H 4DP5X 2F54E 2CLZB 3S9DB 4PJBE 4M9OA 3IMVA 1CF1A 5F7YC 2A4EA 2VLJD 5DUMH 3WE6B 3QRGH 4CU8A 3BRGC 3NZ8B 5AAPA 5LN8A 3EGDA 1NBYA 4MWFB 3FBQA 5E7BA 5B7MA 1FHGA 1OL0A 3PWJB 1UYWH 5FYLH 1A4BA 2O5XL 4CC1A 3G6JB 1SOQA 4XCCL 1TMQA 3QPXH 4HWUA 5AKTA 1ETJA 1JTOA 3RJQB 5F7MC 3WKPA 2HJFA 1XF2A 3VXSA 5BO1H 2CNYA 3ARGA 3SJVD 4ETYA 3OF6D 3NCYS 1BVOA 4GH7B 3D2UD 2X4RA 4OZHF 4W4OA 1KYDA 3T4AA 3FTUA 2IBZX 2N7BA 35C8H 4EI5A 2NT0A 2AK4A 3EW3B 1CLYL 3LRHA 3U9PH 1UOWA 5B38A 5E4EC 3M8OL 2X6BA 1A9BA 4U0QB 3IVKA 3OJDA 1WCBB 3QAQA 4P3CL 2ICEC 3PE9A 5GGUA 1MLCA 3NZHL 3L3JB 5DGQA 1JYVA 4RMRA 1YEHH 2Q7YA 35C8L 1W0WA 5LNDA 5EIIA 2UVFA 1K9TA 3IGFA 1FZJB 2VDOB 2HFTA 3LZOA 2IH3B 4P05A 1IIKA 5D7JC 4FFVD 1IT9H 4FERA 4ELME 3SDXE 3N1FC 4Q6IB 3ZDWA 1P9MC 2K8QA 4M3KB 1A6ZA 3DRTB 5LB1A 2X44D 1M1SA 3II2A 2JV6A 3OAYK 5CR1A 1DVFD 1MCNA 4LOEA 2X4TA 2NNRA 1A6TB 3HAEG 4K9EC 3WDJA 4HUVB 1XGPB 2DKSA 5DJCA 3VJ6B 3H6AA 1MAJA 5I30H 1WIPA 3L9YA 3KHOA 4PJDF 1F11A 1MFAL 5DJXA 1XR9A 3H8NA 1SPDA 5IQNA 5MEQA 1GGIH 5T1DH 3K3QA 3RA7L 3VXTB 3ATEA 2R29L 5I8EA 1U8NA 4PJBA 4NP4L 1RULH 4M1DH 1QNZL 4DJMA 2EECA 1MRDL 2HT2D 4Z77B 1AD0A 2KKQA 2D31B 3RTQC 4QPEA 2OMTA 5I15H 7FABH 2V5TA 4BZ2H 2H0JA 5IOPB 4J6IA 5F7EL 4CILA 1JGEB 2V17L 1BD2B 4H2AA 4NQCB 5C0GB 3ZYJA 2BSBA 3SQBA 3KWUA 4JX0A 5ACLA 3QDGD 3FN0H 2IAND 1E50A 2J8OA 4OUOA 3PQYE 1D7FA 1WO2A 3VQ2C 3BZFA 4HIJB 3QG6A 5IUSA 1SY6H 4DPBX 1CFQA 2F54B 1MI5D 2X4NA 1GAFH 2DEXX 3BHBA 4YE4H 4Y2OB 3ZSTA 5IMLB 4HWZA 3A4DA 3A3YB 4PRIB 4G43B 4TNFA 5GGQL 4F9LA 5B3JF 1F4WL 4LHUD 4OZIA 2R7EB 2I07A 1D7DA 5EBLB 3V0DA 1FN4B 3VCLB 2AANA 4ALAL 2C1PB 2WIIB 1S7UB 4PJCA 3P11L 4W93A 2ROYA 1LWJA 4I2XE 1PG7X 1UH3A 3IAPA 4LCWA 4AMKH 5SX5K 5DUPL 3WELA 3V8CA 4CSTA 3HMWL 5IFJA 5B1AB 2WWMC 3QA3B 8PAZA 3LNHA 1X6NA 3MUZ1 2JKNA 2N59A 5EOTA 2XPGB 5IOKA 2W07B 2WK2A 1MFDL 3MDJA 4LT7A 1HSBA 5DLLA 2B39A 4NUQA 4PJFA 4XZUA 5EBWA 5KVEL 3AG2B 3FRPG 3FRPB 3E2HB 4PRHA 5EU6E 3VI3B 1R3HB 1I1CA 3PPEA 3BCDA 1RZKH 1R1CA 1DEDA 2VDOH 4OCYH 4OB5L 5F3BA 1CI5A 3HBZA 4GMSH 4AQEA 2ZCHL 1MVUA 2V8LA 3NPSB 1AZVA 3P4NA 4X99B 5D1XE 2F58L 5C07D 3LKRB 1M2OA 1YQVL 4X9YA 5E6IA 5AD0B 1ZTMA 4OJFL 3N04A 3B7SA 2QQLL 3GJFK 1XGYL 3MV01 4N2BA 1JHLL 2ZCZA 2WWOA 4OF3A 2I9TB 4GUQA 3ROLA 2ATPB 1MLBB 1OCCB 1X5IA 1DBBH 3ZE0F 1VFAB 3D39A 3SKOA 2AQTA 3T4AB 4IBYA 3ATDA 3SY0A 1PY9A 5FYJH 4C56A 4H8WL 5LNEA 2BNQD 2CHNA 4JLRA 1H6FA 1OW0C 2HH0L 4UDUB 1S4IA 4RRPG 5K59E 3F6JA 2CO7A 3BKJL 2UZXB 4FQLH 1N0XH 3MO1A 2A0LD 2C9AA 1XB6A 5HDWA 2Z65C 4OIAA 1YYMH 2X4UB 4BGLA 3HG0A 2ZUWA 2C1OA 3TT1L 5D4IA 4BE5A 3WNMA 4FXKA 5GHWH 1JF1A 1KLUB 3QE5A 2C3GA 4X6FB 4AOFA 2IWFA 3VD9A 1MKFA 3ARDB 4YXKH 5KW9L 5D1ZC 2ZWYA 5EMYA 1QSFB 2J8HA 3K2UL 4FTVD 4N2AA 4AC2A 1QFOA 3VFUA 3WSQH 3MLPA 3EYVA 1F4XL 1WTGT 2WLZA 2BNUB 4JO1H 3RAJH 1H19A 1SJHA 3ULSB 2ROXA 2DLGA 2Y25A 4FQPA 3WKNA 4OM0L 5D8JH 2VM3A 5DQDL 1NGPL 3QUZD 4BINA 3TYFB 4YSOA 3V0JA 4M6OL 2OMVA 4PBVC 1F8TH 3RZCA 4L0YA 1NEZG 1NLDL 1T03L 4AIZB 2YK1L 4EZMA 2XN9A 3BMVA 3UO8B 1EZLA 4E36A 1O6SB 1NFDB 4ZTPH 1MHPH 4WTZG 1MFBL 4C56B 1CURA 3B5TA 1ZLWH 2DQTL 2NW3B 1MAKA 1TJMA 1AQDA 3BOVA 3JWNE 4FFVC 4UQ2A 1B3JA 1TQVA 2CD0A 2WBJB 3ARGD 4HBCL 2ZICA 2EDDA 4OZGE 3SPJA 3QNYB 4XVUC 4ZFZA 1NIFA 3GZQA 1RJYA 3UGEA 5GGSA 4JKNA 3SQBB 2YK1H 1TUPA 1DJIA 1XGTA 1RFDH 2YAEA 3O6MH 2WANA 4FEMA 1S7VB 1ZJAA 1FFPA 2DWTA 3APFA 3QJUB 2AKRA 4LU5H 2FTAA 2XHNA 3MRJB 4ZO8A 4HSQA 4R8WH 5DD1L 1TZHA 3ML8A 4CBPA 4RCAA 4J3XA 4ZX5A 3ARBD 4YC2C 1DO5A 3IS1X 3U0PA 5FYKL 2JTDA 3BKML 4D0BA 1QAWA 1THCA 4IU3A 1UT2A 5GZND 5HHVL 4LMQI 4TSBL 3WFDH 3QZWB 3SDDA 1WUNT 3M6DA 3SZKC 2IOMA 3TH4T 3AXLA 3HG5A 2XJLA 5L6YL 1MHHB 2MCMA 1BECA 4UU9A 2IAAC 3K2IA 4PJAB 1EDHA 3WEOA 3IRZA 1NDGA 3RUGB 1IU1A 3FFCE 3PGDB 5KUMA 1W0YT 3HS9A 4F57L 4Y7OC 2HP4A 4PCSA 12E8L 2H1XA 4L4TA 4E2OA 4IU2A 2WBJC 3TH2T 4FXGC 2Y06L 4U1MB 1GIGH 2FATH 3FQWB 1X7SA 2DI8A 3LKNB 3QG6B 5E4AA 4M5ZH 5CLTA 5F9WC 4EVNB 2FEEI 4L8SB 3C5XA 4R0LC 5MEOA 2B2XH 2W94A 2ZYSA 1GC1H 5ANME 5ICYA 4OIIL 4KITB 4L2YA 1BMGA 4J3SA 1BVKA 3W2DH 3KPRD 3TN0B 2J7LA 1X5HA 4FDWA 3IXTB 4H5SA 1QLFA 3HLKA 4HCRL 2A9DA 3U2SA 3V5KB 1L5GA 4Y4KA 5A2IH 3UJTH 3UCQA 3V6FB 3WIFB 1KDIA 3WFEH 2R83A 3LN5A 4U31A 2XSKA 4OIIH 2NUTA 2Z92A 4NDMA 5GGTA 3VX0A 5K9KA 1NIBA 4R0LB 3VXNB 3LXBA 3U25A 4HLZH 5D1QD 3EH5B 4NBXB 4A6YH 3FNKA 3GSXA 4JDTL 3U4EB 3LZNA 4GQ9H 4YL4A 5JA9A 2N1KA 5CUSL 4OIBA 5F7AA 3JWNG 4A7GA 3DXAB 3C6LC 1A22B 1H5BB 3DGGB 5DUBA 1F13A 3JWNH 3L4WA 4GAJH 4E42B 1FCCA 5FAAA 4G82A 1ZE3H 3WNPA 3HC0B 5HHNB 3W5NA 3I50L 3CFEA 1U58A 4H1LA 1YA5A 1E43A 4LQ1A 4PJ9D 2FGWH 2XPYA 3AU1B 2CK0L 4LPWA 3UTTB 1K5NA 3MTXA 3P30L 4GP5B 1S7XA 3MRMB 1TZGL 2OP4L 1IBBA 2H32B 3N42B 1OGSA 1U2HA 2EE6A 5GRXG 2WXQA 2ADFH 3GRBA 1J1XH 4PJDE 4UYPA 2OMBA 1S5HA 4ERSL 4BFJA 2X88A 5F71A 1J5OH 4Z7UA 4M29A 3S36H 1I3GL 3BP4A 3SKNA 5AOKA 1KXVA 1BF8A 1A5FH 1SXSA 4TS6A 1N6QH 1HH6A 2QVFB 3RFZB 1B0GA 5DD3L 2AXHA 2X09A 3ET9F 2CBPA 1JG9A 4NUJA 2LFGA 1KCWA 3GS0A 2H2PD 4FYSA 2Y22A 1BQKA 1HU8A 4ACTA 1UD5A 4OZFH 1QACA 2VDNL 2VZVA 3X14B 4OCRH 1S6NA 1LO4H 1PPIA 2FQGA 2WVVA 1RZIB 1X5LA 3QEUB 1I9IH 4P48A 1VA9A 4CVWA 1K2DA 4ZOEA 1NAKH 4G8FA 4JFPA 4BK5A 1OXYA 2DQEH 3QHZH 3SSGA 3QWRA 4PB9H 2W88A 3VGHA 1CDCA 2NSQA 4WI5A 4QHMA 5IVZB 4KNSA 3GB7B 1T6WA 3KYAA 2GK0A 4XPBL 2OSLA 5AEAA 5IZ7A 1KNOB 1ONQA 1YMHB 4RMSA 1JVKA 2YARA 4M5YL 1A6VL 4UOJA 1IE4A 2HLAB 4DOHB 3A47A 1SYSA 4GKLA 2GBUA 4P5TA 3BVUA 5E2UH 5HGHB 2YQ2A 4Y9BA 2BHUA 2AQSA 5EFIA 1LP9B 1XX9C 4GP8B 1ZTXL 4JREB 2AEWA 3L3KB 4JMNA 3TVMB 3CMOH 3OM3B 3HR5B 4I0PD 1GCYA 3L4CA 1MNUH 5CIPH 3W11D 4DGIH 1MRFL 1YQVH 4TSAH 1SN2A 2DQUL 2YBRB 4U1GC 3RIFF 5D7LD 3V0EA 1B6DA 1S5HB 1F97A 1JDAA 4UZUA 3ZKXC 4ORGB 2WLYA 4S2SA 3N3EA 5IB4B 5IJDC 3HE6C 2QPEB 1JZ2A 4Q2ZA 1DHKA 1CFBA 1RK1A 5D7SH 1J05B 3IFNH 2JKIS 3OMIB 3TJEL 4TLUA 5F0LB 1OK0A 2A6IA 2O5XH 4XMKH 5IHHA 5EIIB 1RL1A 4LLVB 2ESVA 5I74B 3MRNA 3IPFA 4M61A 4ZBJA 3SZ6A 1T5XA 3MRBB 1HXKA 32C2A 5TJWK 6FABL 4PD4K 1KBGH 2VISB 1BQ5A 1ZHNB 2VM4A 1E5AA 1DJGA 2JCCB 6PAZA 2Y7OA 4A6YA 2F53A 3Q3GA 4NHUB 5AZ2H 1JZHA 1J9CT 3LY6A 3CLEH 3IT8D 1TITA 4XO5A 3HS0C 3O3EA 4JFFE 4ABQA 1XXDC 1ZE3C 5GRVK 4ANXA 1KBWA 4XMWA 4J3BA 1TZOA 2HJKB 4L8DB 4HGMA 4G6FD 4WI9A 2Z91B 5CJOL 1RAMA 1KIRB 4WO4A 3RVVC 5D2LA 2FE0A 2AI0H 3QWRD 2BXYA 3QNZA 4BK5C 3CZSA 1GGBH 3MC0A 3NZ8A 5BPPA 2PO6C 2JKWA 1DBAL 4NBZB 3ARPA 1CLZL 2YOCA 4I8DA 5F97E 3RWHB 4Z7OF 4ZNEE 3CVIL 4YXHH 3SDXF 5EF1A 4DP1X 3FCBA 1OSYA 4P49A 5ITBH 3NJXA 3OZ9H 4DAGL 3COOA 3A22A 4JDVA 2VDQH 4UIMB 3BPCA 5F9JB 1IAKA 3P0VH 3NCYP 4XPFL 3QWNA 1SLVA 2ADJB 4NM8H 3ABKB 2E6PA 4X4XB 5I26A 3K4ZA 4PJCE 4KMTL 3PWPB 3HHMA 5CP3H 3VFMB 1E9QA 1FNSH 4HPYH 4X9FA 5FV2A 1ODAA 3K8LA 1JD7A 4JHUA 1J0HA 4PJEB 1VKXA 4OJDH 3AS0A 3PS6A 4XBEL 5DCCA 5K5YA 4Y2NA 2F9BT 2IG2L 1YDPA 2YEZA 3R18A 1O9VA 3TBBA 4N1HB 1AJ7H 3ZDZF 4QGYA 3G5XB 5IBUG 4P2QE 3AUWB 2I5YH 1KXTB 2QHRH 3RUGF 4CNIB 1OGTB 1OGAB 2VSMB 3SYCA 4R84A 2UY6A 1XGZA 1P1ZB 1X9UA 4OF5A 5BZZA 3ZDXE 4GXVL 4YNYA 1S7WA 1DFBH 2QR0B 3I3BA 1NFKA 1KCRL 1RJZA 2DH2A 2CSPA 1EGJH 3KEHA 3QCTH 4R2GC 4H25A 4YO0B 4XMLL 1UJ3A 4F33B 5CJXA 1NBVH 4GEIA 1F4AA 1C1EL 4RNRB 5I17A 2Q86B 3NSYA 2AV7A 5F9AC 3H3PL 3GPSA 4JM2F 2DQIL 3FQUB 1MVUB 4LHJB 3P9MA 1YAIA 1NTDA 4NX0A 2XWJA 4MRBA 2VWEE 3RY6C 3FCUB 2P5ED 4AIEA 1X6LA 4GMTH 1YN7A 4RZCA 2QR0A 1CDIA 1O7SA 3O3BB 1LD9A 4O51B 3IE4A 3KCPA 3ECBA 1QKZH 2X2YA 3SBRA 4QRBA 3HI1B 3DMMC 1GS8A 2OI9B 1NH6A 2AJUH 5DFAA 3DTXB 4WAFA 5DWPA 3T71A 2N56A 2XXGA 1ETB1 1R47A 4NHCL 4Z0BH 2FJHA 3KM2A 3VD7A 1YDPB 4I77L 4KK6C 4QJ5B 3RIAK 4LAQL 4OCYL 3KAAA 4XH2B 1KJ2B 2GSGA 3CPLB 3FO9B 3OJ2C 4AW7A 2F7IA 2Q76B 1Z66A 3MLUH 1SVBA 3BGMA 2ADGB 5KVGH 1AC0A 5IW6A 3GMMB 5F96L 4R4NC 5JO5A 4XNZB 3GXFA 4W6WB 1ORQB 3ORJA 3QIUD 4YR6B 2FO8A 4NPYA 1FZMB 4ZUTB 4XN2A 5DJYA 4JFDB 3Q2LA 3CCHB 5C0FA 1GW6A 2MQCA 4HG4K 2A74A 3D2UA 4XWGH 1DQQA 4FNTA 1ITBB 3U0WL 1GYUA 4EPSA 3WMQA 1OSZB 1L3WA 1V05A 1JV2B 1JRHI 2ZP0T 4KKCC 1AI1L 5E1AB 2KLTA 3W11C 1S7UA 2VZ3A 1MVFA 3EYOA 3GBNL 1JRHH 4PJCB 5TFSH 4XCCH 1ERNA 3STZA 2FX9L 4NQCA 1MQKL 5C0GA 4G1EA 1BZQK 3NCCB 1FZKA 1RD6A 5HHPB 2VM9A 3LRLA 1P7QA 4FQIL 4LKCB 3FTXA 1NC4D 1TTAA 5GZNC 8FABA 2NY1D 2BNRB 3KLKA 4JDEB 5DJDB 4JRXD 4XGZB 1EAPA 5C9JA 3LN4B 4RFEB 3MRRB 2Z91A 3HRZC 2GY7B 3SYQA 5BZXA 3ZE1E 2ESVB 2F54A 2OXGB 3PWVA 1CD0A 3INOA 3BVNA 1VFUA 3A23A 4IJ3B 4PPTA 3CFBB 3VM7A 5GZOA 1A7PL 5A2JH 2YJLA 2JB6B 5L2KE 2Y07L 2VLLA 4TNVK 2F53B 3HHRB 3MGTA 4NHUA 1I75A 3MBEB 4GQQA 4AJ0A 4U1SA 3FO2B 4RMTA 3P2DA 4HOWA 3FQTA 3RPIB 3WS3B 4C4KO 1DVZA 5DYFA 1IM9B 5IVOA 4U2ZA 4TTGA 5C0IA 3U4KA 2G3XA 1HINH 4X8JB 2AJXL 1RZGB 3VM5A 4YSQA 5E00A 5KJRL 1SXNA 5C0JB 1DBML 3DPBA 3LKOB 1FYHB 2XZCL 4RMQA 1BJ1J 3RDTA 3GKWL 3L3OA 4MQXC 3QRFM 1D6EB 3O2DL 4BDVA 1P6AB 4HIEB 3BYTA 4RETB 4Y5VC 5EO1B 4JRXA 4ZMXA 4FADA 1NANH 3VD5A 4UTAL 2CMRL 4LP8A 1IGML 4MJJA 4Y1AE 3BPOB 1U93B 5C6TL 4NN7B 4Q89A 1VEPA 2ZZUT 2GKIA 1HHGB 5I5RA 2B77A 3Q6FB 3BZEB 3FB5A 3NSCA 2DAVA 4PYHA 4UTBL 4UM8A 1KTJA 3NRQA 4IDLA 4L5FH 1LK3H 2PN5A 2O5YL 1Q38A 2ZCKH 4YSTA 2C3VB 2UX6A 2YZ1A 3RU8L 5I73C 5SX4I 3WY1A 4GQZA 3L4UA 4RGND 2RTTA 5C07E 2G5BB 2XY2A 5T33L 4YUEH 4WK4B 4R97B 1BD2A 4K23L 4XCYA 2VXQH 1HZHL 2FNWA 4IBLT 1R5VB 4K7FB 3MXWL 2O5YH 3CZFB 3GMRB 5D4JA 2FBJL 3QDJB 3WE6A 2NLJB 3BSHA 3LB6D 3HZMA 5TGBA 4BFBD 1C5DB 3F58H 5I6XB 5GRUL 2VTFA 3ZDXB 4AMXA 4AL8H 1I1AB 3ULVD 1RZGA 2WMPA 2C26A 2OULB 2QT6A 3Q8BA 4QYOA 3H3BC 3MRKA 4TKWA 5DU7A 5MI0B 2Z0UA 1TF4A 5D7IF 4Y19B 2QGDA 2GBTA 4PBDA 1A6AB 4WI0A 1ZIBA 3LEVL 5KSVB 4KK5C 1CDBA 1USZA 2A6JB 3V52L 1EPFA 2K0RA 4M8VA 2R0ZH 4EN2A 5F1KC 2O30A 5D96B 2QVKA 1Q9WA 1QASA 2Y23A 4Y16B 4L3ED 5DUPH 4L1SA 3D06A 3FT9A 1MJUH 4MA1B 3C6LA 3WAKA 3TURA 1Y18B 2NXYB 3VD1A 1M7XA 5FFLA 2CBOA 3AU1A 4JGMA 1BIIB 2OCFD 3LS5L 3B9KD 4PW4A 3KDMB 4XT1C 2AJVH 1H3PL 1R5IB 3WJLA 1AHMA 5C0AD 3U0PB 1NCNA 5LGKA 1RU9H 2A6KA 3HOGA 1JERA 3CZFA 4ZXBC 1L9OA 3OWRA 4FYQA 5D5MF 3QJSB 3EZJB 3VSUA 4HJTA 3T0BA 1VCAA 3U30B 4NFBA 3ABMB 2AK4B 1SGKA 2CO6A 3FO1B 4NZ8A 5JHDD 4IMKA 3IWVA 5E1AA 4Q52A 4OF8A 5ERWA 5EEVA 3FDWA 4P5TD 3IEAA 4ATTA 4KK6D 5HP5A 4QUOA 2LFEA 1QSZA 2VQ4A 1TG8A 5JHLH 1EZUA 3KPSE 4NCC2 3KH3A 4AJYV 3BYYA 1B4LA 3V9CA 2VE6A 5DRXB 2A9BA 1M7DB 1ZSDA 5DS8A 4D7BA 4GSDH 4J27A 1IE5A 1IARB 1XBDA 3QRBA 3V5KA 3ABGA 4Y4KB 1L5GB 2OW6A 4BQ6A 3U7WH 2VLME 5HDQH 4IBTA 1HWWA 5HHXH 1JBJA 3DOSB 4NZTL 1F41A 1NBQA 4FFWC 3UX9B 3HE6D 1T4KA 4ZUUB 4G1MA 2D7MA 2APSA 3B5HA 3IETA 4B7LA 1BYPA 4G6AD 4NC1C 4EIZC 3G9AB 3US1A 4G7RB 4K5MA 4B9YA 5GXBB 4FHJA 2XTSA 4MXQD 4KU1A 1KYAA 5F0MB 1MF2L 3GQFA 5D1ZA 3FQ1A 1JP5A 2EVGA 4R96A 3BJLA 3DGGA 5DUBB 3EYSL 4UYQA 2NY1C 1FCGA 3F7VA 3L5IA 5I8KH 3S5LA 1E2WA 3EOTL 1MF2H 3CFBA 3HZKB 1AZBA 1ZGLP 3LIZL 3K1DA 5AAWC 4KKNA 5L2JB 4KHXH 3MRPA 4HWNA 3N50A 2RAMA 5ALBH 3RRQA 5T1MB 5DJ6B 1MNNA 1HAUA 1TVBA 3B6SA 2F19L 4ELKB 5BOJA 2W9DL 5E70A 1WDAA 4OLXH 4DTGH 1PEZA 2WGXA 2R2BB 3MNMA 4WKZB 1FNGB 1FORL 2NW2A 4UOW1 5C0ND 3G6DH 3MJ6A 1UVQB 2P5WD 3GJFH 1Z2KA 5F6IC 2XTJE 3WFHA 4AYSA 2VERN 1G9MC 3DO7A 4U05A 3UP1A 3EG9A 4NZUH 3RNKA 4V1DE 2N3JA 3U4EA 1WAPA 2WLMA 2J5WA 1AGCA 2CKBL 2F5AL 2ZOUA 3VI4E 1F3RB 3ARWA 1YY9D 4AQEB 4P9ML 2IF7A 3TJEH 2H6OA 1J5OL 4MB3A 3REVA 3A67H 4JR9H 1TZIB 1OARH 3CVHB 3M1OA 2XKSA 3CMGA 4IMLB 2OTUA 3EOYG 2QGBA 5F6HJ 5EZJA 2F8OA 3F12B 3GK8L 3MYZA 3TYGH 2LLNA 2X4SA 4LEXH 4XP5L 3RFRA 4PTTA 5E03A 4K3DL 5K9QI 3TGXA 4DQAA 1UD2A 2PP7A 2HWZH 1GGYA 1MI5E 4AYFB 1OKEA 4XO9A 1B0IA 3HA0A 2XQYK 3ZTJH 3QORC 1J0JA 2DKUA 5C8JB 2ZWNA 3FFCA 1IGCH 3O2WH 4H2CA 3DSNA 4PRBA 2QADC 3LNIA 3QR1A 1G87A 1WFUA 1IMHC 4RSYA 4TQEH 5C08E 2G60H 2ZXAA 1EXHA 1TU2A 2R0LL 3QC5X 4KMTH 5ACZA 1HK6A 1KGCE 2KPNA 4G9FE 2JJTC 1L0QA 2XYCA 3FMGL 2BP0B 1QTYT 1FP5A 4XTRD 1CUOA 2IOIA 1NGZB 2AABH 4N90E 4ZOAA 4AXWA 3IJEB 5I18L 1WWWX 3DI2B 3FQUA 3UPRB 5KS9A 3WHE1 4Q9RH 4Y1AB 1PLGH 1JN6A 1IBGL 4Z3EA 1UZ8A 3KVPA 5KJ7E 2BY0A 2DV6A 4HJ0C 1JFHA 2C3HA 3UTPE 3WNLA 3QVAA 4PWGA 3MLZL 4PWHA 2J25A 1NEZB 5HY9A 4EDWH 4R83A 2FEJA 1E3ZA 1MFNA 4M4RA 5IR1A 3ZRFC 4GS7C 3S96A 3V4UL 5LDUA 3U36A 2A73B 4ZTOL 1CFNA 1HQ4B 2C9UA 3LS4L 5LAXB 5IESL 3J07A 1T1YA 1ZVNA 3MRBA 2CKNA 4NXKA 3GSNA 2LLLA 3LD8C 3KDMA 2XN9E 5IK3B 1P7KB 1LJMA 4DW2L 1FUNA 3OXRA 1S7TB 3OAZH 2YO3A 4JFFA 3U1SL 1LE5A 1JHLH 1RUAH 2ZCKL 1FWXA 1Z32X 1UM5H 2X9ZA 2F53E 5HHMD 5KANG 2GT9B 3VFRB 4DP2X 4EUPG 2B5IB 4HIIB 3C87A 1CD9B 2JKSA 3OB8A 3RNQA 4E9RA 5C3IA 3SPIA 5HYJD 3SDDC 3OLEA 2GJRA 2X4PA 4JFTA 4KTDH 1G6RB 2OMYA 2ESVE 3EJZD 4M6NL 3ZE1B 1ZT7B 4KJPD 2WUCH 4GQ9L 4YDJA 3OXSB 3S35X 3D2TA 1IAKB 2FGZA 1F4HA 5HVFB 2JIXA 3MNZA 2OR8A 3GXMA 1G7HA 2FRGP 4JFOB 1O7VA 2O6FA 3MRLB 3C5SB 2YMTA 3RWHA 5IB1B 5D7HA 1MLCB 4MJIB 1OAXL 3VGGA 3GBLA 4AEIL 4WUKH 5JOPD 1P4IL 1NWOA 5FDWB 2IALA 4AWJC 4HZLA 4XRCB 2W65B 3M07A 4P2QD 3PDOB 4A7SA 4XAKE 2W95A 3GIVA 4MJ5B 3WBDA 2ZYHA 2EDHA 1E5ZA 3BW9A 4DVBA 4JKMA 2EIJB 1MWAB 2IV8A 5IFHL 1U3NA 2NX5D 1HYSC 3EGXB 2E7BA 3OSVA 1NAKL 3D39E 5F9WB 5GIRB 2Y36L 4KZDH 2YSSA 4OM1L 4OCSL 2NY7L 1IFRA 3PUUA 4L3FA 1J8HE 1NFDE 3MBXL 4V2BA 2H1PL 3R4RA 1V7NL 1LTXA 2R1XB 3LH9A 4LLUA 4W4NA 5F70A 1U3JA 5BZDB 5IHZB 2ZD0A 4G72B 1DFXA 4YEFA 5BQ7B 3PQYB 1HDMB 3E1ZA 4LHUG 3L1EA 4ELMF 1H6EA 4EDXA 2BW5A 2MRYA 4FZEL 2PUQT 1MNUL 3RPKA 5ESAB 2NNFA 1J8HD 4NBYB 1NMAL 3MRQB 4JG5A 4XOAA 5HJ3B 2OLDA 4JHAH 1DDHA 1T5WB 2WIIA 5T3ZD 3V6BR 2YKLL 2GYSA 5BZWA 2JJWA 2UWEF 4S2SB 1T0NB 4N2MA 4XCEA 2EZ0C 1X5AA 4LXFA 4MXVF 1AZNA 2QKIA 1CYXA 2HAZA 3DXAA 1AHWA 4DKEL 4NO2A 1H5BA 1KT2B 3I75A 2K8MA 1L9TA 2Q8AH 1FYTA 4FTVB 3R0MA 4I2XA 1CFQB 4JFFD 2VCOA 3WU1A 2NZ9C 3QAZB 4X4YA 3D4ZA 4GKOA 1NFIB 3MV7B 5DRNA 2NUTB 2HPOA 5HI4C 3RIAF 3AS2A 3UBGA 5H4YA 1XH0A 5J12C 3HBQA 5I66B 1KPVB 4JFYA 1RJLA 3KW8A 4LSTL 1AGFA 1WA2X 5KVEE 3VD2A 5CZXD 1OGAE 4LNRA 2IPKB 1TR7A 3HPLB 1B4RA 5IB3A 1ET8A 1XH1A 4NKQB 1BQLH 2BIQA 2WZPD 2APXA 4EN3C 3BVXA 5CEYA 1BZEA 1F90H 3TONA 4OLZH 3S3DB 4EI0A 4I3SH 1QI5A 4H8WC 1WC7B 5FWQA 4X4ME 1NSNL 5BJTA 1OB1A 3VJ6A 5DJYB 5BQDA 2OSYA 1EXGA 5ALBL 5I24A 2X7LB 4OFPA 2CDFB 3GHBL 4QXTA 5DJAB 1WG3A 4KDWA 1IBYA 1MG3C 5AVSB 3ARQA 3GUFA 3L1OH 4A7QA 4BBWA 1WA0X 2D9CA 1F6AB 4ZW8A 5C0AA 4F2MA 1BQHG 1UH4A 1G7LB 2AMUA 2B1OA 1IGMH 1MZZA 5H2BA 4N68A 1JPEA 1SOXA 2PCFA 3QUXC 4JPIB 5DHVH 3RJDA 3LRSA 4H8UA 2OZNA 3MREA 4FNUA 1FG2B 1NQBA 1U8IB 2OX5B 4E9VA 3O41A 5I1DB 5KBLA 3APDA 4QRUA 3K71B 1KY6A 3S96B 3ZDZE 2YXWA 4YHKH 3ML9A 5BV7C 3CQPA 4YDKL 4WW2A 2KH2B 3H1ZA 2NY3B 4XNAA 5JW3L 1KELH 3W2DL 5EF2A 4FQXC 1G0XA 1RULL 2NY4C 1UADC 3MXWH 3QJXA 3RWDA 3HUJB 4HS8H 5I0WA 4X6CA 1EDQA 1WT5A 5IMOB 3HN5A 4FL4B 1Y7VA 3IMBA 1W72B 3P02A 2B59A 3AQXA 1P6FA 1NC2D 1D5RA 4J3UA 3TWCH 3V4LA 3FOMB 5E94B 4H20L 3EBHA 4NZFA 1U8HB 4U49A 3F7QA 2CKBB 5EDSA 8FABB 3AWEA 4PMFA 1PSKL 5IJKA 5CJQH 2PYFB 3DHMA 4NZRH 4FGMA 4XBPB 4FFWD 4G8GD 4J5VA 3VI4F 2K7PA 3G6AA 1P4UA 1NZRA 1RIVL 2GITB 5DZOA 1MCOL 4CMHB 1UWXK 1CDGA 1NC2A 2A83B 4AQ1A 1IKOP 1FVEA 2ZJSH 3FT3A 3DVNB 3LN9A 4NIKB 4WI2A 3P0GB 4PP2A 2VJ8A 2VZ1A 3BZ4B 2W0LA 5F0JB 3GMLB 4X9IA 5KJ4A 4XCFL 3GTVA 3ZTCC 3TEWA 2OR9H 1KB3A 4ZAKD 4NO5B 1YECH 5BMFL 2F58H 4GSDL 5IF0A 1C1EH 1E5BA 1HHHA 2IQAB 5DZJA 2PYEA 2K70A 1WBZB 3H9ZA 2GSGB 3FO9A 3NACL 4UNVA 3UTTD 1CXEA 3LKOA 3QRLA 5K69A 4M5TA 3X13B 1CFTB 1CGXA 2WHVA 2BIPA 5KVGL 5MEND 5SV4A 3MXVH 3CQQA 4KJQC 4MDIA 2EDOA 2Y2TA 4KVCL 4MQXD 1U4FA 4YFLF 5SWZA 2E74C 5I6OA 4RFEA 4HJ1A 5GSRA 3N55A 5T1KA 1OTTC 1Z3GL 1TPXC 4H8WH 1INQB 2NYZA 1EMTL 1CE1L 2BINA 1RUAL 1QWUA 1M3IA 4YZFF 1FNGA 2NW2B 4MCYB 3WDHA 3D9AL 2XFGB 1IAII 4O2CA 2R29A 3WKYA 2XBDA 1A2YA 3WENA 1GVIA 2YPLA 1I8KB 1EA9C 5F1SA 2VN3A 3FTGA 3H9HB 2ZUSA 3BP6B 2HMIC 3QI9C 2AEQL 2B0SL 4L4VD 4Z7VA 1J18A 3CFNA 4ZOBA 4JL1A 4W70A 3L5WB 2J21A 4U6HB 5L2JA 2NNAB 3L81A 4MQSB 3SGDI 2NY6B 3BGFC 1ODUA 3HG1A 4AIZA 5F3BB 1UXMA 3C60D 3B37A 3HCVB 2XN9B 4UV4H 2OMZA 1R24B 5AALA 4WNSA 1R3IH 1EAPB 5C9JB 1UZ6F 2ARJQ 3AQZA 4JS7A 4RBPK 2DQGL 1V3MA 1HAWA 3O9WC 4RIRB 5C09B 4WTQA 2YD7A 1HQRA 5JNYB 4UILH 2Q6WB 3QPXL 1A0QH 3B9KA 3IDYB 3D85B 1SUJA 2SODB 5ALCH 1SJHB 1M2VA 1KCVL 3DVFA 1D2OA 1MH5A 4PJ8C 1SHMA 2Y7NA 9CGTA 5FA3A 2QSTA 5C3LD 2XFXA 4AGMA 3H85A 3UJJH 4CVZB 3ZL4H 4UAOB 1NJ9A 4AYGA 4X83A 3MODL 1UGKA 1T80A 2N1TE 1HCZA 2X2UA 1L9SA 1YN7B 4AGNA 3JYCA 2D0HA 4N8PA 1KCSL 3MO1B 5C2BL 3P4MA 5C08B 4B9ZA 2DD8L 4ZO9A 4OM0H 5EDXA 1KXQA 2ZXCA 3U1SH 2DJMA 5JXAL 2C3WA 4HUUA 3B1UA 3HG1E 2NUPB 2YN5A 4HT1H 7CGTA 4H0HB 3MV9D 4DO6A 1JZ5A 5ITFB 2QQKL