2Y2YA

Oxidised form of e. coli csgc
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
95
structure length
95
Chain Sequence
SSQITFNTTQQGDMYTIIPEVTLTQSCLCRVQILSLREGSSGQSQTKQEKTLSLPANQPIALTKLSLNISPDDRVKIVVTVSDGQSLHLSQQWPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Resolution Insights Into Curli Fiber Biogenesis.
pubmed doi rcsb
source organism Escherichia coli o157\:h7 str. ec4115
molecule tags Chaperone
molecule keywords CURLI PRODUCTION PROTEIN CSGC
total genus 11
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2010-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2420 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y2yA00
2XSKA 2N59A 2Y2YA 2Y2TA
chains in the Genus database with same CATH superfamily
5AAWA 1JXKA 2OSYA 4K5OA 1WVZA 2H2PD 1A14H 4KVNH 1DO5A 3L9EA 4Y88A 5HHOB 4MJ5B 5D7JC 1WC7A 3TC9A 1UEYA 3L1OH 4DP7X 2BSSB 1C5CL 4MS8C 5KS9E 4D0BB 4PJXF 4P04A 5I1DA 3RBSA 1KBVA 3B3BA 4NSKA 2YN5A 4WTXA 2Z7UA 4Z78A 1FHGA 1KB9J 4MD0B 5IQOA 4FQCH 4OZIB 1K3IA 1VZIA 1CICA 1DQLL 3BN3B 1BZ7A 1PX8A 3OXRA 4QAMB 1KWKA 4GG6E 1CI5A 3EHBD 3EO1A 4EZLA 1NFDB 4MVBD 4PJEB 1FFPA 2B1HL 1C16A 3OHXA 2IC2A 4RAHA 4NHUB 3TCTA 1N5YH 4U1LA 3S4SG 3FFCA 3RL1B 4XGZB 4GG6A 3DHMA 1NIEA 4WEUD 2DQIH 1PSKH 3FTZA 5GS2D 3IMRA 2ALAA 1I8IB 1N0XH 1QO3B 1FGVH 4F15B 1GIGL 1Q9LA 2FX7L 1CK0H 3C5XA 4Z7QE 3TJHC 3ZE1B 1KENH 5E8DL 3CG8A 3WO4C 1FYTE 4K0OA 1NCNA 1TQBC 4AMKL 2KBGA 4FQIL 2YD4A 4R5TA 1BM3H 1HHJB 1FIGL 4LPCA 3O6KL 3I9AA 2LT9A 3T6XA 1DQTA 3L3GB 4S10A 5KOMC 1UZ8B 1EBAA 3LVTA 4HD9A 4J2QA 2YFNA 4F91B 1YEDA 1RZKC 5TE7L 1RVFH 3LRGA 1RJZB 4G7QB 3UJTL 4Z7UA 5MEPA 3O4OC 3JYBA 1IC7H 1NCBH 4JM2F 4QRRE 5E7BA 1OTTC 4P2OC 3P02A 2K70A 4NKOB 2QHRH 1KFAH 4J4PD 4ZG1A 1HEZB 5DC4B 3AG1B 5JQIB 2VGLM 4GAFB 4MTMA 2ZOTA 1JK8B 3OLEA 5F6IC 1U8QB 2UXFA 1LD9A 3PAYA 2I32A 3WSQL 1JYWA 5DJXA 3I6LD 2JFCA 4JREB 4UM9D 3L3OA 2X6AA 3QJRB 2OA9A 1XMWA 2R23A 4G7YL 1VGKB 4KUZL 4K15A 4OKVB 5FV2A 3NCFB 1YUKB 2DWDA 3U7YH 5B3JF 2ADJB 3CHXA 2R4RH 1KLGB 1UA6L 4JKPH 1ZE3C 3CBRA 4OZ4A 3KWUA 1OAKH 4E42A 4FADA 4YHOH 2DLGA 4PJCB 5E24E 4HEMA 5AWNH 2RH0A 4HWEL 2ARWA 3UTTA 4BDVA 3MBXL 1ORQA 3B9KD 3VFVA 3SGEH 3MLWH 1TYJA 3W56A 3CHPA 3KLHC 3PFQA 1QFWL 4HV8A 5L8LB 1IQDB 5LBSH 5IFHH 3GXDA 1XSKA 4BD4A 5LDUA 4UNTA 4OF8A 5AG9A 1NUNB 1K72A 1S6NA 2HG5B 3CX5K 2I9TB 3H3KA 1E5YA 1MCNA 4RMBA 5H2BA 5D4JA 2XKSA 5G2NA 4JM0A 4U1IA 3PRZA 4UINH 4X5XB 1CTMA 3JXAA 4HS3B 3CFKB 5SWZA 3VD2A 3QJSB 5FDWA 3QRFM 3AU1A 4JVPA 5M7QA 1J0ZA 3GWJA 2V17H 5I8OL 3UYRL 2DQGH 2HN7A 1NZRA 3FH5A 1NPUA 4KNSA 2H2SC 3FTUA 4S1SH 4CMMA 2Y7QB 4UT6A 4PCYA 4QAWA 4M1DH 1SY6A 4X7TA 1KB9K 1BOYA 4Y19E 1I8AA 3S3JA 2YWYA 4AKOA 5IZ7A 1CFQB 3ROLA 1FZKA 3EDKA 4MRBA 2P8LA 4YUEL 3U0TA 4NKIL 4NQDA 5FECB 3LOWA 1I53A 5LQBL 1WP6A 4I3SL 1Y07A 4A55A 5DEJA 1JZHA 4N26A 5F3HA 4OFYA 4PGJA 4JJ5A 2FLBT 1GYCA 1ACYL 3PUUA 2PXYD 4GKZB 4IKKA 4AGPA 3WXVH 5K69A 4F8NA 2BFVH 4RGOH 3KHOA 2Y7QA 3LIUA 2FO8A 3FRPG 3RAJH 3E1F1 4JN2A 4X9IA 1BQUA 5DJCB 5BQ7A 5B7MA 2ZAGA 3T77A 1CD1B 1ZPLA 2VXUH 4H2AA 1SEBB 1TTAA 2IVFC 3VTTA 3OKKA 1U8IA 4ZNCD 3MCKB 4Z77B 1F3JB 5BS0E 2ADYA 1T80A 4HCGA 4OF3A 5K1JA 1NDTA 4W9HC 2O6CA 4FKHA 1MW0A 1F1GA 3H42H 4P9HH 3VRLF 4G8IB 2C4FU 4YDZA 3NJNA 3VXTA 3VYOA 1F11B 3WFHB 2LVCA 4KDWA 4ODVL 1MHEA 2IOMA 3MUUA 5FV1L 4L8DB 2F58H 2BW4A 3T5WA 3VD0A 2BHYA 4HOZA 1MI5B 2NX5B 2OCCB 2X41A 3BVNB 3CH8A 3HZYB 3P4MB 3DV6A 3V4UL 1AP2A 3TEUA 3WO4B 1RK0A 3F8UB 4JDVA 1A6PA 5I1LA 1CK0L 2Z34A 1E4HA 1PCSA 1AQMA 2BVEA 4H1LG 4L8DA 1X5GA 2K3HA 3JWNC 4YVUA 3X3FH 2KZBA 1YNTA 5JHMA 4RQQA 5LNEA 3G7TA 3K3QA 3UTTE 4F1SA 4IMKA 5K59E 1UJ3C 4ZMYA 3B8SA 4Y9FA 1OGAB 1A6WH 4MXVF 3BPCA 1Q9OB 2AJZA 5AVTB 3VFOB 1RZFH 1OCRB 4W9KC 5DJZA 5IW3A 1QATA 4JBSA 1GW0A 3F7YA 4L3CA 1FIGH 3MRHB 2W9DL 1RK0B 2Z91B 3G3LA 1CU4L 3D3VB 4AT6A 1CD9B 5AOIA 1HE8A 5DHDA 2ERJC 1OAYH 3BP4A 1KBGL 1V7NL 4XODA 1MZZA 3CFBB 3EAKA 3TO2B 4NWTH 2WYIA 5J06A 1A9EB 1P7KB 2NW3B 3WTTA 5F0LB 2Q3AA 3QJHA 4K7PL 3RWEA 1SXBA 4OZFA 5CBAB 1D9KD 4U1MB 4XBGB 4N6RA 1CQYA 2EE6A 3KWXA 4FN0A 2EXYD 2YA0A 3ZMRA 1P6FA 2Z92A 4JRFA 1YNLH 1S9KC 2F7RA 1CF8L 2L8AA 2AVGA 4I8DA 1Q9LB 1M05B 3ZTJH 2IAMC 4IOSD 5HHPA 5JOPE 2FD6L 3QUYD 3CXFA 1BEXA 4GRMB 4KKAC 4O00A 2FE0A 5EOQH 4JKLA 3GRWA 2RFXA 1EGJA 1UD3A 4NJ9H 4XVTL 4YHMH 4GW4B 5EN2B 4RGMB 2W91A 1MFAH 5DVNA 3L8QA 4Q56A 4QOKD 4M5ZL 4POYA 2D7NA 1SFDA 4I2XA 1N67A 2Y6TE 4JFFE 4JFXA 5EOTB 1LK2B 5DLML 4NWTL 2XY2A 4YDLC 5IUSA 5L8KB 4G5ZH 1J5DA 2WLNA 3MODH 4LKXB 3T4AB 5H2BB 3T65B 1WRFA 4NQEB 1RHHB 4J4PA 4WEEA 5DVOA 4IOFD 1QFWH 4NNXB 2F53B 3ECVA 3MRMA 1MFEL 3RVWC 1INEH 3IDUA 2MIZA 3QWQB 1SMAA 4FZ8L 1NBQA 1ED3B 1CDYA 2BIMA 1TZAA 3ROLB 4CSTA 2CDGB 5A43C 4DQOH 4RIRB 5D6DC 1E9OA 1WFUA 3ABGA 3OGCA 4P8QA 5DYOB 2NY6D 4GQ9H 1Q0EA 2QGBA 3P73A 4U1JA 3QZWA 3NEXA 3UC0L 2IADA 1E4XI 2QTVA 1QUNB 2DYSB 1PVHA 2NYKA 3NA4A 1E2ZA 3ECWA 3HC0A 3RFRA 3SCMB 3T4YB 1M6UA 3LN9A 4ZPTA 3S2CA 3POHA 2YAQA 3TBYB 1MUJA 4TNEA 4G8EA 3IS0X 1CLCA 3FRPB 2JJWA 4WAFA 1OTUC 3QCVL 1HZKA 1S9XB 2OL3B 3P54A 4NP4H 1D2PA 4HD5A 1B90A 4XPHH 5HVWA 2I26N 4DKFH 1YEIH 3RHWF 5T8IA 3ULUE 2DQFA 3QEQE 1O9WA 4J5VA 4XMUA 4N0YL 1S7SA 3KPQA 3QORA 4UUJB 3OAUL 4OLEA 2V33A 1AJ7L 4ZDHA 4YX2H 3HZVB 3KNBB 4WKZB 1MFNA 1UVQA 2X2UA 3T08A 3DO7A 4JFWA 5KTEH 3EDEA 5IB4A 3W39B 4DGVL 5ECJE 3G6AA 2Y7NA 3RPIA 1CURA 3FO2B 4JZJB 4IHOB 2VDNB 4JKKA 2BZ7A 4M29A 4LCIL 2G2PA 1YO4A 4D8PB 2VW7A 4Y1AD 3LV3B 1MF2L 2CO2A 4FNQA 1VFBB 4Q9QL 5FFGA 3UBXB 2APVA 3GHEH 3THML 3CZUB 3LNDA 3F04A 4WF7A 3BGFC 2BS9A 2UWEB 3RY5A 1G5AA 3BSHA 4H44C 5I71B 4TOYL 2EYTA 5FGBA 4PLJD 1KB5L 1OAQL 4LHQB 2Q7AA 4DP8X 1K2DA 4QGYA 1FNEB 1TYEB 3H1ZA 3GZQA 4LQFH 3TEWA 2IWFA 3OLIA 1WBYB 2WZ0A 3HKZA 1LO5A 1KT2A 4WENB 3RNKB 3QNXA 1IGYA 4KO5A 3BC9A 1X3DA 2EP6A 3PF2A 4IU2A 1GGCH 5B1JA 4NQDE 1S5IL 2H32H 4D7PA 3G04A 4MMZA 2VDPH 1KY7A 4XWGH 3FQRA 5EC1A 1EEUA 1JD7A 1FFNB 2Q8BH 43C9A 2Y2YA 4A7GA 4YHIA 4FG6D 4F92B 3QEUB 3JT0A 3Q5OA 4UT7H 3QUZB 3QPQD 3WJJC 1N0XL 1T7XA 2DQMA 4XN4A 3P30L 3UDWC 3ABLB 5HVHC 3AVEA 5JIPA 2GSMB 1QRKA 1FPTL 2EXSA 1BYPA 1XB8A 1VLXA 5EBWB 4MJJA 5DRZB 1QWHA 3NCJH 3K71B 3TONA 2K9UA 3MLRH 5BCAA 3FN0H 3TVMA 3OMNB 5FA3A 3SPJA 4XCFH 4AYGA 5EEYA 2CLRB 4LLAA 5AKVA 1P6AB 5I1CH 3MLWL 5AW5B 3ZSSA 3F62A 4KGJA 1L9MA 3TLRA 4UTBA 3T1WA 2IDFA 2KL6A 1AANA 3C5ZD 1AMXA 4FMKA 5ADOH 3SIKA 1YMHA 1LHZA 3CC5B 3I3EA 5ERWB 3IJYA 2OMXB 2YK1H 1I9RH 3V0FA 1KN4L 3IMTA 1AFVL 4F33B 1J10A 4Q2ZA 3RBGA 1DBMH 3MUHL 3FQRB 1F4YL 4HMDA 5CJQL 3KCWA 4XX5A 3ZHLA 1SYVB 1CXHA 4PJDB 2V2WB 4PREB 1T3FB 3ERXA 1D6EA 2RA1A 2ICWI 4MQ7A 3CAFA 4YDLB 3ZE1E 4J4PC 3ATEA 4NS0A 4EVNB 1WFJA 4OCRH 3BMVA 5KWYC 3F2LA 1UT1A 4N8UA 3BX7C 1R19A 3AS2A 1I1AD 3DURA 1A7OL 5ES4B 2HWZL 1CWVA 1T89C 3GJEA 1A3LH 5I15L 4PB9H 1P9MC 1NCJA 3SKOA 3UAJA 3P2BA 3SKUD 4MQXD 5DD0H 3T0EB 3N41F 4EI5D 5E1AB 1XL4A 1S7VB 4WEBH 3CIQA 1KWGA 3L3KB 3NFSH 5JUEL 2O61A 2XFGB 4HT1L 4NZFA 3L7FA 3E3QC 3S5YA 3EKCA 4PLKC 2F6AA 5AZ2H 1M7UA 3FB6A 4AYDC 4GMSL 1JCVA 3BPNC 4TKWA 4L3EE 3I9IA 2CCLA 3ZHNA 4M61B 4KOCA 1Z9SB 4E41B 5MENE 3B56A 5DQDL 1AG6A 3QDJD 4MD5B 3TA3C 5FYLE 4LCYA 4QXUH 1T21B 4IKJA 3NN8A 5KANI 4HEPA 2DTML 4UUJA 5C0CD 1QR1B 3INUL 2UZIH 4HCRH 4UF7C 3RWFA 1SRDA 4JO3H 4OI9A 4WFGD 5GS2H 1S8DA 1W8OA 5E5MA 2VZUA 2CRIA 3ULVF 2PTVA 1AQDA 3KAAA 1U2HA 1U42A 3JYCA 4OF5A 1BQHA 3RIKA 4J1UA 1MCHA 5FFLA 3QQ9D 1JERA 2NZ9D 2YGNA 1EAQA 1QEWA 3MOBH 1MW1A 3QK0A 4ANWA 5IHZA 1JZEA 4U2YA 3V4VB 4R83A 2DWEA 2LAAA 3NH7H 4NBXB 5D7JD 2O26U 4M7KH 5HDQH 2VR3A 1N5AB 2NW2B 3OKEA 4RZKA 5KVEH 1RJYA 2N4IA 3LZFL 1HX0A 1ZEAH 3T65A 3WYRA 4X6CB 5CMAA 5EIIB 2E7BA 3OHMB 4HULB 3QCUH 1QR1A 3CZKA 3LZRA 2WXNA 1LK2A 1CLZH 4YHKL 1SLVA 2HTKC 3PCYA 4YUEH 4M43L 3O0RH 1I8UA 1PAZA 1OB0A 5D9SB 1BX2B 3NJLA 4R7NB 1B4JL 4F7KA 5I71C 3SKNB 3QIUA 3R06B 1QZNA 1NC4A 3L4UA 4G9FA 1CLVA 2QMKA 5F9WC 3VTMA 4DFIA 1TUPA 3V0IA 5CF3A 3C5JA 5KUMA 2DM2A 3REVB 1J8HA 4FXGA 5H37G 3QHFL 5AFAA 4QOKB 5T3XE 3WNOA 4M7KL 3GXNA 4OLVL 3TJHD 5TFSH 2HMID 1P4IH 4FI6A 1JPST 1XB6A 1WAAE 2ARJA 4U3XA 4EE2A 3CSFA 3K6NA 3N0PB 3QDJB 4DJMA 2OMBA 1UH4A 3BPOB 4OM0H 2XWBB 2P1YA 1B0IA 4FQ2L 1TT6A 2OMZB 4OFDA 2KDYA 2D7PA 2FB4H 2G3ZA 5ESAA 5ISZB 1AVAA 2YAEA 1BQ5A 2X42A 4JM4L 4PBDA 4U1KA 3ZTJG 3ZVVA 5A2FA 1J5HA 2NT1A 1LMKA 2JCCE 3IXAB 4FXKB 1ASQA 1E4JA 1H15B 3NFNA 3SY6A 4MJ4A 1MPAH 4FQXC 2R2BB 5FGRA 3S5LA 4Z7NB 2VM3A 2UZIL 4NXKA 5H94B 4W4OC 3GBLA 3HR6A 4IIQB 3ZR5A 4O02L 1UYWL 3KBEA 1UM6H 1UM5L 3HAEA 1C08B 4PS4H 4DKEL 5EMYA 4R2GC 5B8CC 5IIEA 1R5IB 1F6FB 3KG5A 4BM7A 1O6VA 1KYOJ 1BVLB 1L6ZA 1MJ8L 4WFED 3WD5L 4RBPK 2XG5A 4LLVB 4BSWA 4RESB 2G60L 3FF7A 3NZ8B 3PHOB 4TSCL 2V5YA 3GSXA 3B7RL 2FSDA 5E2WL 5SWZD 2VLRE 4JJOA 1KJ3L 3FT0A 4LOUD 2XPGA 1MIEL 3VWJD 5IBUG 1R34A 1AZVA 5C6TL 5D5MB 1CLYL 3GI8L 4DGYH 3LQMA 2YA1A 2K6YA 3PAZA 3QFDB 2H7WA 2P8MB 1AGFB 2EXYC 2VR9A 4LU5H 4OCRL 2J8UA 1I1FB 3GMRB 4ALAH 3CH1B 4MA8H 4HH9B 2ZUQC 3MLVH 3SY0B 1RJLB 3ZYZA 5JHDD 4WTWA 4R7LA 2D9CA 3DI2B 2TAAA 2OSWA 4HLJA 8PAZA 1WD8A 4QF1B 3GRWL 4HOXA 1S3RA 2DI7A 1MREL 5IESL 3VW3L 2ICEA 4Z23A 2ATAA 3DVNB 4NKMA 4OKDA 3D52A 3PIQA 3HFFA 2B5IB 4P4KB 4XCYB 1TENA 5CIPH 3P40A 4POUB 1T7ZA 1J0HA 1CI3M 1QAWA 1RIVL 1TVBB 2UUDH 3JT2A 5EO1B 4XVJL 3V10A 4DUWA 2EDEA 5MHSE 5EUKA 3OZLA 1EZLA 2BSED 3MXVL 2QSCL 4D7BA 4U6YA 3HOGA 5B8CA 3MV8A 2BNQA 4P59H 4YXLL 43CAB 3VO0A 4O4YH 3VRIA 4AGLA 1NOLA 2A9MH 5I8KL 4X99A 1KCUH 4XP4L 1UM4L 5D7LB 3FW6A 4JW3A 5DHMC 3CFCH 3CJJA 4GW5A 3O8XD 2X89A 3O3EA 1MCLA 4PV1C 2X87A 5IVXF 4PFEA 2YC1B 1Y18B 1E5BA 2YSSA 3FB8A 1Z5LA 4YE4L 2NUTB 3FUFA 3RVVD 3VI3A 3VYNA 3SD5A 2UY6B 4G5ZL 4ZMOA 4Z95L 1MEXH 3FK3A 5CFHA 5EIQA 1XF2A 4PJBB 3UTSD 1CLOH 3O6FC 1PLGH 4IKLA 4OGXL 5IW6A 1UOWA 3X2QB 3U0WH 1P7QA 2WNGA 3ZR6A 3MC0A 2LGNA 4TUKL 3MXVH 5AEAA 2VRQA 4TL4A 4J27A 3UO1H 1IEAA 4XPTL 1REIA 2OMZA 4B3VA 3QIUC 3O6ML 1I1AB 1GPOH 2PCPB 5I76A 3NCCB 1T1ZA 2D2CC 5CR8A 5I82A 4GXVL 3F7VA 2HH0L 3MROA 5LGJB 3MCLH 1Y6MR 1S7WA 2CMRH 1QSEB 4XO4A 1GC1C 3LHPH 1NAMH 3QNXB 4KK8D 4WI8A 4AQEA 1FA4A 2F8OA 3SGKC 1T4WA 2JVUA 4P5MA 3T2NH 1DQJA 3C5JB 1YPZF 3QDGB 5SWSE 4LCIH 3CDZA 1F58L 2B9BA 4PEEA 1JPFB 1FYTB 2IDQA 4TVPL 4MB4A 2QR0B 4DZBB 1W2KT 5FB8B 3IJHA 1QSEE 1UKQA 1XGRA 2EE9A 1QSVA 2EIKB 4XVOA 3L3OB 4UT6H 3GMLA 4G59C 5GJSH 2I07A 1PZCA 2C9QA 1KGJA 2P4AB 4HKZA 3TS8A 1IBHA 2BFGA 4NZJA 2AV7B 3MNVB 4WWKD 5TF1H 5F1IB 3WLBA 1MWOA 4OGYH 4KKNA 2YQ2A 1JPTH 3NJXA 5CJXC 5T33L 4AEIL 2QZ5A 2GITA 2ZJSH 2I60L 1JWUB 1TVHA 1EANA 3G5ZA 1YAIA 2AABH 5LGKA 4N25A 5GSVB 1WGVA 3RAJL 1GOGA 1J0YA 2VDLL 2PPCA 3MBWB 5T3XL 4RRPM 2IANE 4GEIA 5IK3B 2XDHA 1H8NA 1A1OA 5FF6A 4FHBD 3WIIH 2ATPB 4GSRA 1KBWA 2OMUA 2VZVA 5I5JA 5TGBA 4XZUB 3OWEA 4TSBH 2GTWB 4IBTA 1INQB 2Z7ZA 1MH5B 2DYPD 1UZ8A 1NICA 4UT6L 2G2NA 3ZE0E 5MEQB 4JFQA 1R3IH 1M6OB 3D4GA 3G08B 4ZO8A 5K1NA 4M93B 4PJFA 1JVLA 2VCOA 3VWKB 3HBQA 4XCFL 1IEHA 4PHXA 3UO1L 5DSCB 4TRPL 1MLCB 1EFXA 2N0MA 1KLFB 3NIGE 3H7BA 5CINH 5ABZA 3L4WA 4D3CL 4NBYB 1QFWI 1PNDA 1TVHB 3QRLA 4FXGB 2EYSA 3OV6A 1KZYA 3FB5A 1TTBA 5I1EH 5JDJA 4MA3A 1IL1A 5E9AA 2QKIA 3ALXA 3M7FB 5I1AA 2EZ0C 4XMLH 3SBRA 1XGYH 1R0AH 4AJ0A 2HJKA 1VF5C 4B97A 3FN0L 1P5UC 1Q0XH 2CD0A 4NQEA 5FX3A 3WFDH 2HRGA 2GI0A 2Z8VC 1D5MA 4ZPVB 1VFOA 3BQUC 2Q86A 4HS8H 3R7RA 1BXVA 5DUMH 5K39A 3LH2H 4G8GA 2QADB 4AIZB 4FFWC 4WSGA 3FFDB 1ORQB 2VR7A 4MBOA 3SBQA 4ILDA 1LE9B 2B59B 3MA9H 3M17B 2Y4SA 4WU5A 1SGKA 5JIKA 3ESVF 3OTTA 5DZJA 2Z35B 1M7IB 2E56A 3ARSA 4JDTH 4PVNA 4PJHB 4I9WD 4HZ1A 2NR6A 3GXIA 3BAYA 2NOYA 5F7DB 4LHUB 5F7YC 4ZO7A 1JCKA 2ICWJ 3F6JA 4HUNB 3U4AA 4MMZC 1A5FL 4O4YL 4ORGA 3QORC 4OZIE 1YYLH 4L37B 4M6OH 2QV2A 4ZOBA 3C2AH 3MACH 1F90H 3LDBB 4G9DB 3APNA 2CLRA 2BM3A 3ECBB 4LHUG 5MI0C 3WBDA 4IK7A 2A74A 4NO2B 4N0CD 1MJJB 2AXFB 4JPQA 2DTMH 2Y1YA 5IROC 3SEPA 1YY8A 4PRNA 1TO5A 1O6SB 1BG9A 2VR8A 3IJEB 1Z0MA 2MFNA 1H3GA 1DQQB 2F9BT 4AQAA 4WNQA 5F3HB 5LNDA 3LZNA 2MQ3A 4L4VA 3NGBC 5D8JL 5HHXL 4AQ1B 3J8F7 3ILEA 1QX1A 5AOMA 3C5ZA 3N1PC 3BAWA 4UQ2B 3X1BA 3BQUA 2VL5A 4UOJA 4JFFB 25C8L 2XZCH 5FKPA 3SJVB 1D5ZB 2CGYA 2WBXA 1R3KA 1N68A 3D4CA 3E6FA 4G6AC 5EZOH 5E8NA 4ZFOB 1DVFB 1U8OB 2FIRT 2IV9A 2EKSB 2G9KA 4GS7B 5DUPH 3V0DA 2GFBB 4AKQA 5DHYA 5FOBA 3MO1A 3ULUH 4ETYA 1B6DA 3NGBB 5C08D 1FRGL 1RIUH 2X7LA 4P4KD 4PP2A 4GQ9L 5LB1A 1OAJA 3QE5A 4KJWC 4QUOA 1E27A 1E43A 1GYWA 3B37A 3NACH 5ENWA 4F7PB 3CXDL 4U1LB 4QHMB 4HFWA 2NZ9C 5JHLL 5JW3H 1T0OA 1IGIH 2WYHA 1OP5K 1P2CB 1H0DB 4XBEL 4R2GB 4L5FL 1MJ7L 2CNYA 4JR9L 4BCXA 3NIFB 1KJMB 2VUOA 2NY3B 3AREC 1D7CA 1UCBH 4MCMA 3LEVH 5IMKB 3QO1B 5I1DB 5CJOH 2CHXA 4O9HL 4OJFL 4OCSL 4PW3A 4RAUA 3WTXA 1DJZA 1RUAL 2HKFH 2OZ4L 4G1MB 4GI8A 2I85A 2WWOA 2XBZA 2MPAH 2XXGA 3DO7B 2XY1A 1CF1A 2PXYC 4MJIE 4UNUA 2JB5L 2XBDA 3UROR 2YAMA 4G6JH 3LEXA 4M1DL 1U33A 3PHOA 3JWDC 5GJTL 3A6BL 4HA1A 1FJ1A 5FCUH 4DP4X 2YMTA 4PY7A 1HINH 2NPLX 1BFTA 3ATBA 1X5AA 1XCXA 4PS7A 3P3RA 5HDBE 4TVSa 4FABH 2DD8H 1S8DB 4TNWK 3DGGB 1T1WB 3Q1EA 1EHAA 1Q72L 2EO9A 1AY1H 2P45B 3OZ9L 1OAUL 2B2XL 3F5WA 4LKCA 4LSVL 4WSKA 2WLIB 4YK4C 1I4FB 2Q2LA 4EI6B 1UD6A 5D70H 2DWSA 3A4EA 2W8CA 3HC0B 5T5FL 5D2LE 2AXGA 5CINL 5BXFB 3U30B 4FHJA 1AS8A 4AVKA 1DE4B 4GFTB 3ARGC 3UPRB 3R1GH 5LBSL 2X6UA 1WBYA 4ODHL 3QZWG 3SKMB 3IXAA 1TQUA 2X6BA 2XHNA 4P59L 1BD2D 1OLLA 3KPRE 4YDVA 3RWJA 1BV8A 3ABMB 3KPLA 3SDAA 5HTSA 3O2WL 3MRRB 3FUKA 4Z7UE 2WIIA 1BXXA 3LXUX 4IDLA 3DX7A 2W80C 3ULUL 2ED9A 3NQIA 4AL8H 3LKOB 1FVDB 3N42B 2GT9B 2XQBL 4OFQA 5F3BA 5IT2H 1NDMB 3A47A 4B9IA 3O0LA 3X3GH 3G5VB 4AI7A 2NMSA 1QBLH 1HAUA 1L9RA 2ITCB 1FZMB 1SVZA 2BVQA 4AGOA 1J8HB 1IILE 3RGBA 3QG7L 1AQHA 3P0VL 1QWNA 4O5LH 4PJDE 1P5UB 3EH1A 3G6DL 3L1EA 3UG4A 1KTLB 2ZWNA 3W0WE 3KM2A 4XWOC 2GYSA 3IDYB 5A16A 2K9FB 4MQTB 2HKHL 1AXSB 4N87A 3VXSD 3KPRD 5I24A 1RPUA 3RU8L 1AGCB 3SBWC 3WKMH 3QPKA 2B4CL 4MD0A 4Y1TA 4QRRB 4A66A 4X5RA 1P4UA 1G4RA 3BWSA 1KEML 4PIBA 5D2NE 2GIMA 2ZUYA 4FFVD 1OCWL 1ZD6A 4KJQD 3U4BL 3NAAL 2CMRL 4OQ1A 2QPUA 1UA7A 3E2HB 1QEWB 3FO0L 4POZC 3MYZA 3QUYA 5D1QA 2OMVA 3IXTA 1QBLL 4KROB 2Z91A 2KLRA 2DLEA 4LBEB 5J3HC 3SPVB 2J88H 3GPSA 1N6QH 4ZFOA 1A6TA 3UZEC 3D0VA 1XIWB 5JO5B 1B2WL 5LG1A 3BZ5A 3LDBC 4X5PA 1A1MB 2X12A 2NY5H 3EO0B 2YJQA 2WXRA 2X1XR 1U58A 3NIGB 4HLZG 4M48L 2WZAA 4PSPA 1JVKA 4IHBA 4P23D 5KVDH 4DP2X 1BAWA 1AXSA 1PD1A 4X6DE 5C0AE 5B22A 1MCWM 4LOEA 4IBWA 3ILPA 1NANI 1C5DB 3GO1H 4KH9A 4HZLB 3FBKA 4BQ6A 2ESVE 4JO2H 1JHTA 1R3JB 4E9VA 3RB5A 2F8XC 2WQRA 1C8PA 4JFDE 3HE6C 2OM5A 4E41A 1OIOA 1CFVL 2RFXB 3UYRH 3PV7A 2DW5A 1KN4H 1MFAL 2V8LA 3NZHL 4BE6A 2K7QA 3IGAA 4P46A 1NM9A 1FNSL 3H2WA 4BH8A 4G9DA 4BKTC 4PG2A 2NY3C 5K1VA 3N50A 4F58L 1K5NA 1QD0A 2NY0D 1SVBA 3JV6B 1I8LC 4YWGH 3COOA 4GMTH 1J86A 3NDZE 2ZPKH 3A67H 4HWZB 5LDSA 5ITBL 1BIHA 4FQPA 1E4KC 5C0NC 3ULVD 4N4YB 3GKZA 4JHWL 1OF2A 2VQUA 4X6EB 5CU5A 2X9YA 2B1HH 2QBWA 4EVNA 4UQ3B 3GNML 1RUAH 4IOSA 3HPLA 3QQ4A 1EBPA 5E6ID 1H6UA 1KNOB 3R4RA 4JM2A 4MNGA 3AY2A 1S9YB 1GR7A 4NQCA 3DUUA 2HVJA 4NT6B 3L4YA 4XMPH 1OK8A 3OR7B 2X10A 3FUNA 3QWOA 2B16A 3D3VE 4BWUA 2X0WA 1T6WA 3QXUA 1MQ8A 4N8VG 4R2GD 4XPAL 1I1AC 1YEHL 3PWJA 5D1ZI 2WZPD 5JOEA 5JPNC 1MSPA 2Y3AA 4EF3A 5HJ3B 3U0PA 3SDXF 1WIPA 1J1XH 3S3DB 2FGWL 5CHNA 2LU3A 5ANMA 1GC1L 4HIPA 4WO0A 1JGVL 5D1QD 2PW1B 5DD5L 4PIRF 4X6CE 3D9AH 4HOMA 3S8WA 4ZD3L 2BY0A 1IM9D 1RLBA 1IVTA 5EZJB 4QRAA 4CVWA 5EUOF 3H55A 2ZXAA 3LRSB 2F53E 3US1A 3WDHA 1CXLA 1CTOA 5HHVL 4GQRA 3TBBA 5EBWA 3UYOD 1FDLL 4GXUM 5E95B 3WY3A 4RGMC 2EEAA 1J1OH 4LSSH 3PIQB 3BISA 1SHMA 1FO0H 1CC3A 4TQHA 1D5MB 3C60C 2EIBA 3QWRA 4A2MA 2VM9A 3BDXA 3B3IB 5ABDE 2YD2A 4K5NA 4G70B 1X5KA 5FFOA 3AFLA 1BVKB 4B9GA 3ARFD 3ARQA 4NUJB 3EJZD 5CJQH 1QYGH 3G6JA 1JGIA 1UB6A 4JPKL 4IIZA 4UDTA 2RCSL 1CT8B 3D25A 3EFDL 4RZCB 3LJ3A 5I1KH 4RBPH 5DUJA 4LARL 2A0LC 2CDEA 4P5TA 4C56A 3LXAA 2SODB 3F58L 2RQEA 3KJ6H 3OKKB 2B3RA 4OZGF 4PRHE 1D5IL 5HYSG 4EZJA 1RZPA 2XN9D 1FH5H 1M3JA 4BGLA 3ZZ1A 4E42B 2UWEA 4I18B 5DJCA 5FW6A 4DPAX 3DARA 1PG7X 3EYQD 3N1GC 2NY0C 2JF1A 1IBDA 2QLVB 3WGVB 1D7FA 1FLRH 1UWGH 4PWJA 3IVKB 1WIUA 4OUUB 4TTDD 5T5FA 3V9EA 1SDDA 5F2FA 2XXFA 5A2KH 5CXPA 5J57B 3CBKB 1JZ5A 5DR5L 2WO3B 1T0MA 2E9GA 3MTRA 2AERT 3U9PH 5DC2A 1QFUL 1KDIA 2QQNL 3PPSA 2HUEA 5HXMA 4AQ1A 1DLHB 3F12B 2V5TA 3QHFH 1OT1A 5HYSA 3ZW3A 1A65A 2AK4D 4ZMZA 4JRXE 1BP3B 3L95A 4W81A 4Z7NF 5HBBA 5EZLB 4DGUA 4XCCH 1MFDH 4UAHA 1ZV2A 5FLUA 3E9UA 4DAGH 4AXWA 2X38A 3ZL1A 3WNIA 1NGPH 2ZUVA 3B7YA 3EDJA 2I69A 1S7WB 4G11A 2VXTH 1VADA 2DM7A 5TQ2H 1KYFA 1FAIL 2ZXCA 3RZCC 2R56H 5I76B 3QNZA 3QXVA 2AJUH 4P9MH 4OLVH 5HGHA 5JHDE 1AR2A 5CLZA 4LHUA 1R4XA 4KJPC 4P2OA 5D93C 4K3DH 4DP9X 3CZJA 1WEJH 4P3CL 2WAHA 2G5BB 4B3EA 4F9PC 4NO5B 5CJOL 1PY9A 4Y9BA 4K7PX 1BZDA 2GTZB 3GJFK 1MHCB 3OKNA 5KYUA 4ALAC 5BOZG 1Y1DA 1MAML 5KVFE 4EDXB 9CGTA 3DBXA 2YKKA 4WJG3 3FQTB 2A6IA 5C6PB 5E6YA 4CU6A 4YSTA 1HH6A 35C8L 4RSYA 5IMOA 3DECA 4G8GB 3FTGB 2JKIS 4FULA 1F11A 3WXWH 4QGTA 1NC2A 3QI9D 1NCGA 3UTTD 3GSWA 5IJVB 2Q7YA 1R33A 2E8ZA 4YNYA 4U2ZA 3NSDA 2AQ1A 1NBZB 4KAQH 5E94B 1WWWX 1YMME 2BSDA 3NCXA 4QRPB 4LVHC 4NCC2 4X9YA 4GW4A 1ECZA 5CD5D 1KNOA 1UOKA 4MNGB 1TTFA 1MI5D 2NX5D 3GUFA 4HJGB 5E9DD 1TXKA 1NGYB 1XF3B 5IQ9B 2AVFA 3CFEB 2BC4A 5TPWH 2JXMB 2PPDA 5AYTA 4M7LT 1JSYA 1G7PB 1NCWL 3LB6C 2EDQA 1M05A 1OGAD 5IJBC 1F00I 5INDA 1L4IA 5C8JA 1U8MB 2L3BA 4KJWD 1QFHA 3WUWG 2RGSA 3GTTA 3NVQA 3QPQC 1S3KL 3ILQD 4F5CA 3NN8B 1CXEA 5DA4A 4BZ1H 5TGBB 3X14B 3PGCA 5I18H 2ZG3A 1OOAA 4G6AD 1VZGA 3ARXA 5B8CB 2CKBL 2EH8L 3TO2A 3LPOA 4HUUA 2TRYA 4Y1SA 2VLME 1XD0A 3F7YB 5DJ8A 4IDJL 5EO1A 5CLXA 2NDGA 5BZWB 3ZE2E 4MSWA 3CFDB 1NFKA 1AY1L 1WBZA 3NIFE 4YC2B 2XWXA 4XPBH 5C0BA 3RWGB 3ZL4H 3EJJX 2YD1A 5AB2A 3W0WD 2I9TA 3CVHB 2IWGA 4OF7A 3QDME 4R5VA 2CKBA 5G55A 3OD3A 5C0AA 1ECYA 1A2YA 1CICD 3L54A 3OKOB 4OFVA 1SXAA 4XCEB 1YNLL 4WGVB 4G9FE 3NESA 1YNTB 4APQD 1N12A 3BIKA 1MAMH 2FH6A 1FFTB 5HJDA 4N2CA 4MJHA 2FRGP 2Q3XA 1T83A 3NJIA 3Q2LA 2ZF8A 3VACA 2BSTA 2WUBL 2V2WA 3NUKA 1CGWA 3TBSA 1IKNA 3TH3T 1DYZA 2A73B 5T5FH 1YN7A 3MLTB 4FYTA 3TF7C 4HGWB 3MJ7B 3DX6A 5IOKA 1VGEH 3CZGA 4JR9H 3O4OB 4OFIA 5E2TL 2DKMA 2PMZA 3MROB 5LGJA 1I85A 4GY4A 2VC2B 3U6RA 1RZKL 4YQXL 2XZQH 3WTSA 5I1CL 4JY5L 2JCCF 3LH9A 1ACCA 3BFWA 3A6OA 2OBGA 5INCA 4FQHB 2Y7LA 2D03L 3CHRA 1TOXA 2VM4A 1DJIA 4EN3D 3HG1B 4XNMA 3KPSA 5DJDA 4UQBA 3ELQA 5BQ7B 1M1XB 3QNYB 4YXHL 4WTZA 4Z7UF 3UX9B 3RZCD 5EEWA 3RGVA 2ZX5A 2B39A 3Q0HA 3RWDA 5J4MA 4XAWL 4GKZA 1A6AA 1YQVH 1UB6B 2C4FT 1OQOA 1U9KA 2ZOKA 4XNZC 3V0EA 5FYKH 4UBDC 3QEUA 5D7SH 3VI3B 3NK4A 4LRIA 1LYQA 1J87A 3RI5F 4MLIA 1ZLUK 2W0PA 3S3SA 2DB8A 2YLKA 3NA9H 3UBXG 5DGQA 3G04B 3MCYA 4NEHB 3S35H 4CGTA 4UQDA 4WY7L 2FX9H 2BWQA 2VABA 1IGYB 3E2HC 3N91A 2CBTA 4N0UE 3T3MF 1QO3A 3CPLA 4N0YH 4JPIB 4PI2A 3W2DL 3HZMB 3FUJA 4LPYA 4HUWB 5C0CE 4ZMNA 3TBVB 3IF1A 4KO9A 1NGZB 5CILL 3GXFA 3NIDF 4ZAKA 2WV3A 2AK4A 3SE3A 2WQ8A 2NTFA 4CJ0A 2R7EB 3DUSB 2X3AA 2WM0A 4GSUA 2MCAA 1H3UA 4ZUVB 2CIKB 4Z7AA 5IMLA 3UBXI 1K4DA 4UCFA 4AM0B 4FQ1L 3F00A 4HW6A 4RNRB 1GGTA 4UQEA 5I5RA 2I7OA 4RMRA 5MENB 1WWCA 5EHFA 3GZPA 2CCVA 1UYWH 5GS1A 2YUXA 2EE0A 3ELAT 3WOVA 2ZUWA 3DIDA 1RZJL 2B20A 2C3HA 2WQXA 2AXWA 2D2OA 5IFAL 2XWJB 3BN9C 4PGDA 2RIKA 1IFHH 2WLZA 5CBEA 5GS1B 5GRZA 3ETSA 3O81A 3HHSA 4IGBC 1DVYA 1YDPA 4JHWH 1K4DB 4YHPB 3CFNA 2VLJD 3FOMA 4ZUWA 4AM0A 2N7AA 4RAVB 2DQUL 4WV1A 1NGWB 1FNHA 1JDAA 1JGEB 2FBOJ 4HALA 2NQCA 2R7EA 2VMEA 3DUSA 2PWEA 3HW7A 5DRXB 1GMIA 3BKCH 3WFBL 5I6PA 1KTDA 2VDNL 4A2GA 3S3BB 4OCXH 2EICA 1OP5H 4BGDA 4Q97A 4FNUA 3RPKA 3AAZB 3TEYA 2L7EA 3ZZLA 4BUQA 1WZKA 1EVUA 3PY9A 5ALCL 5I19L 5B3SB 3WKQA 4DCQB 2XFXB 4FXKA 4WI4A 4CVXB 4PRHD 3ARPA 4XP9L 3EO0A 3CGTA 4OD1L 1SY6H 3DX1A 4A7SA 2V7HB 2ZYHA 3JTTB 1G6RB 2AEOA 3EYSL 3MLYL 4HX1B 4OQTL 5DLMH 1JYNA 1U8NB 4DGWC 2F19L 2I25N 3VFSB 4G6KL 2ITDB 2IOOA 3HTLX 4YHLL 3K0WA 4AW4A 3TIDA 3PQYD 2JLLA 2CK0H 1HCFX 3DXAE 4P2RE 4QRTB 4U7KA 4X5LA 3KGTA 4FTVB 5I8KH 1PEZA 1I85C 2Y1ZA 4NGHL 3ET9F 2DIAA 2BNUA 1E2VA 2C7UB 4XE5B 3D85B 5E2UL 1T3FA 4GKOA 1KGYE 5LN8A 4RMQA 2JB5H 3EFFA 5G4NA 5EU6B 4I0PA 5GRXG 5C9JA 4G7VH 3WIFA 2K3TA 4PTUA 5KVFH 1QHPA 3U7WL 2Z31C 1BDYA 4PB0L 4X9FA 5GJSL 3UTQB 3O3DA 3WKPA 3NABL 4HHAB 3PWNB 1JRHL 2JCCB 4JL2A 3F84A 4N0FA 2AEPL 4J3OG 2WY3B 3B2MA 3IBOA 4Z7VB 3VNZA 5AW9B 5KG9A 3QDMD 4HJJL 3ASWA 4JM2C 3IS1X 1YEIL 3GMMA 1S9YA 4E41D 2WKOF 3QS3A 3KPMA 4UOQA 3UZEA 3ZKQD 4GKNB 5FM4A 1A2YB 3DTUB 4K94L 4M4PA 1I7ZB 1WT5A 1QRNB 2VDPB 3E8UH 1MFUA 4LDCA 1HHKB 3IKCA 4X6FB 3RGHA 4M9PA 3CVHA 3AREA 3S6CA 1DCEA 4XC1H 3RKDD 5HGHB 2GSGA 4G7SB 2WIIB 1IBBA 4ODTL 1VFBA 3LV3A 5E99H 1NOFA 2A74C 2DDQH 2WQSA 5JDSA 2TSBA 3HNVL 4ZD3H 1E4XL 3EJZC 4IHOA 2WLJA 3AUWB 4ZUUA 3MRCB 2BMKA 3HE6A 5JPMC 4N1HB 2LVEA 1ZY9A 3KYKL 1PZ5A 1MCSA 1XF1A 5F96H 1A7QL 2YAOA 5DSCA 4APQB 4PS4L 1F4YH 5F1NA 2PYFB 4MXVE 4HLZH 2A74B 1A6ZB 4NO2A 5HYEA 4QLWA 1BFSA 1K8DB 5HDLA 3U1PA 5I16A 4F2FA 3DV4A 4I89A 5L4FA 1NGXA 2MKLC 3OL2A 3SPCA 1LE5B 4MHHI 1YMMD 3IKKA 3QUHA 1DBAH 3II1A 2A9ML 5C70A 4KI5F 3OXSB 1IBFA 1DBJH 4DIXA 2DQJL 1TJHL 4DVBA 5L6YL 5I75C 1QFOA 4G8EB 4OSUL 5C07E 4LP8A 1U8CA 4YHPA 1KZQA 5FM5O 2CDFB 4ZUWB 1Q9KB 1L5GA 2YUZA 4Z0BH 3UGEA 5C08B 3QUYB 4WI9A 3M17A 4CN1A 4TUJA 1AR1C 1IX2A 1P84K 2UVEA 2XA8H 1ITCA 1I31A 2OL3H 3QJFB 4H8UA 3GSUA 3D5OF 4LCCA 3HR5A 1C5CH 3E80A 3MKKA 3BGFB 3CQFA 2DJMA 4GINA 1EH9A 1ERNA 4P2OD 2E7LC 1NQBA 1SBSH 1XH3B 2ZF9A 2R0ZL 1NAKH 3ZDYF 1AHWA 5KSVA 3ARYA 3GZOA 1AYRA 1CU4H 1BPLB 1HH6B 3CUPA 1OPOA 1RUML 1HNFA 5H35A 3IJHB 4UB0H 1HWHB 2RR3A 5I1IH 2WXQA 4K8RD 3MJ9L 2VLMD 3QXDB 4B7IA 2WN3A 3FKUS 3VXMA 2UX7A 1H8LA 2XQYK 2PTUA 3GGWB 3RWIA 1OAKL 3F6LA 4OR1A 3M45A 4P2YA 4XMLL 1TJGH 4KZDL 2VABB 2VMFA 1RURL 5DQJA 2KQNA 5BJTA 3BH4A 3HZMA 2QELA 5AD0B 3STLA 2UUDK 5IEKB 4QI3A 1I3GH 1N8ZB 4V1DE 2BSRA 4Y2DD 4IIQC 1ORSA 5DJ2A 4D9QE 2BY2A 1N70A 3IU3A 3WHE1 2EXTA 1G1OA 4GBXA 1PZ2A 2LQRA 1XH2A 2G2RA 4FNLH 4F2EA 2GTWA 2IGFL 4R7DA 4MMXC 4PYGA 1MFBH 2HLFD 2R1WA 3BH9B 4LCUA 3RL2A 1N3NB 4AIXA 5EDSA 5TE7H 2J8HA 4FGMA 3MJGX 5BMFL 5IB3B 4Y5YA 3OAUH 4HT1H 2Q10A 4ZI8A 2EEXA 5KBPA 4NQCB 2VDRB 3ARWA 3KPTA 3L9RA 2A9NH 2X4PB 4GXUN 2RAMA 3RX7A 2UX6A 4BELD 3V4PL 5FM8A 5LXGL 4R4FH 5J1AA 5GRYA 4NRXB 5BRZE 1FNEA 6PCYA 4BFNA 5KVDE 1K6QH 2DJSA 4BUGA 4Q6IB 3FQNA 3VXNA 5IR1B 3ULUC 4Z7OE 1PDKB 1WSST 5SV4A 2AQRA 1ETB1 3BPCB 2MPVA 2ICES 1G43A 1TR7A 3FOMB 1FNAA 2R15A 4F8LA 3QUXD 1HQRB 3HHMA 4HJJH 4R0LB 5E9NA 1MCDA 1R5WA 4LP5A 3TA3A 3ZXAC 2Y06H 2UXVA 3AU0A 2AEPH 2X1QA 4NQCD 2NY4D 4MDIA 5J1AB 1UACH 4WKXA 4P4KA 3JVGA 2Q20A 4AIZA 2XSKA 1I8LA 4KITB 5IOPB 1OW0C 4MZ2A 5IM7A 1MFMA 2EZ0D 3AROA 1X9QA 3FPYA 4NC0B 3FB7B 4JANB 3EF4A 4UI2A 5B39A 2EEDA 5JPMA 1PKQA 3JQOB 1F0LA 3JZYA 3NPSB 4X9BA 1JV5B 4G9FD 5KBMA 4J6RH 3CFJB 5T3ZH 4DP0X 3VH8B 3SO5A 4NYLB 2XJKA 5CN1A 1NFDF 4KJYA 4JRYA 4PWIA 3MNZA 4ZYKB 3FZUC 4OGAC 4E9XA 1QLRB 1DDTA 2WIMA 1A3ZA 5L9DL 1FNGB 3TWCL 2A4CA 3LRLA 1F3JA 1X5XA 4P23A 3FFOA 4R7XA 5E9DE 3TNMB 5IJCC 2ZWYA 5EOQL 4PR5B 2R0KL 4ZTPL 4BK8A 4Z1PA 4LBAA 2XBTA 3NCYP 5F88A 5IB1B 5GGUA 1DSFH 2WXIA 2HCZX 5DJ8B 3S36X 2D03H 3TWYA 1JZ6A 2B0SH 3NYKA 1P7HL 5HPMA 4NDMB 4QHKJ 2FT8A 1Z0NA 4KHXH 1M6OA 2YARA 2EIDA 4M9OA 3IM1A 1R3IL 1UGNA 5E70A 4KKPA 1M9WA 2PCFA 4E68A 3EH3B 5KS9A 4WFFD 1QW8A 4XZUA 4ICWA 5CGBA 1J7VR 3PE9A 3S96B 4HJ1A 3AY4C 4HMCA 4P3DB 2F7QA 1VFMA 4AQAB 3GSNA 2QFPA 3MU3A 5FF6B 4J3OH 3PG2A 4WWKA 5BPPA 4DKAA 1DVFD 5C1MB 1EXUA 1IAIM 2X0VA 2CCWA 1T7WA 5F1OB 5HHMB 4PJ8D 1L6PA 3FSOA 4OZHE 4TUJB 2ITCA 1FYTD 1SPDA 3DRTB 1RLWA 2P7TA 1RZ7H 4M1CD 3QDMA 2HRPL 1EXUB 1JNHB 5C2BH 1NC4D 3ESPA 4PY8J 3CLEL 1I7RB 3AM8A 1WWBX 1AS6A 5GGVH 2VLRB 5KVMC 2DDQL 3LKRA 3BWUC 3W81A 1K5NB 2OULB 1DZ0A 3EO9H 3GB7A 1PG7H 4MDJA 8FABA 4L29B 3O2DA 5CCGE 3BLKA 4Y16B 1BF8A 1O7SA 2X4OA 5HVHB 2DY2A 5DHVB 2F58L 4Y2DC 4JKMA 2GTZA 2Y1VA 2DMKA 1QYGL 3EYUH 3X13A 5D96C 5I5MA 4U7SA 4NUMA 3AT9A 3O3AB 3SGDI 3A4AA 4NJAL 4NZUL 2OR8A 1AFVH 3L3OC 4YSEA 3R0MA 5KZCD 1NMCB 3C6LA 2BSBA 3UJJH 1KPVB 4ZO9A 1GGBL 4KTEL 4WTQA 5GRWA 4PB0H 3MACL 2WKGA 4U0RB 4L4TE 3Q05A 4F8QA 3RI5K 5E8PA 4FZEH 1SEQH 1XH0A 4EQ2A 2YKLH 1KN2L 1FZJA 1ZA3B 3HMXA 4U3CA 3OJDA 2L7QA 1WF5A 2WXMA 4K71B 3RP1A 3DX3A 4K23H 2I9LA 3DSNB 5TF0A 5IB5A 2V9UA 1BM7A 1WYJA 1NIDA 1CIDA 1F4XH 3N9GL 3A6CL 1GS7A 1HZHL 4R7VA 1IGML 1F3RB 5CO1A 4U1KB 3REWA 1YEDB 1XR9B 5D4HA 1KG0B 1L6XA 5EOCH 3TA3B 4Z3EA 3HN8A 4HPYL 3ESNA 2Q8BL 3HNTL 4FXGC 4HIIA 1U8MA 1Q90A 2MWCA 4M3HA 3V4VL 3D8MA 4PJ6A 4U6HB 1CFTB 1CBVL 4AG4H 2WZ6A 4G8IA 1BGXH 4AW7A 3WFDL 3UCQA 2WLLB 3QCTL 1JK8A 1IB5A 1NEZA 2Z4QB 4XXWA 4HS8L 3C60A 2ICCA 1HYSD 2OX5A 5C2BL 1RMFL 1TZHA 3WNLA 1ES0B 2J4WL 3FSAA 3TGXA 4N86A 4V1DD 1HL5A 5B3NA 1YEJH 3JBG7 3N85H 5F3BB 5E1HB 1GGIH 2EDOA 2JELL 4H8PA 3UYPA 3KGRA 5D7KD 2EC9T 3BO8B 3SCMD 3E6HA 3E9TA 4V1DA 2Q7YB 5CEZE 1PD6A 4NRZB 5F70A 1SF3A 4J6RL 5CSBA 5T3ZL 3V7AE 3NQKA 4I4WA 1OTTD 2Y5QA 3OSKA 4MA1C 4GBXB 5H37H 5A2LH 5TTRA 4F7MA 4CILA 3FQXB 1L0QA 1MJUL 5T1LB 3I6KA 4Z7VF 2BSRB 3RQ3A 3R7QA 2X4QB 4OI8A 2MPAL 2CLVA 4CVXA 1A6ZA 1GHFL 5TE4L 1FFQA 4QHNB 1EERB 3LRSA 3IT8D 1ZEAL 4HUXB 1QASA 4L3FA 2W88A 1EVTC 1UXWA 5D5MA 3VQ1C 2XWRA 1IAKA 2P9RA 4OM1H 4BA0A 5HVFB 4FJYA 1FFRA 1QSEA 3NJKA 4WJ5A 3GMPA 4X5WA 3GKWL 1ZTXE 1DBBH 3DGGA 3G6JF 3QIWB 5TE6H 3DOSB 3GSVA 4N85A 1ZA6B 2GUOB 1LP9E 4RFOL 5C07D 1PJWA 2PCYA 2XV0A 1M2OA 2X09A 1VFAB 5I28A 1ZIBA 3UPCA 1B0RB 4Z3IA 3OLGA 2I60H 4KRMB 1PQZB 4PJHA 2AV1A 5IG7A 1UWXK 1OARH 4ZTOH 1G4MA 3S88H 3C08H 4OGYL 1WC7B 4LCCB 4QHUA 4YX2L 1A0QH 3L2LA 3H56A 1JL8A 4MASA 4XNUL 5KTEL 2Z7WA 4KI1A 3LHAA 4ALAL 1NDGA 3H8NA 5CSZB 4I9XA 1AD0B 4N8CH 3QFJA 1A3RL 2HFGH 3ILDA 4RLDA 5CIPB 3QAQA 2VLJA 1YY9C 5FYJH 4RGNC 3BKJL 4DW2L 2ZICA 3TP4A 3O6FB 1QABA 5JIMA 4F2ME 1XGPA 3A5VA 1NLBL 3BUPA 2ISDA 3SPGA 1KIUB 5CR1A 4J3VA 4NWUL 4M62H 1WUNT 2UZXA 4C4KT 1UM6L 4RFEB 2F54E 2XNAA 1ZJBA 2AW2A 3SZKC 3WXVL 5C3LD 1CBJA 2ZXDA 5DEGB 1SN2A 4LIQH 2DQHL 3QDAA 3TCLB 3ULVL 1PZDA 3IF1B 4ADGA 1ACXA 3MRNB 2WWMC 3L3HA 1JF1A 4RFEA 3CMOH 2XZQL 4JZJC 5FKPB 4XN7A 2EYRB 2XLLA 2FYYA 4J3WA 1SYVA 1RUMH 1XD1A 1VCAA 2OXHA 3DVNA 4NKMB 2X1WL 4PJ8A 3L3GA 4W9JC 4MNQE 1BZ8A 3B2VL 3VA6A 1J5OH 4FQJL 1VIWA 1LO4L 3K6IA 4M5SA 3V95A 5BS0B 3H9ZA 1KB5B 4RMTA 2ROXA 1VRSA 4CJ1A 4YZFE 4PRPA 3UBHA 1EX0A 2ED7A 1SDAB 3MV9A 1ZE3H 1NEZG 5GZOA 3I75A 4P3CH 1U3HA 4NUPA 3MBWA 1QUPA 3CVIH 3KPOA 3MRIA 4H13C 3N43F 4DPCX 1KGXA 3QNYA 3G5ZB 5EZJA 2AP2A 5IF0A 4PHZA 2GITB 3KWTA 3WS6A 3E8VA 5EFIA 2R39A 2BHFA 3S37H 3KLQA 4NB7A 4ZSOB 1DEDA 5I0WA 1C16B 4MCNA 3RWFB 4NXSA 4I77L 3V5HB 3BPLB 1WPCA 4MMXB 2I07B 2R29L 4W9LC 2LFGA 4JHUA 1PZUB 1MW3A 1CICB 4DSYA 4DAGL 2ICWA 3BWUF 4GG8B 1AD0A 2B1OA 3FSWA 5I73B 2F15A 3LRHA 5KJ7E 3C60D 2IADB 2KZWA 5DMIL 2YAFA 4EI5A 2YJLA 3RNKA 3T3PB 2RTTA 1LP9F 1P5UA 1QI3A 5G5DA 3T2LA 1A66A 3P4OA 5BVJB 1BVOA 2YWZA 3K80A 3VFPA 3MOBL 5C3TA 2GJPA 3OR6A 4X7FC 3U9UA 4KK6C 1D7BA 1JPSL 1JTTA 1N6VA 3C8KB 1TF4A 4JQIL 3VRJB 2WVSA 3VXUE 5JXAL 2WQAA 1A7BA 3F7VB 5IHLB 1XAKA 3K2KA 1NCWH 4UNIA 3F7RA 1XFPA 1UGKA 3JTTA 5DRNA 5AB0A 2QKIB 5GPRA 5EEUA 1LO0H 4AH2B 4ATWA 1YAZA 5C6TH 1JHLL 4MKMA 3GMPB 5ICXA 2ZYRA 3C2SA 3FYEB 4KRPB 2WOBA 2X88A 1EEQA 2XV3A 4YDVB 1QBAA 4PLJC 5JYMA 2M8XA 4KZ0A 3OR6B 3U9UB 5KSUA 1P5VA 2OW7A 5I30L 4KPHH 3TJPA 3UP1A 1J8RA 1G7QB 3SDDB 4LGPB 3PL6A 1MLCA 2AHIA 2VTFA 5D9SA 1FG2A 4N2FA 3JZ7A 1AYOA 1JK9B 5HHOE 1G0YR 3U6XS 1U95B 2CHDA 4W6YB 5TH2A 3IBEA 4WLCA 4HDIB 3RVVC 4JZNA 4NQQA 1T7VA 2IPUK 3K46A 2JIXA 3O6MH 2FECI 2A6JB 2DQDL 2CBPA 2CA4A 4HKBA 2QQLL 3BJLA 2NY6B 5LKNA 3FFCD 1CDHA 2ATPA 2DOCA 4A7TA 2EC9U 4HIEA 4LCCC 3D51A 4Y5YC 3R18A 1CUOA 3QC5X 1AHMA 2G75B 2UY7A 4PD4J 4X7DC 2ENPA 5IQLA 3UG5A 4PWGA 1DQMH 1XMEB 3I02B 2NY3D 3NPSC 2A77L 4X80L 5F1IA 3NZHH 5C07B 1X9LA 3TYGL 3ZGIA 3TPUB 5CN3A 1JWMA 2C1OA 3UAFA 5I6XC 4IEFA 3TZVA 4W68A 1FZOA 2ZOLA 3F7LA 4M5YL 3GIZL 4DTGL 2WPGA 1GRWA 1MRDH 4ABWA 4H25A 4LF3B 4X7SH 1W80A 4C4UA 5IOPA 2ENSA 5IQ7L 1LO5B 1BD2A 2TRHA 2G5RA 3APCA 4XXDB 5J1TC 3MLRL 3QI9C 3DVFA 4MDIB 3ECQA 3WHE0 5ID1A 4BFGA 2YA2A 1HHHA 1AGFA 2BIPA 2EKSA 3ISYA 4O02A 2BVPA 1EZUA 2GJ6B 3OQ3B 1FN4A 4KXZH 2FO4B 2GFBA 2FHFA 4EUPB 4N2LA 1QI4A 1JBJA 1A21A 1SZNA 5TK4A 1HS6A 3ZO9A 2ODHA 2AKRB 1JE6A 1T1YA 3LKPB 3N06B 3NEEA 4AL8C 3PGDB 4OH2A 1QHQA 2P44B 1WTGT 1XGTA 3NSYA 5I8CB 2XTJB 2GEQA 1IQWL 2IH1B 4Y16C 1ZLWK 2NUPB 1DBJL 3UL4A 1XDTT 4MLSA 4PLKD 1NFAA 1J5OL 4HJTA 5FO7B 3L3IB 3CFBA 1HEHC 3MFFB 3O41A 5F6HJ 5EU6E 1KGCE 2VC2L 3HA0A 3ARFC 3N43B 3V8OA 1I1YA 3WCYA 1PW3A 2ORBH 4JPVH 4LAQH 4LQFL 3PWPB 1HXKA 1IE5A 1SUHA 3G5WA 4XP1L 5CEZD 5E99L 3MNWA 3MFFA 3O41B 2J8UE 1T6BX 4EMZA 4AQ8A 1KDJA 4XWOD 2EE2A 4K2UL 3U48A 1UWEL 4PJBE 3QG7H 2OL3A 4JAMA 2IH1A 3EOYG 1C1EH 1W9XA 3L5XL 3QUMB 2XTJD 4LEOA 3QB7C 3SO3B 1VKXB 4L0ZA 2YBRA 1BECA 2J55A 1IM3D 3L5HA 4KY1L 4LU5L 1A7PH 2QHRL 1BOGB 3B2XA 5AVSB 5F1KC 4ODUA 4TPRH 4JDVB 2XTLA 4G1EB 4JY4A 1G7MB 2ITFA 5CCHE 3I2CH 3IAGC 1PZAA 4LGSB 5CP3A 3CHOA 4QHNA 3BE1L 3BDYH 4WDIB 2FQDA 2H41A 1Z3GH 2DI8A 1FNGA 5DD3H 2XWTA 4U1IB 3W9EB 2DPKA 2NY2C 3GSWB 4R96A 4WY7H 3OKDA 1ZIAA 3T4AA 3QEGL 1MFBL 2V2XA 2IO5A 3TYFA 1NGQL 4NZTH 4NO3B 4Y19D 2NR6D 3ML9A 2HJFA 3FTGA 3PP3K 4RFOH 1UQSA 3BVTA 2IXQB 3VFVB 3N04A 1VEOA 4FE9A 4IU2B 4YDIL 3FTYA 1FDLH 1HIMH 2WGXA 3Q8EA 1NSNL 2JELH 4XN8A 3U2SA 5FUZL 3H7BB 1FBIL 1E65A 1L5GB 3RVTD 5L7XL 1C9SA 2YBGA 3OAYH 4JVUA 4CBZA 4Y89A 1UURA 1AACA 4RRPG 1JXDA 3QFDA 3CXHK 2ZCKH 2KHAA 4AJWA 2DQ6A 4HKBB 3NZ8A 4OZHA 4UB0L 2LLGA 5LN4A 4B60A 4PD4K 5I9QC 2N1KA 2ZXWB 4B9FA 1AGCA 1QP1A 2NY6C 4ZW8A 4M6ML 3GRBA 4BSWB 1OP4A 2DM4A 1CLOL 3SQBA 3VGBA 1HILA 4O2CB 2ZP0T 3FO2A 2PYFA 1IM9A 3MRGA 4Z95H 2P26A 3DTXB 3ROOB 4JGUA 4ZS7H 4LP4A 5D70L 1JS4A 4L9LC 3N9GH 2O6PA 3SYOA 4G3YH 3WIHH 4JHZA 3G5VA 5DLLA 4AV5A 2EIJB 1A6VL 1DN0B 4Z7VE 2E76C 1FLTX 3ABZA 4MDRA 1UC6A 1P1ZB 4AUJA 3IDXH 4G8GD 4HU8A 5KN5B 4I7ZC 4FFZL 3EZJB 2P43B 4S1DC 4XMVA 4Y9GA 1ZT4B 3P9LB 3QAZB 1U4FA 4OZHB 2BNRB 2DQTL 2DQJH 3HG4A 5HD8D 3SYPA 4W9DC 1JI1A 2OJ1A 4EN2A 3V6OC 4LVEA 2J1WA 4CU8A 2WINA 4HS6A 1G6RL 2BJML 3GRWH 4KY2A 4N2HA 4O2EB 3T4YA 1G87A 5DZNA 2WUBH 4UQIM 1YEKH 5DFTA 3QAZC 3SDXE 2FEDD 4XP6L 4ABQA 1SMOA 3WDJA 5FHBH 4BYHA 3KL3A 2GTQA 4Y16A 4BXVA 5FC9A 1C5DA 2MMXA 1MWAA 2PTTA 5C0GA 3OMZA 1J48A 1NOAA 4LHJB 1ND0A 1BVKA 1EGJL 3WAJA 4PV9A 3QISA 4GRLD 1A9BA 5HI3C 4C59B 1WAAF 4AJVA 3FTWA 4E5XA 4ZSOA 5JR1L 3I02A 3D18B 1W0WA 3BLPX 2JI2A 1OSZB 2A1WH 4GSQA 3VXQB 5IHUL 2GK0A 3WEOA 1JYVA 2Y24A 5FA4A 2EDLA 4U0QB 5DQ9A 3FO0H 3VXMB 4M6NL 2VDOL 1XSJA 1KEGH 3KLDA 1BMWA 4K9EC 4LHUD 4UTAL 3VXUA 1AH1A 1UXMA 3VFTB 3TNNB 3D4YA 4DVRL 2NXZB 5ILTH 4IOIB 1U3NA 4GAJH 1XF4B 1D7DA 2C3XA 5AL0A 1CFQA 2ZUQB 5KJRH 2ZOOA 1FC2D 5F7LB 2VH5L 3WUWB 5ACMA 3C08L 1INEL 2V9QA 1G9NL 3UADA 2GVYA 4HXAH 3INOA 5E8DH 4XBPA 1K2DB 3ZUNC 3D69B 2VITB 4AYID 3L7FB 1MIMH 3D85D 1A4JA 4Y4KC 4ISVB 2BP8A 3BSGA 1U92B 2J25A 3QJXA 1DR9A 4MHHG 1LEKA 1E6JL 4OLWH 4BWTA 3LNFA 2FJFB 2OV0A 4HG4J 5BQDA 1DVTA 2F7IA 3PYCA 4LLQA 4LXFA 5E6RB 1CG9A 4NUJA 4MKTA 2JJTC 5JW4Q 1DQDL 1OTSC 1JNLL 4PRPE 1U92A 4CN6A 5JPNA 4FCAA 4HH9A 2WN2A 1CGSH 5AAMA 3PLYA 3BI9X 2X1PA 4Y2NA 1V3LA 4HIJB 3FCBA 5F44A 3X17A 3TVMD 5DK2B 4AYEC 4YDJB 1S9WB 3BESR 5CWSB 3H3BC 1Q9WA 4PJAB 3WY1A 3EGXA 4P99A 1DANU 2OMXA 5EOCL 2DQFB 2PWHA 5AKTA 3WFCL 2QGCA 2HT2D 1VKXA 3GPEA 4Q2ZB 4LEOB 4I5BA 3H6JA 3CDFA 3WSQH 2JH2A 5C07A 4XBEH 1MF2H 4KOBA 5AVWB 1KIQB 4JG9A 3RHWK 1HCVA 2D31A 1YMHB 4WWPA 1GCFA 1ADQA 4PS3A 3V6ZA 2R0WL 1FGNL 1B3JA 3ILQC 4AYSA 2IDUA 5IF0B 5LAXA 1WHPA 4GSXA 2J6EH 5CZKA 2KLSA 2QTEA 1F2QA 3QWOB 3KYNB 3S5LB 4E9YA 2VN5A 2PNDA 3N2JA 2NNAA 2AQ3A 4U1JB 2MCPL 4A6YA 4C4BA 4DPRA 3QHZH 1BQLL 2IQ9H 4CL7A 3OF6A 3FFDA 4XO3A 1BAFH 1RQ5A 2QEJA 1DSWA 2I27N 1GZHA 1G6RA 2DM3A 2FJHB 5E4EB 3DXAA 4PUBL 3UFIA 4FYSA 3BVUA 4ODSL 4CADA 5BW7C 4L8SC 4OJYA 2HJKB 5HHNB 3II2A 3QQXA 1KENL 4Z7WB 2AQSA 2XVGA 1A1NA 4JFDA 2FEEI 2YZ8A 1ULVA 5TDPA 1G6RH 2BP8B 3REVA 3D85A 4X7TB 4O02B 3TZVC 1ZHBA 4APQC 4XMTA 4HUVA 4HJ0D 2PYEB 3K72B 5HYJA 2VZTA 1RZ8B 3GKWH 5FYLD 2FH8A 3BVXA 4A2DA 4FP8H 3FUMA 4YSPA 5GISL 3SKNA 4KXBA 1KXVC 2CUAA 2HVBA 4R90L 4AH2A 4XP1H 2WTRB 4H0IA 2J73A 3AT8A 4E9TA 4HK3J 4J3SA 5D71L 5FHBL 5FO2A 2VUYA 5TE6L 5E2VH 5IBTH 1DJGA 5I75B 1BF2A 1TSRA 4P5SA 2EEFA 1AZCA 4PUBH 1OSYA 4D0BA 4L4VB 2WVUA 3IAPA 1BG1A 5GHWH 4DPBX 3PNWA 4I1RA 2C9AA 1J8HD 2CG9X 3FT9A 4JE0A 4F2MB 1MPAL 2NY2D 4NRYB 1NMAL 2CO3A 3KJ4B 1PL3A 1U91A 3O8XC 3WLWC 1PFOA 1S9VA 4EBQL 5A2CA 4X6BA 1IKOP 1I3VA 2WVVB 3BUTA 4XCEA 3QEHB 3SDYL 3JUYA 3UP6A 5AVXB 2J5LC 1ZT1A 2OTPA 3T0XA 1SLWA 4W4OA 5CUSL 2R0WH 4P2RA 5L0QC 3EXJA 2YPLD 1EJOH 1MRCH 1ZVSB 4K71C 4XMKL 4CSSA 1FI8C 1MRFH 4YK4B 1S7XB 3NCJL 2MSPA 3TBYA 5CNHA 4WU7B 3MUGA 4QJ3B 4WW1A 3GDBA 3MV7A 2WHVA 3DGCR 2R0LL 1UT2A 1INDL 4LLUB 4A63A 4HUUB 1OOWA 3UZQA 4XOAA 3GSQB 4XMPL 1ZSDB 1N0LA 2W07A 3ASOB 3BHBB 5CM1A 2J3SA 4X4KA 1DQML 4LL9A 1LE9A 3GMNA 1RUQH 4NRYA 3NEOA 4UZUA 4HWBA 4L3AA 4R8WL 5CLWA 5IQNA 3MCG1 2CO7A 3HMWH 2VB5A 3GIZH 1J0KA 1T1ZB 1G6VK 4KGLA 2WW8A 1P2CA 3CU7A 3IFNH 3T6QC 4OSUH 4M48H 2WNKA 2D0GA 1OSEA 1IEBA 2ZOKB 1H3TA 3VGHA 4C83A 1DP0A 1OAQH 2J8UF 1HWWA 1SVCP 5I1AB 5C0RH 3U1SH 1RIVH 1U8IB 4I0PD 4HVBA 2A6KB 4WQOA 3L3JB 4PH8A 4TQIA 2AJ3B 1NAMB 1X5HA 4HUWA 5E00B 4QHPA 2H0EA 4PJAF 3CN3A 2QKSA 3B9KC 2QQKH 4I13B 3HKFA 4NQVB 5BXFA 5BO0D 4H0HB 4DUVA 1BZ9A 3M1OA 3D34A 1QLEB 2V3EA 2J5WA 3WNMA 5C3IA 1Y18A 5BV7H 4N8VA 1HILB 4NFBA 2WLIA 5AZ2L 4IOIA 2HKHH 1N4XL 3TM6A 1O7DC 2JMRA 5C2UB 4A38A 3DX6B 4DGYL 1CDCA 4W1TA 5FA3B 1QQDB 4I0PB 4QXGH 4AZUA 1GGYA 3EYVA 2ZXEB 3GXTA 1KCKA 3QQ9C 2J2ZA 5KSAB 3FTXA 2ZYIA 1YEGH 1YPZA 4F80A 1EK3A 1MVFA 2CLZA 3ZDYE 2E74C 5BW7A 3ZKXC 3HG1A 5EWIL 3IWUA 1A4KA 4F7CB 4ELDA 3IFLL 4MS8D 4YN3A 3EFOB 1XEDA 1TU2B 3BP7A 3LN5B 5E6IC 3TASA 4BSJA 5C0CA 3QIWD 5EOCJ 5IMKA 3ZRFC 4MB5A 1QLRA 4BFRA 2QLYA 2H6PA 4NP9A 1D3CA 3NIGF 1DBML 1T4KB 3WE6A 2AJZB 4RGNE 3EF7A 4GIAA 4DKDC 5FYKU 5LUMA 1Q9WB 4PJAA 3L6FA 5BMFH 1GA2A 4NQXB 2FB4L 1CDBA 4YBQD 3CVHH 2BSEA 4NO0D 4HC1A 5DK2A 1DJHA 1XWVA 5ENWB 2QR0A 4DZBA 4PW4A 1F58H 2F1AA 2JJUA 5EZLA 3S37L 1ET7A 2F1BA 1OO2A 5CS7A 5MERA 3CSYA 1JVOA 3NJJA 3T0AA 5L2JB 1U2YA 4L9LA 2X28A 2XN1A 5KS9F 3K6OA 2OYMA 4L4TD 2NQ3A 1KIUA 3BAKA 1T04B 3NH7L 4XHJC 5IVZB 1RV6X 4YSOA 3A24A 2X53A 4OJDH 5E1AA 5FEBA 4X8JA 2Q8AH 3GNMH 3BUQA 3DO4A 3VXTB 4GI6A 3LN5A 3KYMB 3ZBMA 2C3GA 5H8DA 3MCKA 2PYED 3NJMA 4FFZH 1Z9OA 2DQDH 1M42A 1XR8B 3VXRE 5BUPA 1G9NH 4FLRA 2EDNA 2V17L 5AVYB 4AC2A 3KWVA 1AO7D 2GCYA 4M43H 3GINA 4UAOC 4QRSA 3VI4A 1J1PL 3NRFA 4FEMA 4QHKI 1IFRA 2H9GB 2XUWA 5AVZB 3U1QA 4TSBL 4L2YA 1MRDL 3IGFA 4TNVF 3ECBA 2FATL 2YMOA 2UV3A 4WO4A 2V3DA 1OP9A 4WFHD 2Q6WB 1TITA 4OY9A 3MXWH 3BRFA 5SX5H 5I6MA 1ZA6A 2GUOA 1QKZL 1UWFA 2YD9A 3GJFH 3GSVB 5FIEA 5IEKA 1JGDA 1U3HC 3V9FA 4HBCH 4GQPH 2XG4A 2Z6FA 2PPAA 3VXSE 5JLZA 3HG1D 4JQXC 5EPMB 3U0TB 3SCMA 2A9CA 3BAEL 2KH2B 4OLYH 2FVNA 2QADC 2WP3T 5ALBL 3RVXD 1VZHA 3SYCA 4ZPTB 5C0EB 5C0BE 4M1GL 1ILUA 4UZGA 1U6AL 5CCKL 4HWBH 4GG6B 4N3UA 1QLFA 3K4AA 3ZHDA 1M1SA 4NQEE 2CM6A 3OAZK 4J8QA 2XN9B 3CCHB 3WJLC 2PO6B 2WBKA 1N19A 4FQQA 1JGDB 3ZHFA 2RCSH 4HSCX 4TULH 3TYFB 2GB2A 4HBQA 1UM5H 3CUPB 2H26A 5I23A 4CVZB 4QCIA 3PWJB 2IPKA 4DESA 3GMLB 1OY3B 2XXMB 2XWTB 5DMIH 4ZTEA 2E7DA 3QCVH 5AQ0A 3CLFH 1RJLA 3VXPB 4NOFA 1NUFA 4KQ0A 4GRMA 4QPEA 2A2QT 2BHZA 3OKNB 1RK1A 1WBXB 4N2KA 5FK9A 5IVXE 3DMMD 1E5CA 1I1FA 4HIXL 3QEQA 1CYWA 1I9IL 1KLGA 1YQ2A 3QP3A 2WXKA 3RIFK 2EDBA 4IKIA 5D7IE 4NNYB 4PP1D 1TQBB 1PGRB 3IFPB 4HWBL 4OLXH 4FNLL 5A7EA 3ZYJA 5HHPB 3RY6C 2QHLA 4MGXA 4XNZB 1O75A 1LE5A 4U7MA 1ZVSA 2Q2EB 4WK2B 4OLUH 4JFPA 3UGUA 2P8PB 1DUZB 2FWUA 1EDQA 3POCA 1J9QA 1ZT1B 4OAWB 1V54B 4LSQL 4OGZA 5FOJA 4IRZH 4UOW1 5D7SL 4BH7A 4AL8L 4NM8L 2W94A 3DV4B 3UAEA 1T2XA 1VSCA 1R5IA 4XAKD 3SE8H 4KK5D 1UT9A 4Y2OA 2JIXD 1JTPA 1JGUL 1FSKC 4KVCH 1ZAGA 2YMXL 2OL3L 2NT0A 3EJUA 4K5LA 5IQ7H 3ARBC 3MRFA 2BO0A 4O2CA 3DLQR 3HMWL 4B9KC 4LSUL 4BHUI 1UWYA 1IM9B 2XZAH 2EUWA 1Q0XL 5E8PB 3TZVD 1WAEA 2FUTA 4KHXL 2OMTB 1CYGA 1EHLL 3S36L 4GW5B 4XPFL 1S9XA 1ETA1 5HGBA 3K7UA 3Q5YA 3B3IA 5CJXA 2A83A 4KROC 3MLZL 3H9SA 3RJQB 3U7AA 2NYZA 2ROYA 1GAFL 3EADA 4PV8A 2YEQA 3BXNB 4F7TA 1AKPA 3SD2A 1BFVH 4HIHB 5IBLD 3DJRA 4P4RB 1AP2B 3FHEA 4E5XG 4ELMB 3ZE0B 2EDXA 3GUTA 4UV7L 1RZGB 3QRGH 4EOWH 3OX8B 1AZNA 4OT1H 5ABAA 5GZOD 3BWZA 3G5XB 4PJ7B 1JF6A 2NXYB 1TZIB 1YA5A 3KVPA 5HGDB 3C6SB 2H1XA 1M57B 3QIUB 3R06A 4FQJH 3RL1A 4BJLA 4PY8I 2CXKA 1RZJH 4LF3A 1AXIB 3TPKA 2QQQA 4H20H 4LKXA 4PJEA 3RNQB 3HEIB 3BAIA 4QWWD 3NJFA 1J8KA 3CQPA 4PJ9A 4X6CA 5CMAB 5AALA 3LAFA 1EMTL 3QFJB 1OHZA 4I2XB 5DWPA 2NLJA 1V7NH 4HUMB 3X1NA 1SEBA 1S5HA 4YJZL 2FNWA 3KVDD 1FZMA 3U9PL 3QUXB 4FFTA 3GMOB 3BKCL 1YPZB 2QVTA 4UT9A 3O4LB 4S0HA 1MG3C 2M83A 1HDMA 5I30H 4MYPA 4OLUL 2UWEE 2DN7A 4DO5A 4WEBL 1GW6A 2XKNA 2F2HA 3MQIA 1H3VA 5BV7B 3GSNB 4HX1A 5HI4C 1ET5A 1CXFA 5GISH 1PDKA 2CHZA 4GNKB 3AGWA 2OSXA 4I5BB 1FFNA 3KXFA 43C9B 1IZJA 2YC1A 1GGBH 3AS0A 3IU4H 2CHNA 5FUOH 3VX0A 2D4FA 2CGZA 4WI7A 3ZDXB 4OLYL 3AGVA 1U3YA 3U25A 2FWLB 1HXMA 3GS4A 3JWOC 3MNWB 1KACB 1KTBA 3R1GL 4EO5A 1E28A 4ZMTA 4A1RA 4LSTL 3DYMA 3O9WC 1PJ9A 2FUQA 1VCBC 2FJUB 4K8RL 3MRHA 5FYLL 1BMZA 4HHGA 4J3OC 2KC0A 3OWRA 3RWCA 4UOZA 1QEXA 3QULA 4N22A 3ZTNH 3I74A 1NEPA 5E5LA 3FQXA 3OMIB 2ZUTA 2C9SA 3IDIA 4XT1C 1CIUA 5DJ2B 1NGWA 3P9MB 1BFVL 4PRDA 4RAVA 2H32B 3VH8A 1J12A 1NCAL 1ACYH 5E8OA 3HS0A 4GRWF 2VZOA 5EU6D 4BQBA 4L3ED 2ZUUA 3FT4A 1AGDA 1S7UA 2WP3O 3VFMA 2WO4A 1YYLL 3IGAB 4OCWH 4P46B 3H9SE 1WDAA 1LO2H 2GI7A 1UXSA 2VXUL 5L2KB 2FX8H 3VD1A 2QMJA 5EO0B 4Q58C 3IDXL 2X4NA 5D7LE 2QJDA 1QSFA 3D2UD 5DCCA 4PCTA 3UTTB 2W95A 1LMIA 3QCUL 4K3JL 2P5WE 5HJBA 2C9RA 2EO1A 3ARBB 3SOTA 5DJYB 1FYHB 3MGOB 4OIIH 1OE3A 4N0CC 1DSFL 4D0CA 3LTVA 2VKXA 2HX9A 4YH6A 4OZIF 4MB1A 5D4QA 3HMXL 1Q72H 4ZUVA 2WTOA 2YGOA 4GUPB 2EH7H 1JMZA 4CKQA 1RUKH 1OW0A 3MJ6A 5J1SC 3FQNB 1RHFA 3EHBB 2F53D 6PAZA 3RVWD 3D48R 1BQSA 3T04D 5AOLA 4KBPA 1Q94B 4HAFA 4F7CA 5D1QB 3DSNA 3V8CA 2OMWA 5C09A 1EAOA 5TD4A 4UANA 1AKJD 1EEZA 3BT2H 2ADIA 4OLWL 3ZZQA 1X5LA 1XTMA 4JFEB 1AD9A 1D6VH 5EULV 4HLEA 4Q9QH 5GS0H 4AG4L 4JFFA 2APXA 3K6SB 3LH8A 2VDKH 2YGPA 4NNXA 5ESAB 4JKPL 5E5UB 3BKYL 4XNYL 1OGSA 2IWKA 3SQOH 3DXAB 4L5FH 1U8PB 2J20A 5J12C 3G6JE 3UAJC 3K6SA 4N1CA 2W81C 1JK9A 4Y5XB 4LPXA 4N8PA 1T21A 3HPJA 3MV01 2Y5TB 1U8KA 3ABKB 4URTB 1MVUB 5DQJB 3O3BB 2ADIB 1W6WA 1ZTXH 1LK3H 4K3HA 3MLUH 3ARUA 4QT5A 3HZKA 4BZYA 5A6IA 1UD5A 1A6UL 1NCAH 2X2YA 5LXGH 2BIQA 1IUZA 3UIZA 4B53A 1HK6A 1G7JB 1H8SA 1I75A 2XZCL 5D1QE 2NNCA 4FDWA 4RDBA 5T1DL 3PWPE 5F9JB 3ASNB 2W38A 3QJQB 2PYEE 3NMEA 3Q43A 3IDGB 3T0EA 3B9KA 5F9WB 1BQHG 3LCYA 1ZLDA 1QKZH 1PY4A 2TSAA 5FW8A 3W5NA 2AJVH 3DURB 1OD9A 5ACZB 2J5LB 2KS0A 4UTCA 5JIHA 5GRJL 5BVJA 1FC1A 4WGWB 2BVYA 3FMGL 3M6DA 2WYTA 4QKTA 1EXHA 2WQUA 4NN6B 5K39B 3CHQA 4ES8A 1TCRB 2IQ9L 2WMPB 4XB3A 5TE4H 5F7HA 4KTDL 2XWCA 1E8YA 1L7IL 3DETD 4EN3B 3MV7B 2IGFH 2MRYA 2VJXA 5LAPA 2AJXH 2GJ6D 3G9VA 5JPNB 3K1KC 3JWDL 4G42A 3T2PA 3KYAA 1KTCA 4FQ2H 3B9AA 4I87A 3RWGA 4DOHB 3GBEA 3KDMA 4OB5L 3SOBL 1LVEA 1NJ9A 2F5BL 3LKSA 5HGDA 3S8FB 1E6JH 4JEGB 1QBBA 1JZJA 3M8OL 2FGWH 3U9WA 2E47A 4KAQL 2J4WH 3CFDA 3S9DB 3WTYA 3UIYA 3OX8A 1SM3H 5ISZD 1SYSB 2Y2WA 2NQDA 3WFCH 2VXTL 2V5RA 4M7LL 3GIVA 3CPLB 3BQVA 5E4IA 4HPHA 2CJUL 2OLDA 3HE7C 3US9A 1R3HB 3CIAA 3MGTA 1D5ZA 3L4VA 3KPNA 1TZGH 2E6PA 4LT7A 4MXWH 4TQEH 4ADJA 1RZKH 3MBXH 4YHIB 2OTUB 3RTQA 3QIBB 1PZ3A 2BVOB 3C5ZB 1QPKA 4OZGE 2KUTA 4I4WB 2FCBA 4UT9L 5K59F 3T8MA 2GABA 3SDXB 4PBXA 4PTTA 3VXSA 2ZX8A 5E0QA 5BVPH 4JN1L 3ZT7A 5A6MA 1HHKA 3BP5B 5GHWL 4WFGE 3T4AC 1HVXA 3ARGB 3KDPB 1F6AB 1RXLA 4FYQA 3VDCA 1TTGA 2HFEB 3SKJH 1KCWA 3WKYA 3C09C 5E1IA 3NIDB 5LG6A 1DVFA 2A9AA 5FCSH 4ODXA 3ZK0A 1DBKH 2QADD 1WH0A 2NYYC 4JDEB 2D7TH 4AV0A 4JFDB 2VLLA 3K8LA 1QRND 4Z7WA 2VLRD 4PJIE 3R8QA 4B41A 1YDPB 3D12B 3SSGA 4B27A 5C9JB 1EGJH 5FECA 1NLDH 3OPUA 2OKMA 3FMGH 3U83A 3WE1A 3CC5A 1ETZB 1KYUA 4HIXH 4GRWB 4LOUC 2A73A 1MCEA 2WMPA 5L4IA 3RWEB 2ATKA 4KXDA 1AOHA 2QGDA 5L4JA 4A6YH 1BF5A 2UWEF 4NDMA 4ZUSB 1HKLH 3L9RB 2BVQB 4EIGB 3HS0C 4KKRA 5EF1A 2EVFA 3EYUL 3GUTB 3SODB 3H9HA 5DEFA 1Q1JL 5D6DA 3D18A 2VAAA 2VDOH 1KY6A 1OB1B 4F3FA 3EGSA 4YBHA 4OFYD 2IWEA 5E8OB 1XGTB 5HDOA 3H9SB 3P9MA 2BOCB 3OJ2C 1E6OL 4PRDB 2YXWA 4YPGB 4AEHH 1VHPA 4D0DB 1TJIL 1AXTL 3EH2A 1WCBB 4LRNL 4ODTH 5CLTA 3TEXA 3BYYA 5F7NC 3WV0A 3OSVA 2Z0UA 3IFNL 1NBYA 3MX0B 1T2QH 2QDVA 3VXRD 2YPKB 1FVCB 2J6EL 1EZSA 1NGZA 1ML0A 1JPSH 4QR7A 3RU8H 3WKML 2AEIT 5I1IL 3UJTH 2YEVB 4PJBA 2I7SA 3A23A 3LNHA 2X4QA 4TL5A 1YHPA 1NPNA 5LXVA 3I6KB 3DTXA 2MEJB 1Y7VA 4IBVA 3KYOA 1X7SA 4W70A 4GLRH 1DEEA 4WGKA 4EN3C 1ZLEA 3VG9B 4IRSA 3IVKA 3BO8A 1MH5A 35C8H 1NBVH 4U3SA 4KH2A 3X12B 4MZ3A 4PJFE 4G71B 1WHOA 4NFCA 2X40A 1WV7T 2C9UA 5KN5A 3O2DL 5D1ZC 1WICA 3TTYA 4O51B 4X6DF 4MRCA 1C12A 1JFHA 1RUPL 4XPFH 3CFEA 3D2TA 1G1KA 4IU3B 1EXGA 1TVBA 2OMWB 5C09B 1WBXA 3DIFA 2XYBA 1KLFA 1TLMA 1NGPL 1WZMA 3P1VA 3AXLA 3MRQA 4Y16D 1ZK9A 4UMSA 3D30A 4YQXH 3GDCA 1GSMA 1N3NA 4PP1C 1G7IA 2XWDA 3PS6A 1JN6B 2YEZA 4YPJA 3U6RB 2BP5M 5HJGA 1IAIL 2FECL 2OP4H 4IRZL 1YN6B 3ETBJ 1A64A 4U1SB 1WA2X 3EYFA 3GSNL 1XZ0A 5DZVA 4X50A 1TQVA 3GMRA 3ZOAA 1E27B 1HH9B 1MCOH 4PGCB 3CVHL 2LU4A 4GKSB 2FX8L 5A2BA 1IE4A 3H0TA 2A38A 3GSRB 1SEQL 3PWPD 3QQDB 1KPUA 4U1GB 3VRLE 3WJMA 2EVHA 3ARDB 2ZCKL 1UACL 2EC8A 3OGOE 1N6QL 2QT6A 1NBYB 4X5QA 1AXTH 2F74B 5EPMA 3C12A 2R4SL