2N3JA

Solution structure of the alpha-crystallin domain from the redox-sensitive chaperone, hspb1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
MQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Heat shock protein beta-1
publication title Structure of the alpha-crystallin domain from the redox-sensitive chaperone, HSPB1.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2n3jA00
1EJFA 2WJ5A 3GLAA 2N0KA 4MJHA 2WJ7A 4YDZA 4M5TA 1GMEA 3QORA 3QORB 4YLBA 3IGFA 4I88A 2CR0A 2MNWA 4YL9A 3AABA 1RL1A 2XCMC 5LUMA 4FEIA 3L1FA 2Y1YA 4JUTA 3VQMA 3Q9PA 3EUDA 4M5SA 1SHSA 2KLRA 3VQLA 2CG9X 2O30A 4JUSA 4ELDA 3QORD 4YE0A 2RH0A 4PCKA 2Y1ZA 2K8QA 4YLCA 1WH0A 3W1ZA 2JKIS 3L1GA 2KMWA 4ZJ9A 1WGVA 3N3EA 2BOLA 2Y22A 4RZKA 5DS1A 3QORC 2N3JA 3AACA 3GUFA 1WFIA 1X5MA 3GT6A 3Q9QA 5DS2A 3L1EA 4PBDA 3J07A
chains in the Genus database with same CATH superfamily
1MLBA 4EI5C 1A0QH 1KV3A 1MCHA 3EZJB 4WU5A 3TEYA 5GS0D 1DLFH 4FNRA 2HG0A 1GY2A 1MRCH 5HHME 2NY1B 3P4MB 4OI9A 1Y6KR 4UQ3A 1NLBL 4WKZA 1F8TH 4G1EA 5HHPB 4NKMA 4TPRH 3ZN6A 5JPNB 3OMNB 3TEXA 3WD5H 3BWUF 4A55A 2NY0D 1HS6A 5C71A 3BMWA 2ZX8A 3D06A 3RAJH 1IE4A 4G7QB 5J9PB 4DEUA 3LZPA 2VERN 1MCEA 4Z7WB 5DTFB 4FA7B 4N8PA 5D7IB 1FNEB 1Y07A 4O2FB 1V27A 5A3IC 2WQAA 1LGVA 1QI4A 4KNSA 3WTVA 4JB9H 4OM0L 4YDJA 1HVXA 4NQXA 1KOAA 3IM1A 4N8VA 1J0KA 3I6KA 5FPIA 4M1CD 2CO6A 4AYDC 2YK1H 2CO7A 1MRDH 3M1CA 2NUTA 3R18A 5CEZD 4IJ3B 4HEPA 4QXWA 4NPJA 3SPHA 3KZ8A 1JXGA 2NR6C 1D5XA 4IIQC 5AVQB 1ZLSH 4L29B 3OKNB 3VD7A 3NZUA 3VWKD 1FH2A 4PBVC 1XAUA 1CICD 4JHAH 2PXYB 3IDYC 4ONHB 4ATWA 3KPQA 5DK3A 3ARDA 4Y5YC 8CGTA 5EF2A 2VMFA 5ADOH 5IZ7A 1KYAA 1W0YT 4PJ8B 4F9LC 2Z7UA 5JIIA 1T66C 4PGZA 4B6ZA 2FJGB 3EHBB 1TVHA 1G7HB 1JHTA 5M94B 2OJZH 4OLVH 1A4KB 2F7OA 1N64L 4OGQC 4PUBL 1DDTA 3T0EC 1DEEB 2F19H 1E9PB 5JIHA 4DUWA 1I8IA 4JQXC 5F8RC 4Y19A 3W39A 4Y5VB 4OU3A 4PJAF 5DFVC 4M29A 4BH7B 2IPKA 4I9WE 3L9EA 3KBHE 3T3PB 4G8EB 4H0IA 5EOQH 4U0QB 4FMFA 4GRLD 4WHYH 4HW6A 4HOZA 3IMUA 3CFMA 4BJLA 1K72A 2BSCA 1NFDB 1J5CA 2GI7A 1IJ9A 1MW0A 3H2PA 1YNLH 3IEAA 3P0GB 4JRLA 1L5GA 1IILE 1YLBB 5GS0C 3EH3B 4W6YB 1AZZC 4XNYL 5BZZA 4L0ZA 4HAFA 1P53A 4KVPA 4Z7UF 1FFNA 2YAFA 5ESVB 3WHXA 3CU1A 3UIZA 3ULVD 5DR5H 5T1MA 1QR4A 1UJ3C 3CFEA 4MQ7B 2P42B 4JLRA 2NY0C 3FQWB 4OZFA 3H9SE 1GW0A 4OFIA 2OMUA 5D2LE 1JRHL 3M7FB 4PRAA 4YSTA 4XMVA 3Q3GA 5DD3H 3J8F7 1RJZA 4M5ZH 3UTSD 4PJ5A 2IG2L 1EFXD 3HOGA 2DIAA 4Z7OF 1S5IH 5IHBA 1JGLH 1INDL 4QCIA 5FO9B 1VKXA 3VXUE 3DLQR 3GHPA 2FEEI 3UC0L 4JRXE 4LOUD 2F1AA 3ZTNH 1LQBC 3MV7E 3G04B 1U92A 3PDOB 3WIHL 3DURA 4ZYKA 2CHNA 4TNGA 2YFNA 5GRWA 5ELIA 4G6KH 4WI5A 3I2CL 5B21A 3KVPA 4P4KB 1IAOA 4EMZA 3VWKC 2BNQA 4OFVA 4P48A 1CIUA 4I3RL 4PJCB 2VT0A 3OAUL 4UT9A 3SQRA 2V8LA 2EYSB 3OZ9H 1XQ4A 3WE1A 3IFNL 3ES6B 4PG2A 1V8HA 1I31A 3DC0A 3N9GH 3K71A 1UZ6F 3DX6A 4UB0H 4YHLH 3L48A 3FU0A 5EO0B 1HINH 3UAEA 4QRSA 4N2LA 3QNXB 4ZUTA 4GAYB 1T7YA 1WWAX 1K4CA 4JG0L 4W9EC 4YGVA 4ZZKA 3TPUA 5BPPA 5J8OA 3QARA 1DO6A 4FQ1H 1I9EA 4RSYA 5LCVA 4A7UA 1D6VH 1M7UA 3MRLA 4H8QA 5E8EA 4GRLC 4KJWD 5HI4D 2R56H 2AP2A 2Y07H 5JW4Q 3I9IA 3BAYA 1CDCA 4R0LC 4HPHA 1EWHA 3S5LG 4WGKA 2KUTA 3PIQA 2XPZA 1JWMB 2EIMB 5LBSH 4M8QA 3LIZH 1IKFH 3VB8A 2OP4H 2JH2A 2X4OA 3GJFA 3GRGA 4Z7WE 5C0BE 4F3FB 3GQFA 3VE0B 3T8MA 1Z9NA 1G7LA 1PLAA 4LRIA 1Q0YH 4TVSa 3QIBB 5E2JA 4ZFOA 5I76B 4O2CA 1J5OH 4D9LH 1RIUL 5BQDA 1IM3D 1CL7I 3EO9L 4I85A 5E0FA 3QFDA 3RDJA 4OZ4A 3AT0A 4QHMB 4HK3N 1GYWA 4EBQL 4Y2LA 1KEML 3NJIA 2WCSA 3CFQA 1LDPH 5JYLA 5FXCH 2ATAA 5F7BA 3RL2B 1P5VA 3P3SA 5AUMA 1CT8B 4HUWA 3P11H 3LKSB 4X6BB 3DMMA 3T04D 2DI7A 3GSVA 2YPLB 2WZAA 1SGKA 3DRQB 3ZTJG 1B6DA 3NIFE 4CN1A 2IDSA 4DP0X 4ALAL 3U1SL 3DIDA 4BZYA 1SNRA 1ZSDB 3FU7B 3V7MA 2E7HA 2D03H 1T1YA 1PQZB 1QO3B 4AYBA 1LWHA 3QH3B 3DGDA 2AFNA 1C8QA 1ZHBB 3H0TA 4G6JL 4PB0H 5EU7E 5B1CA 3EH1A 4Q9RL 4LOUC 1CD1A 2IWKA 2VLRB 3DX7A 3L5XL 1JNHB 3FK3A 4H7VA 4LZKA 1O7VA 1C9SA 1DO5A 4N9GA 5DC4B 1DUYA 1MLCB 4EOWL 1IVLA 3QNZA 1G9MC 3S37L 2WXQA 3T3PE 3FQUB 5I6OA 5JHLH 4TN9A 1NUGA 2WXIA 4GRWH 4V1DA 3O3EA 1NAML 4MCYA 4QY8A 3KYMB 4BFBD 5HPMB 2X3CA 3PJNA 3DV4A 2VDLL 3FO0H 3CZSA 2HRPH 1D7CA 4NOBA 1AC6A 4FP8H 2FAUA 1HJBC 1MAJA 1OE1A 3MA9L 3KL3A 5EWIL 5HDWA 4MJ5B 1YEDB 1U8KA 1OSZA 2EXSA 1M6OB 1LILA 1MFEL 5H37H 4X8CA 5LXGL 1A6TA 1BBDL 4IOIB 4EQ3A 1U4EA 1T0NB 1UXMA 2DD8H 4XO8A 3TFBA 3MNZB 4TLSA 4W9LC 1JP5A 4BWUA 5CJOH 5CD5D 1M9WA 2LGNA 3NGBC 4PCSA 2YPKB 1DQJB 1R1CA 5E1IA 1YA5A 4KJWC 4JY6A 4H8VA 4QOKB 1S9WB 4OIBA 4F2EA 2ZX5A 2YS4A 3MLRL 3NZSA 1A4JA 3OSVA 1WH0A 3ZO9A 1OAKH 1A21A 3NIGE 1CZ8H 2BCKB 4YNYA 1KCRL 2FYYB 3RVUD 3K6DA 4U1JA 4RZCB 1BA9A 1ACYL 1PDKA 4HWEL 3B5HA 4HZLB 4P59L 5IREA 3RZCB 3ATAA 1MCFA 1BJMA 4JPVL 3QZPA 2AABH 2A74B 2VR3A 2VJ8A 3CVHA 4PP2B 2VDNB 4XNXL 1N6UA 3H4HA 2F8VA 2K1MA 3I9GL 5F1IB 2X1WL 1NGXA 4FABH 4ICWA 5MHSD 3T2NH 5JW5A 1PTZA 4NZRH 4FFTA 4M5YH 5CU5A 4JRFA 3II2A 4BGDA 1P7QA 2VLMD 1WUZA 3DTDA 4S0TD 2WWMD 1AGDB 3LN4B 1CK0L 7PCYA 1KSRA 4P2CG 2XPGA 4ODHL 3U6RB 5FIEA 1JFHA 2I9TA 4GUQA 4WFED 3MOAL 3QDHA 3WEXB 1LEIB 1JPGB 4OZHE 4H5SA 3U0TA 4WUUD 1AGEA 3CVBA 1ILSA 3B7YA 3QFJE 1Z9LA 4MA8H 2BIPA 4P9MH 3DVNA 5CEZH 4P2RB 1AGCA 4HC1H 3DRTA 2VXUH 4DZBB 3A22A 4OM1H 1FDLL 2ETWA 2MCG1 4WNQA 4N0CC 1T03L 5A6LA 3SE3A 5KVFH 1FG2A 3RZWA 1HIML 1CTOA 1YUKB 4JPIA 2EE3A 2HLFD 2DQHH 2Q3AA 4R7NB 2UX7A 2VERA 4B7IA 4PV8B 1CR9L 4GAFB 2DMHA 4ZBJA 3BI9X 2WAQA 4G5ZH 4GY4A 3WNKA 4TNWF 5I6KA 5EULV 1IAKB 1BAGA 1U3HA 4DO6A 3NSJA 1FP5A 4OKVA 5HGDA 4HXAL 5CD5C 4IDJL 4DO5A 4PBWD 5DJ8B 1OAZH 3TA3D 2C1PB 1S9VB 2OMVA 1AIFB 1B4LA 3VVWA 4WENB 3B2VH 1BBJB 3WFZA 4EN3C 3AMLA 3KS0J 3OC8A 3JBG7 3MGTA 4UQ9A 2XJKA 3E2HB 5E9NA 2VWEE 2YPLE 1IBFA 3WO3B 1PLGH 1B2YA 3ZDXB 4Z7NB 4L3EB 4C55A 3MZTA 4DH2A 4ETYA 5ILTH 5C09A 3CFKA 2KQMA 2Z31B 4QXGH 4NC1E 3MJ8A 1OAUL 1E6JL 1QMUA 2OL3L 3CLFL 2OTPA 4ZNCD 4HOXA 3RIAF 4F2MB 2XXCB 4Z8FH 1CE6B 1JIBA 1U8JB 2ZICA 4ONOA 4GG8A 3JVGC 2Q76A 4OQTL 5IQNA 4LLAA 3OKDB 2ICEC 4IRJD 3RWHB 1J5DA 3TVMD 3A67H 3TBYA 3U7WL 4DKTA 3W0WA 1IIIA 3PWUA 2MQ3A 3LEVL 3S5ZA 2BMKA 2DH2A 2WWMC 4RISL 3MOQA 1XF3A 4AK2A 3HPJA 5E23A 3FTWA 4S1QH 4LGSB 2WLLA 3DSNB 1J8RA 4L23A 1DBAH 1VCBC 4RFEB 5DJZA 3T0AA 4YR6A 1QSZA 4QPEA 1QFUH 2D8KA 1WWBX 4AMXA 4P3DB 1HL5A 4H8UA 3LH2H 1G9MH 1NMBL 4W9KC 4X6DB 4P5TD 3MO1A 4DAGL 3GUTB 3KYKL 3NBNA 1NOFA 3BVTA 5FYLD 1BG9A 2WYZA 1FL3B 2VDKL 2GBVA 3BP4A 4B3VA 5ACLA 1NCWH 1EHNA 1CDHA 4UT6L 1L9RA 4NN5C 4KJPD 3V6FB 4ADIA 3HKZA 4P46A 4O2EA 4J3OG 2IBZX 5LJYH 3S34L 2BS9A 1R3IL 4F1SA 4QT5B 5KYYA 1H6UA 3VDCA 1MFAL 1E6OL 1SDAB 2X4RB 3BZEB 1FYTD 1B6UA 1QLEH 1BX2B 4FL4C 5E5MB 3KWWA 3WEBA 2PPDA 4HJJL 4KZCA 4V2BA 4HULB 3CXFA 2VRQA 4HKJA 3T6ZA 4HIXL 3FQRA 3TA3C 5TF1L 1J05B 1BVNT 4NRXA 2E76C 5DQDH 3QI9D 2AKRB 4JGJA 4BRJA 3EKCA 4BCZA 2EIDA 4XZ4A 1RZIB 1A9BA 5I8EB 1QSEA 4X9IA 5TDNA 2AV7A 1CTNA 2VH5L 5HVGB 3MCKB 4FLOA 3BRDA 1DBKH 4AVKA 4ELDA 4PJAE 4P2OA 1KIPA 2WXHA 4UOZA 3ABKB 1JUFA 1P69B 1KGXA 2J5LC 2X4QA 2LLNA 3ARFB 2HWZL 4JY4B 4ZMAT 2GT9A 4LEOA 3ZT7A 4I9WD 1P6AB 2GTZA 3K4AA 3QQ9D 4D0DB 5DSCA 2TAAA 4MYWB 2W60A 1T89C 4P2RE 4B9YA 1WTGT 2JKWA 1FL5A 1UB5A 3MV8B 2N0KA 1P4IH 4WFGE 5BRZB 4N20A 3B8YA 4FOMA 1A4AA 1RHHA 5IR1B 1E27B 2PCPB 5TDOA 4AE1A 2Z7ZA 4NAJA 5BZDA 3TNMB 3AWEA 5KVDL 4UTBH 3SQBA 1HHJA 2A1WH 3PL6D 1FVDB 1UZGA 2OL3B 4XCCH 3REVA 3FCSB 4LIQL 2FJFB 4PLKC 3WTTA 1XIWB 4HFWB 5IK3A 3VJ6A 1QBLH 3F12B 1RJLA 1ZV9A 3ZPDA 4F8OA 4DN4L 4AENB 2H26A 5IB4A 4D8OA 1FYHB 4B41A 1FLRH 3GFUA 2V4LA 3VG0H 3KPRB 4QI3A 1V7MH 1NJ9B 3BOVA 4KQ3L 4OVVA 4W9DC 4M02A 3RUGF 4GYBA 5AZEH 5K9QI 1HYRC 4NS0A 1GCFA 3OKEB 3P4OA 4O5LL 4KJPC 1TETL 2AQPA 4FXKB 5F6IB 2NY4B 1V05A 1QFWM 3QVAA 4M1DH 4KTEL 4J8RB 4HIJB 5C08B 3ZL2A 4LKCB 5DS2A 3IGLA 4HWBA 3VI3F 4F2ME 4EVNB 4QLWA 4AQ8A 4YIQB 2WV3A 4M5TA 1OF2B 3D18A 3QIUD 1PZUB 1H6TA 1W72H 4OD3L 1T5KA 4EI5B 5C0CA 3GMPA 1CGUA 3QI9C 1K4DA 1ZJAA 3WXWH 1F3RB 4QRQA 1JZJA 1KG0B 1DQTA 3W9EA 2Y69B 3ZYJA 3MCLL 2PTTA 4IOFD 4HJTA 5D72H 4RESB 1EVUA 1MJUL 3C9NA 3QUMA 4LAQH 1AO7B 3LDBB 2H8PB 1KB5H 2DWTA 3DHUA 4LCCC 1OGAA 1YN7A 2HRLA 1ND0B 3RI5K 4QHNA 3MRNA 1BEXA 4GW1B 4GT0A 3KJ6H 1HQRA 5J1SC 4OLEA 2A6DA 3QDJD 3C09B 5IMOA 4EIGB 3NCYP 1NBZB 1EH9A 2P8MA 4FC3E 2V5RA 4EIBA 4DIXA 4G11A 5A6MA 2GITB 4HCIA 1X5IA 5BQ7A 3CVIH 5I1LB 4JR9H 4KMTH 5I1DA 2G2NA 3PL6C 4WV1A 3NIDF 5CGYD 4HJGB 1VGKB 3EJJX 1IUZA 3RNKA 3ZKNC 1O5PA 3IDYB 2VDML 2FUTA 4PG9A 1WBZB 3K5RA 5HYSA 1JE6A 2D3VA 4NWUL 2BX5A 1CLYH 1WD9A 4ANXA 1ZT7A 5HHNA 1RI8A 3D85D 5LGHH 1AH1A 3GINA 3NCXA 4LFHD 5GZOA 4C56E 3EIFA 2IADA 2X70B 2EABA 2YN5A 2CUMA 1CGVA 3A23A 4XCEB 3JTSB 5FW8A 2DAVA 3U9PL 5H35A 1QPPA 1DBBH 2QELA 4Y16C 5DC2A 1KIQB 4X0KB 5LG1A 3S3BB 2VLKA 1HH6B 4ADJA 3GKZA 4Q74A 4TUKH 5DT1H 5AVYB 1FZMB 4ETQA 1MFDL 4KKLD 4Y4HB 2ZUUA 3ELAT 3BKCL 3KE0A 2ATKB 3RWDB 3T1FA 5IQLA 3U4BL 1JZGA 2X10A 5DUML 3QIUC 4B9PA 3B6SB 5MENB 2AJXH 2RQEA 5E94A 1UACH 5JORB 2P5PA 1J5IA 3RL1A 1MPAH 5BRZE 1EZLA 1O6TA 2B39A 1AY1H 3L9RA 3M8OL 2RBLA 4XNMB 4GKZA 1VERA 3Q43A 4PS4L 3HI1B 3V0WH 3BVUA 5HJ3A 5BCAA 2NNCA 1DE4B 1KGWA 2K3HA 2O5XH 3FB6A 4P2AA 4XWGH 4X8XA 2GW5A 4N2EA 1OALA 4RAVB 3IMSA 4TRPH 5JHMA 1HH9A 5F88A 3WFBH 3KLSA 2WCPA 1MAML 3QYNA 2BO0A 3DPBB 2C7UB 2JTDA 1BW8A 5EU3A 3QNYA 3LAFA 2NY0B 4GRMB 3BUTA 1R3JB 4JO4H 4KHXL 3QRGH 2PCFA 1ZIBA 2R1XA 5BVPL 3N40P 3LPPA 4HUCA 5EZPA 2E6QA 3KPOB 2A5UA 2ROYA 1XV8A 1DJXA 2XC8A 2UY6B 5PCYA 4FF9A 2QTEA 2QSCH 1PG7X 2A77H 3LXBA 1I7ZA 1ODAA 2D0FA 4KMQA 2F6AA 4I5BA 4Z0XA 3NZHL 4R5VA 2DQJH 1JAEA 3VXRA 2CK0H 4ELKB 2F53B 3SDDD 1CDGA 1U8OB 1UUSA 5CGYC 3WFDL 3D69B 5BJTA 4PS7A 5C08E 4J1UA 2NSQA 4F7PA 1CICB 3OR6A 3BO8B 3QQDB 3T77A 3HB3B 2E9GA 2BOLA 1DYZA 1EV2E 3F7QA 4U05A 3FU5A 4E36A 2BS71 2W94A 1AE6L 1G9HA 2IBZY 2LAGB 3KGUA 2X4TB 1DL7L 1UCBL 4XNAA 4R5XA 1S78D 4UOW1 1H9VA 2OCCB 3O9WD 4Z78A 3C6LB 3U6XS 5FYKL 2ZSWA 1RIVH 3E9UA 2TSBA 1XH0A 4N0UB 3GSNH 4JRYE 2ZF9A 3L3JB 5IVXE 4AEEA 3QS2A 4OGYL 5E00B 4ZPVA 3G6JB 4H13C 1IEBA 5J7CC 3TM6A 2UX6A 3RWEB 2PLTA 2BXZA 1CXHA 1J86A 1E5UI 1HFUA 3K72B 4AOFA 3OKLA 4LSSL 1QHOA 3UBXI 4HIHA 2A9ML 2VN5A 3MRJB 3WO4C 5K9OB 4XCYA 4I89A 1IU1A 2BZCA 2OSYA 2IOMA 4F27A 1J8HD 3VD9A 3B5TA 2SODB 1VFAB 3QAZB 4PMFA 1K8IA 5I5IA 1UM4L 4R83A 4BCYA 4MZ3A 2F58H 1KBKA 5IEHB 4Z7VA 4LLYB 2IANB 5DHYB 1GJIA 1D5XB 3RNQA 3L3OA 4M7LH 4RBPK 3MRHA 2VXQL 2X7LB 5D2NA 4U1LB 4BZ2H 3CSYA 1WITA 5EOCL 3SDYH 3UTSB 4X5PA 1BZ9B 1HHGB 1UADC 2YZ8A 5ESQA 1P9MC 7FABL 1BVNP 4Y9BA 1ECZA 3QWRD 1C16B 4AQAA 5B1JA 1M1XB 1DQQB 1Q9WA 2VJXA 4QGTA 4J5VA 3UO1H 4BFKA 4OD2B 1A4CA 4JO3H 4ODVL 4ZUVB 4C57C 4H26A 3FW6A 1VZHA 1JCKA 1UXLA 3QO1A 5D1XD 3A4FA 1T0MB 1EO8L 5SWSE 1X9RA 3LS4H 1ZLUH 3SDDC 4BQBA 4OCNC 4M93C 2H41A 1M57B 2XWBB 4E9WA 4DNLA 4YPJA 5A16A 1XR9B 2XYCA 4LIQE 4UQBA 3QDMA 1JV5B 5FR3A 3PDGA 2CA3A 2X9WA 3MNDA 2OMTA 1JD7A 2NUPA 2CJUH 2ADFL 4XVSL 4N0FA 3GSXA 4JANB 3L4YA 3RHWF 3QEQD 1VPOH 1PG7H 2QSQA 4ISVB 3PWNB 5GGUB 1S78C 1WT5C 1H0DA 4RFNB 3O9WC 4GW4B 4QXVA 3U2SA 1MHHA 3B7SA 4HKXB 1FN4A 3D2UA 3EJCA 3NZ8B 2QKIA 3CZLA 4S1DD 4FA8A 2W1NA 4OT1H 4D94A 4MCNA 1HE7A 2MQ0A 3MUY1 3N04A 4C4KO 1KGUA 1J10A 1EMTH 5EO1B 3ROOB 3W2DH 1T2XA 3BP7A 4ES8A 1JYNA 2YAPA 3J07A 1OZUA 1MDTA 4MAYA 2E3VA 5KEZA 1GZQB 5CLTA 5CJ8A 2BY3A 2QDVA 4BXSV 5GRJL 1B2WL 5IB5B 1KBBA 4H1LB 4NERA 4G6MH 3TWCH 3UJTL 3NK3A 4GMSH 1G6RH 1CTMA 2PO6A 2GABA 4XPHL 3RWJA 5IESL 2EIZA 4IMKA 3PHAA 1CDJA 3CN4A 3N91A 3APCA 2JJTC 4MNQB 3VQLA 1IM3B 4TSBL 4UAHA 1YEEH 4EDWL 4LSVL 1XT5A 5D8JL 1QABA 5FX3A 1FGNL 1LM8V 2ZUYA 2Q7YB 4I13B 5K39B 2M83A 1XBRA 4YSSA 1ZVSB 3HG1D 3VYNA 3WEMA 4XH2B 2ITFA 3F62A 2B1OA 4Q2ZA 1R0AH 2XX0A 1TQBB 3D50A 3INUH 5DVKA 3GBLA 3QDGD 2DEWX 4UV7L 5LNEA 4PRDB 5I73C 2VWEC 3GBNL 1OAJA 4DTGL 3GLZA 3LKPB 4LMQI 3WLBB 1CG9A 4FQIH 5DF0A 1DVZA 4NC1C 2Z8RA 1SOSA 4AJWA 3TZVC 4P0DA 1UB6A 4WEBH 1YEIH 3A6BH 1NINA 4LARH 4LGRB 4UQ2B 1N12A 3UAAA 3WNLA 3CVHL 3DIFA 2V2WB 4JPWL 3L3KA 4GI6A 2NW2B 4L1DA 4LSQL 4K7PL 2IAMA 1KPVA 1MVFA 1N5YL 1FO0A 5B8CB 4MA1C 4N87A 5BS0D 2NOYA 2EDTA 2YUXA 4PRIA 3T8XB 3BRFA 1RUQH 3HAEH 1FVEA 3IGFA 3TCLA 2V17L 4RRPM 1HSBA 3AABA 3ARGD 5DI8B 5EZIL 5E51A 5GRVK 4FQJH 1T7VA 2GBUA 1QNIA 3PIQB 3WYRA 1J0ZA 2ITCB 1HOEA 2Y24A 4FTDA 4GFTB 3ZXAC 2HZHA 3LYRA 4DVRH 1ERNA 4U0RC 4FFYL 4XB7A 1IC7H 4L1BA 3BWUC 1FFQA 2J6WA 2TRYA 2R0KL 1TZIA 1G1KA 3EDFA 4S1DC 2HFFA 2EDJA 2B16A 4YSPA 1ZEAL 5FDWA 5TE6L 5AAWA 4BBWA 1P2CA 1ADWA 2DL9A 2ZCLH 3BHBA 1HU8A 1NGWB 2DW5A 1X4YA 3TO4D 3DOSB 5L4FA 4JPKL 5F9WC 2Q8BL 1CDIA 3TS8A 2H3NA 3L4TA 4XC3H 3CN1A 3FB8B 2PWFA 3ENEA 4D9RE 2BH0A 2VDQL 4GKLA 4AKPA 3LNFA 2C4FU 4XVJL 5J6HA 5ABZA 3GIZL 3G6DH 1N10A 3ULAB 1C5DB 1L9MA 2ZTBA 1LE5A 2AVFA 3DX7B 5IHWA 2P8PB 1DFXA 4S1RL 4Y19E 3BPLB 3IFPB 5AYUL 2BIMA 2OMXB 1OGSA 3OHXB 4JFHE 5M95B 2L7UA 3ARBA 4I87A 3FN3A 1QQDA 5GHWL 3V0GA 1JWUB 3WU1A 1Q94A 2QVFB 3D2TA 1E9OB 2O5YH 3TV3H 5E2UH 4CN6A 4K3DH 4W68A 4M9OA 4OZGB 5DD0H 1D5RA 2EVFA 5B7EA 4IYKA 5AOKA 2JJVA 2GSGB 3C5JA 3UABA 1CI5A 2MRYA 1HX0A 1JWSA 1A1OA 1BFOB 4KKAD 3K8MA 1MWAH 3WTSA 1O6VA 2UYLA 1E50A 1MHCB 4HK0A 4KDTC 1M53A 1A6TB 2YXWA 5AVTB 4PJIA 5I2IB 1HXKA 5ALBL 1Z3GL 2FE0A 4POUB 2BVTA 3NESA 1PW3A 2H0PA 4U1SB 3U46B 3I84A 3GGWB 1PBYA 1F41A 3WMQA 1GIGL 1G87A 2DWEB 1OD9A 1HKLH 3MTXA 1AGBA 3WEOA 4PPTA 2GCYA 3ARGC 2IC2A 1KJVB 1A1MA 2EDQA 2RMNA 3PAVA 3WUWA 3HI6H 2FO1A 2DWDB 4EXKA 1SEQL 3V5KB 1SJMA 4PJ5E 5IROD 5BO1L 3LPGA 4MNQE 4HZ1A 1W15A 1UC6A 3BLKA 3V9FA 1ZHLB 4QYOA 3WL9A 4MJID 2ZG3A 4QIRA 4NNPH 2Y2TA 4RWYL 2FEEL 5FYKE 1B3JA 4L2YA 5B7MA 1SN2A 2EXYD 3NSFA 4R4BB 2VSKB 2QGEA 1BXVA 1URZA 4MJ6B 4WU7A 4Z3JA 3FT2B 2Y6SD 5FWQA 5F0LB 1CDYA 1UQSB 1C7SA 1SQ2N 3OKYA 3TO4C 2X53A 2WTRA 3LCYA 2R1WA 4LVOC 3VXPB 1IAII 2FJUB 3RGVD 3B9KD 2XV3A 3N06B 4UOJA 2P5EB 5I5RA 3EO0A 4Q6IA 4ZDHA 3VFRB 4QKTA 5FKAA 5GGTL 1N64H 5KSBF 4PUBH 1OXYA 4ZMZA 4YSUA 4ONGH 5GJSL 4FYSA 4OZIA 6PCYA 4U7SA 3ZKSD 1BF2A 2H6PA 5A1AA 4IRJB 3R4DA 1G0YR 4GO9A 2XXFA 2X4PA 5I0DA 3SGJA 3TVMB 1E5YA 2BOBA 2IIJA 3RDTD 3RBGA 1X5ZA 1MEXL 4YLCA 4LL4A 4HUVB 3UPRA 1RUKL 2EDHA 4OLUH 4U1KA 1GSMA 5DHXB 1MY7A 4H25B 3IJSA 1R5IB 1E4HA 1LP9F 1NIBA 4NN6C 5T5NG 2V2XA 5CD3B 3ESMA 1EJOL 2YGOA 2CLRA 3C5ZA 1RJYA 5C6TH 3VSUA 4XBGB 1PZBA 3VUAA 2ZUWA 4UZUA 4BFIB 1EAOA 3D05A 5MP6H 4P5KA 1P0SE 1NFAA 4ZX3A 4RAHA 2VQ1B 4RMQA 1CL7L 4U6HA 4P5TB 4OKVB 2R4RL 5CZKA 2EDLA 3CK0H 1H6EA 3S37X 4UILL 3OJDA 4KXZH 4QTIL 2GJRA 1WGVA 4G42B 2QHRL 3H1ZA 5J12B 5GGRA 5FUOL 2YIHA 4O02A 4QJ4B 5KAQG 4NQQA 3BAIA 1JRHH 4KOBA 1QWUA 1AP2B 3FTGB 2X2JA 2IG2H 2TRHA 3SBRA 3UO8B 2IFFH 3BRGC 1HWWA 3WJJC 2VLLB 5IROC 3WCYA 5HPOA 1YPZA 3UC0H 1FYTB 5A7EA 1QASA 4DP5X 3LXAA 4HH8A 1JK9B 3UACA 4HPOL 4EUPH 3KLQA 2W9LA 2OMYB 1NIDA 1MNNA 3Q2NA 2DQMA 4MS8D 4N2BA 3GS0A 3WIHH 1CXEA 5E9DA 1QNZL 2EXYC 3WIAA 3R0NA 5CP3A 1OB1A 2W38A 2W9EL 5D7KE 1E9QA 2Y6SC 1KJMA 3GSOA 4NBYB 4I3RH 3OAUH 2WXFA 2ZZUT 4U3XA 4OZGE 2PR9A 3IFNH 4PGJA 1JFQH 1E8XA 1EVTC 3RGVC 5C0ND 3B9KC 4G7VL 2BP8B 2X87A 1NKOA 3U7AA 3P3UA 3WN5C 2EE2A 3UZQA 3PUCA 5CIPH 4UM9A 5DFWH 1BCIA 4HWBL 3IDGA 5J1AA 3OKMA 3HNVL 3N0AA 1XGUB 4L8SC 3HFFA 3T4YA 1A2YB 1IBGL 4OH2A 1KWKA 3PPSA 1M2OA 3MRDA 3EYFA 4MB3A 5FYJD 3SKMB 3RDTC 4L4JA 1Z6JT 3P73B 5FECA 5TE7H 5FO2A 1DHKA 4YHIA 1EGJA 2XWEA 5EZLA 3X14B 4IBLT 3QUML 1IRAY 3I02B 2ZPKH 3QULA 2K70A 3MX0A 1J11A 3PV6A 4MAZA 2CLVA 1RIUH 3CMOL 3EO9H 3SE6A 3D6GA 1TLMA 2QT6A 4AGQA 3CZEA 4K5PA 3BH9A 2XIIA 4FMKA 4HWZB 4TSAL 5J6GB 3SE8L 3HJEA 1NCOA 4UDTB 5DJXA 1KEMH 5CCHE 2N1TE 3MLXL 1EBPA 2X89D 3STZA 1KFAL 3ARED 3FAXA 3ILQD 4UQIM 5GPRA 3AAZB 1BLIA 3INOA 4IRSA 3RWFB 4DP9X 3SCMD 4HIEB 1KXHA 3FRUA 3MHZA 5G55A 4Z76A 4YHMH 4W4OA 3VI4F 3RVTD 5TFSH 1OCWL 3TF4A 2P5EE 2LT9A 2FL5A 3A4EA 3GZKA 4DPCX 1NCIA 1S9YA 2P7TB 1SXAA 2OZ4A 2QPEB 4G6JH 3QR2A 5BV7C 3B9DA 4Q9RH 1NL0L 4AYGA 3L5XH 1SEBA 3LPFA 1BVLA 1Q9OB 4NEHB 2CGZA 3HFML 2UXVA 4IU2A 5F3BA 1XR8A 4EOWH 4X7SH 2BSEA 5J5EA 3O3DA 3GMQA 1R3KA 2WUCL 2XA8L 1NAMH 4ABQA 1I7TA 2W65A 4ZSOB 1NDTA 2VDLH 1C12A 2GUOA 2KLSA 4QXUH 5TK2A 2EQDA 3ZSTA 4D7BA 4MAUL 3UDWA 2PYED 5FYKU 1ORSA 3AXHA 5DEZA 5C0NC 3MA9H 2LFGA 5EWIH 1AZCA 3MRBA 4HA1A 4JFQB 4PJ9A 1MFEH 3UZVA 1QAWA 3KLKA 2JKIS 3BWAB 1YC8A 1BBDH 3HG0A 2J1KA 3BCDA 2NY5L 3U82B 1J0HA 3VQ1C 2WIIA 1EQWA 5DJ2B 1HHKB 1A6WL 5F44A 3GLAA 1QEWB 4CU8A 3ZU8A 4OVUA 2FX8L 5DS8B 4F9PC 3K4DA 4OY9A 2HFTA 4OV5B 4ZFGH 2PKDA 4Z7VF 3VFMA 3ARUA 2XLLA 4UM8B 1OE2A 3ARSA 1OPOA 3D52A 4YWGL 1Z32X 2ARJA 3X1GA 3B7RL 5LNDA 4GUOA 3I6LE 1ACYH 5C09E 4HUXA 5TDPB 4HWEH 2EECA 3BE1H 3JYCA 4P59H 2PWGA 3QUYA 3OGCB 4FG6D 5FB8B 3FUNA 3H3PH 3MBEC 3OZKA 2RR3A 2XN9B 1QHQA 1DBJH 3AU1A 3ILDA 2FIKA 3KLLA 4CRPA 2BZDA 3LEYL 4JNXA 3I9GH 3D85B 2DQIL 4C4KT 1YAZA 4E9VA 3QUZD 1JTOA 1BMGA 1QSFD 1EZUA 1XCTA 3VACA 3LVTA 2PPCA 4U3SB 3W0WE 3BZ5A 4A37A 3SCMC 4W9FC 4OGXL 2LAAA 2WC7A 3E6HB 2XIBA 4JN2B 5E2VL 1W8EA 4RNRB 3HA0A 3V4PB 1G84A 3RVTC 4X80L 1TEYA 5BXFA 1KXTA 5F1SA 4M6ML 3BIKA 4K8RD 4XCNB 5L7XL 3P77A 1C5BL 1FHNA 5JOPE 5C8JB 4KTYA 1AR1C 4DCQB 1G7MB 1H5BA 3B9EA 4JDVA 3IFLL 1N26A 4TULH 5EU5B 1FDLH 1T03H 5DC0A 5C0DB 2VAJA 1ZXKA 3G08A 3H9HB 3L45A 1TNNA 4XXCC 4WHYG 5AW4B 5HDBE 2RH0A 1BQHB 2VE6B 3NQIA 3V4VB 2V7HA 2WQWA 5E70A 3B3BA 4G8IA 1UWYA 5ESAA 5JIKA 1Y6MR 1F0LA 4WTZA 3ZE0B 2BVYA 5EIIA 3JV5A 4L9LB 2AQ3A 2MHAB 3CUPB 3ATFA 4IJTA 2B08A 2P26A 3FCTB 3HZVA 3MV9B 3NABL 3QRBA 4HCRH 4MS6A 3TIDB 4KNQA 1W0WB 2D7QA 2X2IA 4X5XA 2XCMC 5TJWK 4EO5A 4HXAH 1GY1A 4JFFA 4IDJH 1TMCB 2F54D 3ARDD 2J3SA 5I9QC 4CKQA 4L48A 1MCCA 1U93A 1MH5A 1R3HA 1TO5A 3QJUB 4M7JL 2D4DA 2KMWA 3P9LA 4XN1A 4K3EL 5GSRA 2YOAA 5LXVA 5IBUB 1ED3B 1QSEE 2CMRL 3DHJA 5FDYA 2A73B 1OAUH 1E6JH 2XTLA 3RX5A 3CLFH 1VFBB 4FG6C 3FB7A 2FDBP 3DYMA 2WQRA 3HPLA 5KYXB 3NACH 5I1IL 4OKDA 5C3LD 2VQTA 2EXTA 3US0A 1OM3L 1SOKA 3QUZC 5HGAB 2P24B 4KVNL 3AGWA 3OB8A 4NN7C 3LEVH 4GG6B 1NCCL 4ERSH 4HG4K 1X9QA 4RISH 3S3PA 4P2QA 5IKCB 4LHQB 5IP4A 4OR1A 1U9KA 1A6ZB 1ZHKB 3M17A 5F7DA 5FO8B 1WS7A 3I9PA 3L3DA 3UZEA 2EXWC 1F2XK 1OSPL 1N68A 2KQNA 4K8RC 4O4YL 2IQAB 2IBGA 1P5UA 4MMXC 1JPTL 3SPVA 3E7JA 4YMPA 5I6XC 1OO2A 1YMMA 3NTCL 4JHBA 4LCWA 3C2AH 2N7BA 2VDKH 4UYPA 4PD4K 3BUYA 2DKMA 5DQ9B 1J8HB 5DA4A 4UT6H 4NO0A 3PAYA 1BECA 5CM1A 3PUUA 3LOWA 3FT4A 2G5BA 1MVUA 1SJHA 1C08B 1A8JH 2O6FA 3RPBA 1R3IH 2AGJL 3QQXA 2CRIA 1M2VB 4OCMC 4YHOL 3STLA 1MFAH 1AQDA 3KPMA 4FTVA 4Y4FA 4HGWB 4LRNL 4XO9A 3DROB 3Q7JA 4K71C 2XN9E 3ZE1B 5KN5B 1RUPL 2AMUA 3FNKA 5GGSB 4P8QA 2YJLA 3OR6B 5D7JA 2BNQD 4KY1H 4HJJH 4HSAC 3BQUB 3P02A 1HYSD 3ARDC 1M7DB 2XI9A 1Q0EA 4ZUUB 4ODWA 5TF1H 4JZJB 4NIYE 3SZ6A 2H9GB 1YAIA 4MWFA 5C0CE 1R5WA 3OAYH 2AEPL 1A6AB 1DLHA 2J8UB 1K5NB 1BIHA 1U8PA 4XX5A 2VH5H 1KUMA 2X0WA 5DRWB 5EEYA 1FC1A 5L6YL 1PSKL 5D1XB 2R1YB 3MBXL 3RY5A 2HWZH 4LHUA 1ZLDA 1Y0LA 4XPGH 2E7MA 4NQTA 2WYHA 1G1YA 4PJDA 5F1NB 5J6SA 1ONQA 3IJ7A 4OLZL 3RWGA 3X12A 1PD6A 1KN2L 2LU4A 5HYJA 3DARA 1RZ8B 3LHAA 4LLQB 4HS6B 3GUFA 4J8QA 2YD4A 4LLWB 5D70L 1BMWA 4ABVA 1FFRA 2I85A 1PZAA 3GXNA 3VO0A 3WENA 4XBEL 1E7UA 5CLYA 2ZWZA 5K9JL 5C9JB 1MQKL 2FGWL 1OF0A 5KVDH 1D3CA 1M9SA 1E4XH 3H8NA 3HZKA 3VXTB 4CVWA 5IOPB 4L2LA 3FH7A 1FO0L 5H37G 1T20B 1UCTA 1EEYA 1BJ1J 3BEWA 3AS3A 3BMVA 3MV9E 3D4YA 1OAQH 5GS2D 4A66A 3L3HA 4DN4H 4ZXBA 4WK0B 5ACMA 2VITB 1BQKA 5CGTA 1G7QB 1RURL 1N59B 1DQLL 2JLLA 1URIA 2J25A 4GUPB 4MJ4A 1HHIA 1ADQL 1QWHA 1TYRA 4KQ3H 3VYPA 2G30A 2E9JA 2IV8A 3VRIA 2AI0L 1S7VA 3PG2A 4PGBB 4Y9GA 2E74C 3BPNC 1RL1A 3SIKA 5I1HL 4DN3L 4MX7A 2VLKE 2BPBA 4XNBA 5IOKA 4KTEH 1W2KT 3C5XA 3WFEL 4HCFA 3HG1B 3QJFB 4OAWB 2OMZB 4JZNB 2WBJD 4DKFL 5K59F 1U8NB 1CB4A 2WAHA 3X3GL 4BKLB 1VF5C 3QDGB 1LK3H 4AV5A 4V1DD 3F6LA 5ANHA 2XYBA 5C0EB 2NUPB 3EJTA 4GQPH 4OD3H 1HYSC 1AHMA 1EHKB 3L5WA 3N40F 2Z92A 5C0FB 2LTQC 3PNRB 5KYWA 5ETUB 2G60L 3FT1A 4PG2C 1QW8A 4UI2A 1MFBL 3ARWA 3PCYA 3GJEB 4LPUA 2N1KA 2EIKB 3GKWH 3MRFB 3II1A 5J0BA 2ESVD 3EYQD 3MCLH 4LBAA 5EOTA 1PZDA 2JCCF 5I1JL 1MJUH 1TKWA 5MEPB 3HUJF 1MRFL 3X3FL 3UAJA 3UC2A 4Q6KA 1GGTA 3OXSB 43C9A 5DWPA 2FNWA 1LD9B 3NCWA 5BS0B 2QV2A 4OJYA 2XVGA 3MBWB 1EANA 3NT0A 3LRSA 1OP4A 3FHEA 2CBOA 1I7UB 4WY7L 4KXCA 2NQDA 4Z7UB 2DJSA 1CDUA 1T1XA 2EJ1A 1UURA 4KC3B 3MLPA 3VG9C 1QA9A 2C9PA 4OTXH 4AEHL 2O6EA 2YBRA 3QQ3A 4LRIC 4MD0A 3ZMRA 4KRLB 2X2YA 1JGIA 1XZ0B 2PF6A 2FGZA 4IDLA 4Z95H 3MROB 3VXRE 4K8RH 3L1GA 1FL6A 3HNSL 3HE6D 4PRHD 4TYUA 4XHJD 5INDA 3VH8G 2ADIA 2OI9C 2VDMH 3IXTA 4I1PA 3TO4B 4NWUH 2QPSA 5FC9A 3Q6FB 4FHBD 4N8UA 2WBKA 4TUOB 3SYAA 4DESA 4KGJA 3DMMC 2JCWA 3QFGA 4Y4KA 1OCCB 1D5IL 3GSUB 3U9PH 4CJ0A 4I3SL 4BSVA 4Z77B 3VXNA 1X7SA 5H94B 4NZJA 1V3LA 2J8UE 1TT6A 4URKA 4H0LC 5EUKA 1BXAA 1HNGA 4KQ4H 1MFDH 3GSWB 5IHHA 5AQ0A 3BKCH 1R34A 3DX4A 2F8IA 2C4XA 2Y3NA 4BFOA 1IGJB 3HC0B 5DUMH 3EO1B 3BIBX 3CPLA 3SJVD 1KN4L 3A6CL 2GTWB 3IJHB 2JIXB 4PRPD 4ZO7A 2JVUA 1XSJA 2VLJA 2JQAA 3M8OH 2OCFD 1BREA 2HLAA 1L4IA 1SJXA 3MMEB 4PS4H 4GQ9L 4X8JA 3PNWA 1CLZH 2GY7B 3CBRA 4YH6A 1HOCB 1ZK9A 1WBXA 4MRBA 5IQ7L 1RMFL 4NRYA 4YZFE 4HETA 1PZ5A 4P5SA 3VTTA 1MAMH 1GMIA 5KBKA 1U3HD 2HN7B 3BC9A 3FRPG 4YHPB 5EF1A 3AS1A 5JW3L 1F1GA 2HUEA 3V8OA 3WTWA 5LDSA 5TQ2H 5LHDA 2LHAA 5IQ9B 3JV4B 1X5LA 4NYLB 5DHVA 1A22B 3ZTCC 4AIXA 1ET8A 4OCYH 5CEYB 1H6FA 4XPTL 1S8DB 3I85A 2FWOB 2VDPL 2WLHA 4F7CA 5C09D 5L8LB 2V9RA 4PRBB 3U4EB 3GHEL 2FATL 3RG1C 1U3NA 3NZHH 4Y1AD 3FQXB 1NBYA 4JE4B 2FBJL 1M71A 2IWGA 2Z4TA 5F0PB 1S5HA 2W0FB 5FYJL 2VC2B 3WFDH 4NQSB 1A3RL 3JTTA 1WK0A 1FNAA 2VDRH 2ZIDA 4XHJC 4ENED 2NT1A 4OZFH 4R26L 3SOTA 2ADYA 5KTEH 1EUUA 1DUZB 1ZD6A 4AQ1B 3T6VA 5IJBC 1M05B 1QVOB 1AE6H 5F7WC 3OKKB 1YSOA 1AMXA 3AG4B 3MUGB 2WY3B 3WN5B 2Z4QB 2CKBA 4TKWA 2A38A 4PJGB 4WI0B 1WFNA 3VFGL 2FQGA 3E6FA 5JHDB 4NO3B 4E9RA 3QIWB 4PJXA 1XHHA 4P5MB 2VXSH 3N5AA 2ADJA 1MCRA 4ZOBA 4GNKB 1OV8A 5M7QA 4YQXL 3OG4B 4HEMA 3X1BA 1V3KA 4KH9A 4OGYH 1HDMB 5ABDE 4IBUA 2H47C 1KNOB 1L9NA 2PN5A 2EH7L 3BVXA 3MXWH 4IIZA 3UTOA 3RRQA 1KENL 1OW0A 3SE3C 3CFBA 4UT9H 1CGSL 4LSSH 3KNBA 1RU9L 3UTQA 1PX4A 4K3GA 3LKRA 1YEJH 1JPFA 3K6IA 3ETTA 4LLUA 15C8L 2XKNB 3WUWB 1XCXA 2XFXB 3Q1SL 2DLFH 2VXTL 4HH9B 3D25A 1XFPA 3CSTA 3K2UL 4PWGA 2HXAA 3O4OB 3TEWA 4LPCA 4P57A 3KLAB 2H1LM 4NUMA 5E99H 5IIEA 1UM4H 3SDAA 3AQXA 1TPXC 1AI1L 3BEVB 1YN6A 2A6IA 5ICZA 1U3HC 2X42A 3BT2H 5LCVH 5DD1H 5SWZA 1JGEA 4I2XB 5DHDA 4KK9D 3VRJA 5IG7B 3FSVA 3GI8L 2CSPA 2AJSH 3B37A 4YLQT 4F2FA 5K1NA 4E5XB 1EZSA 3GJFH 1FZOB 1EGJL 5HYQA 1QKZL 5CCGE 7FABH 1D6EB 1QSED 3IKCB 4L4TD 4KZEL 3UBXB 5L9DL 2G4GA 3IF1B 5BV7B 4ODVH 2ZYHA 2BXYA 4YXHL 5EUOF 2DQFA 1U6AL 2VR5A 3U30C 1EO8H 2GJPA 5D1ZI 1MCIA 3LN5B 1OVZA 4JFDB 2V2TB 4ENEC 3Q2LA 2NX5A 5I19H 4N6RA 5FOBA 4W4NA 4PRIE 3KW7A 5ABAA 4CU6A 4M00A 3WNNA 3DSFL 2ADFH 2P80A 3NA9L 5HDLA 2ODIA 4RRPA 2OTWB 1RXLA 2NYYD 2VDPB 4F7TB 1XGPB 35C8L 4FNPA 5JW4R 3C5ZB 3SKNB 4CVXA 2RFXA 5CCKH 2OZ4L 1TJXA 1GMEA 2UWEB 3KCPB 4NXSA 4AW7A 4N28A 1ES0A 1I8LC 5G2NA 1UA6L 4XX1E 1TZ8A 3IBEA 5EDSA 3LEXA 2GTQA 2IDCA 2EYRA 5IMMA 3US1A 3DYOA 4GO6B 4RDBA 1DQDL 3BSZL 5T1LB 2WKLA 1WFJA 2AK1L 3LKNB 5IFAL 1FA4A 3ASWA 3KL0A 4HMDA 4NXKA 4YO0B 4IGBB 1BSIA 3MAWA 5GRJH 3T1WA 5B39A 5EU6B 1Q9LA 5FM5O 5TGBB 4IS6A 3RVVD 3U36A 3UJTH 4HJUA 4LPTA 4YJZL 3IN2A 4XPHH 5IESH 1UXWA 4P46C 1TTGA 1AHWB 3PFUA 4UBDC 5D96C 5FUZL 5GJTL 4TSBH 4A2HA 4EDWH 4ODUA 2WZ6A 5IM7B 4PJBA 4HKBA 3DX3A 2I25N 4LPVA 1FH5L 5L2JA 2GEQA 5I8OL 5A2KH 1SDDA 1B0RA 5E9DB 3IJEA 1JSYA 1VDGA 3AREB 2EIEA 5FFOA 2IDQA 2G75A 3RYMA 3GMRA 4KK9C 2ZOKB 3SGDH 1JK8B 2JXMA 3CDZB 3HE7A 3GBNH 4YVNA 3FOLB 5T5NF 4DTGH 3CN2A 3MACL 5LGYA 3LSOB 5IB1A 3TBTA 5D4HA 4X6CB 2I9LB 4KI1A 2P49B 1YG9A 1Q1JH 2QGDA 2Y9RT 3EDDA 4P2OC 2BK8A 1CQKA 2BY2A 4MDJA 3A4AA 3BKML 4WAFA 4UM9B 1F6AB 3QXDA 1XXDC 4N4YB 5T1DL 1N5AB 3CVHH 2RIKA 1BP3B 4LSQH 4PJIE 4WI8A 3LY6A 1OGAD 2R7EB 4BZ1A 3LRKA 2JK5B 4ZD3L 4A7VA 4JKPL 3TLRA 3M46A 5KAQF 1NC4B 2X4UA 5B7FA 3A47A 5EZIH 2O61B 5HGGS 1MUJB 2PYEB 1IGML 3FUMA 1VJSA 2NYYC 3BGMA 3CBJB 3S4SB 1YRKA 3FH5A 4K73A 1D5ZA 2XTJE 2RALA 4J2QA 3PV6B 2IH1B 2R0KH 3HI5H 3M1BB 4IBTA 2ODHA 4OLXL 4NUJB 4YGAB 1J5HA 5AYTA 1ZLUK 1F6FB 4HUUA 4AGNA 4B9JA 1ZEAH 4B53A 2KZ1B 5TE6H 3VSTA 1I7RA 5GZOD 2A6KB 5FAAA 3S9DB 1AZBA 2YLHA 5DZNA 1TOXA 5TH2B 4RIRB 1EXGA 5JPMA 3RVVC 2X6VA 5B38G 1T3FA 3UBFA 1FPTL 2VDQH 4KTDH 1IAIL 2VLKD 2OX5B 3CC1A 1KT2A 1GAFL 2XBZA 2E75C 3ATBA 3QCVL 4XVJH 1FQ9C 1M3JA 3GIZH 5F9JA 5G5DB 1T5XB 5CN1A 3ZKXC 4OZIE 4LEXL 5FKPA 1FNHA 3DV6A 1HK6A 2JB6A 3ARRA 4UNUA 5IHLB 1ID2A 1QSFB 5GHWH 3SKJL 4CVUA 1ICTA 3AXLA 2DQ6A 1TIUA 3NEXA 2CO1A 2P48B 4PJDF 4I0PA 1NEZG 2EDXA 3VXMD 3FU9A 4GQRA 2JJUA 1QBBA 3U9UB 3CSFA 4Z7QB 1TNMA 1D7FA 5TPWL 3COOA 3UJIH 2YEZA 1DSYA 2Y4SA 3TF7C 3NRQA 5BZWB 2FHFA 4MMXB 1OP3K 4A7GF 2APVA 3RTQD 3LKQA 3FO1B 1Z3GH 1F5WA 3W11C 4NQEA 2CDGA 4R2GD 1XEUA 5CHNB 1T83C 2HMID 1PL3A 1NH6A 1RZ7L 1S3KH 2EC9U 3EFDH 4L4VA 2WM0A 4TSCL 2X5PA 3O6FD 3LZLA 4HX1B 4LLVA 5IJVA 4G7SB 1ZA3B 3MYJB 1D9KB 3CDGA 3AGVA 1R19A 5GRYA 3WY1A 1J9TA 2I7SA 2XNAA 2Z3FA 2UXFA 4M43L 3VM7A 3L3IA 1E5ZA 1RK1B 4U3HA 4UINH 4PI2A 4EI6B 5EU6E 1AFVH 1SEQH 1R33A 1KZYA 3PJSB 4B27A 1AIZA 5BO1H 4I18A 3BZ4A 5F6HJ 5ICYB 1JJUA 4WV1C 4JFYA 1ORQB 2Z65C 2FECI 4MLIA 2OSWA 1YPZE 4HHAA 1DBMH 3QEHB 3RUGB 4RWYH 1LVEA 5ID1B 1NMCB 1SF5A 3N6YA 2CBPA 3MFFB 3BN3B 5CILL 2F54B 4Y8AA 2GJZB 5E9DE 2XVLA 4ZQKA 5IFJB 3KEHA 4L8CB 3W9DA 5GZOC 4R96A 3LZRA 1G7PA 3VI3B 2CR6A 2XKUA 3QQ4A 4XRCA 1EJ8A 3UL4A 1TSHA 3BAKA 1JDAA 2DM7A 3GMOB 3NJXA 3QWOB 5D4QA 2BCMA 1PCSA 2H0JA 2IDTA 3KYNB 3KPSB 4EE2A 4MVBC 5EU4B 1K6QL 4K7PY 4JGNA 1SXNA 1WZ1L 2VL5B 4N26A 1X5MA 5LN8A 4Q0XL 1QFWL 1MKFA 5F7EL 2CBTA 1CLOL 2YGPA 1GS8A 1JS4A 2R2EB 2X12A 2NY5C 1IKNC 3CVDA 4LCIL 2GFBB 3SE9L 1F4XH 5ERWB 2DY2A 1TZHA 2Y3AA 1KJ2A 3DTXB 5FOJA 5L88H 1HQ4B 2BNRD 2IXQB 2KLRA 5JZ7C 3EYOA 3T4AC 5KG9A 1MW1A 1YYLH 2H2PD 4FZEL 1JHLH 5DK0B 3BH4A 4RGND 4LOFA 4MA3A 2A6JA 3P0VL 2MMXA 1SFHA 1CBJA 3GXIA 3SGEH 1IEAA 1TQTA 5BVJB 2L7QA 5CSZB 2LU7A 5INCA 25C8L 4QNPE 2KERA 4G7RB 1R9FA 4R2GC 1RUML 3I3BA 3N1FC 2HMIC 3EH5B 2G9KA 5FM5M 5E8PB 3O6FC 4UILH 3VQMA 4QTIH 4WIQA 2QHRH 3OQ3B 5D1ZA 5EC1B 1E7VA 1R3LA 3BISA 3L9BA 1S3RA 4XZUB 4H20L 3OPUA 3VFSA 2EVJA 2HUHA 2BNUA 5C9KA 5C0IA 1SM3H 3MDJA 3MRKB 4F33B 3FO2A 1JYWA 4ZUWA 1EO7A 1D2PA 4LL9A 4ZG1A 2D4FA 2IALB 2AK4B 1BXXA 1A3QA 3HPLB 2OSLB 1E8YA 1QNZH 2EYTA 2CNYA 3QDMD 4YDKL 5KW9L 2IQ9L 4X4KA 3IAGC 1AGFB 1OTTD 1G4RA 3AJ7A 9CGTA 5IW6A 2LE9A 5EEVA 2WLNA 3ME0B 3QORD 3MRMA 1L9OA 4N24A 2ZKWA 5E2TL 1MFMA 1TUPA 2FZ3B 4JDTL 6PAZA 1JN6B 3TBSA 4IU3A 3ECVA 3DYPA 4G7VH 1PKQA 4UTAA 2WVVA 4Z7QE 2Q2EB 4U1HA 3L4WA 3D2UD 3PHQB 1WP6A 4HWBH 3BKJL 4M3HA 1UFGA 5E03A 4NZTL 1NBCA 2W92A 4AM0B 1GPOH 1P5UB 2D31B 3DVGA 2AANA 4PJFA 1CFSA 2OMWA 4MAYD 3VCLB 1D5MB 3F84A 1IO4C 3B3IA 5SV4A 5DHMC 3O3BA 2G9HA 3Q13A 2R2HA 2OQJA 2ZP9A 3VG9B 4NFDA 2ZKXA 3LQZB 5CNHA 1PEZA 1NIEA 3C75A 5T33H 1P4BH 2EEDA 2YC1B 2C7FA 2MPAL 3HAEG 1MFCH 3HC3H 5KZCB 4GXFA 1G7IA 2XBDA 5ES4B 5KJRL 3MLYL 3JV6A 2V5TA 2OJEB 4RGNC 4XWOD 5KSAA 1XF5A 4PWFA 3TN0A 3QUMH 2WKOF 1NCNA 2D3JA 1N0XL 1XF2B 5EA0L 2VR4A 1RK0B 3APNA 5IMKB 1INQA 1J9CT 2B8OT 4YDIL 4APQA 2G3NA 3OL2A 2QPUA 4UMGA 4JDZB 2J4WL 4TSAH 3L3OC 4K94C 4YBQD 3SE8H 5D2NC 1T6VN 1EDQA 2FQEA 2FTAA 1F1AA 5DDHB 5F1OB 1HESA 1KFAH 7CGTA 3EYSL 4X8GA 1DJGA 1JF5A 4UWQB 3JYBA 3VXSA 1G0XA 5B1JC 4R7DB 5E7BA 4GLRH 3ZGIA 4BD4A 3KBPA 4NQDB 1MXDA 2J8OA 4UV4L 4JMXA 5D5MB 1OCWH 2ZX9A 3VTAA 2CZNA 3SKOB 4JBSA 5FYJU 1CQYA 4FYTA 4MQTB 3KPSE 5B3SB 2WBJB 1UVQA 2E47A 3K5SA 4F93B 1ZANH 1M6UA 2IAMD 2ZCKH 1QLRB 2WLIB 4OCXH 1BFSA 1MCPL 2BVOB 1I1AA 3ZKMD 1FORL 3E8UH 4ZS6D 2E9IA 1HWGB 2K3TA 4JN1L 3HFMH 1QACA 4RMUA 4AM0Q 3D39A 4GSUA 4LT7A 2DI8A 1W91A 3RFZA 2XA8H 3QORC 4A39A 4G1MB 3BKYH 2DTMH 1DSWA 4MAUH 5T3XL 3DJSA 4L05A 1SF3A 3FBQA 2ESVB 3PQYB 3D0AA 1CFNB 5D7LA 4I88A 3BH8A 3IDNB 2FWUA 1URLA 5EBMA 1TZAA 3IMRA 3CC5B 3O3AB 4RQQB 2QKIC 4O51A 4FG2A 2Q20A 4GW5B 2NY5H 3KPLB 5GSVB 2WINB 1D5BA 5DYOB 5GGVH 5T3ZL 3FHAA 4N25A 2VW6A 4JFUA 4MAYC 1OB0A 2VR8A 1IM9A 3LZOA 4JFFE 5I6PA 2XZCL 2AXFB 4YX2H 3O8XD 4WJ5A 1T6BX 2Z34A 1U8CA 2PO6C 3MNVA 1I1YB 1REIA 3HRZA 4AJYV 4AT6A 4UTCA 3K6SA 4YWGH 1S7VB 3QDAA 2ZWLT 1VGEL 3FQNB 3A21A 4XWOC 3F7LA 1ODUA 4PR5A 4WTWA 4LF3A 4POYA 2C9UA 3HE6B 4BFJA 4PRHB 1U95A 3U0PB 4ZW5A 1I3UA 1OL0A 4XAKE 2COQA 2ZAHA 3ARBD 1ZTMA 1WC7A 3ISYA 3LEYH 4C59B 4ZW3A 2F7PA 1WZAA 2DQIH 4HGKC 1TG8A 4YBQC 4UAOB 3WFHA 3GT6A 4GRWF 2W07A 3GM8A 4DEPB 2MKLC 2XWCA 4YBHA 4BDVB 2A0LD 4ZNEE 1I9RH 4OGXH 2FYVA 2YGVA 2AQ2A 4TNFA 3NRPA 4I8DA 4HV8B 1CU4L 4P2QE 4TVUA 4AMKL 4X80H 1FCGA 1Z5YD 4DZ8B 4XBPA 4ZTPL 3D3VB 5CKAA 1N6QH 1IC0A 1RZGA 4KJYB 4M6MH 5L7XH 4M7ZC 5C0AA 1C5BH 1DVFB 2IAMC 1TFHA 1YO4A 4PJHB 4Y5XA 2FLMA 1CYXA 5D6DA 3ZKMC 4X98A 4ZS6C 3SJVB 3VGEA 4XI5C 3IFLH 2CDEB 1NFKA 3P1VA 4PRPB 3QPKA 2ZNWA 4YAQB 4EQ2A 1UYWL 2X4NA 1YMME 2ZKMX 1GL4B 1W0VA 4LCWE 4E41D 4HGMA 4A6YA 2ZWYA 1KGCE 3KXFD 5HGBB 4E68A 2CKBL 3OWRA 3Q8AA 4PGCB 5FO7A 3CXHJ 2Q8AL 3S96B 1CFVH 3VFTB 5DJCA 4L37B 1FIGH 2CIIA 2VZUA 4RAUB 1G0DA 4AYEC 5IJDC 1KCUH 3AM8A 1TJGH 3O4LA 3ARYA 4JFZH 3RJDA 1HHHB 1S6NA 4N22A 3FN0L 4G6FD 3NABH 1X6LA 3QW9A 3G9AB 4FTVE 4W6WB 1BEYL 3DGCR 2ENQA 5AALA 2OBGA 2OMNA 2WZPD 2BW5A 2XQYG 2J2ZB 3OXRB 1F58H 4KJQD 1U3JA 4OUUA 1FWXA 3DIVA 4J3WA 5SV3A 1DJWA 4U2ZA 1U8QB 5HHOD 3Q8FA 4F92B 2C3VB 4M7JH 1JXFA 2GI0A 1S46A 1B0GB 3BSGA 2NLJB 4K3EH 4I3GA 4KKCD 4Y1AB 4YEEA 3GB7A 4MMZA 1KTRL 1MG3C 2CMRH 5I66A 5D5ME 4AYID 1FJ1A 3DUUB 4PY7A 1RZQA 1XBDA 3EOBA 1RKRA 2AXWA 2UZPA 3EGXA 5DJ0A 3QNFA 3KDPB 4K94H 4PJDE 3WIFB 5I1IH 3ARBC 4G9FD 5F89B 2OYLA 3BAEL 4MMYB 4JAMB 1OM3H 4EUPG 4WFHE 2A4EA 4Q52A 5HYJE 4X4YA 2F08A 3IWUA 5JLZA 1HI6B 1VACB 3EGDB 1UWGL 1XAKA 2B2XL 5CWSB 4KVNH 5IB2B 4XCFL 1D2OA 2N7SA 2P52A 1O6SA 4ODXA 2DEXX 2CGRL 2V9TA 1RERA 1RHFA 1NCCH 3II3A 4XMZA 5DMGD 5HGHA 1I8KB 2WWOA 4RFOL 2QZQA 1UM5L 3SDCD 5J4MA 2BHYA 1EAPB 2D73A 3PQYE 1UATA 5F7KC 2BVQB 1FV1A 2WUBL 3CH1A 3Q6GL 1OSPH 1YJDC 3F7YA 3QPXL 3QK0A 4M62L 3VMNA 4CSSA 4O4YH 4KOCA 1JPEA 2ILLA 2E6JA 2IGLA 5G4OA 1N0LB 4R3SB 4OGZA 3RKPA 1A1NB 5AWNH 5ECGA 3NTCH 3K4ZA 5G4NA 5I23A 1NC2D 3IMVA 3P4MA 5AL0A 3CCHB 1OIOA 2AQNA 5CAYB 2WYTA 5D96B 2DQEH 3VFNB 1EUTA 4WI2A 1BQLH 5HHPA 5JPNA 4LASH 1MCNA 1M42A 1B4RA 2QVIA 2XTJC 4NOFA 1KYOK 2Y36H 3Q5YA 1XMWA 1M71B 2NNAB 4YHOH 5J9PA 1L0PA 4Z7WA 5DTFA 5D7IA 1TVDA 5HHVL 1FNEA 5L0QC 3V2AR 2HT3D 4LRNH 4O2FA 3S5YA 2XWTB 1MCKA 3ML8A 4GXUM 4R5TA 4LP8A 1OE3A 1IKOP 4NP4H 3Q44A 1YQVH 2V7NB 4KJQC 2QSVA 4L4TB 4A67A 5I15L 2R83A 3JTBA 1WZKA 3A6OA 2XWRA 2AEPH 2AS5M 4PS3A 3S5LB 5C0GB 4L29A 3OKNA 2XN1A 3V0VB 1ZY9A 2PXYA 4ONHA 3MBXH 3D3VE 3ZYZA 1QW9A 3ARPA 4J3BA 1IBHA 4OLZH 4PJ8A 1H3GA 4PJHE 2KH2B 5DQJB 2FJGA 1A7BA 5DLML 2GUYA 1G7HA 3QG7L 5JDJA 1A4KA 1IQDB 3GXMA 3L2NA 2YQGA 4C47A 1DEEA 1E9PA 1HZKA 2V5SA 3V6OA 3MRQB 2ZSVB 4Y5VA 5HTSA 4XBEH 5DMGC 2Z0UA 1WE5A 4Z0BL 4BH7A 4YVUA 4G8EA 2FGWH 3SDCC 4E42B 4F7KA 4YFLF 1KIUB 5I28A 4NZDA 4BZ1L 4EDXB 1FO0H 1NFDA 3C60B 4YLBA 3HS0C 2KC0A 3O45B 1FGVL 1E4WH 3SDXB 4HAGA 1BZOA 1JVLA 4IBSA 4DGIH 4ZFFB 1J1PL 1YUHB 4GO8A 1RURH 1DQLH 4YDMA 5LQBL 1ZHNB 1B4TA 3AXIA 4N2NA 3W1ZA 1ITBB 5ESVA 2H5UA 5DJAB 5FCUL 2AI0H 5CBEB 1ZVYA 1SQMA 1WFTA 4MQ7A 3WJMB 5I1HH 1G9EA 1HILB 1ECYA 2DM3A 2F5BH 3MU3A 3QCTL 4DN3H 2AXJA 3BX7C 2F2HA 1WWWX 4P06A 3CZUB 4XPAL 5D93B 3LN9A 3LXCA 5I1GL 3KPPB 1HL9A 2MJWA 3AADB 2V3EA 3HN5A 1EX0A 4PH8A 3X3GH 4BFGA 5ITFB 3HJ0A 2XQBL 3IRPX 2HT3C 4A63A 5KSBB 3HVNA 1S7WB 5C2BL 5FO9A 5T3ZE 2FX7L 2M26A 2GG1A 5H4YA 3G04A 3PDOA 1KBWA 2VLJE 4KI5D 3EBAA 4P4KA 5DZPA 1KMGA 4HIIB 4HF5H 1TSRA 4P3WA 4FQLH 4PJCA 4JEGB 3UCQA 5I1JH 4LBEB 2AQRA 1LP9B 1MRFH 1SYVB 3X3FH 4JUTA 2EYSA 1CFTB 4TQEL 5KBPA 2IBBA 3WNOA 1MXGA 3ES6A 2EYRB 1NIAA 4N1HB 4FQCL 4JREC 2HTKC 3HLAB 3HMXL 5EO0A 4WWKD 4MLSA 5DJ6B 1MCWM 4RGMC 3VSQA 4AGPA 9PCYA 3QNXA 4TNWK 3ZE2F 3VGDA 5D1QA 1I4FB 3LRLA 4GAYA 4AEHH 3OAYK 2NY2D 3T6XA 4XP1L 2BP3A 2FH6A 1LDSA 1D7BA 5DLLA 1UGNA 1NDGB 5LGJB 1AKJD 4AVIA 1YJDH 5IBTL 1CUOA 2NY3D 3CD4A 4WO4B 4DJMA 5L8JB 1JZ7A 1JWMA 1PIFA 4YE0A 4FQ2H 4S11A 2R8SH 4AW4A 1PG7W 4F3FA 4XMTA 2ROXA 4WWNA 3VE0A 5I30L 1NLDH 3CZGA 2B1AL 4FZ8L 2ERJC 1A6UL 1TTRA 2X41A 1I75A 2BJMH 1X5HA 1QTYT 3QIBA 3VYOA 5I76A 3S0PA 1UASA 3RIAK 2JB5H 4IRSC 3RVWD 1SLVA 2NPLX 3QJOA 3ETBJ 3TV8A 4QHMA 5J57B 2N0MA 2JKSA 4I3SH 4W4OC 4CJ1A 4Z6AT 3ZDZF 4NQCD 3IVKB 2KZKA 3TXAA 5HVFB 2H32B 3RL2A 4IBYA 3VWJD 4KRPD 1CT8A 4F57L 4PJXE 4XAWL 3LKSA 4X6BA 4L3CB 2YPLA 3KYAA 3DRQA 4M03A 1H3PH 2VKWA 2VABB 5IVNA 4XC1H 1X7QB 1ZSDA 3FU7A 3T4AB 1PQZA 1KN4H 1QO3A 3QH3A 4Q7DA 3A6CH 2ENYA 2HB0A 3VXMB 5I8KH 1GC1C 1ZHBA 2NCEA 5ACZB 5E1HB 4HISA 3U4AA 4WW2F 3IXAB 2VLRA 4KAQL 1JNHA 3UDWC 2O4EA 4XNZC 3LX9A 1P4LB 1UKTA 1MLCA 1QRND 3FQUA 4N1EA 4FLQA 3RTQB 4OCLC 2Y7MA 4JFWA 1ULVA 2CGYA 4G8FB 3KYMA 5HPMA 1TTFA 1G94A 3IS1X 1PD0A 3O6FB 5JW3H 1KY7A 4MDRA 2AJVL 2IPTH 3VSVA 4MJ5A 4W70A 1YEDA 3SDXE 4JG1H 2OA9A 3ZT6A 3QZWG 5MERB 5E8NB 2F1EA 1NBQA 4AUYA 2WQSA 4IOIA 4JM2A 3N42F 1T0NA 1Q0XH 3O6KL 5LB1A 3MNZA 5EN2B 1Z9SB 4E9SA 1F6LL 3L1FA 2CAKA 2P45B 1WO2A 2APBA 2F74B 1CMOA 5I71B 2YPKA 3FQ1A 3X17A 4E2OA 1DQJA 3G9VA 2AJZB 2FBJH 3QUYC 4G3YL 1F90L 1S9WA 2ZUQC 4QOKA 5JA9A 4FULA 4XMLH 4CUCA 1J0YA 2NY3C 2BDNL 3VI4B 1A3RH 5FKPB 3IETB 4PTUB 2BCKA 2L0DA 1DJSA 2FYYA 4JFEB 4RZCA 5I1KL 2ENSA 4BFFA 2NX5E 4O02H 5D7SL 4S0HA 3BGAA 2CDFB 4HZLA 4MCZA 3RZCA 1AXIB 1WVZA 2OW6A 4JJ5B 4KHTL 4LO9A 3RVWC 3GEFA 1Z0MA 4EZLA 4PP2A 4P2QD 1U8IB 1HL4A 3ZOAA 4HSQA 4G2AA 5SWQB 1KPUB 5F1IA 3QT2A 5DZOA 3E38A 1CS6A 4QF1B 4BQ6A 1TQUA 1LEGB 1LO0H 3FTSA 3B43A 3BPOC 4XXDA 3UP6A 5AVZB 3VWJC 4KRPC 4YQXH 5ISZD 3ISRA 4KPHL 5EO9B 5CP3H 1BQ5A 1AGDA 3LN4A 4JRWA 2R2BB 2YD8A 4R4FL 2P5WD 2EH7H 3U6RA 1V10A 1WIOA 3HG4A 2H1PH 2BNRB 2PTVA 3WEXA 1KENH 2PW1B 1PZSA 1JPGA 3CZKA 3DXAD 3KR3L 1BJ8A 1CGSH 3B83A 2R0LL 3QEGH 2MNWA 3ZDYF 3HZYB 3L5IA 2YR3A 4RGNB 4NO0D 1UWXH 4P2RA 4QKXB 4DZBA 3Q5OA 5E4OA 3CHOA 1IGIL 5TE4L 1JNNL 1A7NH 3L7FB 5D4IA 2DRUA 5DZJA 3UTPD 3Q06A 3NFNB 1H8OA 4KUZL 1E2WA 4GFXA 4PJBE 5IW1B 1CD8A 4L3AA 2FEDD 2JJSA 3S88L 4LPYA 2DPKA 1XGRB 1DCLA 1HNYA 1YYML 3EJYD 4ZQKB 1A9EB 2HKFL 3OSKA 4PV8A 1FSKC 4U6XB 4AXWB 4Q9CA 1EGJH 2WWKT 3N85L 3PYCA 1ZGLB 1IAKA 4J6RH 5L2KD 3EF7A 3POCA 1T1ZB 2PPFA 4KZEH 1FLTX 4U1MB 1ZLWH 3P9MB 5L9DH 2XJLA 5DJ8A 3QUKB 4AH2B 2C1PA 1S9VA 1T6WA 3BD4A 4LHUD 1AIFA 4BSJA 1NKGA 1BBJA 3OAZH 3T0BA 4YXHH 2AC0A 2UZIL 2F5AL 5BW7A 2JWYA 1JZFA 2J21A 2J6EA 3PHSA 4L3EA 1UM6H 3WTYA 2C26A 1BZQK 2R59A 3QORB 2ZXCA 2Z31A 1P1VA 3DSFH 3NA9H 3E3QC 3CQQA 1CE6A 1U8JA 3D12B 3ZZLA 3CU7A 3TO2B 3OKDA 3RWHA 3VA6A 2OZ4H 3WS3A 2Y7LA 4Q56A 3CFJB 4WHCA 5AAMA 3UZEC 4M1GL 3GDBA 5EEUA 3FF7A 2UZYB 4WW1B 4YFEA 2R0ZL 1UA6H 1Z0NA 2ZAGA 3EJSA 4X9FA 1X4ZA 4LPXA 2DL2A 3CSBA 4FQXD 4BM7A 3GD1C 2J12B 3D9AL 3SO3B 4ZXBD 4AE0A 2O26U 2SEBB 4CDHA 3UFIA 5IFAH 3DSNA 2YAHA 3APDA 3P30H 4RFEA 4IBQA 2MTAA 1JXJA 2BSSB 4X6FB 3K1KC 1EHLL 4P3DA 4HUKB 4Z5RB 5AW7B 5FUZH 1UJTA 5GJTH 4ADGA 5AG9A 2YSSB 2E7CA 4X6DA 3OGOE 1WFIA 4MTMA 3BYYA 4AGMA 3GUTA 1NEPA 1FL3A 1AZRA 5I8CB 4G8GD 1FH5H 3MRCB 4X7FC 1R24B 4RA3A 2V0AA 2FEDC 3V6FA 5D7JC 4CW1B 1MELA 4HOWA 1L9PA 3EJYC 3QP3A 4OJFL 5D2LF 1PKOA 1X6NA 4QT5A 4H4NA 3CXDH 1AZUA 3OF6A 1KZQA 2DICA 2X4RA 3O6LL 2WOYA 3MACH 3BZEA 3MRGB 1XWVA 4ORGB 5E5MA 1Y1DA 2VZOA 1AS8A 2R4SL 1HZHL 4U1HB 1GTNA 3BKMH 2JI1A 4N8VG 3UYOD 2BY0A 4NI3A 3WKQA 1J05A 3ZRCC 1ETZB 2AKRA 3NYKA 4CSPA 1U91B 5K9KB 1RZIA 2F7IA 4ZD3H 5I8EA 2ZUXA 3Q2VA 4HEPG 3LQAL 3MCKA 1CC3A 3QHZL 3V0IA 3G5ZB 2G3ZA 3BVVA 4JO8A 4JY4A 2DWYA 2W0LA 5D71L 3DWTA 1AD9B 3GJFK 1IGMH 2XZQH 4WNJA 3NG5A 2ZOLB 4D0DA 5KSAB 4F37F 3ZQWA 1OK8A 4XMUA 1IJNA 1YNTB 3MV8A 5EF0A 4DQOL 5BRZA 2NY6D 4OF6A 2D3NA 2OTUB 4OLXH 4APQB 4AIEA 3MLTB 4KNTA 5IR1A 4FD0A 2FECL 1E27A 2PCPA 5HDQL 5I75B 4M6AA 3TNMA 2FEJA 4JKWA 4ZXBC 1O9ZA 1BVOA 3O8XB 1WEJL 4J4PD 1FVDA 4Z7WF 3QISA 2EUZA 1WIUA 2VB5A 2YRZA 2OL3A 2L3BA 3MXVL 3FCSA 3QHFH 4B60A 2FJFA 3FQYA 2OFQA 4I1NB 5F1KC 1XIWA 4HFWA 3QJHB 4R90L 1FPTH 3F12A 3IBOA 3IAQA 2K8MA 1MFVA 4AENA 1F56A 4JKNA 4NNYB 4OQTA 2FD6H 3US9A 1GAFH 2AXGB 1D7DA 5EV7A 1A64A 3POHA 3KPRA 1NJ9A 2YKKA 4EEEA 2R23B 1IV8A 4PIRF 4M48L 4XB3A 5TQ0L 3OKEA 4PW9A 4Q9QL 2QQKL 4FXKA 4HG4J 2EDNA 3NIFF 1KB9K 4JFOB 3UAFA 4OZFG 4J8RA 4HIJA 5C08A 4DUXA 4LKCA 5J13C 1CYWA 4EVNA 1SLXA 3HEIB 4YIQA 4ZW8A 1A7OL 2XZAH 4MNHB 1OF2A 4WI9A 5EG6C 4MZRA 4AGLA 5HVHB 1OT4A 2CR0A 3CFDB 1TR7A 5JXAL 3OR7B 4JMNA 2UXGA 1F86A 4EI5A 3UAJC 3DDFA 3DGGB 5CN2A 3PWJA 3T3PF 3RJOA 4AY0A 3D0LB 1RZ7H 2YAQA 4PD4J 4TSCH 4DOHB 3HCVB 1C5CH 4XN8A 1KG0A 4WUKL 4IRZA 1Z3RA 5F93C 2BVPB 4ONFL 4E41B 4XNUL 2DMKA 3KXFB 1LMIA 4NUGH 4M43H 5HBBA 1AO7A 2EADA 4I4WB 2H8PA 2E59A 5K93A 3S3SA 1QHPA 4A04A 3L08A 3LMJH 3AW5A 4OF7A 3VD1A 3ZVVA 4D9QE 1QATA 4ZAKB 2XT1B 1ND0A 2Q87A 4K15A 1CIDA 2YRBA 1UT2A 1MNUL 3ECBB 4GW1A 4G6FB 3V5HB 5KJ4A 5J11B 4DP8X 2ZCHH 1NBZA 4OGAD 5E4EC 1HN1A 4GXUN 1C1EH 1GOGA 5CILH 3ULUL 2GITA 1ML0A 2OPCA 1T2QH 1B9KA 5I1LA 2E7LC 5HHOB 3PXLA 1IZJA 2FO4B 5FFGA 4Y4KC 2NR6A 1QFPA 4JO2L 1UZ8B 4HJGA 1VGKA 3GTVA 3FZUD 3GDCA 3G6AB 1WBZA 3UOAB 4XN5A 4PV9B 2QTVA 1NCBH 4OUOA 4GS7C 4X6EB 1WZ1H 1AQ8A 4F9LA 1QFWH 3Q5TA 2X70A 5C0AB 5B3JE 4G9FB 4QRPD 4NQVB 4XCEA 3JTSA 5GS1B 3RHWK 2VSDA 4F58H 2HJFB 4FQHB 4JY5H 1KIQA 4X0KA 1SBSL 2JCCB 4XP4L 3D4ZA 4PJFE 3SE9H 3WKPA 3HUJB 4PJCF 1HH6A 3KLDA 1EAJA 2R69L 2FT7A 3EG9B 1FZMA 4RA0C 1A7RH 4WTQA 4Y2DB 3SDCB 4Y4HA 3L8QA 4QRRD 4FZEH 5SX4H 3SYQA 4JQIA 3VFWB 2DQCL 2ATKA 3RWDA 3P0VH 2AEIT 5MENA 3ZGHA 3L7EB 3KD4A 3B6SA 1PU0A 1WWCA 5JORA 3MRRB 4LSTL 2IH3B 1Q38A 5D9SB 1A5FL 3WGVB 4GSRA 2JI3A 2Q3ZA 4QHUB 4QHPA 4ZODA 3M45A 5SWZD 2PPAA 4KRNA 2CCVA 25C8H 4XNMA 1SHXA 4JL2A 3ARTA 1RUMH 3NCBB 3HI1A 1NC2B 1DE4A 4XHQA 4XP5H 1WIPA 1NMAL 4PB9L 4RAVA 1AJ7H 1PMYA 1HNFA 2C9VA 3DPBA 5ITBL 2C7UA 3MTRA 1S7UB 1JL8A 1IAMA 1L7TL 3WKML 3VXSE 1ZTXL 4GRMA 3TYFB 1R3JA 4DGVH 4NNXB 1ZT4B 1JZ3A 4KKPA 4LVHC 2CPCA 1CXKA 5AZ2L 4M4RB 1KCBA 3KPOA 3ILPB 2UY6A 3T3ME 1GZHA 1MI5B 4FKHA 4OGAC 5IV2B 1QR1B 5KW9H 2IQ9H 1GHFH 2NNRA 1KC5L 4NRZB 2OXHB 3MPCA 3D39E 2QGBA 3L6FB 4LQFL 4ELKA 1NFIB 2IOIA 5E2TH 2F53A 2WXNA 2DB8A 2Y1YA 3DO7B 1U8OA 3D69A 2IJ0C 2BWDA 2H6UA 3FZUC 1CICA 4KX7A 4MXVE 3A4DA 3BO8A 3QQDA 4KO9A 5I5JA 3TGXA 2FBOJ 2VZSA 3FUEA 3BQVA 5AB0A 3MRIB 5CUSH 1YEKL 2X4TA 3RX8A 1Y6NR 4G59C 1YNKL 3ZDYE 2WOBA 2QJDA 1XL4A 5E2WL 4RGMB 1RZPA 4DOHE 3L81A 1OP5H 5I8OH 1NBVL 1OW0C 2IGFH 2GSIB 3C6LA 4YDVB 5DA0B 3IS0X 3P4NB 5T1KD 3AS0A 4DERA 2K6YA 2DQGL 3CH8A 4N0UA 1BZEA 3L3JA 3MZGB 2MPAH 5E00A 2YGQA 3Q8BA 3G6JA 3TNNB 2ADGB 4UT7H 3RURA 1QUPA 2GC7C 3QJVB 4YDNA 4X7TB 1S2EA 5F7AA 3F58L 3V6ZB 2JKXA 3RWEA 4EAEA 1BZDA 1VESA 3K72A 5LWYL 4KDWA 2BIIA 4NM4H 3SDAC 5EA0H 2VW7A 3CHQA 5CN3A 4WEEA 1NA8A 4YDIH 1SJVA 1TCMA 3MRJA 5DVNA 3R06B 2CWRA 5K9OA 1XCWA 5T5FL 5MEOB 3B2DC 1MN4A 3FFDB 3SOBH 3GMNB 4MRCA 5EC2B 3EXJA 5JR1H 1VFAA 3HE7D 4L8DB 1KLUB 3EYSH 4D0CB 1KLGB 1UOWA 2ZJSL 3FQTB 3TT1H 5A2LH 2EDBA 4PWJA 5IEHA 1UT1A 3N43B 1NDMB 5JXED 2XUWA 4LLYA 2IANA 5DHYA 5JOEA 1OT1A 4UV4H 2JJWA 2X7LA 3N41B 5E6UB 4B0MB 4UF7C 4U1LA 1I9JH 2HAZA 4XMPL 2FR4B 1SUHA 3NCJH 3UTSA 2AEWA 1BZ9A 1HHGA 2WB1A 5EB9A 2DJMA 1ZKAA 1BD2D 2H0FA 3MLVH 4HBCL 1FORH 1C16A 3JWNE 4TVPL 5C0AE 5F21B 3Q48A 1M1XA 1DQQA 1NM9A 4K5NA 1MW3A 5TF0A 2CUHA 4BHUI 3HBZA 2VMEA 1PS3A 4UU9B 1I9IH 3EOTL 4OD2A 4BWWA 3RA7L 4ZUVA 3WKNA 1KTLB 2VIRB 4FKKA 4P23D 2WWNA 1T0MA 4PFEA 2XWBA 4GEJA 1PFCA 5CKGA 1XR9A 1A66A 1JV5A 4NKIL 3PAZA 4L1SA 1GGBL 3NJLA 5KBLA 3O4LE 4LGPB 1T1WB 2XG4B 1AZNA 2RGSA 2PETA 2B59B 2E6PA 4JANA 5IB3B 4MNGB 4QRUB 4ISVA 5IHZB 4WWKB 2I60L 2WXKA 3OKOB 3PWNA 4LLMB 5GGUA 1XD0A 2VO8A 4FXGB 4GW4A 3UXFA 4HLZH 4F80A 1WA0X 3K0WA 2XWZA 4HKXA 2MCPL 1PZ3A 2NY2B 3NZ8A 2BSTB 1OTUC 5I1EH 4M7KL 5EO1A 3ROOA 1AKJB 1XB3A 1VGEH 3QCUL 4OLWL 2Z7YA 5JO5B 4XBMA 1GZQA 3I3EA 5IB5A 2HJKB 2B9BA 1OHQA 4H1LA 4MD4B 1Z7JA 3I75B 1WISA 4AG4H 4TQ8A 2FSDA 1QI3A 3ZHKA 1MI5E 5DHVH 4KTGA 4MNQA 4OW6A 4R97B 5EUOB 3RWIB 1IM3A 1L3WA 2AMGA 4I0PD 4LNRB 3HE7C 3GRWA 2YAOA 2KZBA 4LVNC 3R7RA 3CLWA 1B4JL 3ZDXF 4BK5A 1GZPB 4NQCB 2Q7YA 4NZUL 5E5UB 5K39A 3WTXA 3L95B 4NENB 5FGCB 3RY6C 1ZVSA 3LNEA 1INEL 3BPOB 4Z18A 5JXEC 3E80A 4XH2A 4YHYB 3VWJB 5FCSH 4W93A 2R29A 3QUXD 4L1LA 4ZTPH 3GIVB 4PRDA 4TQIA 2FVNA 3KGSA 5C86A 3RU8H 4N90E 4NQED 3TYGL 2XWJB 4FAAB 4L4VD 1JG9A 3LKPA 3ABGA 3WLBA 1BIIB 1THCA 1QX1A 4FI6A 5F9DC 1WCQA 5FEBA 4MKMA 4XR8C 1P7BA 2PTUA 4QLRA 2HT2D 1IFHL 3OX8B 2W91A 1UYWH 4JKLA 4UQ2A 4FERA 3ULUE 1H9DA 1E3ZA 4NP9A 2V2WA 5D1QB 2VDNL 2BOCB 4P23C 2CKBH 1NCTA 2NW2A 4KRMB 2DH3A 2F7RA 1KCVL 2Q8AH 3V0AC 3VVVA 2OAAA 4FLHA 4HWUA 4G80B 4KK6D 5DURD 4M56A 1QRNB 5B8CA 3PGCB 2O5NA 4RMVA 1ZDQA 3BAWA 1UA7A 4R8WH 3T8XA 1NEUA 2YMXL 1FAIL 2LOEA 2VXQA 5DI8A 4LSRL 3FN0H 3KM1A 4CN4A 2ITCA 2XX1A 2ICWI 3O2WH 1KV7A 1TJMA 2A2QT 2EC9T 5D7IE 4X6DF 2E9WA 4Z3FA 2K78A 2K8QA 3FUKA 3NP4A 1N3NB 4TM9A 1G9NC 1A65A 2FSEB 1Q9KB 1MIML 5JPMC 4FNLL 3L3GB 4CGUB 1T4KB 1GYAA 1LK2B 4DP7X 2GBTA 2A9NL 3V4LA 3BDYL 3GS4A 1S7RA 4B50A 2XFGB 3QUGA 1CBVL 1J0IA 3FONB 4S10A 1NGWA 4PVNA 3DOSA 3EBHA 3RB7A 4FQPA 3FB8A 2WZ5A 4J3SA 5GZNA 2DQDL 1GRWA