2VN3A

Nitrite reductase from alcaligenes xylosoxidans
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
336
structure length
336
Chain Sequence
QDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Importance of the Long Type 1 Copper-Binding Loop of Nitrite Reductase for Structure and Function.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
total genus 88
structure length 336
sequence length 336
ec nomenclature
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vn3A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vn3A02
4KNSA 1J9RA 3PAUA 2DWTA 2XV2A 3NJHA 1EZLA 3OQRA 4E9SA 2CCWA 3FS9A 1PLBA 2GSMB 1W8EA 4YSAA 1NWPA 4E9TA 3S3DB 1CYXA 1PY0A 3PAZA 5E9NA 1ASQA 3CDZB 1AACA 4AI7A 3QJVB 1L9RA 1WA2X 1NWOA 5I6LA 4KO9A 2TSAA 2VN3A 2J55A 4GP5B 3ZDWA 1GS7A 3QJUB 1PNCA 3QJSB 1MZYA 4HIPA 1FWXA 1PF3A 3ERXA 3EH4B 3NP3A 1RCYA 3FSZA 3NSDA 5D4JA 1HFUA 2IH9A 2UXTA 4YSCA 4QLWA 3UADA 2NRDA 2E86A 3CVBA 1XB6A 3PLYA 3FT0A 3IBOA 1V54B 4P5RA 2IWKA 1SF3A 2XLLA 4GXFA 2FQEA 4UANA 4AX3A 1AS6A 4GP4B 2PPAA 1AR1B 1GY2A 1KCBA 1PCSA 2Y69B 4GYBA 3CDZA 2JKWA 2RACA 3AW5A 4M4RB 1CUOA 2WO3B 2GI0A 2B3IA 3T6ZA 4E9WA 2IDQA 4G7QB 3NJMA 5B1BB 1AZNA 3ABMB 2FT6A 1ZDSA 2FTAA 4KOBA 2WO2B 2PCYA 4YSDA 3T9WA 2AZAA 2EIMB 2QPEB 2IWFA 1BYOA 4DP0X 4JHVA 2P80A 1AZRA 5LDUA 2QDVA 2XXFA 4A67A 3ABGA 2P80D 1AG6A 4GY4A 2BZCA 1GS6X 1OV8A 3NJFA 2HLEB 3FSWA 1JZFA 2IDUA 3H56A 1HAWA 2WSDA 2HRGA 7PCYA 1NIDA 3IN0A 1NICA 3AG4B 4W9ZA 2HXAA 2W8CA 3FU7A 3SBQA 2XYBA 2YAPA 3X1EA 3FU7B 4A2DA 4M3HA 2I7OA 1MG3C 2H5UA 1OCZB 4BK5C 2DYRB 5B1JA 3T6WA 3SBRA 1FA4A 2YQBA 1OCRB 1ASPA 4UAHA 2CUAA 2N0MA 1ZIBA 1ET5A 1JXGA 2VM4A 1ETJA 3TBCA 1BQRA 2FNWA 2QT6A 4A66A 4N8UA 1URIA 1JZHA 1WS7A 4E9RA 3H4HA 3NYKA 2J57A 1PMYA 2JXMA 2I7SA 1IUZA 4YSOA 2FWLB 3ASOB 3PAVA 3UABA 1L9SA 1QLEB 2FJSA 1PZCA 2GIMA 3IE9A 5I5MA 1OE3A 3ASNB 4TXVB 4BXSV 4F2FA 3WG7B 3OMIB 1UATA 1TU2A 1EHKB 2GC7C 2FT7A 4YVNA 2PPEA 2DV6A 2Q5BA 2YAQA 1HAUA 1JXDA 4YVUA 4A2EA 2PP8A 4ENZA 3PXLA 4YSEA 3BQVA 2DWSA 4BWTA 4AKOA 2VMJA 3EHBB 4YSTA 2BHFA 1GS8A 1GYCA 3FYEB 3NJIA 4Q8BA 3AZUA 4NERA 2FT8A 5B7EA 3BVDB 4HALA 5PAZA 1X9UA 1PLAA 2OCCB 4G70B 1OF0A 4FA7B 1KDIA 2OJ1A 2DYSB 1XMEB 1W6LA 2XV3A 2XUWA 2GB2A 1OOWA 1KBWA 3OMAB 4HAKA 3OM3B 1GW0A 4AZUA 3JTBA 1N70A 9PCYA 1CYWA 4KNUA 1IC0A 4A2HA 1B3IA 1KDJA 1ET7A 2XVBA 2GBAA 3UACA 3ZX1A 5D4HA 1JZEA 2FQGA 3DTUB 4JKNA 4CSZA 2YXWA 2BW4A 2IDFA 3ABKB 3MX0B 4P5SA 1BEXA 5I6OA 1CC3A 1SNRA 4WKXA 5PCYA 1OCOB 1JZGA 2VSMB 1BXUA 4DPBX 3FQ2A 1SDDB 5I5IA 2HRHA 2Y1AA 3CZUB 5F7AA 2ZXWB 1JZIA 3NP4A 3RYMA 3DIVA 1M56B 3N2JA 3SBPA 3X1GA 2R7EA 1QHQA 3WNIA 1KCWA 1E30A 4DP9X 2VSKB 5B7FA 1KYAA 4HCFA 1DZ0A 2EIJB 1TKWA 4HHGA 2BO0A 2AVFA 2YAEA 4G7SB 1J9QA 1SDDA 4EF3A 1TEFA 4KO5A 3T71A 2OV0A 3T6VA 4E9XA 5TK2A 1AS8A 2UX6A 3ABLB 1PAZA 4YSPA 4YSUA 2PPCA 3NJJA 1R1CA 1X9RA 2XX0A 2AANA 1GR7A 2W88A 1WA0X 1BYPA 5FC9A 1L9TA 1SF5A 1A3ZA 5I28A 1BQKA 4NAJA 1BAWA 4HCGA 3CVCA 2GC4C 3CG8A 1MDAA 2FQFA 1RZQA 2XV0A 4KO7A 2IH8A 3L45A 1NIEA 1KGYE 1CURA 1JERA 5B1KA 5I5JA 2VW6A 1J5CA 1L9OA 3ZIYA 1J9TA 1GY1A 1NINA 1SHXA 2BP0A 1L9PA 1WA1X 2XX1A 2EILB 2YXVA 3H4FA 3QQXA 4UF7C 2PLTA 5I6PA 1OE2A 4JHUA 1AQ8A 1RZPA 3QJTB 1SHWA 1RKRA 4L0PB 3ZBMA 2PCFA 1N68A 3KW8A 4K9JA 1VLXA 1WAEA 2ZWNA 3NJLA 1L9QA 4YSSA 3QJRB 1AZUA 5B3SB 1E65A 1PLCA 1M9WA 3FU8A 2B08A 4PCYA 3UAAA 3AY2A 3TBBA 4YSRA 1XB8A 2YAOA 1M57B 5AKRA 1ASOA 2UX7A 5I6KA 1BXVA 3DKHA 1JVOA 1NDTA 1BXAA 3CVDA 4E9VA 4NB7A 4Q89A 2MRYA 3OD3A 2UXVA 4QKTA 5AFAA 1ZPUA 5B7MA 3MBWB 1ID2A 3HEIB 4KOCA 4CSPA 1A8ZA 1AANA 4DP2X 1W6WA 3FSAA 3G5WA 3SQRA 1AAJA 1E67A 2YARA 2JFCA 2BP8A 1PZAA 1NIAA 1ZV2A 5EHFA 6PAZA 3PCYA 5F7BA 4A2FA 3S8FB 2GHZA 1OE1A 2J5WA 3WIAA 5I26A 1A4BA 3KW7A 1NTDA 1XB3A 2H3XC 4N4YB 3C75A 2AZUA 1MG2C 3GDCA 3WI9A 4DP6X 2HX7A 5IY5B 2VW4A 1KV7A 4HCIA 5AZUA 3X1BA 4BWUA 2H47C 2PPFA 1NIBA 1AZBA 3FQ1A 3V9CA 1ILSA 3FU9A 4E9YA 1PNDA 4KO6A 2DY2A 1QNIA 2HZHA 2QPDB 4G72B 1DYZA 1IBYA 1GSKA 2ZOOA 3WNJA 3D12B 3FPYA 4HZ1A 3WKQA 2IAAC 1SFDA 3U25A 3N55A 5D4IA 1E5YA 4YL4A 4DP7X 1ET8A 3GYRA 4W1TA 3TA4D 3EH3B 3FQYA 2CBPA 1NZRA 1SJMA 3UGEA 1I53A 2HX8A 2CJ3A 2IWEA 2AFNA 4ZK8A 1KBVA 2X87A 3NSCA 3X2QB 2J56A 2BP0B 2PPDA 2I85A 3X1NA 1AIZA 1NPNA 2XWZA 2EINB 1IBZA 1J5DA 1T5KA 1A4CA 1V55B 3TASA 2VM3A 4BWWA 3NJGA 3NSYA 3S3BB 3WKPA 5I6NA 3NJNA 3V9EA 1ADWA 1NPJA 4FAAB 1FFTB 1JOIA 5I6MA 2CALA 3JT2A 1V10A 3QPKA 3OMNB 1NIFA 5B1AB 4DPCX 3EH5B 1A4AA 3S8GB 1JZJA 3FSVA 4KNTA 3NSFA 3FYIB 1ZIAA 2XU9A 2PP9A 1JXFA 4DP1X 2Q9OA 2YAHA 2FQDA 3UAEA 4DP8X 3PPSA 4BDVB 1AOZA 1JVLA 1AS7A 2PP7A 1IKOP 3HB3B 4G7RB 2YAFA 3NJKA 4AKQA 4X4KA 2BWDA 3FPXA 5TK4A 3TU6A 2BW5A 1AZCA 3NT0A 4YSQA 3AG1B 4PAZA 4HHWA 3X1FA 3IEAA 2IDTA 1E5ZA 2TSBA 2BZ7A 4DP5X 3QJQB 2R7EB 2UXFA 5B1JC 2BP8B 1YLBB 1ZDQA 4MFHA 1MZZA 3AG2B 2MTAA 1WS8A 3S3CB 4WTQA 4BXVA 4G71B 1ILUA 1BQ5A 1PZBA 1SFHA 2EIKB 4DPAX 2HX9A 4BDVA 1J9SA 3AG3B 4A2GA 1A65A 2XXGA 4E9QA 2YAMA 2A3TA 2CAKA 2BWIA 3GXUB 2IDSA 6PCYA 2LLNA 2ZONA 4DP4X 4GP8B 4AKPA 1AG0A 5ANHA 4F2EA 8PAZA 2X88A 2VW7A 5A7EA 3EF4A 4RH4A 1F56A 1OCCB 4F7KA 1TEGA 3IN2A 2UXGA 4A68A 2QDWA 3T6XA 7PAZA
chains in the Genus database with same CATH superfamily
1DBKH 3Q5YA 4BHUI 4J3UA 5CEZE 1XL4A 4FQHA 3JV4A 2G0KA 4JCMA 4WK4B 4MAYA 3DJZA 4HULB 2WXKA 1FE8H 1PTZA 3ME0B 3VDCA 4KDTA 2A77H 1UKTA 1RERA 3BPCA 3LMJL 3GSWB 4FULA 2B20A 5MEOB 4L37B 4OT1H 5C0IA 4LSTL 4NWUL 4J1UA 4PM1A 1A0QL 3M1BA 3A0OA 3FUNA 2AJSH 3UTSA 4YQXH 4L2YA 1Q1JL 4LBEB 4CADA 5J0BA 5L2JA 2XQBL 3A4EA 3OC8A 2PCFB 3QUYA 15C8L 1JK9A 2Z8WC 1N4XL 4LHJB 1AXTL 2WXIA 4ICWA 5CILH 4F2MA 3REWA 1O6SA 5CEYB 3T77B 2EABA 2XRAL 3QQNA 4CDGC 1ZEAL 3NSDA 1TNMA 1KXVA 1OCWL 1WCBB 4J3TA 1FNHA 3JWNG 4OGQC 2E8ZA 5JHDE 5F7EL 4LSPH 5KBNC 4AYGA 2G5BB 1F6AB 2NRDA 2ZE0A 5D7IB 3CVBA 2R1WA 1KEML 1CPUA 3OKMA 2F7OA 4P4RA 5HY9A 2OL3B 4HMDA 3CXHJ 3DHUA 1NC2D 2NY5H 4Y9FA 2QADB 5FM8A 2ZTBA 2PNDA 4UANA 1RUKH 1U58B 1AR1B 2V7HB 1D5BA 1XHHA 3D6GA 3M7FB 3WUWG 3KG5A 2WLIA 3AB0C 3VH8B 2JKWA 1G4MA 4KJWD 2RACA 1WWCA 2PKDA 3RWDB 2DW5A 4HKZB 1H8NA 3W0WA 5C92A 3MRKB 4XZUA 5BJTB 5JA8B 1GOHA 1UHVA 3FB6B 1RH8A 2FTAA 3U0PB 3AQDA 3UXFA 2XBTA 4MWFB 4XNXL 1OP5H 4WNJA 3B2DC 2A6DA 4DP0X 4FRWA 4KITB 1M2VB 1UD8A 2K1MA 3AS2A 5I82A 3ULVL 3ILPA 3ZL2A 4MQ7A 5E1HB 3NJFA 3QUML 4C56B 3VD2A 4XP4L 1CK0H 4G43A 5DRNA 2Y7QA 2D0GA 2EDOA 2JJSA 2EC9T 2IJ0C 3K46A 2FWOA 4YC2B 4HHAB 2YD2A 5LGHH 2W8CA 1B0RB 1RURH 3GRWH 2CHWA 1IE5A 4GUPA 2EO1A 1XF3B 2CKNA 2AK1L 3ALWA 4X4MA 1ETB1 4U3XA 3S88H 1SXCA 4UQAA 5E8PA 5GRJH 2ZYHA 5K9OB 1T7ZA 1IC7H 1TCRB 3D0AA 5JHAA 4FG0A 4NQDE 3FFOA 3H7LA 4N0CC 4XCYA 1B4RA 1TG8A 4YH6A 3HKZA 4UT9L 3TBCA 3ZGIA 1KLGA 3L3OC 5HHOD 4G8GA 2BVPB 1NDGB 4FQ2L 3EDDA 3S96B 3Q2CA 4S1SL 3S97C 4Y7MA 4AIXA 5JXEA 2JXMA 2JNZA 3MA7B 2VJXA 4JKMA 1F45A 3LEXA 4PJ5A 3KH4A 1WBXB 1OE3A 2XACC 5JYLA 3DSFH 2E6QA 1Z0MA 4IRJD 3F7RA 4H4NA 5T1LD 3BO8B 2GC7C 5MERB 1WFTA 1DBJL 3GMQA 3EKCA 3FCUB 5BUPA 2KL6A 1C1EL 2CDFA 2ENSA 2BMKA 2EKJA 3N0AA 4I9WE 3BMVA 4ZMZA 4HFWB 4MB4A 2FBRA 3J07A 3BEVA 5I9QB 4AQ1C 4WWOA 3GHBH 3WFHB 4P2OC 4DO4A 2YD3A 4RBPH 5KVDL 1LEIB 4JZJC 4DKAA 4TTDD 2Y6TE 5B7EA 3IU4L 2YXMA 5I76B 5C0CE 3QIWC 2E9IA 5KVEH 4OCRH 2JJVA 4P3DB 2PO6C 1EDQA 4G8EA 2R51A 3F12A 4G8AC 2Z31A 5LNEA 2JLLA 1RULL 4FNRA 2ADFL 2R39A 1E42A 3SDAC 2OPCA 3ZDXE 3EJZC 3R06A 2DLGA 1MY5A 3OVUB 4FN0A 1D5XB 3TA3D 4AZUA 1JYWA 4K71C 1SGKA 3CSFA 1CYWA 3LKSB 2J1XA 1B3IA 3T09A 3NJXA 4UI2A 3HMWH 3VB8A 4R7XA 4XCFL 4U1LB 1J18A 2R4SH 2XZCL 2QHLA 3HE6B 4OD3H 3OR7A 2NY0B 4NN6B 4ADGA 4UAOC 3WTYA 4ZMVA 3RL2A 3X11B 3F7VB 5PCYA 3GMRA 5DO8A 1JZGA 5FUZH 2NXZC 4W93A 3C60D 3SDYH 4GIAA 1QVOA 3VD3A 4NQVA 5I8EB 4DKFH 5CNHA 3ABZA 5F6HI 4HQQH 2DICA 4MX7B 1ODAA 3VXUA 2ZYIA 3D4ZA 4NAMA 3EO0A 4DFHA 4WI6A 5AOLA 4PJ7A 2CIIA 3C9NB 3FB6A 4I85A 4YHYB 5EA0H 4XN8A 1IVTA 3T0ED 3GSXB 3AAZA 3V6FB 2CHXA 4FQHB 2X4QB 5HHPB 4LRNL 1P5VA 3IXTB 3DOSA 3TO2B 4PPTA 2VABA 2YUWA 1A2YB 2BO0A 4ZW3A 2EYSB 1SM3L 3FSOA 2FATL 4NCC1 1ZTXL 1F97A 3MLTB 3J2PA 4QRSA 5DQ9A 5EU3A 4HC1L 3EG9B 1E8WA 3EOBB 3AROA 1I3GH 1FG2A 2BH0A 4IRSB 4NZRH 2V5SA 4DOHE 3KWXA 2PPCA 1IGYA 2ZOTA 4DKEL 3UBXI 5DTFA 5GRZA 3MXWH 5DWUH 3U36A 4KFZC 4U6XA 1H3GA 1YYLH 1I1FA 3S4SA 1TEYA 1HNGA 3IRPX 3TIDB 4UU9A 5E9DB 4NKDA 4CC0A 4KRPC 4TOYL 1M3IA 3B4NA 1JN6A 3REWB 2G3XA 3MGOA 5KEZA 1KCKA 2XIIA 3SYPA 1QWUA 1I9JL 4JQXA 1GPOL 3INUL 2YPKB 1U95A 4PRIA 4U1NA 4GSQA 4NO0A 2C9VA 5TE4H 3RPBA 4YDNA 5ISZB 1L9OA 1PEWA 3Q8BA 2IPUK 5IQLA 1UA7A 3C8KA 3D87B 2DYPA 3EF7A 4XPBL 1HZHL 4P9MH 4NT6B 4PJCB 3DC0A 4LRIC 4ORGB 3S37L 1BQHB 1OTTD 2KERA 3KM1A 3C5SA 1CG9B 3FCSA 1DJYA 2OA9A 4G1MA 1NMCC 3M8OL 1TT6A 4ICXA 4NRZB 3ARPA 5GGTA 4Y4KD 2O5XH 4K5LA 5E4AA 4X99B 5HYJB 1UOVA 2HKFL 2UX7A 3SCMB 1KPVA 2HJFB 5D70L 1NDTA 4AE0A 1AKJB 3L5JA 5B4MC 1TFHA 1B4TA 4Z3FA 3POHA 4NPYB 4P3CH 2PWFA 3CU7A 3L3JB 2EIEA 4P59L 5I18L 3QUXC 2EEDA 4QRTA 2XV6B 5T1KD 5AFAA 3LY6A 1EGJH 1JPST 1EJ8A 1XF4B 1KJMA 1E40A 3BPNB 4QHNA 3KYNB 5GRYA 2WQ8A 1YNTB 3GMNB 1Z2KA 2DWDA 3SQRA 3S98A 4JDTH 4G9DA 5SX5K 1E67A 1BV8A 2JFCA 3F01A 4YXKL 4DGYL 5DVNA 1THAA 1J8SA 4UDTB 5DDHB 3Q2LA 2AEOA 3SE9H 5L9DL 4HD9A 5FUOH 1SN2A 3MCYA 4HA1A 2X89A 5DU7A 2H0JA 4YDVB 4PJAA 1QFWL 2CJSA 2R23A 4LVHC 5A6LA 2HWZL 4WHCA 4AYFB 3NSJA 1IGJA 2VN7A 2A9MH 2MQ3A 4J6IA 3SPGA 1FLRL 2XJLA 1O9VA 5EU5A 3IJHA 3RWIA 5GGSA 1LHZA 3K2UH 3ETSA 2YD1A 1Q9KA 2PMZA 5DT1L 1YN6B 1OT2A 4MNGA 1E9PA 3VXMA 3X1BA 1W0WB 1Q72H 3N06B 3OLGA 1Z32X 4L4VB 2AJSL 2IG2L 4P4KA 4JFHE 1X6LA 4N25A 1L0XA 4R7NA 3SDAB 2GI7A 4F24A 4UT7H 3VI4E 1PNDA 2YJLA 4PLKD 5C8JB 1QABA 1UM6H 3WNJA 2IAND 4GLRI 1VCBC 1SXSA 1GGIH 2AV1B 4JE0A 3ZYZA 5DMKA 5BZWB 5B4MD 4ELMF 1CDHA 1PFOA 1VPOL 1QA9A 3UROR 1HN1A 3SCMC 5D2NE 2CNYA 3AVEA 5KS9F 2R29H 2FHFA 3AT0A 3MX0A 2EUZA 2JJTC 3GK8L 3IS1X 3QORC 4NZUH 4XOEA 3HNTL 2R2HA 4N2OA 5FFGA 2F8OA 2VR5A 3LPOA 4ZUVA 1HNYA 2I85A 3ZPDA 1MH5A 4MJ6B 5JUEL 3U0TA 1J5DA 4HKZA 1YY9C 2WY3B 3JWDH 4HV8B 1JS4A 2CK0L 4PJGF 4ENEC 5FGBC 5I6MA 1EK3A 4A1RA 3QIBC 3CX5J 3QPKA 2NCMA 4FNTA 3TEYA 3WY4A 4HXBL 4DW2L 3G5YA 4LMQE 4YQXL 2QVMA 2CBMA 4IMLA 4PJFB 5CLYA 4WUKL 1OL0A 2R1YA 3TTSA 1D7CA 4YLBA 2QV2A 1R24B 4JFDB 4EUPH 1ZE3C 2EICA 3IMVA 4F15C 1MCWM 4HETA 1V7NH 2WIIB 4X4KA 2AXWA 3ZIMA 2BWDA 1K8DA 3UTSE 4KKQA 5I1IH 3QDJD 1KNOA 3KLAB 4BFIB 5C70A 3IEAA 4KRNA 3ALPA 1E5ZA 3BSZA 1TCRA 5BRPA 1G7MA 4EI6A 3K6SA 1LEGB 4H8PA 1J05B 1EWHA 3ROOA 2XJKA 4N6RA 2EDQA 1L3NA 4AJ0A 4H0HB 2X4OA 3LHAA 3JXAA 1AHWC 4CN6A 5IWLC 1C16A 1IAOB 1JGLH 5F0PB 1YECH 5CJQL 5C08B 1EO8L 5EEYA 1IFHL 2MNUA 5DQDL 4ABVA 4H8WL 4M7JL 4MB1A 1HX0A 4HBCL 1PZ2A 1OCCB 3NCCB 2MSPA 3U30C 4YJZL 3PGCB 3BKMH 4KHTL 4BRVA 4RGMB 1ZLWH 1EO8H 3MJ8A 1VEMA 3VXTA 3PFQA 4LCUA 4ZNCD 1H15A 3X17A 7CGTA 2H26A 5D2LB 1MCQA 2LU7A 5F96H 4BUGA 4M7ZC 5A2FA 4LNRA 3LN9A 5ILTL 4L0YA 4G8GE 5E95B 4Z76A 4F7CB 3HR6A 5EIQA 5LXGH 3D4YA 3LPFA 4HJ0D 4JRYE 4PGBB 4WNSA 1DQDH 4F7EA 2J1YA 2PXYD 3SDCA 4LXFA 3V4VA 3CMOH 3NCYP 3MRBB 1CDCA 2D7OA 2UWEA 4GP5B 2PTUA 4N0YH 3TPKA 3SJVE 4PS8A 2ZUSA 4OF8A 5J12B 3GZQA 2NQCA 1MI5B 3DUUB 4DAGH 2VT0A 3DO7A 1KFAL 3GT6A 3ZT6A 4FKEA 4NI3A 4M5ZL 4FNQA 3BGMB 4HW6A 3VCLB 2WSKA 1E43A 3EH1A 5JA9A 5F2FA 1YMHB 1RZJL 3ATAA 1PDKB 3QULB 4XCEA 4XMLH 1FH2A 4EQ3A 3G7TA 4R90H 2NZIA 1SN5A 2VZ1A 3EGXA 4AEHL 1TTAA 2VDNB 3E6FA 4AX3A 5J1TC 4GG6B 5CBEB 4Z1PA 4U3CA 2IADA 4LO9A 1MFEH 4D0DA 4MBOA 4ODVH 3P02A 3HN3A 3NDZE 5CD3B 5L8JB 4HV8A 1CDUA 1YVLA 2B3IA 2WBJB 3WIHA 3NCBB 3TN0C 3QQ4B 3UZEA 4LT7A 1NGPH 1MF2L 2GCYA 5DCCA 5DUJA 2PCYA 2X0UA 2AZAA 3IRCA 3QP3A 2R0ZL 2HKHL 3IXTA 2GY5A 4LP5A 3TO2A 4M43H 2NY5L 1A2YA 1AE6L 1R3KA 2HG5B 3C09C 1AZRA 4O2CA 3OX8B 4M8RA 4MNQB 4NOFA 2FATH 3RJOA 2NY4B 3F85A 4L4TD 2RQ8A 4U7MA 3RB5A 3NBNA 1U8NB 5HYIA 4QIRA 5GSRA 1KB5H 3NIGE 1S9VB 4LVEA 4H25A 2BY0A 1BQHG 2VZ3A 1QBLH 3QC6X 4LF3B 5IW1B 5IQ7H 2EUWA 3LVTA 4QKXB 3CN2A 1NCDL 1Z5LB 4NO2A 5ITBL 1NFDA 3IDNA 2FHCA 3QS3A 1KIPA 1X4YA 3EFFB 3N50A 3KLDA 4CW1A 1FGNL 4PIBA 3KS0H 1BJMA 1G7MB 4IRJC 1S7WA 1F5WA 4JPSA 5D5MA 4HF5H 3TX4A 4JFOB 2MOVA 3NCEB 2K7QA 3VI3E 2RBLA 1R5VA 5D2NA 5D6CB 2P1YA 4FHKA 2CUAA 3GBML 2YSSB 4HK0A 3FTZA 4ZW5A 2BDNH 2QT6A 4A66A 3VXNB 2DQUH 2IGTA 4B7IA 1GZQB 1BLNB 4DGIL 2MMXA 3ULSA 4LLQB 3HC3L 1EQWA 1JAEA 1PMYA 2IBGA 3QEQB 4FGMA 4NZDA 5E51A 1N5AB 5CINL 5KBKA 3C5SB 3VSTA 5D71H 1SYVB 4QF1B 5DZLA 3ZKSD 4DESA 4X4ZA 1N9PA 1QOKA 3B7SA 4XP5L 1EHKB 3WJLA 1KTDB 3HB3D 1FRGL 2C3XA 1SUHA 3VMNA 2F19H 1E6OH 2ICWB 3OB8A 4PJEE 5TDNB 2DWEA 4AT6B 5A43C 1AR2A 2E7MA 4M5SA 4OZ4A 2R4RH 5H94B 5KUMA 3TA3C 1T20B 4BQCA 1QYGL 3HLKA 3FULA 5I1EL 3CIQA 4FZ8L 4PGBA 3OJMB 2LVCA 4JPWL 4P05A 4QRSB 3S2AA 1NGXA 1UXWA 3BVDB 2OP4H 1ITBB 1D9KA 3EYFA 1DQJA 4ZQTA 4RWYL 2B4CH 2NXZD 2VZOA 3WIFB 2ITDA 3B7YA 3QJHA 1KBPA 1YPZF 5FCSH 1FZKA 4L0ZA 5KW9H 1BZ7A 4WEBL 3LOWA 5A2BA 2WQAA 3MN8A 1XBRA 4HFUL 3QFGA 2DQHL 3KPSD 2HWZH 4XC1H 4XPTL 1TZGH 3B9KB 3IDMA 3C08H 1AFVH 3E8UH 1U8QB 1KB5B 3MYJA 1BZOA 4O2FA 1CC3A 4MNGB 3ZJAA 2WANA 3FL7A 4FHBD 4ISVA 1S7QA 1JMZA 3MBEA 5GHWH 1P4LA 4PJXB 3E38A 4XZ4A 5IM7B 2EXSA 3ARGC 4NKQB 1JNNH 1QHPA 5L88H 2IOMA 2P5WE 1M56B 2VDOB 3NTCL 2Q87A 3DX8B 4HKJA 4MTMA 2VMDA 2HPTA 4OUUA 1B0GA 1RU9H 3HFFA 5I18H 4TUKL 5J6HB 2R9HD 3ZYJA 1JD7A 4OR1A 3V6OE 2WNGA 4D9QE 2EDJA 1PKQA 3WSQH 2HG5A 3WDJA 1DQIA 4XCCL 1BZQK 2NQDA 3IGLA 1TZHB 4QRQB 1AGEB 1FYHB 5L8LB 2B15A 3KLQA 1D7DA 1SYSB 2X40A 4XGZA 4EF3A 1TEFA 2EVFA 2OV0A 1NUGA 2EH8H 2E59A 4G1EA 2JI3A 3FUDA 1C5CL 2DQTL 4Y19E 5JOFB 1A0QH 4X8GA 3I9AA 1A7RH 2Q7AA 2UY7A 4LFHG 3I50H 2P5WB 4L3ED 3UBXG 1JGEA 5FYJU 1FDLH 1L9TA 5JIKA 3RVUD 3I9PA 1A3ZA 5FW8A 4X5WB 3QI9B 2ADIA 3O3EB 4F8NA 3V0JA 3DX6B 4FJYA 2O1AA 1FO0L 3RJQB 5IIEA 4N0CD 2Q3ZA 1VFBA 4WUUD 1WHOA 4HUMB 4KO7A 3TO4D 4BGLA 5F71A 3DX0A 4HWZB 2O5ZL 4JVUA 3OLIA 5GRVK 1O7DC 2VISB 4ODVL 3KD4A 3KPNA 4Z7UA 5HPOA 1IEBA 2HAZA 3PWLB 4E9LA 1XGPB 4JY5L 2B16A 5BMFL 4I48A 2WZ6A 1K4DB 3KWVA 1ZSHA 2CZNA 2LABA 3PABB 3QBTB 3QUYC 2OYPA 3UJTH 2LOEA 3VI3B 3CXDH 4HXAH 1NEZB 5D1ZD 3R4RA 1EJOL 1AZUA 2A83A 1T1YA 3UP6A 4U1JA 3FU8A 5B3JF 4OCYH 2J5LC 3CZKA 5HVWA 4LSPL 1UOKA 1UURA 1TYJA 1YMME 3NA9L 5HGDB 4XN1A 4ZPVA 1OPOA 3TVMA 4P5TB 3ULVH 2XG4B 3TO4B 1XXDC 5C0EA 3HHMA 2Y5TB 4N0UE 4DKTA 3QUXB 2YRPA 3PQYA 4QJ5B 4Y5VC 3CE1A 1PIFA 2DQJH 2GAZA 1ES0A 1EZUA 1YUKB 3F7QA 4G5AA 4U1KA 4L29B 1MFNA 5KSUA 1F4AA 1HE7A 1W6WA 3WXVL 4FP8H 2ZOLA 3FT2A 3CDCA 1WQVT 2LLGA 3BSZH 5BZXA 3VJ6A 5J9PA 1I7UB 4RZCB 4IBSA 2HTKD 3VFTA 2I07A 2DQJL 3HAEH 4MSWA 3PCYA 5ETUB 1MCEA 1Y6MR 3B9KA 3IDMB 2VDLB 1JGVL 1UM4H 1CBJA 3MR9B 4N28A 3WIAA 8FABB 3W3BA 4X8JB 4EUPA 2M2DA 2YR3A 5BOZG 2F7QA 1TSHA 2OL3A 4YHIA 4NP9A 2VW4A 3KEDA 3IAGC 2IOOA 5BRZE 1JPGA 3HFML 5DJCB 1E5BA 3AFLA 2H32H 1MHPH 1RK0A 2VDLH 1UEYA 2X3CA 2KDYA 4OGYH 5MEPB 1T7XA 3DSFL 3SKMA 3I85A 3ZTJH 3WKQA 3V0WL 3QXVA 5FV1L 3TA4D 1D2OA 4MASA 1CXKA 5B38A 4JHBA 4Y1AD 3GNML 2FX8H 1EZSA 1I8KA 1IJNA 2IEPA 3CN4A 3R4DA 4F8QA 5I75C 2AXHA 2D9QB 1A7NH 4L2LA 3N85L 5C0JA 4EI5A 3PIQA 1HSBA 5IREA 5HDRA 1ORQA 2PPDA 2UY6B 5DJDA 5I1GH 1AIZA 2OQJA 1NPNA 3OF6D 3DX3A 3GMPB 4HZAA 4RGNE 4UNTA 4UQ3A 5K1VA 3GSNL 5IVXE 2E4FA 1BXXA 3FHQA 4MAYC 4R97C 3CFBA 4UQEA 4NUMA 3H54A 4XC1L 4XPTH 3PNWA 3QFDB 3CXHK 1U8OA 4LPWA 3L1FA 3P11L 2CIKA 4YE0A 1TKWB 4F80A 5JPMB 3MACH 2RTTA 4N8VB 2VL5B 2VUKA 4CN4A 1U8LA 1BAFL 3ARXA 4I88A 4JG1L 3VGEA 4JKPL 4LNRB 2AMUA 1J1OL 3NIDF 4AENA 3RDTB 3KEHA 4RZKA 1RY7B 1CICC 4Z7WA 5ABDE 4WWKA 5JUEH 3BRGC 4EN3D 1NMBH 1G0DA 3HC4H 5K1JA 4PV8A 5KJ7E 4F5CE 1IKOP 1P4LB 4PJXA 4NNYB 4RA0C 1D5IH 4XB8A 2JIXB 2C3WA 3ROOB 4LIQH 3FT3A 3TT3H 4ZUWA 4I2XE 4XB3A 2HFFA 2R7EB 1B0GB 1DL7L 3T0VA 1LMKA 2ZOKB 3M07A 5CHNB 4YDKL 1CF8L 2CNZA 2AJ3B 4YXHH 1EAPB 4AZ8B 5FCUH 2ENYA 3BUTA 1AGCA 3ZZSA 4IGBB 1PAMA 2IO5A 2VDPH 4UQIM 2W07B 2X2IA 2EIBA 4S1QH 5EBWB 4MZ3A 5AYUL 2ZT9C 4HSQA 2BC4B 2V2TB 1U3YA 1XD1A 4LSVL 2NDFA 4H8VA 4YXHL 1S7SB 1XCQB 1EUTA 4KAQH 3QUMA 4WO0A 2X6BA 1C8QA 3P1VA 1HZKA 3F12B 3RZWA 3G9VA 3RWHA 3ZZ1A 4FYQA 5GGTH 1RFDL 1X7TA 3MV11 4F9LA 2XV2A 3HLAA 2XTJD 3VB9A 4IK7A 5E99L 3QEGL 4YMPA 4E9SA 5IQNA 2MH4A 2X0WA 5GZND 1LO5B 2PR4L 2WTOA 1UB5B 2V5RA 3GSUA 2EXWD 2XRAH 3PWUB 1KBGH 1OXYA 3DA0A 4WV1B 4U1LA 3RX8A 1MFMA 3O6FC 4JFXB 2WXFA 1JV5A 5LCVH 4GRLB 5MHSE 1KB9K 3DRTB 3NZ8A 5JQHC 1DR9A 4L8DA 4P2YA 4YC2C 5T3ZE 1ZV9A 2XQYG 4MCYB 3BN3B 3T0BA 1SUJA 2EDKA 4QXTA 3PP4H 5AYQA 4ZMTA 2EXWC 3SO5A 3VCLA 1H3XA 2WKOA 2YRBA 3GK8H 3Q7JA 2WW8A 1XGQA 1T1YB 2VKWA 2NTFB 2Z7YA 2UVEA 2O30A 1KENL 2VDRB 3GC3A 4ZXBA 3BFQG 3FO1A 5CFAA 1BM7A 4OCNC 2ZKWA 3A67L 3ZKXC 3LD8B 5D7IA 5SWZA 4YUEH 1YEEH 2O72A 1QI5A 3FFCE 3QQ3B 1HQRA 2IH3B 1PFCA 1U8CB 5IP4A 1SF3A 2CGZA 4N1HB 4RFNB 3MOBL 3ULSB 2FGWL 5DEGA 4PD4K 3PQYE 2H7WA 1PSKL 1HT6A 4HIHB 3T2NH 3TLRA 3C8HA 1AQKH 1CLVA 2HRPL 3VFOB 2EDDA 4AUUA 1G9EA 5KYNA 3LZOA 3LKPA 5F3HA 3IAQA 4J3BA 1ZV5A 3MOQA 1X5LA 1U3JA 3DX7B 1MCDA 2ZPKL 4YL9A 4MNQA 4YSDA 4XMLL 1FI8C 3SYQA 1IFRA 3FJTA 2FLRT 4MJ5A 2WC7A 1BYOA 5EEXA 3TV8A 5F3FA 4JHVA 5LDUA 4HG4J 4EZJA 4IBZA 4JHZA 1W72A 3MJGX 1QACA 4M9OA 3U4AA 1E5UI 3HI6H 3IN0A 2PUQT 3AG4B 2AGJH 2J72A 3D18A 1IQWL 5F1NB 2XYBA 1UYWH 4IDJH 5IHZB 1R75A 4LARL 1J1PL 1YRKA 3SE4C 2WJ7A 3CZJA 1DLHB 2J71A 5I6XC 3ZKNC 3HZKB 2MPAH 3GSVA 4G9FD 2CUHA 4J23A 1I8IB 2H0FA 3SBRA 5CEZH 5C07B 1T89C 2WGNB 5K9OA 1TTGA 2EDXA 1OCRB 5FO8A 1QX1A 2N0MA 2ODHA 3JV5A 2P44B 4MDRA 1Z6JT 2R2EB 4U3HA 4W68A 3QSKB 2HJFA 2VM4A 5B21A 3S2CA 3MRLB 3IJEB 4Y5XA 4GW4A 2WIMA 3TWCH 3FN9A 3T2PA 3U82B 3Q8AA 2ZNWA 4R3SA 2X44D 1YNLL 2A9DA 3VD7A 5I66A 3CTTA 1QRNA 2J57A 4J3VA 4XZUB 3IFPB 3ASOB 2PYFA 3PAVA 4P0DA 3SE3A 4G83A 1W15A 5BMFH 3T0DA 4JFZH 2GFBA 4C58B 4PRHA 1ACYL 4F2FA 4PV9B 4KUCF 1HXYB 2IAMB 3DRQA 3NIDB 5L0QC 3FCTB 3QZMA 2Y25A 1F18A 4X9BA 2CJUL 4WFFD 1JXDA 5LJYH 5E6ID 2G0LA 4J12A 2EEXA 3K8KA 3ZDYF 4IRZA 4UBDC 1VZGA 5I5RA 4IOIA 3HG3A 3ULUF 1KG0B 4HUVA 2LQRA 2J6EH 4NUJB 3KVDD 1CGTA 1FDLL 2H2PC 4YLCA 3F7YA 1J0IA 3L3OB 1SMOA 2FO4B 1HWGB 2GUOB 4XMWA 3MLSH 4MMXA 3IU3A 4XTRC 4Y2OB 4R2GB 5D71L 2UVFA 2V8LA 3PJNA 2VXSL 2F54A 2VC2H 1OAQH 1ZXKA 1OALA 3FFCB 3QORA 4I2XB 3U4EA 3OMAB 5E1QA 2D7MA 1KN4H 1K8IB 1TJGL 2Z93A 3WOVA 4L05A 5JOPD 4NENB 2KZ1B 4GQRA 3ZKMC 1XT5A 5EN2B 3UCQA 3TGXA 2NTFA 4K8RH 1G7JA 4HXBH 4DW2H 2XN2A 1T83A 3OG6B 4A7GA 2BVPA 4HJJL 1TVHB 5I1EH 1F4WL 3TPUA 4DJMA 2FECL 3NCWA 4ISVB 3MX0B 1CD8A 5B22A 4OF5A 5I6OA 1DTUA 2CPCA 4ZDHA 2AV7B 1LMIA 3X11A 1J0ZA 1B0IA 4PQXA 2ZUQC 1QKZH 4Z0XA 3T8XA 1SOKA 3QJFA 5E7FA 3DX8A 4RMBA 4BE5A 1AKPA 2NY2B 4Q4IA 3KPSE 1LO4L 3QIUB 1NUDA 4AMXA 4UNVA 3GS7A 1ZK5A 2DQDL 3VGAC 5KBMA 1MVUB 3KGTA 3STLB 1MWAH 5E94A 2EIZA 3ZDXB 4N90E 4Y9GA 3VG9C 3VG9B 3HR5B 4LLMB 2ZCKH 1HILA 3T04D 4ZMXA 1E6JL 2GJZA 1U8PB 2O4EA 2P26A 2C9SA 3TJEL 4ERSH 1CFVH 3CD4A 4TRPH 1ZS2A 4Q9QH 2VDQL 1TTUA 5C0EB 3VWJA 3QUXA 1MW3A 5HDBB 1LILA 5IVXB 1T3FB 3P30L 4KQ4H 4AV0A 4GW5B 4N2DA 4RGNB 2DTSA 3MV7E 4HH8A 5I1AA 3ARGA 2W88A 2WIIA 4TNEA 1KYFA 4FEMA 4OGXH 2W65A 3FQNB 3NACH 2HFEB 1NLDH 1KXHA 1YNKL 4EDXA 2GC4C 5ICYB 4EI6B 3K6SB 2HVJB 3ESOA 1DLFH 2GTQA 3BDYH 4KKNA 3ZKXB 3KL3A 5E56A 3ESNA 4A6YH 3FO1B 1NBZB 5L4FA 3VXSD 5I5JA 2D2OA 2VW6A 3SE8L 1G9NL 1QNZL 4MHHI 3K6OA 4KH9A 5CGTA 3ARSA 4K23L 1DDTA 4IJ3B 4W9CC 3QNYA 1G7LB 3TBVA 3I9GH 2HPOA 4GB9A 1DZBA 2ITCA 3FHAA 1S9WB 3LQMA 1SHWA 1RKRA 5GJSH 1N68A 1S3KH 1W8OA 1CGUA 5IBLD 1VLXA 3UBHA 2OSYA 1BG9A 1GMIA 2WLHA 4X9GA 4YSSA 1OARL 1LL1A 5HYSG 3N42B 3UAAA 1EV2E 1JI2A 1XL6A 3MBXL 4KJQD 4XRCB 2YAOA 1H5BC 4RGND 1D5MB 2BPBA 3V52H 3TA3A 3ATEA 1DVYA 2WTRB 1J8RA 1R46A 4JZNA 3CVDA 3EBHA 1HHGB 4R90L 5D72L 1CICB 3HZMB 2XI9A 4BZ1L 4DPRA 3B7UX 6TAAA 5BV7H 3J8F7 4LOUD 3PIQB 1MNUH 1EJFA 2GW5A 4K4KA 4KAQL 4NKDB 1CLYL 4PB9L 3FO9B 1JNHB 3BEWB 3WJJC 3G5WA 3CN0A 5EU4A 3VFPA 4OCYL 3QUHA 3IDXL 1U8HB 1YY8B 5GGVH 4A55A 4BQ9A 2ENJA 4M00A 4PJXE 5JO5A 5INDA 2YKLH 5K9KA 1LP9A 3B9AA 4JAMB 1I1AB 4MXVF 3PWNB 4I4WA 4F9PC 3ULVD 3WFDH 2J5WA 1FYTA 1ZVHA 3R0MA 1M6OB 1BFSA 3N3EA 4NPKA 1NTDA 3QDMD 1NL0L 2J4WL 3LNGA 3COOA 4DVBB 3VU2A 4PRPA 4JFZL 4Z0XB 3T8XB 3WEXA 5JXAL 3S36X 4WWKB 3DV6B 3S5LA 5IY5B 1ZHLA 2MNJB 1DSWA 4MA1C 3ZW3A 5EEVA 1TO4A 4BKLB 1NCWH 5K39B 3FFCD 2OKMA 1BEYH 5DFWH 2ZUYA 3RVXD 3SPVA 4OFIA 5FHAL 1IBYA 3B6SB 4JN1H 2FUTA 2GSGB 3B2UC 1OGAB 1NFKA 3BP7B 1UH2A 1RZGA 2WYIA 3DO4A 3G5XB 3QZNA 2DJMA 3B2MA 4IM8A 4NQEA 4DK5A 3N55A 3CSYA 3KL5A 2AQQA 5BS0A 2BFGA 5I1CL 3U79A 4M1GH 1EEYA 3KXFA 3O11A 4LRNH 3DPBA 2PO6D 3BT2L 4POYA 1MCWW 2N1TE 2UY6A 5DJDB 5L2KA 1UXSB 2Z31C 3IDGB 3WYRA 3IDYB 5KSAB 1A8JH 4QTFA 1XDTT 3QO0A 3ORJA 4ETQA 2X87A 2R2HB 3BWUF 2H2SC 4MMXB 2APWA 5DRXB 3F5WA 3GSNB 4M5YL 1ZT4A 1IBZA 2HCZX 3ESVF 4JM2F 1O5DT 1A4CA 4A7GF 3KBHE 3WELA 1PG7X 4R83A 4ZPTB 3RHWF 5I6NA 1NLBL 2RA1A 1UB6A 1V7NL 2KLSA 3MO1A 1FFTB 3IJ7A 1MHHB 5E4EC 3E6HA 1HOCB 5B8CB 5HGHA 2BZDA 4BYHA 4PRDB 1NJ9A 2X1XR 5FW6A 3PWUA 4OZGB 3B3IA 1LLAA 4LDCA 2R1WB 4IU2B 2OMUA 2DQCH 3MNMA 4O02A 4S0SD 1NANI 1S7UA 3V0VA 4JN2B 4JRFA 4BK4A 1E2ZA 2MTPA 4K3JH 3PPSA 1BBDH 4JFXA 4LLQA 1EZVX 3NIGF 1A7QH 4RWYH 2L04A 4MLSA 1M4KA 2AV1A 3STZB 3VH8G 1JDDA 4G7RB 4YGVB 2NY4D 4Y89A 4L8CB 5ACMA 4KXZI 4W9JC 1NDMA 3F7PC 3D09A 5JIQA 2ZOKA 3FPXA 4M7JH 5TK4A 1VF5C 4YHYC 3REVA 2XWEA 1WC7A 4PAZA 3MROA 1PD0A 1UT1A 5DURB 4ANXA 4BK5A 1MJUL 3MU3A 1NM4A 4JG1H 4W9IC 3VM7A 4L4TA 3QZBA 4NP4L 5EBWA 4OKVA 1JFQL 2VDQH 2EC9U 3TN0D 4MNQE 2GBUA 4G71B 1PZBA 2CE6A 2HX9A 3VXUD 5CP3A 4FQXB 4J3OF 3ZHDA 1TUPA 4FQCH 2JJSC 1A65A 1O5PA 4YFDB 5MP6H 1JHKL 4XVTH 1IT9H 2FJFB 5D1QC 1K9TA 5FF6B 5C08D 2Y7NA 2XNAA 4FMFA 2Q6WB 4DP4X 4DKDC 3LDBB 4NC1C 3KNBB 1E4KA 2VQ4A 4U33A 5HHNA 3VXMD 4D0BB 3CJJA 4ANUA 1NGWB 3S5YA 4DFIA 4ELME 1ESOA 3OKOA 3SE8H 5AAWC 1Q4NX 3LN4A 3ZQWA 4AH2A 3Q2NA 4UOW0 4NJAH 1ZA6B 4Z7QE 5C0RH 1A9VA 5T8IA 1BIIB 3GXIA 5ITFA 1NUFA 3OX8A 3QO1B 4BH8B 1LD9A 4KKLC 4XMPH 4D9RE 5K9JL 4NQUA 2Z4QA 3UAJD 3ZL4L 2YEVB 2CD0A 2Q20A 3L3GA 2BIPA 5I6LA 2QKIC 4HISA 4OCXL 2VC2L 3MLZL 4QYOB 4QPEA 2CJTA 5CJBA 4U1SB 4A04A 1OANA 1IARB 1KN4L 4KXDA 1CF1A 4HIPA 3P77B 4XI5D 1NCCL 4G8IB 5ALBL 4P5MA 3JTSB 3NFPA 5GSVA 2A4ZA 5DHVB 3MNDA 3QQ3A 4X5PA 3NPSB 3O9WD 1IC5H 1SY6A 3GKZA 2WQSA 1OM9A 5KSBB 2FRGP 3S36H 5EOTB 1E2WA 1ZLWK 3E1ZA 4NX0A 4PP1C 4EI5D 2IWKA 1MFBH 2QLVB 5CXPA 4B5ZA 4EZKA 4XVUC 2Y6SD 1GXEA 4WW2B 4GP4B 2Q7NA 2IOIA 2VWEE 5I76A 3GJEB 2BRQA 4AITA 4ZFOA 3TEUA 3CDZA 3H0TA 3W0WE 2GJPA 5LNGA 2YKLL 2GFBB 2WO3B 4ODTL 2P5WA 4HXAL 2GPZA 4WU7A 4Z7VB 1UXMA 1BLIA 5BOPA 1BAFH 2X6UA 4YK4B 3PY9A 5TDNA 3WO4C 4FC3E 3ZE2F 3FB5A 5GRXG 4PB0L 2A6DB 2B14A 5HGBA 2XVLA 4HIJA 1TJGH 3VGDA 1FVDA 1HTYA 3V6ZA 5F7NC 4QHMB 5DZVA 3Q3GA 3UTTD 3ZSSA 4R4FL 4G43B 5IROC 4GUQA 2QQQA 1GYWA 3ETBF 4JFED 2P5PA 4I77H 3LHPH 5EBMB 4YDJA 5KZCD 4L1LA 4N8CH 1HU8A 2E7DA 2Y7LA 3SGDH 4Y5XC 1NDMB 3AREA 4TNWK 1XF3A 4YXLH 5FUZL 1SBSH 4A2DA 2VR9A 1Q94B 4HU2A 3CFTA 1CLZL 1QPPA 4L4TB 2VDPL 4NENA 5BXFB 1NAMB 5DS2A 4N8CL 1GH7A 1FG9C 5IVZB 3OHXA 1ED3A 3DROB 4GT7A 4UAHA 2FBJL 5IEHA 2ATKB 3FFDA 3JWNH 3U6RB 1E6OL 1O7DE 3L6FB 1DBML 2OJZL 5JDSB 4EN3C 2QHRL 5MENB 2ARWA 3UZVA 3DX9B 2H2PD 3TJHD 3H4HA 4HS6A 5CSZB 3NYKA 1T1XA 2B1OA 1CFTA 2FIKB 5JPNB 3QQ4A 4OJDH 1LEKA 2FJSA 3SJVB 1EEZA 3BCDA 1LWHA 2CRZA 4KHTH 4WU5A 2MWCA 2Z7ZA 1UATA 1WLHA 1DUYB 3U7WH 3S35X 1JVKA 3DBSA 4L3EE 1HS6A 1ZSDA 1WT5C 4FQ1L 2PP8A 3F7YB 3WEOA 2WAQA 3QO1A 3EYQC 4TOYH 4ZTOH 3KBFA 2ED9A 5C08E 5AD0B 3BWSA 3VVWA 5C9KA 1TQBB 1VJSA 1GS8A 4U1IB 3PHOA 1AD0A 4FE9A 3O0RH 3NJIA 1NEPA 2MJWA 1UOLA 2YQ3A 3MCLL 3UO1H 1T6BX 3F04A 3V10A 3IMSA 1ACCA 1I3VA 1MPAH 1MFAH 3PWPD 2ENPA 4QD2E 2FYYA 5ID1B 2KBGA 3RLSA 3CZEA 3GF8A 1G5AA 3W5MA 3UTSB 1DJGA 1JZDC 5LG6A 2GJ6E 2WNKA 1DDHB 1N19A 1OWWA 3QZWG 1N70A 4JO1L 3QEHA 4KNUA 4A2HA 5EZLB 5GSVB 2J6EL 5E9DD 3NSXA 5D4HA 2WLNA 1I7ZB 1BLNA 4OQ1A 4AQZA 5CEYA 2R27A 3T77A 4K15A 1GAFH 3BE1L 3QXUA 4OLYL 5AUMA 3RNKB 3KPQB 4UTAH 5IQ9B 1PX4A 1ZMYA 3TESA 2UUDK 2WXOA 2EACA 4KKRA 5HD8D 2MQGA 2AQPA 3ZTDC 3ZUCA 3WSQL 4WKXA 2NY2D 3DWTA 4EPSA 1EVUA 3G5VB 4ZG1A 4I0KA 4PU2A 1ZANL 2C4FU 4GO6B 2VO5A 4KROD 3H2WA 5EN3A 1WUZA 3BAWA 4IBUA 3KPPA 1HHJB 3VXUB 2EH8L 3B6SA 3NP4A 4LGSB 1NFDE 4R9HA 4HIEB 3X1GA 2BOLA 3U48A 4BZ1H 4F37F 5BO1L 4UDTA 2QMJA 4XMPL 5DDHA 2DD8L 3ILPB 5EU6E 3RY6A 1VGEH 3HAEG 4J8RA 5FM4A 3JUYA 3WXWL 3FB7A 4AYFA 5FOBA 5IHLB 1U93B 3IFLH 1F8TL 5D1ZB 2CO6B 3PQYB 4Y16D 2O26U 2HG0A 3ZK0A 4E9XA 5BW7C 1K72A 1DFBL 2AKRA 4YSPA 3W9DB 3NIFB 5D1XA 1U3NA 1NCCH 4JANA 1HKLH 2V2XB 4DCQB 4P5TD 1GR7A 2B2XL 2GJ6A 2VRAA 4Z7QF 5E08L 2ESVA 4OM0H 2E9WA 2LV4A 3DDFA 4TSBH 1R5IB 1IZKA 1FO0B 5AW6B 5KVFL 4GUOA 2P8PB 4HBCH 2X1QA 3SBWA 3WMQA 2ICCA 5FKPA 1DJSA 5FV2A 5GRVL 1S9XB 3BH9A 3UTSD 4MGXA 1F4HA 5HP5A 2FGZA 3TBWB 4L3AA 3NH7L 4GS7C 4NO0B 4BZYA 3C2AH 3S34H 1N18A 3MFGB 2YD8A 4WUUB 4GINA 3GGWB 4G7VH 2DQCL 3T3PE 2O61B 2BHUA 4OGAD 3OF6A 3D39E 5L6YL 3F65A 2BP0A 2YWYA 3FOLA 4MCNA 4LU5L 4NT6A 2WQRA 1P4UA 2VISA 3EDJA 4TUOB 4Z7UB 1OE2A 2B8OT 4OGXL 4WGVB 1Q0YH 1NEUA 1QSFD 2D8KA 5HI5C 1KJ2B 3KWUA 3QJTB 2HTLC 4FDWA 2FSDA 3EYSH 1F58H 5AW0B 4C55A 4EEEA 3V0GA 3II2A 4I89A 2YKKA 3OJ2C 4PJ5B 2NLJB 1D6VH 2IWGA 2PCPB 4PJDA 4QRPA 4JJHA 5F89A 1IILE 5AEAA 1QO3A 1KGJA 3MRIA 5TDPB 2R2BB 2IBZY 3L2MA 4APXA 4M7KH 1SYSA 2EEBA 3ZE0E 5KUKA 1F6LL 4WHTB 2WXJA 5DC0A 1ASOA 3O3BB 5F93C 3H9HA 4TTDC 4K23H 1AY1H 1D7BA 4P2OA 1WZ1H 2XTJB 1XXFC 2VUYA 4UT9A 4JR9L 2C8NA 3IGKA 1ICTA 1NLBH 3C5ZD 4YHNA 2IANB 1SBSL 1XSJA 5FYKD 3RDJA 5F7KC 1YNTA 2YD6A 2GAZB 5F0JB 4X2UA 1FL6A 4AEHH 3RAJL 4WFGD 1YEGH 3O9WC 3PU7A 2WB7A 1AYRA 1FLRH 5SWSE 3D0LB 3GHEL 4XWGH 3D2UB 1KPRB 1KB9J 3K2UL 3OKOB 1NIAA 5EHFA 1IGIL 5F97E 4UWQB 1NC4D 3EZJB 4JHAL 5I8OL 3KHQA 3ZDXF 3EJZD 4FL4B 1UVQB 3EXJA 1TZAA 3E1F1 3UMTA 1QVOB 5HHXH 3NABL 2V3DA 5F0MB 4NQVB 1X5ZA 4O9HL 5K39A 2X70A 4OBSA 3WI9A 4GO9A 4L4VA 3VXSE 3UTTB 5MI0B 1KV7A 1AI1L 1JPTL 3NMEA 3TM6A 3F7VA 2PPFA 3C9NA 5AVRB 1I9RH 3FQ1A 5GHWL 1FBIL 3TCTA 3UYPA 1N10A 4H88H 1QNIA 4X0KB 1N5YL 2C9UA 4PJCE 5HHOA 3VTAA 2YMXL 2K3HA 7FABH 2H4EA 1GIGL 5JW5A 4X83A 3SGKA 1T0PB 4NBYB 4PN6A 3I02B 2HFGL 4FX5A 1THCA 3OJVC 2IF7A 3FQYA 3HS0C 3KYOA 4XBEL 3IETA 5TJWK 5LGYA 4JM0A 4U3SA 2HYMA 4RAUA 2C1OB 1RZFL 4TV3A 3WENA 1CMOA 4NNPH 4ZK8A 2JB6B 1T0NB 1EIBA 3LXBA 2OX5B 3X2QB 3JVGC 4ZFGH 3AACA 4NM8L 4X7SH 5IK3B 2JQZA 1UB6B 3MO1B 4DCQA 1N7ML 1KLFA 4TL5A 4ZZKA 1ULVA 3T2QA 3O9WB 3K0YA 1J8HD 1NMBL 2VXVH 1WZLA 3HC4L 4EKJA 5JHLA 3CFDA 4B9JA 2WQXA 4M8QB 1HHIA 4PBWD 2J8HA 2ZG1A 3BGAA 3VWKC 4OV5A 2WXNA 4PUBH 1JOIA 3LRLA 5FECB 5DK0A 1V10A 1K4CB 2FD6L 2FSEB 4LP8A 3OXSA 2N7AA 2BVQA 5JPMC 3SGDI 2YEZB 4HEPA 2IALA 4X7CC 3VYNA 2CA4A 1YEIL 3RGVC 2FL5A 5ICXB 5IKCA 3VA2C 4OJAA 3WUWA 2MKLC 3SKUD 5CBAB 1JXFA 3ASWA 4KJYA 4PJ8D 4CC4A 4HOZA 2YAHA 1YJDH 1EEQA 2KLTA 3DGGA 4M5YH 3WN5C 3ZU8A 2VB5A 5DHDA 2FD6H 2GBVA 1ZOXA 1JWSB 3FRPA 3SKMB 2DTMH 1CGSH 4AKQA 1IAIM 1ZLVH 5TQ0L 2N7SA 3B7RL 2W81C 5E6IB 3ARRA 4APQB 4JLRB 4YSQA 2V6HA 1SBBA 2X9XA 1CTOA 4HJGA 5E2TL 1A1NA 1XGRB 2I60L 4KFMA 3QUZC 1OAXL 4ODSH 1JHTB 5FAAA 3PV6B 1PIGA 1M1XA 3BSGA 1YSOA 4HJJH 2GBTA 2OI9C 1DJXA 2WKOF 3G9AB 4MFHA 5EPMB 5F1IB 2BSDA 3GUTB 1DVQA 2GJRA 1QATA 2EIKB 4OAWB 3TJEH 1UXLA 2DPKA 2I60H 4QTHB 3AG3B 5LBSL 4JDEB 3LNEA 2X09A 4LPCA 1RZKL 3KLSA 3QNXA 4KK8C 3GXUB 4H25B 2IDSA 5TE6H 1BPLB 3TH4T 4N0UB 1PJWA 4GAYB 4F15B 8PAZA 3CVHH 4RH4A 1JP5A 3H0TB 3VTTA 1MRDL 4RDQF 4QHNB 2B3RA 5FLUA 4P2QD 4XPGH 3PAUA 3DX7A 3WFDL 4E5XA 3NJHA 3OQRA 3G6AA 4R8WL 2CCWA 3L7FA 1NL0H 1JNNL 2J4WH 2Z92B 3BJ91 3WD5L 4YNYA 3CSPA 2ZCKL 2DDQH 4G6MH 4JK0D 4LU5H 5BNXD 2P5EB 2CDGB 2SODB 5MP6L 2FEDC 1K6QL 3E3QE 1UWGL 4QAMB 1K2DA 4GEJA 1RUAH 4OZFA 3T0WA 1U8IB 2YBRA 2DS4A 5EF2A 3BD4A 3D33A 2PYEE 3RX9A 1MCOH 2G75A 2DH3A 1EEUA 3DI2B 4PRHE 1GS7A 4D3CL 4JGNA 1KJ2A 3DURB 1HKFA 4BA0A 4KTDH 1K8DB 2BY1A 3V8CA 3L48A 3VGBA 4HUXA 3NQKA 3X14B 3AM8C 4Y5YC 1QFWI 3RVUC 1AQKL 2HRPH 4PJHE 5AWNH 1GC1H 4LQ1A 1HFUA 5D7SH 5E5LA 3MV8A 4PHZA 4Y1SA 5AKTA 4WK2B 4Y9BA 3UPRA 3L95A 1IAKB 1QUNA 1MWOA 2QVKA 2F19L 1MWAB 3MLRL 2E86A 3OAUL 4J6RH 4PJ8C 3UTZB 3VFWB 3W11C 3GBEA 1CTNA 1I8LA 4PSPA 2VSCA 1XBDA 1C08B 1NCJA 5F88B 1YEHL 4Y19B 3ZTEA 3US1A 2IV9A 4G6AD 4LGRB 2Y69B 4POZC 3EYVB 4PV9A 5J13C 4XH2B 3D4CA 3VWKD 2HN7A 4GW5A 2Y07L 2QEJA 3C6LC 3QRLA 2FB4H 2GHWB 4Z78B 4ES9A 4WSGA 5C0AA 1JV2A 1IC5L 2FT6A 4YK4C 3T3ME 4NFCA 4WNQA 5E8PB 1OGAD 2HKAA 2WO2B 5CAYB 2NW2B 3U4BH 1TJXA 4LLUB 5L2KE 4XT1C 1GOFA 4N22A 3QR0A 4RX4A 4N2CA 4H20H 3FB7B 4JMXA 1RZ7H 1QSEE 1D6EA 2P80A 5EH1A 4LCCA 5IGXL 1U0QA 4WF7A 3E9TA 3I75A 4Z77B 4MBRA 5FO7B 3ISYA 5A6MA 2QBWA 3WO3B 1TIUA 3NA9H 2ROYA 3GHPA 3BIBX 1CLYH 4PB9H 3HZ3A 3O2VH 4MS8C 4GKOA 3LXUX 1DEEB 1G7PB 4QRRE 1OP9A 4NZJA 2Y22A 5CZVH 3FDWA 4JN1L 2V9TA 5I6XB 2H5UA 3GI8H 4QHUA 3T6WA 5IQ7L 4HPYL 4B50A 3SDDD 1EHLL 3KLAA 3U7YH 4BFIA 3K74B 4MAUH 5IQOA 2VZVA 2CLVB 3HBQA 3O3AB 1T1WB 3D25A 1EFXA 2FLMA 3LB6D 5AUMB 1PJ9A 4JRXE 2XWJA 2X4OB 4JFDD 4XN7A 4BE6A 4N8UA 3ARGD 1VFUA 2CLRB 1UWFA 2YS4A 1J9CT 3NGBC 3TV3H 5HXMA 1EA9C 1AGFB 1IQDA 3BAXA 1QFOA 1V27A 5KSVB 2X4SB 2GIMA 1A7BA 2ZXBA 4M4RA 2VLRD 2YD4A 2DEXX 1WTGT 1CN4A 1U6AL 4PWKA 1JGIA 4D9LL 5C71A 1EAOA 2DQUL 4HIIA 3QDME 1E8YA 4YVNA 5I73C 4K3EL 4WFED 4TQ8A 5B8CC 4UT6H 4OGYL 3LKSA 4YVUA 5FECA 2EZ0D 1J8HB 3C8DA 2P5EA 3FTWA 2IPKA 4N2HA 4KKPA 2QGDA 2YRLA 4HJTA 3WY3A 4N68A 1D7FA 1T20A 2MHAB 4CMHB 5DMYA 3IVKB 5CKGA 1KG0A 4N2KA 4OM0L 5DRZB 3MRBA 3ULVF 5FKAA 3IYLW 1GYCA 2EJ1A 2DQ6A 2LU5A 5BZDA 5KVFH 4I8DA 3V8OA 5G4OA 2OCCB 2RMNA 4V1DE 4IOFD 2OZ4H 1GPOH 2XV3A 3CNKA 4X6CE 2N1KA 5AW7B 5BOJA 4TQPA 1GW0A 4L3EB 2KMWA 5GRUL 2CIIB 2JLPA 2F53E 1SVBA 4NQEB 5I0XA 1JRHI 2HT2D 3UACA 3DMMD 2A1WL 3DO7B 3N1MC 4CSZA 3N9GH 3SO3B 4XNMB 2P43B 2IDFA 2Y2WA 1SOQA 1V3MA 4EMZA 4XBPA 2DI7A 1SNRA 3CVHL 5E8DH 1KACB 2JXMB 4MQSB 4ZDHB 2VSMB 3EOBA 2TRHA 4G6KL 2VXTL 3WHXA 2B1HH 4PY7A 1X5GA 2K8MA 2YGNA 4H1LA 4X4ME 3TYGL 3ZDZE 3DIVA 2DL2A 5CCJA 5CEXA 3HG1D 4BQ6A 5E6IC 3GZPA 4WNQB 4Y4FC 1WBYA 3VXPB 2EXYD 4YR6A 5C8JA 1LP9F 5CZXC 1YQVL 4LCYA 4RZCA 1E27B 2BIMA 2HFGH 1U8NA 4AQAB 1E30A 3I3DA 1XSKA 2J8OA 1OLZA 3PRZA 5DJ0A 4LCCB 6FABL 4XVUD 3QZLA 1X5AA 4GKZB 4WI7A 3BFOA 1Z5LA 4DGYH 3X3GL 4N0YL 3T71A 2W60B 1C5BL 2I24N 2MFNA 3P3YA 3LAFA 4GAJH 4JN2A 2IANA 4LAQL 5JW4R 2BOCA 5EZJA 1JDCA 3LYRA 1X9RA 2OJEA 2AANA 2V33A 4LSVH 1KIRB 4Y19D 5DUML 4UIKL 5FC9A 2F5BH 1SF5A 3RWFB 5BPPA 3UYRH 4ZMWA 4OZGF 4ALAC 1WT5A 3GSOB 4HWEL 3WHE1 3A22A 4JCWA 4X6DE 2KHAA 3S9DB 4J6RL 4NAJA 1AI1H 1JPTH 1P4BL 4Y4HB 2O61A 1S5HB 1N12A 2M26A 1P84J 4Y1AB 1FNGB 1VEPA 4FABH 2ZXGA 1E3FA 3WCYA 1HOEA 4F58L 3OZ9H 4Q6YA 1HSAA 4Z7UF 1WA1X 4UF7C 1NDGA 5HI5D 3PWLA 5ISZD 5EF0A 3CSGA 3VXNA 4BUQA 4G80A 4QRPB 2NSMA 4C83B 4JFTA 1CD9B 2J8UF 1NGZA 1DVFD 3M45A 2NR6D 4D8PA 1YEDB 1NQBA 4NZUL 3JV4B 1RUPH 3Q01A 1UA6L 3MV9A 1PW3A 3GHBL 4JO4L 4NO0D 4PD4J 4D94A 4XPFH 5JW4M 2ED6A 1NGWA 5CMAA 1JPFB 3HS8A 4FFZH 1ZLUK 5IMLB 1FH5L 3ZZLA 1HYSC 4LP4A 3MV01 3DOSB 1RVFL 4KHXL 1CZ8H 4YDVA 2VLKD 4LCWA 5EUKB 5ANME 1MJ8L 1TVDA 4KTYA 4E9VA 2FYVA 3EJJX 4IHBA 1QLEH 3N40F 2E9GA 1FG2B 4TULL 4XN4A 4AT6A 3I75B 5HDBF 1ZPUA 3C5JA 1T4WA 4G1EB 4CUCA 4NQXA 1FH5H 1OQXA 4JCLA 4R0LA 1U8MA 2HFEA 4YDIH 1T2JA 4HJ0C 3TYFA 4BFBD 4FFYL 1UZ6E 5D93C 1XMWA 2GEEA 4UOJA 3UAJC 1MCFA 1MIEL 2BRRL 4HS3B 3V6OA 1T7YA 2VN5A 4HLJA 4KKLD 1PZAA 2AEQL 4Y2DB 1OP3K 3AS1A 4PCKA 4KXAA 3V6BR 2WBWB 1JNLL 3VFSA 4C54A 1GMEA 1E7VA 2WCSA 3MRGB 5F7BA 4MAYD 3RPIB 4PGJA 3BRFA 4QNPF 1R3IH 3M17B 3KW7A 1UWGH 2BRRH 2BNRB 3KCPB 3GSQA 3DGGB 1JPGB 5DJ6A 1MCJA 1N64L 3HC0A 5AZUA 5HTSA 2NY0D 4P07A 3KPTA 1ILSA 3RWDA 3W0WB 1A21A 4M9PA 2QPDB 3V7AE 3W9EA 3QC5X 4QRRB 4EDWH 5CZXD 5DI8B 1UKSA 3T0EC 5JQ6L 3FPYA 5DMIL 3ZRSA 1Q0XL 4OVUA 4B97A 5KJ4A 4ZW6A 3H85A 4M6MH 1H6TA 5K33A 1INQA 3LQZA 1I3GL 2Z9TA 3DTXA 1A6UL 4MMZA 2G4GA 5CLWA 2VQ1B 4P4KD 5FYKE 4L18A 3QIWD 3RGHA 1JZ2A 2Z31B 3EUDA 4JRLA 1WK0A 2F5AH 3FO9A 5AAMC 1BBJB 4P57A 4WI8A 1KJMB 1AYOA 3AB0B 1SJHA 3H3KA 3QR1A 4NM4H 5EU7E 1COBA 3CFBB 4FYTA 1E4XL 3MNVB 4XNUL 4C4UA 3VG0L 3S3BB 4ES8A 3HBPA 2WZAA 5AAWA 4PJ7F 4UZSA 1SLXA 3HIZA 2HFTA 2VN4A 4YHPA 1Z9LA 1DJZA 3BQUB 4X5XB 1VHPA 3P0YH 2X4NA 5D5ME 4ZYKA 1HESA 4N20A 4Z7QB 5IR1B 2Y4SA 4XHJC 4AQEA 4ENED 1QAWA 3FYIB 1QLFB 1CQKA 3BWZA 4I18B 3UOAB 3L54A 2OMVA 4J4PC 1AJ7H 4ZFFB 3UZVB 1U8IA 4HS6B 1WBZA 5L4MA 4CGTA 2PP7A 3P4OB 3KPNB 2YBGA 4GOSA 4N2LA 4XAKD 3UBFA 2VXUL 3STBA 4FF9A 4PUBL 5D2LF 5MEND 1RK0B 5GXBB 2NY3D 5L7XL 4WIQA 3DURA 1YEWA 2X4QA 3X1FA 2JQAA 5IEKA 4JFPA 3MROB 1QA9B 2KQMA 6FABH 1BM3L 5B1JC 4RRPA 3PPEA 1JWMA 4PJ7B 3QG6B 2WAHA 3BP5B 2ZUWA 4EE2A 1NOFA 2DQFB 1WS8A 2MTAA 2ZPKH 3JV6B 4U49A 4W9KC 4BXVA 5DJ0B 4ZMQA 2XWCA 4GAYA 1B2YA 3FTYA 1L7TL 4A2GA 5FYLL 4B9CA 2AF2A 4PWHA 3I84A 2E7LA 3WUZA 4P5TA 2YPVL 2WD0A 3WEAA 3WTUA 2X88A 2H1XA 3CZNA 3G04B 5A3ID 3EF4A 3QW9A 1I3RA 3GMNA 1ZLSH 4GBXC 2D3NA 2MCPH 3UL4A 5CN3A 1E4HA 5J5EA 1L7TH 3HI1B 4U1KB 3GRGA 2R1XB 3QA3A 2F8XC 1J9RA 4IBVA 1AKJD 2AVGA 2XQBH 3RX7A 2BSSB 1OP5K 3NEOA 4OZGE 4P49A 1GKEA 1OTTC 2VUOA 3CFCL 5IB1A 1S7UB 3VSVA 5E00A 3FUEA 1JPSL 2MHAA 4B5EA 3MRQB 3I6LE 4JRXA 5T3ZH 3BUPA 4Y9CA 4YO0A 3RNKA 1ASQA 3STZA 2OTUB 3KDMB 4HT1L 3BIKB 4KVPA 1WICA 1L9RA 2VL4A 1S6NA 1BZDA 1N8ZA 5J1SC 2OTPA 3PJSB 4S11A 3VXOB 4FTDA 3EGXB 1MRDH 2PR9A 4MAUL 1JXKA 5INCA 1Q0YL 3GTVA 3IDUA 4TVPH 4ZS6D 4WO4D 1F1GA 3T2LA 4L48A 4XPFL 4U1SA 5AW8B 5KYWA 4FNLL 4DQOL 1CDGA 4LL1A 1HJCA 3MV8B 4IBLT 4AJVA 4B9IA 3UPRB 1JZ8A 4X9HA 4OSUL 3V4UL 4CNIA 3EFOA 2F53A 2P45B 4KXCA 3SYOA 2PF6A 4YBLC 1N0LA 2JCCE 4G1MB 3ZDZF 4YSCA 3FRUB 4YFEA 1CTMA 3UBGA 2L0DA 3INOA 3SGEI 4I0PA 2A2QT 4KZ0A 4BSVB 3RDTD 5IFJB 1F02I 2UZYA 2ARJB 4IRSA 2KYIA 3VXSB 3WAJA 3FH5A 5HBBA 4DZ8A 3KHOA 1M6UA 4GXFA 2WQUA 2K7PA 4Z7OB 2VXTH 3E2HB 4Y2OA 5HHNB 5GQBA 4OQTA 1JK8B 2WXMA 2H45A 2IVFC 4GXUM 4JANB 4LLYA 2ETWA 4M4RB 3ZMNA 4MLIA 1JF5A 2JCCF 3D06A 2VR6A 1MHEB 3GJFH 1R0AH 2K4AA 2OMXB 3SDAD 2ZKXA 1FAIH 1SXBA 2IAMD 3PDOA 3KGUA 2G2PA 2D0HA 2DKMA 2X4PA 4GQ9H 4KJQC 2DMCA 3EYUL 2WXPA 1E2VA 1A7PL 4I1RA 2BY3A 3WLBB 2XXFA 4ZAKD 1CIUA 5EUOB 4P4KB 1M05B 3U2IA 4WJKB 3OAWA 2VLJB 5GRUH 4IKKA 3SZ6A 5KAQF 1L5GA 4JPVL 3WFZA 2WMPB 1WP6A 4XBMA 1DJHA 1TDQA 2VDML 5K1NA 2OTWA 2A74A 1KYDA 4U6HA 2W9EL 3BVTA 5FA4A 1A64A 1EAPA 1UEMA 3QUZD 3RRQA 4MD5B 5G2NA 3L5XL 5EZLA 5I1KH 4JQVA 1LK2B 4PJDB 3V0AC 5HYJD 1EBPA 3L4ZA 2Y7SA 3LNIA 1ZWIB 2YQBA 3PWJA 5K9QG 1HJBC 5K69A 4LSSH 1F13A 1AKJA 3CFNA 3I6GA 1I7TA 2EC8A 1E8ZA 3F8UB 3N1PC 1ETJA 5L88L 2MPAL 2WBXA 2XCMC 4RSVA 2NY4C 5DHXB 1YMMA 2NNAA 5C3LD 3FTGA 5T1JA 4YHNB 4K5OA 1TETH 2FWLB 3UABA 5DURD 3C60C 4GIOA 4NNXB 1Q38A 2AK4E 4JFHD 2Z34A 2ZXQA 4LOVA 1WZMA 2CHNA 5AB0A 3WG7B 2BP3A 3O4OB 1FL6B 1NCGA 3G5YB 4PJDE 3TF7C 2VDQB 5L2KD 1K5WA 1CQYA 1TMQA 5CS7A 2DV6A 2APSA 2PETA 5I0VA 3BQVA 5BS0D 5FYLE 1DJIA 1LO5A 3DARA 2E56A 4NHUA 3MRPB 1JSYA 3FYEB 2CKBA 2X9ZA 3QUGA 3O6LH 5CJXC 2G3NA 2R83A 3V0DA 4LIQL 4OCXH 2EDLA 4JO3H 2PO6B 1OT4A 3W2DL 1XMEB 1W6LA 2XUWA 1OSPH 2CO1A 4X7FC 2WSPA 4PJ5E 1RZIB 4LMQI 3UYPB 5D7SL 2E9BA 3QARA 1UCTA 3WS6C 3SQOL 3QZWB 3MRJA 3ZHKA 3N44F 3O6LL 5CILL 1GSMA 2GQHA 4P2OD 5FKPB 1IM3A 2JCCB 3GSVB 3WS3A 1KDJA 1ET7A 5JDSA 5BQ7B 3W2DH 4HUUB 1A6ZB 5IVXF 4MDIA 2BNRE 5EIIG 5HGAA 1KTCA 2R2EA 4OD2A 4GRLD 3VFNA 1LEKB 5DJ6B 3F84A 4G3YL 1X6NA 2BVUA 2G9HB 4HS8H 3C60B 5FOJA 4JJ5B 4DPBX 1CO1A 4LCUB 2EXTA 3BPNC 4NPJA 2Y1AA 3Q2VA 2QZQA 4OIBA 2HJLB 3MRFB 1UA3A 5LN8A 2F61A 4MCMA 5IHUL 1DQLL 4Z3IA 4GW1A 4QY8B 1N59B 2AJYL 5DO2C 4NUGH 4PEEA 3AY4A 4R97B 1FIGH 5E94B 2AQ2A 1MIML 3ARED 2WCGA 5C0ND 3CFEB 3GM8A 2AI0H 4WUUE 2BSSA 2QSTA 4PJFA 1LM8V 4RX4D 1KXQA 1H15B 2BXYA 3LZNA 4P2OB 1HHHA 5D1ZI 4C57C 1JZ3A 1KYAA 2BHZA 1R3KB 4Z7AA 3HC2A 3PXHA 2NZ9C 4FQIH 4J8RB 3KVPA 4MJ5B 3QHZL 2EEFA 5LBSH 4B9YA 1SDDA 4KO5A 1X5FA 2WN2A 5TK2A 3T0XA 2J73A 1A6WH 4G6FD 3PYCA 5IW3A 2BP5M 3RVTC 4OSUH 3V4UH 2ADYA 3PFUA 1V05A 1FRGH 2XDHA 2XXMB 2XN9A 1N3NA 2MQ0A 4NYLA 1L4IA 5KVGE 2QQKH 4PWEA 2DI8A 3VXUE 4Q9QL 4L8SC 1J5IA 4DAGL 2K6YA 1YYMH 4R4BA 4RLDA 5H2BB 1BAWA 3A67H 5EN2A 2GSIA 3DUUA 4IBWA 3N41F 2E9JA 3HNSH 3C6SA 1TXKA 3I9GL 4OFYA 1RLBA 1LO3L 1NBZA 3BGFC 1UZ6F 1DQML 2XYCA 3A4AA 3HC3H 3TV3L 2G5BA 3MYJB 5A3IC 1GZHC 1RMFH 2CM5A 3BGMA 3ZE0B 4TL4A 4E41D 1U36A 4D0DB 2V9QA 4CU7A 1GY1A 3APMA 5LQBH 2XX1A 3POCA 3P3TA 1G7LA 3TBVB 3FOLB 4Y5XB 5AZEH 5DFVD 4BFKA 3DV4B 3RPKA 4AEEA 3FQUA 2H6UA 1GYAA 1RZPA 3PF2A 3LS5H 3VFVB 5T5FA 3ME0A 3D0VA 3D3VA 3MLUL 3EOTH 4QUOA 5LKNA 4OI7A 2V9UA 1HEZA 4O2EA 4E5XB 1HE8A 2BFVL 1TPXC 1FL5B 5EOCJ 4L37A 4OIIH 2OR9H 3K7UA 1M57B 1MW0A 4Q2ZB 2GUOA 2GUYA 3OV6A 4PWJA 3ECQA 4ATTA 5L9DH 3MQIA 3MRPA 4F92B 4LLWB 2CDGA 5AB2A 1TJIL 5D1XB 2GT9A 2Q76A 3OGCA 5FYJL 2YSTA 2AGJL 2J7LA 3GB7A 3SDCB 2BSTB 3V4VB 3QIWB 3MBXH 5L4IA 4JDZA 3NOIA 2FAUA 3I6KA 3Q6GH 4RAHA 3KLHC 5C0IB 1KOAA 1ID2A 3JVFC 3BEWA 3A21A 1GZPB 1A8ZA 2VDNL 4ONFL 2ZP9A 1B0RA 2OTWB 2GG1A 3MXVL 4PBVC 4ZAKB 1RPQA 3RPIA 5CP7B 3BH4A 3RL1B 1QRKA 5BS0E 5HYQA 32C2A 1NBCA 1Y1DA 2C9XA 2BVYA 1BHGA 5D7JD 1E9OA 3KCPA 5EO9B 4DTGL 5ANMB 1UASA 3TIEB 3TNMB 3OZKA 5HGAB 1F4YL 4XNZB 3RVTD 1OSZB 1UVQA 3ARFA 5GS1C 4PMEA 2H3XC 3O45A 3TT3L 2VITB 2P24A 3MZGB 2G9HA 1DVZA 3SHSA 5ADPH 1A9EB 1AR1D 5DZJA 3UTTA 4NWTH 4IBTA 5IHHA 4IS6A 3STLA 3PABA 2WBJA 4YBQC 3ULVE 2LHAA 4CKQA 2AEQH 4GW1B 1NCHA 5D7JA 3F6LA 1DYZA 4Y16A 1U6AH 4NM8H 2ZOOA 3CFKB 4URTB 2WINA 2ZSVB 5ESAA 1SFDA 2P47B 3DMMC 1CL7L 1EERB 3PV6A 1ET8A 3JWDL 5DK2B 4FS0A 5BJTA 4E36A 1YPZB 2X12A 3ZR6A 4IIQB 1NC2B 4QHPA 2QTVA 4I0PB 1A6TA 3IDIA 1SJMA 3FKUS 2R4RL 2FJUB 4J1UB 4JDVB 5IFHL 1FFNA 3B2VL 2F8VA 3L3DB 3QEQD 1CGVA 3LPGA 2XZQL 5FGCE 4OCSL 4WI0A 3VFGH 4QO1B 5D6DA 1OAYL 5AL8A 1S5IH 5JQ6H 5DVLA 5DVOA 1KLFB 3EBAA 5HGGS 4D9RD 3SPIA 1RZIA 4N5EC 4WEEA 5D6DC 4NLAA 5F0LB 4PRNA 3TVMD 2QV4A 3FU5A 2YLHA 1HOCA 5B8CA 3VRJA 3FTVA 3ZR5A 4F9LC 5DLLA 1IEHA 5I1LB 5CJOH 4GI9A 2E75C 2XC8A 3TEXA 2XWTA 4DPCX 4DUXA 5KVMC 1XGTB 3U83A 2CLVA 4JRXB 1H3PL 3D2TA 1I9EA 1UUSA 1QPKA 3HCVB 4HG4K 2X4UA 5E6RB 4JFVA 1MCHA 2H3NA 2XSKA 3OKKA 2QADC 3P54A 4XI5C 4QMEA 3S96A 3GMQB 4IKIA 5TPWL 4U6HB 1NGQH 2YAFA 5D7JC 1RUQL 4S1RL 1H0DB 1A6VL 5FA4B 5I8EA 2N01B 5DQDH 3QDJA 2P52A 2AXFB 2FK9A 2BM3A 5IB4B 1M71A 3I6SA 4HIXH 4PCSA 1JIBA 3PHSA 4HJGB 3S3SA 2QQNL 1J0HA 4FXKA 2GJJA 2Z91A 1NBYB 1IT9L 4M7KL 5IT2L 3OAYH 2C3GA 4JEGB 4X6DB 1ZDQA 4K8RC 3FHEA 2O6PA 5EB9A 1MZZA 4JE4B 1XR9A 4R8WH 2FCBA 2G60H 1PY9A 1QSEB 3MUY1 1BOYA 4DGVH 4BDVA 1GGCL 3BWUC 4P3CL 1C12A 4GG8A 4FP8L 1EAQA 2GKIA 3MV7D 5DQJA 5C0GB 4Q6IC 1EBAA 1RIHL 2WJ5A 3QJZA 3WIFA 3MLYH 3O6ML 1AR1C 3NCYS 4AKPA 1XO8A 1XIWC 1FPTL 3DBXB 4ZTPH 5A7EA 4I77L 1JK8A 4WTZA 1TEGA 4G9FA 5EC2B 5A2AA 4N90D 5KSUB 4ZW8A 2YXFA 3PNWB 1MAJA 2G2RA 3OMZA 4FFYA 1EFXD 2DWTA 4O58L 4RAVA 3ZL4H 1G6RL 1F4XL 2G3MA 2OMXA 1CE1H 1PLBA 3UBXB 2GK0B 3MCKB 5FUOL 4KJYB 1NWPA 1IAII 4PS3A 3WTWA 4J2XA 4OQTL 1U8QA 1NMAL 1YC8A 4BD4A 3HE7C 4OB5L 1MCPH 3BH8A 4PP2A 2XBDA 4CSSA 4M1CC 1KC5L 4UOZA 3OZ9L 4HPHA 3C8KB 1W16A 4ZBJA 3LRHA 3VW3H 3CHSA 1EUUA 2P3YA 4NJAL 4HOWA 1NEZA 4N8VG 3B5HA 3GMRB 2A6KB 3LIZH 2AXGA 2IIJA 5DFAA 4B3VA 3CHQA 3QJUB 4EJ1C 4LPYA 1UM5L 2F5BL 3V5DB 2ERJB 3FRUA 2IAMC 2JJUA 3ZE2E 5KANI 4P5MB 1KJVA 3NPZB 5HPMB 5BQ7A 4Y5YA 2GSGA 3HUJE 1HEZB 1Z3RA 4O2EB 3RU8H 4EN3A 2UXTA 4J3OD 3DSNA 5HHVL 1EFXB 3Q8CA 1RVFH 1A3QA 4XVSH 1I8KB 2WLLB 1X3DA 3UTZA 5J6GA 1KT2B 5E2VL 5E8NB 4FADA 5CU9A 3FT0A 2Y72A 3MKKA 4GFTB 3F2LA 1TFPA 1WAAA 2Z8RA 5MENE 3HHSB 4V1DB 1KCRL 1KTRL 4GKLA 3A5VA 1J0KA 1MAMH 1P5UC 3MRRB 4L3CB 1PCSA 2EDTA 4FQPA 2HMIC 3KNBA 5BRZB 4F7TB 1DQVA 3C6EA 4RGNC 1H8LA 3VE0B 3FUJA 4CJ1A 4G7QB 1ZLDA 4H44C 5B1BB 1PX8A 4Y4KC 4F8PA 4MXQD 1N0XH 1ZDSA 3K4AA 2YC1B 3D08A 3ZXAC 1XSIA 2EO7A 1XWVA 1JGUL 1W9XA 1E9QB 2NY1B 4LLUA 2AXJA 2QR0B 2XWBB 2JTDA 1IM9D 1ZK9A 4WI3A 5ETUA 3ZYOA 4JW3A 5H35B 3V4PL 2WXHA 3WKNA 1BEYL 4F27A 1BD2A 1CT8A 2AEPH 1P84K 2WSDA 3QWRA 3MHZA 2W0FB 2KKQA 3DUSA 2NQ3A 5GZNA 3BPLC 5HDQL 1FAIL 1A66A 2QPFA 4LQFL 1UZGA 1G7PA 3ZDYE 3P0GB 3GIVB 5D7JB 1MG3C 2DRUA 4U1JB 2MKWA 1SVCP 3GLAA 3QUZA 4XMTA 3R8QA 1NBYA 4FNSA 2ZKHH 4JPQA 4CC1A 3T1FA 2ENQA 1AQHA 4NPYA 4X6DF 3SD5A 4I9XA 3TVMB 5BVJA 1KCLA 2DD8H 4MDIB 2A6JA 4NQCE 1XEUA 2Y24A 3FAWA 4MKTA 1ITCA 1AXTH 2XFXA 4AE1A 4WCYL 5T1KB 1A1OB 1UH3A 3D9AL 4KC3B 2DIBA 4CC4C 2O5YH 1OB1A 3P3SA 1PZCA 3VFVA 3U0TB 4I2XA 1DEDA 5F3BA 1HXMA 4G42B 4PWFA 4XPBH 3U4EB 2IQ9H 3TT1H 5JPMA 5DJ8B 2NDGA 2K4WA 3SDDC 2AJXL 4MD0B 5CGMA 1R5IA 1MRFH 2MIZA 1MFAL 2DDQL 4G6ML 3WJMA 1CFSA 1XH1A 5AD0A 3BYYA 2DWSA 3O0LA 3OLDA 4G7YL 3MFFA 4GKNA 3LN4B 4AH2B 4ZS7L 4LPXA 2ADFH 5I8KL 1U8LB 4K0OA 1HHKA 1Z5HA 1U92A 3AMKA 3AZUA 3EO1B 3ENEA 4KKCD 4H26B 4NERA 4RDQG 3RTQB 1U8JB 5CCHE 2IPTH 3E8UL 4GIPD 3BUYB 4G70B 1RI8A 3P77A 1MFDL 1KDIA 3HMWL 3JYCA 1QEWB 5C0CA 1AP2B 4OLUL 1BVKB 5F9OL 1KIRA 1BQSA 4U1MB 2ODIA 4U1GB 4HAGA 3OKYA 3QDJE 4HAKA 3OM3B 2YA2A 5F9AC 2YD9A 4QJ3B 4RVBA 1JGDA 1NCNA 1QR1A 3MUHL 4ZD3L 3F58L 1LO2H 1IVLA 1OK8A 2ZX5A 4R4BB 2FHBA 5H2BA 2XWJB 3I9IA 4TNFA 1ZANH 2V3EA 4LVNB 4JKNA 4PJGA 4WKZB 5IEHB 2Q7YA 3QJXA 3SPJA 5CHNA 3U6RA 4JJ5A 3L9BA 4IIQC 4P5SA 1B4JL 1BEXA 1P9MC 1EXHA 4HEME 4WW2F 1BYNA 4ZTPL 4X5QA 5HYFA 1WZ1L 3KWTA 2D7TH 3CK0L 2D3JA 5C86A 4CVZA 3CZUB 1P6AB 4AYDC 3T0EE 3RYMA 3LH8A 5HJGA 4FCAA