2VN3A

Nitrite reductase from alcaligenes xylosoxidans
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
336
structure length
336
Chain Sequence
QDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title The Importance of the Long Type 1 Copper-Binding Loop of Nitrite Reductase for Structure and Function.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
total genus 88
structure length 336
sequence length 336
ec nomenclature
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vn3A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vn3A02
1ET8A 3FSAA 2B3IA 3BVDB 3S3BB 1AZCA 5FC9A 1NTDA 2AANA 2FQEA 1KDJA 2I7SA 5PCYA 4YSUA 3OM3B 4QLWA 2BW5A 2DYSB 4P5RA 1JERA 3L45A 1UATA 2IAAC 3SBQA 2J5WA 6PCYA 3DIVA 1GYCA 2FQFA 1AS7A 4AI7A 2I85A 1I53A 1OE1A 3FSVA 2IH9A 1TU2A 2H5UA 4YSPA 3ZDWA 2CALA 2BZ7A 3IBOA 3GXUB 3ZBMA 1PLBA 5B1BB 3S3CB 1NIEA 4YVUA 2UX7A 3BQVA 2XX1A 1V55B 3SBPA 4E9TA 1JXFA 1CC3A 1RCYA 9PCYA 4ZK8A 1SDDA 1MZYA 3NSCA 3QQXA 4M4RB 2X87A 1A8ZA 3KW7A 1ETJA 1OE3A 1SFDA 2IDTA 1BYOA 1JOIA 1ZPUA 2N0MA 3EHBB 1ZDSA 3S8FB 2UXGA 1NIBA 1SF5A 1MG2C 3RYMA 4DP1X 4PAZA 3NJHA 3CG8A 7PCYA 2FNWA 2VW7A 2GI0A 5I6PA 3PCYA 1SHWA 3WIAA 3U25A 5AKRA 2BP8A 2DWSA 3FSZA 2GC7C 3TU6A 4A2EA 3UAAA 1AZUA 4DP5X 4FA7B 2XYBA 1WS7A 1V54B 1J9SA 1DZ0A 2FQDA 2YQBA 2RACA 2HRHA 3IN2A 4YSAA 2HLEB 1L9SA 4W9ZA 5I5JA 1PLAA 1CYWA 4JKNA 2GC4C 1NIFA 1SFHA 4MFHA 1YLBB 5TK4A 4CSPA 1JZIA 3ASOB 1L9TA 4A66A 4E9RA 3ERXA 1KV7A 1E30A 3FU7B 1NDTA 2CUAA 1URIA 1XB8A 1W6LA 4RH4A 1BEXA 1CUOA 5D4JA 1IKOP 4F2FA 1NIAA 3TBCA 3NJNA 1NWPA 2HX8A 4W1TA 1SNRA 2W88A 5I6LA 1WS8A 3N2JA 3PXLA 3ASNB 2H47C 4E9SA 2H3XC 2PPDA 1NPJA 5F7AA 3OMIB 3FPYA 1AG0A 3UAEA 2UXTA 4GP4B 4JHVA 2FQGA 2QPEB 3NJGA 2ZOOA 1B3IA 2Y69B 1ILSA 3TA4D 4YSDA 2FT8A 8PAZA 1BYPA 3OMNB 3EF4A 4JHUA 5A7EA 1NWOA 4AKPA 4NERA 1GW0A 3PAVA 1AAJA 5D4IA 2FJSA 3ABMB 3OQRA 3FPXA 4WKXA 1J5CA 2VMJA 3CZUB 1X9UA 2IDUA 4G7RB 2BWDA 1SJMA 3DTUB 3NJLA 4KO5A 1BQKA 1BXVA 1BQ5A 2IDSA 4KO7A 3IN0A 5B1AB 4BDVA 3PLYA 1GS6X 3AW5A 1PLCA 1TEGA 3NJJA 3AG4B 3CDZB 4BWTA 2BHFA 2YAFA 1M57B 2AZAA 3FSWA 4E9QA 5I28A 3ZIYA 1HFUA 2BP0B 4G70B 2P80A 2PP9A 1J9RA 3ZX1A 5I6OA 3NT0A 1RZPA 1M9WA 2HXAA 2JXMA 2EINB 3IE9A 1PZBA 3FU8A 4L0PB 4PCYA 2FT7A 1JXDA 3QJVB 1W8EA 3PAUA 2BWIA 1PNDA 5B1KA 1PCSA 3FYEB 2UXVA 3WKQA 1XB3A 2VW4A 1ZIAA 4EF3A 3X1FA 1RZQA 2CAKA 2VW6A 2OJ1A 2IDQA 4DPBX 1ASPA 1TKWA 2B08A 4YSSA 4BXSV 3S3DB 1GR7A 4AKOA 1MZZA 2YAEA 1ZIBA 1PNCA 1PF3A 1ILUA 4E9YA 3X1NA 4DPCX 2NRDA 2YXWA 3T71A 1HAUA 4GP8B 3NJIA 4E9VA 3ABGA 1RKRA 1AQ8A 2J57A 3EH5B 2GBAA 3KW8A 1VLXA 2MTAA 4DP7X 2FT6A 4N4YB 3QJSB 4A68A 3FU7A 3AG2B 7PAZA 3G5WA 4YSTA 2VN3A 1ASQA 1OV8A 2PPFA 4K9JA 2AFNA 1PY0A 1KCBA 5IY5B 2VM4A 4KNSA 3MX0B 2EILB 5AZUA 3X2QB 4UANA 1L9RA 5LDUA 2EIMB 5D4HA 3AG3B 4E9XA 1AR1B 4KO9A 3CVDA 4A2FA 3FS9A 2ZXWB 3JT2A 5I6KA 2HX9A 2YARA 4E9WA 3QJTB 1GS7A 4DP2X 1ET5A 1XMEB 3GYRA 4KOBA 3PAZA 2PPAA 5ANHA 1V10A 3D12B 4DP6X 1QLEB 4UF7C 4HZ1A 4YSOA 2FWLB 1A65A 3WNIA 2GIMA 2Q5BA 4A2DA 4YSQA 4HCIA 4YSCA 2XUWA 2J55A 1J9QA 2MRYA 1ID2A 3HB3B 2W8CA 1ADWA 1PZAA 1GY2A 2PPEA 2GB2A 2BZCA 1PAZA 3FU9A 3T6WA 5B3SB 2HX7A 3ABKB 3X1EA 6PAZA 3CDZA 3NSDA 4G71B 2UX6A 3AG1B 2XV2A 2PP8A 5B1JA 3X1BA 3OD3A 1BXAA 3AZUA 3FQYA 2BP0A 3EH4B 4G7QB 1E5YA 2IWKA 2LLNA 4HHWA 3FYIB 4X4KA 2YAOA 2UXFA 1KDIA 2JKWA 4YVNA 3T9WA 1GSKA 4N8UA 4HHGA 1GY1A 2YAHA 1ZDQA 2EIKB 2Y1AA 2XX0A 4HIPA 1L9OA 1A4BA 3T6XA 2TSBA 5AFAA 3QJRB 1IBYA 3AY2A 2I7OA 2R7EB 1W6WA 2PCYA 3TBBA 4DPAX 4KOCA 1OCZB 3V9CA 2IWFA 3SBRA 5B7MA 5I26A 4HCGA 1KCWA 1AOZA 2WO2B 3CVBA 1DYZA 1KGYE 4GYBA 4DP4X 2VSMB 2QT6A 3GDCA 1SHXA 4Q89A 4YL4A 3NP3A 3QJUB 3WKPA 5EHFA 1NICA 1N68A 1JVOA 2EIJB 3UACA 4HAKA 1J5DA 1CYXA 4BWWA 1NIDA 1AZRA 5PAZA 3C75A 1JVLA 1R1CA 3EH3B 4NB7A 1A4AA 2AVFA 2GHZA 2XV0A 4P5SA 3WNJA 4GY4A 4DP9X 2CCWA 1FFTB 4TXVB 2VM3A 4BXVA 4M3HA 3NJFA 3ABLB 5I6NA 4G72B 2GSMB 1TEFA 2OV0A 1OCCB 3MBWB 4DP0X 3SQRA 4CSZA 1AS6A 4BK5C 4BDVB 3QJQB 2PP7A 4AKQA 1NPNA 3WG7B 1MG3C 1QNIA 5B1JC 4GXFA 2PCFA 1MDAA 1WA2X 2ZWNA 2YAQA 4BWUA 2XWZA 1AANA 1OCOB 4F2EA 2DV6A 1ASOA 1L9PA 1WA1X 1OF0A 1ZV2A 2E86A 1JZJA 3N55A 4AX3A 2XXGA 5B7EA 3T6ZA 2P80D 2DYRB 1E5ZA 4AZUA 2DY2A 4UAHA 3NYKA 2X88A 1ET7A 2CBPA 1AIZA 2YXVA 2DWTA 1HAWA 1OCRB 2XU9A 3HEIB 1BXUA 2YAMA 4YSRA 2PPCA 2IH8A 3X1GA 1AS8A 3NJKA 1KBVA 3TASA 5B7FA 2QPDB 4KO6A 5I5IA 5F7BA 1IUZA 1QHQA 2XXFA 2IDFA 4FAAB 1N70A 3UABA 4KNTA 4HCFA 1FWXA 2YAPA 1SDDB 2VSKB 3OMAB 2R7EA 5I6MA 4A2GA 1J9TA 3PPSA 1OOWA 1NINA 1M56B 2A3TA 3JTBA 2OCCB 3FQ2A 4HALA 2BW4A 1KYAA 3UGEA 4KNUA 1BQRA 1X9RA 2TSAA 3V9EA 3QPKA 2BP8B 3FT0A 2Q9OA 1L9QA 1JZEA 1KBWA 4NAJA 1PZCA 1NZRA 1IC0A 3NJMA 1OE2A 3UADA 1SF3A 1IBZA 3NSYA 4F7KA 1WAEA 4DP8X 1A3ZA 2ZONA 3WI9A 4Q8BA 1FA4A 1AG6A 1JZGA 2QDVA 1A4CA 1PMYA 2XV3A 1CURA 2XLLA 4YSEA 1GS8A 2J56A 2PLTA 3DKHA 3FQ1A 2JFCA 4WTQA 1E67A 2WO3B 3H4FA 1F56A 1E65A 1EHKB 4ENZA 5I5MA 1AZNA 2CJ3A 2FTAA 2AZUA 5E9NA 2WSDA 1T5KA 3CVCA 4GP5B 3NP4A 1AZBA 2IWEA 1JZFA 5TK2A 4A67A 1WA0X 2HRGA 4QKTA 2HZHA 3H56A 1JZHA 1JXGA 3H4HA 1AACA 3S8GB 2XVBA 3IEAA 4A2HA 3T6VA 3NSFA 2QDWA 1BAWA 1EZLA 1XB6A 4G7SB 2BO0A
chains in the Genus database with same CATH superfamily
4N9GA 4R5VA 4IRSA 2YSSA 4GMSH 1G9ML 4BZ2A 3DYOA 4LVHC 2CBMA 4HC1H 4X6DA 1RUML 2HH0L 5GRZA 1LP9E 4AQ1A 3VRIA 2X53A 1PGRB 5IJVB 4R0LB 4AYMC 2VAJA 5HGHA 1CVRA 3QYCA 1G6RH 4MCNA 5DYFA 2NYYC 4M7ZC 5D7KE 3DIVA 3MGTA 5IW6A 1A1NA 2EVHA 5DCCA 1U8HA 3BPOC 4XBEL 4FERA 4LAJH 2ZE0A 2O26U 4NLAA 4TS6A 1MN4A 4P2QD 5A2BA 1H6TA 3BJLA 4ICXA 4WW2C 3RIKA 4TF4A 3QUMB 5F21B 2DQHH 5AD0B 1FFRA 3OJDA 3BPNC 3RWCB 1EFXA 3V5DA 5IUSA 3G9VA 3H2QA 1MW3A 3KYKH 3TT1H 1IV8A 1E5AA 1GGCL 3U46A 3FUNA 3LIZH 3UMNA 3ESOA 1GGBL 2OLDA 2YD9A 4PAZA 1IAOB 2R4SL 1RULL 3C9NB 3FH5A 5SWSA 4CKVX 2B1HH 4L2YA 4HW6A 3DX8A 1E43A 1UG9A 3RDTC 3FSZA 3GMMB 5ALCL 3WEXA 5BS0E 4TSAH 3OXSA 4HKJA 3R4RA 3ARBA 3TU6A 2BNUA 4HULB 5F9JB 4GBXB 5T3XE 5JXED 1A2YA 1NBZB 5E95B 4C56D 1JWUB 3GSNL 3AC0A 5AW2B 1S9YA 1KJ2B 3LN4B 3MRPB 3RFZC 1SMOA 2VXSH 2X2YA 2FO4A 3ESUF 4JFPB 1P1ZA 4BBWA 2NR6A 5CHNA 1S7UA 1EDYA 5J0BA 4QRPB 4P3DB 4JFDE 2V3DA 2X2IA 4E9RA 4WWKA 3KM2A 4DNLA 1KYOK 4IBVA 2F2HA 1SJHA 3QEGL 4LSRL 4QOKD 5AENA 3DSFH 3F04A 4JQIH 4O58H 2HMID 5D93C 3MV9D 2HVJB 1HSAA 3QCTL 4NHUA 3UTSA 2B0SH 2HX8A 5HYSG 5KUKA 5F7WC 3TCLA 5C70A 4PR5A 3HB3D 5CIPA 4APQB 3CFKB 4X0KB 1C5BL 4Q56A 3LB6D 1ZT4B 1DBMH 3P9MA 1JK9A 1GRWA 3RVXD 4TUOA 4XWOD 4AWJC 5D1XB 3LS5L 1DLFH 4AH2A 2Y69B 2W91A 1YQ2A 5I8OH 5G5DA 5KYYB 3ALPA 1WF5A 4LSQL 2XBTA 4AIZA 4IOFD 3Q3GB 3KPOB 4NERA 3ZDXF 1UOVA 4RIRA 4BE5A 1QTPA 5DJ8A 3I9GL 4RWYH 1NMBL 4J3WA 3GSOB 5J6GA 1N12A 4GH7B 4G43B 4DPRA 4UM9D 1H9DA 3DTUB 1MHPH 3GT6A 1ZY9A 4KROC 2WTRA 4R7NA 3QQ4B 1OTTD 3K46A 1HHKB 1RH8A 4NXSA 2OR9H 2ZKYA 3IJSA 1PAMA 2ZWYA 4N90D 1U41A 4XVSL 2FSEB 1L0QA 1IBFA 3ZE1E 1USQA 1DDHB 4U6HB 3OPZL 3TJHC 4OVVA 4NO5B 2YEZA 1INEH 5T5FH 5FYKL 3NA4A 4KZCA 2EXSA 5E9DA 1AGEA 2WVTA 1B9KA 1BZOA 5AZ2H 5AB2A 2R83A 4ZTPL 1EFQA 2OMYA 2XOTA 4F91B 2LABA 1XD0A 1ZLSH 4ETQB 4PD4J 4R4ND 3T2PA 2NY3D 4P59H 4JKPH 5C6TH 1H3GA 3VG9B 2NDGA 3AWGA 4JQXA 2CAKA 3CC1A 3DYMA 2VZVA 3WTWA 2EVFA 2LHAA 1ZGLA 4E9LA 3T1FA 5IJKC 5FYLE 2IVFC 3ZE2F 4A6YL 4UILL 3CN2A 2ZXCA 1ES0A 3C8KA 1OO2A 4OLEA 4LEXL 3LD8B 3EYOA 3HZKA 4GP8B 3OWEA 4QPEA 3CAFA 1BQHG 1VIWA 5H4YA 2J57A 8FABA 2R4RH 2ROXA 5K93A 3MV8A 5GRUL 3STZB 5JZ7C 2BIPA 1U8LA 2FATL 2H9GB 2HTKC 1M7UA 1H5BC 3GRBA 1MWAH 2QJDA 3G6AA 4F33B 4GAYB 5HY9A 2YUZA 3X14A 3JTTA 2Y2TA 4P2OD 3U9PH 1GYWA 4RQQA 4NNXA 4Y4KC 1Q1JH 2DOCA 3LSOA 1UWGH 1XCQB 1Z5YD 1X5JA 5MHSE 2PTVA 1R5IB 4AGNA 3L6FA 5ESAA 2WUCH 4YWGH 1IC7L 4JY5H 1DQQB 2KYIA 4HJGB 1IX2A 4XNUL 1ZLWH 3KZ8A 4E5XB 1J10A 1RK1A 2F18A 2NY1D 1DQDH 2BXZA 1M53A 3WIIL 1F90H 1V10A 4R4BB 5DJDA 3TV3H 1G0XA 3OZ9H 5AVWB 2E7BA 2G2RB 4DP6X 4TNWF 2KZWA 1T22A 1N59A 2X4PA 4K3JL 3EJUA 3T4YB 1CFVH 3FTGA 3VXOB 3MV7E 1BX2A 3VJ6B 1TMQA 5IR1B 1FLRL 4NYLA 1KENL 1JE6A 32C2B 4N87A 2EXYC 2PPEA 3NCFB 3FU9A 1EK3A 1GZPA 4JO1L 1R3IH 4NRXA 4DOHE 4HKXB 1U6AL 2BNRA 3PWLB 2PP8A 4X8CA 2FHFA 2QVIA 5HVHB 3I2CL 3RL1B 3O81A 2EIDA 1D2OA 3SGDI 3WIFA 4DAGH 2W65A 2XWJB 3TTYA 2GITA 4WO4D 2IFGA 4GRMA 3MBXL 4PV9A 4WTZA 1OAKL 1OZTG 5I1IH 3VFSB 2HJFA 2BVOA 2V17H 4B3VA 4L4VD 1A4BA 2E3VA 2X6MA 2VLLA 4HT1H 2GI7A 4TL5A 2ZX6A 4AM0Q 1XCTB 1RUPL 1G9NC 2VE6B 3EO0A 3SY0A 4QRBA 1NAMH 1K6QH 1CT8B 1QWHA 2JKTM 4M8QA 1ZLDA 4DPAX 4KJYB 3V9CA 1FHNA 4RA0C 1S9KC 1B0GB 4NAMA 2HG5B 3F00A 4Z7VE 3EBGA 5AOKA 4M61B 4M6OH 5E9AA 4KRNA 4KDTA 4PLJD 5D71H 2YA1A 4Z95H 4KRPB 4XNYL 4OD2B 2IANB 1AQKH 1GOGA 1XEUA 2I69A 2VXUH 3B7RL 3VGGA 3VXME 4CVUA 1N68A 2CJUL 2OI9C 4AL8C 3O9WA 43CAB 1ZTXL 4MSWA 3IMVA 1ZVHA 3ZKNC 2Z65C 4B97A 1XR9B 3MCYA 5TE7L 1QWUA 3QIWD 3KH3A 3I6LE 4OFQA 2JJVA 3DTXB 1NIDA 4PJDA 1CPUA 5A43C 5I1DB 1DBJH 5E08L 4FQLL 3BAJA 4GRWE 4LBEA 4NUGH 5IQ7H 3QQNA 2XV0A 2AVFA 2ZAGA 3K72B 1ZXKA 1JWSA 1NBYA 2BSEA 2VLRE 4UNIA 1KXTA 2G4GA 3II2A 3IJEB 4Q6KA 1KV3A 4Z7OF 3ARGA 1LO3L 4MJJA 4H8WC 3ZIMA 1H0DB 2XQ0A 1WHPA 4G72B 1X9QA 3QIBD 1QI4A 5C0RL 3BCDA 1ZTMA 4DP0X 3SPHA 2Q7YA 3SQRA 5ADOL 3JZ7A 2WKOA 5C0JB 2MPAL 2BOCB 5H4ZA 1DBBH 3L3GB 4Y2OA 2DEWX 1HQ4A 2AK4B 3QFJA 4PJHF 4FQCH 2UZYB 3HN5A 1AYOA 1OT2A 2IO5A 4GXFA 3BSZH 1I8KB 2C3HA 3ZHFA 4KGJA 2HFEA 4TLUA 1JBJA 5I2IA 2XWBA 3GIVA 1BD2D 4X8JA 3SN6N 3NIFB 5DMJB 1YSOA 1EXUB 3HS9A 4M6MH 5C0BA 4FABH 4Y5VC 5KSVB 2H4EA 2H26B 1OAZH 3EYUH 4A7TA 4LPXA 4LRNL 1G0YR 4WCYL 1S7TB 2V5MA 3DX3A 3V0FA 2CBPA 3RWEA 4N2IA 2OJZH 3IDUA 1KELL 2ED6A 4FLQA 2EH7L 2C9XA 5HI5C 5JXAL 1BXUA 1T04B 2EYSB 3LXBA 2A6KB 5D96B 2NUPA 3ARVA 3CZKA 1I1AD 3P4NB 5T3ZL 3MGAA 3EF7A 5CLYA 1FO0H 3AM8A 2BFVL 2RAMA 4EZJA 5JMRA 3M8OH 4RGNE 5EEZA 3EBHA 3RWHB 3UABA 4EUPA 4OKVA 2K8QA 1N0XH 2PTTA 2P47B 5ACZA 4ZZFA 2QGCA 3ROLA 1I7ZB 4Z7WF 2R7EA 4JFFD 1CZ8L 3TVMB 3MUHL 4GSRA 4PRNB 4PTUA 3VXTB 2WMPA 3B6SA 3SE4A 4N5ED 5I16B 3BZFB 3HMXH 4P5MA 3RVTD 2A3TA 3IDIB 4P9HC 1CIDA 1CVSC 1KG0B 3IWVA 4HD9A 4HK0B 4KXAA 4GG6E 2RCSL 3CFCL 3NH7L 5FYKU 3TA3D 4MVBC 2ODHA 3K2UH 1HN1A 2Y3NA 1JGVL 4KDWA 3CPLB 3MLTA 3EXLA 1AY1L 1DHKA 3QQ3A 1Q0YH 4G9FD 3QJFB 4JHWL 1CGYA 1KXHA 2GBUA 1IBZA 3NAAH 1WAEA 3QEQB 1DFBH 5TE6H 3ZN6A 1I1FB 1R4XA 2H1PL 2XETA 5GHWH 2Y72A 4DVRH 4Q8BA 5DD0H 1NCUA 4Y5XA 3QZWG 3TWCH 5IMOB 1E6JH 5CLTA 1JTTA 5I1LA 1ZWIB 4FI7A 4JRXE 1AVAA 2CIKA 3GKWL 3FQ1A 3UJIL 2H3NB 4HU8A 3ZW3A 4GKSA 4WTQA 5IG7B 5C2BL 5E51A 2AMGA 2PO6B 5EEXA 3K5SA 3SGKC 5ISZD 3IGAA 4H0HB 2KQNA 5D5ME 1FGNL 3CWGA 5AVVB 3UH8A 5DQDH 1KPUB 4Q52A 4OBRA 3CVCA 1BPLB 1E5UI 2VCOA 2OK0L 5I0YA 5EBGA 1YPZB 3QUZC 1AZBA 3CFEB 4CDHA 3ZPDA 2P8PA 3ZYZA 4F7CA 2E7LA 1OOAA 2E0PA 1HU8A 5BVPL 3DO7B 4I0PC 2JK5A 4XN2A 5DK2B 5CCKL 1JXGA 3TO4B 2XTSA 1VEOA 2XYCA 4FLRA 5TF1H 4UMSA 3RVUC 3JV0A 4JFEE 3NSFA 2ZX9A 3JVFC 4AE0A 2HRPH 1F86A 3T0EA 1MCQA 4XGZA 4D9RD 1IGCL 1HSBB 1E4XH 3HKFA 4Z7UB 3C60B 4AEHH 2L7EA 2LVCA 2ZUWA 4JRLA 1F8TL 3MYJB 2HT4C 2Z3FA 2AQNA 5G4NA 1WZAA 5TH2B 1AS7A 4ZMZA 3PWPD 4BZ1L 2DQCH 2QLVB 3ECQA 4M48L 4FYRA 2DIJA 3DSNA 4XMUA 1D5IH 4N2HA 1KN4L 5KSAC 2YRPA 4NZ8A 1PYWB 4OFPA 3MMEB 2AEWA 3C2SA 4TVUA 2DRUA 2ZUXA 5DZOA 2F74B 5DZ9A 5AVYB 5EO0A 3LPPA 1HL4A 1MZYA 2ED8A 3LRHA 3RDTD 4AMWA 2DQFB 3L3KA 3KHQA 4UIKH 1OGTA 4FHKA 1X5KA 4LPVA 1ETJA 1CR9H 1JDCA 3MCLL 4FXKA 3BKJL 4NAQA 1YNTA 2DLHA 2W0KA 3Q8BA 2UXGA 1LTXA 3GRWA 3VFWB 5E2VH 1TJGL 4KUCF 3BAWA 1T66C 3O4LA 4KVNL 3SDYH 3UPAA 3EDFA 4YIQB 3W0WB 2G75B 1Y1DA 3BGMA 4OFVA 2ATKA 2EKSA 1FVCB 3SJVB 1JPFB 4ENED 1LEGA 4E41B 4C8XA 4MJIB 4NPJA 5FK9A 2LQRA 1R47A 2NDFA 1KYFA 1KJMA 2F7QA 3QDMD 2M1KA 3IFLL 1YEDA 2VXQA 3IKCA 1RJYA 2VLJB 2YGQA 2MQ3A 4HH9A 4PJ7A 2LU3A 1D9KB 3OKLA 5JUEH 2HLEB 3B9KC 3DTDA 5C0CA 1OLZA 2ZOUA 5DQ9A 3VI3A 1ZOXA 3MNVB 5TDPB 2F19L 4YL9A 3FB8B 2OKMA 4XP4L 4NRZB 5I1JL 5IW1A 3E6FB 4PRPD 1FDLH 3DX9A 2FH8A 2BSCA 3QIUC 4OFKA 2DJ4A 1UYWH 5HPMB 4YC2B 5I1KL 4WI4A 3IETA 4LAQH 3HS0B 3F7QA 3LRLA 3PU7A 2Z4TA 3KL0A 1OB1A 4MAYC 5BRZA 4OJFH 3BXNB 1J5OL 2B15A 4H8PA 4ZUUA 4UTBL 3C12A 3K7UA 3U7WH 4CSTA 1PG7X 1H8NA 1WHOA 3DNKA 1SOSA 2FVNA 4KROD 1FFPB 4MNQE 1QKZH 2P48B 1MUJB 4JL2A 1W15A 2FLRT 2I9LB 2Y5QA 3WS3B 3B83A 5A7EA 5F9AC 4HAFA 2F0CA 2W0PA 2X70B 2QGDA 4LSPL 3E9TA 4IRZL 2FJSA 3ABMB 1OAXH 3TT3L 5JW3L 4XVUC 5JPNC 3NJLA 3LIUA 5F8RC 4JDZB 4ODTH 3N06B 3MZTA 4TQ8A 4TRPL 5E00B 4B0MM 4DKAA 5GRJL 1YEIH 2N59A 4Z9KB 2BHFA 5C0NC 1LGVA 1FYHB 2AZAA 4XC3L 4MS8D 1KIUA 3ZIYA 1H6EA 3CFDA 1H3VA 3MNDA 4YDVB 3RNQA 4X0NA 5E1GA 4E42A 3ARED 4HXAH 5C08E 2P44B 1MVUB 1WAAE 1T0OA 4L8SC 4U1JA 1KZQA 2J12B 1J1PL 4KKAC 2CDFB 1QVOB 5HDBE 2X42A 3GSNA 1QA9B 1CI3M 4ZAKC 4L0PB 5EOQL 4WDIA 4OFYD 4P46A 4G6JH 3BKMH 3S48A 3VD3A 4A37A 1IAKA 3ELQA 4DQAA 4UQ2B 5TPWL 4OVUA 5C0IB 1BEYL 1IJNA 2CNYA 4P2QB 1LQSR 3D3VD 4BZ2H 4XP5L 4EBQL 4L8BA 4I9WD 5EU7E 3FTWA 4Q74A 1SXAA 1RIUH 3GXNA 1U9KA 1MW2A 2HTKD 1CBJA 3CCHA 3IJYB 3WLBB 1JNLL 1YN6A 3KDMB 5GISH 1MI5A 4JZJA 3D39D 5BV7L 3BSGA 2CMRH 5AKSA 4NQVA 2DQTL 4Y4KD 5SWQB 2I32A 1LE5A 1IM9A 1FUNA 2DQIL 2VDKL 3SDDA 3A47A 4RAVA 3VFUB 2IALA 4R90H 5CZVL 3PWUB 3U0WL 1XSIA 2V5YA 3CH8A 2GJJA 5F1IA 4XI5C 4GB9A 4EQ2A 5F7DA 3RWDA 3TIDA 3GLDA 3WNJA 2EEAA 1YMHB 4NJAH 3SGJC 1VFUA 1X4YA 4HZAA 4P5KA 4FXGB 3EW3B 5C0GB 5C09E 3DVGB 4K2UL 2XVLA 4CC1A 2CO2A 4YN3A 3VVVA 4FTVE 1CFSA 4XOAA 2CLZB 3LH9A 3JT2A 4LLDB 1IM3A 1M3IA 3CVHB 3WJMB 2HLAA 3WBDA 4PVBA 1OTUC 1I82A 1YAIA 5JNYA 4KMTH 4KNQA 3VE0B 4M02A 2V9RA 1I31A 2EXYD 1PD6A 2VT0A 3D4GA 2J5LC 3PAZA 2NZ1A 3WUWG 3F01A 4HGMA 4WWID 4JY4B 5J11B 3HBZA 3P73A 4FQ2L 4UUJB 4QOKB 3FOMB 1CQYA 2MQCA 1KLUA 5A6LA 3PWJA 4QRSA 2YGNA 3EO9L 4RDBA 2DWEA 3H3PH 1DL7H 5MI0C 2VDPL 4NM8H 4ZNCD 4CVWA 2OYPA 5EWIH 5F3BA 1Y07A 3PWVB 4ONHB 3HB3B 1HCFX 2ED7A 4LDCA 4NZTL 3UBXG 1T21B 1U93A 1YJDC 2GB2A 2MOGA 2KC0A 4Y16A 3OX8A 3HPLB 3HTLX 3KPSA 5DHVB 3VGAB 2VLKE 4W68A 3CV5A 1MHCB 4U6YB 3AQXA 4W9LC 3QCVL 1XVSA 2CKBH 4PY8I 4HH8A 3MAWA 2X6AA 5JA8B 4JO4H 5DFTA 2EDRA 5FX3A 2UZXA 3V4PL 1D5ZA 4JQVA 1RURH 1SEBA 4MX7A 4D2NA 5IBTL 4A6YA 5CIPH 5T5NF 4UM9B 5EU6E 4NQCB 1OD7A 1LDPH 2V2XA 2NZ9C 1OAUL 3CMOL 5EBLA 3D18B 1U8JA 4KUZL 1BVLB 3TF7C 4PS4L 1E4KA 4JAMB 1I9RL 3DRQA 4O4YH 3T8XB 4L1BA 5HHMD 3S0PA 1A7PH 5HHOD 4BELD 1UD8A 4Z7AA 3RTQB 1XSOA 5HHQA 4S2SB 4XNQB 5D1QE 3ARFC 4H13C 5LHDA 1WWWX 2L7UA 4OIBA 4UCFA 3D1MC 3KCWA 4DEUA 3K81A 2V9TA 4R26L 5L8JB 4E0RB 5AEAA 4XBGB 3MNZB 3CXDL 2NQDA 2A1WL 3KPLB 2XDHA 2GQHA 1I7RA 1A6UH 3LQAL 5A1AA 3TEYA 4RISH 2YLKA 3AXLB 3VWJD 1J0ZA 1FCGA 2NY3B 1XL4A 2D4FA 3NRPA 2YPKB 3QA3B 3RUGE 2EIJB 2A9MH 4JDEB 1KFAH 4ATTA 1NCWL 2Z64C 1W0YT 2JKLA 2ZXQA 1CYXA 1BZ7B 2VB5A 5FA4B 4F7EA 5BW7C 4QXTA 1HWGB 2IAMA 4NB7A 4YHOH 5IWLC 2BVTA 2DYPD 1O75A 3IMSA 4X6DE 5DLMH 5CU5A 3GK8L 1I85C 1E3XA 2X2JA 3LMJH 1FL3B 4G8FB 4NN6B 3L7EB 5FLUA 3BPCA 4OAWA 4CGUB 3FAXA 3V7AG 2ORBH 4OZHE 2I9TA 2BX5A 3SE6A 5IJCC 3KDPB 1Z66A 4O2CB 4FNSA 2PP7A 3QQ9C 1E9OA 1OP5H 5B1JC 3DXAA 4FYTA 4LLMA 1N26A 3KHOA 4P2OB 3K8MA 4MQTB 2BSTA 6FABH 2WCGA 1MRFL 5J12B 3PJSB 4ZUSA 5AVXB 2I60L 2BM3A 2FBOJ 5ANMA 5HI5D 3HNVH 2X41A 1EX0A 1YUKB 4HHAA 3ZKSD 4QNPE 2MIZA 4UIMA 4PRHD 1F6AB 3O11A 4DN3L 3GMOA 5DC9B 4Y7MA 2DWYA 4XBPB 3WENA 4JO2H 4N8PA 5HGBB 2X4RB 4G6FD 5AVTB 4R7VA 5HVGB 1XH3A 2ZX5A 2NY1B 1WCBA 4YZFE 2DJSA 3VXUA 3A67L 4ZW8A 3PDOB 4FFVD 4IK6A 4H2CA 5C0DA 3CUPB 3QUGA 3ZK0A 3LRSA 4HS6B 4PGCB 4M5YH 1HZHH 3QW9A 1MFDL 2OL3A 2BRQA 4YSRA 5EMYA 1NCDH 4DGIH 5IB3B 1ADQL 4LVNB 3O2WL 3ZDZF 5E2UH 1NANI 5GSRB 1YUHA 5KOMC 5J13B 4XCEA 4HGWB 4JKMA 4X42A 5JHDB 1RK0B 3BUTA 1U58B 3IFNL 4RDQG 4KNTA 4U3CA 5IESL 4K94H 3DJTA 1JF1B 1H19A 3KLAA 2Q2LA 1C12B 4XP9H 4KUCD 4YUEH 1HZKA 2ZF9A 3DV4A 5JIPA 5D2LE 3RGVD 1I7TB 1A14H 1CDHA 2I27N 1NINA 2AXGB 1QLEL 4I13B 3FQ2A 4HUXB 1MLCA 1EEQA 2R2BB 3KGTA 2B8OT 2V0AA 4NSKA 2B4CH 2GIYA 4NP4H 5E8NA 1UCBL 4WO4B 1FNLA 4BFFA 1MRCH 4K7PL 4G5AA 3WN5B 4XP6H 2CIIB 1IZKA 1OHZA 1TETH 1AD0B 3CD4A 1T20B 2DB8A 4NBYB 4OT1H 2R59A 4ZFOB 3WGVB 1GH7A 5IK3A 3LZFL 3KWVA 3LZQA 4AW4A 2CDEB 3W5NA 1CFQB 1QHPA 3V7AE 1CDUA 1AG6A 1CDBA 4XWGL 1A7RL 3ZL2A 3D48R 2P7TB 1JK8A 2FNBA 3CVIH 5JORA 3PS6A 4ZMQA 5FO8B 2RTTA 3W2DH 4WFGE 4I0PD 4PJIB 3HC3L 4ZT1A 5IEKA 1I8LA 1CDIA 2VDRB 5DJ0B 1FVEA 1LJMA 2NW3B 3RVUD 1WBYB 4F1ZA 4FQ1H 3NIGE 4LSTL 3VQLA 3S88L 3G5XB 1NFDE 2ARWA 3CFQA 4NT6B 3NIDF 4ELKA 5FECB 2OULB 1MFCH 5EC1A 3WAJA 2VN5A 3AGVA 4HIQA 3DIFB 4LQFH 2ARJA 2DLFH 3N9GH 4LDOB 4Q2ZA 1BV8A 1YYCA 1P7KB 1RFDL 4XN1A 4ODXA 3VFPA 1WV7T 2WYTA 4KDVA 3M17A 4RGOL 3FOLB 2BY1A 1CK0L 3JTSA 4AI7A 3DX6A 1ECZA 2IXQA 4GAJL 4BUQA 4X9GA 4HIXH 3L8QA 1AZCA 2ZJSL 1F11A 3QIBB 5FHAL 1JZ5A 2O5NA 4NQXA 1OCWH 3MN8A 2Z7WA 2FX8L 4Q7DA 3E3QC 4N28A 2BS9A 3L3JB 3OM3B 2ILLA 2BW5A 3N40P 3D09A 1I7UA 3L45A 3OKEA 3BVNA 5HYQA 1VESA 5BNXD 3UEQA 1GHFL 3U79A 1ODUA 4Z77A 3FTZA 3O3UN 4NQDE 3SGDH 5B3NA 5C0FB 1LP9F 3GXUB 1YAZA 4QMEA 3ZYJA 3B7YA 1BD2B 1J48A 4J3OC 4WTZG 1T66D 1MCSA 5DD1L 1UEMA 4TYUA 3R8BB 3RGBA 1G9MC 2ICES 1PG7H 2JJUA 4DO6A 1XIWC 4BSVB 2WLNA 5L88H 2GT9B 5I15H 3G5VA 1G1YA 1NFKA 4MQ7A 5AWNH 3BP7A 3OKNB 2BRRH 3FB6A 4Z5RB 2W0FA 4L29B 5I17B 3MJ6A 1VPOL 4FTDA 2XG4A 3T0BA 1S7RB 5ALBL 2X6CA 3B9KD 1JGLL 2VZ3A 4C4KT 2DWSA 1VFBA 3QQDB 5JQ6L 4PN6A 3I9AA 1UWXH 2J2ZB 2Y6SC 3NA9L 3BH8A 1ACYH 1KYUA 5EZLB 4JFFB 1OPGH 3ECBA 4NZRH 4ZS6D 1V54B 4TLKA 5LWYL 3E8UL 3Q6GL 1CL7H 2DBJA 2A6DA 1MFNA 3L5WA 4JW3A 4LCCA 2OJEA 4PIRF 5IQ9B 2VJXA 4MJ5B 4IOIA 1NMCB 5FFGA 1IRAY 5KYUB 1U3HC 1AGDB 5KAQG 4HIJA 1PLAA 1I1CA 1VERA 2NCMA 5CEXA 3QG6A 5CEZE 5DEGA 5EN2A 4P2RE 3HZYB 1TTFA 4J2QA 3VDAA 3TA3B 3UAJA 2W9EH 5GS2H 3ULVL 4EUPH 1SOQA 3DMMD 4S1SH 1EEZB 3RIFF 3ETTA 1HVXA 1M1SA 3QDJE 4M1GL 4OB5H 1HS6A 1FNEA 1M2VB 1P9MA 2CUAA 4N2CA 3MRHB 4U1MB 5KJRL 1Z32X 1XB8A 5E2WL 1BHGA 5CSZA 3QO0B 3DJRA 2XWCA 4QHKJ 3MRNA 1AR1C 4UT9L 3ROOA 4XO8A 2WXNA 3IPBA 4I7ZC 4E9SA 2YMOA 4W9HC 2MOVA 2H3XC 2IV8A 2PPDA 1MNNA 4OZ4A 3CN3A 3FPYA 5L6YL 5FW7A 3UAEA 3PQYB 5FCUH 3FQNA 1FYTA 1OB0A 2FCBA 1SBBA 3DX7A 3NJGA 4BZ1A 4LHUD 2ZOOA 2G3NA 3B2MA 4RGMC 5I8EA 1QYGH 2ZTBA 5DK0B 5BQ7B 1BZ8A 1KN2H 2VL5A 5HVFB 4QO1A 1A3QA 4ZNEA 4RFEA 3MRFB 4HWBA 3MFFA 4Y1TA 3T3PB 5CUSH 3VO0A 5F7MC 1GGTA 4JFSA 4LVHB 5KS9B 1HDMA 3GSVB 2XT1B 4GKLA 4AC4A 2XZCL 5B1AB 4UTAL 1K8DB 4CC4A 1EO5A 4CMMB 3BUDA 4M7ZB 4KKAD 1KCVL 1QO3B 3PWNA 4Z76B 4M43L 2J72A 4BKTC 5D7LB 4GKNA 4UNVA 2Q2EB 4FJZA 4X5PA 3Q1EA 4K3DL 2P26A 2OMBA 4E9QA 1JDDA 1QQDA 1KCUH 3VSQA 1RZFH 2HN7B 2DBLL 3BIKA 3GI8L 3POHA 3VGDA 4JVUA 4MDIA 1QRND 2F58L 1J7VR 3LQZA 4ODUB 2UY7A 4MA7L 3GSWB 1YEGH 1GYAA 3BPNB 3GRGA 3IE9A 4OJEH 5E6RB 4Q0XH 4ONFH 5DSCB 4CMHC 1Z9SA 1CG9B 4RZCA 4S1DC 1F6LL 3ZE1F 5HD8C 3TS8A 2MCG1 1WVZA 2UXVA 3KJ6L 4Z7NB 5KSBE 1A7BA 4X7SH 3ARPA 3GMQA 3IU4L 3T77A 4EF3A 4JG5A 3IBEA 5K33A 5IUCA 5DZAA 1RZQA 3D85A 2R0WH 1EJOL 3B56A 1JNNH 4F93B 4YPGB 4OY9A 2YD8A 3E2HB 3RDTB 5E56A 1CXKA 2MEJB 4XI5D 4N0CC 3D25A 3UPCA 3L3OA 1PF3A 5F7HA 4UM8A 1UENA 1XCXA 2ZCHL 4OCWL 3TBVA 3ME0B 3QT2A 1HH9B 4G7VL 5I66A 3CX5J 3B5GA 5DMYA 2VITA 3V6ZB 3EH5B 4OW6A 4UTBA 3ZE2B 2OSYA 3MLVH 3QFJE 4LARH 5HDWA 4A68A 2G5UA 3QUML 1OTUD 3G5WA 4JANB 3QDMB 1MIEH 3TLRA 2A73A 1AGFA 3QWNA 5AB0A 3BMWA 3M86A 1F97A 1O7VA 3GB7B 1NUFA 3IT8D 5C0BE 1S9XB 2EAEA 3OKMA 5LDUA 1UZGA 5D93B 1OP9A 2FK9A 3MUJA 3CVDA 3RX5A 2K6YA 3FTSA 1P4BL 1EHNA 4XPAL 5CMAA 4RSYA 2APWA 3RNKA 3P11L 4YO0A 2EDKA 1RXLA 2W9DL 3D69B 3MJ7A 3OB0H 3GYRA 1KB5B 3SBWA 1R3JB 2XRAH 4PRPB 2F54D 1JPEA 3UJJH 3A24A 2JJTC 2VDNL 1U8MA 2BJMH 3ILEA 4AQAB 1OZUA 4B27A 4JM2C 1S6NA 2PYEA 4Q9QH 3P54A 3CSGA 3HFML 1WC7B 5DHYA 1KJ2L 1GCYA 4AK2A 4ZFFB 4OGYH 3OKDA 4QXGL 1PZAA 1EMTH 3BUIA 1HYRC 5HHXH 3I3EA 3SDXE 3FRUB 3QXUA 4OTXL 5DWUH 1ZLVK 4KROB 3PIQB 5EO1A 2VTFA 3KBFA 4MXVE 2KPWA 1CTMA 3P2DA 2C7UA 3FL7A 3OR6A 4EXKA 1YNLH 5F1OB 3DECA 2XPGB 3EH4B 1E5YA 3QRGL 1W72H 2OX5B 4N2OA 2BINA 1JV2B 4DEWA 1HKFA 5M94B 1VZGA 4XT1C 3ZUNC 5K1NA 2YUVA 4EI6B 5EIIA 3QULA 4QRUB 3EGXA 1OWWA 2R51A 4IBSA 4KZDH 1C7TA 4HJSA 4OF8A 1FZOB 2NY7L 3EDJA 1XFPA 2EYTA 4U1SA 3TF4A 3UGXA 2IPUG 1JHLL 5HI4D 4L3EE 3BUYB 3LKSB 3ARDA 5BXFA 2IWFA 2KUTA 3KPPA 3QNXA 3QXWA 4G8EB 3SPCA 3BDYH 2FLMA 1CICA 4LSDA 4GFTB 3UTPE 4K8RL 1SLWA 3CSFA 3LEYH 1TQTA 4U1KB 1HOCA 2E9WA 5T1KD 4CVZB 1BJ1H 2R1WA 4D9LH 2XWDA 3ZO9A 3QGVA 5HJDA 4X4XB 4UV7L 3QRFM 3QPQC 2WP3O 1I75A 3D3VB 4MJ6A 4Z7VF 5D4QA 1SQ2N 3U1SH 5F97E 1ZHLA 5GGVL 3IJ7A 3V4LA 1H5BB 5GS0L 5HYJA 3QQ9D 3WFHA 1ZS8B 2CA4A 3MACL 3WFZA 4Y2DD 1EO8L 1QZNA 4YXHL 3G6DH 3GEWB 3D39B 3H9SA 1MOEA 4CU7A 2JCCA 4Y4KB 2XIBA 1ZEAH 5C92A 4CGTA 3M1OA 2HPTA 4GRWF 1FAIL 5BCAA 3CXHJ 3MOQA 1L7IH 4R2GD 3HAEA 2O5XL 1DUYA 2ICWB 5DT1L 3QRLA 4Y8DC 1NMAL 4W4NA 2Z34A 1NCCL 3RVWD 2AJZA 3VWKC 3HE6A 2P4AB 4Z7OB 1DSFL 1FF5A 5AOJA 2QSQA 5JIIA 1SM3H 3GSQB 4HCRA 2YAQA 3OF6D 1UB6B 3D33A 4BWUA 1BZDA 3V4PA 1LVEA 2OXGB 4KKNA 5H35B 4P05A 1FORL 3C6LA 2JJWA 1ZV2A 2WJ7A 3IAPA 3N55A 4WI3A 3LKOA 3TN0A 2RA1A 2Y36L 3QR0A 1B0RB 3LPOA 3L4WA 5ECJE 3T6ZA 2JB5H 1KY6A 4WUUD 1CLYL 2P5ED 1QG3A 4UZSA 4I18C 2QTEA 1Y18B 5E03A 1HYSD 4HOWA 4B5ZA 3JYCA 4AQZA 4F37F 3UZEC 4ZFGL 1FJ1B 2AXWA 2PWHA 4KKZA 4XAKE 1PBYA 4NM4L 3N1FC 4H0LC 4N0UA 4KVCL 3IGKA 2Q8BL 4Y1SA 1U3ZA 3WYRA 1NL0H 2FEJA 3E80A 3GNMH 3P77B 2FD6H 2OQJB 5ERWA 4FNLL 2XQBH 3HVDA 3N85H 4ANKA 3WFBL 5EB9A 3PHQB 4PUBH 3E3QE 3F58H 2Y6TE 4LDEB 4PJ7E 5FHBL 3PP3H 3S34L 4FJYA 3MRDB 5IB5B 4NDMA 4Z0XB 4PHXA 4PJAA 2A5UA 4R9HA 5C0CE 2FJHB 3U7YH 3DV6A 1YRKA 3OPZH 4IOSA 3VI3E 2NXYD 4UQ9A 4FQJL 2Z92B 1P4IL 2XN9B 4A1RA 3CFMA 1QFOA 1A6WL 2RFXB 1MLBB 3NZ8A 4LVEA 1ND0A 5J5EA 1MELA 1QSEE 1W16A 4BH7A 2GJRA 2HVKB 2J1YA 1A25A 1NZRA 4H1LB 5L2JA 3S4SG 1A0QL 5E1HB 2OR7A 5HHMB 2APSA 5HHOB 4PJXF 3FJTA 1GL4B 3DRTA 4GG6F 1PX4A 1M71A 5FO7B 1LM8V 2ZONA 2Q76B 3ZJAA 4C83B 5T3XD 2OI9B 5CWSB 2BERA 2D0FA 2DLTA 4ZOCA 3T3ME 1RLBA 2XLLA 2FRGP 3IGUA 3O2VL 1QI5A 4MNGA 4XAWH 5HJGA 1BREA 1N5AB 2X0WA 1X4XA 2WO3B 3OWRA 5FB8B 2WZAA 4LEXH 4KX9A 1W8OA 1L6PA 5C7XL 1M42A 5F72S 2CUIA 3MOAH 3P1VA 4GP5B 3VSVA 1OAYL 1ID5I 3VXSA 1PY9A 4JE0A 5DFAA 4DERA 2Z0UA 2R29H 3KWXA 3KPRA 3C2AL 2GTWB 3BOVA 5MEQA 3SOBL 5E8EB 4DW2H 1CU4H 4C47A 6CGTA 5F96L 1FPTH 3WLWC 2DYPB 5B38B 3CHOA 3W39A 2SEBA 1ET8A 1YEKL 2Y7QB 4Z7QE 2NY5L 1T0PB 5IVNA 2B59B 4GO9A 3VSUA 4GIAA 4WJ5B 1MCDA 3CZNA 4MKTA 1F3JB 3DUHA 1L3NA 1JHKL 1O7DC 1AXSB 4QLWA 3O6FD 3MRRA 4P5RA 3U0TB 4M7KH 1F41A 4NUMA 2PR9A 3ZKXC 5IF0A 5D2NA 5C0AA 3DLQR 4JL1A 5EO9B 1S46A 2GK0B 2X40A 5LXVA 2C34A 4ZMWA 1QPKA 3M46A 1YEEH 2AGJL 3O6LL 1QMUA 2WIIB 5B1BB 2LAGB 5E6IC 2X0UA 3LDBB 3FT3B 3HRZA 5GZNA 1T83A 4PRHB 3VG0L 3BFWA 2V7NA 4GAGL 1CC3A 4PMFA 4NQQA 2DMGA 2WLMA 4G6FB 4Y4FA 2HJLA 4NNYA 4OZGA 4HEPA 4N2EA 2Y6SD 1X4ZA 3BQUA 5F2FA 3Q9QA 3TEUA 2N7SA 1FNGB 4JG0H 4FZEH 3GMNA 3ULUH 1EHLL 1IU1A 2CHZA 2FL5B 4AQOA 3RYMA 5GS3A 1AMXA 4L5FH 1H3PH 2IPKA 4B9PA 1QNZH 1QI3A 4FYQA 3FONB 3INUH 1SHWA 1SYVA 1X5HA 4ZUWB 3U25A 3FUMA 2X4SB 1M6OA 4UAOB 3EFFA 4APXB 2VSDA 4O9HL 4D3CH 2M83A 2OA9A 4P9MH 2GCYB 1PKQA 3BH4A 3VFOA 1YQVH 1T1ZB 2QEJA 3PL6D 4BFNA 1NUGA 5FYLD 4PLNC 1OSPH 2HRHA 2OL3H 3PGFL 2PXYA 1U95A 2ATPB 3FCSA 3GGWA 2OYLA 4ZYKA 1L9SA 1JZDC 3WFEL 2HUHA 2QLYA 1J8HA 5ICXA 1YY9C 2GSIB 4P23D 1DBKL 2K3TA 2WNGA 2EDOA 5SWZE 1UA3A 1NA8A 3H7LA 1KUMA 3B2VL 4YHML 3OG4B 2L0DA 2V6HA 5KTEL 1U8PA 4X6CA 1IKOP 5FYKE 4F2ME 3NJNA 1J86A 3REVB 1IGYA 4RFOL 5IEHB 3D06A 5ITBL 1NBVH 2VR3A 3GSXA 4I8DA 2ATAA 1VCAA 4OCSH 2HKAA 3QCUH 3QUZB 5F3HA 4QRRE 5IB2A 5KVEL 5CEYB 4D0CA 2CLVA 3QK0A 3IVKB 1OSZA 1IIKA 1DJHA 4I0PB 1NGPH 4HGKC 4FG6D 5GGRY 2ZZUT 2RBLA 3KMDA 4BFIB 4NIKB 1YNKL 1S78D 4Y1AE 3PPEA 3SKJH 4UT7H 2XJKA 3H8NA 2GHWB 3CIAA 1XGUB 5EV7A 1IILE 3LZOA 1WFMA 2C7FA 4QXUH 5IHUH 5D1ZC 2AJYL 3T0VA 3TYGH 2XQYK 5J6HB 4GLRH 3MV7D 4RA3A 1TVDA 3QSKB 3VFVB 1FFNB 2PABA 3KGRA 4M62H 2ZSWB 3RJOA 5GGTH 3V0GA 3SE9L 3FTUA 4FQXA 1XTMA 5J8OA 5L4JA 1LWJA 5IMMB 4G6MH 3D08A 2OXHB 5KSAB 4AV4A 1DANT 4QRQA 5HHNB 5D8JH 2EINB 1VGKA 3CFBB 4PRDA 3IFOB 3FUHA 4LGPB 3QJVB 1G7PB 3FDWA 4WU5B 2G0LA 4I3RL 3FB5A 2H0JA 2QTVA 3SDAC 1DFXA 3ZKMD 1EHXA 1T03H 3KNBA 4YXKL 4M5ZL 1JAEA 5K9OB 3WXWL 1ZGLM 2BFVH 1A4JA 2IDQA 5HDBF 3GUTA 4OH2A 4B60A 4CU8A 1G7HB 1CFBA 4PI0A 4UOW0 3CFTA 5JIHA 2XTJC 1JNHB 2YZ1A 3S3DB 4AKOA 1MZZA 5DJ2B 3LN5B 2P8LA 4JN2B 4H26B 4OZFG 4PRBA 3RVVC 4NOBA 3MXWL 2RD0A 2BIOA 2FHBA 3BPLB 1G7MA 2QADC 3OGOE 5AL8A 3V9FA 4JHZA 3MROB 4P4KC 3T71A 5F7EL 1KSRA 4QTIH 5F89B 3MUY1 5AAMA 3V4VB 1BQLL 2NLJA 4UOJA 5CZRA 5GIRB 3B9KB 2FIKA 3IDGA 3PNRB 3VXMD 4YE4L 1HHGB 4CVXA 3ULUE 1D5RA 4I4WA 4QXWA 4YHIB 4BEIA 2V2TA 2JNZA 1T7ZA 4LLUB 2DM3A 1OP4A 3KVQA 5ANME 4MMXC 5FUOH 4RX4A 5CBAA 1DJWA 3CQFA 4L1TA 4TVPH 3QIUB 1B9ZA 1XZ0A 2XFGB 3LPFA 3NABL 4KHXH 2NX5D 4UANA 5FAAA 1B0IA 2C3VB 2WIMA 3RX9A 1MKFA 3IDMB 2AV7A 1I8IB 1A47A 3FO2B 3KR3L 3PAYA 4JM2D 5FGBC 5BV7C 2WD0A 1DLHA 1TQSA 2JKNA 1LO5A 3UTTA 1MQKL 1UADC 2CLRB 4M4PA 5C9KA 4E9WA 4UTAA 1GS7A 4I5BA 4FMFA 4IRJA 4WWPA 5DJAA 3LH2H 1KYDA 3DMMB 1GIGH 2G5RA 3DOHA 1O5PA 3ZRSA 4D9QE 3H7BA 1UM4H 4R4FL 4X80H 1C5DA 5FKAA 4JRYE 4G5ZL 1JPSL 1AFVL 1RHHB 1BVKA 2FWLB 4MBOA 5CINL 5IV2B 2F5BH 4KH2A 4ORZC 1IC1A 1UT2A 1Q0EA 2Y22A 2YBGA 3F7VA 4XXCC 3DDFA 4YAQA 3F6JA 1IO4C 2CRMA 3FT1A 4NZDA 1ADWA 3MOBL 4F24A 5JPNB 4X99A 3T6WA 3S5ZA 4EZLA 3CZFA 2V2WB 1ZTXE 2F5AL 3AY4A 3NTCL 1WBZA 4G71B 5LAPA 5B8CA 3MRQB 5FYJL 1N6VA 1RERA 3I85A 2BSRB 1IGCH 3TX4A 3WEAA 2IWKA 4XNZC 2APFA 4PS3A 2WBXA 4OLWH 2H2SD 4K7PX 2EO1A 1QFWI 5GZOD 3P30H 4HIHB 4K7FA 1IVLA 2YN5A 4L8SB 4R0LA 3L3HB 4Y89A 3U48A 3K6FA 4XOCA 1I1YB 2V8LA 1ETZB 3GBEA 3Q5TA 1V3JA 4AJWA 5J9PB 4KJWD 3CN1A 1XZWA 4NEHB 4RGND 5H37A 4HWBH 3GDBA 1QWNA 1T2QH 2CGYA 3CQQA 1LEIB 1PY4A 3C5ZD 1QRNB 3TGXA 1H3XA 3BJ91 4HCGA 3QUMA 1PDKB 5AD0A 1IC4L 3LPGA 1Q72L 2C1PB 3BKJH 2G9HB 3NDYE 2VSMB 3P4MA 4UT6A 2LTQB 3LN9A 4XCCL 5MENB 1Y7VA 3NP3A 1DVFC 1WYJA 3QJUB 1TJGH 3IFPA 1I8MB 3GMPA 4ZUVA 1DQMH 4NUJB 4X6FB 1EUTA 1IAOA 1MH5B 1TNMA 1XGTA 1IC5H 3C9NA 5J4MA 5L2KE 3ZU8A 5GQBA 5EEWA 1FZJB 3ZO0A 3ZTJH 3CQPA 2VDQB 3WS6A 3BWUC 3GMMA 2WQAA 4HWZA 4BQ8A 5L8LB 2CUHA 1Q9OB 1N0LB 5CJ5A 1OGAA 1M9SA 2CWRA 4GBXA 3RUGF 5T3ZE 4TULL 1DQKA 4JRXD 5D7SL 1NBZA 2R0LL 1KJ2A 1AHWB 5DUBB 4HMDA 4FFYA 4KY2A 4BJLA 3VXRD 1TZGH 4PTTB 3PRZA 5DGQA 3VA6A 4S1QH 2XVKA 3QJQB 4XRCB 3FFCD 4X6DF 5F0MB 4P3DA 3IMRA 4ALAH 5KANI 3P0VL 3N1QC 4F9LC 5ABZA 1GVIA 3Q5YA 4XXDA 2J44A 1AIFB 4N2BA 4OZHF 1H8LA 5DRNB 2OP4H 1UKTA 4AGPA 1J5OH 2HVJA 2O6FA 1KACB 4GG8B 4Y19A 5EIVA 5MI0B 4DGUA 2C9QA 4TM9A 4EXPX 3CFKA 4X0KA 4ZFZA 3ZHNA 5C9JA 4OI8A 2F54B 1CO1A 1E6OL 2ENPA 5JOPE 5A16A 3MRIA 4QNPF 5DRZB 3VA2C 1OCRB 1QFPA 4Z7WA 3IDNB 4C57C 4CA4A 3D2UB 4WK2B 5EPMB 1OW0C 1KBPA 1HJCA 3KPOA 4JFZL 2MCPL 4L18A 4I3GA 5MP6H 3RKDD 2NQ3A 2EC9U 3IDYB 5F7BA 4IMKC 4YZFF 4NQUA 3L9RB 5DA4A 4A7QA 5C0EA 4HCFA 3BH9A 1MCPL 3CVHL 4O2FB 3KVDD 4PG9A 4KJQC 2NY0C 4F57L 2X4OB 2ICEB 3G08B 3HI6L 3QQ4A 5EZOH 4LL1A 4LCWE 1GPOL 4JFHE 5JIMA 5DMIH 1A6ZB 4PJ5D 5EF2A 1ORQB 3JTBA 4PJEB 4A2LA 3F64A 3HFFA 2ADGB 2QR0B 4G8GA 1RMFL 2FSEA 1LMIA 3ARFB 1DDHA 3WTUA 3NFPB 1T6BX 4WNQA 3M1CA 5D2LF 1J1XL 1DVYA 5FIEA 1KBWA 4LP5A 4WK4B 3E8VA 2W38A 5TPWH 2B2XH 1BZ9B 2D3JA 1MVFA 2ZP9A 3X3FH 1D5MB 2YBRA 4I1PA 4XMWA 5KEZA 2EIZB 4ETQA 4EBQH 2Z8VC 2A0LD 4O51B 2AKRB 2QDVA 3OL2A 4K4KA 3Q2NA 4P3CH 1FYTE 2DS4A 3QORA 1BGXH 3CK0H 1CLVA 4P2YA 1JNLH 3GO1L 2JFCA 4L1LA 4PB9L 5JW5A 3W1ZA 4F15C 5T1KB 2YPLE 3PJLA 4ZNEE 1WUNT 3SE8L 4G82A 2FECL 2AZUA 2DQIH 3MBEC 4CILA 4PRAA 5J3HC 5G4OA 4KJPC 2ENYA 4OF0A 4P2AA 5I18L 5D72L 3UC2A 2VIRB 5KJ7E 3UZQA 2ERJB 3ZLQC 2XZQL 4JFTA 2JI2A 4U6XA 3ARQA 3HVNA 1A02N 3CX5K 3QFDA 1EBAA 4JBSA 4F33A 1A9EB 2ZPKH 3LKPB 3ML8A 4IGBD 2G2NA 5C7ZA 3HZMB 4HPHA 3UGUA 4JLRB 2K0RA 4AZ8B 2B3IA 2P43B 4H25B 4WVRA 1WP6A 1HXYB 4U7SA 5TGBB 3S36L 5AG8A 2AANA 5JLZB 4ELMA 4JFQB 4HUUB 4X8XA 4R2GB 5CGYC 4A04A 3VFTB 2V7HA 4L0ZA 5L8KB 1ZSDB 1O6TA 1DQQA 3BFOA 3HE7C 4QHUB 3REWB 2JB6B 1A21A 2FGWL 2BC4A 2R27A 3NUKA 1D6EA 3EO9H 4AYBA 2IH9A 4HUVB 1NC4D 5AAPA 4KY1L 4IBZA 4OCYL 1I8UA 2IOMA 3IK2A 3NBNA 1T6WA 3NCCB 4B0MB 4RDQF 1IGTA 3N42B 3T4YA 1EZVX 3VJ6A 4WW1A 4DJMA 5IR1A 5EIIG 5AYQA 3HAEH 4ZK8A 2IPTH 4TLSA 4M4RB 3B43A 1I3RA 2P5EB 2APTA 4WUUB 4UINH 3NPSC 4B7LA 3KPTA 2QL1A 4E68A 35C8L 5FYJU 1TMCB 4BM7A 4EOWH 4HCRH 2DM2A 3S8FB 5C3IA 3O0RH 4G7YH 5D7JA 3RL1A 1Z3GL 1BM3H 3QXAA 3JUZA 5LBVA 4CJ0A 1L5GB 4KKCC 4TNEA 4U2YA 4OGAD 4ZS7L 4KUZH 2EDTA 5I19H 3MRGB 4JPIB 4ZPTB 1FI8C 1GMEA 3BWZA 3VXPB 4WF7A 1QR1B 1I9RH 4JFOB 4TUKH 1TFPA 4F9PA 3SCMA 3JV5A 3HG2A 1XGRB 1UJTA 3C5SA 4PV8A 2DD8L 5CZKA 1T3FB 3NCJL 2DQGH 2VE6A 1PZDA 2DL2A 3U4BH 4FNQA 1GTNA 3O9WC 4EN3A 1THCA 1CT8A 4GQPH 1I9IH 3L08A 1D5XB 2QHRL 4XMPH 1E27B 2WGXA 2R0ZH 2ZKHL 4KJYA 4WWOA 1QHOA 4AEFA 1C7SA 1TJIL 1B0GA 4U33A 5E8OB 4MFHA 1YDPA 4UMGA 3RA7L 1H6FA 3OKKA 4HZLB 2BK8A 3ETSA 3HKZA 4QCIB 5DFWH 4P5TD 5CJBA 3N1PC 3MLRL 1KGWA 3AUWB 2AITA 4QR7A 4RH4A 1PD0A 3L5IA 4WJG3 4LCIL 3BEWB 2XKNA 1ESOA 3HAEG 43CAA 4L9DA 2QQNH 3EGDB 3SO5A 3DGGB 5IB4A 5BZWA 2OSXA 1NLBL 2WVUA 4MA8L 5C09D 5AG9A 2ADFL 5DVNA 5I1DA 2QPEB 2ZUTA 4G8IB 4EDXA 2AEPH 4FTVD 3K72A 3MXVH 4LLVB 2X9XA 3HUJB 4I1RA 2YLHA 4JHUA 1LEKB 4GFXA 4YXLL 3FU3A 4ZFOL 3H9HB 2OZ4A 3SKMB 2V4LA 3ELAT 1XF5A 2ZOLB 4G1EB 3FUEA 3FPXA 3ULAB 4HSCX 2EIBA 2HT3C 1N64H 5I8KL 2Y5TB 1XR8B 5H8DA 2IDUA 3ZT6A 3UCRA 1U92B 1BXVA 1IGMH 3IN0A 3AT9A 1MCOH 3EDKA 3FBKA 5IQMA 3HI5H 1M7IB 1PLCA 4JPVL 3PHOA 2UZYA 1PZ3A 1UUNA 3MODH 2I60H 1F1DA 5TD4A 5E6YA 1KBGL 4EDWL 4JUTA 4FQIH 1DJIA 4FF9A 2VDRL 1M57B 1I8KA 2Z4QA 5C6PB 2VXTH 3EZJB 1RUQL 4M1DH 4Q4IA 3RWFA 4GNKB 5GS1A 4ZXBA 5D7IB 5FDWB 2ESVA 4BQ6A 3ZTDC 4DTGH 1OAQL 2LW3A 2O5ZH 4EIUA 1EXUA 4RBPK 5I6OA 2VO5A 3QR1A 1G7QB 3LXUX 3AM8C 2XVGA 2H26A 4YQXH 3VTTA 1XIWB 2X1OA 2VQ1B 3Q0HA 1V8HA 2IGFH 3VFMB 1F4YL 2WAHA 3IKKA 3RVVD 4QYOB 4QJ3B 3GIZL 5IROA 3UFIA 3SE4C 1SEQH 1PZUB 3WKQA 2X7LB 1QW8A 2DQ6A 4F37K 4I1NB 3SYOA 4DQOH 1ZIAA 2QADD 4U3XA 1UT9A 3MLUL 4O02B 4XMKL 1T04A 2EYSA 2KLRA 4W4OC 2E56A 2QKIC 1I3VA 4FYSA 4KQ4H 4MYWB 1NCAH 4Z0BH 4AQEA 5B21A 3VD9A 1TKWA 2IBBA 5H94A 2DL9A 2R1XB 1FE8H 5E2JA 3U30C 3WFDL 4K3EL 4OU3A 1TR7A 4BCYA 5D1QD 3A6BL 4GRLA 3RWHA 1WZ1H 3TPUB 5KSBF 1T1YB 1N4XH 2C4FT 3FKUS 1TJXA 3FO9A 5KAQF 1NGQH 4BCZA 3WE1A 3HS8A 1RKRA 4ISVB 2JKSA 4K7PH 2BCMA 4M93C 4XB7A 4DP7X 4PCKA 2EUZA 1KG0A 3GBML 3KXFA 5DUJA 1UXSA 5TE4L 4G42A 3CPLA 2W07A 5SV3A 4V2CB 1N6QL 3D50A 2WKOF 4NUQA 5AOMA 4AXWA 2GG1A 2G0KA 3MUGB 3QJFA 1GC1L 1OHQA 2E76C 2HLFC 2X2UA 5D4HA 1TVBB 3L5XL 2K7QA 3UBHA 1I1FA 1N2RB 1QSFB 2O6PA 4X5QA 3RI5K 4IRSD 1AR1B 2E7LC 3UJTL 4YBQD 5IMOA 4P23B 1LK2A 1SQMA 5AYUL 1ZWIA 3I50L 4BA0A 1U8CA 2WINB 1MFEH 4LDLB 2KHAA 3N1GC 4PI2A 5GGUB 2DIAA 1CGSL 3K6IA 3X11A 3GXDA 3ARXA 2DH3A 2PCFB 1TZIA 3A4DA 3CSBA 4FE9A 4G6KL 3FO0H 4KX8A 1KPUA 3RAJH 3RIAF 4G2AA 5DVKA 3NEEA 3HJEA 3KLSA 3AB0C 2C4XA 1YPZA 4NZFA 2DDQL 3CFEA 3E7JA 2NTSP 4QIRA 1ID2A 1RFDH 4NP9A 1J0KA 1KGCE 3CC5A 1PAZA 3LCYA 2YUXA 3NACL 4X98A 3DO7A 3CDCA 4PJAE 2ZUYA 4AM0A 3QWOB 3X1EA 2E46A 4P57A 4GAJH 4MAUL 4QHMB 1EFXD 1NGZB 1G7JB 4HWEL 5I5RA 4YS4A 4KTDH 5E5LA 5FHAH 3Q1SL 2RH0A 4LGRB 4NJ9L 4D0BA 1V3KA 4NQEA 4UDTB 4S0HA 2A6IA 2FBRA 3KS0H 2Z35B 2Z8RA 5SWSD 4Z7UA 2ZG3A 3QVAA 4QAMB 4R96B 4FG0A 4MXVF 4HEPG 5D6CB 5IFAH 2UWEE 3VACA 2ZD0A 3ZHLA 3FQXB 1FZKA 1RAMA 1B2YA 3ARBD 3AT0A 1MY7A 2RJMA 1MFAH 5DF0A 3QHTC 2AW2A 1UA6H 5IW3A 2LT9A 3CU7A 1DVFD 3MLWL 1AC6A 4JN1L 4MCZB 4N8CH 4PP2A 4PJCB 1B0WA 3IDJA 3PP4H 4GO8A 1ZCRA 4HBCH 1ETB1 2WCSA 5AUMB 3VI4B 1PZ2A 4Z3JA 5BMFL 5DVLA 5MERA 5F7UA 3ARZA 1J0HA 1KGYE 2F74A 2R9HC 2NR6D 2R56L 2DQFA 4JR9H 4ODSH 1W0VB 5DO2D 1NGXB 2P1YA 3NQIA 4WWKD 3VXSE 4X2UA 3DUUB 2WNKA 3L17A 3OMZA 4XH2B 5F70A 4LESA 3WNOA 4CBPA 4CUCA 4XOEA 5DS8A 5KVMC 3W0WA 5KVFH 4YIQA 3L2LA 2G75A 3QZLA 1J5DA 5JQ6H 4BUHA 3UTSD 3GS7A 3FH8A 1FVCA 1U91A 1JPFA 2MJWA 1RLWA 1RUKL 3H3KA 2YQ3A 5HHVH 5DMGD 3NA9H 3WUZA 3ZDYE 3MJ9A 4JREC 4DN4H 4HPYL 2K6ZA 4ZO6A 3MRBA 2ZUQC 2XQYA 3TPKA 1E28B 4DP9X 2Y0SA 4KQ3H 4J3SA 2F53E 3VFNB 4MD4B 3QB7C 5GGQL 5JIKA 5ID0A 3W3BA 1MJ7L 4LE8A 4WFGD 4A2MA 3BP5B 2OR8A 4GEJA 1KTKE 2OV0A 2Y1ZA 3NJXA 4PM1A 1W0WB 4HJTA 3FQTA 4HS8L 1YYLL 3TONA 1GGIH 1S7SB 3H6AA 5D2NE 5C0AE 4GW4B 3F12B 2D7QA 4O5LL 2RQ8A 4F7MB 4OQTA 3FB8A 4NRZA 1ZLUK 3E6FA 4XVTH 3B5TA 2VDLH 3HMWH 5HPMA 1T5XA 4KI5C 4OCXL 5EIQA 2K1MA 5EU4B 3RKPA 3QUKB 2NX5B 4DFIA 3HS0A 1NEZB 2YOCA 3R4DA 4JM2B 3C6SB 3PNWB 1JZJA 5E4OA 2WXLA 1XH2A 1U36A 3S37L 4OZGE 5A2JH 1A64A 4WFFD 3U9UB 1P5VB 2X88A 3JWNC 3EO1A 3I3BA 3QXDA 2Y2YA 3AMLA 3VG9C 3TURA 1CS6A 2XACC 5E9DD 3QWRA 4JMNA 3STBA 2O6EA 4I87A 1B88A 3GUFA 4KKBC 3BDXA 1VFAA 1YC7A 3IU3A 3WS3A 2HRLA 3D30A 3B8SA 5B7FA 1YNTF 2X70A 3BT2H 3O3AB 4JKKA 4HD5A 3LD8C 3O8XC 4ZO9A 4UTAH 3KLHC 5AQ0A 1RZJH 4AZUA 2DQEL 4LHQB 2D31B 3ZR5A 1MWAB 3HG1B 1BM7A 1RZKH 2GSGB 5TFSL 5JW4Q 2MHAB 1NGYB 2GAZA 4P04A 2X6UA 5CU9A 1J9TA 1KB5L 2WWMD 1HCYA 4M9OA 4GSDH 1UACL 2UVEA 4EIGB 2DBLH 4NQSB 4R5TA 1RVFH 1JUFB 2VDOH 1IBDA 2WWKT 2CBQA 3J7HA 3MV8D 1D6VL 4PJ7F 1E5CA 2FHCA 5CAYB 1MCJA 2TSAA 3QPKA 2BP8B 1F00I 4R8WH 4X6CE 2XPYA 1SBSH 2CDFA 1QVOA 3IGFA 2BCKB 3VI3F 3KPNA 5DVOA 3IU4H 3NSYA 3LNFA 1ZVYA 1LHZA 1RPQA 1JD7A 3QNZB 2JKXA 5FUCE 3FQ4A 1SJXA 3C5ZB 4KJPD 4M6NL 4PQXA 3O4OB 1YEJL 4NPYA 15C8H 1AI1H 3ZGHA 4JG1L 3WLBA 1MEXH 4MTMA 5IHZB 3G7TA 4ENZA 1E40A 4PJXB 5EA0H 3ESNA 1JGEB 3DJSA 5LGJA 1HHIB 1JRHL 3T3MF 1DP0A 5H37H 3T4AC 4LEOB 3NP4A 1UJ3C 4Q6IB 4ABVA 4YLBA 4J8RB 3R7RA 4PLOB 4BQCA 3VFUA 4R7DA 3KPQA 5FCSH 4DUVA 4J3VA 2VJ0A 3T8VA 5HVHC 4JO3L 4NKDB 5CGYD 4TVSa 1CD1B 2IOIA 5J1AA 3ZTEA 2X4QA 2D8KA 4UT6H 4JCMA 4YHPB 3RU8H 4HBQA 3VRJB 2BNRD 2FECI 1S7XB 3U1PA 3BVDB 4XVJL 5FO9B 4FXGA 1LNUB 1P4BH 5C0GA 3DVGA 3VXRB 5M7QA 3BN3B 3VH8B 1F4HA 1KTDB 3S35L 2I7SA 3P11H 3O3DA 1Q0XL 3V6FB 3U83A 3WJMA 3FFCB 1ML0A 1DCLA 2IAAC 5C97A 5I1CL 4LU5H 3ATDA 3VE0A 3P69A 1R5VA 4I18B 5DRWB 4Z7QF 1ZA6A 1A6TB 1V5JA 4K5LA 3FOMA 1AH1A 3B3BA 4BSWA 2PYFA 3HZ3A 1QFWH 2UX7A 3BQVA 4NENA 3ULVE 4FFYH 1KJ3H 1A7QH 3T0XA 4E9TA 2ZWZA 1VF5C 4JQVC 4EIZC 2NY5C 4B9FA 1KCRH 4A38A 4KQ0A 4ONHA 1A8ZA 1T21A 3N50A 3SDCC 1I3GH 3KW7A 1CWVA 3O6KH 4XNAA 1SLUA 4KXZI 1E4KC 2XI9A 5H37G 5B4MC 1JYXA 2ZKMX 5J3HD 2AABH 1KT2A 2APXA 2PWFA 2J1ZA 4U6YA 2V33A 3GHBH 5EOCH 1G6VK 2AVGA 1TZOA 1QSZA 3HNTL 2YR3A 3HBQA 2CBOA 1OM9A 3O9WD 4IEFA 2NNFA 2CG9X 2I5YL 1MJJB 1MCIA 1NAKL 3COOA 4NQCA 5DD5H 2FR4B 4PJFB 4PPTA 3UAAA 1G94A 4U6TA 1AZUA 1BVLA 3VW3H 2BSED 3DIDA 4N9OB 1DZ0A 1A7NH 3PGCA 3IJHA 4N0FA 4I85A 3A0OA 4ORGB 5F1NA 4YSAA 4OJDH 1B2WL 4PJ5B 3ARGD 5FGSA 5C6WH 2JKIS 3CFJB 3RTQA 4F7PA 4WRLA 3BZ4A 4EJ1C 4RMRA 4FQPA 4X4MA 4JKNA 3BESR 5FV2A 5IKCB 1BIIA 1NFIA 4JFDA 4Q9RH 4LLWB 1YLBB 1LO0H 3I74A 4NC1E 3NCYP 1B4JH 1F4AA 2E9BA 2G3MA 1KV7A 1QBLL 3L4YA 4XMVA 1UM5H 4AW7A 4XBGA 1UZ6E 3GTNA 4OIFA 3MNZA 3BISA 3QFJD 3KPLA 12E8L 4X7TA 2UZIL 4A7GA 2Z91A 3KPMB 4JGJA 4N24A 3CPUA 4BK8A 3GMLA 2FO1A 4L37A 4JZNB 2LLGA 4XPFH 5IBLC 3WNLA 2YPKA 3AJ7A 1MFBH 1WS8A 4MDRA 1UKSA 3N2JA 4PJGB 4QHLB 4HJJH 1QEWB 1KLGB 4OGXH 3WKMH 1MREL 1FO0B 2CO4A 2JELH 4OF3A 5AL0A 5D96C 1CDJA 1EAPA 4RLDA 2XFXB 2ZNXA 3Q5OA 4WENB 1S5HB 4L4TD 1AKJA 1P2CB 3OMNB 5EZPA 1YEHH 4D8OA 1A3LH 4AMKH 4WGWB 2YWZA 3FHEA 2ZIDA 1CXEA 4OLZL 3OHXA 3DVNA 1TCRB 3G6JB 2B14A 2N56A 3MJ8B 4ONOA 5DT1H 3TVMC 1IGFL 1NJ9B 2VZ1A 1ZV5A 1YVLA 2JKRM 2WLHA 4G7RB 3ALWA 5E5MA 1OARH 2NY2D 5JTWA 4OLYL 4IGBB 5GS2D 1M05B 4WI8A 1EIBA 2AJVL 1ZLVH 3ZKXB 2Q1EA 3CDZB 1KYOJ 1XF2B 1UVQA 1UOLA 4BFEA 4KHTH 4DSYA 4HJEA 5I28A 3T2NH 3VQ1C 4ZTEA 2XZAL 5E6IB 1CIUA 3ZMRA 2PP9A 1ZK5A 2TRHA 3NK4A 1T7XA 1R0AH 4K9EL 1OXYA 4TSCH 3LHPL 4H8WL 1T1WB 5DWPA 1Z9PA 3BKCH 3B3IA 4W9IC 3WIHH 3K6DA 2X4RA 2VLME 4HFWB 4PCYA 2WWOA 3BI9X 1M4KA 1NC4B 5KBDA 1ERNA 1PNDA 2GJZA 1U0QA 2A77H 5LNEA 3LRKA 5D7HA 1A6VH 2DQUH 2PO6C 4UV4H 4HF5L 3WEBA 5I1AB 1DBAL 5KANG 3WFBH 2ADIB 4X4YB 4NGHH 3QDAA 3TBSB 1PZ5A 4G9DB 3L1OL 5JHDA 1FAKT 1RK0A 2YAEA 2G5BB 5FHBH 3DUSB 4IMLA 1FIGH 3V52H 4UBDC 1J1OL 5BO0D 3FF7A 1DSYA 4JVWA 1V7MH 3CLEL 4X5XB 3A4EA 3UTPD 4PY8J 3WXVL 4BFJA 3NJIA 1I7TA 2VN7A 1DZBA 2IFFH 3WV0A 2ZX7A 4ZW5A 1A6WH 4HUXA 4QRPE 2R2BA 2D2CC 1MCWM 5AVQB 3ZTNL 2VXVH 4HQQH 3WN5A 2XY2A 2CIIA 2XIDA 4B9KC 3IYLW 4H44C 3T0AA 3KWWB 1AD0A 2X9WA 4TSBL 4MD0B 5LNGA 1V7NH 4HKZA 3QEUB 4MDJA 4UQEA 1GOHA 1PY0A 5FDYA 2CBTA 1SYSA 5AZUA 4ZFOA 1WBXB 2AV1A 3X2QB 2OMXA 2F8XC 1BMZA 4MXWL 1O9ZA 3AG3B 4NZUL 4YR6A 3ULUF 2J6EL 4KO9A 3T0ED 2NXZD 3FS9A 2ZXWB 2OMWB 2P7TA 4OIIL 3MA7A 5EULV 5IP4A 4QHNA 5D1XE 1GMIA 4HK3J 3F5WB 4P9HL 2BFGA 4Y4HC 4I89A 4KPHH 3U2JA 3BAEL 4ABUA 1SN5A 3MLZH 4P5TB 1S9WB 1JXJA 4WTWA 5DJ0A 4XCNB 3EYSL 1XH0A 1IKNC 2YC1B 1P7QA 1A65A 4RSVA 3EDDA 3G5XA 4CN6A 4DKFH 5IGXL 5C2UB 4NT6A 4PW3A 3V0JA 2WZ0A 1HK6A 2NNAA 1XO8A 2EEXA 2A6JB 3GZQA 1GY2A 2Y7MA 2ZXGA 4E5XG 5FGCB 5E24E 2BZCA 5D1ZB 1CBVL 2DAVA 4BK5A 1RY7B 1P7KA 4FTVB 1H6UA 3O2DL 4B9JA 5KYWB 2F08A 4LRIC 3A4AA 3X12B 3CLFH 4DH2A 3JV4A 1N8ZB 3FYIB 2UXFA 4XCFH 3O4LD 3T2QA 4YGVA 3ATAA 4HV8B 2JF1A 4N8UA 3MLYL 3L3JA 1K4DA 4MXQC 3HLAB 1D9KC 2OPCA 5LQBH 1KIPB 1B4LA 4NNPL 3ZQ9A 1MY5A 3F7YB 5B3JF 4ZTOL 4UQAA 3WKYA 3OKYA 2I7OA 3W5MA 3LNDA 4JFYA 2LR4A 3BKYL 1F2QA 5C0FA 3SDAB 3MLSL 3VNZA 2OZ4H 3OXRB 4JB9H 2WNXA 5JW4R 3VDCA 4HFUH 4J3BA 4DFHA 1JGUH 4Z7VA 5T1DL 4F3FA 5C0CD 3S3SA 3KGUA 4GYBA 4LP8A 2XTJB 4BSVA 5EF3A 3WTYA 4X8GA 1SHXA 2OMVB 4NFDA 1F3RB 1BVNT 2GT9A 1LO4L 2NW2B 2EUVA 3MRCB 3U2SA 1NUDA 1YMMB 4XPTL 5F9OH 2QADB 1QP1A 5FKPA 4Z5RA 5HYFA 4P4KB 4LCCC 4LL9A 3AADB 5EG6C 3WHE1 3AXHA 4NI6A 4HJ0D 5BRZD 4B53A 3SO3C 1URLA 3P2BA 3LVTA 4DKEH 4XZUB 2VLRA 1I9JH 2ZICA 4IHBA 4AG4L 1FFTB 1WEJL 4XN8A 3SYAA 2ZWLT 2HWZH 4MMXB 2BIIA 2GFBB 2HFGH 4OM1H 2MCAA 3OGCB 2IH3A 3S36X 1A4KA 3SYQA 4L1HA 2D7OA 4UU9A 2R1YB 5KW9L 3L4UA 5E1QA 5BV7B 1KB9J 3Q6FA 5E2TL 1AGDA 1R3HB 3LEVL 1QBML 1J5IA 3C8HA 5DTFB 3SY6A 2DEXX 2WLJA 3MR9B 3WG7B 5ENWA 4YHMH 5DRXB 3GBNL 5HJ3A 4A39A 5E94B 1KTBA 1EEZA 4FA8A 1FL5B 2WUBL 4J3XA 3G9AB 1KGUA 5F88A 4X7CC 2AXJA 2OZNA 4I2XB 5SX4I 4U1MA 3EFDL 3S96B 2ITDB 1OF2B 4HETA 3WE6B 2K8MA 1A3RL 4N9GB 3WFCH 1WA1X 2E9IA 4IRSB 2E86A 2YSSB 3BRFA 3PG2A 5J57B 3L81A 1EERB 2WQ8A 3TCTA 1VENA 4JDVA 2NSQA 3PJNA 3QS3A 3V4VL 2NT0A 3GFUA 3VRIB 5T1JA 1CDYA 1WAPA 3CBJB 3I9IA 3PQYA 4CC4C 5HGHB 1AIZA 1HIMH 1E4HA 4MNHA 4FC3E 5KJ4A 3F6LA 4XE0A 5C3TA 1ZJAA 1A1NB 5IW6B 1D5BA 3HEIB 4P46D 1UH3A 4LPCA 4NWUL 4OFIA 3MRFA 3X1GA 4AQ8C 2J88H 2QPDB 1KB3A 4XNZB 3TJPA 1ZANL 2AJYH 5LBSH 5I1EH 3BAYA 3UO8B 4ZW3A 4FULA 1AGBA 3VFGL 4H88H 4IDJL 2J8UB 3V6BR 1RJCA 2F9BT 3OJDB 3B9AA 5E4EC 4QI3A 1K8DA 2AQPA 4XNXH 4CMMA 1JN6A 1OTSD 5FXCH 1EFXB 3V5DB 1QO3A 1MI5D 1UZ8B 1YCSA 1RK7A 3V0IA 3RE0A 4FL4C 3U46B 3MV01 5D7LA 4RRPM 1DEEA 2P52A 1JFQL 2QGBA 5JXEC 4OJYA 1RZ8A 1IM9D 4GG6A 5SWSB 4KZEL 1L9MA 1PSKH 4WW2A 3SDDD 4URKA 2O1AA 1AQDA 3KBHE 4DIXA 4ODUA 1TO5A 3GSWA 3WEXB 2XWEA 4ALAC 4B7IA 2IANE 3OXSB 3L3OC 4HKJB 3FK3A 1P6AB 3MKKA 4JGNA 3DROB 3M88A 1DVFB 2NYZA 4J2XA 3EJRA 3RPBA 4DP8X 3UPRA 1ZJBA 1TVHA 2QPUA 4DVBA 2KS0A 3G04B 2IEPA 2QQLL 2EYRA 5F44A 2FO4B 4FG2A 3QE5A 1E67A 5KG9B 2HMIC 1IM3D 5CHNB 4F1SA 2X4UB 3APFA 5EZIL 5D5MA 1CF8L 2C9RA 3ILQC 2FTAA 1MPAL 4QRAA 4WU7A 4XMXA 4N2GA 4OQ1A 2R2HA 3H9ZA 4WGKA 2J4WH 2OMNA 3A6CL 4GW1B 2CKBB 2GTZB 1XHHA 4XWOC 1WDAA 5KYXA 3D34A 1HSAB 4HS3B 5HDQH 3UTSB 5IIEB 3RFZA 3TCLB 2AK4E 3NOIA 5E4AA 2F15A 3NFSL 3EBIA 4IOFC 5CIPB 3DHMA 3IMUA 4JFEA 2CDGB 1Q8MA 4JANA 3BGFC 1AYRA 4Y16D 4JDTL 3QDMA 4B9IA 4TUOB 1AO7D 2J7LA 1NCGA 3GSRB 3KPSD 3P0YL 3LKQA 4AH2B 1JRHI 3NIFE 4TLTA 2ADJA 3GB7A 2CK2A 5G5DB 3IAGC 3LYRA 1R24B 4AIZB 1FGVL 1N5YH 2D03H 3WD5L 1Y0LA 5KOVC 4OLXL 1KDJA 4RIRB 5J6GB 3MJ9H 1YYML 3KGSA 4OI7A 2ZCLL 5AOLA 3D69A 3F6IA 2I85A 2VDQL 3FTYA 2WTRB 4G5ZH 3FSVA 1TTUA 4YDLC 5B4MD 1MVYA 4NCC2 5FPIA 4KRMB 4ERSH 4UQCA 4AQAA 4H7VA 4B41A 2O5YL 3RIAK 2DQDL 3ZKQD 2EQDA 2EDQA 2D3NA 1SPDA 2C5DC 5DJCB 9PCYA 1UH4A 3NSCA 1HNFA 2QQKH 4R4NC 4RNRA 2YEZB 4FG4A 4B9YA 4OQTH 1FFOB 2IDTA 4WO0A 1E90A 3FQRB 1HC1A 5E9DB 3VTAA 1AGEB 3PIQA 3QDGB 4OLUL 2NMSA 5IQNA 4FA6A 3OVUB 4AMXA 3CZSA 4YHLH 1Z9OA 3EHBD 5EC2A 3ARDC 3L3IB 5AKRA 1JV2A 2C9UA 1ZGLB 1WD9A 2C9VA 1IGIH 3T1FB 4A7VA 1E8WA 1Z5LB 4NN6C 4M7JL 3TYFB 4EI6A 1KC5H 4QRUA 2IAMD 3DJZA 3RHWK 4CW1B 2ICWI 3QEQE 2WSPA 1COBA 4LOUD 1YJDL 3KBEA 2FQDA 1WE5A 5FS5A 3RB7A 3D9AL 3HNSL 3QNYA 4WEBH 2Z1KA 2O93L 3EYOB 2XBDA 4XN7A 5CJ8A 4OV5A 4ESKA 1T7YA 2F1EA 5IBLD 2PR4L 1CYWA 2JQAA 3OAZH 4LCYB 8FABB 1IQDA 3MV8B 1BOGB 4G8EA 1IBGH 3BUBA 1U8LB 4G3YH 5J12C 3UZVA 2R69A 1L9TA 5IJKA 2H2PD 1E30A 3G6AB 3EOTL 5DVPA 4F15B 2EO7A 4PJ9A 5HY9B 3DXAD 1N3NA 3E38A 4TQEH 1EGJA 1LO2H 4FNUA 4X4XA 2EUWA 1YPZE 3ULUD 4NNXB 5EBMA 1ORSB 2E47A 2NY1C 1UHVA 3FUKA 4PEEA 1RUAH 5HXMA 2ITCB 4GMTH 4L48A 5F7AA 1KCKA 2BY0A 4LFHG 3VMPA 2XZZA 1AG0A 2E75C 3L6FB 5ESAB 3E1ZA 4MNQA 3KCPA 4WHTB 1YEFH 5KVGL 1B3IA 3VGHA 1RK1B 1CE6B 5G4MA 2AQ3A 4TPRH 3T2OA 3VXUD 5J13C 4TTDD 4ZUTA 1BYPA 3ZHKA 4XPBH 4Z7UE 1T22B 1N59B 4H20H 2X4PB 2XA8L 4GI6A 2MNWA 3MO1A 3C6LC 4NO3A 3FTGB 1BX2B 4JFWA 4PGBA 1X9UA 2YD1A 4NYLB 3MJGX 2EP6A 1DTUA 2ICWA 4ZPVA 3FCUB 3HE7B 2VR4A 3NJJA 2F8IA 1PKOA 1GGYA 3DO3A 4N2AA 3H0TB 4NRXB 4WO4C 2YRZA 2YFNA 2BNRB 3ET9F 3GSQA 4OD1L 2CM6A 4PWIA 1NSNL 1P7BA 7FABH 1HEHC