1NCCL

Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
214
structure length
214
Chain Sequence
b'DIVMTQSPKFMSTSVGDRVTITCKASQDVSTAVVWYQQKPGQSPKLLIYWASTRHIGVPDRFAGSGSGTDYTLTISSVQAEDLALYYCQQHYSPPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INFLUENZA A SUBTYPE N9 NEURAMINIDASE
publication title Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface.
pubmed doi rcsb
molecule tags Hydrolase(o-glycosyl)
total genus 55
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1992-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nccL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nccL01
1MFDH 3CMOH 4DKDC 2OK0L 1OLZA 3W11C 5DRNA 4NSKB 1VPOH 4RFEA 5F3HB 4HBQA 1NDGB 5MI0B 3GSOA 2FB4L 4EVNA 1AI1H 1IGFL 1XH3B 4P23D 3U2SA 5I0ZA 1UA6H 3QUZA 4ZTOL 5ICYA 5KG9A 4PRAB 4YLQT 1P9MA 5I1EH 1EO7A 5H94A 1AP2B 3BW9B 4HD9A 1QLRB 5DC9B 5GSVA 1JPFA 3ZSTA 3MRIA 1CDIA 2VDNH 4F57H 2L0DA 5EOCJ 4PJ5A 3W5NA 3VRLE 4U2YA 5IESL 1GVIA 3QDAA 1Z5LB 1IM9D 4XC1H 1N6VA 1A9EA 2P5EA 2FR4B 4KXZI 3HC4H 4R2GB 1QLEL 4NC1C 3STLA 5L2KD 4CNIA 1WC7B 4HKZB 4U6VH 5GGTL 5JUEH 2GITA 3GMLB 4Y4FA 3TH3T 4D8PB 4NKIL 4NWUL 4ZFGL 4DOHE 1XF4B 3NCYP 4X5XA 3SKJL 5F7MC 3BP6A 4KRLB 4LEXL 1MHHB 5T1KB 5K93A 1U0QA 1UB6B 4NGHL 4NRXB 4KVNL 4KFZC 3D25B 4U4BA 4KRPC 2P48B 2W38A 1HINL 4Y5VA 2GJ6B 3QI9B 4FP8L 1JWSA 4OZGE 4XCFL 2DBLL 4BH8A 1CLCA 4MA3B 5EO9B 1G7LB 2YPLE 5EU4B 2I26N 3GEWB 2K1MA 5D2LF 1G6RB 5DC4B 3T77A 4GMTH 1RUPH 2XA8H 3KDMA 5KVDH 3KPOA 1MCQA 1ERNA 4MJ4A 5GHWL 4JCMA 4U1GB 4MNQE 1QA9B 2JCCA 2D31B 2AQ3A 1BBJB 4XVUD 4OGYL 3ABZA 3QDMD 3SDDB 1TZHB 1JF1A 3QQ3B 4R8WL 1OAUL 4PGBB 5AZ2L 3WHXB 5FO8B 1V8HA 5ESVA 5F96H 4TQEL 4TUKL 2KKQA 1CGVA 4O58H 4OZHE 2IFFH 2F54E 4IMKC 3JV4B 4XXCA 1DEEB 2VR9A 3QO1A 1YY8B 3NIGE 1A2YA 5SWZE 4HKJB 1AY1L 4GRWB 2DLHA 2HFFB 1JZ3A 2ED9A 3RWJA 4BKLA 4FQXB 4FXKA 3IJHA 4D2NA 2FB4H 4M3KB 1XF5B 2ICWI 1IGFH 3U30C 4HMDA 2R4RL 3I6KA 4ZTOH 3V4UL 4GW4A 3VXMD 5J1TC 1CFQA 1NCBL 2IMMA 2XZAL 3GBML 3NIFF 3JVGC 4IMLB 4NQXB 5FYKL 1TLKA 1NGXA 3CVHL 5IESH 1F5WA 5LAXB 5ITBH 4ZSOE 3QDGB 4KI5F 3NZ8A 2C1OB 4WFED 4X6BB 3MV9D 4QRQA 1RZKC 1CG9B 3VFTA 4LSTL 3MNWB 1QLEH 4PRBA 5TE6L 3QXUA 1SY6A 4ODVL 5GGTH 1Q72L 5HI5D 4I5BA 1HEZB 2FECL 2NXYB 4NKIH 4NWUH 1DN0B 4MA1C 3DMMD 4NQCB 3SKJH 4LEXH 1Q9KA 4NGHH 4KVNH 4LCCB 1R3JA 2IANA 3L3DA 3LB6C 4TVPH 4U7KA 1HINH 4WUUD 3V4PL 3O6FB 4FP8H 4RGMB 4GG6B 4XCFH 2DBLH 1TZIB 1NMCB 2W1NA 3MNVB 5HVGB 1HIML 1TCMA 1F58L 4LRIA 3ZKNC 4YFLI 1IQWL 2BHUA 2Q1EA 4NN7B 4PIRF 1DLHB 2WWKT 1PY4A 3MJ6A 3KLHD 4LK4A 2NXZB 3AREC 4LKXB 2P44B 1V3MA 4WJ5B 4PD4J 4J6RH 5GHWH 2BSED 1FV1B 4CGTA 1U6AL 4MS8D 2EDEA 3BXNB 2Y6SD 4GBXA 4V1DB 4OGYH 1AKJB 1QBBA 2MQ3A 1VGKA 1HWHB 4FFVD 5EOTB 3L3IB 4U1NB 1AGEA 1A7OL 1MAJA 4WRLA 5I1DA 4NNXB 3O3EB 4R8WH 1T2JA 1OAUH 4P49A 1T2XA 2HWZL 2P8PA 2BVEA 4TQEH 4TUKH 1ACZA 4BELD 5JTWA 5BO1L 3GMOA 1JGDA 2Y72A 2FZ3A 2ADGB 2NZ9C 5GS0D 2BC4B 3LOWA 2YPKB 3Q48A 1AY1H 2P5EE 3BP7A 1D5IH 1G7JB 2J5LC 4AL8L 2H8PB 3EOTL 1CR9L 3BJLA 2DM3A 5BXFA 3FTGA 2H9GB 2W0FA 1BQHA 2FJGB 3VWJC 3CSYA 2VLJA 1U3HB 2OJEA 4OFIA 1GJIA 1U8HB 2R4RH 3GSWA 4P5TC 3HG1D 3V4UH 4BZ2L 1ZLWH 4KJYB 5DJ8A 1FLTX 4WW2F 4DEPC 2Z35B 2MMXA 1T89A 4Y4KD 2XZAH 1G9NC 2ENSA 3GBMH 3SN6N 4CU7A 1ZT4B 1Z9LA 1JZ6A 4L4VE 5FYKH 2ZUSA 2NNAA 4ZXBC 3U0TB 3MV7A 5TQ2L 3CVHH 4G9FA 2A9NL 5E7FA 5JXEC 2AKRA 2KL6A 2UZXB 4LDLB 2DL2A 1GGCL 5ETUA 3T0EC 3ZDZE 3RGVD 1RJZB 4LSTH 1FVEA 5D93B 5D7LD 4GAYA 3QJFB 5I1AA 3QUXA 4LPVA 4JM2F 5TE6H 1MCEA 4ODVH 1QO3A 2VXSL 1Q72H 3MRCA 2JCCE 3TNMB 2M2DA 2HN7A 3WS6A 3FZUC 3T1FB 1YECL 1LEIA 4XCNB 3UTTD 3PABA 1E4WH 1TJGL 1S8DB 1WBXA 4PJHA 4RZCA 5JIIA 5FM5O 3V4PH 1BWMA 3FB5A 2YUZA 2EIBA 2HG5A 5CGYD 5E6IC 2Y7QB 5INDA 3SKOB 1HIMH 4IS6B 1FYTE 4N0UA 3CPLA 3G04A 1F58H 4QRUA 1IQWH 3VFUB 3VXUA 1T4KB 1NC4D 5C0IB 1BVLA 3C5JA 1CXEA 1ZSDA 2VKXA 1KB9J 1SBSL 3VE0B 1D3CA 2DN7A 5AYUL 3FT3B 4WFHE 5JW4Q 3KPRD 1U6AH 2G2RA 3LKQA 5M94B 3BIAX 3I6GA 1A7OH 5DJ6B 5E8OA 5IMKB 3IDXL 4JM2B 3IKKA 4J2XA 1JTTA 4BUGA 2HWZH 1I3UA 1Q94B 1FGVL 3AXLB 1NCWL 5BO1H 1A7PL 4YXKL 4UZGA 3MV11 2DQGL 2EDYA 3CCHB 1I1AC 4Z7VA 4S1DD 5F89B 4F2MA 4NN5B 5DJXA 3ZE2F 4DTGL 3U7WL 1XAUA 4HC1A 4Y2DD 4AL8H 1KEGL 3EOTH 3DJ9A 1CR9H 2OQJB 3V7MA 4MJIA 1J7VR 3OAUL 1M4KA 3BUYB 3D18B 3O41A 1QFWM 2C7UA 3TT3L 2VZ3A 4GFTB 1AC0A 3D3VB 3DXAB 5JOEA 1NEZB 2IANE 4BZ2H 5AZEL 3T65B 4DGYL 2H1PL 3BQUB 3TN0C 4CVZA 2AJSL 5EU6A 4WI9A 3HUJB 4RRPA 4ZUTB 1MEXL 5D7JD 3VXNA 3N1QC 1U8OB 3CFKB 5MEPB 2GKIA 5JW3L 2B5IB 1AGFB 2VAJA 1QPPA 5TQ2H 5DA0B 2A9NH 2BY3A 4LASL 4FQQB 4FQLL 3ULUD 3OKKB 4WNQA 1GGCH 2XPGB 2B8OT 4A2MA 2Z31A 4GW5A 3CFDA 2CRYA 5I2IB 1UH4A 2VTFA 2VXSH 2WWKO 3BO8A 3C2AL 1BVZA 1MJ8L 5ICXB 4G9DA 3MLZL 1JCKA 1H3WM 3DIFB 4X99A 3K1KC 5MEQB 1YECH 1EO8L 2VLRA 2ZNXA 3BEVB 5CJXA 5ERWB 3V6ZB 4HIIB 4A6YA 2EIZB 4F7EB 4Z77A 3THML 3GZKA 5ADOL 3NAAL 1IAII 4XPGL 5HGAB 3OKDB 5DK0B 3R1GL 1VDGA 3QIWD 3S3PA 3IDNB 3OXRA 3MRJA 4ZFFB 5D5MF 5F1KC 2XN9B 1U93B 2NX5A 3L3KA 1IC5L 3PV7A 5CJOL 4G80B 5GGSA 5I1GL 4IJ3C 1G84A 2IG2H 5E6ZA 5AYUH 3ZTJH 1UKTA 3ZYJA 2VLJE 4P5MA 1KCSL 4KVCL 5EN2B 5IF0A 5C08B 4R0LA 4I13B 4L9DA 1CQYA 4YDLC 1XCTB 5C1MB 2BVOB 1HDMB 3IDXH 1FNEB 1F6AB 4YHML 1II4E 3MCKB 4YC2C 1FGVH 5MEOB 5FM4A 1YZZA 3MNZA 1QVOB 1NCWH 2R2BB 4YXKH 1C16A 3U82B 4D0CB 1QLFA 1S5HB 2QADD 4G9FE 2DQGH 3F6IA 4O2FB 4OLXH 4F7PB 1ITBB 2AV1B 3S8WA 3RPIA 2BCKB 1KLUB 3N50A 2EIEA 4YAQB 4I0PA 3U7WH 3OR7A 5B4MD 1CICD 2UWEE 4LLQB 3D2UB 1KEGH 3TH4T 3ARGA 3HR6A 2ZG1A 3U4EB 2NY5L 4P4KB 4NKQB 3UP1A 3OAUH 3FQRA 5ALBL 3VGDA 3IXAB 1P6AB 3IU4L 4HKBB 4PJFA 1RJYA 3WN5B 1H3VA 1TVBB 4DGYH 4JY5L 4HULB 2H1PH 2AJSH 4N8CL 4ETQA 1T21B 1I85C 5ESQA 2DLIA 1MEXH 2BVTA 3EO1B 3HLAB 5JW3H 2G9HA 2VSCA 4N0UE 1RD6A 4WO4B 3VXUE 2VYRE 5JOFB 4LASH 3RI5K 4FQLH 4LSQL 1T1YA 3IJYA 4WTWA 1H0DB 5J56B 3FOLB 4MJ6A 4KMTL 1A6VL 1DN2A 3HCVB 4CDGC 1JYVA 4OB5L 3OB0K 1CIUA 3C2AH 3QDJB 5EZJA 1MJ8H 3BGFB 3TF7C 2ESVA 2RFXA 2GHWB 4L3EB 2OMBA 2XFXA 4UDUA 3SGEI 3MLZH 2EDTA 5KSAA 1L7IL 1RZIA 1TCRA 1WIOA 2N7BA 2PNDA 3CC5B 4WHTA 1EO8H 2AI0L 2YOCA 1O7VA 5DJDA 1J8HB 4QGTA 3THMH 5ADOH 3VXSA 4XPGH 2E27L 5KSVB 2NY4C 4WWKD 1W72A 4Z7VE 3R1GH 4YH6A 3PWJA 4DGIL 3IDGA 1KIPA 3C60B 4PJGF 3SJVA 5D72L 1J12A 3B4NA 4RFEB 2EDOA 1D5XB 1NGWB 1IC5H 2OR9L 3LEVL 5CJOH 3VFSB 4LSPL 1JPGA 5I1GH 3U2SB 5HPMA 2HT2C 1WWWX 3QUZB 4QT5B 2ADJA 5JHLL 3GSNB 1KCSH 4KVCH 3NPSB 3RWFB 4HXBL 1P7QD 1R5WB 1J0ZA 3UPRA 2MJWA 2YUVA 3D48R 2BNQD 5EU6E 4PJ5B 3CFEA 1A9BA 2V9QA 2COQA 4YHMH 1FFRA 2JJSA 3TO4C 1Q9LB 5HGDB 4G6FD 2NY0D 4FQHB 4OI9A 2D7TL 1X5AA 5DFVC 3ARQA 2ADIB 1MCIA 3S4SA 4NKDA 2DI8A 3O9WB 1I7UA 5D71L 1QG3A 3B6SB 5IMLA 2NY5H 3WFHA 4LFHD 5ALBH 1WJ3A 4NO5A 5C0AA 1DVFD 3IU4H 4OQTA 4DFIA 2VLRE 2J8UB 3SDAB 1NGYA 4GSDL 1RZ8B 4YHIA 4O00A 3S5LG 5BRZB 1AHWC 2VZ1A 3QXDB 4QEGA 4JY5H 4RIRB 3VG9B 5J89A 3D69B 1UT9A 3IDJA 2H32A 1LILA 5DO2C 1T5XB 4MWFB 3NFPA 3PDOA 4K3GA 5BW7A 3KPOB 3K4DA 1WIUA 4LBEB 1CGWA 1VESA 1P4LA 4LSQH 1CIDA 4KAQL 4R7NA 4MD4B 2Q86A 2APXA 2NY1C 4KMTH 1Q9WA 1KB5L 3MUGA 1A6VH 1WWBX 4OB5H 2VLKA 3S96A 1JGEA 4X7CC 4X7DC 3L5IA 1FFQA 3S6CA 5E4EB 1C12A 1L7IH 5ESVB 3O45B 1MCWW 4LHQB 2AI0H 3H9SB 2XG5A 3WUWB 3OB8A 3MLVL 3KPLB 1U8MA 3HB3D 4LOUC 2E27H 4FXGA 4XT1C 4JJHA 3KVQA 1A2YB 2X7LA 3KAAA 3L5JA 2IAMA 5EBGA 3TJHD 3PP3K 4DGIH 4G8EA 5KJRL 5DD3L 5D72H 5E9DA 4O2CA 1SYSB 3PNWA 4OV5A 3H7BB 2R9HD 1HXMA 2H2PC 4XRCA 2OR9H 3LEVH 4NQEA 2YPLD 1IGYA 4LSPH 3VDAA 4GT7A 1MJ7L 3QR2A 4S2SB 4EI6B 3WFZA 3TBYB 4CAGA 1G0DA 3IFLL 3RX7A 3MRFA 4Q74A 4JAMB 4OZ4A 4PJFE 4HXBH 5IROC 3U9UB 1ZT1B 1BBDL 4PGEB 5L0QB 1RFDL 3D0LA 4MNQD 3FB7A 1EDQA 3TM6A 1R5IA 43C9A 1FFOA 4Z5RB 4I8DA 3C08L 2PW2A 5GGSY 4OKDA 2XACC 3NZ8B 5DJ0A 2ICCA 2VZOA 4EBQL 2D7TH 2G60L 2VXQL 5ALCL 2V17L 4MNHA 1CE6A 4GLRI 4WU5A 3V8CA 3ZKMC 1VEMA 1CBVL 1BFOB 4I5BB 2IQ9H 4K3HA 2F54D 3TCLA 5D71H 1D5ZB 1KJVA 2ESVE 5SWZD 3BKJL 5F93C 1EGJA 2DB8A 1H5BC 2IFGA 2YA1A 1T66C 4TUOA 4X9IA 5IW1B 4PUBL 4GSDH 2VWEC 2CR3A 3TNNA 4AEFA 5GGRB 4JFZL 4JZJB 3VXSE 3MACL 4EDXA 3QHTC 1KPUA 5DZOA 5CD3A 2C3XA 4HUXB 1EMTL 3U36B 2GJ6E 4ZFZB 5J3HD 3VMNA 1GSMA 4M5YL 1CDGA 4JCLA 4KAQH 5D1QA 1FG9C 1FP5A 4YUEL 2A74A 5HYSB 3EYSL 1KB5H 4OI8A 2WSKA 1YNKL 3IETB 4JDZB 4NDMA 5IHLB 1AGEB 3BVNA 4XWGL 5H35B 2J7LA 1YEFL 4PRPA 2R2EA 3GMRA 3QUYC 4HT1L 3MREA 1I8MA 3PHQA 4FZEL 1FE8L 4M02A 3MLVH 2IALB 32C2B 1U8IA 4QGYA 4XMPL 2GK2A 3W5MA 5KJRH 5DD3H 5T1LA 4OGZA 4DAGL 1KCRL 3KYOA 4H8WC 2VQ1B 1T20B 3S36L 2A83B 5HD8C 1S7XA 2DJSA 1MJ7H 1OARL 12E8L 3MJGX 4WW2A 1IEAB 3ARDB 4GO6B 4X6FB 3U46B 4AIOA 3IFLH 5DJ2A 4KRMB 4HUWA 4X4XB 5E8PB 1BBDH 3FHQA 4JLRB 1RFDH 3WNLA 3NA9L 5D2LE 2NW3A 4KKBC 3MV7B 3K2MC 3EGSA 1NJ9A 2A6KA 1PBYA 5F6HJ 1G1YA 2AKRB 2YRZA 3C08H 4EBQH 2G60H 2VXQH 2I07B 5ALCH 2AXJA 2IPUK 5IM7A 2V17H 5I1AB 4N8VG 5F7EL 3MA9L 3F12B 3VXQA 2X9XA 3ARFB 3EFDL 3PJSA 4N0YL 1KJ2A 2VLKE 3MXWL 3QDGE 1B6DA 5D2NC 5C0CA 1A3QA 2E7MA 2CR6A 2P5ED 3BKJH 1R5VB 1M7DB 5DQJA 4RAVA 2X4UA 1KCVL 2HTLC 4WV1A 5FO9A 2BOBB 1HHKA 5GS0L 2UYLB 1UXWB 4PUBH 5KVMC 1NGQL 3DV6A 1CFNB 3FB5B 4MNGA 3IDIB 4Y4FD 2UZIL 5LXGL 3BRDA 4JFZH 1S9KC 2LU4A 4KTDL 1CK0L 4UUJA 1DCLA 5LQBL 4QRUB 3MACH 3QNZA 5F7DA 5TH2A 2EYRB 1F97A 4KRPB 2PTTB 1D6EB 2D03L 2R1XA 4PJIB 4S0TD 2FIRT 1CWVA 1EMTH 5T5FL 4HFWA 5EU5B 3DOSA 2E7LA 1AXSB 4NQEE 4B53A 4L4VD 3QEHA 1FL5A 4YUEH 3EYSH 3T3PF 1KLGB 1H8NA 1YNKH 4LPYA 3WFBL 2X4QB 5IVOA 1NMAL 2NCMA 4GMSL 3F58L 5DS8A 4XWGH 3NIFE 1JYXA 4XWOC 5HYEA 2ITDA 1YEFH 1U8LB 5C0DA 4HT1H 2B0SL 1MLCB 2HJFB 2CKBL 2E9JA 4EI5C 4KI5E 4FZEH 1FE8H 3TZVC 4R90L 2PO6A 1H8SA 3L3JA 4F2MB 1ZS8A 4K71C 4XMPH 3VGBA 1KTLB 4OI7A 5DJXB 3CSGA 1I4FB 3SHSA 4Y7MA 3FFCA 3WNOA 3SDCA 1ZAGA 3ZTJG 5GIRA 3TA3C 4DAGH 1KCRH 3R8BB 5J1SC 3S37L 2H2SC 1FYTD 2C7UB 3S36H 4P2OA 5DLML 2ARJA 4X7SL 4LNRB 3DECA 1OARH 4P3WA 1IKNA 3RA7L 4KQ4L 5HI4D 1MLBB 2M1KA 2P7TB 4CVZB 1MWAL 3BZEB 1LQSR 1R3LA 3U83A 2HH0L 5C0JB 1Q8MA 4WFHD 3AC0A 3LY6A 3NA9H 4TNWF 3U30B 3GFUA 5C0EA 4OFPA 1RUML 3HE6C 5I66A 1NKRA 3TEUA 4JFHE 2CLZB 1EUUA 3S98A 3WUZA 5F7EH 5F44A 3S35L 2ZOLB 1M71A 3MA9H 3EUUA 3SE4A 5IJVA 1IGJA 2BDNL 3EFDH 3EYQD 4KK9C 3ZSSA 4I2XB 5I1LA 1KPVA 3MXWH 5E95B 4LPUA 1VENA 2XT1B 3BN3B 2AVGA 4PRPE 4ZUVA 1KCVH 4LGPB 5GS0H 3QNYB 3IFOA 1NGQH 1R6VA 3F5WA 4GH7B 2CD0A 3BIKB 4MA1B 4XBPB 2PCPB 5LXGH 4HGMA 5D5MA 4KTDH 1CK0H 3MRJB 5ADPL 5LQBH 4WU7A 3HZVB 4MJ5A 2DLEA 1TQCC 1U92A 2D03H 2VLLB 4OLWL 5FGBA 3U6RB 5DHVA 3RWDB 2VN4A 1GZPB 5T5FH 3TBSA 2Y5TA 4OLUL 2F8OA 5LWYL 3TVMA 3BGAA 2QBWA 2CRZA 1U91B 2C4FU 1PZUB 2HLFC 3VWKA 3WFBH 1NMAH 2C3HA 3OKEA 4XI5C 4GMSH 2OXHA 1NANI 2JJWA 4NJ9L 4APQC 3GK8L 4HWZA 1LO4L 3LKNB 1HHHB 3ULUL 4YHLL 2UVEA 2CKBH 2RQ8A 1IVLA 4GBXD 4R90H 2PKDA 1S7TA 1O0VA 5FV1L 5IP4A 4YBQD 5BVPH 4U1IA 2NY2C 4RMRA 4WDIA 1PKQE 2EDFA 4F15B 3KXFA 4AT6B 5HGHA 4C83A 5FFLA 3FB8A 4OD3L 2DIJA 2BSSA 5F88B 1AXTL 5IVZA 5F7YC 3MRLB 2BMKB 4KKLD 4AG4L 3MJ8B 3CJJA 4F9LC 4DVBB 3MUHL 3S37H 5C0CE 2Q20A 4OKVB 5DLMH 5DJZB 4X7SH 3AS0A 5SV4A 3CDCA 3QIBA 1HOCB 3H3PL 5E1AA 1EA9C 2J5LB 3RA7H 4ZNCD 3BPCA 4I3RL 1MWAH 1U2CA 2HFTA 5ESQB 4DW2L 3MLPA 3P4MA 3FQXB 3VWJB 4ZQKB 4FFWC 1TDQA 2R69L 2VLJD 3U4BL 4QY8A 4QLRA 4P5TB 3HPJA 1LEKB 1IGML 1YPZF 2YN3A 3HAEG 3IJYB 5F9OL 15C8L 1FL6A 3QNXA 4P2QB 3BHBA 3O4LA 1ORSA 2EXWD 3S35H 5HVWA 4Q9BA 3BFOA 4G9FD 3PG2A 2VDLL 1MFCL 3B9KC 5E94B 4XTRD 5KSAB 4PRDA 1RZIB 1TCRB 2V7HA 1M6OA 4DZBB 3UTQA 1IC1A 3I6LE 2VB5A 4NCC2 4NQTA 1ONQB 3QB7C 1MVUA 5DJDB 4C56A 1S9WB 1CFVL 2JK5B 5C07A 2GY5A 4ELMF 3BD4A 4N5ED 1LE5B 3QFJA 2A6JB 3MRDA 4WEBL 4PJGA 3ZE2E 5ADPH 4FG6D 1R3KA 1OCWL 3C6LA 2VAAA 4OLWH 1YYML 3A6CL 3FFCE 5CBEB 4OLUH 5LWYH 4JFXB 5E6IB 4ODHL 4NO3A 2ADJB 5E8NB 3C6SA 1VFBB 5BCAA 1JGVL 1A6PA 2YUXA 3QJHB 2P45B 5ILTL 1OOAA 3VXUD 1NAML 5IB2B 3V0VB 4ODTL 5I74C 2MHAA 3DNKA 4D0BA 4NJ9H 3GK8H 2VITA 1LO4H 3DUSB 3VGHA 1L0YA 3BOVA 5LGKA 4HS8L 1T1WB 5DFTA 3ULUH 3JUZA 4YHLH 4MQSB 3EYFA 5C09B 4W4OA 4OGAC 4RAUB 3GBLA 2QKIA 4HCRL 1JRHI 3V52L 3UXFA 3BT2L 4UNTA 4UI2A 1ZGLB 1B0RA 4AYFA 3S4SB 4HUUB 1T83A 5EA0L 2APFA 1M05A 4OD3H 3EHBD 3OR6A 4ELMB 1CD1B 3REVB 1G7QA 1AXTH 3CD4A 3DBXA 2DQIL 4ZUUA 1TJIL 3SEPA 2JLLA 1CN4A 3FAWA 4K2UL 4AG4H 1I1AB 4JDVA 2G75B 1GL4B 1J05A 1URLA 4EUPB 5IFHL 3MRQA 5J8OA 3H3PH 1BZ9B 3WJJA 4BQ8A 3PGFL 2ZNWA 1VACB 5KVGL 4I3RH 4R4FL 3VFWA 4OF6A 1QHPA 5HHVL 4H25B 4DW2H 2J88L 3FN3A 3FB6B 5D5ME 4L4TD 1ND0A 4L3AA 2P8LA 2FL5A 3HZMB 2R69H 4JQXC 3U4BH 1BLNB 4CVUA 4ENEC 1Q0YL 3I02B 1IGMH 1SJHB 5FECB 1Q1JL 4M93C 1VEOA 5F9OH 15C8H 5F1OB 2Q86B 5CILL 5EU6D 3LRSA 3MUGB 1NC2B 5F1SA 3QUMA 4PJCF 2X1PA 2R23B 4L8SC 4U1HB 1JV5B 3QIUC 3MTRA 1S9YB 4IOIA 2VDLH 1MFCH 2A9ML 1C12B 3PWNA 2DKMA 4F58L 3HN3A 5GRUL 2YD1A 1NUNB 1OSZB 2Z31D 5CJ5A 5AG9A 4OCYH 4HS6A 4NIKB 4LCYA 4LCWA 3PQYB 1CFVH 1GZQB 3NN8B 4M7LT 1KG0A 1AFVL 4PB9L 3MO1B 1QQDB 1SJXA 4Y4HC 3TV3L 4WEBH 3K8LA 1IM3B 4KK8C 1J87A 1OCWH 3TPUB 2VLRD 3PWUB 3UBXG 3RZCA 4OV5B 1DUZB 4ZOAA 1YYMH 4IRZL 4XRCB 1J8HE 5FV2A 2MCPL 3TYFA 2IBZX 1R0AH 2QLVB 1TITA 2DL9A 3BZ4B 3DPBA 4ODHH 2QHLA 4G8IB 3EYVB 4MHHI 5AAMA 4QXTA 3QWQB 5JW4R 1JGVH 1QKZL 5ILTH 1NAMH 1MHCB 4GAGL 4ODTH 4J1UB 2ZCKL 1NSNL 3S5LA 4IJ3B 2ICEA 4HS8H 4M5ZL 1SM3L 5DTFA 3VI3F 2FO4B 4PR5A 3S88L 4Y16A 3HNVL 4HCRH 4N0FB 3V52H 3GHEL 2EEDA 4P0DA 3BKML 4YDLB 2AQ1A 3BT2H 4MNHB 4MMXC 1X6NA 4U1KB 1RUQL 4L9LA 4WHCA 1IEHA 5GGTA 1MCRA 3KPQB 3TWCL 4C54A 3IXTA 3GKZA 5EA0H 4GS7C 4NQDB 4YC2B 4ZDHA 3O4LE 1HILA 4H26A 5GS1A 4XX1G 4YHKL 1SYVB 5HYJA 1KJVB 1KYOJ 2DQIH 2FIKB 1KXQE 4K2UH 1YMMA 1I7ZA 4I0KA 1K3IA 1XGTA 1YDPB 5BQ7B 4UIKH 3S3JA 5I8OL 4FMFA 2HTKC 5IFHH 3FQTA 2E9WA 3PGFH 4C56E 4BQ9A 5KVGH 4ZFOB 2VQTA 4R4FH 3L5WA 2PYFB 3GSQB 5HHVH 4JKLA 43CAA 4G6JL 3QFJE 3WHE1 3O3DB 2FEEL 4PJGE 2PYEE 4HDIA 5D7IF 4XXDB 1Q0YH 4RWHA 3QBTB 1PDKA 5HHOB 4PJ8A 3OKNB 5EOCL 3U0WL 5SX4I 4NN6C 3T2QA 1DUYA 1QSFA 1TXKA 1MCBA 1P4BL 3HC0B 5EU3A 3RUGF 2CKNA 4PD4K 2I9TA 4I48B 1PSKH 2A9MH 3H9ZA 3GMRB 4F58H 5E0QA 1LO0L 5GRUH 3MREB 4L5FL 1GPOL 1PFCA 5E8EA 4H1LG 3PL6A 3C5ZA 1CFTA 5IK3B 1BD2B 5I17A 2ESVD 1AFVH 4PB9H 4D9LL 4PJEB 1R24A 3TV3H 4F37K 4C58B 5JPMA 3EOAB 3L3HB 2EE6A 1XF3B 5GGUB 3VXTB 1X4ZA 5D7SL 1WFTA 3WEXB 3FN9A 4IRZH 1I1FB 2MCPH 4PRNB 2BZDA 3VXSD 2NY4B 2QQQA 5D7IB 4N0CD 4Z18A 3SCMC 1JNHA 3IDMB 3LSOB 1QKZH 3LS5L 1WVZA 2NR6D 3OKLA 1K8IB 2GJ6D 2GYSA 3E3QE 3QI9D 2ZCKH 5CHNB 4XVJL 1NSNH 2CXKA 2YRLA 3TBTA 4WI6A 5C92A 3RUGB 3EGSB 4M5ZH 3GSVA 2D7OA 1SM3H 3G5ZA 4MDIA 1ZEAL 3S88H 4MSWA 4NPYB 4HUVB 3Q5TA 3HNVH 3PGDA 4Z8FH 4ZOBA 1DE4B 4OZFG 2I9LA 2XWJB 3BKMH 5IM7B 3HZKA 1FJ1A 3QWRA 1RUQH 4E41A 2V9TA 3TWCH 3P30L 3KR3L 1CGXA 4KRNA 4XVTL 5D96C 3TO4B 1A6TB 2XZCL 3SDDD 1S7QA 4EQ3A 4CJ0A 1FZKB 5I8OH 4CU8A 1E28B 5F9DC 4IRSC 2W91A 5LGHL 4LLMB 3QQ4B 2WBJD 4UUJB 5I19H 1DEDA 1Y6KR 5IG7A 5HHMB 1VKXB 1UH2A 3QNZB 4G6JH 3BPOC 4ZUSA 1XGUB 3A6BL 3ET9F 4QHNA 1VA9A 4OFKA 5DRWA 5E99L 4F9PC 2P8MB 1MCOH 5DQ9B 5EOCH 1ZT7A 5IKCB 3U0WH 2UY7A 2ZCHL 2FH8A 3QEHB 1XIWA 5C70A 5CJQL 1P4BH 1G7HB 3CFIC 4RMTA 3QEGL 1KB9K 3BH8B 3LN9A 3RHWK 3B5GA 4MA8L 5E2TL 1U8JA 3MYJB 3BZFA 1C08A 1LO0H 4ODWB 4FNLH 2V7NA 1HNFA 2APBA 1GPOH 3DETC 5A16B 2NY5C 2I24N 3OWEA 1NBVL 1BX2A 4PRHA 3SPVA 1S7SA 2VLKD 3QDGD 4L8BA 3P4LA 4D9LH 1J0YA 4YDIL 4JZOB 4YO0B 1QFPA 4YHYC 4XBEL 2QQNL 3JTTB 4N8VA 5D7SH 2NXYD 3EFFB 5F3BB 1UVQB 4Y5XB 4G7YL 2XQYK 3VFVA 3RP1A 1YMME 1KELL 1UJ3A 2IAMD 4OIBA 1CT8B 3QAZC 3X12A 1P5VA 3LS5H 3CMGA 4KKCD 3DUHA 5DRZB 2XWTB 3DX8B 2UV3A 2IADB 4XVJH 4XVSL 3HE7D 4NQED 2VUYA 1F02I 3MRRB 1F00I 2RHEA 2NPLX 5C0EB 3BYYA 3V6OC 3ELAT 5GGRY 3RDTC 4EN3B 3KG5A 1HH9A 5JHDA 4JVPA 5DWUL 4X4YB 1QYGL 1NCTA 5ACLA 4PY8J 4YR6A 3P30H 3EO9L 3KR3H 3CGTA 4U6XB 1AKJD 2XZCH 2IPKA 1VFAB 3JWDC 5F1NB 1WWCA 3KPPA 4PJ7F 3F5WB 2MTPA 1RIUL 4JFDA 2YS4A 3KPTA 2YD3A 3CFCH 1PG7X 3MJ9A 5LGHH 1JNNL 4G5ZL 3IKCB 3QG6B 2CJUL 4HH9A 3O8XC 4U6HA 1CD9B 2DWDA 1A3LL 1H5BB 3BJ91 1F3DJ 3A6BH 1C7TA 2CPCA 3G6AB 2XXMB 5E99H 2ADFL 1EXUB 3B8SA 2JJTC 2ZCHH 1MQ8A 2C3VB 5CJQH 4AM0A 1LK3L 1BREA 5FYLD 3VG0H 2GTZB 1ZA3A 3QEGH 4QF1A 4O02L 4MA8H 5CGTA 5E2TH 1CXKA 2VL4A 3H0TB 5B3JF 4HWZB 4JFHD 1FVDA 4PRIA 1EHXA 1ORQA 4NZJA 5D1QD 3KLAB 2EKSB 3MLWL 1U3ZA 3EDEA 1EK3A 5IB5B 2EYTB 2DM4A 4AJ0A 2D0GA 3V5HA 1NBVH 4O51B 1OW0A 3KXFB 4PJ9A 4PRPD 4CMMB 3QUYB 5HGHB 4XPBL 1X5HA 3MJ7A 3GMPB 2BSSB 1XR8B 3DUUA 3RWGA 4XBEH 2QQNH 1JIBA 3JWOL 1WZLA 4JPIA 4X98A 3VFPA 3DI2B 4TNVF 1KELH 5C9KA 3H9HB 4G42B 3VXOA 3ZKSD 5DJAB 4WUKL 4LRNL 4PGCB 1RZGB 4ODXA 5T1LD 4AIXA 4UT9L 2SEBB 4XVSH 4LSDA 2GSIB 1WTLA 1YPZA 4G6AC 3MRPA 3S97C 3Q6GL 4H5SB 4P99A 2OSLB 4CMHB 5FUOL 4X0KB 2HJLB 4NOFA 5DWUH 1HH6B 1QYGH 3T3PE 3O3BB 4J3OC 1I1CA 4NM8L 1HSAA 3RJDA 5DYOA 3EO9H 5C0BE 1MCSA 1PQZA 1N5AB 1NH6A 1ZHBB 4J3UA 2V7HB 1M6OB 3MODL 3X17A 3Q6FB 2OXGA 1D9KD 3DRTA 1UWGL 4XP1L 3W0WA 4JM2D 1HXYB 3NTCL 5GRWA 1AJ7L 4BQ6A 3OMZA 3CX5J 1J11A 1MVUB 3SDXF 1OY3B 1FNFA 5DZLA 3QFDA 5C07B 1RIUH 2AK4A 4U05A 4PRHE 1JNNH 4JY6B 4G5ZH 1ROWA 2KH2B 5D2NB 5C0CD 3K80A 2GI7A 4MYWB 2V2WB 2CJUH 2EICA 5D6DC 4NO0A 4NZDA 1A3LH 4TRPL 3MRKB 2LVEA 4U1MA 1JHKL 2ADFH 2JELL 3KPSB 2NY3C 4GRLA 5I8CB 3WIHA 1YN6A 2K7PA 2VRAA 1A6AA 3ARBC 4LLYB 4LGSB 1KUMA 2OCFD 2F9BT 4O02H 2VE6A 2VL5B 3JTSB 5GGQL 3TN0A 1TTFA 3BQUD 3TJEL 1SVCP 3FOMB 1L7TL 2ZUVA 3MLWH 3G6DL 2PXYA 2PETA 5DXWA 2QKIB 2RGSA 4QRPA 3OAYK 3RVXC 3DX7A 2LE9A 2CIIA 3HAEA 3R8QA 3I6LD 4XPBH 3QO0A 1M05B 3WNKA 5F8QC 3BRFA 1QSEB 4ZUUB 4EI5B 3JWOH 1J18A 3TZVB 1Y18A 3WNMA 2QJDA 4W70A 2X70B 4YQXL 1WBYA 4G43A 5INCA 2EO1A 5D1XA 1K6QL 1U8NB 4IM8A 4K71B 4MB5A 2CDFA 2GIYA 3OGCA 2WINA 3NIDF 3D85A 3FFCD 4WUKH 4LRNH 3SDCD 1SQ2N 2YSSB 1WCBA 5TDPB 4JFDE 4UT9H 3TA3B 3MUJA 5J6GB 1AGBB 3RBSA 3MGTA 1XGRB 1S5IL 3ULSB 1RK0A 1KPRB 2XN9D 3IDUA 3Q6GH 2BVPB 5GXBB 4G3YL 5FUOH 2F74B 3T8XB 3BP5B 1I8IB 1GC1L 4OIIL 3U0PA 4DUVA 4PJCA 2ZP0T 3LEXA 3T4AA 4X9HA 1BFVL 1OAXL 2WZPD 4P2RB 2W9DL 3L3GA 4HGWA 3WFEL 4NM8H 3CLFL 3DX6A 3BWUC 5DUBB 4LVHC 2W0PA 3O6LL 3PWNB 5I71B 3D0VA 3HE6B 1P7KA 3HPLA 3MODH 2JIXA 2GCYA 1UWGH 4P2QE 4XP1H 4PRIE 3NTCH 1A4KB 1AJ7H 2IBZY 3BP4A 4MMZC 2VZSA 1TTGA 1WBZB 5CBAB 1JWMB 3JSSA 1HQRB 4P57A 8FABB 3HR5A 2YC1B 2ID5A 3T0EE 4WENB 4P46A 2YA0A 3MLTB 2YRPA 4TRPH 4HEME 4KK5D 1OD7A 3VXRA 3GGWA 3D2UD 3TYFB 4LP4A 4OF8A 3KLHC 1BGXL 1JHKH 2Q76B 2JELH 5DRXB 4CBPA 4HC1L 4F3FA 3SGJC 3RBGA 1HHJA 4KXZH 5ESAB 4QXTB 4FQIL 4HPOL 4BFIB 5ENWA 3C09B 2G5BA 3JV6B 2AAVA 3V79C 4FFVC 4Y1AA 2JJUA 4CRPA 3TJEH 2EECA 1OGAB 1I85A 4QRRB 1L7TH 2DIAA 4K9EL 3P4NA 3G6DH 2R2HA 1IZJA 3TBWA 2QSQA 3KYKH 1YPZE 1N64L 3VWKD 3V5DB 5DK2A 2FBJL 5D7KE 2VO5A 4LFHG 4APQB 5HDQL 5GS0C 1AO7B 4JRXB 4HK3J 2MQ0A 3SE3A 4H26B 3ES6A 4U1JB 2R1WB 1QRNB 4YEFA 2LU3A 2AJZA 3CUPB 4UT7L 4TSAL 1XGTB 5F1IA 4YQXH 1AQKL 1K6QH 4WFGE 1OAKH 3BN9C 2NY2B 4DZ8B 4U6YB 4YK4C 3QQ9C 4MQ7A 3H3KA 4NHCL 3P4OB 1J8HD 4ELME 1S78D 4XHQA 2VLME 1VADB 5C0ND 2AK4E 3OTTA 4XCCL 3EJYD 4Y4KC 43CAB 4A6YL 5ISZB 5J6HA 3KJ4C 1Z0NA 3NFNA 3OJVC 5DDHB 5IEHB 4LPXA 1FZJA 1S5IH 1T0MA 2GSGB 4P23A 1IJ9A 3QPXH 1DQJA 3QIBD 1A1OA 3VJ6B 4PB0L 4G3YH 4PJ8B 1A1NB 2JKXA 3TH2T 2YWYA 1GC1H 4OIIH 3UBXA 2Z0BA 3RGVC 1KB5A 3F7YB 2EKJA 1BFVH 4XCEA 1OAXH 3FO1B 1ZHLA 1SEBA 2W9DH 3WFEH 4X9BA 3CLFH 1NBYB 1B3JA 5DHYB 1EEQA 3MRHA 1EBAA 5KSBB 3O6LH 2CLVB 2OBGA 4IRJC 5KS9B 3VFOA 2HLAA 2C4FT 5TPWL 1BOYA 4KQ3L 5E8EB 2NYYC 4JG0L 1T5WA 5L2KA 4R2GC 4ZAKC 3T0DA 4GRMB 1PGRB 3B9KB 4RSVA 4S0SD 4MXVF 5CGYC 1R24B 5JPMB 4U1LB 2WQ8A 3O9WD 4MJ2A 5DMIL 5IB4A 1XCQA 4BK5A 4C56D 5BMFL 3MRNB 1BGXH 3PQYE 4TTDD 4E42A 4HC1H 2FX7L 2XA3A 3QFJD 2PYED 4FQIH 1BVKB 4HPOH 4Y5YC 3C6LD 3NBNA 3SDAD 5E03A 4LQ1A 1E4JA 3ARTA 3KYMA 5CMAA 3CVHB 4HKXA 5IMMB 4LVOC 4K9EH 1N3NB 3G5ZB 3DVNB 1CD0A 1I7TA 2HAZA 2OLDA 4J3XA 2RBLA 1CLZL 3PGDB 1N64H 1I1YB 5I74B 3VCLA 3KNBB 2FBJH 3QDMA 2ERJB 5EBWA 2WMPA 5HDQH 4PJCE 1U8PA 1OTTD 1H8OA 1T1ZA 4F7TA 2DQTL 2X89A 1U9KA 4UT7H 3LKOB 4TSAH 1C8PA 1AQKH 2DQCL 3FN0L 4J8RB 5IW6B 2Z8SA 4NHCH 1XZ0A 5HYQB 2P1YA 2ZSWA 4H1LA 4XNQA 1AR1C 5EO1A 4XCCH 2Z93A 4A6YH 4XNXL 3LCYA 5D7JC 1A6ZB 4GG8A 5AAWA 3VH8B 4NBYB 1W72L 1X4YA 5HYIA 1K4CA 4PB0H 2XTJB 3VXRE 3OAYH 4FZ8L 3VXMA 3UEZA 4PYHA 1XIWB 4NQVA 1N8ZB 3AFLA 3FMGL 4I1NB 5I15L 1IEBB 2CUHA 1QACA 2F53A 2FLBT 3G9AB 4YPGA 4NRZB 3M17A 4M93B 5DD1L 5HHOE 3B43A 4KGJA 4X6DA 4UBDD 4Y1AE 1IZKA 3MV9A 5TPWH 4KQ3H 2DQJL 3VI3E 5A43C 4FOMA 4JG0H 3KYNA 3LIZL 4F8TA 4L8SB 1IGIL 5DHXB 5I8EA 3HS0B 3QIUB 2B2XL 4FFYL 1IAOA 4OV6F 3GI8L 1KT2A 4GUPB 1NBZA 2YXFA 4QNPF 3JV0A 3G5VB 1DLFL 3QIWC 3C9NA 3R0MA 2Z4QA 3EOBB 5ACZB 4OZFA 5T1DL 2YEZA 5DMIH 1T7ZA 1JNJA 5JR1L 1JWUB 4LCCC 3ARVA 1A7QL 1N2RA 3EO0A 4WUUA 5FA3A 5BMFH 4X8JB 2Z92A 2O61B 3O6FC 3AY4C 5JQHC 1UJ3B 2FX7H 2IPTL 4K8RC 1FSKB 2ZG2A 5D8JL 5CGMA 4TSCL 4NHUA 3SDYL 2PW1B 3B8YA 5EIVA 3RZCD 3P3YA 3MFFA 1RZJC 4J4PD 1NGPL 1CFSB 1EUTA 3VD3A 2NXZC 4NT6B 3AUVA 4FABL 1A7RL 5D7IE 3ZHLA 3OJDB 3QZWB 4TUJB 5IFJA 4WW1B 2Y9RT 3BEWB 3DURB 3AM8C 4S1RL 1M1SA 5JHDB 3T09A 1CLZH 5K9OB 3L95A 1ZHKA 2QADC 1IAIL 5IV2A 3L6FA 4LEOB 4LHUB 2FYYB 1MH5A 5KSUA 2NTSP 3V6FB 3IAPA 3TP4A 4PG9B 2R8SL 3VDBA 3NCJH 1H3TA 1K2DB 3LQZA 4JY4B 5B4MC 2DQTH 2VJXA 2VISA 1S9XA 4Y16D 1ZLUK 2YD7A 4NNYA 4G8GB 2OJZL 1TTUA 2FO1A 1CGSL 4PJ7A 3A6OA 2FHCA 4J7RA 2BRRL 2KQNA 1D5MB 2DQCH 3FN0H 3AAZA 3EIFA 3AMKA 3WHE0 4GS7B 4Z0XA 3OX8B 2I5YL 2EXYC 3RTQD 3R06B 2FWOA 5KVEL 2LTQC 1BFTA 5DMKA 1YMMD 2HFEA 2EZ0C 2W9LA 4G6ML 4XNXH 3X11A 4OZIF 5EZLB 5FYJE 4U0QB 4NKMB 3PWPB 1U3HC 4QHMA 4QHUB 1W72H 5M95B 3AU1A 4IHOB 5T3ZE 1K85A 1UQSA 1YQ2A 1HYRC 4AQOA 3GMMA 1KLFA 4ZS6D 4XX1E 4PJBF 1PEZA 3MZGB 3NABL 4HIJA 4QHKI 2VDOL 3FMGH 4UU9A 5I15H 4Z78B 5MHSE 3VGFA 2F8XC 3W11D 2W07A 5L8LB 2V5MA 5DD1H 5IQ9B 2WM0A 4C55A 4NN6B 2DQJH 5IB1B 3LIZH 1UM5L 3EBAA 2X4SA 3ZYOA 1IGIH 3O3AB 5IIEA 1KJMA 4K7FB 2B2XH 4FFYH 2O5ZL 2XNAA 5BS0B 3GI8H 1T1XA 1JUFB 4WWKC 1DLFH 1P6FA 3RJQB 1FL3B 1N59B 2CLRB 5T1DH 3UTTA 4RDQG 5JR1H 3LHPL 3PL6D 5E5MA 2BSTA 1A7QH 1QHOA 4XCYB 3MRBB 2XG4A 3MROB 4X98B 4OZIB 2IPTH 5F9JA 5JMOC 4FN0A 4JPVL 4S1SL 5GRVL 5IEKA 5D8JH 1YEGL 1WCQA 4TSCH 5B38B 5FCUL 5D9SB 1ODAA 4JKWA 3SDYH 1MWAA 1EGJL 1NC4A 3M1BA 4MCZB 5FF6A 3DHJA 5HDBF 1NGPH 3QCVL 5D4QA 5CZVL 1ZVSA 1J0IA 3SCMB 1A7RH 3MRPB 4HIEA 1F8TL 4ELKA 5AD0B 1ES0A 5IB3B 1IQDA 4S1RH 2NY0C 4JHWL 5I9QB 2H32H 4DWHA 1IAIH 4DKFL 1QZ1A 4QOKB 2ITCA 3VXME 5EO0B 1GOFA 1VFMA 1Z2KA 2R8SH 3PV6B 4RA3A 5LGJA 4JQIL 2AJUL 4OT1L 2F53E 2Q87A 1FG2B 2OJZH 3DRTB 1CGSH 3W0WB 3OHXA 3SDXA 5T1MA 4X6EA 2BRRH 2WUCL 4ACPA 3O0RL 3MA7B 4OCXL 3WLWC 3VFNB 5D96B 1A21A 4Y2DA 4JRWA 3T4YA 2I5YH 5KVEH 3RWIA 1FC1A 5EUOB 4G6MH 2NZIA 4ZUWB 1PYWA 4U1MB 4IRSB 4LDEB 4JFFB 1G0YR 1RMFL 1J5OL 1BIIB 2ZJSL 3WIFA 3NABH 4KMLB 3ILPB 5IOPA 2VDOH 4YHOH 5TE7L 1J1XL 2VWEE 4K94L 5FIEA 2HVJB 3FO2B 3LDBC 4RGNB 4IIQC 4AEEA 1IT9L 2VABB 5C0BD 1UM5H 2BVQB 2OZ4A 1AD0B 3HI1B 3NMEA 2OTWA 4FQCL 5CEXB 2QHRH 3UAJD 2O5ZH 4HUKB 4Z7QF 3CU1A 2CQVA 1AR2A 3BSZL 4LAQL 4CL7A 5JOPD 1NEUA 2IH1A 3D39B 3ZE0F 5I76B 3LHPH 2KBGA 4PRHD 2R9HC 5DQDL 3SY0B 3LH2H 4Q6IC 1UKSA 3C8DA 1BQHG 2DICA 3EZJB 4XNYL 1FC2D 1AH1A 4PJ7E 4JPVH 4S1SH 1U8KB 1KJ2L 3MBEA 1YEGH 2FATL 3EYOB 1KN2L 3S34L 1JTPA 3DV4A 1YNTB 4ZODA 5H8DA 2HVKB 1EGJH 5FKAB 3CNKA 1K8DA 5BVJB 3QEQA 3QCVH 5CZVH 5FA4B 3RWHB 5KBNC 5FDWA 1F8TH 2FX9L 3QAZB 5JNYA 4P3DA 3BH9A 4XPTL 3LB6D 3GDBA 4F33A 4JHWH 4R6UA 1ZWIB 3TIEB 2YHGA 3U0PB 4R7DB 1IC7H 4DKFH 1YUHA 3QXTA 1NUGA 3ZT6A 3B9EA 5DEZA 3ZKND 3LN5A 1OWWA 2AJUH 1WTGT 3RDTB 4OT1H 5B3JE 1UXSB 1P7KB 3QWOA 4JRYB 3ARED 1MUJB 2BP3A 3IJSB 4G8FB 1NCDL 2WUCH 4MXQD 3O0RH 2VNCA 2A6IB 3P77B 4OCXH 1OP3K 1T3FB 1CICA 4OCMC 2W9EL 1RU9L 5GS3A 3W9EB 3BUTA 2RR3A 5TDNB 4LCIL 4R96A 4P4KC 2J3SA 1IL1A 3X3FL 2NTFB 3RX5A 4JFDD 4XNZB 5GGVY 5J3HC 2Q7NA 4BH7B 1C5CL 4YHNA 2XWBB 1BQLL 1RMFH 2BNUA 1J5OH 2ZJSH 2W65A 3O8XB 2P42B 4LKCA 2CDEB 2AXFA 1J1XH 4MQTB 4QHLA 3CU7A 5TE7H 2DLFL 2ZOKA 4I77L 4L8DB 4K94H 3RWEA 3KPSE 4PY7B 3SKNB 3WE6A 1IT9H 1BECA 4D0DB 4HCRA 4NYLA 4PGDB 4BUHA 1ZA6A 1T04A 4FQCH 1P5UA 3DX9B 3C5SA 1NDMA 1UB5A 1EVUA 3BSZH 4P2QD 4LNVA 4LAQH 4PRID 5CIPA 2R1YA 4PJAA 2EH8L 4ZXBD 5FK9A 4Z7WA 1CLOL 5D1ZC 1X5ZA 5DQDH 2GTWB 3VFMA 3DRQB 1I9RL 1IAKA 3T0ED 3X14A 4XNYH 4KJPD 4QRSB 4PJ9D 1JN6A 4NKOA 4MQ7B 1NFDF 1KYOK 3SDXE 5EWIL 1KJ2H 2X1WL 4YX2L 1FORL 2FATH 1FFPB 1KN2H 2FCBA 5DD6A 3S34H 5IHZA 3RI5F 2HT4D 3C60C 3L7EB 3F6LA 3QXWA 3RGHA 4BSVA 5C7XL 4N68A 3E6HA 3DVIA 4PREB 4ISVA 5CCKL 4BQCA 4P23B 1INQA 2DKUA 2FX9H 3B3IB 3QUZC 5HHPB 4XPTH 3HNSL 1P9MC 5KW9L 3Q1SL 4KKAD 3P9LA 4N9GB 1G9ML 1KB5B 1P7QA 3NZHH 5E6ID 3BKYL 1YEKL 4M8QB 5K9KB 5CP3A 2BNQA 3MV8B 1PY9A 3AS3A 1LD9A 1BOGB 5D7KD 4JVWA 1MY7A 1IM9B 4HLJA 1NCDH 3LKPA 1T5WB 5L2KB 1MI5A 3O11A 2AV7B 1KTRL 1U8QA 4P2RE 3O4OC 4Y89A 5C9JB 1QBML 4WTZG 2H3NA 2ZUXA 4RMUA 2YMXH 3TO2A 4I18A 2W9EH 1RU9H 4WFGD 4MAUL 5C2BL 5KAQF 2OS7A 1WWAX 2C1PA 4NCDA 1VGEL 2KZWA 5HJ3A 2ZZUT 4JANB 2VXTH 1M7IB 2VLMD 1SMOA 4Y5VC 3X3FH 3G08A 3L1OL 3WL9A 3PWVB 2AK4D 2APTA 5DJCB 4OFYD 3RL2B 1H3PH 1I1AD 1C5CH 5ID0B 2NW2B 1BQLH 1MHPL 1UWEL 5C0GB 1OF2B 4E5XB 5F7HA 3NIDE 5EUKB 3E6FB 4NO0D 4Z7UB 1XGYL 3HHRB 5EPMA 1MCWM 4WIQA 3PP4L 2DLFH 4PJDB 4I77H 1OQOA 3ARWA 2NY3B 1GH7A 4MZ2A 5J4MA 4GRLD 4E0RB 3QEQE 3B9DA 2A6DA 4JJ5A 3RL1A 1DTUA 3QDMB 3WJLA 3ZYZA 3TN0D 4JPWL 2X9WA 3QULB 3G6JF 4Z95L 2M8XA 4F7TB 1A14L 3G9VA 4YFLF 1DBML 2EH8H 3ZDYE 3ROOA 4W4NA 4LCUB 1CLOH 4ONGL 3RVTD 3SKMB 3MYZA 2WQRA 1I9RH 2ATKA 4XXCC 3OQ3B 3ARPA 1G7PB 1DDHB 5EWIH 4YX2H 1FORH 4OD1L 4EIGB 1TFHA 4HWUA 1GXEA 3PQYD 5EO1B 3IFNL 3QA3A 1NCNA 5C7XH 5L2JB 2YPLA 4MLSA 4J3SA 1K4CB 3GJFA 4X4ME 1E27A 4KK6C 5TGBA 3D85D 3V4VL 3HNSH 2QEJA 5KW9H 2P24B 3Q1SH 3QRGL 5HY9B 1G9MH 3DGGA 3V95A 5ID1A 1S9VA 3OSKA 4PPTA 3V0WH 1MHEA 3BKYH 1OPGL 1YEKH 5DHVH 4XB8A 4UV4L 4MNQA 5JDSB 3IDYC 4YPGB 1OLLA 3T2OA 2D4DA 3EYQC 2ZSVA 4QCIB 1I8LC 4HK0B 2BVUA 4HIHA 3ETBF 3JWOC 3GKWL 1ZK9A 2YBRB 1MJJB 2X4RB 4OZHA 1Q9OB 1KT2B 2F54A 4HH8A 4X8XA 3DMMB 1P1ZA 4MAUH 3S3SA 5C2BH 1MCFA 1BJ1J 2L7JA 1GAFL 2JIXD 5D6CA 5BJTA 3SOBL 1Y0LA 2BY0A 2HMID 4WUUB 5FA3B 3L1OH 2Z92B 1SHMA 1ZV5A 4PV8A 4EOWL 3CH8A 2GT9A 5TFSL 3H6JA 3ILQC 1EH9A 1MHPH 1UWEH 5CEYA 4JZJC 2Y07L 1RK1A 4JFOA 2WBKA 4P46D 1S7RA 4LRIC 3OG4B 3TFKC 2MPAL 2Z9TA 3OKMA 3MFFB 3VXRD 3DTXA 4M8VA 5B8CA 1EAPB 1UYWL 2NLJA 1BJ8A 1V3JA 1FZMB 4NBZB 2J2ZA 3DVGA 5HHOD 5IBTL 3MPCA 1X5YA 2N1KA 4GW1A 4RNRA 4M9PA 4ZSOA 4L3CA 3GSNH 3PWLB 4YBQC 4JPWH 1CF8L 5KSUB 4PJXB 1JK8A 3LQZB 1P7HL 2IBBA 3QYCA 4Z95H 3KYAA 4JZNB 1A14H 3FRUA 1WAAF 1DBMH 3QT2A 2APVA 3P9MA 2DJ4A 1GGYA 4KKLC 4ONGH 1DFBL 3QUML 4R4BB 1HN1A 3G5YB 1ZLWK 3JV5A 2VIRA 3AAZB 5IWLA 3V0AC 2Q7YA 5FGCE 2DQFA 4P9HL 1MI5E 4OCWL 4M61B 4OD1H 3X13B 2BNRE 1AGDB 3NCBB 3LD8C 4MXVE 5ANMA 3IFNH 2X4TB 3BWAA 1YMHB 4YK4B 2FSEB 4CW1B 3QH3B 2XV6B 2EDXA 3HG1B 1NKOA 3ARDC 3GSUB 3V4VH 5GJSL 4PJBA 1KIQB 2GK0A 3QRGH 1T89C 2NY4D 4Y4KB 1IILE 4ODUA 4XPFL 4UTAL 5I16B 3KJ4B 1OPGH 2LFGA 5CEZE 4UV4H 4KJWD 4CVXB 2LABA 1HSBA 4HFUL 2B39A 4X7TB 4HX1A 1F42A 3RGVB 2CKBB 2X1OA 4L8CB 4PLNC 1QEWA 5D7LB 5E56A 3DO7A 4PP2A 3GKWH 1RY7B 3RVVC 3QUXC 4OD2B 5IIEB 2XI9A 5DSCB 2ATPA 2F5AH 3ARFC 1FNSL 4HS3A 3WS6C 5ITBL 3SQBA 4IRJB 1GAFH 2VSDA 5BZWA 1C5DB 4HV8B 3SOBH 1AIFB 4ZAKB 3ZHDA 1I7RB 4GAFB 2YK1L 5HBBA 4EOWH 1EFXA 2X4OA 5TFSH 5DFVD 1MFEL 2X6MA 5J9PB 5FYJD 2Y07H 1GC1C 1MWAB 2MPAH 1X7QA 5T3ZD 1ED3A 5JA9A 1NC4B 4TVPL 1T22B 3L3OA 4WI4A 4GRWF 4M03A 1UYWH 4KJQC 1N6UA 3M8OL 1B88A 5EC1A 1NGZA 2PTVA 3MMEB 2HJKB 1KNOB 4KUZL 4L4VA 5IR1B 5MHSD 4Y5YB 3KPRB 4P4RA 2XY2A 3IU3B 1LHZA 1FFNA 4F9PA 5IBTH 3FT2B 1S7WB 1CF8H 3FQWA 4LVOB 5DO2D 1MRFL 3IFPA 1LO5A 4J6RL 3EHBC 1HQ4A 4YDVB 2Q6WB 4JR9L 1DFBH 3QUMH 4Q9QL 3GMQA 3W39B 1S7UB 2A0LD 4OCSL 4ZPTB 2NY1D 2GJJA 2HP4A 5EBMB 4P9HH 4Y2DB 4OCWH 1EEYB 2X89D 2K3TA 4QNPE 3CX5K 1HHGB 1I3RA 5FO7A 2FEDC 3UTSE 4EJ1C 1FYTA 3Q3GA 1D5IL 4MX7A 1JRHL 5GJSH 3RRQA 4K9EC 1OGTA 4I4WA 4LOUD 4Q2ZB 3VFRA 1Z3GL 3C8KB 4UTAH 4XPFH 5D7JB 1RHHB 3ULVC 3T0VA 4F7MA 4NRYB 4GG6F 5DEFA 5J06A 3HFML 4LIQE 4MQXC 4K7PX 1PX3A 1X3DA 4HFUH 2Z91A 2V2TA 1JNLL 3QUKB 4D9QE 3UJIL 2Z31C 5DVNA 4MD5B 3ZTNL 4ZMAT 1JHTB 1L6ZA 1AGCA 5BZDB 2F53D 3GUTA 2AJ3B 5J1AB 1FNSH 3S36X 2DMCA 2BSRA 5IMOB 1JL8A 4R3SA 3FO9B 4LLWA 1TMCB 5GISL 2NMSA 5CJXC 2LV4A 3RNKA 4XP6L 1ZGLP 2YK1H 5CP7A 5I6XC 4JFYB 4POZC 3QIWB 1MFEH 3V5KB 4QTHB 2GJZA 1E4WL 4YGVA 4QYOA 4LSVL 3M8OH 3P73A 4FQPA 1A02N 4U1SB 5ANME 3ARSA 4LLVA 5CWSA 4OZIE 1FNAA 3FT4A 1YYLL 4KUZH 1KGCE 4AENB 1H3GA 3KS0H 1KJ3L 3P0GB 4R0LC 5MERA 1PG7W 4PJBE 1FCCA 4ORGB 3IT8D 2R0KL 3OBAA 1FDLL 2MSPA 3QEUB 2WWMD 1MRFH 2OR7A 5C8JB 2VZVA 4LLDA 2LAGB 3KGRA 1J86A 2CIKA 2QADB 4JR9H 4UQ3A 4Q9QH 1ACYL 1EX0A 2ORBL 1CTNA 4IOFC 3O2DA 5EFIA 4OCSH 1ETZA 4OSUL 3OXSA 4F15C 4I0PC 2BJMH 3VGAB 1CICB 3FQNA 2DI7A 3ARGC 4HZLA 3G5XB 1CDUA 1CZ8H 2DMBA 5L9DH 3KPMB 3FQUB 3QUYD 4JVUA 4QRTA 5FOBA 4X7FC 4LVNC 3L9RA 1RZKL 1Z0MA 2E6PA 3CVIL 3CZFA 1JRHH 3MR9A 4X5WB 2XZQL 2LTQB 2W65B 1Z3GH 1DQQA 3FCTB 1NAMB 2VR5A 2QTEA 4C4KT 3HFMH 1IC4L 2BERA 2AXFB 5ICZA 5KN5A 4LPTA 4Y19E 5HDBE 2HRPL 1RULL 4XP9L 4X6CA 5F7FA 1JNLH 1JMXA 4JFFE 4OAWA 3NA4A 3HRZB 4FTVA 1FNGA 3UJIH 5HYFA 2JJVA 3ZTNH 1LO2L 3LQAL 4YHPB 1FVCB 1NCAL 2IC2A 1ZA6B 5IVXB 3ARZA 2AJVL 5E7BA 4L29A 1LP9F 5KSAC 3GIVA 4KKBD 5GISH 1I8KA 3LKRB 2UWEA 1BZQK 1SJEB 4XP6H 6FABL 1NFDA 1CLYL 1F3DH 4WWKB 5HHQA 3CH1A 2YD6A 4PLOB 4XNMA 1W2KT 5DT1L 1Z6JT 5F9AC 3BD3A 1FN4A 5DVKA 5CSZB 5GRYA 4NFDA 1YA5A 4LSVH 1K4DB 3TBVB 1MCNA 4CADA 1CL7I 1DANU 1TPXC 2K9UA 3MJ9L 1YYLH 1BF2A 4NCC1 1TVHA 1C5BH 4N9OB 3OV6A 3CFBA 3F7VB 1DBJL 1KJ3H 2H26B 1HZHL 3KPSD 2FGZA 1XGQB 4GKNB 1MFAH 2R0KH 4DCQA 2BNQB 1QFHA 2IG2L 1FDLH 3ARBA 1P84J 1NQBA 1D5BB 2VDQL 3HUJF 2JJSC 4G6FB 2NY0B 3K8MA 3F7QA 1XF1A 1HHIA 2ICWA 1LP9B 2Z8VC 1S7VB 3L7FB 4RGOL 4NQUA 1ACYH 3LKSA 1T0PB 2BVYA 2ORBH 3F8UB 2IWGA 4JKPL 1U8QB 1KTDA 3RWCB 4OSUH 1U58B 5MENA 1AD9A 3D5OF 4PV9B 4Z7QE 3MRGB 3CXHJ 5EBLB 2AXGB 4WI8A 1NBQA 2QR0A 4JN2B 2FJFA 4LF3A 4UIMA 1F3JB 1W0WB 4OLXL 2ENYA 3ZE0E 5DJYA 1DVFB 1JFQL 1YN7A 2CXGA 3OJ2C 3LPWA 1RZKH 3CVIH 3WL9B 4AIZB 3EW3B 2XKSA 3TZVD 4HW6A 4PG2A 4OM0L 4ZYKA 1T0NA 2XZQH 3EJJX 1G7MB 2DJUA 5F7LB 2GAZB 1T6VN 1P69B 4MD0B 5DUPL 3DROB 4L4TA 4J3WA 4BSWA 4XB7A 1IC4H 1TVDA 4P5KB 2DYPA 5BW7C 3HZYB 2HRPH 2IQAB 1RULH 4XP9H 4HGKC 1QR1B 1K3ZA 2H2SD 2XICA 2CSPA 3LPGA 1F4HA 1HYSC 3UYRL 2B1HL 3LQAH 1LO2H 3VRJA 3GJEB 1NCAH 3LMJL 2AJXL 2A73A 5HGBB 5H2BB 3G6JA 2AJVH 2D0HA 3DGCR 4HPYL 4KROD 1A4JB 1A1MB 2OL3A 3LDBB 4IDLA 4JGMA 4IIQB 3RNQB 4P2RD 1ZVYA 2H6PA 1E4KA 1CFBA 1LNUB 4DOHB 6FABH 5SWSA 4MAYA 6CGTA 2B7DT 1CLYH 5SX4H 2D7QA 3D1MC 2IAMC 1LK2A 5AUMA 1RPQA 3WDIA 4AY0A 5DT1H 3EDDA 3GI9L 2GFBA 4KKCC 4KK9D 4OZGB 5I1CL 3QA3B 2GUOB 2A77L 4Q6IB 3ROLA 3UYOD 2V5YA 1R3HB 2YPLB 4WTZA 3U7AA 3ECBB 1OWRM 5JO5B 1RV6X 3MJ9H 2AW2A 4Z76A 3MBED 3CDGA 4JPKH 4E9LA 5ITFA 1DBJH 1YY9C 1HZHH 4OF7A 3MGOB 3VFGL 3QEQD 5A40E 3STZB 4MNQB 4UNVA 1RJLB 2YWZA 4M1DL 4LPCA 4KI5C 4FXLA 2VDQH 5DI8B 3WIHL 5B3NA 3HRPA 5E00B 5AEAA 3RY5A 4RGOH 4AH2B 1X9QA 4C4KO 4X6CE 4JKPH 4MDJA 4FTVE 3DO3A 3CZJA 1QR4A 2V2XA 3MV8E 3UTZA 4UDTB 2HLFD 4OZHB 3IF1A 4XI5D 3B9AA 4HJGA 1P1ZB 3W9DA 3RFZC 1W0VB 4APQD 5SWZB 4ONHA 3IRZA 4N1CA 3M45A 3CAFA 3LN4A 2R0ZL 1LGVA 1JFQH 4JFEA 4JQVA 1OB1A 3EOYG 5EZIL 2ICWJ 4M43L 4OM0H 3MSPA 1RUAL 1NFDE 4JO2L 1EO5A 5DUPH 2P5WA 4HG4J 4Q9RL 2ED8A 1OD9A 4M48L 3QXVA 5FYKU 4Q58C 4NSKA 3BGMB 1P2CB 4PTTB 5F3HA 1NDGA 5D1QC 2IEPA 1XR9A 3UYRH 1B90A 2B1HH 3WMSA 4DQOL 5C0FA 3ZE1F 4ZSOB 3LMJH 2AJXH 4N0RA 4PRAA 1SJVA 4HPYH 2DIBA 2Q8AL 4HWNA 2D9QB 1AP2A 1QLRA 2J8OA 4FFWD 3WUWG 3FONB 2NY6D 3MRMA 3WNNA 1Z5LA 3MUY1 5JORB 1K5NB 2VIRB 4RA0C 4ZTPL 4W6XB 5GSRB 4JFPA 5E6YA 2FR4A 1XMWA 4NC2B 3GI9H 1WC7A 4BFEA 4HKZA 4DN3H 3GMLA 5D1ZB 5MENE 4ONOA 5I1CH 1KCUL 4D8PA 2A77H 1XF4A 1PX4A 4XNUL 3CFJB 2DWEB 1MHHA 5T1KA 3ZDXF 5K9QI 1UB6A 4NRXA 4OBRA 3D25A 4WW2C 4K94C 5HXMA 2GJ6A 2NY7H 5DRNB 3S7GA 3QI9A 5K59F 3VFGH 2J8UF 3GSOB 9CGTA 4MA3A 5EO9A 3ZZ1A 1G7LA 4EVNB 5EU4A 2BK8A 4YFEA 4M1DH 3T08A 3NCMA 4L4TE 1G6RA 1W8NA 5ICYB 3WIHH 5KG9B 3HMXL 1FLRL 1PG7L 4P48A 5E5RB 5H94B 4F37F 1J0JA 5GSVB 1JPFB 3MRIB 2RJMA 4JDTL 5F6IC 1QA9A 2D31A 5F9WC 1BBJA 2BY2A 2WW8A 3Q5YA 4V2CB 3SDDA 1TZHA 2IH3A 1ADQH 4W6WB 4ORZC 3G6JE 4Z7NF 3BMWA 2CK0L 3QQ3A 5BZWB 1A9EB 2P5EB 4PGBA 3STLB 3WHXA 1MI5D 4CNIB 2R0ZH 3BDBA 2BNRD 4WV1C 5KZCD 4MA7L 3O4OB 1U42A 5EZIH 2GITB 3HAEH 1X4XA 2IQ9L 4Y4FB 2P47B 4M43H 4X5XB 2WBJA 3K4AA 1RUAH 3JV4A 5SWSE 1DEEA 3BP6B 2KPNA 4JO2H 1I75A 1YY8A 4Q9RH 2X40A 1X7QB 5I1IL 4HKJA 2MQCA 3HNTL 4M48H 3UPCA 3PHOA 4Y5VB 2HFFA 1JWSB 4FQXA 5EC1B 4BH8B 3KLDA 2E7LC 3NVQA 5E2JA 1L9NA 5CEZD 5HYSG 4KWUA 1XF5A 5D2LA 5EG6C 4DQOH 4CUCA 3QHZL 3UJJL 3T77B 3KDMB 5CINH 3UZQA 2Q8AH 1UADC 1NFIA 1FHGA 4WI5A 4IMLA 4NQXA 2JCCB 3JZ7A 4YEEA 4ENED 4I3SL 4JKMA 1KIUA 1CGYA 2PO6C 3GMQB 1WFUA 3QDGA 5L88H 2Q3AA 1JF1B 2C1OA 4ZTPH 4X6BA 5BV7L 5FGSA 2DQUL 1LO3L 5J7CC 3MNWA 3UYPA 1A8JH 3QIUD 3SDCC 2CUMA 1HEZA 1KCUH 1YNLL 2AEPL 1DN0A 3DYMA 4NQCA 4XNUH 4Y5XC 1WZ1L 4K7PY 1FYTB 1WISA 3QO1B 4P2OC 1UC6A 1PLGL 1E4XL 3RHWF 1IKNC 4JFEE 5FYJL 1TNMA 5TQ0L 3IAQA 5JA8B 3TIDA 3RWJB 4BKLB 4FXKB 3IJHB 1TZIA 3HE7A 4WFFE 4Y4HD 3OGOE 1UG9A 1MPAL 3MNVA 4KK8D 2HA1A 2P5WE 3HC3L 3I6KB 4X9GA 4EN3C 1DLHA 4GW4B 4YBHA 3HMXH 1FLRH 4PTUA 4XZUA 1PG7H 4GKSA 4LKXA 1CFQB 4WJ5A 3OL2A 1J1PL 1FV1A 3K74B 4JDTH 3SE4C 3IDYB 4M7JL 1HWGB 2X5PA 1NGXB 1EZVX 3BXNA 1B4JL 2EE2A 5T3XE 1AKJA 4D3CL 1MF2L 5EOTA 3L3IA 4J3VA 2CK0H 4QRQB 3VFTB 3NFSL 4NNXA 3O3EA 1WAAE 4KK5C 4PRBB 5C6TL 5HVFB 4MA7H 3FL7A 1NMBL 3TT1L 1DZBA 5DK3A 4HEPG 2ADGA 3UTSD 1J1OH 2BC4A 1GGBL 2YPKA 1Q9KB 2GJZB 5I1IH 2QSCL 1G9MC 1R3JB 2IANB 3HNTH 3L3DB 3N0PB 4R26L 1G7JA 2H8PA 1RAMA 1GHFL 3UPAA 3KLSA 3TVMC 2H9GA 1JGUL 3D9AL 2FJGA 4ZNEA 3VMOA 2HTKD 1U8HA 3QHZH 3UJJH 3ESVF 3GIZH 3DSNA 4UOJA 1EPFA 4KJYA 4OJFL 1P4IL 4KTEL 4D9QD 2Z35A 4HIXL 1ZT4A 4TNVK 4IBLT 5B22A 3U0TA 5C3TA 4GBXB 2QV2A 4I3SH 2CIKB 5SX5K 3UO1L 3WD5H 1VGKB 4YBLC 5BV7H 1ETZB 4JN1H 5IBLC 5I1DB 1FAIL 2DQUH 1LO3H 1RJZA 4DFHA 5GZOD 2P8PB 3QJFA 4HZLB 3TNMA 2W92A 1N4XL 3GMOB 1YNLH 2AEPH 1JGDB 5JW5A 2FZ3B 1S3KL 2Z8RA 1WZ1H 3T1FA 4XBGA 4XCNA 3BP7B 1PLGH 1E4XH 3QIBC 2R4SL 3I2CL 1JGLL 1S8DA 1JJUA 5FYJH 5KOVC 3LD8B 5TQ0H 4S11A 5BXFB 4PJHF 1KTKE 3FTGB 5T3ZH 1DQQB 2W0FB 3WXWL 3RVWC 1BQHB 1MPAH 2Y7QA 3CSYB 4AK1A 3SKOA 4IS6A 1KGCD 2VLJB 2OJEB 4LDOB 4MHHG 5A2IH 3HC3H 3GSWB 3VFUA 4RFNC 1T4KA 4GRWE 5C0IA 5EORL 4CMHC 5DJ8B 3PHSA 3DYOA 4OIAA 3EAKA 4PJIF 2PTUA 3SCMD 2EDJA 1J1PH 1MRCL 3NH7L 2NNAB 4M7JH 4G9FB 1B4JH 4JB9L 2AABL 5TDOA 4D3CH 1MF2H 5ETUB 3U7YL 3GIVB 4LL9A 1PKQA 1D9KA 2ILLA 5IMKA 1FVEB 3NFSH 4JM2A 4M3JA 4GAYB 5C6TH 3QUXB 1Q94A 3BPLC 5T33L 1QO3B 3MRCB 2C3WA 4YDJA 1NMBH 5HHQB 3TT1H 2HN7B 1KENH 4XAWL 4PS4L 4XNMB 1IAIM 5F89A 1GGBH 1LEIB 1L9MA 3C6LC 4RQQA 3PABB 2QSCH 5GGVL 4R26H 1WBXB 4PJHB 4RZCB 1ZVHA 2BXZA 4W68A 1GHFH 2OQJA 2V5SA 2HG5B 2N7AA 1EFXD 1JGUH 3D9AH 5INDB 3BUYA 3D18A 4KDTA 4NQCE 4H1LH 4N0UB 3G04B 3CPLB 5DMGD 4Y19D 3VXUB 1JYNA 4IRSD 1WITA 1A5FL 3D3VA 1Z9SA 3DXAA 1BVLB 1NEZA 3TESA 3C5JB 4JFFD 3T65A 4OJFH 1ZSDB 1P4IH 3BQUA 4KTEH 3K1DA 4HIXH 3HUJA 4GG6E 4ZUTA 5EOQL 1U8OA 3ULVF 3CFKA 3RY4A 5MEPA 5CFHA 1AGFA 2G2RB 4M62L 3UO1H 3LKQB 1IGCL 4FQQA 3OKKA 1JP5A 3I6GB 2XPGA 1KTDB 5E8OB 1FAIH 4ZG1A 1T83C 5J11B 3FJTA 5I2IA 3HMWL 1RI8A 3F7PC 1N4XH 4V1DE 5ICXA 4Z7VB 4B0MM 1V5JA 1S3KH 5CS7A 5BVPL 3DIFA 4PGZA 3MLRL 5MEQA 3DETD 1UWXK 3BEVA 5ERWA 1CDBA 3TCXA 2R4SH 3I2CH 3V6ZA 4HIIA 1JGLH 3WJJC 2EIZA 4F7EA 2FNBA 4OZFH 4Z6AT 4MJIB 3OKDA 3FKUS 2CGRL 3WXWH 3O41B 3QPQD 5JDJA 3IDNA 1MNUL 5IT2L 5H37G 2XN9A 3GHBL 1U93A 5I73C 1N0LA 1OTUC 5EORH 4S10A 3VA2C 4PBXA 2ZUWA 3CDYA 4UBDC 4G80A 5EU6B 2X1XR 5L8JB 5IUSA 3HI5L 2EC9U 1MRCH 3NH7H 3VXNB 4ZNEE 1JTOA 5EN2A 4JB9H 4WHYH 5CLTA 5FYLE 4H20L 2AABH 5C08A 1BFSA 4LQFL 3VGEA 3W81A 3ISWA 4P9HC 4WNQB 5I71C 2DI9A 1XCTA 3U7YH 2Z31B 4GW5B 2BVOA 1HDMA 3CFDB 1GIGL 1FNEA 1F6AA 1JMZA 3MCKA 2VN7A 3RDTD 5T33H 5MEOA 2YR3A 1QVOA 3BO8B 2R2BA 3O2WL 4ODBD 4G9DB 1MCPL 1S5HA 4O2FA 1X5GA 4PS4H 4XAWH 5IBUB 1LDSA 4F7PA 4X99B 2AV1A 2BCKA 1KLUA 4BFBD 2VLRB 4YAQA 4F80A 2CDGA 5GGVH 3RZCC 4A6YB 4Z77B 4LLQA 2XKNA 4MB3A 3D2UA 5I6XB 5HHNA 2X41A 3SGKA 4WTXA 4Z76B 3IXAA 3OXRB 4U7SA 4HKBA 4QWWC 4TYUA 4LLUA 5HDOA 3C09C 2NX5B 1A5FH 1FZOA 1DP0A 3L3KB 3WN5A 1TVBA 4Q0XL 1R3IL 1E6OL 2O93L 5GGSB 1T21A 1QFWI 5EOQH 4H8WH 3VXPA 3EO1A 3HLAA 4P5MB 4RCAA 4WO4A 3AS2A 5IF0B 4M62H 4R0LB 1IGCH 3SBWA 5JOFA 1H0DA 4L9LC 3FOLA 3BDYL 1EHLL 4MVBD 3HCVA 5GS1C 3IF1B 3HMWH 2XZZA 3MNZB 3CSBA 1C16B 3QDJA 1QLFB 1LP9E 2OZ4L 3T0WA 4L3EA 2OYPA 3RPIB 4EUPG 5EIIA 3MLRH 3CC5A 4I0PB 3VMPA 3OR7B 1J8HA 3ARGB 3OAZH 4ZS6C 4M7LL 5KSVA 1G9EA 3FQRB 2CGRH 3WO3B 2DLGA 4EXPX 2P46B 1MNUH 4NUJA 4LVNB 5ELIA 5IT2H 1TJHL 2AXHA 3GHBH 3C60A 1CD8A 4PJFB 2BOCA 5SX5H 1RJYB 4PJ8C 1D5XA 1NGWA 1X5LA 4ETQB 3GM0A 5KANG 1XR9B 3VFSA 5I1KH 3HI5H 5C0FB 1WICA 4QT5A 2G9HB 3GSNA 4PLKD 3T0BA 4H20H 3RWFA 4LQFH 1GGUA 3D3VE 3DXAE 1R5WA 1T1YB 4FTVD 4MJ6B 4G6AD 1VCAA 3HUJE 1GIGH 2VMFA 3MV8D 4HF5H 3MRMB 3PL6C 1Q9LA 5HGDA 3C5ZC 5EZJB 3O2WH 4FQHA 4MGXA 1QSZA 2ESVB 1MCPH 2RFXB 2XFXB 4UDUB 4JFPB 3B5TA 1WT5C 1OSPH 5I1JL 1KFAL 4WHTB 2ADIA 1A6WL 3O9WA 4GXUN 1DQLL 4OCYL 1O5DT 1FPTL 1KN4L 3B6SA 3VXSB 1YJDL 4LMQI 2K7QA 1W72B 3VD7A 5TF1L 1MQKL 3PWJB 2PYEA 3IDGB 4WI3A 3T2NL 1KIPB 3SJVB 2J8UA 3SDAA 1C7SA 1RZ8A 5BRZA 3QXDA 4Q0XH 1R3IH 1E6OH 4RIRA 1R0AL 4HWBA 3D69A 1JPGB 1TPXB 3RVUC 5HPMB 5IHBA 1DBBL 4HJ0C 1T5XA 1LMKA 3T2PA 3I50L 4MWFA 1HKFA 4KGLA 2XN9E 4PBVC 2PF6A 4LBEA 1WZKA 3ZT7A 2NY3D 2ERJC 3UPRB 3BDYH 4MD4A 4XAKE 3CFEB 1A9BB 4DKEL 3ARBD 1EHLH 1HK6A 1F4YL 4G7VL 1IFHL 2B20A 4EIZC 2IH3B 4F8QA 4W81A 2YPVL 2OZ4H 1UJTA 3GJFK 5C08E 1SMAA 3O45A 5B39G 4D94A 4NKDB 1I7UB 3BESR 5F71A 5MEND 1D7FA 3H9SA 1MCHA 3D6GA 3Q2CA 1WUNT 2WBJB 3WUWA 3RVXD 3KPLA 5IMLB 3WFHB 4M7LH 4NO5B 5C0AB 1GYAA 1INDL 2JB5L 4UIKL 2OK0H 3PHOB 1TJHH 4KUCF 1NGYB 4YHIB 1SYSA 1KF9B 3WDHA 3H7BA 2EDQA 4LSRL 2XTJC 5D2LB 2MCG1 1XIWC 2LAAA 1CVRA 3IDJB 2H32B 3UROR 1OTSC 4S2SA 4EI6A 5EDXA 4M4PA 3TBYA 5J57B 3NFPB 4OF3A 1X5IA 3PDOB 3UAJC 4JAMA 1DANT 2DYPD 2P49B 4AEIL 5DR5L 1P4LB 3N06B 1DBKL 3U9UA 1ZT1A 4R7NB 4PGEA 1NFIB 5GPRA 3PF2A 1EBPA 5F7UA 1UWXH 4RMQA 1Q9WB 4LPWA 2Z8WC 4Z5RA 4KY1L 2DTSA 2VLKB 1I8LA 3S96B 1JGEB 2HT3C 4GXUM 3IB4A 1PSKL 4OF5A 4PP1D 5I1JH 4UNUA 3VDCA 1KFAH 1REIA 1A6WH 3JUYA 3C8HA 1GRWA 2FD6L 1DQLH 1A22B 1BFOA 5I8KL 2C9AA 4Y8DC 5GRXG 1ZANL 1DQTA 4ZFGH 2X4PA 2XOTA 1A64A 1RZFL 1FPTH 1KN4H 1I3VA 5SWSD 1D5ZA 1U8MB 1YJDH 4MAYD 4FXGB 3QDJE 5I75C 4POYA 2X7LB 5TF1H 1UJ3C 2IAMB 4L3EE 1MQKH 1U95A 1FSKC 4G8EB 2BHZA 3T2NH 5IW1A 4XMLL 4O2CB 5E9DB 3TIDB 3PNWB 1A7NL 1HXMB 1UM6L 1RURL 4J4PA 3LQAC 3HE7B 4BFGA 5GGRA 1NUFA 4NQEB 1EZVY 1B9ZA 1IGYB 4JZJA 2MNUA 5LCVL 4AMKL 3E2HC 3LRGA 1DBBH 5CEZL 3MRFB 3I50H 4HUXA 4PTUB 4XZUB 4OZ4B 4GKSB 3U36A 4ZFZA 4HUNB 4WWID 3MCG1 3D0LB 4MXQC 3FB7B 1R5IB 43C9B 5HYSA 3ZE1E 4DKEH 1FFOB 1F4YH 4G7VH 1IFHH 2PW2B 5A3ID 5DJ0B 3IETA 4JDZA 2YPVH 5H35A 3B83A 4Z8FL 5AZ2H 1CE6B 4WU5B 2W0KA 2E9BA 4PJ5E 3ARYA 2MWCA 4HJJL 4NP4L 5CIPH 4M7KL 3TCLB 4S1QL 1OQXA 3RY6A 3RTQA 2IALA 1OL0A 32C2A 5HGGS 3NCFB 1INDH 2JB5H 4JFED 2QSTA 4I0CC 4TUOB 3VD4A 5ABDE 4PJEF 5DUML 5JZ7D 3LS4L 4U49A 4P9ML 4LSRH 3TNNB 4WFFD 2EEAA 3BN9D 3ZDXE 2VQ1A 5I19L 1T20A 3QQ9D 2A83A 2P5WD 4EDXB 2D2OA 5HI3C 1KPUB 4X6FA 1IEAA 3ARDA 3U46A 5CD3B 5K59E 1FAKT 5FDYA 3ALXA 1L6XA 1OM3L 1Q38A 4AEIH 2J8UE 4ERSL 3PXHA 5DR5H 5BRZE 1MCOL 1DBKH 1NCBH 1YQVL 4X4XA 5E8PA 4JLRA 5D1QB 3BKCL 4UAOC 2A74B 3IAGC 1BJ1H 5T3XD 4KY1H 3QG7L 5CP3H 4NDMB 1GOHA 5JLZA 3BVNB 4KJPC 1OW0C 2I07A 2R2EB 4PJ9C 2FJHA 4PRPB 4FNLL 3F12A 2FD6H 2HT4C 1I8MB 3ARFA 5I8KH 3PHQB 1ZANH 5JW5B 3SO5A 1RZFH 4Z7NE 1BQUA 1H3XA 4XBGB 4IRJD 3LZFL 1U8IB 4GQPH 4XGZA 2X10A 2NYYD 1R5VA 5FUCC 1M7DA 4R2GD 1UCBL 3BDXA 1NLDL 4ZAKD 2BOBA 2UYLA 1UXWA 4XMLH 1CFNA 5T1LB 3IDIA 4KKAC 1A7NH 1UM6H 3H9SE 1RURH 3KYOB 2YKLL 1XFPA 4X9FA 1RVFL 1S7XB 5LCVH 4AMKH 5T1KD 5FM5M 3H8NA 5IJKC 2EYRA 4WW2B 5CEZH 2PTTA 1D6EA 4PJIA 4LIQL 1OVZA 5I9QC 5DJ2B 3DHMA 4HUWB 3BPNC 5EU5A 3O2VL 3WFCL 1AXSA 2NW3B 3LVEA 1MY5A 1KLGA 1NJ9B 2A6KB 3MUZ1 2X4QA 5CZXC 5TDOB 3N9GL 3RU8L 5CD5C 1PKQB 1D9KB 2J12B 2WBWB 3MV01 3UZEA 1TETL 1U8LA 3RIFF 1JZ8A 3T0AA 4TOYL 5F6IB 1MLCA 3VXQB 5F9WB 2HJFA 4YDJB 3PJSB 4NP4H 4HJJH 4M7KH 4S1QH 1KJ2B 5C0CB 1B2WL 3BE1L 1UM4L 1KTLA 1JF6A 4RQQB 5A1AA 1I4FA 5DQJB 4RAVB 2X4UB 5FO9B 4WV1B 1HHKB 5DUMH 3DV6B 4MNGB 1ZMYA 3LS4H 3NCCB 4P9MH 3CFCL 4IMKA 4ODSL 4GRLC 4WHYG 5F7DB 5TH2B 4LNRA 1ULVA 2FBOJ 3RKDC 2R1XB 5JPNA 5JMRA 1MLBA 1OM3H 2P7TA 4ERSH 1AR1D 4CN4A 3GJFH 4FQXD 3BZEA 4HFWB 1YQVH 2KUTA 4Q6YA 4HMCA 5GRZA 4RGNC 5C0JA 1FL5B 2PXYC 3BKCH 3EJZD 4N90E 5C0BA 1H15A 1UGNA 4HAGA 2IF7A 3VG0L 2X09A 3QG7H 3RVTC 1FQ9C 5DS8B 4DGVL 1P84K 3OPZL 3UCRA 1RQ5A 2ITDB 2CLZA 3JVGA 4ZO7A 5C0DB 2EDWA 3KS0J 2ZOLA 3QQNA 1RHFA 2PO6B 4I2XA 1JF5A 2FH6A 3L3JB 3LZFH 5D1XC 5FCSH 1ZS8B 2X9YA 4YDKL 4UT6L 3CXHK 1QUNA 1NUDA 1VFUA 4U6TA 4Q7DA 1TJGH 5DA4A 1UCBH 1NLDH 3FFCB 2WLZA 3QNYA 3SDCB 1MIEL 1VSCA 1ZOXA 5GIRB 4ESKA 1F2QA 3BIKA 1AXIB 4XBPA 2CH8A 2PCPA 2YKLH 4NQCD 5GS2D 4P2OB 2XKUA 1RVFH 3F62A 2ARJB 2OTPA 3HZVA 3K7UA 1KXVC 3DVFA 3NOIA 3U6RA 2VLLA