2VN3A

Nitrite reductase from alcaligenes xylosoxidans
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
336
structure length
336
Chain Sequence
QDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title The Importance of the Long Type 1 Copper-Binding Loop of Nitrite Reductase for Structure and Function.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
molecule tags Oxidoreductase
total genus 88
structure length 336
sequence length 336
ec nomenclature
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vn3A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vn3A02
4YSEA 4HHGA 1AAJA 3OQRA 2YAEA 1URIA 2IWEA 3NJFA 3NSDA 2IDUA 2YARA 4YL4A 5B3SB 4GP8B 1ADWA 2HLEB 3X1GA 3EHBB 2DWTA 2UX6A 4DP2X 1ZPUA 4WTQA 1AACA 2VW7A 3X1FA 2PP7A 1KYAA 1V55B 1VLXA 2PPDA 1JZHA 2AZUA 2XUWA 2YAQA 3KW8A 3NSCA 1BQKA 3FQYA 3EH3B 4Q89A 3ZX1A 7PAZA 1KCWA 2HX8A 1L9SA 2YAFA 2FQFA 4M3HA 3QJUB 3EH5B 1WAEA 3WKQA 1E5ZA 3S8GB 1J9TA 1GS8A 1T5KA 1KBWA 2QPEB 4W9ZA 3SBPA 3FSVA 1ILUA 4ZK8A 3OMNB 2GSMB 1PZBA 3EF4A 2IH8A 5I6KA 2FTAA 1HAUA 4DP8X 3AZUA 4EF3A 3NJMA 4YSAA 5F7AA 2B08A 1GY1A 3X1EA 3OM3B 2PCFA 1RZPA 1IUZA 1NIBA 3H56A 4DPAX 4G71B 3QQXA 3SBRA 1CC3A 1JOIA 3QJQB 2R7EA 1JZJA 1QHQA 1X9UA 3CVDA 2JKWA 1DYZA 2FQDA 3TBBA 1GS6X 2BWDA 2XU9A 4YSCA 3AG1B 1SDDA 2W88A 3UGEA 4KOBA 3UABA 3FT0A 1FFTB 1L9TA 2PP9A 1TKWA 3BQVA 1XB8A 3TA4D 1SFDA 4KO6A 6PAZA 4HCGA 3CVBA 2H5UA 4MFHA 1AOZA 1W6WA 1KDJA 4BXSV 2VMJA 3CVCA 1L9OA 4HCFA 1KDIA 5D4IA 2IDFA 1J9QA 3HEIB 1X9RA 4G72B 4HZ1A 5I28A 1ZIBA 1IBZA 3UADA 1CYWA 4AKOA 4FA7B 2P80D 5I6MA 3ASNB 1BXUA 4A2HA 4FAAB 2HRHA 1PNDA 3DIVA 2E86A 1L9QA 2XV3A 3CG8A 3RYMA 4YSDA 7PCYA 5FC9A 1M9WA 2X87A 1GY2A 1IBYA 2IWKA 2TSBA 2XX1A 4QKTA 4A2EA 3QPKA 1M57B 1J9SA 1IC0A 2EIMB 1PLBA 1AANA 4KO5A 2HX7A 1TU2A 4JHVA 2OJ1A 3EH4B 3OD3A 3PAVA 3PLYA 2J57A 4UF7C 1XB3A 3DKHA 2BP8A 1OCRB 1JVOA 2PP8A 3NJHA 3PXLA 2YQBA 3OMIB 3T71A 4DPBX 3IBOA 2GHZA 2UXFA 3UACA 3HB3B 2ZOOA 4AKPA 2XVBA 1ZIAA 2A3TA 2DV6A 1J5DA 1NDTA 2XWZA 3SQRA 4A2DA 2UXVA 3QJSB 2AANA 2HZHA 1J9RA 4KNSA 3GDCA 1JXDA 1AIZA 5IY5B 4BWWA 3ZDWA 2N0MA 3SBQA 2FWLB 4YSPA 1WA2X 4WKXA 1DZ0A 1NPJA 2BP0A 3GYRA 3NYKA 3V9EA 1PY0A 2WSDA 5F7BA 5I26A 2FQEA 1ZDQA 3IEAA 3NT0A 1NIAA 3WG7B 4QLWA 4L0PB 1NPNA 1RKRA 2PPCA 3IN0A 1NIEA 2ZXWB 1HAWA 3PAZA 5B1JA 3QJTB 4YVUA 3S3DB 1N68A 3D12B 4RH4A 1QNIA 3NSYA 5I5JA 3FSAA 4HAKA 2FNWA 1A4AA 4NERA 2GC4C 4E9WA 1SFHA 1F56A 5LDUA 2I7OA 3S3CB 1UATA 4A67A 2GI0A 2VM3A 1A3ZA 2BW4A 3JT2A 4CSZA 4K9JA 3T6ZA 2EINB 2YAPA 1E67A 1NTDA 5PCYA 2DY2A 4DPCX 2BZCA 2I7SA 3NP4A 2OCCB 3N55A 1R1CA 3FPXA 4A2GA 4AZUA 2CCWA 1AZCA 5B7FA 3ERXA 1L9RA 1A8ZA 1AZUA 4KO9A 2MTAA 1A65A 4UAHA 5B7EA 1AZBA 3X1NA 5I6LA 1FA4A 1JZFA 2EIJB 4E9TA 2ZWNA 1AS6A 3ASOB 1J5CA 2YAHA 3N2JA 2YAMA 1XB6A 5B1BB 1MG3C 1NWPA 2AVFA 2PLTA 2IDQA 3FU7B 4DP7X 3WNJA 1ILSA 1BXAA 4BDVA 3CDZA 2FT6A 1WS8A 1PZCA 3IN2A 2XX0A 4JHUA 4W1TA 3OMAB 2VSKB 4CSPA 2BHFA 2XXGA 3FU8A 3NJJA 1CYXA 1BYOA 1SHWA 4DP9X 4GYBA 1GS7A 2PCYA 5AKRA 1OOWA 2HRGA 5TK2A 1SF5A 5I5MA 5D4HA 1ASPA 2VN3A 1TEFA 1OE2A 1JXFA 4NAJA 3NJIA 1PAZA 1OV8A 1SDDB 2AZAA 2IAAC 2CJ3A 2GBAA 6PCYA 1BQRA 1OE1A 5A7EA 2IDTA 2RACA 3WIAA 1AG6A 5I5IA 2IH9A 1SHXA 5B1JC 2UXTA 3FQ1A 4DP5X 1SNRA 3WKPA 3U25A 2Q5BA 3FYEB 2EIKB 1OF0A 3ABKB 3AG2B 3L45A 1CURA 1MZYA 4PCYA 2H3XC 1MDAA 1NIFA 2WO3B 5E9NA 4A66A 1GYCA 5TK4A 2OV0A 1IKOP 1KV7A 4F2EA 2GB2A 1ASQA 5B7MA 2Y69B 5B1KA 4GY4A 1NWOA 2WO2B 4G7RB 1W6LA 4GP5B 5D4JA 4P5SA 1ET5A 3PPSA 3KW7A 4Q8BA 3T6VA 3NJLA 2PPAA 1BXVA 4TXVB 1AS7A 3C75A 1OCCB 2IWFA 1E65A 2EILB 4F7KA 1PNCA 4KNTA 4YVNA 4A2FA 3NJKA 4YSRA 1SF3A 2BW5A 1OE3A 3NJNA 4GP4B 3AY2A 4YSUA 4HHWA 2YXVA 5B1AB 3UAAA 2CBPA 4UANA 2X88A 2YXWA 1AZNA 1BQ5A 3GXUB 4E9RA 1JZIA 2DYRB 4HIPA 3QJRB 3MBWB 4PAZA 1PMYA 1JERA 1NZRA 3H4HA 2CALA 3NSFA 4P5RA 1OCOB 2DWSA 2MRYA 4GXFA 3AG4B 3DTUB 4A68A 2BP8B 1ZDSA 4KOCA 3PAUA 1PF3A 4E9YA 3FSWA 3T6XA 4G7QB 3X2QB 2NRDA 1AZRA 2VW6A 8PAZA 1YLBB 2UX7A 4HALA 2JXMA 1BYPA 5I6OA 4G70B 1TEGA 2VW4A 4E9XA 3NJGA 4E9SA 1V54B 4KO7A 2H47C 1RCYA 2P80A 3TU6A 3S3BB 2HXAA 2BZ7A 5ANHA 4DP0X 1A4CA 2J56A 2FQGA 3T9WA 2IDSA 1AG0A 2TSAA 2BP0B 4N4YB 3FU7A 1NICA 1ASOA 4M4RB 9PCYA 2XV2A 3TBCA 4DP6X 2Y1AA 2JFCA 4G7SB 3FYIB 3FU9A 1ET8A 4AI7A 1PCSA 3FSZA 1I53A 1JZEA 3BVDB 2PPFA 2XYBA 3WI9A 1EZLA 1AS8A 1NIDA 1GW0A 4BK5C 1E30A 2PPEA 2Q9OA 1CUOA 1QLEB 1FWXA 1AR1B 1ZV2A 1BEXA 1JVLA 1KGYE 1KBVA 1WA0X 1M56B 1KCBA 3X1BA 2AFNA 2GC7C 3H4FA 4AKQA 4NB7A 3FQ2A 4HCIA 4YSTA 4F2FA 1PLAA 1MZZA 2VM4A 1E5YA 2R7EB 3UAEA 3PCYA 3WNIA 2QDVA 3MX0B 2LLNA 4YSSA 4KNUA 3AW5A 1BAWA 1A4BA 2XLLA 2I85A 1GSKA 2FJSA 2FT8A 2XV0A 1JZGA 3V9CA 1B3IA 3CZUB 4DP1X 1N70A 4YSOA 3ZBMA 5I6NA 1PLCA 1PZAA 1V10A 2CUAA 2QT6A 2W8CA 1GR7A 3NP3A 1EHKB 4YSQA 1ET7A 3S8FB 2XXFA 1ETJA 1WS7A 3G5WA 5EHFA 3T6WA 2FT7A 2QPDB 4BDVB 1XMEB 2QDWA 3CDZB 4BXVA 4AX3A 2UXGA 1AQ8A 2BWIA 5I6PA 1ID2A 2J55A 2BO0A 1W8EA 3ABLB 3FS9A 1L9PA 4JKNA 1HFUA 2YAOA 1MG2C 3ABGA 2VSMB 2CAKA 3ZIYA 4BWUA 4X4KA 2DYSB 4E9VA 5AFAA 1SJMA 3QJVB 3JTBA 2HX9A 1NINA 3TASA 1WA1X 1OCZB 4BWTA 4DP4X 4ENZA 2J5WA 1RZQA 2B3IA 3FPYA 5PAZA 1JXGA 5AZUA 3AG3B 3IE9A 3ABMB 4N8UA 2ZONA 4E9QA 2GIMA
chains in the Genus database with same CATH superfamily
4YEEA 4IGBA 1MCWM 2XPYA 5G2NA 3N44F 2P5WE 5IB4B 2IDUA 3OC5A 5GGSB 5L2KB 4EKJA 1ADWA 4RGMC 2YD9A 3DGGA 5HI4C 2DL2A 1A7PL 4S1QL 4I18C 3TGXA 1RZIB 3T8VA 3CPLB 5TDOB 1P4BL 1KCVL 2NQDA 4X4YB 4M4RA 1F8TL 4R3SA 2ZOLA 3NPSB 2Q1EA 1OGAB 2EZ0C 4PJEF 5EA0L 1EAOA 1QSFD 1VPOH 3MV7D 2H4EA 4FHJA 5SWZA 2Q7YB 3UGUA 4LPYA 3OKKB 1TZGL 1MAMH 2C3VA 2VERN 1FYHB 3T4AB 4PV8A 3F58L 2EDHA 2RTTA 3U9UB 3PNWB 1GC1C 1T5KA 3DX8B 5I17B 4GKNA 2IAMB 3QWQB 3U0PB 3ZKMD 1BLNB 1E4WL 3HI6H 4NO0D 4DFIA 4NNPH 1Z9SA 3I9IA 4H0LC 1UEYA 3MLYH 4M3JA 4Z78B 3ULVH 2P5WA 1CFSA 1DJXA 3EF4A 1MQKL 3GRWL 1L5GA 3IDNB 4OLUL 2FTAA 2XN9B 5I0YA 5F7AA 1MLBB 1N64L 2PCFA 1QYGH 1JL8A 4M93C 1RU9H 4JBSA 3PXJA 1I85C 4O5LH 1F1DA 1GIGL 2IFGA 1NC2B 4JDTH 1UZ6F 2VC2B 2P5EE 2Z35B 2R2BB 2ZUWA 4UQBA 3UGEA 1CG9B 5ICZB 3ZRCC 4Q6YA 3LS5L 4AGNA 3SODB 3CDCA 1U91A 1NFIA 1ZS8B 2VDMB 3IJHB 3SQOL 1SQ2N 3CWGA 1IARB 5JLZA 2IADB 4AXWB 1NUFA 2E0PA 3MXWH 3P11H 5DFTA 3OXSB 4L8SA 3CSPA 3HMWH 5TE6H 4HCGA 4CDHA 1TMQA 2E47A 4N6RB 4ZXBA 4Y88A 1OAXL 1ZT1A 2VMJA 2I9TB 4F27A 4I3RH 4Y89A 1H8NA 2VISA 1HH6A 4W70A 5ESVB 3UGXA 1ITBB 4XRCA 2OMXB 3KJ4B 2K78A 1AHWC 1KB3A 3BC9A 3ASNB 4Z7VE 4Z7WE 2R69A 1JTOA 1G1YA 1WZ1H 4PB0L 4K7FA 4ONGL 4NQVB 4PB9H 1R5WA 2BNUB 2DZEA 4PY7B 4BUGA 2EICA 1L9QA 2XV3A 5JUEH 1ETZA 2P5EA 2BVQB 3LPGA 3CE1A 4LAJH 5KSBE 1AGBB 1GZHA 4JM0A 2YC1B 4I18B 5EEYA 4YHPA 4ICXA 2NR6C 4Y2DC 3KGTA 4H8WC 4IKNA 4O02B 5FYJD 3G6JE 4LCWD 3S6CA 1V7MH 3QISA 3DV6A 5MERA 1TT6A 4Z95L 3CSBA 4BZ1A 5E1AA 1EFXB 1A7RL 3B9KC 3D33A 5F1KC 4AK1A 5JIHA 5GISH 2VRQA 2COVD 3L08A 2WN2A 3KPRB 4HK0A 3GJFB 4UF7C 1CVSC 2UUDH 3K6SB 4K7PH 1DQKA 1PSKH 5J56B 1XZWA 4FXTA 1EAQA 1OCRB 3I74A 4I89A 4Z7VA 3EUDA 4KHXL 2CIKA 2B1HL 4G6JH 1KN4H 4Z7WA 4AQ8A 3NG5A 2IOIA 1LO3H 4PQXA 3VXNA 4XC3L 4JFXB 4FG6C 1QR4A 4R4BA 2VITA 3IJ7A 3S7GA 5KSBA 1ZSDA 4Z3IA 4YH6A 3QYCA 4DK6A 5IMOB 3G6JA 4QXUH 3LRSA 3Q2LA 4XVJH 3STLA 2MOVA 2WWKT 3GLAA 4JY6B 3EYQD 4ZODA 4Z77A 1Z9LA 5ABDE 1CU4L 1R0AL 5HI3C 1ACXA 1DZ0A 3NTCH 3AC0A 2W38A 3LYRA 4ANVA 3GB7A 3DX6B 2KZ1B 3IEAA 4PJBF 1MXGA 5CCGE 4XN8A 4ABUA 2HKFH 2KLTA 3UDWA 4AMKL 1GYWA 2ZSWB 1QFPA 3MRJA 3NSYA 3MRKA 4B9ZA 3FSAA 2IG2L 3UROR 3MRCA 1F4AA 5BXFA 1UWEH 3OKYA 2XA8H 4L8DA 1EAPB 3VFTA 2NMSA 1AHWB 4NPYA 5ETUA 4NT6B 1XIWC 4M62H 3K2MC 5G5DB 3V6OC 4DAGH 1L3WA 1BVKA 1RIUL 4K9JA 1SEBA 2C3GA 3I6LD 1IGML 5CJQH 1IVLA 2YAPA 3LZPA 5EULV 4BA0A 2BSSB 3FO1B 4K8RC 2CPCA 2TAAA 3HN3A 1VGEL 4UU9A 2ZUQC 5FGBC 1QUNA 3GJEB 5HHOE 2UVEA 3HI1B 3P9MB 4XHJC 3FQ4A 4BFEA 4Y2DB 4H0HB 2WBWB 4G8EA 2ZWKA 4DK5A 1Q0EA 1LEIB 4FLQA 2NXYD 3ZL4H 3GZPA 1CXHA 1JHTB 2JK5A 3MA9H 4ZX3A 5DQDH 3C8DA 1J7VR 2F19H 2OMUA 4U2YA 4KTDH 4ZFFB 1FJ1A 3B9KB 2Z31B 2VAJA 5E8NB 3VGHA 5I9QC 4S1RL 4MZIA 1KBGL 4OLWH 2QKIA 5C0DB 4NZRH 4P4KB 2FUTA 2Z0BA 2A9BA 2WQXA 2NQ3A 1T04B 4PGEA 4XAKE 3FT2B 3FF8A 5EOQH 5T8IA 1AKJB 5LJYH 2DQIH 4N0UE 3RGVA 4KKRA 1SPDA 1NFDF 1LO5A 4U1HB 5E94A 1ZTXL 1MIMH 2V9QA 5GZND 4DP9X 3UO1H 2YPLB 3QXAB 4O58H 3WELA 5HHOA 4BFKA 1CLZL 4QHMA 4PJHE 1SF5A 3HUJB 5BOJA 2WXIA 5AUMB 2Q2EB 3NIFE 4HD9A 2EC8A 2EDWA 2F74A 3S5LG 2Z65C 3QQNA 1EO5A 1ES0B 3D08A 3TWYA 3JWDC 1XSJA 1MCFA 1CFNB 4GMTL 2AXFA 3O3EA 1YEEL 3Q9QA 2BFVH 5E6IC 3ZE1B 3BUBA 1B0GA 2X70B 5HYEA 1BQRA 1LHZA 1KGWA 5I1EL 1BPLB 4W9DC 4JM2A 3MJGX 4QOKE 3BOVA 4N8VG 2IH9A 3L6FA 5C0ND 3FAXA 3O6ML 3QJXA 4OCNC 5KSAA 5HGAA 3O6KL 5FHAH 2P43B 4R4FH 2WVTA 4N0UA 5J1TC 5INCA 3F7YA 1HWWA 1TITA 2H3XC 1OAYL 4EVNB 4RMBA 3OSKA 1ESOA 5K1NA 1QPKA 3M17A 4HJGA 1RURH 5TDNA 3A67H 4XMPH 1OWRM 1J5OL 4DPRA 3PDOA 1YAZA 4PJHA 5F96L 3GBEA 3VXQB 1XIWB 3C8HA 5GPRA 1HHHB 4PB0H 4MRCA 4V2BA 4ZQKB 2OSWA 1HCFX 2Y1VA 4WU7B 3RPIA 5K9KB 3FFCE 1R3JA 2ZUQB 1OAQH 1KWGA 1G5GA 3UTQA 4Z7NF 3BRGC 1WEJL 3UIYA 2LOEA 3CSYA 2VZTA 4PJIE 1EANA 2O72A 3LIUA 4KNTA 5J3HD 4QOKA 1QNZH 2WINB 2NTSP 4GP4B 1J1OL 1MJUL 2FLMA 4XNUL 2DAVA 1A1MA 4G9FD 5C0CE 5KSVB 1H3PL 1KLGB 4L1TA 4PLKD 4X9HA 2WVVB 1FZKA 5I9QB 3QJRB 4BKTC 3NSFA 4Q9QH 3MFFB 5HSFA 1U8MB 3RWDB 2O6PA 1WPCA 2ZX9A 2YD3A 4Q9BA 2D7TH 4R7XA 2NY6C 2BP8B 4LLQA 4PY8I 1IU1A 3WDIA 1U92A 4P5KB 1P7KB 2WYHA 4JNXA 3HPLA 1YNKL 4MKMA 2GUOB 5IHWA 3SDYH 1DJSA 1U6AL 4OIIH 1WCBB 2D03L 2YS4A 2WBJD 3WJJC 4OLVH 4IGBB 4M7KL 3FFCA 1OP5K 3E3QE 4JFSA 1OD9A 3PHQA 2WWMC 4PLJD 1DUZA 2YRLA 4J3OF 2KUTA 3WNLA 4PJIA 2XWCA 4XVSH 5BQDA 2K4WA 4PJ7E 3UIZA 1ADQL 2F15A 2WB7A 5SV4A 1WTGT 5C0CA 2HVJA 3Q6GH 3VFVA 4M4RB 3DVGA 1EV2E 1C08B 2ZOLB 4MDIA 5SWZB 2VQTA 4LT7A 2XKNA 1GMIA 3ECBA 4AWJC 1NM9A 3WS6C 1J1XH 4D7PA 4A7GF 2C3VB 3FU9A 4AI7A 1HDMA 2BRQA 4R90L 2CCLA 1IEHA 1JCKA 3BKJH 1TTCA 3WKYA 5KVEH 4G6AD 1V05A 3DOSA 5CLTA 4FFWC 4U6VL 3EYUH 3D30A 4DHLA 4LLMB 5E4EC 1DANU 1EGJH 4EBQH 1CFSB 4OIFA 2HA1A 1BEXA 3EOYG 1UXWA 2D73A 1JGVH 3BAIA 3F65A 4PJ7A 1F3JB 1P7HL 2J8UF 3RDJA 1UM5H 4ZFZB 4P05A 3VB8A 1E5YA 2IALB 2FX9L 3WFCL 3WNIA 4XCCH 1H3UA 4JFHE 3AAZA 3C08L 5E8OB 3MBEA 4I4WA 2I26N 4N2GA 3RJDA 4XZUB 1U3HA 4QTFA 4BZ2L 3ZBMA 5I6NA 2GJ6B 3LKQA 4YN3A 4FXGC 1A7QH 5ID0B 1KIQB 4ODTL 3ARDC 4ZW6A 1WS7A 4ZXBB 3WO4B 2NY6B 2CE6A 3F12B 3QUZC 4FF9A 2WGNB 1P84J 1VCAA 5IB2A 1C5CL 1TTAA 5DEGA 3R8QA 2WV3A 3TBSA 2F1BA 3DX2A 5IMLB 3C8KA 2BIPA 3MNZA 4NI6A 1EJ6A 3FO2A 2AEQH 4B0MB 1M6UA 2XRAL 5T5FA 1ETZB 1IGYA 1CFBA 2P5EB 3HFMH 3MJ8A 3MOBL 1FL5B 4GQQA 4NQQA 1BZ7B 1NINA 4YHPB 4DP4X 1WA1X 2XXMB 5DZLA 2X4OA 4EQ2A 1PX8A 3IDJA 2X44D 1RZQA 4OZ4A 1OT1A 1JXGA 2KDGA 4RNRA 3CFQA 3IE9A 2IBBA 1D5MA 2VXUH 3QIUC 1BDYA 3DV6B 2R0KL 3MGTA 5MERB 3ETSA 1CGTA 3BUYB 1U2CA 2QMKA 4IRJD 5JQHC 1F1GA 3KL5A 3NOIA 4B9CA 5FFGA 3JBG7 3WV0A 2IVFC 2PF6A 3GSUA 3P3TA 5D72L 1Q0YL 1YEJL 2EJ1A 2HJFB 2KYIA 4IS6A 3ECWA 1F86A 3QZNA 3D2UD 3QNZA 4X9FA 3X1FA 3NK3A 2XQYG 5E4EB 1E4XH 3DETD 2W0FA 5KYXA 2K9UA 3GXNA 3QJFA 2EUVA 3IPFA 1L6PA 2G5RA 5HTSA 3FQYA 3GMNA 3U1PA 5E95B 3RNQB 2H1PH 4PR5A 1T03L 1T1WA 1YDPA 1JVKA 4FDWA 1BEYL 3HC4H 1BIIA 1YJDH 2HX8A 4ZS6D 4WCYH 1ZSDB 3LNIA 1N19A 4KVNL 3W0WE 3ARTA 4K7PX 1EUTA 4H1LH 4BM7A 3PP4L 2R56H 3K2UH 3LHPH 3STLB 4HWEH 1S8DB 3CFCL 3MZGB 4UUJB 5FECB 5KVDH 5DQJA 1L9MA 2VUOA 1U3JA 1T1ZA 2N7AA 3FTWA 3UBXI 2AQ1A 5T3ZE 5IWLA 5DJ2A 2P52A 3VSVA 1PZBA 4AQEA 2VLKE 3L2MA 1ONQA 3HC0A 3CN0A 5GS1A 4LVEA 4FXGB 1WFMA 3TLRA 3FB5A 4XMUA 4X6EB 2KLSA 2D31B 1RERA 4Z8FH 2C3WA 3ARDB 2QBWA 4DPAX 1RULL 1NUGA 2IAMD 1BF2A 3QUZB 3MRCB 3TJHD 3BUIA 3MRFA 2XWTA 1X9UA 1GGIL 5A3IC 4KXZH 4LU5L 1MOEA 2D03H 5ETUB 3W0WA 4YSCA 4OLZL 1KCKA 1D6VL 2WUBL 3EJQA 1BVKB 3P30L 4FNPA 3ZT6A 1I7RA 4H25A 2VCOA 3TO4A 2XPGB 5MI0C 3LY6A 4FTVB 3BP5B 2OPCA 3TC9A 1DVXA 1QUNB 1NC2D 1TZ8A 2YUXA 1PEWA 4KTEL 2X4TA 3O6FA 5HHVH 4WVRA 3TCLA 5KVGE 3II1A 1CXKA 3PGFL 4RDBA 4M8RA 4FKKA 1AOZA 1DJHA 2VLKA 4UI2A 1QA9A 3BKML 2IDFA 5F0PB 5TQ0H 4QT5A 4G72B 3QIUB 1DP0A 2JK5B 1X7SA 2GI7A 3G5YA 3QUKA 4XMKH 3JWNC 2XWJB 3IKCA 3NESA 2OMUB 3CQPA 3KYOA 4NZUL 3MNDA 1EEUA 3QC6X 5KBPA 2X1WL 3QR2A 4BV1A 3QNYB 3K4ZA 4KFZC 2ZKHH 3C9NB 3OHXC 4JHAL 3UZQA 2F8OA 1VA9A 4PGEB 2LGNA 1G1CA 3BD3A 1Z7JA 1RUML 4TQ8A 1KIUB 2P5PA 4OJDH 3D25B 1ANUA 3FB8A 5F6HI 4Z5RA 3GMPA 5KBKA 4P3CH 3EO9H 4FQJL 4KMTH 1A14H 4QHMB 1CFQA 5CJXA 4ERSL 5FR3A 4ISVA 5IEKA 5JW3H 1THCA 1UZ8A 4JHVA 5HI4D 3LXCA 2F74B 4KKPA 1BG9A 3OD3A 1HILA 3QQ3B 3PLYA 3VE0A 5F0JB 4GUPA 2VAAA 1H3VA 5DRWB 5JORB 4W6YB 4JQVA 2V8LA 4JDVA 2CO6A 2NY2B 4Z7VF 4ZYKA 4IHOA 3B7TA 5MP6L 1SLWA 4JM2B 4YZFE 5AVTB 1MNUL 3TVMC 4Z7WF 3TCXA 1JMXA 3I75A 1GZPB 4NHUA 1WBXA 2BY3A 1EHNA 4AKPA 1E50A 3MVSA 2XWZA 2Q86B 5KSBF 5C09B 2VR7A 1C12B 4ODBD 2Y4SA 4WUKL 1J9RA 3PIQB 2YSSA 4ODWA 1KOAA 3G6JF 3EBGA 1A0QL 1GOFA 1MLCB 2D9CA 4HJGB 4WHCA 5TDNB 4DT2A 3NDYE 3GYRA 1HN1A 1Y6MR 3MNWB 1MFVA 4R96A 1ZDQA 3VX0A 4NO2B 2B0SL 1E3XA 1U33A 3EJPA 2WAQA 3VUAA 4AT6B 1BM3H 4NIYE 2MSPA 4X0NA 5MI0B 1OGTA 2Q6WB 1DQVA 1YYML 4K23H 1GZQB 3UTQB 1N68A 4KY2A 1LQBC 1EIBA 1IZJA 1KSRA 5GHWL 4YWGL 3QQ4A 4OCMC 3SDAA 4P5MA 1SYSB 4MCYB 1IFRA 4YGVB 1U3ZA 4DGWC 3ZIMA 4WI9A 3L17A 5IVXA 4YFLF 3N5AA 2F8VA 1AFVL 1AD0A 2O5XH 5BVPL 2V9UA 1WWAX 3EJTA 2WP3O 3OHXB 1M05B 3FQXA 4N20A 3T2LA 2DLTA 2HLFC 4KQ3H 4L23A 1HEJC 3MLUL 1I4FA 3HPLB 1CF1A 4GB9A 4D2NA 5IFAL 3S2CA 4HOMA 1N5AA 1HEZA 1DQTA 3QGVA 3CTTA 4N2EA 5T1LB 3FFCB 4N2CA 1YEDB 3H9HA 4UAHA 3EDFA 5L9DH 1FORH 3C60A 5HYJB 2ZWNA 3I6KA 1M4KA 4P46C 2OQJA 4ANWA 3GSWB 5KZCD 1E7UA 5C0AB 1MFUA 1RMFL 2AVFA 3L16A 3SPCA 3T3PB 2GABA 3KXFE 2NR6D 4Y2DD 3BO8A 4E9LA 3TT3H 3V4PL 1OT4A 4JFPA 5C0CB 1X5GA 2VXSH 3SKJH 4F8QA 3IDMB 4RX4D 3SE9H 2A7BA 3VXRE 1JXKA 3HA0A 1YEGL 4K5LA 2FT6A 3ULVC 4W9JC 2NW3A 3CX5K 3TVMB 3A24A 4GKZB 1G6RH 3B9KD 1NCGA 3ZMNA 4BKLA 5I24A 1RJLA 3D2TA 3IETA 3K4DA 1E4XI 1A6ZB 3TBVA 4PN6A 4CRPA 5D4HA 1ASPA 2C9PA 2JI1A 3ZZSA 3VFPA 3B7YA 3OXRA 1AKJD 3U4EA 3OX8A 5TE7H 4DUXA 2Z64C 5HY9A 3VQ2C 3W9DA 2UZYA 1DSYA 4HLZH 2FZ3B 3DO4A 4FG6D 2RACA 3TTSA 3QQ9C 2C9RA 1DE4B 2E8YA 3V0AC 3SD5A 3KXFA 2GJRA 4I9WD 2E7DA 1JF1A 4M7JL 5IR1A 3LDBC 2OTWB 4OGQC 2QPUA 3QUYC 1JGDB 4IMLA 3VXRA 4MJHA 4R84A 3AAZB 1CURA 4FZEH 2ZXAA 5HI3D 2AQPA 2GTWB 4RRPG 3ETBJ 3VXTA 2W92A 1GYCA 3Q3GB 1X5ZA 3M1CA 5L2JA 1KTBA 3MRHA 4FMFA 5DK0B 3HE7A 3PAYA 3LKQB 2EDYA 4PJHF 3T0EE 2E6JA 1N3NB 3EOTL 3NIFF 5IP4A 2A1WH 1I9EA 4G7RB 4PSRA 2WOYA 3N43B 3TPUA 4LRNH 2XYCA 4OFDA 1AS7A 1AH1A 2CK0L 3DX0A 1FQ9C 4GI6A 5DEGB 2IBZY 4PJFE 1CFVH 1KPUA 2WQVA 4YSRA 5CNHA 5GRJL 2BW5A 3O3AB 3UAAA 2WLMA 2GJJA 5DJ0A 2ZCLL 1MCQA 4NLHA 4P3DA 2FD6L 3GXUB 4P46B 5JW5A 3MJ8B 4K8RD 5E7FA 5DJZB 1ZVSB 4HIPA 5K93A 3MBWB 1JNLH 4XHJD 1X5YA 2X4OB 5DYOA 4C55A 2MRYA 1AYOA 3EUUA 3OZ9L 2ZP8A 4XBGB 2VXTH 4KOCA 4MQ7A 4Q7DA 4UILL 5DVKA 2EVIA 2DQHH 1CLOH 3T0EA 2QKSA 3O2DA 4LOVA 2G0KA 3DX9A 3EJUA 2JXMA 4LLUA 4AZ8A 5AVSB 1NA8A 2H9GA 2VSDA 3ZHDA 1KTCA 1TEGA 3ALPA 4YEFA 3MJ7B 4KMLB 3HMXL 4LPUA 4PJFA 1ZTXE 1ZA6A 3MMEB 4G2AA 4HIXH 4M61A 4ODSH 3IDXH 3MJWA 1L9NA 1O7DC 4PJIF 9CGTA 5F7UA 1A0QH 1FRGL 4D8PB 2CSPA 4YDVA 2P8LB 2E9IA 4B3VA 2TSAA 3QJFB 3D4ZA 4PYHA 1JK8B 4HVBA 2AKRB 3BWSA 3OKDA 5EU7C 3B37A 5KBLA 1QHOA 1YAIA 3U82B 2WB1A 9PCYA 1T1WB 3WXWH 1E7VA 3DOIA 3NVQA 1QQDB 5DS8B 2VUKA 4BK8A 1X5IA 3R7QA 4LSUL 1LNUA 5LO7A 4TVPD 3LDBB 3C6LC 2X4RA 1AGCA 2ZXEB 3QUYB 4W93A 3KBEA 4MZRA 3SPVA 3WIIH 4XMLH 5AZ2L 5DQJB 1DEDA 5FA3B 5GIRA 3AU0A 3QEQB 4CVXA 5A2FA 1DQLL 3LKOA 5GHWH 4YWGH 1DBBH 2J6WA 4KPHL 5E6ID 3S3PA 1MRCL 3O2WH 1EMTH 4PRDB 3J8F7 4XI5C 3B83A 3RZCA 1ZLUK 3RY6A 5IMKB 2R23B 2WXMA 7FABH 4ZMXA 5BMFL 3ZW3A 5J11C 3M86A 5FM8A 2WJ7A 2O5ZL 2AFNA 2RAMA 3KBPA 4PJ7F 2CA4A 1BWMA 4LP5A 3FUJA 5KVFH 4KVPA 2Y06L 3GPEA 1CS6A 1KTJA 3P3SA 1CR9L 2JJSC 4FI7A 3ZHNA 5AG8A 3BUPA 3P0VH 1VFAB 4HIEA 4K94L 3BZFA 4N25A 4XC1H 3JVGA 2CUHA 4LVNC 4QD2E 4N2NA 1O75A 4XXWA 2OMZB 2WSKA 4YSOA 1PYWA 3QRGL 3TO4B 4Z3EA 3RNKA 3PU7A 2W8CA 4MJ6A 2BRRL 3MLSH 5DHVH 3S97C 5IBUG 4YSQA 4YHOL 2NW2B 1X7QA 4BQ6A 1EEZA 4JG5A 3SDXE 4LBAA 2ICEA 2VLKB 2K8QA 4CGUB 4GQPH 1AGEA 4QT5B 1B9KA 1C8PA 4ONFH 4AH2B 4D0DB 5DWUL 1A6WL 3CK0L 5F7KC 2GJ6D 3FS9A 1TLKA 1H0DB 4ZMZA 1N67A 2VWEE 2VLMD 2DQEL 5BOPA 3ABGA 1U8CA 4I87A 1YUKB 3CFBA 1JWSB 3ZLQC 2NY6D 2EC9T 5F72S 2APBA 1G7HA 1JZ8A 4X8JB 1P5VA 3QW9A 1K8DA 3MFGB 2OW6A 1KBPA 3QXVA 3HHSB 5ADOH 4ELDA 1I9JL 3FB8B 4RMVA 3ZR5A 4G42B 5AYUH 5TQ2H 3U36B 3X3FH 2WWMD 4MXWL 5IREA 3U0TA 4Q89A 4PBWD 5IEKB 2DJSA 1UZ8B 3SDXA 2APTA 3CFIC 2CDGB 2HFTA 4GXVH 4IEFB 1XZ0B 3C6LB 3FB7B 1P0SE 1BF8A 5EU5B 4JM4H 2Q87A 3TBYA 3W81A 2ZOUA 1TZHA 1IC4L 3MLVH 5FDYA 3UJJL 3IJEA 1L7TL 4R97C 1V55B 5SX4I 2CO2A 4F15C 3LZLA 4NFCA 4WEBH 5EBGA 3NIGE 5I19L 3I75B 4F33A 7PAZA 1B4TA 4HT1L 1C1EH 1AXSB 4P23C 4GQ9H 4DZBA 3DVIA 1L0PA 5I0ZA 1ZLSH 1WFUA 2NY3C 2VQUA 2FBJH 3ZTNH 4OZIB 2AQ3A 7TAAA 1FHGA 4FFWD 5C7XL 1ZHLA 3QNXB 4N26A 3SYCA 4HU8A 3SGJC 1ADQA 4JY4B 4N5EC 2AJUL 4F2MB 5I1JH 3DGCR 1T83A 2IFFL 1V5JA 3UP1A 1K85A 5F9WB 5C8JA 1HXKA 3LKNA 3U0WL 5AVXB 4LIQE 4RA0C 3TT1H 4LVNB 5T3XH 2YK1H 1TENA 3MQIA 4X99A 4XMXA 3V55A 1NSNH 1OGTB 1LD9A 4LEXH 4OD3H 3TF7C 4IOSD 2D0GA 4TNFA 4FFYH 2O30A 2YEZA 1IUZA 3H56A 4BEIA 4MRBA 4G71B 3K2IA 3MR9A 5DR5H 2R0WH 3PP3H 4PJGE 4YK4C 3TO2A 3IAGC 2F5BL 1KJMB 3P4NB 4KI5C 3UTTE 3MC0A 4I77L 3WTXA 1SDDA 1WIPA 1I31A 5EF0A 1JZ2A 1AD0B 1I8KA 3DXAE 3ARDD 1R47A 3QORA 5EC2B 4L4VE 1WTLA 2R1XA 3BQVA 2D8KA 4ODXB 3QUZD 4PJCE 4EKXA 3DUUA 5H37A 3BVTA 4MXVE 4UT7H 4ZDHA 5ESAA 4RIRA 1OAKL 8FABA 1AC0A 1PKOA 3EYOA 3KPMA 3IDYC 4XP1L 4G7YH 1HEZB 1CGWA 5FW6A 5HPMA 3L3DB 5FKPA 2Y1YA 4HZ1A 3R8BB 5I28A 2H0PA 5EB9A 3DHMA 5A2LH 3UADA 4GRMB 4OCYL 5FS5A 3C60B 4FA7B 2R2EA 4BZ2A 4FTVD 5E08L 4FC3E 4H88L 4LSUH 5FYKD 3CFJA 3LV3A 2UY6B 3QZWG 5IB5A 5F3HB 1A4KB 5E5RB 5EOTB 4FADA 4PJGA 2E86A 4NKOB 3MUY1 5A16A 3UTPD 1SQMA 2ETWA 3UTTA 3CPUA 5DMYA 1S5HB 2B59B 1GYVA 3CC1A 3QIUD 3P2TA 4R97B 3ABZA 4Q4EA 4D3CH 4ZTOL 4F15B 2NW3B 3DXAA 3VG9C 1UA6H 1XGPA 2H26B 2BSDA 4K2UL 1BQHB 1WBYB 5FC9A 3X12A 4M5ZH 5F9OH 4FTDA 1B6UA 2P7TA 4EUPG 5B8CA 4P23B 4PJCA 3QZOA 1MRDH 3P4MB 5I8CB 1J9SA 5SV3A 3W39A 5ICXB 1OHQA 4BSWA 2FX7H 4LASH 3VFPB 2DN7A 2X1OA 1SGKA 2WPGA 5MEPB 3L7EA 1OGPA 1SRDA 2J57A 4KUCF 1XB3A 4JFZL 3V4UH 3DVNB 1ZEAH 1UB5B 3QWRA 4FI6A 3GMMA 3CMOH 3DBXA 4PRAB 5EG6C 3W9DB 4P07A 1EHAA 4LF3B 5LXGH 1BX2A 1JK9A 3DRQA 1DDTA 1P2CA 1RK7A 4B9KC 2V0AA 3KXFB 1JF1B 1I7ZB 2A3TA 4J12A 1NDTA 1J5HA 2JVUA 3VXRB 4A2DA 3QJSB 1SOQA 5K59E 1EJOL 5JW4Q 4F1SA 1JPSH 4UM9A 1TCRA 3MRHB 2X53A 1FNHA 1BBDH 1U30A 5E6UB 3FQUB 3O4LE 3T77A 5FO8A 1HZHH 1O6SB 1NCDH 2FSEA 3QG6B 4WI6A 3BAWA 2OJZL 5C09D 1TIUA 3IN0A 4LCYA 3PAZA 5B1JA 4B41A 1HHJA 2QGDA 3WSQH 3PHAA 5AOMA 3M8OL 2W5PA 3TYFA 4HJIA 5A3ID 3JV5A 3IDYB 5I74C 2RHEA 1S7XA 3N91A 1DSFL 1U41A 5ITBL 1MCBA 1BOYA 4JCMA 3GBML 4E9WA 3KPOA 5DUMH 1TO4A 2NYYC 4P3DB 3CN1A 3K0YA 3S3CB 3S4SA 3QI9A 5C08E 1RLWA 4K9EL 3U79A 3AMKA 5IVXF 3EJJX 3RVUC 3B43A 4G8GB 3QCVH 1UH2A 1W0VB 2ADFL 2XETA 3CVIH 4XN5A 5F7EL 5DRZA 3RURA 4IU2A 4KXCA 3NP4A 3O4LA 2OCCB 4MQ7B 1F3DH 1MIEH 2ED6A 3ULUL 4JFQB 5ENWB 1P4LB 2WZ5A 4XNBA 4GUQA 4PJ9A 3VG9B 1IKFH 1HXMB 5I1KH 4LLUB 3GSXB 2VDNL 1QTPA 4YDZA 4C59B 5I6XC 5FAAA 2D4FA 4XNXL 1AGFB 1G9NH 5B7EA 4OKVA 1A65A 3TFBA 1AQKL 3QDAA 2MHAB 1YJDC 5AVRB 7CGTA 3INUH 4L05A 3ZDXE 1FA4A 4KC3B 1C16A 4RBPK 2GW5A 2BOLA 1E6OH 1ZMYA 3CLEH 1D7CA 5DVLA 2D9QB 4YDVB 3U1QA 5TJWK 2GSGA 5AZEL 1BZ8A 5T1LD 1IB5A 1ILSA 1Z9OA 4PJ8C 4RWYH 3EDKA 5C08A 2NNXA 1IGJB 5CJBA 2ZT9C 1DCEA 5HYJD 1C5BL 1NJ9B 4LOFA 3ZQ9A 5C0AD 3NSXA 3V6OA 4HWUA 3HVDA 5SWSE 3KVDD 4CVXB 5C9KA 3LKOB 5LWYH 4YHLH 5IHHA 1EXUA 3BJLA 4ZQTA 2BSTA 4MYPA 2YRBA 3F7RA 3TVMD 2ZUXA 3B9AA 3L3GB 3EBHA 1F58H 2Z0UA 3BN9C 1S7QA 3ML8A 3TCTA 4X5XA 3PV7A 3V4VH 4HUXB 5FFLA 3UC2A 3GGWB 4U1LA 4OT1L 2FATL 2R4RH 1ZXQA 1CDIA 5EFIA 4L37A 5I8KL 5FPIA 4NCC1 1WWWX 4H20H 3GPSA 3OLIA 4Y16A 4I1NB 3Q2VA 5I74B 1ZKAA 4FFVC 3F3HA 3BZFB 4A66A 3FHEA 2X6VA 2ZP9A 3VGAC 4HIJA 1HIML 3U9PH 5EF2A 1GA2A 4AYMC 3D50A 2G30A 1IQDA 4ZMVA 5SWSA 4FQ1L 4DW2H 4MJ6B 4BCXA 1J0ZA 2GEQA 4DOHE 1IGTA 2E27L 4KH9A 1W6LA 1VENA 5EZLB 2ZKYA 3EYFA 3OGCA 4JPWH 2A73A 3WCYA 5K9JL 1NEZB 3NZUA 4M6ML 1NAML 1OSPH 3HZYB 1KF9B 4A6YH 5B1CA 3BWZA 2QTVA 4YOKA 3ZR6A 4IYKA 5I6XB 2ZXGA 2JCCB 2OBGA 2D2OA 2YXVA 4HMDA 4P57A 1IQWH 4HPOH 2B2XL 1SEQH 3WTVA 3IVKA 1TU2B 4I9XA 3BLBA 3FUNA 4NO3A 5DGQA 2HLFD 3H4HA 1INQA 4OLYL 4Y8DC 2CRZA 1WHOA 2DQTH 5D1QE 4F7MA 3N85H 4PJ5B 2LHAA 4P06A 3PAUA 4PJ8B 3O8XA 4UQCA 4MA7L 5DD3H 1K4DA 3C2AH 3FF7A 5DHEA 5C0BB 2DQCH 2NRDA 1DN0A 1RJZA 4OY9A 1SJEB 2NUPB 4P46D 5E9DB 2J7LA 4XCNA 1RUPL 1EDHA 4XH2B 2ZX6A 4PW9A 3FJTA 1HTYA 3ILPA 4TNVF 3RWGB 4DKAA 4GAGH 5IQ9A 4WSJA 4JO2H 1IJ9A 4PJFF 5ANHA 3ATDA 3IJEB 4ZFOL 3PG2A 3T9WA 5I1CL 5IMMB 3ULVD 2CMRL 2F58L 3E6HA 3QT2A 2XN1A 4YAQB 3NCEB 4YR6A 4NENB 1Z6JT 1S9WB 2IMNA 1KJ3L 4WFGD 4Y9GA 3TH3T 3P73A 4HUNB 3E9TA 4C4UA 5D1QA 1CD1A 2E6QA 3D3VB 3DPDA 4XR8C 3KYMA 1AJ7H 2C26A 3OTTA 4XCYA 4XO4A 5MEOA 3C5JB 4FG0A 1OB1A 4LSPL 4RISL 3VO0A 1NOFA 4E41D 2WQUA 15C8H 2ESVE 1VFBB 2H6UA 4Y5XA 2B39A 3GSVA 3VGAB 1FFQA 2HJKB 3QQ9D 3L5IA 1G9HA 4GW5A 4X99B 3LEXB 4O9HH 3VXPB 5DJ6A 5IJDC 2JLLA 1FNSH 3QAZC 4FJYA 3WAKA 1KTKE 3QUYD 4TM9A 5F7EH 2Y72A 3FQ2A 3MOAH 3T0BA 3QEQD 4J3VA 3L48A 2XACC 3PL6C 1OP9A 1TDQA 2HVKB 1FN4B 2YD8A 2CWRA 4Y4HC 5FOJA 1QHPA 4OGZA 4GKSA 2XLLA 2G75B 1T5WA 2OSXA 4DEUA 3TJEH 3HKZA 3V9CA 4KZDL 1NC4A 4HXAH 1NDGB 3PRZA 3W5NA 4IRSA 4RQQA 2ZG1A 5FYJU 3NP3A 5BQ7A 4I1PA 4L4TB 2AK1H 2ESVA 5ESAB 1GCYA 4RIRB 3ILEA 3VFGH 8FABB 4HUVA 3EYOB 5I0WA 1UCBL 1UUSA 2VDQL 5HPMB 2DQFB 4ORGA 5FKPB 2GBUA 3AREA 2CM6A 4WEMB 2FE0A 4P2QD 1KZYA 1FZMA 1LO4H 3MRBB 4JFDD 3TX4A 1EVTC 2NY7L 35C8H 3PJNA 3CFJB 3CDYA 4ODVL 3LV3B 4CA4A 1QEWA 1GTNA 1Q1JH 2ZKMX 3KYKL 1D5ZB 5DJAA 4PJGB 4DO5A 1FFOB 3M7FB 1E27A 5A16B 4N2IA 2BFGA 2QJDA 4HWZB 1E90A 1Z9NA 4Y2OB 2VABB 4XOCA 1CXEA 3PE9A 4JG0H 2DYPA 3LTVA 1O6TA 2H8PB 3KJ6L 3KS0J 3L5WA 3X12B 3IJYB 4P2OA 1B9ZA 4L4VB 2QEJA 2P7TB 2WYIA 2WIMA 5FGCE 5CINH 3WTWA 1ZLVH 3TEYA 2BP5M 2XG4A 5GGSY 2YRZA 2V7NA 4GAFB 3DI3B 1XGQA 3SDXF 4BSWB 4Z7AA 3IB4A 3UCQA 1P9MA 2BIQA 5C0FB 5I8KH 1GJIA 1HI6A 3CHPA 4UIMA 3BEWB 3P2BA 4TSCH 4ZJ9A 3TA3C 4RFEB 5AVVB 1AACA 4NJ9H 1I9IH 5MEQA 4NI3A 3GKWL 1HOCB 4ELKB 1KWKA 2NOYA 1MWAH 4HJJH 1KCWA 3QAZB 5A6MA 5GRUH 3KZ8A 3C6LD 2CBOA 4LLAA 1X6NA 5IJKC 1PD6A 1QP1A 1S6NA 3HMXA 1U8QB 3ZL2A 2DJMA 2K3TA 4FFZH 4OGYL 3NEXA 3ARYA 1A3RH 3D18A 1J18A 4WGWB 3WKQA 2DQDH 4XI5D 2PYFA 4NQUA 5GS0H 3BWAB 4Y4HB 1G7MA 1Z3GL 4L3CA 5AOKA 1YEIL 4ETQA 4PUBH 5K9QG 1U8HB 1XSOA 1OZTG 4WNQA 3ZKQD 4AL8L 2X1PA 3C6EA 4OF0A 4MWFA 1BJMA 4TPRH 1JMZA 3C09C 1D9KC 4LCYB 1NL0H 4WWNA 2JQMA 1QI4A 2L7UA 2CIIA 3VXMD 5ADPL 2B08A 4A7UA 1BVZA 1PLGL 4MHHI 1MW1A 5FA4A 1EX0A 2KERA 3TEUA 3RVWC 1JOIA 4TOYL 1E4KA 2HB0A 4HV8A 1CT8A 1S7XB 1FE8H 3NIGF 3U1SH 2FH8A 5DUBA 1CI3M 2ZYIA 1I7TB 3KR3L 2BWDA 1NMAL 2PR4L 3SDDD 3QI9B 1N5YH 4YHKH 5CP3A 1HZKA 1W16A 4H26A 1PJWA 4QHKJ 2P49B 3IGFA 4FP8L 2ZJSL 3RWJB 2JWYA 1R33A 4KROB 4IU2B 4Z3TA 3HLAA 2F68X 5HGDA 4JB9H 5EN2B 4B9YA 1JYXA 4BXSV 1VJSA 5CGBA 2OMNA 1ZLWK 3WJLC 4OKVB 4JRXE 1ZD6A 2P47B 5BJTB 4HSQA 4WTWA 2D3VA 3QO0A 4Y4FC 3QWOB 2NSXA 3MRDB 2DWEA 4LGSB 5AW1B 3WEBA 3TA3B 4ZD3H 3EH2A 4GRWF 4PS4L 3PHSA 3WAJA 3MJ9L 1E28A 7PCYA 3FONA 3UTSB 1GY2A 4NEHB 1MRFL 4FQCL 2VJ8A 1UA3A 3CLFH 5JOPD 4Y19D 3ET9F 2NZIA 4PJCF 3HNSH 2ZXBA 4L48A 1OP3K 3TWCH 3FO9A 3UPCA 2CU9A 3LMJL 3ZUCA 2YFNA 3D9AL 2OJ1A 1RL1A 1I82A 1PDKA 2W95A 3EH4B 4P0DA 4OZGE 1UM6H 2K6ZA 4LEOB 1EVUA 1PZ3A 3ES6A 3NEEA 5IHUH 1BQLL 4JRXA 2RGSA 4JZNA 2Q7AA 1V3MA 2A9MH 5JMRA 4G6MH 4ZUWA 1AIFA 3LKPA 4P23D 1OARL 1BOGA 2ADGA 1RUQL 3T71A 2NY3D 1UYWL 1D9KB 1VADA 1YC8A 4DETA 4UV4L 2HSIA 1OQOA 2J6EH 2UXVA 4N5ED 4X7SL 1DQQA 2WQWA 4I5BB 4OTXH 4Y16B 5KYNA 3VSTA 4R7DA 2DLFH 2XFXA 1I8IB 2AQQA 3OJDA 4HIJB 3DJZA 5C0GB 1ZCRA 2X0UA 3G9VA 3NCCB 2R0ZH 3OAYK 3WTUA 3V6ZA 4TQIA 1T1YB 4WW2C 5FK9B 2WSDA 1SBSH 2E76C 5IFJA 4KKLC 1PZ2A 3WHE1 3FN9A 1WT5C 4OZGA 4P5TC 5HBBA 1KTRL 4FQ2H 2XHNA 1NPNA 3L7FA 2B1AH 3HBZA 3EYFB 4XPAL 1IBHA 3MODH 5HDOA 5DRNA 4DQOH 3D8MA 4K5PA 5J7CC 3CZEA 3QNFA 3VMPA 2WLLB 1S7WA 4KI5D 1IILE 2FIKB 3GMQA 4A38A 2XWRA 2DKUA 2GC4C 3QHFH 4OD2B 1T4WA 4P57B 4K73A 2L7QA 1HWGB 4KK9C 3AQYA 4M43H 2VN4A 4K07A 5K59F 1M7DA 3L3OA 4Y4FB 1SXBA 4FG2A 4YE4H 3T6ZA 1BFSA 5IOPB 2JB5L 3WY2A 2FYVA 2BVOB 3ASWA 3O8XB 1R1CA 2JKXA 2QQNL 2I24N 3LS4H 4DOHB 3N1QC 3MX0A 4Y1AD 5FF6B 3EG9A 1SJVA 4F8OA 5TFSH 1S78C 1LE9B 2OTPA 4G8GD 2D0FA 2VKXA 1UVQA 1BIHA 4OGAC 43C9B 1UQSA 3B2MA 5B1BB 2VXQL 5CD3A 1HWHB 2IGTA 4HBCL 3HNVH 3KLSA 1U2HA 5EUOB 4N2DA 1KFAH 1HK6A 4JR9L 2D0HA 4WU5A 2DLHA 5IBLC 1TETL 3IN2A 2WYTA 3LPPA 2AABH 4Q6IC 5AEAA 4JPKL 4NKDA 3ZK0A 1CYXA 2CXKA 4ZS7H 4Z18A 1A7OH 4GYBA 5DHVB 1GS7A 5MEOB 4P4RA 3IPEA 4F7CB 5GQBA 3RTQC 3V4PB 4GAJL 1IGIL 3LKRA 5IFHH 4Y5XB 5HVWA 3ZYZA 3OKEA 3GSVB 4RFOH 5J8OA 3KBFA 2XTJE 4GW5B 1KLUB 5DC0A 2AZAA 4AITA 1EUUA 4AVJA 3A6BL 3VD4A 3ZDXF 3U7WH 1JWUA 5GSRA 4MAUL 1WAPA 4CKQA 3QXWA 1PY4A 2R1YA 3KLDA 4P5TB 3AT9A 3WBDA 3BH9A 3PV6A 2DH3A 2SODB 5JOEA 2Q8AL 3QULA 1Z5LA 3SSGA 4C57C 5LCVL 1DQDL 3SBWA 4LSQL 4RAUA 1RLBA 2BNRE 3BT0A 2XJKA 3SJVE 1HKLH 1FGNL 5EMYA 3S36H 1N7ML 5JYLA 3L5XL 5BO1L 5IW3A 3IJ8A 2JKNA 3CU1A 4NQSA 4TLSA 1D5XA 4FE9A 5DJXA 1U36A 2CLZB 1CZ8L 4J6IA 3ZHLA 4LGPB 3IE4A 3N3EA 3IMWA 2X5PA 2Z93B 1VDGA 2NYKA 3O4OC 4DJMA 3Q1SL 3T6VA 2EYSB 3QPQC 4WW1A 4HHAA 5D1ZI 1BXVA 2VR3A 1JHLH 3P3UA 2ICES 2IWFA 1SYVB 4YXLH 1DVQA 3BWUC 4F7KA 4YDLB 2NYYD 1YECL 4NNXB 3ULUE 4GBXC 4QHPA 1B4JH 3CZFA 3N41B 2VJ0A 3RVUD 4JZOA 5B1AB 2BINA 3MV8D 4DEPC 2EUWA 1IBGL 4U33A 1J12A 3I6SA 3SJVA 4U6XA 2BNRA 5ILTH 3V9FA 2ROYA 2VO8A 3V6FA 3S88H 1C9SA 2DYPB 2IGLA 3AG4B 1GVIA 5FGSA 5DT1H 1IAOB 5IIEB 2DLIA 1HYRC 1NCCL 5CWSB 4HKXA 2V7NB 2DIBA 4GO6B 4HPYH 4HALA 4Q6IB 5E2WH 1M7IA 3CSTA 3QIWC 5E8PA 5EZOH 1X9LA 4G70B 5DHDA 4LARL 1O9ZA 2A6KB 2ZNXA 3JWOH 5EBMB 4E9XA 2VZ3A 1GH7A 1D3CA 4RRPM 5DC9B 4X7SH 4KDTC 5AOLA 5CEXB 5F3FA 4HFUH 4AYFA 5M7QA 2VLRE 4PJ5D 1FCGA 2PWFA 4NYLA 5AKTA 2V2TA 4PJ8D 2UWEE 3TJPA 4TRPH 1K5NB 1U8OA 2AXJA 3VFMA 4KGLA 1AE6L 2YGNA 5C0BD 2IDSA 1AG0A 1F2QA 2YEVB 1JRHL 4HCRL 4EI0A 1QWNA 5E9DD 1IEBA 1ZLDA 1QLEL 1TQWA 4XNYL 4HKBB 1K9TA 2O5NA 2Y1AA 4ONHB 4P2QA 3IU4L 5FHBH 2E75C 5E6YA 4PRNA 1IT9L 1DLFL 3NABH 4TUJB 3OKLA 3BH8B 3D18B 4W6WB 4IRZL 4PP2B 5FGCB 3UERA 4LLVA 1JD7A 4UTBL 3EHBC 5T1JA 2DBLH 5CEZH 4ZTEA 1EZLA 4Z23A 1CICB 1DVFA 1JS4A 4BE6A 5I1AB 5JR1L 3BN9D 2X89D 1QAWA 3ZDYB 1U8JA 32C2B 3BZ4B 4MWFB 5HHNB 1SJHB 4X6FA 3BGMA 4OGXL 3MCLH 1FC2D 1WDAA 4XX5A 4TQEL 3QEUA 1F2XK 3D3VD 2DF3A 2VLRA 2UWEA 5L6YL 4PS3A 2JJWA 2ZYHA 4HCIA 3AY4C 1TZOA 5CP7A 1MXDA 3BVUA 5C3TA 3FZUC 4FFVD 3V0IA 1CT8B 1G7IA 5CZVL 4FULA 4D94A 2EYRA 4N0CC 5C86A 1KB5L 1OAZH 4NC1C 4PGJA 1IC7L 4KNUA 1AMYA 2HJLA 1IBDA 3LEYL 4JDEA 4UINH 1JZGA 1G9NC 2EH7L 3WU1A 5DC4B 4DEPB 4JY5L 1E9QA 1M1SA 4ADJA 3Q48A 4OV6F 1RUKL 1PLCA 3ATFA 5CCKL 3HLKA 1RZ7L 3T5WA 1D7DA 1EHKB 4LDLB 4NQCD 1CFTA 3O9WC 3QZLA 1VFMA 2XXFA 4X6DA 3P0YH 2X3BA 1KUMA 2HWZL 3TM6A 5G55A 1JV5B 3QRBA 2AJZB 4JQXA 4AY0A 1QKZH 4WENB 4M7LH 1CD9B 1AQ8A 4MAYC 4D9RD 3ABLB 3CXFA 3QIWB 1PIGA 1XX9C 4J8RB 2WM0A 4L4TD 1M2VA 2VH5L 3LNGA 2CAKA 5KG9B 4BWUA 4ODHH 5HDRA 4KRMB 2DWEB 2EDJA 5GRXG 4O2CA 5CF3A 1JGEB 1ZWIA 2VLJB 3VFRB 5JXEC 4HS6A 3HC3L 4P9MH 5BZZA 2J5WA 3EGXB 1BA9A 2OULB 1PFOA 2CHNA 1UH4A 2VB5A 4MJ5A 4XP9H 1OGSA 5KW9L 1ODAA 5E2VH 2D7QA 2ZONA 1ZS2A 1SN0A 3T3MF 3B9DA 2ICWJ 3AJ7A 2F7RA 3LNHA 1N26A 4LRIA 3UC0H 2YAEA 3SDDA 4PMEA 1MCOH 1PDKB 1RZ8B 2BOBA 4QRUB 4YL4A 3IFPA 5D8JL 4NCC2 5DA0B 3ES6B 3NK4A 1FGNH 3EHBB 1HNGA 4JCWA 1M1XA 1J0YA 2QGEA 4N2LA 4ZOCA 2ZF9A 4TSAH 5T1DL 4ZUWB 4L3FA 4CJ1A 1WV7T 3LKPB 2OYLA 1E8ZA 1EBAA 1URLA 3BGAA 5I1DB 4S0TD 2R8SH 2ADGB 2VDKH 2VZVA 3ZX1A 1FFPA 3EO1A 1QMUA 2YD4A 2BMKA 4KY1H 1FNFA 1IJNA 2YAFA 4WLCA 2P42B 2ZWZA 5I8OH 5CUSL 1NLBL 2W9LA 3QUML 1HCVA 4R7DB 2XFXB 3AMLA 5I73B 5DZVA 3II2A 1QW8A 4R0LC 2YPVL 1FVDA 1OALA 43CAA 3QDJE 4HUWA 1YECH 5GGVL 3V6ZB 1CF8H 2MQCA 3N9GH 2XI9A 2H32B 1BMWA 4Z7QE 1IZKA 5IFJB 4NP4L 2A9NL 2EVJA 4GKOA 5B38A 5KEZA 4M48H 3L3HB 4LL1A 4U6TA 5GGRA 2JJUA 2FO1A 3E6FA 3BZDA 5F89B 2IQAB 2X4UB 1KY6A 1TJXA 3ARQA 3PL6D 3OKMA 2K7QA 3OPZH 1KT2A 3QA3B 4OCLC 1NIBA 2X6CA 4Y4HD 3K8KA 1XR8A 4QHKI 4ICWA 5EWIH 3MA7A 2V5YA 1HSAA 2X4SA 3I9GL 1PFCA 5EO9B 3NACL 4MAYB 2FQDA 3UBFA 4MZ2A 4KGJA 4W6XB 4RAHA 1AVAA 1L6ZA 1M7DB 4HFWB 3MLZL 3QAQA 4KJPC 4PBDA 1YYCA 1F4XL 5AAMC 5IW1A 3QDJA 4H2CA 2HG0A 4ZFGL 1HJCA 2YD0A 1RZJH 3FTXA 1KMGA 3ME0B 1W72L 3NH7L 4GSDH 3ZKXC 4CL7A 1AOHA 1DO5A 2J4WL 1W6WA 2RJMA 3JV6A 2G2RB 4YPGA 3SGJA 3EG9B 1T7VA 4HCFA 3LXUX 2CGRL 2VRKA 3LRGA 1P53A 4PJAB 3DIFB 1U42A 4J4PA 5FUCE 1QLEH 1YA5A 4LOUC 4AM0A 3MBXH 4N9GB 2I25N 1S3KH 1BXUA 2QVMA 4FAAB 3EJZC 3MXVL 2NX5B 1MFCH 2WTOA 2XKSA 1XL4A 3BPNC 5DD6B 3AB0C 1VESA 4M1DH 1INEH 5AW0B 4OCXH 3FRPG 2AGJL 1N6UA 3RYMA 2WZPD 1DVTA 1VACA 4MX7A 4U3HA 3DMMA 1FL6B 5D7JA 1QRNE 3FC8A 4WWOA 5KVEE 2EDRA 2VDLH 5DD1L 3ZE0E 3QBTB 3N06B 4P4RB 1PLBA 5CZKA 4MSWA 3FTSA 3TA3D 3UYRL 4PRIE 1UEMA 4Y7OC 4CN4A 2A77L 4R0LB 4HKZA 3ZTDC 2DTMH 4Z7IA 1RP9A 3DOHA 1NGZA 3B2PA 4K3EL 3UTSD 3AGVA 1GXEA 4APQC 3UZEA 2IMMA 4PGBA 4FYRA 4PJ6A 2R1YB 3OB0H 2J1KA 2Y22A 1I1FB 1MFAH 3IBOA 3EZ8A 3PV6B 1QLRA 1A6UL 5AALA 3IDIA 2ZNWA 2HH0H 2ZUVA 1YHPA 1MHHA 1QRNA 1QBLL 2OMBA 4JUTA 3IAQA 5HYSG 4YIQB 4BWWA 2ZE0A 3HG1D 4NQSB 2YD2A 1AHKA 1D9KD 1YNTB 3EFDL 1BD2E 3ARBC 1QR1A 4WI5A 1R17A 4PRIA 2AEPH 2R29H 3IXAA 4M56A 2ZCZA 3PABA 1KTDA 4L0PB 1RKRA 4OZGF 1VZIA 3RVWD 1YYLL 4HHAB 3V5HA 1R3HA 4EN2A 3V52L 3HG4A 1H8SA 4JPIA 3MO1A 5E5MB 3ZKXB 2DQGH 2F2HA 1ZT7B 4HMEA 4PP1C 5EU3A 3BE1L 3FQWA 4MNQB 4PRPE 3KLAB 5D9SB 2OS7A 3UBGA 2X3AA 2FJUB 3OL2A 3QQDA 1T1XA 3VAEA 1A5FL 3UCRA 2V2WB 1M71B 4WSKA 2VN5A 4K4KA 4R5VA 1I1AA 1Y18A 2G2PA 4F24A 4XCFL 3AB0B 2PMZA 1BCIA 2ZX7A 4G3YH 4QF1B 4QHUA 1LGVA 3K6OA 4A1RA 2EDQA 1BD2A 1FIGL 2CCWA 4N3UA 2A9AA 3HBPA 5B7FA 1TJHH 5E8PB 4KO9A 4ODUA 1WBZB 4Y4FD 1L4IA 4NZJA 5AW3B 5IB3B 2XG5A 1N0XH 1SOSA 5J1AB 3FUKA 2V2TB 3GJFK 5GRWA 3DVFA 3MAWA 5J9PB 2AXGB 1Z3RA 2PLTA 3VFMB 4A2LA 2A6IB 4G6FD 4G80A 4N2AA 4GW1A 4PRPA 3VI4E 4IBVA 2IDQA 1HCZA 2PO6A 1YMME 2IBZX 1YEFH 3NN8A 1IEBB 3Q01A 4ZUSA 3JVFC 4PV9B 2J71A 4TQHA 1EHLH 4W4OA 5IJCC 4AEIH 3HG0A 4PRNB 5JXAH 4U1MB 3OKLB 1TZIA 4BFIB 1IGCL 2HRGA 4OCWL 4LLVB 3QCUL 3KWWB 3ARGC 3H42H 1DVFB 4GSRA 4PJXE 2AQTA 4KJYB 2D7MA 3VD3A 5I82A 4HSAC 3NJIA 4RGNC 2WNGA 1HHGA 1OIOA 3MJ9A 5MHSD 1Y6NR 4I85A 1BP3B 5IVZB 4OZHE 5JDSA 5HVGB 5DTFB 4BFGA 4OM0L 2V5TA 2EUZA 3WIAA 4TF4A 3ALXA 4G8IA 1TKWB 5FYLH 3VI4A 4DP5X 4ZAKC 1XF3A 3WKPA 4NQEE 1MCIA 2Q5BA 1YMMA 1W72H 4PG2C 1Y0LA 1H3XA 4XPFL 2X3CA 3T0XA 1AI1H 4H7VA 4PCYA 3K1DA 2HJLB 3GIZH 1HXYB 3ORJA 4G1EA 4YHIA 3NGBC 4KKLD 1ZVYA 1E9QB 4TNWF 4P5TD 1H9VA 5BVJA 1KXVC 3MLWH 3RL1A 3U4BL 3RPKA 3FCBA 3VG0H 1V27A 3SE8H 3MRPA 4JKPL 3SCMC 1IGFH 1IIIA 2WGXA 3KW7A 4XP6H 3VH8A 1Q38A 2K0RA 2W60A 3CVHL 4OZHA 1TJIH 1NFKA 3CDGA 3EOAB 4NWTL 3WE6A 2FR4B 3V0JA 3QB7C 2WLZA 1JPTL 4KK9D 1OE3A 3L3KB 3WLBB 3AY2A 4YSUA 4TUOB 3WTYA 1NGQH 2Z7UA 3V0GA 4NQEA 3U4KA 1P1ZB 4UTAL 2D2CC 3D85A 2IQ9L 3ZGHA 4UNVA 5F7YC 5K5YA 1N0LB 4PG9B 4QO1A 4WK4B 1NAMB 1OCOB 3QH3A 4HS6B 2IO5A 1KIPA 2A74C 3A4DA 3GI8H 5IESH 5D4QA 4K3EH 2I32A 3ELAT 4CNIB 2BVPA 2AJSH 1S78D 4HU2A 4DKEH 2LU4A 4G5ZH 1E4JA 1USZA 2UX7A 3ZTCC 4OGAD 4J1UB 4WEEA 1UWXK 5CSGA 1FFNA 2BOBB 5C07E 2NNFA 5KS9E 3UPRA 3V0EA 1M1XB 5I30L 1GKOA 2FIRT 4F57L 4CVWA 4FQXC 3BYTA 4R5TA 4APQA 3WUWA 1BFVL 5GJTH 3SYAA 2J56A 3ULUF 1G7LA 1BPVA 5IBLD 4YX2H 2IEPA 1DVYA 1LK3H 3GM8A 4WSGA 5D7KD 4M5YL 4M6NL 4JMXA 4YDIL 4F3FB 3RTQD 4X4ZA 2AV7B 4YXKH 5L8LB 2Z91A 2BOCA 4ZAKB 3UBXG 1SHSA 2CBMA 2DLEA 4KJQC 4WKZA 3TIEA 3NZHH 4ZFOB 2VXQA 4HGWA 5KANI 3VXUB 2J1YA 4Q58C 2FWUA 2QSCH 43CAB 4HUWB 1T7XA 4HH8A 5J4MA 3MLXH 1RVFH 1E30A 2DJUA 2QVTA 2RIKA 1SY6H 3STBA 5C07A 5KS9A 2B7DT 5IUSA 4N68A 1BQHG 1M56B 1WA0X 4GRLC 3ZKNC 3AFLA 3GHBL 3S37L 1KT2B 2UWEF 3H8NA 4LCCA 1KELL 1R3IH 3HNTH 5ISZE 3ZXAC 1T7ZA 3L4WA 3VI3E 1NAKL 2VDRH 3PQYE 5FYKU 4WF7A 5IVOA 4P2CG 5IQ7L 3PHOB 3MA7B 2WWOA 1HSAB 1DQJA 3WIFA 5DUPL 3MRGB 3BLPX 5HI5C 3NFSL 1T20A 2J8HA 2QQQA 2VN7A 1QWUA 4N24A 3SKMB 4G1MA 1MFMA 5IHBA 2JTYA 3CZLA 5EU4B 3P9WB 2BSCA 5KBMA 2XWBB 2P24A 5IW1B 3QDJB 3QPQD 4K3DL 4QRAA 1U93B 1BQSA 4IMKC 3NAAH 3WDHA 1CBVL 5LCVA 4Z7QB 3RU8L 4LCVA 3VW3L 3CLWA 4X6DF 2E7MA 2YSTA 1UTDA 3JSSA 1JD9A 5EBWB 4AGOA 4DGVL 4GBXD 2HG5A 4DVRL 3FRUA 1C5DB 2L8AA 3GO1H 2VZUA 3BUTA 3T65B 4AM0B 4AYDC 2XV6B 5I0VA 5ISZA 1ZVNA 4XPTL 1CYGA 1G9MH 5F1IB 1NMCB 2VXVL 1HFUA 3PQYA 3VI3A 2BXYA 2VJXA 3VXOA 5M94B 2G3MA 2ITCA 3SGKC 3CZJA 3QCUH 4X4KA 1H8OA 2M8XA 3FB6A 2F18A 5E0QA 2F54E 4E9VA 2ICWI 1U58B 1X44A 3SE3C 2VDQB 3EO0B 2HUHA 4FQXB 1NBVL 4Z7OE 1KXHA 2DDQL 5D7JB 1KJVB 2X4QA 2GT9A 1U3YA 3QIWD 4ECNA 3ABMB 4XBEH 3QYMA 4TTDC 4RMTA 1NPUA 2OSYA 2GIMA 1P5UA 4EDXA 4MSWB 2VLJD 1URIA 1WWBX 4YQXL 4ZUTB 3KWUA 2WSPA 1W9XA 4ZNCD 1NGZB 3BPCA 4FQLH 4QRTB 3RVXC 2V33A 3QG7H 3LIZH 6FABL 5GGQH 1KGCE 2AZUA 2XNAB 4OCSH 4RVBA 2EO1A 2Y7OA 5E51A 2OL3H 5GGUA 2F54A 3NA9H 4YFEA 1G6RA 4GRLB 1NGWA 2I60L 1A6AB 3IDIB 4AUUA 4KDVA 3MRMA 1YQVL 3EHBD 3SYQA 1MHHB 4PPTA 4FQIH 3SZ6A 1BECA 2P8MA 2MCPL 1N59A 3BGFB 1WAEA 3X17A 4FKHA 4WJKB 4S1SL 2QPEB 3FO0H 1B2WL 3FT3B 2FGZA 4HCRA 4JHWL 3ZSSA 4AVIA 5DI8A 3Q5YA 3GTNA 4JS7A 3VFNB 4ACTA 5KWYC 1W8NA 4JO8A 1I1CA 2NNAA 1OSYA 1GGCL 3K6IA 3PABB 1S7RA 3FQNA 5I5RA 5I18H 4MD5A 4WFHD 1PZ5A 3FZUD 4NIKB 4HX1A 1UUNA 4JPVL 4PW4A 5AYQA 2YGOA 2X9WA 1MUJB 5F7DA 3PWNB 4IRZA 4JPIB 4N0CD 2P8PA 4UTBA 1YPZE 2B9BA 1FBIH 1DTUA 1U8KB 3K72A 5EU3B 1CE6A 3K71A 1YMHA 4NM8L 5L4JA 1LVEA 4X98A 1UACH 4Z0BL 3QEGL 5EH1A 5T5NG 2A6DB 3V2AR 1WC7A 5D55A 3J2PA 3QDGB 4BH8A 4N85A 3VD0A 1I9RH 3VRIA 3BW9A 3ZU8A 3CFKA 3O9WD 4JN1L 4XXCA 1E2WA 4L5FL 1J88A 5IJKA 2IXQA 3H2WA 5GXBB 2DTSA 4U1NA 4KO6A 1BD2B 4NJAH 5JIKA 4DUVA 2ZOWA 2OP4H 1KB5A 1CQKA 1PVHA 1RXLA 4MAYD 3G08A 2FVNA 4Z9KB 3EFOA 5HDBB 3LVTA 3OZLA 4POZC 1SJXA 1JFQL 3DX7A 4N3TA 4KXDA 4ODUB 2XG5B 4JGMA 4N0FA 2P80D 3HG1A 3BVXA 3C2SA 3TZVA 2UY7B 3HE6C 5I1GL 1N8ZA 2WCGA 4DCQB 1UKQA 4XMTA 4EJ1C 5JXED 2VDMH 4HAFA 4DTGL 3BP4B 3TV3H 1KPRB 3AGWA 3NQIA 3DX3A 4NOFA 3D06A 2C7FA 1NEZG 3EGSA 4JO4L 4XPBL 2WZ6A 2V9TA 1KYOK 3DDGA 1IIKA 3NZ8A 4W4NA 4UZSA 3MV9B 1OK0A 4M8QA 4KI5F 5EIIB 2NX5D 2O93L 4JN2A 2EC9U 5IW6A 3GHBH 4CBZA 1CGSH 2M2DA 4JRYB 3QJHA 4MB1A 1EEQA 5JHLH 2Q8BL 3FBQA 1FVEA 3SKUD 2C1OA 5G4NA 3K8LA 5JMOC 1SLXA 1YN6A 3RDTA 5I15L 3M07A 1K72A 2EE6A 4KRLB 4NUMA 3KM2A 2ZTBA 4GMSH 3TYGL 1IKNC 4O02H 2AJYH 3WY4A 5E24E 1RIHL 4FNTA 4PRHE 4BE5A 3Q1EA 4YO0B 4X5PA 5CEYA 5B4MC 3L9BA 2Z4TA 1NCWH 2VN6A 3VI4B 2LU5A 3UACA 1XF3B 1CLYH 4U1IA 3LZNA 1ZIAA 3GXMA 4PTTA 4QXGH 4YS4A 4P2RE 3MRRB 3DSFL 4OB5H 2AANA 1B90A 5CHNA 2C9SA 4KNSA 4WWKC 2N4IA 3GDCA 3E8UH 3U2JA 3UTZA 1HNYA 3ZE0F 5B39A 2GTZB 4WI3A 2J1XA 1LK2A 1U8NA 3NCJH 5HJDA 4PYGA 4OZFH 5BVJB 4HC1L 3GXDA 3RL1B 1T0MB 4PJXB 5AWNH 1P6WA 3MLRL 3WE1A 3NT0A 1RZFH 4G11A 4BH7B 3FU6A 25C8L 3MRPB 4JAMB 4QLWA 2IPKB 2WQ8A 2ZCKH 1OCWL 4J3BA 5B22A 1DBAL 3NEOA 3V95A 4B97A 4OJFH 1XBDA 1AY1L 5B3JF 4PRHA 2DH2A 4Y1TA 5KJ4A 4XP4L 1A4AA 1JFHA 4NQEB 3WFEH 1JNNH 3U6XA 5LDUA 2H1LM 5AAPA 4P2RA 2HT3C 4A67A 3WNOA 4KJPD 2MTPA 5IQMA 1CGYA 4QO1B 3LQZA 4NSKA 4BRJA 2TRYA 1MEXL 4F9PA 2OA9A 5DSCA 1E67A 4DN3H 3WY3A 4LFHG 5GJSL 1SXCA 1S9XB 4X6CE 3CN4A 3V0WL 4JFYB 2NT0A 3QFDB 4MNQD 4ZMPA 2BIHA 4LOUD 3PGDB 4GQRA 4XPHL 1UM4L 4N8CH 1T3FA 4TLKA 2DBJA 4GI8A 3DDFA 5T5NF 1AO7B 2CHWA 3EJZD 1AZUA 4JDZB 3DV4A 5I6LA 3CZGA 2N56A 4F8LA 2HFFA 3UPRB 3GQFA 3PNRB 5ID1A 1J0HA 3MYZA 4MTMA 4Y9BA 1OM3H 3PY9A 1G4MA 4HEPG 3B34A 4XN2A 3BSHA 3WNMA 1KTLA 3R06A 4EOWH 3E8VA 4JO3L 2Q3AA 2XXCB 4M5TA 3NUKA 5CJOH 1MVFA 5HYQB 5L8KB 4L8CB 1KC5L 3OF6A 1JGUL 3SE6A 4JFEE 3BDYH 2YA2A 1F97A 2E7LA 4W1TA 5D1XE 4ZSOE 2VGLM 2XXGA 1T89A 3Q5TA 4WKZB 4X6CA 2YD7A 4WHDA 2WVSA 5HHME 1G7JB 1S2EA 4OLXH 1EQWA 1HH9A 5T3XE 1AD9A 3IBEA 4FNLL 2WW8A 1KCSH 5F7NC 4WWKB 4NM8H 1ZHKB 4APQD 3VDCA 3B5GA 4GG8A 4Q0XH 4TMPA 4F58L 4FQHB 5C07B 2WLHA 2BHYA 2XICA 2Y36H 3QEGH 2AJ3A 3GTVA 2OXHB 3DSNB 1TQBC 2X9YA 2E7CA 3FOMA 3ZT7A 2APSA 1AQHA 3E1ZA 4UIKL 1CVRA 2R69L 3QPXL 1X4YA 3S96B 5E2TL 1RZJC 5DD5L 5DHYA 4GNKB 2FL5B 2R15A 4R26H 1JCVA 1DQJB 1W0WB 2OX5A 4JFEA 2E5EA 1H6EA 1MZYA 5I76B 5D7SH 5D1XA 4ZSOA 4L3EA 4C56D 3HR5A 3H0TA 4K71C 3ARBD 4BK5A 3RL2A 1CIUA 3DRTB 2EVGA 4UNUA 5JIIA 1WCQA 4XGZB 3F05A 3C5ZA 3UG5A 4RWHA 5FKAA 3GZOA 3V5DB 3VRJA 1F11A 3FMGL 4KUZL 2GB2A 2P24B 4XPGH 5J6SA 1OTSC 1FSKC 1OSEA 3CAFA 4K3GA 3FQRB 3BQUA 1ZGLA 4EI5C 1DJYA 4X8GA 4U2ZA 4FFYA 3X13B 4PP1D 3B2XA 3NJLA 2HG5B 4OZHF 5H35B 1OW0C 1A4JB 1NBYB 1J05B 1E42A 5DMIL 5DQ9A 1UD2A 3NJNA 4JKMA 3VI3B 4HHWA 3AWFA 3PQYB 2EQDA 4B0MM 3RFRA 4K3JH 1X4ZA 2VDPH 3GZKA 2AJXH 3LZFL 3QHTC 4PCTA 4LAQH 3BT2L 4XOBA 5E2JA 3SDCC 3S5YA 3IDGA 3FAWA 2DYRB 1PMYA 5C6PB 1RHHB 4X7TA 4GFTB 1IM3D 2X4PA 3P2DA 2DWSA 3EOBA 5LAXA 4A68A 4KVCL 1MPAL 1A7NH 1HHIA 4JGUA 2EDBA 1Z66A 4ZO9A 4CN1A 3BIKA 5TF1H 4RFNB 3ECQA 5E99H 2NSQA 3H2PA 1KEML 1KJ2H 3HAEA 1KPVA 1X5HA 1V54B 5ESQA 3MRQA 4FX5A 2OAAA 4ZTPL 5KYUA 3BPCB 2ZPKH 3F7VB 3FTGA 4NQXB 5AW8B 1F4YL 1BZ9B 5E1GA 3HZKB 4B9IA 1TTUA 1I1RA 5C9JA 1FL3A 2CO7A 5EEWA 5F88A 2BHUA 4YBHA 3B7UX 5D6DA 1FYTB 4OQTL 4BZYA 1MJ7L 4Q9RH 4OSUH 5GGUB 1TQBB 1IAKB 3IXTB 1JZ3A 3WNNA 4GBXA 3KEHA 2CHXA 3CFUA 3TBCA 3FQTA 3EKCA 4LHUB 1IFHL 3MRMB 3U46B 4Z7OB 3T4YA 3ARGD 3EGDA 3P0GB 2DICA 2P8MB 5C2BL 3H9SE 1CE1L 3FH8A 3D48R 5FO9A 4U0RC 4RGND 2EABA 2X2HA 3BZEB 3JV4A 4FLOA 1GW0A 5L4MA 5J11B 5JNYB 1MELA 3JWDH 1QLEB 3W9EB 4KAQH 4PD4J 1EBPA 1UT9A 4LXFA 5EZIL 4OD1L 5KS9F 5K69A 2FLBT 4M9OA 4ZAKD 3VSQA 1PZ5B 1T2JA 1MEXH 2AMGA 1RJCA 4IKIA 3VXUD 4EI5B 5D7LB 1MJ8H 1JZ6A 4FQQA 3VU1A 1HCYA 3BVVA 3K71B 3D0LB 4C4KO 3HG3A 4FMKA 1NCAH 2J88H 3RX7A 1EXGA 4MDJA 1J8HE 3D0VA 1HL5A 4BUQA 3VRIB 4U1SA 1BBJA 1P4IH 2ZWLT 4LP4A 3U4AA 3H9SA 2ARWA 4QJ4B 4AG4H 3SCMD 4MJIE 3EADA 3LRLA 3SDCB 4E5XA 1A3LH 4U1NB 3BEVB 1KB5B 4TNWK 5FUZL 4UT6L 3T6WA 4PREB 12E8L 5DMKA 3JXAA 4AUJA 3DURA 3UP6A 4ABQA 1VGKB 2EIBA 5G4MA 4URKA 2AK4B 2YKLH 3IGKA 3KCPA 3LN5A 2ZQKA 3T09A 1IAIL 1J11A 2BS9A 1LWRA 3TZVB 4M7LT 1YPZB 1K2DB 1N8ZB 4XB7A 4LSSH 1F1AA 2RCSL 3ZIYA 5DJYB 1INDL 3GEWB 5CKAA 2CO4A 3AM8C 3PUUA 1SJMA 4P2YA 2DEYX 3MI6A 2H2PC 2ZIDA 4QTIL 3ZKSD 1OCZB 4F1ZA 1J8HA 4X80H 3RWCA 4BFBD 2B3IA 3FPYA 3GXTA 1KY7A 2IH1A 4JRLA 4M8QB 1SVCP 2G3NA 4MJIA 2N7BA 3WJMB 1X5JA 2BZDA 3IFOA 3LH9A 1E8WA 2V7HA 3ARWA 1QBML 4UTAA 4KITB 5GZOC 1OLLA 1TVBA 3OKOB 5E2TH 1FG2A 2C1OB 3NJFA 4FQXD 3LQAL 4LSDA 4C83A 5D71H 1S7SA 4NKMA 4U0RB 4O2FA 4DP2X 5KN5A 1RP8A 3VWJA 1TNMA 4WI0A 5D2NE 4LLWA 3S35L 3RUGE 1NCHA 2GIYA 5HGHA 3IK2A 4JG1H 1FLTX 2BNQE 2OLDA 3QO1A 3CXHJ 3SE4A 3DJSA 1QFWM 4I0KA 3ZL1A 4BZ1H 4KJQD 5HHXH 3MACL 1DJZA 1L9SA 1VB9A 5DJCA 4I3SH 4Z7OF 2UZXB 1JNHA 1UWFA 1ORSA 1E6JH 4JKWA 5E8DH 3CMGA 3U30B 3S8GB 4P49A 1DQIA 3SBPA 1F6FB 3L3IA 2ICWB 3RWFA 4R7NA 4YFDB 2CJUH 5DMIH 5INDB 2EKSB 5F3BA 2F8IA 1Q94A 4IBSA 2D3NA 2O26U 3D4GA 4GRLD 4ADGA 2DWDB 2WKGA 3IFNH 5CBEA 3UOAB 3ZKND 4D9QD 3V4VA 2GITB 1BAGA 3UAJD 1RZKL 1MI5D 1MFDH 5FM5O 3SOBL 4OCRL 5I1HH 1QWHA 3MRLB 3QUMB 5CGYC 3KPPB 3T2QA 5IVNA 5D2NA 3OM3B 4JQIL 2UUDK 2G3ZA 3RUGA 3I2CH 1RZPA 4CDGC 3AXHA 5CSZB 1D5IL 4L4JA 3CH1A 2YUVA 5HI5D 3TPKA 3QJQB 1GOGA 3T6QC 1DHKA 1FNEA 1WGOA 4DGYH 1BHGA 2YMXH 3DARA 4X7CC 5TE4L 4HH9A 2GUYA 1IEAB 5CGMA 2WY3B 5EORH 1G7QA 1NGPL 2W88A 2E59A 3ALWA 3VXSE 2Q7NA 1FDLL 1SXAA 2APFA 2IANE 2MQ3A 5LGYA 3N40P 4JANA 1XR9A 3MZTA 4DSYA 2HKHL 3LQMA 4BFJA 1BZQK 1GGTA 2EDXA 3JT0A 2NCMA 3CVCA 5DC2A 1T3FB 4YZWA 3U7YH 1KDIA 2QVIA 4A6YA 3QDGD 1Z2KA 4WEUD 4X5RA 3ARVA 5EPMA 2ODHA 1D5BA 1EXHA 3HRPA 3HZVA 5I6MA 1JSYA 1LM8V 2C4XA 5ID1B 4O51B 4HIHA 1KCUH 1NMBH 3GNML 4MMZC 1SMAA 1W72B 1BFTA 3QR1A 4HBQA 5FYKH 2XQBH 3QK0A 4JX0A 1KTLB 1ZHBA 3RFZA 3HI5L 3IDUA 5E00B 1NCBH 2O5YL 2NLJB 4AYGA 4TTDD 1LP9E 3CQFA 2EYTB 4IU3A 4HS8L 4HSCX 3VXSA 3CSFA 4Z7NE 2YBRA 4X9IA 2A83B 3KPSB 3KBHE 4QKTA 4JK0D 4WY7H 2L7EA 5HHQB 3IS0X 4L29A 3HS0C 1T5XA 4NFDA 2WQAA 2EACA 1GMEA 2OMTB 3B8SA 1MFEL 4CW1A 1HOEA 3RVXD 4JREC 3J7HA 1A02N 3KHQA 6TAAA 1F90L 3G5XA 4N8PA 4UB0L 4OM1H 2VKWA 3RA7H 5IK3B 3MV9D 3FU3A 3LN4A 3F7PC 3HRZC 4UQ2B 5C6WH 1S7TB 4RAVA 2KH2B 4IDJL 2NTFA 5T1MB 4JRYD 4OFPA 3DHJA 4U7KA 4A63A 1K6QH 5ICYA 4TTGA 2EEAA 4QRQB 5T1KB 2GAZA 1HL4A 2ZOOA 1G6VK 2XVBA 1J86A 2XTSA 3QXDA 1T6BX 5T5FL 3QFJE 2OX5B 4JFEB 4X9BA 4ZPVB 4D9LH 5CFAA 3ILDA 4L8BB 1LP9A 4DIXA 5CAYB 5D1XB 5JO5B 4ZSOB 3QCTL 2WCSA 4DN4H 2KZKA 1FO0L 3H0TB 3IFLL 4YDKL 5ABAA 2D3JA 2N0MA 5J5EA 2F1EA 4CC4C 2ROXA 2CUIA 1B6DA 1F11B 4DFHA 1TVHB 4HJ0C 3D39B 2VIRB 4R4NC 1G9MC 3PWUA 1MCJA 3FT1A 4WGVB 1ZGLB 2BVYA 3BQUB 1PZSA 5JHDE 2B4CL 2PPCA 2Q2LA 3LH2H 4WO0A 3B5TA 1QFWH 1Z5YD 3E2HC 4YVUA 5AW4B 5GRVK 1ZY9A 5MENB 1QLFB 4L5FE 5DMJB 1U95A 2W9EL 1GJUA 2W9DH 3DK0A 3AACA 2FK9A 4RZCB 1RUAH 3WFHB 1KULA 2ORBL 5IKCB 2WK2A 1RFDH 4TS6A 3APNA 1F56A 3B2VH 1ECYA 1B0IA 2HN7B 4G6KL 4PBVC 2OKMA 1AQDA 4JVUA 3QFJA 4CU7A 3ESMA 4S2SB 4CSZA 1DJWA 4MMZB 2GBVA