1NCCL

Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
214
structure length
214
Chain Sequence
DIVMTQSPKFMSTSVGDRVTITCKASQDVSTAVVWYQQKPGQSPKLLIYWASTRHIGVPDRFAGSGSGTDYTLTISSVQAEDLALYYCQQHYSPPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(o-glycosyl)
molecule keywords INFLUENZA A SUBTYPE N9 NEURAMINIDASE
publication title Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface.
pubmed doi rcsb
total genus 55
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1992-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nccL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nccL01
3O6FA 1DVFC 3MRNB 5INDA 1NLBH 1RZJL 1TETH 2CR3A 4YDKL 3TNNB 2JJTA 4KVNH 3BH8A 4XT1C 1I3RB 3U4EA 4KK9D 3FTGB 1KB5A 4KQ3L 4ZPVA 4GXVL 4E42B 2HMID 5AZEH 4WTXA 3HE7C 3RZWA 4B0MM 1SJVA 1VGKA 4MVBD 3MACH 5SWSD 1NEUA 1MEXH 1ZLVK 2P7TA 1MI5D 3C9NA 1TJGH 1INEH 4B53A 3H3PL 3JWOC 5FCSH 1AD9A 3IFOB 3VMOA 3U30B 1UWGL 5F96H 3PIQB 3MJ6A 1YEDB 1XGYH 3CNKA 3EOYG 1RSFA 3T4YA 3QQ3B 1CXKA 3VXSE 1AGDB 4GAYA 5L2JA 2MKWA 3L1OH 5F7KC 5C0ND 4PJHA 2AQ1A 5F89A 3DNKA 4WUUA 3QNYB 4QRSB 5EZLA 4ZFOA 5I73B 5IQ9B 4JM2C 3HZVA 5IBTL 4WRLA 2UVEA 5FKAA 4F80A 1LQSR 4PJDF 1G9NC 1KTLA 4JHAL 4XNZB 3I3EA 3F7PC 1CFSA 5GRXG 3OKLA 1EIBA 1FORL 5E1AA 3MZGB 2R1WA 3QUZD 4IOIB 5DD3H 3WDIA 4P4KD 1QFPA 4TSAH 1C08B 1XCTB 1T2QH 4LLUB 5CS7A 4FXKA 3S37L 1UJTA 4TNWF 3T0XA 1JGVL 4PJIF 5CEXA 3OG6B 3HZMB 5BQ7A 1U8QA 5C0BE 1WCBB 3BP5A 2PO6C 5JHDE 1EVUA 4JRYA 2A83A 1Z9LA 4L3EB 4DZ8B 5EC2B 4Z8FH 4UNUA 3MA7A 32C2A 3ARFA 5E94B 1AQKL 1I7RB 2PR4H 4NC1E 4S0SD 3CSPA 2DQJL 3VXRB 4AJ0A 2JB5L 2QTEA 1VFAB 4S1DD 4GS7C 4HG4J 5KSAB 2I5YH 2F74B 3PL6A 3C6LA 5EPMA 4CBPA 1UQSB 5IW1A 4LCYA 3CH8A 4J6RH 4XHQA 1MLCA 2OZ4H 5JA9A 4KK6D 4AEIH 3WXWH 3MV7B 3M45A 3LV3A 3G6JA 3H9ZA 4R2GD 4GQ9L 5C6TL 1A3QA 3P30H 5DJ0A 2YC1A 2F8XC 3GBLA 4IOFD 2DWDA 3QJFB 5SV4A 5JA8B 5JW5A 1J0KA 2DBJA 5IV2B 1RURH 3HNSL 3VXTA 5I16B 4GRWF 3L3KA 5D1ZC 3F12A 4QTHB 2AP2A 4RAHA 2XN9E 3MRGA 2I25N 4NBXB 2X1XR 1RIUL 3HCVA 4BFEA 4ZD3H 4NKOB 3CLFH 3MLXL 4JFFE 5DQ9B 4MXVF 3EYUL 5A16B 5ACZA 2FYYA 4ZUWA 2NY7H 4Y5XA 3ES6B 4WO4A 3QI9D 1LO2H 3HFML 3NFSL 1LEIB 5HVGB 3WKML 5IKCB 2WNGA 2O5XL 3BQUC 4ODSL 2G60L 4XMLH 3QZWG 3EYOA 4KKCD 3TJEL 5IHUH 1MNUL 2D7MA 5LBSH 5KANG 1TPXC 3RWCA 4OM0L 4NBZB 1JFQL 3RWHA 5C08A 2I9TA 1KJ2A 1T4KA 5D7IF 4YHKH 3S8WA 1FLRL 5KW9H 3MMEA 2QSVA 5CSZB 3B3IB 4L3CA 3LKQB 3ARRA 3IXTB 2V2WA 3TZVD 2F9BT 1I1CA 4QY8A 4S1RL 5AEAA 3KPMA 1DQQB 4NZTL 3DX7A 5H8DA 5JXED 4G43A 5C0JA 2X4TA 3RQ3A 1RUKH 2VDQH 4JREB 1BJ1H 2UYLB 4ONHA 3SDCC 4FA8A 3S36X 4CL7A 2D4FA 5GJSL 2DYPD 4G43B 1QBAA 3KJ6L 4UV4L 5I1EL 1QBLL 4NQCB 2BJML 2VLME 5FF6B 3BT2L 1Z6JT 3PV6B 3GJFH 4ELMA 5L8JB 4JFOB 3RY6A 2X05A 4HH8A 4WEMB 4BUHA 2QQLH 2HJFB 5K59F 1T0MA 4KKAC 5DFTA 5J11C 5CJOH 5I1AB 2RJMA 4GKZB 1A1MB 1NJ9A 5F6IB 4MXWL 2R1YB 1UXSB 1YEIH 5ALCL 5JIKA 3RL1A 3H6JA 3VWKA 3C8HA 3KPRB 1ZHNB 2YRZA 4X4YB 2JCCE 3ARED 3X3FL 4PGEA 5EORH 1T83C 1BQLL 3OKMA 3RVUC 3HLAB 5HVHC 2N7BA 4UDUB 2FL5A 1OTTC 2Z92A 2VERN 1BX2B 2D3VA 1MY5A 1U58A 3Q48A 3U7AA 3DYPA 4HSQA 2VSDA 4PGJA 1NDGB 4IRJC 4JANA 1ITBB 3OAUH 4EI6B 2IPKA 4P2YA 4K2UH 4P4RA 2Y06H 3PQYB 3TIDB 2FJHA 5GRVL 1A3RL 1UCBH 2OBGA 3DARA 5DJYB 4G7YL 4H0IA 1T7YA 1BECA 3FO9A 2FBJL 3GNML 3L5HA 1IC7L 4LQFH 3I85A 1HH9B 3RKPA 5TDOB 1W0WA 3Q5TA 2B5IC 4RMQA 1KB5H 4CMMA 3QWRD 2HJLB 5CBAA 5E4IA 1IQDB 4I2XE 3AFLA 3D3VE 4CUCA 1KPUB 4BQ8A 2NNAB 2ZOKA 3UAJC 4M7JL 4P2OB 3I50H 3HPJB 3GEWB 3I02A 5E56A 1MRDH 2OQJB 2R0ZL 3SCMC 1FYHB 2CLVA 4ZS6D 4I77L 1LP9B 1MPAH 1A22B 3RPIA 3WO3B 3VXSD 4MX7B 3HG1E 1QO3B 1ZANH 4AENA 2F5BL 5L9DL 5BVPH 1AJ7L 3O8XD 2R8SH 3C8KB 4QHKI 1IFHH 3C6SB 1OP9A 1JNJA 1L7TL 4JFXA 2BNQE 3S9DB 3KR3H 1BM3L 5L0QC 1DLFL 4WJ5B 3PV7A 1ZLWH 2FO4A 4PR5B 5SV3A 1KCRH 3N9GH 2YMXL 4APQD 1XIWD 2KUTA 3W5NA 4M4RA 4FQIH 4XWGH 4HS6A 3KPLB 2E9JA 3QCVL 3TNMB 3HUJA 4YFLI 3KYMA 1KN4H 2X4RA 4MA3A 1ZS8B 1UB5A 2X4OA 3DXAB 5IFJB 4Z95L 2DS4A 3WS6A 4HS6B 2OXHA 4I18C 1KXTB 1X44A 1JV5A 3HUJB 3FHQA 3MCKB 2EC8A 4Z7WF 3MBED 1YYML 2COQA 3QUMB 2FD6H 2ADJB 3DIFB 5E6IA 3QXDA 4R8WL 5C7XL 5JHDD 4EI5D 3NTCH 1FIGH 4Y4FB 1KJVA 2X5PA 4PLKC 1RIHH 3GDBA 3CSYA 3O0RL 3NCYP 5F9JB 5D96B 1X5KA 3JXAA 5HY9A 2Z8RA 4JFQA 5HPMA 3KPTA 4KPHL 1FVEA 3B6SA 5CEZL 5ANMB 2VH5H 2PXYA 3BKCL 1JI1A 3P0YL 4MAYA 3IAQA 4EDXB 3CFCL 3MCLH 1EJ6A 3Q3GA 1IBGH 5IQ7H 2C4FU 4HHAA 3TT3L 1VFBA 3DX9A 5BZDB 2X4NB 4TNVK 2NYYC 1IAIH 3VJ6A 4PFEA 5EWIL 3C60C 5SWZE 1VFBB 3DX9B 2AJUL 2QADD 3V95A 4P3WA 4AH2B 1QLRB 1HKLH 2LV4A 4XRCB 2XN9D 3CC5A 5IFHL 4ZAKC 1HQRB 2J88H 1JE6A 4N0YH 4P9HL 4PD4K 3CDYA 1RK1B 4JFFD 5DS8B 3ZT7A 1EAPB 4DOHB 5IB4A 4FQ1H 4ZNEE 1PD6A 1ZXQA 1RMFL 3L7EB 2Z8WC 4Z6AT 4Z7NF 1U91B 3GSUB 4L9LC 1JHLH 2APFA 1DQJA 2C1PA 1TQCB 1CU4H 5E99H 1T7ZA 3EZ8A 2EXYD 2AKRA 5D7SH 5DUPL 2LU7A 3L3GA 4PGBB 5EIVA 5EOCL 2HYMA 4RNRB 3DVGA 4NRYB 2HLAA 1YQ2A 4JPVL 4MJIE 2FR4B 2AKRB 5L88L 2APVA 4R90L 4ZFFA 4YHOL 1KJ2H 1ZT7A 2KH2B 5F21B 5L8LB 1TQBC 2CO7B 5ETUB 1IGFH 4RMVA 2Q7NA 5LQBH 4MA1B 4PRPA 4JHZA 4H25B 4ZO8A 1AY1L 4HIXL 3V4UH 2EDHA 5HGGS 2Q6WB 3GSOA 4GT7A 5BS0A 1KIQA 4Z7VE 1IC4L 4HIHA 2NZ9D 4LSVH 5GGUA 4XAWL 2UWEB 1OHQA 3SOBL 3KAAA 4UU9A 2XY2A 4JRXB 2MQ3A 4P5TA 2BNUA 3P4NB 5HYIA 2ARJB 1I3VA 1VESA 4FQXC 2VLMD 5HDBF 3D2UD 4JGMA 5ALBL 5AYUH 2AERT 3LCYA 5I1IL 3PP4L 5DMIH 4BYHA 1DEEA 3MROA 1HH6A 3QUXC 3JTSA 1SEQL 3AB0B 3EYSL 2V9TA 1WWWX 2EXWC 2FH8A 3JBG7 2FHFA 4OLXH 1OT1A 3S3JA 1YMHB 4OZ4A 2C3GA 4JZOA 1HI6A 1X7QB 5I1JL 2W1NA 1IC5L 3GSXB 1RZ7H 4BSWB 3S4SA 5DMKA 3VFNA 2PCPA 1GC1L 2VDOL 3BUYA 5GGSY 3D0VB 1DZBA 4GSDL 4GG6B 3MO1B 1B2WH 5FUCE 1ONQB 2W0PA 4OLWL 5FO8B 5TGBA 5EZJA 3GMQB 4DVRH 4HPYL 4JR9H 2AJZB 4CN6A 2DQDL 2IAMB 4U3HA 4HUXA 4TUJB 4IHOB 1N0XL 3U4BH 5LGKA 1S5IL 4M6MH 4PJHE 5KVDL 1BAFL 2J3SA 3BZ4A 4BKLA 3IETB 3RAJH 4PJ5B 3RVWD 4WUUE 1GAFH 1WBXB 3UJJH 3CLEL 4XXDB 4WWKC 1Q0XL 3JUZA 1A6VL 4E5XB 4N68A 2W9EL 1WITA 2X10A 4MD0B 2V17L 3AROA 2ICES 2F8OA 4OZGB 3PWVA 2E7CA 3DUUB 4UQ2B 3OF6D 2ESVA 1CDHA 4K07A 1D9KA 5HHXH 5LJYH 3F7YA 3CDGA 4MDIA 3WSQL 3LPFA 3D3VD 3P4OB 3EFDL 5IMMB 3BPOC 2VC2L 1MH5B 2XNAB 3EOAA 2APTA 3GGWB 4Z9KB 5DJ2A 1RJZB 5IB3A 4AIOA 1N2RA 1JGEB 2YD6A 4KY1L 4J4PA 1QSFB 3T0DA 2Q1EA 1W2KT 1BVLA 4WW2C 3VG0H 4JRYE 1XCQB 1WBZA 4GW1A 5DRNB 1IKNC 1M6OA 4PJGA 3R1GL 3JUYA 4WY7H 3S96B 1N64H 4PBWD 4JJHA 3WMSA 3HG1D 5DVOA 3DSFL 3QEGL 3O9WA 2AJXL 4NHUB 4J8RB 1E4XH 4HUMB 4HIIA 1I1AB 5CILL 3S3SA 4DN4H 5F7NC 2BNQD 3G6JE 4Q74A 1MHEA 2I24N 4JO2H 3O3BA 3U0TA 4GO6B 4QXTA 3P73A 3GHBH 5DTFB 4GMSL 3UTQB 5CP7A 1BLNB 4TQEH 1OCWH 1XGPB 3MZTA 2BVQB 2VDPH 3CVHL 4ODWB 3HMWH 1MFBH 3CXHK 1T5XB 3VGBA 1EEQA 3PGCB 4MQ7B 2PYED 3LZFH 3QPXH 3OR7B 4KH2A 5FO9A 3VE0B 2NY0D 3BKMH 4GMTH 1VEOA 4NIKB 2I07A 4GRLC 2P47B 2NW2B 1H3WM 1FH5L 1L9NA 4WEBL 4U1MA 4WI3A 4OCRH 1OAUH 3HR5A 5E5RB 4GKOA 3L3HB 4MNQA 4L8DB 2PETA 2ORBL 1A4JA 4NNPH 5HGBB 3QWQB 4RAUA 3T4AA 5DJ6A 5C07A 1EAJA 3ABZA 2WWMC 3EYVB 3QIUC 4J3UA 4LQ1A 4OD3H 3QDAA 5DVNA 4Y16D 1CDYA 2PN5A 1AGCB 5TF0A 1CFTB 3CX2A 5DA0B 1FBIL 3ARDD 3MLYH 4X7EC 3HC4H 4UZGA 4Q6IB 1WC7A 2DLGA 3L95B 2B8OT 1BBDH 4N9OB 2G9HA 4KKBC 3NVQA 4XBEL 4PV9B 3TA3C 5DQJB 4MJ5B 5SWZD 2CK0H 4MCZB 4NDMB 4XMPL 2WBWB 4UV7L 4K9EH 5CD5D 1HHHA 4PY8J 2VDLL 1DSFL 4Y5VC 5JW4R 4BH7A 3UTSD 4EJ1C 1VCAA 3W39A 1RAMA 5EOQH 1S7TA 4X6CA 4JCMA 2XA8H 5HYJA 1EA9C 4HKBA 4XCNB 4ELME 4KVCL 4M62H 1NGPH 4ZQKA 2J1KA 3V5DA 3IDJB 3RBSA 3D25B 3SJVA 1UXWA 1CF8L 2QSCL 4CU6A 3CFJA 1S7UA 1A6TB 2ICWA 4JG1H 3TO4C 4OV5B 2F54D 2FBOJ 3OXRB 3GJEA 3V0WH 4LL9A 2DBLL 3T0EB 5ESQA 4KK9C 3MOBH 4LCUA 1YYLH 3K2UH 2HMIC 1JNLH 1YEFH 1WAAA 2VXQH 1KT2B 5J12B 1NBVL 1MJ7H 1AC6A 4MJID 4YZFE 2H45A 1K4DB 1T1YA 2AI0L 5IG7B 4UT9H 1U92B 5DZOA 3LN4B 3L9RA 5E5MA 3REVA 1Q9WB 4MNGB 5DD6B 3QDJA 4U3XA 5IHZB 4KAQH 4MCYB 1EZVY 5D9SA 3QB7C 1PJ9A 2BC4B 2FDBP 2XTJB 4YXHH 1JTTA 4W4OA 4Y1AD 1FZKB 2C7UA 1UM4H 1NC2A 1J11A 3UJTL 5JQHC 2OL3A 3ILPB 4F37K 2AAVA 2Q76B 4NUGH 1MSPA 4XMKH 4DGVL 2DQIH 2NZIA 3O6FD 2B1HL 3S36L 1B4JH 4XPTL 1JWUA 2AVGA 4OFKA 1K3IA 1DBBH 1WICA 4HH9B 5JPNA 4R7NB 5DK2A 4JFDA 4PP2B 1P9MC 1UC6A 3WO4B 3KPPA 3MC0A 1MCIA 4TVPE 1YN6A 3MLUH 3C5ZA 4NM4L 2FIKA 4CVUA 4NHCH 4LVOB 1HZHH 2GTWA 5DEFA 3LDBB 3LN9A 4I0PA 4JFPA 3O4LA 2XKNA 5C1MB 5HXMA 2XWBB 3QG6A 3HRZA 2CGRL 2YD1A 4I0PB 4AMKL 1QQDB 4NKMA 1EV2E 4TPRH 4P0DA 2A74A 3VFRB 1UVQA 3GMMA 1HXYA 1U3ZA 4XPBH 3WJJC 4YFEA 4WUUD 3CFDB 4ZFZB 3S98A 1J1PH 3V6OA 2J4WH 1M05A 5IJVA 3I6GA 2YKLL 2Z8SA 5T3ZL 3EOTH 3ULUL 4KK6C 5GGVY 3MRRA 4L29A 4X6DA 2MCPH 3WFDL 5I71B 4R2GC 2X7LA 1CIUA 2E3VA 5C0GA 2AJYL 3HUJE 2AS5M 4P3DA 3ISWA 4IOFC 4QXGL 1MAMH 1AO7A 1ZVYA 4X6FB 2NXZC 1R3LA 3TBSA 4MYWB 3ARGB 4KUZL 4LEOA 1F4YH 1UKQA 1I7TA 2XV6B 1RULL 4L5FL 3SBWC 3RA7H 4YDVB 1XF2B 5HHPA 3FT3A 1S9KC 5MP6H 1MJ8H 4JRYD 4HBCH 3FQUA 4OTXL 4YPJA 3PHQA 3LH2H 2A6KA 1A3LH 2H32A 3VGAC 2MOVA 3QI9C 4PG2A 1RU9H 5JOPE 1R3KA 4R0LC 2R2HB 1FAIL 1RZ8A 4JO4L 4WEUD 1EBPA 1KBGL 4N1CA 4QRRB 5IF0A 3VDCA 1YEGL 4KKCC 5DGRA 1EHLL 1WZKA 3TJEH 2JK5B 1J9CT 2B1AL 4K8RH 1MCFA 5MEQA 4WUKL 2R0WL 4DFIA 2C9AA 2WBJA 3KJ4C 5EULV 5I6XB 4XC1L 1CD1A 2OYPA 1JGLL 1X5FA 3FOLB 2HT2D 2E27L 4HPOH 3QEUA 3VRLF 1MCDA 4Q97A 3TBVA 5JORB 1PDKA 2EYTB 4WI8A 3WXVL 3TZVC 3ARVA 4OB5H 5M94B 4MNHB 4AZ8A 2FECI 5FB8B 4S1RH 1JP5A 3NCYS 1LO4L 5JXEC 3ARBB 2MNUA 4NZTH 4HK0B 4TYUA 2AXJA 2E7MA 3QUYB 1R5VB 3P3YA 4X6EB 4OZFA 2HKFL 4ORGA 1A9BA 2OI9B 4HC1L 1U93B 1KNOA 3FB7A 1G9NL 1S7VA 4GOSA 3SE4A 1EEZA 4OF6A 1U8IB 1YJDL 3WFEL 4U6YA 4ONGH 4LDOB 1J0JA 4KDVA 4LSUL 4R96A 3PJSA 3VWJC 3DX6B 5C08D 1N4XL 2GEEA 4O2FA 4MD4B 1MCPH 4RIRB 1CK0L 2K7PA 3QWOA 3D1MC 4PRPE 4WHYG 2B39A 3AREC 1H15A 3ARYA 2OK0H 4JQVC 5DXWA 3BPLB 5BS0E 3C5SA 3NPSB 4HWBL 2R2CA 4X5WB 4XP6H 3B83A 3SPVA 4DAGH 1B3JA 2DM7A 1LEKA 1QKZH 3SGJC 2XXMB 4JVPA 3LS5L 5BXFB 3KGRA 3V6FB 2H26A 2D2OA 4NO0B 4F9PA 3RVTD 5MEPA 5E70A 5KSUB 4PRNB 2NX5D 1SYVB 3LSOB 1YMMA 1UYWH 2A77L 3TO2A 3BI9X 3ZTNH 4XC3H 3U7WL 3EYFA 3W0WD 5JDSB 5CFHA 3K74B 2P24B 3LEVH 3VFPA 2AJSL 4CMHC 2LE9A 5CJXA 3VWKD 4OSUL 3UYRH 4Y4KA 5ESVA 5ICXA 1GOGA 3EYQD 4QRUB 4KV5E 5FHBL 4R4FL 4FRWA 4MJ2A 1KJ3H 2NTSP 1U6AL 2V7NA 4L4TA 2VLRA 5FK9B 2V5SA 1CI5A 3P2TA 3MV8B 4ZS6C 2ZUSA 1CLOL 4XPFH 4ENEC 4XP9H 1UG9A 2FWOA 5A2FA 4QO1A 2OL3H 5CINL 4K7FB 4RDQF 3KPSA 1C12B 3SDYL 5I74B 1HILB 1ZA6B 2VXVH 3IDXL 3AAZB 4IRSB 5EO9B 1NANH 4JY6A 2LTQC 3MRMA 2FATH 1MOEA 4F8TA 2X2YA 5TE6H 2ESVE 5CCKL 1MHPL 1AP2A 4ZUVA 4U1JA 4APQC 1XIWC 1WV7T 8CGTA 2GK0A 3VXUA 5D7KD 2HTLD 1J5OH 2MHAB 2EH8H 1FL3A 3ARZA 1T0PB 5FM5M 2P5EB 2YBRA 4UI2A 3OG4B 4P59H 3U7YL 1CGXA 1KLUB 4UMGA 3EJYC 3P9LB 4MB5A 3DBXA 3CVHB 5F3HB 1MWAA 3DV4A 5TE4H 3QCTH 4Z77A 1SJEA 4PJEB 2ENYA 4FG6D 4PJGE 3WLBB 2VJXA 1I7UB 4U7SA 5DI8B 4FFZH 3AM8A 1KPVA 1J7VR 5INCA 1IAII 4NFBA 2CDEA 5GHWL 3KLHD 3G5YB 4MSWB 4EI5C 4PYGA 4XCYA 4XZUA 1ZSDA 5T5NG 1ETZA 1I9JH 3QXAA 2XZCL 3ZHKA 1UEYA 1SVCP 1CIDA 4NC1C 1DLHB 2CR6A 4NQEB 4H88H 1CFQB 1QSEA 3WFCH 5D7LB 3OXSB 4ZYKB 1R3HA 4XZUB 3SGDH 1U8PB 1JK8A 1P4IH 4QRPA 2WUCL 3SE9L 1D5ZA 3I75A 2XZQL 5JMRA 1KLGB 5F7EH 5C0RL 1UENA 2IFFL 1DANU 3WN5B 1HWGB 5DK0A 5HD8D 2QEJA 2VWEC 2DLTA 1SBSH 1T89A 1IL1B 4PJAA 1VERA 1ZE3C 5FKPA 5J1AA 5J3HD 1CFNB 3HRPA 4NCC2 4YXKL 3PGFH 3TWCH 4W70A 2ICEA 3HC0B 3BGFB 2GI7A 4HF5L 5FGBA 5JOEA 3BWAA 2QADC 3THML 2BFVH 3VXPB 3RUGA 1SYSA 5E6ID 4NO3A 5HPOA 5DFVD 4QOKB 5TQ2L 2AQ3A 2VO5A 4BELD 2AK1L 4H1LB 3KLDA 4MNQE 2IJ0C 4OZHB 4C4KT 2VL5B 4PRHA 5D8JH 4YE4L 5C07E 4P9MH 4GBXB 5E03A 5HI4D 2H32H 4ZODA 4UDTB 2VZVA 4QCIB 3P0VH 4HWZA 4KTEH 5JOPD 5ITFB 5C0DA 4OD2A 4XI5D 3U0WH 2PXYD 3TC9A 2P48B 3R8QA 4MAYD 3ZL4H 1CCZA 3PWNB 4G6AC 4YX2L 4LEXL 4NT6B 4JDZA 4Y5YB 4HKZA 3WHXB 5AG9A 5I1CL 3RU8H 1JGUH 4K3EH 3ZKXB 3RZCA 4OUUB 3SO5A 3TVMC 5EBGA 2ICCA 2MPAL 2WUBH 3D69A 1NFDF 1CTOA 3UZQA 1O0VA 4NFCA 4LVEA 1WZ1L 1T80A 4JRWA 4KRLB 3F58H 4OCYL 2IQAA 3GJFK 3IDIA 4H8WC 1E28A 4X6CE 1YQVL 1XR8A 2XG4A 3GSVA 5F1IA 4OGAD 5HYJE 1K6QL 4Z0XB 2R4SL 1LILA 5IW6A 1NCNA 3AU1A 2J8OA 4GRMA 4Y2DD 5D5MB 4KMTL 3CVIL 5B38A 4YAQA 3RP1A 3LRSB 4TUKL 3SJVE 4ERSH 4WHDA 4UNTA 4S1SL 4OZFH 5LCVH 2HRLA 4CVXB 4OIAA 1B88A 1LDPH 5FCUH 1RJCA 1NCBL 3N85H 4XXCA 1S7RA 1WAAE 4NYLA 1NLDH 1JVKA 3P9MA 5IFAH 3FN3A 5DJ8A 1F4WL 1FV1A 3O3UN 5B3JE 5K9KB 2ED7A 3OKOB 4PJFA 2A9ML 3KPOA 2EDKA 5LGHL 4PJXB 4UOW1 4NQSA 4PRPD 3QDJE 2YD2A 2A73B 3B8YA 3RHWF 5DZLA 1CL7H 2WZPD 3V4VH 3V2AR 3SEPA 2JF1A 1FZMA 2J8UF 4KFZC 4WI4A 1AI1L 5D7JA 2MCG1 4HT1H 2HVKB 4P5TD 4ZS7L 5KOVC 1GGIL 1OGAB 4F37F 3BGAA 3RVWC 1IEAA 2BSSA 3VXOA 2BOCB 3TBYB 1HEZA 4NWTL 2OJEB 1A6VH 2HN7A 1NDMB 1J8HB 3KS0J 4I0KA 2VXUL 3BKJH 4JFDE 2OR7A 3WBDA 5C0EA 2AJ3A 5I30L 4RX4A 4OZIF 4HZLB 3TFKD 3IFNH 4NFDA 4AL8L 4FQ2H 3T0WA 1D6VL 1JGDB 5H35A 1E4XI 4MZ2A 1KOAA 4K3DH 1YEKH 5D2LB 5D70H 4U1LA 5KAQG 2DLIA 4LSTL 1M7IB 5T1LA 5EZOH 3QQNA 3O4LE 5T1DH 2E8ZA 5KS9F 4JKWA 5BRZA 3N0PB 1F3DJ 2DLFH 4RQQA 4X5XB 3IDGA 5J9PB 3VGDA 3H9HB 5EZIL 4UIKL 5F1OB 1ZTXH 5FUZH 3DVNA 1S9YB 3FQWB 1YECH 5TFSH 2OR9L 1R3JA 3TCLA 1FNLA 4LGSB 1B0RB 2UZIH 2Z31A 3V6OE 3R06A 5EG6C 3BW9B 4UT6H 4Z7UF 1S7XA 5CEZE 1HINH 4ETYA 3NABL 5IT2L 2BRQA 5GS1C 4Q6YA 2ESVD 2DQFB 1DVFB 2XPGA 1D9KD 4JFEB 5EC1B 2ADIB 5DJZB 1AO7E 2CKBA 4NWUL 3MUJA 5GGVL 3VD7A 1NAKL 2A6IA 1DBJH 3HE7B 2FSEB 3M07A 1HHKB 2NY0C 4J3XA 1NCDH 1MWAH 4J4PD 2VDKL 1MJUH 1G0DA 3MRBB 5IVOA 2R1XB 3MNVB 4LLMA 1OM3H 1FJ1A 4DTGL 2NY2C 3KYAA 4LHQB 5KG9A 1Y6NR 5E2WL 2NLJB 5C71A 4YFDB 3O9WD 4AM0A 1CFBA 5IMKB 1G7QA 5C0CB 3VXMB 5IVXB 2DIJA 4M6NL 3G5VA 4QYOB 3WE6A 1IGIH 5B3JF 3SDDB 3RWIA 4Z5RB 5IB1B 1FRGL 4Y16C 4K3JH 3DYMA 4K8RD 4KI5E 3ARDC 3MRQB 2E7HA 4YGVB 4IDJH 1B90A 4JM2B 4EOWL 5TF1L 4NSKA 3K4AA 1ZLUH 1PVHA 4MA7H 1PZUB 3ARUA 3D85B 2YXMA 2CDGB 4OAWA 1YUHA 4V2CB 3W9EB 2CLZA 1Q1JL 4JEGB 4JO3L 3BEVB 1XF1A 4NRZA 1FL6B 3SDAA 5TH2A 1FNSH 2D03L 3V0VA 4DKEH 4G8IA 4OZFG 1LNUA 4G9FA 4QKXB 3FB6B 2DQEH 2EE9A 1A5FH 5IIEB 1IEBB 1QRNA 3QIWA 5DHVH 1OTSC 4LDLB 5JDJA 4G9DB 3AS1A 5HGAB 4EQ2A 3QIBC 1I8KA 4QNPE 2PO6B 3LMJH 5C07D 3RI5F 3UYPA 2E7LC 3LIZH 4R7DB 1LK2B 5JPMA 2FEDC 3LKRB 2NXYD 1LWRA 1LD9B 5KSVB 2W9LA 4LSRH 5HHQB 3MA9L 3BYTA 4LLVB 1MFAL 5ADPL 3SQOL 3CZFB 4XVTL 4NJ9H 2HG5A 3OPZH 4K94H 4ODTH 1LE9B 1IKFL 1L9MA 1F3RB 4JG0H 5I18H 4PJ9A 4HJGB 2F53B 3HNVH 4PRBA 1RD6A 3HKFA 3UTTB 5EN2A 3AVEA 1A02N 4N8PA 4WFGD 4IMLB 4RCAA 5J0BA 1IGCH 1T1WA 3BKYL 3DGCR 3X13A 1CE6A 4U2YA 1L0YA 3QHZL 5LAXB 3LKOA 5D1ZB 4CN1A 1DE4A 3X13B 1YNLH 1GGBH 3CIQA 5HYJD 1Q94A 1CD8A 3QAZB 1HNFA 4X6DF 1HYSC 5ENWA 4WI5A 4PTTB 3EIFA 4L8CB 1I9RH 2VRAA 3IVKB 2VTFA 1YMME 3O6FC 1XF5B 1NUFA 2ED8A 4GAJH 3SJVD 2A6DB 2G2RB 3P4LA 3ZYIA 1N6UA 2JJTC 3FL7A 2R0KL 2JTDA 3HC3L 1YY9D 4BZ2L 2DQTL 3BQUB 3RWGB 1FN4A 4KKNA 1MHHA 5L7XH 3NA9L 4PS4H 4I48A 3GHEL 2GTZA 3ZKQD 1OSZA 2OM5A 2FJGB 3GMNA 4XP1L 5I17B 5DQDL 5E08L 4P3CH 1TPXB 4UILL 1MHHB 4L4TE 4HLZG 3N1PC 2VLRE 1CDIA 3QDJD 1INQB 3UJIL 4Q9RL 5KVFL 1N8ZB 5HHOB 4NO2A 5BW7C 3KNBA 1MCHA 5FUCC 5FGCE 3TIEB 4HIJA 1NC2D 2GUOA 4Z78B 3KPSE 5IMOB 1TCRB 3PDOA 4KXZH 4LHJB 4NNXA 2XKUA 2ZP0T 3FO0H 1SY6L 4FXGA 1ZGLB 2Y7QA 3CPLA 4YQXL 3NZ8B 5CKAA 12E8H 2W38A 3LOWA 1RUMH 1MCQA 5B21A 4JFDD 2K1MA 4PJBF 1G7JB 4Q7DA 1WEJL 4PLNC 4NZUL 2CUHA 4F7EA 3EJJX 1OB1A 3C5ZD 4QRTB 5EO0A 1H3PL 3GMLB 5IROA 1YDPB 4CNIB 3SKOB 1CZ8L 3BEWA 2Q7YA 1IT9H 5J11B 4TRPL 4HGWA 3VFUB 2AV1B 4H0HB 1ZMYA 4KRMB 5MENA 1JYVA 3LKSA 1YNTB 4YNYA 2RFXB 2AXFA 1JPTL 5HVHB 1KCUH 1OAYH 1MRCL 3ARFC 2R29L 2WQRA 3MLZL 3QFDB 3QP3A 3IF1B 1QSEE 4PV8B 1U8KB 3H0TB 4Z0BL 3PL6C 5M7QA 3C6LC 3FFDA 1K5NA 4QRPE 4OLVH 3W5MA 4IRJB 5HI5D 1Q0YL 4U1NB 3TPKA 2P8MA 1XGQB 4Y19B 5AWNH 3BXNA 3GSQB 4PJAE 2O5ZL 4H1LG 5LWYL 2ZG3A 3WDHA 2A0LC 2B1AH 2CKBH 3CXDH 4EZMA 1DN0B 3GM0A 1KCVH 3IFLL 3QRGH 2NY6B 4RFNC 1P7QB 2Q86B 3RIFK 3OB0K 3LKPA 4N5EC 5ICYA 2HT2C 2NY5H 3OB8A 2AGJL 3IGAA 4LSSL 3RUGE 4XNMA 2VLJB 1RHHB 3BP7B 5IB5B 4NZRL 5FGRA 1IILE 4IIQB 2BNRA 3M17A 3OV6A 5LG1A 2H6PA 5E7BA 1QNZL 4P5KA 4PRHE 2VQ1B 3FRPA 4ALAH 4M7LH 3LPGA 3DO7B 3IJYA 2CQVA 4WO4C 2YEZA 4LSPL 1AD0A 4X6BA 3G6DL 5DC4B 1C5BH 4HDIB 2EICA 4OQ1A 3F6IA 4N9GA 4ZFGH 3BZEB 1UADC 3FMGL 2IBZX 4UTAL 2ZUXA 2DDQL 1GCFA 5L0QB 2WBJD 2HWZH 5DDHB 1VHPA 4P99A 3OKKA 3PWLB 1ZT1B 1AE6L 4QXUH 5E2UL 2ICWI 3BRGC 1LGVA 3BDYH 4IRZH 4M6OH 3SDXF 3Q1SH 4HJ0D 5LGJB 1IC1A 5T3XH 4PJCA 3MUGB 2VZ3A 2Z91B 4XNYH 2XA3A 1Z3GL 3QNZB 4I18B 2PNDA 2FB4L 1A6ZB 1N5AB 2VDMH 3STZA 3U36B 5EU3A 1U8JB 4JVWA 4WV1A 4NKDB 1CICB 3LS5H 1JPFA 4JZNA 3HNTL 3O4OC 1CLYH 3UC0L 1TVBB 5JNYA 3RY6C 4ZTOL 4QHMB 2Y6SD 4LARH 3RTQB 2BY3A 1RJYA 1JHTA 3QQ9C 4EBQH 1V7MH 1BVKA 1EX0A 4WW1B 8FABB 3DROB 1WK0A 4CVZA 1A1NA 5I76A 4PJFE 2VLLA 5BO1L 2ADFH 4NN5C 2XTLA 1U8OB 2YD4A 4DGYL 5C0AB 3GO1H 1NANI 1MVUB 3JV4B 1D6EA 3FB8A 5I76B 3KLSA 1X9QA 4M1DH 4NQTA 1NBZA 3QDMB 3FQRA 3QFJB 4GW5A 4GUPA 4RBPK 4F58H 1D6EB 4OFVA 5EUOB 1DQLL 1PEWA 3EFFB 3C60B 3FQRB 1L0QA 4WIQA 5FDWA 1L7IL 1I4FA 3LB6C 2ARWA 1JRHH 4XPHL 4KK5D 1OTUD 1EHNA 4ZAKB 3LQZB 5FDWB 5JHLL 3NPZB 1KULA 1ED3B 5EU7E 3FFCB 1PSKH 1JN6B 5FO7B 1DBML 1Y6KR 4Q9BA 1CR9L 4BH8A 3V4PH 5KBNC 4PB9L 3QDGB 2IQ9H 5FYLH 4U1IB 1QTYT 1MCCA 1UZ8B 5GRJH 3BRDA 1FFPB 4ONFH 2DM2A 1OP5H 1DUYA 4BQ6A 3QHFH 2V7HA 3LN5B 4L9LB 3FHAA 3HPLA 5J56B 4Y4KD 3PHOA 2HTLC 3ZKNC 4NM8L 3D48R 1FC1A 1XF4A 5FM5O 2IALB 3SGDI 3IKKA 2BOBB 2OP4L 4LCCB 1U3HA 4L4TD 5BRZE 2Q8AL 2VLKA 2VLRD 4WFHD 3Q6GH 5EA0H 4P2CG 5GSVA 3DMMA 4GLRH 4WDIB 2HFEA 4O4YL 3MLTA 1A14H 2FLRT 3U6RB 3KPSD 4PJ7B 3MBXL 4UT7L 3B9KA 1K8IB 2Q3AA 1S9XB 5BVJB 5HVWA 3GIVA 3ULVH 4RGND 4XVJL 1W72L 2O5YL 2YZ8A 2EO9A 3ROLA 1T6VN 2QR0B 3RGVA 4IM8A 4FQXB 1JHKH 3DHMA 5DJCA 3UTPE 3VXUD 4XP5H 4EN3A 4M5ZL 1LE5B 1DBKH 2WANA 3O6LH 3RGVB 5HD8C 3QUXB 5J3HC 35C8L 4M43L 5FIEA 3WIFB 1SEBB 3MTRA 4GH7B 4L4VA 5HYFA 2EKSB 3HAEA 5D1QB 3D39A 5EOTA 5CSBA 1JWSB 2VABB 4ETQA 1VADA 3GFUA 4MAUL 3LEYL 1BGXH 1RZFH 5E6IC 2ATPB 3PNWA 4K7PY 1KSRA 4OIIL 1CG9A 4DN3H 1I1YA 1INDL 4JZJA 4S0TD 4AEFA 1PKQA 4WFFE 3MREB 1QSED 5JMOC 1HHGA 4YH6A 3WIIH 1ES0B 1TJHH 1NFKA 4QRPD 1WSST 2BVPA 5ID1B 3IFPB 3B43A 3OX8A 2OX5A 4LOUD 5C09B 4ZNCD 2YSSA 4OCSH 3ZSTA 2PXYC 3R0NA 1NMAH 4ISVA 4WWKB 1I3GH 4X8JA 4JPIA 5CMAB 1FZOB 4JAMB 4F7CA 4JKPL 3WIHA 4NKIL 3O3DA 4XB8A 5FECB 1CLZH 4O51A 3BGMB 3MJGX 4RFOH 2EYRB 2DMBA 5D1XA 2R23B 4P2RA 4Q0XH 2BVOB 3QJHA 4K9EC 3REWA 1FNAA 1K8DB 4G9FE 4HAGA 4AQ1B 1DDHA 2BSTA 4NN7C 1EXUB 1QRNE 2NQCA 2CRZA 4RAVB 3NZHL 1QBBA 3PGDA 1BZ7A 2HJKA 3OZ9L 4WW2B 5CAYB 1FPTH 1J1OH 4GKSA 3NIFF 5DMGD 4HFWA 5DRZA 1CL7I 4YDJB 3PWJB 4JY5L 1I75A 4AIZA 3QULA 3GSWB 1GGTA 4LLWB 4QHLB 3MRCB 1QR1A 1BFVH 1RFDH 2NY3C 4LMQE 1JI2A 4HFWB 1M7DB 4F33A 3B4NA 1FAKT 1H3VA 4K23L 5HHVH 1JPST 2WSKA 1AR2A 5ISZB 4P49A 3NCJH 1J18A 5GRWA 1WISA 2R69H 1S7SB 3KWWA 3GRWL 4NQDA 4O00A 1ND0B 1AKJA 2PW1B 3SY0B 5GPRA 4KTYA 1A7QH 6CGTA 5GS0H 2FJFA 1S5HA 3MV9A 3T8XA 3BVNA 4PJ8B 1QYGH 4B50A 2DIBA 3LPWA 2IH1A 4GRLB 5DHXB 1WFNA 3HI6L 1BQSA 5HGDA 4AT6B 1NGZB 3O41B 5F7YC 4O02H 4LLDB 4PREA 5F72S 1U8HA 4N0UA 3RNKB 3KPNA 4HWEL 1TZIA 2VAJA 4X4XA 5I66A 3MXVL 2EKJA 1WIPA 4LPUA 3J7HA 2JB6A 3MV7D 2EDOA 4YDIL 3IDMB 1GPOH 3VFOA 1G6RA 1TZIB 2AQ2A 2BRRL 3DI2B 3QIUB 4LSQL 3ETBF 5I1GL 3TFKC 4OBSA 5IW3A 3JV6A 3IJHB 4LRNH 4XNQB 3T3PF 4N90D 4KHXL 4IS6B 3JWDH 3L5IA 3TN0A 3HS0A 2AJVH 1MCWM 1KB9K 3BP6A 3FOMB 3RWFB 4XCCL 2EEBA 4LRIC 1ZEAL 2VAAA 5JW4M 3TA3B 3BDBA 3BE1L 3HS0B 4KROC 3BSZL 2CIIB 2GJZB 1JYWA 3O6ML 3Q6FA 2ZCHL 5BJTA 1G7PB 3TYFB 5D7JD 1KN2H 4K71C 3BZDA 3R0MA 1AR1D 3QYCA 4Y5VB 3SKUD 3O2WL 3NACL 4KQ4H 3ULVE 2FH6A 3E3QE 4JDVA 1QEWA 4G6MH 2RCSH 4Z7QF 1XGUB 3O6KH 2QQKH 1JUFA 4Q9QH 4QXWA 3V0AC 1SM3H 3U9UB 2IH3B 1TFHA 4ZUTB 3WUWB 2HH0H 5CBEB 4RX4D 1A6PA 3GZKA 1B4RA 4KJPD 4I3SL 3TO4B 1LP9F 2D9CA 4RMWA 2H8PA 5JOFA 4QRQA 3A6BL 1F58L 4HKXB 3QNXB 4G8FA 2VDRL 2GK2A 1FFNB 2HTKC 2GSIA 5BRZD 1XF3A 4LPTA 3O2DA 3RKDD 5IMLB 5SWSB 1MI5B 1A0QH 4GG8B 4J4PC 4JHWL 4H8WL 3QA3B 2VE6B 4WHTB 3OHXA 4WCYL 2GSIB 3KYOA 5GIRA 4HGMA 1J8KA 4LAQL 4NPYB 4G80A 4TOYH 3MNZB 1QVOB 4ELKB 3KDMA 1ORSA 1KELL 2Z31D 3O9WC 5ELIA 2ATKB 3T65B 3RX5A 1FNGB 4YO0A 4GKNA 3FN0H 1NLBL 1TETL 1L6XA 4KVNL 1FVDB 5F88B 1P7KA 2WINA 3VXQA 2C4FT 2MQCA 1L4IA 4HULB 2C3HA 4O5LH 5AZEL 1GYAA 3ILQD 3JTTB 1JJUA 1GRWA 3UTPD 5E8EA 2EYSA 3MACL 5ID0B 2ZUQB 1MEXL 4RFEB 3FONB 4BSVA 1PQZB 3UO1H 1TJGL 1G7IB 3MLPA 4NJAH 3T2NH 1INEL 5IVNA 4EXPX 2DQGH 3QUZA 5B4MC 5E9DA 3FRPG 1PG7H 1QFWH 4P4KA 5AD0A 5F96L 3HAEH 3RL2B 1XGYL 1SMOA 3CJJA 2BNRE 5EIIB 2ZOLB 2WLZA 1KIPA 1BFOA 1GXEA 4ODUB 4N8CH 5GXBB 4M8QA 4PD4J 3L1OL 3O2VH 3FQTA 1YPZB 2PTTB 2P45B 4FOMA 3D18B 2X4PA 3FQXA 4JY4A 4MJ6A 4C58B 1A2YA 4L8BB 1VKXA 1T3FA 3K4ZA 1LO5A 4ACPA 2WP3T 3F62A 4MJ6B 1F90H 2ARJQ 2BSRB 2CD0A 4P2OD 5K9OB 1F4XH 3WIHH 5DD3L 4D0BB 4TSAL 2MFNA 3DRQA 4R2GB 1T2QL 3TV3H 1JF1B 4PJCE 5T3XD 2ERJC 4R4BA 3SDAD 3V8OA 4Z7OF 3QG7H 4G8GA 1Y0LB 2AEQH 2XFXB 4ODVH 5FOBA 3DRTB 4U3CA 3HZYB 2XQYK 3FN9A 4G9FD 3ZHDA 1OP3H 5B22A 2VQTA 5CZVH 5FV1L 1QRND 3QIWD 4QWWD 5D6DA 3U79A 3WFHB 4Z8FL 4DZBA 3OBAA 3U2SB 1OD7A 2PR4L 1AQDB 5ICZB 1KLFA 3MLRH 2CIKA 3EAKA 2I5YL 3B2UD 1AIFA 3OWEA 4OV6F 1CVSC 1E27B 1S78D 1XGTB 4J6RL 2OZ4L 4AEIL 3WXWL 5J57B 3OKNB 5I1LA 3VFWB 5C8JB 5J12C 3QI9B 4U6VH 1UA6H 2HRPH 4KXZI 2A1WH 3ZDXE 3P30L 1YY9C 1WF5A 5JW4Q 3CFEA 4QF1A 1JNHA 4HJJH 3MRFB 1VGEH 2BVUA 1RURL 2H1PH 4PTUB 5J4MA 1HSAB 2UWEF 3SKNA 4JFYB 3MUZ1 2OTWB 5DQDH 4PJDA 3PDGA 4H26B 5FYKH 3L3IA 3SE8H 3DETD 3TEUA 3TPUA 3VH8B 3S6CA 4ZD3L 3CLFL 5J6HB 2DWEA 4Y4FD 4W4OC 3IS0X 3OJ2C 1TENA 4NP4H 4DK3A 2QKIA 4ZO9A 3TZVB 2NY7L 5IHLB 4ZOBA 3DTXA 1NMBH 1PY9A 5E8DH 3WJLA 4X9FA 1NGXB 4MXQC 4PJIA 2Q3ZA 4PPTA 1K4CA 5FYLD 4JN2A 3G04B 5KSBA 4XMLL 4HUUA 2GSGA 4QHUB 4YQXH 2DYPB 3H9SB 5IHUL 2CLRA 1G6RH 5LBSL 4GG6F 4Z76B 4LHUA 1GZPA 3FRUA 1W72B 2BY2A 2H3NA 4L9DA 1EUUA 4U6HB 5DSCA 4FQLH 3UPRB 4P48A 1H0DA 4YHKL 5KW9L 2VLKE 3IDYC 3BPCB 4DGIH 3QEQB 4YPGB 2GKIA 4N8VA 5TPWH 4V1DA 4I0PC 4PRAB 1T04A 1E0OB 1UACH 1ADQA 1NGWB 3STLB 1I9EA 4X99B 3T09A 2ZUYA 3BISA 2DMKA 4JGUA 3AREB 4G6KH 5C9JB 1RUKL 2VDQL 3MCG1 1A6WH 4R9HA 4YHPA 4OZGF 2P43B 2Y25A 5L6YH 2F58H 3VRJB 3FCTA 5CJBA 1N59B 1PX4A 2X4SB 4X0KB 3ULVD 2CDFB 3CH1B 2VZUA 1BOGB 4HG4K 1IEHA 2QQLL 2V9RA 1P1ZA 3GI8H 2R2BB 2CPCA 3HAEG 5CJOL 4GAGH 2CRMA 3VD3A 1C16A 4QHKJ 1YEIL 3C08H 3QWRA 2FECL 3SHSA 3GI9H 3IAGC 4BJLA 4NO5A 3IU3B 4XHJD 3ARGC 1UH3A 3AMKA 3BDXA 4LBEA 3LRHA 3FO2B 2ILLA 3CXHJ 5TDNB 5EORL 3P4MA 2YRPA 3D39E 2NY1D 1XR9A 1TCMA 3QISA 5I0DA 3T3ME 1F2XK 5MEND 4X80H 2QHLA 3O2DH 3ZDYF 2FLBT 1UWXH 2VXTH 3I6LE 1FNHA 3ESVF 4X4MA 4LPYA 5F9WB 5D7IA 3NCBB 1PKQE 3OAUL 5T1KA 4K2UL 2Y06L 1TVDA 1FNEB 2A9NH 1ZLUK 4PG2C 1S8DA 1UCBL 1J05B 5T5NF 3U0PB 3VXSB 4D3CH 4LQFL 4YHYB 5E2JA 4EVNB 3O8XB 4LKCB 4PGDB 1KB5L 4KKLC 1CD0A 2E8YA 3KXFA 5E8OA 5IM7A 2W0KA 4J12A 1MFCH 4KI5C 2LTQB 3MRIA 2FX9H 2BZDA 2WBJC 4DCQB 4LCWA 4PRDA 3I2CH 2OMNA 5EU4A 3WS3A 5HDQH 3QPQD 1PZ5B 4XX1G 3RDTA 3I50L 4P2RE 4APQB 1XIWB 2VIRB 3A6CH 1JMZA 1MJJB 3BJ91 4IJ3C 4POUB 1MRDL 4Y4HA 3WS3B 4RA3A 3AUVA 4W81A 1NBQA 2IAMD 1DUZB 2HP4A 4U0RB 2VXSH 4MWFA 3MBEA 1MPAL 2BNRD 4JFHD 2Y36H 1U36A 1ZANL 2H2SD 3NGBC 1UB6B 3QUKA 1ZHBA 1MVFA 5BVPL 4FHBD 2R8SL 4FQQB 3ARSA 2JJVA 1IFHL 4U1SB 5H37G 3V5KB 5IR1B 3MXWH 1S3KH 5C0BB 4I9WD 4PY7A 5JHDB 1GL4B 4EI5B 1G7MA 5F1NB 3KR3L 4ZFOL 5CZXD 1JRHI 2R0LH 1G7LB 4ZO7A 5JUEH 1V05A 3NFNA 3SE4C 1KCRL 3N9GL 5JIHA 4G42A 4BM7A 4L8SA 1RUAH 3AY4A 3ZE0F 4FQIL 1B6DA 1MF2H 4XWGL 2W0FA 5DRXB 4LVHC 1KN4L 1VEPA 4CDGC 1YN7A 4XPGH 3M1BA 2EH7H 5GS0D 5EU5A 3VG9C 4HUNB 3MV9E 5FYKE 2X4UB 4S10A 4KU1A 5DHYA 5CGYD 5E8PB 3UP1A 4GJTB 5DUBA 5T33H 3MJ8A 2FD6L 1C5CH 5BZWA 3L6FB 3MJ7B 4WHCA 5HHNA 2QADB 5MI0C 1FIGL 4RMTA 1NGQH 1QZ1A 4KK5C 3ALWA 1RIHL 1A21A 2XN9B 2A6JA 4N0UE 4F9PC 4X9HA 4XAKE 2M8XA 2PTVA 4FZEH 2IPUG 4GLRI 4JFFB 1NC4A 3B2VH 3ARWA 3BD4A 1H5BA 3DV6B 1WIOA 4U2ZA 1BVZA 4LIQH 2VH5L 4P46A 2LVCA 1HDMB 3MCLL 1IBGL 5IQ7L 5CWSA 1H3GA 3D5OF 1UEMA 4PBVC 5CJXC 25C8H 3G08A 1P4LA 4Y4KC 3HZKA 5AYQA 1IAIL 1OGTB 2VR4A 5F97E 3RRQA 3VW3H 4OJFH 2FCBA 4NKQB 5IOPB 4BZYA 1H8SA 3KS0H 3HI5H 1KV3A 3ZDZF 1HKLL 5C2BH 4NQVB 3NN8B 1E4WH 3WUWG 4F7TA 4G7VH 3WNNA 2J88L 4N0YL 3QZWB 2IPTH 2XWTA 5HI3D 3X14A 2BX5A 1HWHB 3C2AH 3G5ZB 3MYJA 5DF0A 2NR6D 3H7BB 4U1HB 4FQ1L 4JFZH 1R5IB 4D0CA 5KJRH 5DR5L 4Z7WA 5BOZG 1JPSH 4YHIB 3D0LB 3VFVB 3KPQB 3O3EB 4WNQB 3MQIA 1JHLL 1F3DH 2CJUH 3UTZA 4TSCH 1JYNA 1CU4L 5E99L 3K0WA 4R4ND 1GZQA 5D7SL 5A2IH 5TQ0H 1RZGB 2X4QB 3P9WB 4NNYA 3EO0B 3D2UB 1Q38A 3QO1A 1KENH 2UZYB 1J0HA 2VR5A 4AEHH 1KJ2L 1RV6X 2FZ3A 1IGFL 1UCTA 2JKXA 1U3HD 4X7DC 5HYSB 1Z0NA 5LQBL 2VLKD 3BIBX 3V4UL 3HA0A 4UIMA 5KAQF 4CKVX 1ADQH 3ZTJH 3DMMD 2W9DH 4LSVL 2JCCB 3AM8C 3VCLB 3QBTB 1IRAY 1KXQE 1JF6A 3V9FA 3CFBA 5A2KH 1J0ZA 3B9KD 1QUNA 5GGSA 3SKMA 1UWEH 4GRWH 4I3GA 5I1DB 4Q9CA 2W60A 2W0LA 5IBUB 4F9LA 2GAZA 1OOAA 1HSBB 1C5DA 1SVZA 5AYUL 4YIQA 2WQ8A 5DMIL 3T0ED 1YEJH 4HV8B 1AGBB 3IT8D 2KL6A 3WN5C 3EO1A 1CGVA 3T0BA 4NGHH 3V7MA 4CU8A 5L8KB 3DECA 4M61A 4OLXL 4EN3D 4TTDD 1V3JA 2W92A 2DQCH 3RX8A 1T89C 4N0FA 4PY8I 1RZ7L 5IEHB 4M93C 4FN0A 4O2EA 1ZLSH 5E9DE 1F11A 4KJWC 5FGBC 4L4VD 5B8CA 4M7KH 4D8PB 3D39D 2LAGB 3CUPA 1B2WL 1ZKAA 2X1WL 3DX8B 2DM3A 2XTJD 4I2XB 2FRGP 4DVRL 1MRFH 3D3VB 1NKOA 4I4WB 2D7TH 4JR9L 1ZHLA 1YPZE 3TH3T 3I6LD 3NIGF 3RVXD 43CAB 3OJDA 1R5WA 3U4BL 2R9HC 4M6ML 3O3AB 3P11H 2YZ1A 3L5JA 1N5YH 3RAJL 3MRJA 4Y89A 1GAFL 3UJJL 1U95B 1MREH 3SDCA 3TT1H 5DMGC 3RWJB 5AUMA 4ORZC 3F5WB 1KPRA 3HG1B 4HUKB 2OZ4A 1OAKH 2FIRT 2HA1A 3R8BB 4YEEA 3WEXA 2P8PB 3OAZH 5HHXL 3ZKXC 4K94C 4F7MA 3MRPA 1I1FB 5KVEH 1E4JA 4ZSOA 3QCUH 2G5BB 2BNQB 4OLYH 2DLHA 5GS1B 1AXSB 5JLZB 4BFIB 3RZCC 2DI7A 3RVVD 5D1XD 1HXMB 4G8GE 2GJ6A 1Q9LA 5IB2A 3MR9A 1NUDA 2ZCKL 1D5BB 1G84A 1EFXB 7FABH 3VG0L 4DQOL 2PYEB 5C0IB 4NRXB 4WY7L 2NY0B 1N64L 4RZCA 3BIAX 5H94A 1HQ4B 2ZSVB 3E8UH 1WT5A 1E4XL 5HYQB 2NY2B 1CQKA 4LIQE 5EUKB 1M71A 4DN4L 1YY8B 4MQXD 4C83B 4JO2L 3VH8G 2Y5EA 4LP4A 3GHBL 4KK8D 3VI3F 4X98A 4TQEL 1OCWL 1T5WB 2VISB 4XWOD 2BCKA 2VDPL 1BZ9B 4Y16B 1IM9B 2VN7A 3HMWL 1MFBL 4NQDD 2DQHH 4MQSB 1AKJD 3RIAK 4JDTH 3ARDB 2ZPKH 3LZFL 4PJDE 1OWRM 3QPXL 2BCKB 4CADA 1XT5A 3BKML 4GMTL 3MV9D 4XCFH 5D6CB 5FYKD 5HJ3B 4DFHA 1MIMH 3OKEB 2XRAH 3FT2B 3QH3B 1ORQB 4G6JH 4XVUD 3ULSA 5ITBH 4M03A 3BE1H 4OCRL 4PP1D 5FM4A 1ZA3A 3JWOH 5FXCH 1OAUL 3SCMA 5CSGA 5SWZB 1WLHA 1ZK9A 3UTSA 1F6AB 3CK0H 2EDXA 4YR6A 1MCKA 1EO8H 2D31A 5D7JC 3IDNA 4OKVB 1AR1C 4IDLA 43C9B 4NNPL 1KG0A 1BMGA 1KTDB 3JWNC 2AXGA 3BHBA 4PJIE 4LKXA 4XAKD 4YBHA 5EU7C 3V52H 4F7PB 1UJ3B 3MRHA 4OD3L 3EGSB 3EOBA 4AG4H 5FYKU 3DYOA 3OGCA 1CDGA 3ARTA 5JO5B 2P8LB 3IJSB 3MLYL 4KGJA 3HC4L 4N8VG 2F54A 2ADGA 3GJFB 4FMFA 4U33A 1BBDL 4KJPC 4YBQD 2BMKA 2YUVA 1IM3B 3UCRA 3TN0D 1NQBA 2C3XA 1SMAA 2CK0L 1EDQA 1XZ0A 1X5GA 4K9EL 3BP4A 2GCYB 1MUJB 4H5SA 4MJIB 2J7LA 15C8H 3RKDC 3A6OA 4U6TA 2DLEA 5EOQL 2D4DA 1FVCA 3RFZC 3C5JB 4ZPTA 4GRWE 5DC0A 2JLLA 1FL5B 4Y1AA 2XA8L 4LPVA 3DURB 2QHRH 1NBYA 1QFWI 3FQNB 1FVCB 3GMOB 2EIZA 3GIZH 3WNLA 4M62L 1NGPL 5SWQA 2Z31C 4M1CC 5FEBA 1OAZH 1HHIA 4Z7VB 4HKJA 4JG1L 5F3BA 3G6AA 1UM6H 4S2SB 4MMXC 1UGNA 4MXVE 1B0GA 1DANT 2PW2B 3V0WL 3VI4F 1T0NA 2BDNH 1FSKB 3KLAA 3MOBL 3O6FB 5JR1H 5INDB 1YYLL 1HOCA 3K2UL 1RJLA 4PJEF 1JNLL 1YEFL 5EH1A 5FUOH 1IAKA 2VXQL 3BH8B 2APXA 1T0NB 1MJ7L 3DOSA 1T7VA 3U4EB 2PYFA 1KB5B 4ZPVB 3V7AG 4UT9L 4RWYH 1RIVH 1JTPA 4KHTH 4WU7A 3MGTA 3DVFA 1S9VA 1VGKB 4KAQL 2P7TB 3MRKA 3C9NB 4LVNC 4YXHL 3V7AE 3PP3H 4X4ME 1UM4L 5D7IE 4JPWH 1AD9B 4ZXBA 5DRWA 4EKXA 4HW6A 4NUGL 5E2TH 4X9GA 4OGYH 4XMKL 4BQCA 2RR3A 2G5RA 2DQIL 3QT2A 3SDDC 3WL9A 2SEBA 3I84A 5GS3A 3T4YB 5K33A 4YEFA 1B4JL 4GAYB 5L2JB 1XGRA 3PWUA 4C55A 4WTZG 4HWNA 2RQ8A 4PJHB 1DBBL 5CJ8A 4TULH 1B6UA 3MFFA 5F89B 3KXFE 3UBXA 4WUUB 5EZLB 3V6ZA 2YPKA 1YJDC 2OR8A 4ZFOB 4LCWE 3HZVB 3MLUL 3UDWA 5FKAB 1ITCA 5FOJA 1AGEA 3EUUA 4NHCL 5K59E 1KTLB 1HZHL 3L3OA 4ONOA 2P1YA 5E9DD 4OZHF 4I5BA 1CFSB 3OKLB 5I15H 3MV8D 1HK6A 5E1AB 1RVFH 2R1WB 1WWBX 1OF2A 4UOW0 1EGJA 4FXKB 1V7NH 3PABA 1FDLH 3X12A 3BN9D 1SBBA 5KSBF 4TPRL 1IGYA 2HVJA 3GKWH 4HCRA 1J86A 4QWWC 5K9QI 1ZWIA 4JO1H 5CEXB 1H9VA 1F45A 5BQ7B 1U8QB 4XPBL 2O93L 3BP5B 3RNQA 5JQ6H 3HE6A 1Z2KA 5KOMC 4JRYB 1J1PL 2A83B 2J4WL 5GSRA 3MA7B 32C2B 3ARFB 4UQ3A 2EDEA 1R24A 3EOTL 4CW1A 2MCPL 3PL6B 3C6LB 4EUPA 5EPMB 2JJSA 2M1KA 2P49B 4D9RD 2XT1B 5IW1B 1R0AH 4LCYB 1MLCB 3CMGA 1MAML 2HT4D 3LV3B 3G6JB 4PJ9C 4XH2A 4XCEA 1WBYA 3S7GA 1OLZA 5DJ0B 5D5MF 2YC1B 4G8GD 1F4YL 2DWDB 2HFFA 5JW5B 3RJDA 5EO1A 3EHBD 4S1QL 1D7FA 1H3XA 4RFNB 3RA7L 1JWMA 4IBLT 4DVBA 3VXTB 3L3KB 4H0GA 1LO0H 3QAZC 5MP6L 1MJ8L 3F12B 1NEZA 2ITDA 4LASH 3JVGA 1ZVSA 3MRGB 4HBCL 5IESH 4XBPA 3HCVB 3OJVC 3LH2L 1ZLVH 1Z5LA 1A3LL 3WCYA 1RU9L 4UNVA 4PJXF 5ACZB 2FYYB 4ZUWB 3K3QA 5MHSE 1MLBA 3BESR 4Y5XB 4FFYH 4WO4B 2EZ0C 1Q8MA 4K8RL 1CDCA 2GQHA 4HIEA 3FO1A 4OGXH 3WFBH 3MRDA 3EYOB 5FA3A 1FGNH 5J13B 5FYJH 4HPOL 4UBDD 3RWCB 1DTUA 2YS4A 1FHGA 4I3RH 3RWHB 1QR4A 5C08B 4QOKD 2VDNH 1ZGLM 2I9TB 1KJ2B 3NH7H 1T4KB 4OB5L 2D7NA 1TZHA 4OI7A 3MMEB 3N1GC 1RPQA 4L3CB 1S7QA 4BK5A 2V2WB 2OSLA 4QY8B 3I9GH 4GBXD 4MDJA 4Z7WE 3KPMB 3DX7B 1CBVH 5C0JB 4GAFB 2X4TB 5HYSG 3ULUF 3ULVC 4ONHB 3E3QC 5D2LF 4PRID 2NX5A 3B8SA 1DP0A 5E5UB 4EXKA 3O4OB 4LHUD 4W6WB 4ONGL 4C56A 3SGEI 4ELMB 2YXFA 2MKLC 4OF5A 3BMWA 1FG2A 5CUSH 1KTKE 1CE1H 1EH9A 1T0MB 1I7ZA 4XVSH 3W0WA 4YHNA 4CU7A 5TE7H 5DEGA 5IROC 1MCPL 4N0CD 4XHJC 5CIPA 2I9LA 5IBUG 3TBTA 3S35H 1NJ9B 4V1DD 3GB7A 2OK0L 4NN5B 2JJWA 2VMFA 3RL1B 3VWKB 3BRFA 3U1SH 4XP6L 4DAGL 4HFUH 4PGEB 3QQ4A 3OKMB 1QKZL 4M48H 4WENB 2FL5B 5CD3A 2Z92B 4OM1H 4GXUN 1GSMA 3K8KA 5CJ5A 1U58B 1I9IH 2PTUA 3HHRB 3K7UA 1UYWL 4J3VA 4JANB 5IBLD 1FO0A 3ZTNL 4XC3L 2IPKB 4P4RB 2FJHB 3LEVL 2NY6C 3DO3A 3MJ9A 1L0XA 2DOCA 3FO9B 2R2EA 5BV7H 3UYRL 4LLQA 4Z7NE 1W0WB 4D9LH 2FX7H 4CMMB 3QPQC 3T1FA 5CBAB 3BO8A 1KJ3L 4O9HH 3ZE2F 4IIQC 5IVXF 3ZYZA 3L3DA 4M7ZC 3BD5A 5EIQA 2ZOKB 4YUEH 4J1UA 1KACB 5GZND 1JIBA 3LHPH 4MD5A 2P44B 4XPFL 2LU4A 3I02B 1KCKA 4F3FA 1OD9A 2L7UA 4XP9L 5DT1H 5F9OH 1ACYH 2OL3L 1FZJA 1UZ6F 4KJQD 3W9DA 2WIIA 1A9EA 2CLVB 2AEWA 5T1KD 2H2SC 2NTFA 4JM2F 4PGZA 4P5MA 2VXVL 5GZOC 4F2MA 4LPXA 4GW4A 4RA0C 3RPIB 1Q9OA 5DJXA 4AENB 1OAQH 4TUOA 3CDCA 2FATL 1KEMH 2RAMA 5CZXC 5TE6L 4POZC 3KXFD 5DVMA 4JFXB 1NUNB 4ZSOE 5F7DA 2N4IA 1NFIA 2C3VA 4MZ3A 1J5OL 4XP4H 5DO2D 4LCWD 5HDBE 2EH8L 4OLUH 2FO4B 3MLSH 3RDTD 1QSVA 3AGVA 3RWDA 2C3VB 4P59L 2GJ6E 4L1HA 2E9WA 4NUJA 5GS0C 2PYEE 4Y4HD 1FE8H 5TE4L 3QCTL 5CGYC 3KYMB 2X4RB 4MA3B 1UB5B 1YZZA 2X4OB 1DR9A 2XG5A 1CICC 1EGJH 1BQHA 3AXLA 3EKCA 4FFZL 3WNOA 1JV5B 3OKDA 4FNLH 5EFIA 5FHAH 3L3JA 4HCRH 4WV1C 3VXNA 3B9VA 1I9JL 5E6IB 4PB0H 3QXDB 3RTQC 4H88L 3WFCL 1Q9KA 1XH3A 1KJVB 5F7HA 1P4IL 3CSYB 1GHFH 4MS8D 1A7NH 5F7EL 4I1NB 5HY9B 3ZYOA 4JFQB 4EUPH 3E6FA 5HPMB 3BH9A 1FVEB 1SBSL 3B6SB 3AMLA 2YN3A 5F7UA 2QV2A 5IWLA 1JZ3A 1AXTH 2VNCA 2PXYB 5FYJE 3PGFL 4MAYB 3TWCL 3QXTA 3Q3GB 4HHAB 5E00A 4YXLH 2BFVL 2AABH 4D2NA 1MIEH 1N3NA 2CO6B 3QEHA 4YHLH 1B0WA 3VJ6B 3UTSE 1X6LA 2ZKHH 3O45A 4U6XA 4F8QA 1N3NB 5I2IA 4HEPG 1CQYA 3CC5B 2Y5TA 4UUJA 5KTEH 4RRPG 4L4JA 4NN7B 5D8JL 2ZG1A 4P9ML 1VPOH 4C54A 4Y2DA 1NC4D 2IPUK 3P0VL 5DR5H 4KTEL 4LGPB 2R4RH 3U0WL 5IB4B 2X70A 4P46D 5MHSD 2F54E 4HBQA 1JPGA 3ZL4L 4JM2D 1T22A 1W0VA 3C87A 4QT5A 1X4YA 4G8EA 4R4NC 2O61A 5D2NA 5BMFH 2NY3B 1DQJB 2C26A 2C1PB 2YD7A 3RU8L 3BJLA 4LCCC 1A4KA 1JGUL 4K3EL 5KN5A 5FGSA 2WUBL 3L3GB 4KMLB 2J2ZA 3MGOA 3DVGB 1FP5A 2HLAB 3P77A 1U3HC 2IBBA 3VGFA 5MEOA 3ZSSA 3F58L 2IC2A 1U8LA 4ZFFB 1ZT7B 3DMMC 2GY5A 2IADA 4LNRA 4PRPB 4Y1AE 1LEGA 3GSOB 4WGVB 1BD2A 2PO6D 3UX9B 5BS0B 3B9KC 1XMWA 1KIQB 3AS2A 4X7SH 3KYKH 4U7KA 4HIHB 4ERSL 1Y6MR 5GGUB 5LCVL 4IMKA 1LDPL 2V2TA 5FCUL 4UU9B 1FFOA 3N85L 4P5TB 2BNUB 3CZJA 1FC2D 1S7WA 4R0LA 3RGVC 3CFKA 1NLDL 1F3JA 3JV0A 5IFAL 4HUVA 4EN3C 3K2MC 1AGFA 1DEEB 1UWXK 3MROB 1HH6B 3JTSB 2E7BA 5D1QC 3UTTD 5CIPH 4LF3A 1P69B 2ZNWA 5DJAA 5IVZA 4OZ4B 4Y7MA 3HMXH 5J8OA 4JZOB 1HI6B 3LEXA 1CL7L 3S4SB 3V4VL 2VITA 5DMKB 3VFNB 3NFPA 2PCPB 3BUYB 4DKFH 1FQ9C 1KFAH 3ECBA 4HS3A 4KROB 4HT1L 5TGBB 5EZJB 1V5JA 1NFDA 4JZJC 1D5MA 4JQIH 4HUXB 5T1MA 5F7FA 4K71B 1U0QA 3TYGH 1NGYA 1I8IA 2XXCB 3BZ4B 4BKLB 1FO0H 3BKJL 1D5IH 4OBRA 4LCIH 3CCHA 2DIAA 2P5WA 3IFNL 4FQ2L 3MJ9H 2XICA 1JZ2A 4K3DL 4XBGA 1YEKL 3PWVB 1ERNA 5D70L 2ESVB 2B4CH 5EU6A 2YPLA 3VWJA 3FB5A 5EZOL 1NSNH 3MOAH 1D9KB 4FP8H 5F93C 3F7VA 5T1DL 3RVVC 5D1XC 2Z35A 3F7YB 5HHOD 3CDGB 4MDIB 1Z0MA 2DLFL 1QLFA 3EOAB 5DJ2B 2ZCKH 4PIRF 5IB3B 4OCLC 1N2RB 4DQOH 1T1ZA 1ZTXL 4WVRA 4XGZA 5FUZL 2WW8A 1YECL 5TFSL 1OQOA 2XZZA 3SGJA 1BVLB 3VD5A 3SDCD 2UZIL 1WBZB 2FX8H 4GW1B 1M6OB 4PJGB 3L5WA 3ROOA 5EBLA 4UT6L 5B39A 4FTVA 1HINL 5J6GA 1VFUA 2J8UA 3O9WB 2N7AA 1QA9A 2HLFD 5C6WH 4D0DA 4HIIB 5ADOH 4KK8C 1TJIH 2XACC 3STBA 1MHEB 2JIXA 4X7TA 1MQ8A 3O3BB 1F6FB 3U0TB 4QXTB 1NEZG 3P73B 4PJ8C 2NW3A 1SJHA 4E41A 1GH7A 1DBJL 5CP7B 4WGWB 2GJ6D 1KEGH 5KVGH 4H20H 4X7TB 1NCDL 1MWAL 4OZIA 2H2PD 5IEKA 1MJUL 4U1KA 5HGHA 4ZOCA 1OM3L 3MLVH 1OTTD 5FO9B 5IEKB 2I07B 2CKNA 4ODHH 2KQMA 4U1MB 5KS9A 3VFTA 3I6KA 3DVIA 4LPCA 4IRJD 4KJYA 2OJZH 1IGIL 3HR5B 4JJ5A 2UZXB 3HI1A 4P23A 4MNQB 4K3JL 1KIRA 1A4JB 4RAUB 3T4AB 3MNWA 5DJ6B 5C07B 4KTDH 4HUWA 4IDJL 2IGFH 1T1XA 5EUOF 2HAZA 1RK0A 2DL9A 3NCMA 4J2XA 2J6EA 4MA7L 5C08E 4YBQC 2XQBH 1P7QD 2W65A 3D9AH 1WC7B 5FYJD 1WIUA 4Z7UA 2Q87A 1QFHA 1MHCA 5F7LB 3RPKA 1A1OA 2VLJD 3X11A 1BF2A 4LU5H 3BZFA 2G9HB 2GJJA 4V2BA 1DL7H 3UAJD 1FNSL 5F9DC 1JZ8A 1ZHKA 1MCOH 5L2KA 4DKEL 1TZGH 4TNWK 1KJMA 3SCMD 3SO3C 2ERJB 2DQEL 1A5FL 4DWHA 2DD8H 3T77A 1KJMB 3CX5J 1HHHB 4ESKA 1CT8A 1QLEH 4BH7B 4O2CA 3ZMRA 3L7FA 3LMJL 3W39B 3FZUD 5FA4A 5FYJU 3LIZL 4DW2H 2WV3A 5BCAA 1S7TB 4X6CB 2QBWA 2NX5E 4LSRL 4XTRD 5HYJB 4PGCA 2MQ0A 4C56E 4HKBB 5I1HH 4FQHA 2ZJSH 4ZQKB 1OL0A 3V5DB 4NJ9L 3OPZL 3SJVB 1UXWB 3W0WE 4HK3N 4K94L 4ODTL 1S7UB 2ICWB 3CFJB 1J0YA 3GJEB 1F00I 4JG0L 5I18L 1WZLA 2EDNA 3HNVL 5JTWA 2ITCA 5ESQB 1X3DA 4LCUB 4MVBC 4PJ7F 4LLYA 5DYOA 4P2QA 4BFBD 3O81A 5ESAA 3LKNA 1E6JH 1K3ZA 2DKUA 1IGCL 2FNBA 1UT9A 1T1YB 4M02A 3F7RA 3SQBA 4FQJH 5J7CC 3L9RB 5E5MB 3REVB 4DUVA 1T20A 1IAOA 3QO0A 1YNLL 1GGBL 3S88H 3QDJB 3VRIA 3VRLE 5D9SB 4A6YA 1I9RL 3PDDA 3BIKA 2C7UB 5C0NC 1NC2B 4GAJL 2OL3B 5CHNA 4J3SA 2AK4A 4HXBH 4UAOC 4AIXA 3GBNH 3IKCA 1MELA 1CXFA 5H2BA 3MRLA 2ZUQC 5D72H 2PUQT 5C0AD 5I8EA 5AAMA 4QHNA 1JWUB 1A7RH 5D7KE 4RISH 5L7XL 2Z9TA 4HGKC 4PS4L 5JPNB 1HN1A 5DK2B 3QDMD 4JFDB 1BEYH 4P3CL 2F19H 4JQXA 5GGTA 1X6NA 2R56H 1WZMA 3QUZC 3KPPB 4UINH 5TJWK 3KYNA 4P4KC 1YN6B 3C5ZB 3C60D 2FIKB 3E2HC 2GTWB 4FQCH 5DEFB 3IDYB 4ZXBD 1OSPH 1EPFA 4JFPB 3O4LB 2XKNB 4HQQH 4R26H 1KCSH 2V6HA 1LMKA 4RMRA 4G5ZH 3TBWA 3OAZK 3QG6B 3HRZB 4G3YH 5I8OH 4NKMB 2F5AL 3FO0L 2A74B 2VZTA 4S1DC 1UVQB 3GMMB 2D7OA 1HXYB 3GBMH 1DQMH 12E8L 5JIPA 3NIDF 2HT3D 1LO3H 1RUML 2YA2A 4NN6C 5IK3A 4ODXA 1F13A 3B9EA 1M05B 5IJVB 1WFUA 1I8MA 3I6GB 4C4KO 1BQHG 4KRNA 1PG7X 2YPVH 1IT9L 3MRRB 4L29B 4X6DB 5GGRA 2X7LB 3G5XA 1JL8A 2V2XA 2Z4QA 5C0GB 4WW2F 5MERA 4P3DB 1ACZA 1AO7B 5A1AA 1KYOK 1R3LB 3LAFA 3LY6A 3ARQA 4S1QH 3TBSB 2V5MA 3GSNA 5CGTA 4LEOB 1KCUL 5JZ7D 5D6DC 1I7TB 1OAYL 5AG8A 3GMPA 5TDPA 5HHPB 4RDQG 3FT3B 4KUCF 2ZSWA 3HE6D 1RUQL 3BPNC 3ESUF 4UTBH 1X5IA 3PWPA 4OLVL 3FQUB 4FQXD 3PHQB 2P42B 4M4PA 2A6KB 2CH8A 1D5XA 5AWNL 2H32B 1JZ4A 4JN1H 1R3KB 1GVIA 1RZ8B 3OAYH 2CKBL 2EXWD 3CXDL 4MQTB 1M1SA 1KCVL 3QRGL 5IF0B 5F7MC 3K1DA 4F57H 5J89A 5MEQB 1FCGA 2NY5L 2C1OA 4TNVF 2WBJB 2KKQA 1KB9J 4PJBA 4MMZC 4LDEB 1CD1B 4O58H 4IJ3B 3QEUB 4PJBB 1Y18A 1AHWA 4OQTA 3TBVB 4PG9A 4ALAL 4M7LL 1U8MA 4ZDHA 2X44D 1V8HA 3INUH 1O5DT 3LD8C 3WJLC 2CXGA 4OT1H 1QG3A 3NGBB 1G7HA 1C5BL 2VN4A 3UPAA 3DPBA 3FAXA 2VSCA 3VFMA 7CGTA 3B5GA 4ZFGL 1OT2A 4KZEH 1BP3B 5D2NE 1T03H 4OZFB 2DJSA 2L0DA 4ORGB 1A9BB 4Y88A 2CRIA 2G75A 2HWZL 1NAMA 3U9PH 1KNOB 2J6EH 3FB7B 1S7VB 1EEZB 4QXUL 4U6YB 3ELAT 3BDYL 4IRZL 5DD0H 4M6OL 4R96B 3Q1SL 3PJSB 3LVEA 5T3XL 2AV7A 4O2FB 4LVHB 4FS0A 4XNYL 4FABH 3VG9B 2IBGA 1OWWA 3QWOB 4TVSa 5ERWA 4QGYA 1H15B 2VDML 5EBMA 1S9WA 1BD2E 1BBJA 1H8NA 3C5SB 2GYSA 3VFSA 4EDWH 1EEYA 1JZ7A 1EEUA 3SPVB 1CLYL 1LEKB 5C92A 5AZ2H 5MI0B 2QJDA 4DJMA 2H26B 3GMRA 4U31A 4LARL 3IXAA 3S4SG 3S5LA 5IBLC 5EBWA 5MEPB 1U9KA 4C56D 4EBQL 1FYTA 1V7ML 1TDQA 2EDBA 2CMRH 1YMMB 2ADFL 3TO2B 3GO1L 1CLCA 5IP4A 2HKHH 3PP3K 4C59B 4HS8H 2EEDA 2QQNH 2WAHA 3EYFB 4M1DL 4LFHG 3VFPB 4M1GH 3GUTA 3UBXI 4F58L 5DK3A 4UOJA 4Y4KB 2CSPA 2GITA 5ESVB 1YA5A 5ICXB 1HHJA 4HX1A 2M26A 5F9WC 5DJDA 2VKXA 2A2QT 1JRHL 3E6HA 4YGAB 2V7NB 4L4TB 2EIDA 3O11A 3DJ9A 1NFDE 2VLRB 1BIIA 4KJQC 3MUHL 2EO1A 5DWUH 4A6YH 3SDXA 1PSKL 2X1PA 4W6XB 2IANA 4YHYC 4X5LA 5FGCB 3O8XC 2FWOB 5CEYA 1JNNH 3QIBA 3V4PL 5EOCJ 3KPSB 2IQ9L 5FYLL 3ZE1F 3GSRA 2E6JA 4Q2ZA 1RZIA 1G9EA 2P5WE 2UVFA 5GRJL 4EQ3A 1U8NA 4AY0A 4ONFL 3T2OA 4M7LT 4MB4A 3QHFL 3HN3A 4RGNB 4JY6B 4ZUUA 3MRMB 4ZUSA 1DFBH 5EU6E 2YPLE 1J1XH 3RWEA 1AP2B 4ZUVB 3RDTC 4NCDA 2GFBA 4KKBD 4U1JB 1OVZA 1P2CA 5GGTH 2GK0B 4U0RC 3TA3D 3VXUB 4P57A 1RY7B 3Q6GL 1QBMH 1FL3B 2EDTA 5EA0L 2YBRB 1IGMH 3WD5H 1IGJA 3MBEC 3CMOH 5B39G 4P57B 1RZKH 3DBXB 4MA8H 1A14L 1MWAB 3DV4B 4ZTPH 3ALXA 4Z77B 1SJEB 3C8DA 1P4BH 3U82B 3R4DA 3NMEA 2HFGH 4R6UA 1K2DA 5I8CA 1KPVB 5INCB 5HHME 3MRNA 1TVHA 4FTVE 3ULVL 2CDEB 4WI9A 3TNNA 2J8UE 4XCYB 1G0YR 2DKMA 1ZSDB 1ETZB 3QXAB 1TVHB 1I8LA 3FTGA 1JHKL 3TO4D 1QSEB 4MS8C 4E42A 1R3HB 4L8SC 4XP5L 5J1SC 4ODBD 3AY4C 4TN9A 1DBKL 3O6LL 4QRPB 1JK8B 4YHMH 1MQKH 1D5ZB 3I75B 4E41E 1MFDH 4DEPC 1F8TH 2B0SH 1F4HA 5DK0B 4M3JA 2OMBA 4PJAB 5FKPB 5J1AB 4OZIE 2ID5A 3IFOA 2Y23A 3PIQA 1YEDA 1R3IH 4M93B 3LQMA 3WNPA 2ICEB 4FZ8H 1BGXL 1RZFL 2YUWA 3GSNH 3BWAB 3IU4H 3QQ3A 4DN3L 5BW7A 1AGDA 5DHVA 5KS9E 3EBAA 4YFLF 5DD5H 3RUGB 1SYSB 2WWKT 4NO3B 5I19H 1A6AA 1WFTA 3WIIL 2Y07H 5DHVB 3QNYA 2D7QA 4QRSA 1TJHL 3BFOA 4OCNC 1H5BC 5IQ9A 2FGWH 1IAMA 1A6AB 4PRHB 4OLZH 4OCSL 4P46C 1NMAL 3MSPA 4HWZB 1FG9C 1I3GL 3AS3A 3UROR 5C0DB 2EXYC 5DURD 4OD2B 3RGHA 1W8NA 4Z7UE 1CLZL 4D9QE 4IOIA 3KVQA 1C08A 4RFOL 1XCTA 4LLUA 4JDZB 1X5AA 4Q0XL 1WWAX 5L2KE 4HKZB 4MHHI 3GK8H 4WFGE 4WFEE 3RZCB 1OLLA 3B9DA 2YUZA 4CAGA 3HZMA 3D69B 2VZ1A 1WCBA 4HEME 3S3PA 4OQTH 3PF2A 4L3EA 4DKDC 4DZ8A 5EC2A 5E2VH 2NZ9C 5E94A 1A7OH 1I7RA 2IQAB 3IDIB 3DLQR 3CFIC 1NCWH 1FPTL 1YNKH 1NCAH 1E28B 5JW3H 1J1OL 3VXRA 1LK3H 1XR8B 1VFAA 3GSVB 5F1IB 5KSAA 3MPCA 1PAMA 2B20A 2F74A 2X41A 2OTUA 1UQSA 5IW6B 1BFVL 1RFDL 2E9IA 3AU1B 4GRMB 5B38B 4YAQB 3QDHA 5IGXH 3MV7A 1BWWA 5ILTH 2OTUB 5HHVL 4NOBA 3NCJL 5HVFB 5KZCD 2YK1H 3QJFA 2R69L 1NAMH 4YWGH 5IV2A 3H42H 2VWEE 2LU3A 1S7RB 3L5XH 1DQDH 2AEPH 4P2QE 4NYLB 5I16A 1A7QL 3P9MB 5GS0L 2ZUVA 1X4XA 5DJ8B 1FV1B 2NXZD 4QTHA 1QYGL 5C2UB 4PJFB 3KPOB 1HIMH 4NQSB 1KC5H 1E4KA 4NKOA 4XPAH 5DQ9A 5A16A 4JM4H 1BD2D 2CUIA 4O02L 1V3LA 3ES6A 1LEIA 1FZMB 2VKWA 3U83A 2AK4E 4F9LC 5IKCA 3K46A 5D7JB 5E7FA 4KZDH 1K9TA 1GPOL 4MJ4A 4A2LA 4CN4A 4J3WA 1IEAB 1TIUA 1P53A 2BSSB 2DQUH 3VXOB 5GGQH 1HEZB 2BXYA 4KC3B 4LRNL 2HN7B 5ECJE 1OARH 2BP3A 5C0EB 5HBBA 1EHXA 2AJ3B 3JWDL 5LXGH 2AJVL 5CSZA 3B3IA 4X4ZA 5B8CC 1EMTH 5H35B 3LKQA 3IXTA 3WNMA 2JELL 1C8PA 1OW0C 4U1LB 5CGMA 5T1LB 1DQQA 2DB8A 2BHZA 1KN2L 1WVZA 4PUBH 1EBAA 3MLWH 2UYLA 1FGVH 1YEEH 4LFHD 5BRZB 5DUMH 1ZLWK 4MB3A 4NCC1 1YEHH 4RQQB 5FM8A 4KQ4L 3IDGB 3A67H 1CFVH 4OF7A 1C1EH 4NQCA 4QTIH 1PYWA 3BMVA 2BHYA 4G6ML 2RCSL 5FF6A 5KVMC 3PV6A 3O6KL 2QQKL 3NCEB 4JFOA 5K9JH 3VFGH 3H9SD 4Q9QL 3IRPX 1SM3L 3DVNB 4ZOAA 2HJFA 1PYWB 2HH0L 1R3JB 3TCLB 5IJKA 2P5WD 2Z31B 4X6DE 3R06B 2H9GA 5HDLA 4HMEA 2HLFC 5I1AA 4GKZA 1S7XB 1A1MA 2R1YA 1UXSA 1REIA 2VYRE 1IQWH 2H9GB 3KPRA 2XPGB 5EU6D 2YPLD 3VWJD 3QEQD 4TTGA 1ZHNA 4X4YA 2EDQA 5C3LD 3WYRA 1K85A 1BIHA 3HLAA 2CKBB 2KZWA 4UDUA 3EDEA 1P84K 2DTMH 1A0QL 2BVYA 2H2PC 2VZSA 2A6IB 1BX2A 2ZCLH 3NAAH 1OAXH 1VB9A 1NDGA 4TOYL 1PKOA 4LVNB 4LLMB 4EI6A 1CGTA 1CYGA 3FN0L 3PQYA 3PWPE 3WUZA 1FJ1B 1WT5C 3TIDA 4KGLA 5HHMD 5KG9B 4FTVD 5DJYA 2CXKA 4MLSA 4AM0B 1G7QB 4K7PH 5E95B 1HH9A 5TDOA 2EDWA 4HMDA 3G5VB 4O5LL 4CGTA 3WE6B 1H3UA 2HJLA 2JIXD 3RWIB 1IQDA 2BY0A 1KPUA 5HTSA 5HSFA 3W11D 2NNAA 3UO1L 4E41D 4KDTC 4NJAL 3T2NL 4Q58C 4P2OA 3HPJA 2DQGL 4PJBE 4NSKB 1PG7L 1QFWL 4G6FB 4JGJA 3H3KA 2OQJA 1MFEH 4UB0H 5ACLA 1DBAH 2OXGA 3DUSA 3ALPA 4OAWB 1YUHB 5A3ID 2CLZB 1LP9A 2XQYG 4WI7A 3SGKA 5CD5C 4N8CL 3DUSB 4NRZB 3SDAB 4LPWA 5TH2B 3O2VL 4MX7A 3V0VB 1QO3A 3S34H 1NL0H 4G8IB 1UJ3C 1LNUB 4ENED 4G9FB 3C8KA 3C6SA 3FZUC 1QRNB 3QIWB 4P23D 4OCXH 2VQUA 2WIMA 4WJ5A 4XTRC 1I8KB 4PR5A 1LHZA 5JPMB 2IG2H 1F90L 3VDAA 2N1KA 3ZKSD 1F4XL 3KPLA 2O26U 3TNMA 4QLRA 4JPKH 3WIHL 1ZS8A 4D9QD 3DXAA 3TV3L 1VDGA 5IFJA 2HG5B 5DLMH 4I8DA 3QG7L 3MCKA 5L2KD 2AEQL 4ODVL 4PJ9B 3QUMA 3EJYD 3M8OH 4PRBB 4WFED 2ADJA 3DIFA 1TNMA 5CZVL 5CLWA 2RHEA 5EN2B 3S5LG 1AFVH 4Y4FA 1T1WB 1CE6B 3EO9H 2AXHA 5F6HJ 3BWUC 5C0BD 5F9JA 3MLRL 5JXAH 1BQUA 1WTGT 3LKOB 4BA8A 2DICA 1DE4B 2IF7A 1FSKC 1Q94B 1N6QH 5ANMA 5ENWB 1FYTE 4U6VL 1UA6L 2YD5A 2HRPL 3RBGA 2A1WL 1N7MH 1EJOL 4EDXA 2UUDH 5F7WC 2VR9A 4BQ9A 1NPUA 2OTPA 4HJJL 5BV7C 5BZDA 1VGEL 2X4NA 2JCCF 2H1PL 3TF7C 4P2QD 3CSGA 4XNUH 5I1KH 1FN4B 3LS4H 4PLOB 4AH2A 4RSVA 5FYKL 3SE8L 4WFHE 4FXLA 4I48B 1QLRA 2GTZB 4XRCA 1OSZB 3GMNB 4RMSA 1HQRA 2PKDA 3H7LA 5M95B 3T2QA 2UY7A 1RK1A 4ZXBC 5DS8A