2Y2YA

Oxidised form of e. coli csgc
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
95
structure length
95
Chain Sequence
SSQITFNTTQQGDMYTIIPEVTLTQSCLCRVQILSLREGSSGQSQTKQEKTLSLPANQPIALTKLSLNISPDDRVKIVVTVSDGQSLHLSQQWPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords CURLI PRODUCTION PROTEIN CSGC
publication title Atomic Resolution Insights Into Curli Fiber Biogenesis.
pubmed doi rcsb
source organism Escherichia coli o157\:h7 str. ec4115
total genus 11
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2010-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2420 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y2yA00
2N59A 2XSKA 2Y2TA 2Y2YA
chains in the Genus database with same CATH superfamily
4WI4A 5I8CB 1L4IA 1KTRL 5HGBB 3VGHA 5IJDC 4WWID 5EIIB 3QR2A 3V0VA 1YECH 2PP9A 3BVVA 3LPGA 4P2YA 1IC4L 2GW5A 3FAXA 3I75B 1KIPB 1LO2H 4Y4FD 1OCCB 3VI3E 5I73C 3LKSA 6TAAA 3T1WA 3QJXA 3SQRA 4KNSA 5E0QA 3ABGA 4H0IA 4ONGH 2VSDA 2EKSA 3BWSA 2CO2A 5C0AE 4IU2B 3IKCA 5IOPA 3FL7A 2BIOA 5FM4A 3PAYA 4ETQB 5KZCD 2QHRL 1KTDB 3B9EA 5J6SA 5C0IA 2EO7A 3VQ2C 5D1ZI 2ZUUA 4F1ZA 3SO3B 3RGBA 3KBEA 1RZKL 1KWKA 5HJ3B 1CIUA 2NR6C 3GJFK 4U49A 5TF0A 1IEAB 3PJSB 5FCUH 3TEXA 1CXLA 1EFXD 2ZT9C 3AM8A 4OM1L 1MW2A 4M8VA 3T65B 5E2TH 2P5WD 4J2QA 3GPEA 4GAYA 3NAAH 2GJRA 1J5CA 1OM3H 4HW6A 3BGAA 2R29H 1AS8A 4S2SA 4PCSA 3ZYJA 1G9EA 3VXRE 3A67H 3VJ6B 3FQ1A 4FXLA 4NYLA 1KJ3H 5I30L 3X11B 3O3AB 4F37F 4IKIA 3MJGX 3WD5L 4FQLL 3BP7A 4J3VA 4YFEA 1MI5B 9PCYA 4FI7A 1CE6B 3HE6A 2ED6A 1FO0H 1OXYA 4JQXA 3VRJB 5IROD 1FVCA 2XXGA 4J3SA 1QR1A 2LU4A 3B9KB 4EVNA 1A7BA 1KT2A 1WTGT 1XGTB 4YGVA 4EBQL 5T1KA 3KAAA 2C7UA 5EO9B 5C8JA 2WNKA 3QEUA 3VYPA 5HHME 4ESKA 5FPIA 4NO5B 35C8H 4ZD3L 3OGOE 4XH2A 1AKPA 1AY1L 4TOYH 4F3FA 4CL7A 4Y19E 5KS9A 1TZHB 3CDYA 1DVYA 3TJPA 2LOEA 3BAEL 2XU9A 2OYPA 2YPVH 1UWEH 4YLCA 5I1JL 1UA6H 5LBSL 5E6IC 4IK7A 5EH1A 5KBLA 4C4KO 4P2RA 4Z0XA 2ZCHH 2BC4B 1F6AA 4K2UH 1INDH 1ZEAL 4K3DL 4QGTA 2CO7B 5DZLA 3TVMC 1QRNB 1UD2A 2DOCA 1IJNA 3U48A 2A6IA 4KVNH 5D7LD 4A7GF 1U8OB 4KK8C 1NANI 1RVFH 2RQEA 1E28B 1HXMA 1IM9A 4U6YA 4X5QA 1OCWL 4NPYA 4F2MA 2GBAA 3HFMH 4L4TB 3VE0B 4CJ0A 3NVQA 1E5YA 1IUZA 2EEAA 2YD1A 1LL1A 3JWDL 3TCLB 3GI8L 3U79A 1SY6L 1KCKA 1M71A 5L4JA 3DDFA 3MRLB 2VR9A 3BQUC 3WIIL 2EYRB 3HMWL 1WJ3A 2CUHA 4HMCA 2DQDL 1I1YA 1JVLA 1K8IA 2VO8A 4R3SA 5T5FA 2ZP0T 4QRRD 3FQUB 3CZGA 3EBHA 4FP8H 4LHUB 4UAOC 1R75A 3W5MA 3FTZA 4BFNA 5FOBA 3HS0B 2XN9B 3FRPA 1MCEA 3CX5K 1LYQA 2HPOA 5CSBA 3WN5A 4U1MB 4FNSA 1EEQA 4P5TC 3ZXAC 5C0DA 4LDLB 4I5BB 3QISA 2A5UA 4ZPTB 4G7RB 2JJWA 3BZFA 4HKBB 3WFZA 4W70A 4JPQA 3I6LE 4WK2B 3WHXA 5D7JC 4I88A 2R1WA 3RWIA 2AQRA 1CT8B 2HFGL 1NEZA 2V0AA 1LE9B 2EVJA 1ODUA 3A5VA 2YJQA 2YQBA 4XNMB 4KOCA 2G3NA 4GINA 3SPHA 4ATTA 5F88B 3MRCA 4QR7A 1V8HA 4U1JA 3TO4B 5KAQG 2XV3A 4Z7QF 1LTXA 3IU4L 3UZVB 1GPOH 1NTDA 3FSZA 3MRGA 1NGQL 3P4MB 2IADB 5ISZE 2VL5A 3DOSA 1NBCA 1YRKA 3GIZH 3Q2NA 5JZ7D 5F0PB 3RWGB 5C2BH 2JLLA 1JUFA 4W4OA 5IVXF 4AMWA 4F24A 4OR1A 3JTTA 1I4FB 3HBGA 1AP2A 5HGDB 4K0OA 4BFOA 1YMMB 1N64H 3SCMB 4KQ4L 3B8YA 2HUEA 2ZX6A 2QPSA 2ZF9A 2Q76B 3RNQA 3TCXA 2AJVH 4BRJA 2CA3A 4MAYA 3ELAT 2B59A 2JELL 1TPXB 3WFEH 3MYJB 3N5AA 2NUTA 4XO3A 1A6UL 4F57L 5FYLD 2GEEA 3A3YB 5DEJA 4ODUB 2DIAA 1YEGL 3ZHFA 2OM5A 5IV2A 1RUPL 1ZK9A 2N7BA 2WSDA 4NKOB 4EI5B 3FNKA 3OSVA 1ZLWH 2ZPKH 3BVNA 1CF8H 1URZA 1YSOA 3QDAA 4ZFFA 4LBEB 2VLJB 1F5WA 4OB5L 1I8MA 4R7XA 4UOZA 4G9DA 4OJAA 2OW6A 3EGXB 2JJTC 2N0KA 4K8RL 2VXUH 2DKSA 3DJZA 3ZL4H 5C92A 2I5YL 4JQVC 5HYJB 1HCYA 1FH5H 4PW3A 3B7UX 3QQXA 4ADIA 3MNVB 1Y6NR 1QWHA 3ZDXF 3L2NA 3W11C 2KZ1B 3E3QE 3PIQB 1G1YA 4NPKA 4Y4KC 1R5VA 3ILPA 1A64A 4PRPE 3AWGA 4JDZA 5JTWA 3QUGA 4HGMA 3REWB 3ETTA 5C2UB 3HA0A 5ES4B 3HE7C 4ZUUB 1L9PA 2X4QA 5CD3A 3SJVD 4PU2A 4PJFB 4ELMB 5ICYA 3I2CH 4HOZA 2FYYB 5TQ2H 3TLRA 4A7QA 1DVQA 3UABA 2BP8A 2KMWA 3S8GB 2O5ZH 2OYKA 2WYTA 3FB6A 4AL8H 3O8XB 3QIBA 2NY0B 1QASA 4N0FB 5A6MA 2MFNA 4BQ6A 3QW9A 4BELD 3GKWH 1WV7T 4UU9A 3G6JB 4NS0A 4PLKC 4MJ2A 4HH9A 3N42B 5L4IA 2O6EA 3HG1E 4G1EB 4CVWA 4KFMA 1ZA6B 1J0KA 3PQYE 4YEFA 2A3TA 4DO6A 1RUQH 3OAUH 1E50A 3BXNA 2WWMD 2X2JA 4JO1L 3GXNA 1HX0A 4LKXB 4AGMA 1NC2D 1YEFL 2CBQA 2NQDA 2WIIB 5I2IA 1D5XA 5D2LB 2O61A 3HFFA 3ZE1F 1TUPA 4J3OG 4RDBA 1BBDH 1MCCA 1F1AA 1BMGA 4L3FA 4UINL 5E1GA 1FA4A 5JW4R 3TO2A 4XI5D 1SJHB 1TTUA 5EBLA 2BSRA 1GZHC 4PRDA 4XTRC 3MJ7A 1Q9OB 2FJFA 4Z76B 1EZLA 2QR0A 5I74C 3ILQD 4NZUL 1PMYA 1N8ZA 5D71H 4AW7A 2J20A 2EIBA 1L9OA 4L8DA 3ORJA 1MXGA 4D3CH 2E7CA 4JNXA 3IETA 5TQ0H 3V0AC 1KIRA 4AQOA 4TF4A 2F08A 4OQTH 4BYHA 4L3EA 3TFKD 4HISA 4BCYA 3KR3L 3VA2C 1I7RA 1K4DB 3RA7H 4KXAA 3ZKMD 1NANH 5CJXC 2O72A 2EDTA 1WA2X 1XF2A 2NMSA 4JGMA 4N22A 2OSLA 5EIIG 1HHKA 3HAEB 4XCCH 5I6LA 4GS7B 4R4FL 4XNXH 2NR6A 5EDXA 4A2DA 1PGRB 2X70B 2R83A 3AS2A 5KVEL 3Q5YA 1G0XA 4R9HA 1TJIH 4HIQA 2CJTA 2PXYB 4R90H 2HLAA 2ZONA 3MCKB 3ULVF 4ZDHB 1W6LA 5BVJB 1MPAH 4FF9A 1KULA 2GFBB 3DXAB 1SHWA 2IGTA 5FECA 3QEQD 4WI0A 3AZUA 3CN3A 1KJMB 4NC2B 2IV9A 1MFEL 3JV4A 4CSPA 3TX4A 5K1VA 1WK0A 3CFTA 4OZFH 3W9DA 3VWJD 1AQKH 1EJOL 5GRUH 5HI3D 3V4PH 2VC2H 5E9DA 4BFEA 5DI8A 2NY6D 4WHCA 1HZHH 2J1ZA 4Z5RB 4LLUB 4ICWA 2OCJA 4ZTEA 4O51A 1RZ8B 4DKFL 4G6AC 2UX6A 5K59F 5J9PA 3HI6L 5IJKC 4Y0GA 1QSEA 3CZJA 2FT8A 5DJZA 4NHUA 2NNAB 3UO8B 5CJBA 1NL0H 2XWBB 4NX0A 3RVTD 3QNFA 1ZSDB 3GGWB 4M02A 4YR6A 3S3CB 3V5DB 4S1SL 5B1AB 1TKWA 2WTRA 3LYRA 3MGTA 2VT0A 1SMOA 4MJIE 1X3DA 5L88L 3QDME 1QEWA 2ITDA 4PGDA 3PGFL 1ZXQA 4Y16D 2XJLA 4TYUA 3BAKA 2W9EL 4AC4A 1JZ4A 1LM8V 4H8PA 3TBSA 2NUPB 5E6IA 1XGZA 3UEQA 3QNXA 2WVUA 4G1MB 3HRPA 4UDUA 1E6OL 5DJXB 3WNPA 4Y5VC 2BS8A 2QZQA 2RR3A 3SEPA 43CAB 1D5ZB 5J5EA 2X53A 4F5CA 5KANI 5E00B 1E9PB 5ANMB 5EU6D 2P43B 5LUMA 5IJCC 5HDBE 2Y0SA 1KXTB 5J3HC 2UY7A 1MI5E 5DJ0A 2G75B 2GIXA 2BRRH 5HHOB 4OJDH 1D9KD 1KLUB 1IIKA 4E42B 2RACA 5GIRA 1BQHB 3RIFF 3U7AA 4PRNB 1J88A 1GHFL 5TTRA 2EE9A 1YMHA 2OKMA 1SUJA 3RUGA 5J1AB 1OSZA 3O41B 1Z32X 1XGUA 4H26A 1ECZA 4WQOA 5D70L 5E1HB 3NPSC 1VPOL 3BQUA 3DSFL 4M6ML 1FIGH 4PVNA 5KJRH 1F3DH 4H44C 4L8CA 2VH5H 5F1KC 1XTLA 4QHLA 2Y24A 1Q1JH 3FSWA 3SKNB 5I0ZA 1WCBA 2BY3A 2FO8A 1J8HA 2C9RA 3OKYA 4P5TA 1TZGH 4LOEA 3SPVB 3TV3H 2VLME 3QCUL 4GB9A 2ZXEB 2CBPA 5E4EC 4HKZA 1EX0A 3I84A 3MRJA 4G8EB 5SX5H 4UTAL 5D7JA 1Q1PA 5MENA 1MHHB 1T7WA 2HKFL 2VR4A 1KCSH 3KLSA 2GABA 5I9QC 3KJ6H 4MMZC 4LHUG 2F0CA 1QRNE 1JGIA 2A4EA 2GTQA 4G7YH 5IM7A 5D8JL 2CNZA 2Z34A 4FRWA 1CLOL 1HNYA 4FCHA 1UH2A 3VG0L 3ZQWA 3EYOA 1TJGH 2WZ5A 4G11A 3DSNB 5C07D 3PNWA 4NQCB 4GOSA 4QRPD 3IM1A 4L4TE 1MIML 5C0ND 3FT9A 2V7NB 4FFYA 1I8UA 4GQPH 5FM5O 1U92B 4XC1H 5DHVA 5F1NA 4J3WA 4YAQA 4HPHA 5J1SC 1BVZA 4YHKL 3BAYA 4MB3A 1NGYA 4OJCA 3CFBB 1AZBA 1X7SA 5B4MD 3TYFB 1EDQA 2XQYA 2IMNA 3HVDA 5SWSA 1OGTA 1T22A 2JCWA 5CN2A 3QUXC 3H42L 3AUWB 5HHXH 5I1LB 2XN9E 4H2CA 4CSZA 1LQSR 4NFDA 3JWNG 1E9OA 3WDIA 3AMKA 4FJ6A 3EO9L 3L5WB 4B9KC 4XXWC 5KVEE 2HX8A 1JWMA 2QQNL 4ZX3A 5L0QB 3U82B 4OZHA 1QLFB 2ARWA 4HS3A 2VITB 2ZCKL 4I0PD 5DGRA 3NRQA 1XR9A 2DWSA 1JPEA 4LLVB 3VTTA 1JYXA 3BKMH 4PJAE 5DZVA 1NEUA 3VSUA 2BFVH 5I6MA 3VXQB 1F6LL 4P07A 3DYMA 5J0BA 2C3VB 1IAII 1EANA 1Y0LB 2JJTA 4BM7A 3KM2A 2VERN 3APDA 3TBTB 1NFAA 4JQVA 3SDAC 3JWNE 4K5LA 2FR4B 4UV7L 2H6PB 3EJJX 4Z7QB 4EUPA 5DMGD 4P3WA 3D69A 4Y4KA 1E7UA 1ZGLA 5BOJA 1RK1A 4MS6A 4XOAA 3UDWC 5IB4A 3PWPB 3IPEA 4UF7C 1YMME 4J8RA 5IVXB 5IW6A 3HE7A 2EEXA 2ATAA 4XP1H 4KMQA 3CJJA 4F58L 4X5WB 5DVKA 5A43C 4WW2F 4YHMH 2AI0L 1TQVA 3UCQA 1X5LA 5FYJH 4CILA 2H2PC 3CIQA 3KCPA 1E4WL 1OGAB 1VEPA 3NFNA 3VNZA 4KDTC 2DQFA 2IQ9L 3O6ML 5DD6A 1EXGA 3O9WC 2YOCA 1C5CL 4Z78B 4BA0A 3GF8A 3L1OH 4NQDE 3NFPA 1N2RB 3WJJC 3WLBA 2PPCA 1CXIA 5K9KA 5FO9A 4UTCA 6PAZA 2YGQA 1VF5C 4FHKA 3RVUD 2R1XA 4IKNA 3CPLB 4DP2X 3CDZA 4F2EA 1E5AA 2L04A 2XZQL 5I18H 2VLRA 5GS2D 5B1KA 1MJUL 2AJ3B 3RJDA 4N5UA 5JQ6H 4X9GA 4PS7A 4MJ6B 4M3KB 3EG9A 1L7TH 5E7FA 2EEDA 4XCEA 3SSGA 3B34A 1U8PB 4GT7A 1GZHA 4YNYB 1FQ9C 4S10A 3ZDXB 4D2NA 3IJEA 3EGSA 5KTEH 4HD9A 2VYRE 3FC8A 1PAMA 3WMQA 4O2CA 1WC7A 3LRSA 3VH8G 3EYSL 4PJFE 4ELME 2W88A 5C0BA 3TBVA 2CIIB 1KUMA 3LTVA 3X1EA 3WNJA 2F1BA 3OAYK 2G2NA 5DJAA 3ZE0F 3EOAA 1ASPA 2XT1B 4B95C 4H5SB 1WAAE 3R8BB 3LEYH 4HK3J 4JQIL 3VFUB 5CJXA 4F33B 3BT2L 4FNUA 5LB1A 3G6JE 4ZFQA 3EO1A 1XL4A 3K6SB 3IXTA 1SBBA 4X0KA 4PY8I 4JZJC 5EBMB 3V8OA 3QJQB 1X5ZA 1J5DA 3DX8A 2Y06H 3M7OA 4DN4H 4PJDF 3U1QA 1I3UA 4CN6A 5EWIH 1OLZA 2F54A 5AB2A 2EZ0D 2CO6A 5FHAL 3DX3A 4AK2A 5DYOA 3K81A 4GKOA 2UZYB 1X7TA 3WDHA 3RWDA 3O0RH 3C2SA 5D2LE 3KLHC 2FIKA 3AG1B 1B2YA 2PW2B 5DT1H 3BWZA 3TEUA 5IIEB 1IGTA 4JVWA 3OB8A 2D7TH 1QABA 3EUUA 3WNLA 3QDHA 1DANU 2BZ7A 3RWJB 3ZE1B 3HR6A 1MFDH 4MMXB 2HXAA 3LRMA 2CR3A 3HAEG 1PJWA 3QHTC 1UENA 2UXVA 2WLMA 3OKKB 5E5RB 4Q4EA 1PEWA 5E7BA 4PB9L 5T5FH 4JHUA 3UBXA 4A55A 1MW0A 4PH8A 3B9AA 2ZSWA 5F7AA 1RZKC 4MJ4A 3UEZA 2P4AB 3TT3L 4DGIL 3BHBA 3LRKA 1IFGA 4HFUL 3BP6A 5F96L 5IJKA 5E5LA 1WHOA 4RMWA 4AC2A 2E4TA 1KWGA 5F71A 3QP3A 1UD3A 3SYOA 4BZ2A 1RIHH 3QRLA 4RFEB 1ZA3B 5CN3A 2EQDA 2Z8WC 1G7PA 3LHPL 2CDFA 3S4SA 2WWOA 4XB7A 1G4MA 5GXBB 4W6XB 4PJ5A 3QXAA 3LNIA 4HEPG 1OO2A 3FKUS 4GBXB 4Q9QL 3EFFA 1OTTD 2WUCL 4PIRF 3PDOB 3HB3D 4IRJD 2RAMA 2FQFA 4EN3C 4PGCA 3JV5A 3JZYA 4HUCA 3CSGA 4XXCC 5AW0B 1LJMA 1A6VL 4IKLA 5HY9A 5FF6B 4GW4A 4CSSA 2BVYA 1OF0A 3DXAE 4UOW0 4Y5VA 5JYLA 4G71B 1X7QB 3FQXB 3ARBB 4OZGE 5CLWA 5HHVH 3E3QC 2IQAB 3MREB 2AERT 3P3RA 5TK4A 3K2UL 5B7MA 4WUUD 4JGUA 3QAZC 1A2YA 4MD0B 4M9PA 1L6XA 1U8MA 2C3WA 4Y2DC 1DQDL 3NSYA 1LNUB 2NW3A 2FDBP 5CILH 3L4WA 4OCWH 2HVBA 4UV4H 4PP2B 1JPGA 4KNUA 5JNYB 1CXKA 3P77B 3G04B 3BAXA 3QJHA 4ZRGA 1KENL 1F18A 1UWXH 2XX0A 3VX1A 1IAIH 1CGVA 4Z7WA 4J1UB 5FEBA 3GBDA 4JN2B 5DJYB 4E9SA 4LMQE 2A9DA 1V3KA 2YD0A 4KO9A 5GGUA 3K6NA 2OL3B 3ZKXC 3L3IA 1FFNA 2NY4D 3C8KB 5E2WL 1BQHG 1UM6L 1VFAA 4RBPK 4D7BA 4PGBB 4JPWH 3O4LE 4TULL 3N50A 1N5AB 1NCWL 1I8IA 1JPFA 1KGCE 3CXFA 3FSOA 1TDQA 3C5ZD 3H9SB 3MVSA 4H88L 4I2XB 3O4OB 1MWAL 3TNMB 4OW6A 4M61A 1C16B 1P7QB 3LB6D 4QRQB 3MRPB 2FZ3A 4JZOB 5E8NA 3JWDC 4MMZA 4HPYL 1FV1A 3P0VL 4TUJB 5C7XH 1A6AA 1YNTA 4BEIA 5L4MA 4AENA 4W9CC 1KJVA 1RFDL 4GP4B 5EEXA 2MNJB 4LFHD 4TQPA 2WYIA 3K4ZA 3U36A 3TBCA 3HG3A 2J4WH 5C9JB 5J7CC 4YXLH 1G7LA 3K4AA 4PJBF 1CDUA 3A24A 3TBYB 4EQ2A 3OWEA 3VI3A 2FJGB 4FNRA 3VXMB 3BIKB 4C83A 1QUPA 2Q2EB 2X44D 3GSOA 1CDIA 3U7YH 3UP6A 1YEDA 4BKLB 5C0AA 1R24A 1PLGL 4JPIB 2XXCB 1NPNA 4TVPD 4J3OC 3QUXA 2PYFB 2NNXA 5DD5H 1AD0A 4PBXA 1SHMA 5HVWA 2A9NL 3QFJB 4EI6A 1LDSA 1JD9A 4XXWA 1T1ZB 1CTNA 1ITCA 2ZXAA 1MFAH 2IH1B 5EU3B 3C5JA 2G5BA 5ADPH 1CR9L 4LHJB 4PRBB 4LKCB 2DIBA 4FQ1H 1OY3B 2DEXX 2NXYB 3I02A 2Y7MA 2E86A 2BMKB 3L9BA 3PWJA 4N1HB 3RBSA 3DGCR 3B2UC 2DIEA 5FHBH 2VTFA 3GSQA 3VB9A 2XJKA 3CLFL 4XPTL 4PSPA 4KPHL 3ZTJH 4WNJA 2J1XA 2HVKA 4WZ9A 1PDKA 1XO8A 3SDAA 4OGQC 1NFKA 4NQCE 2C9PA 2VABA 2PPFA 3QFDA 3R0MA 2WWKT 1GCYA 4ZFGH 3GSXA 2XZCL 4N9OB 4XO9A 5C0CB 2J5LB 4HJSA 3V6ZA 3UDWA 4DP0X 5DURB 3G5XB 2EDQA 4G8GD 4LVNB 1OB1A 2BWIA 2D8KA 2G4GA 3AY2A 3KGRA 4NNPL 2EDRA 3BKYL 3H56A 5GGRY 1QZNA 4AYMC 3ZKSD 1CGYA 3M17B 1MY5A 3ZSSA 2D2OA 3HC0A 2NOYA 1DSYA 3DX9A 3FOMB 2Z7WA 4P06A 3SO3C 1SFDA 2FT6A 3OJ2C 4Y19A 2YPKB 4QO1B 4APXA 1WWCA 3VXSB 4K8RC 4KHXH 3W9EB 1EO8H 2QMJA 4LLYB 4XNDA 1KELL 2IPTL 4GXFA 2J3SA 1QNZH 4IS6B 3ARVA 3U2SA 1BZ9A 3Q44A 4ZXBD 3MUHL 4R2GB 3QORB 3WJJA 1IQWH 1OAQL 1DZ0A 5IJBC 2NW2B 4PGEB 2J5WA 3IPBA 3ARPA 1DFBH 4AH2B 3ARXA 3EHBD 4LCUB 4KXCA 4ZQKB 5HI5C 4GIPD 3LPOA 4WK0B 1BLNB 4ICXA 3D0LA 1M6UA 4WHYG 4PJ9C 3U0PB 1FVEB 5JHBA 3GMPB 1JVOA 4U6HB 3C60D 1HE8A 4LLDA 2WWNA 2GHWB 4QXWA 2BIPA 2EAEA 5C09D 5T3XH 4MA1C 3TYGH 3ULVL 3PWPE 4Z7UF 2I25N 2HG0A 1NCUA 1RHHB 2VDNB 2NX5D 3DIVA 4KVCH 1CK0H 1U4FA 4W9GC 4OLXH 5D7SH 5GRVK 5L2JA 3KWVA 5SX4I 3MOBH 1ZPUA 1JWSB 1S5IL 1IGCH 3BGFC 4Q52A 3QR1A 4B9FA 3FQNB 2QMKA 1NCOA 4PJGF 2B3IA 4WW2B 1MVUB 1OGAE 1UKTA 3MRIB 1PG7H 4DVBA 1U9KA 3QJVB 2NYKA 4GAJL 1FNHA 2ZXWB 1L0XA 2AJYL 5HBBA 4WTQA 3KMDA 4JZJA 1OARH 4H20L 3VFVA 4AJWA 2OL3L 3FO0H 4YZWA 3BAIA 5DVLA 1HHGB 3ETBF 4PRHB 4AVIA 2K7QA 4HLEA 1H9VA 4HJUA 4M43L 3CXHJ 5CEYB 1I7ZA 1TFHA 2W8CA 3F7RA 4RMQA 1T2JA 1W8NA 1O6TA 4GQZA 5BMFL 2G2RB 4ODBD 3UPRB 4XWGL 1A7PL 1SXZA 4JRLA 5I8KH 5ISZA 1A4KB 4NRYB 4NIYE 1ADQL 1GZPB 4BJLA 3X3GH 4NO3A 5KWYC 2HWZH 4X0NA 4XCYB 1J0IA 4R0LB 5FYKH 3T3MF 5DSCB 3AU1B 5T33L 4IMKC 3EJPA 4HHGA 5HJGA 1LEGA 2CGRL 3TJEH 5I28A 1OAYL 5KVFL 2CJUL 4ZUVA 1XGYL 1HILA 2R51A 3HS0C 3L7EA 3W57A 5AG9A 5C08D 2ILLA 3AB0B 3RJOA 5EO0B 2Z64C 3LKPB 1KXVC 3T08A 1Z0MA 4XVSH 2DPKA 3K8LA 3O3EA 5E95B 3ATEA 3CFEA 1HHIA 3TZVD 3TT1H 1N4XH 5GGTL 1WBYB 3UBXI 3KYOA 3QQDB 1R5IA 1AXTL 4M7KL 4JY6A 1TETH 5I6NA 4DUWA 2WSKA 4MA7H 1UZ8B 1FVDB 4NC1E 4U1LB 4WI7A 4XVUC 1GMEA 2R15A 4RMBA 4EN3A 1CCZA 4XXCA 4JDTL 5F9WB 4PJDB 4WI5A 1QYGH 1OF2B 1M05B 5ENWA 2DIJA 2JCCF 3Q06A 4CMHC 1OLLA 3JWNC 1W8EA 1Z3RA 3O3BB 3OAWA 4L2LA 4M6NL 1HAUA 5TGBA 1IAMA 2X6CA 3PAUA 3BH4A 4AVJA 1KCVH 4GPVA 1W6WA 3MO1B 2QKIB 3ZE1E 3H9HB 4FFYH 4Z7AA 3V5KB 4QRUA 2OQJB 4TSAL 4B0MM 2A0LC 5DHVH 2Y72A 5LWYH 1T1YA 1H3PH 1NM9A 3GMLB 3B4NA 3LKOB 4LPUA 4PRPA 4YSRA 1HCFX 4Q6IC 1U8LA 4Y2DA 4PLJD 1FYHB 2RTTA 4MRCA 5AW9B 1K3IA 1IZJA 5HDWA 2OTWA 4A6YL 3E38A 2FHFA 1A1OA 2NZ1A 4G43B 1DUYB 3WTXA 1F02I 1RLWA 3FUHA 4P05A 5CMAA 1U3ZA 4FA7B 3KPSE 3SKOB 1FAIL 2ARJQ 1A7OL 2X0UA 4OI9A 1A7RH 3FRUB 5KBKA 3QUMH 3HG1A 1AOHA 4AMKL 3PQYA 2PW1B 4D0BA 5CBAB 2Y07L 5FW7A 4MMYB 2A7BA 2FECL 3DLQR 3ZE2F 1RP9A 4YBLC 5L4FA 3KVQA 5HYQA 2XN1A 4LSPL 4K07A 2D31A 5LVEA 1SY6A 4AXWB 4TQ8A 4IRSC 4EUPH 3ULVE 5DUPH 3FMGH 1B90A 3AQXA 2VM3A 2WLLA 4O02B 5ABDE 3FOLA 3RPKA 4BH7A 4UYQA 1CFBA 1S78C 5I0DA 3V4LA 4IBTA 4V11A 1QR4A 5CGYC 1OCOB 4HLZH 2XV0A 3W2DH 1MFBH 3HBZA 3R1GL 1JZDC 2IBGA 3BPOB 4X6BB 1U2HA 2JKNA 4PWHA 3VFMA 5KG9A 2HKHH 5CO1A 5CCJA 2NY0C 1EVUA 1XZ0B 2BNRD 2IJ0C 5K59E 2VDNL 2B14A 2YAQA 4ONFH 2JVUA 3JQOB 2IH3A 4YDKL 3ES6B 2OMUA 4JKMA 1GAFL 2YD7A 3BW9A 4F7CA 2VW7A 32C2A 1CFVH 1D7BA 2NY1D 3WL9B 4N6QA 2HRPH 3WV0A 2KLRA 1WSST 3GMNB 4BFJA 2TRHA 1Z9OA 3MRNA 4FA8A 3S36H 1OTUC 2XSKA 1JNNL 1FSKB 1PL3A 1DJIA 3BPLB 2W65A 5AYUL 1LD9B 1WICA 2OX5B 3OG6B 5BO1L 4PHZA 3CFJA 5DS2A 2A83B 2XY1A 2R69A 3PABB 1MXDA 3DYOA 1KEGH 3P0YL 4U6VH 5EUKB 3QRGH 5SX4H 4FKEA 2EIZB 2Z35B 4V2BA 3QPQD 3SZ6A 2NY3B 4P2RD 3VFSB 2PCYA 1Y6MR 4LRNH 1C12B 1I1AD 2QADD 4M93B 3E1F1 5KVFE 1OP3K 2B4CL 5FGBC 5EIIA 3VMPA 2D3JA 3I75A 4L4VD 4CADB 4ODVH 4PJBB 3L2MA 5T3ZH 4DCQB 4WSKA 4IMLB 2ADJB 5DHMC 4QNPE 2H0EA 1CLZL 4RETB 1RIUL 2CR0A 5D7HA 2BOLA 2HRGA 3NGBB 3R7QA 4Q9CA 1EDYA 2ZG2A 5DJCB 5L2KB 4ETQA 3BP4A 5IHUL 3C5SB 2B5IB 3QFJE 5AVYB 5M95B 3SODB 5T1DL 1P1VA 2D9CA 4R4NC 1NH6A 3BUYB 2CUMA 4KKBD 4MNQD 3F7YB 4A63A 4GS7C 2BSSA 1C7TA 3MV8D 4MJIA 2HCZX 3OB0H 5HJ3A 1VGEH 2FD6L 3QDMA 1IEAA 1YUHB 2DQTL 1T4KB 2P8PA 3PJSA 4NM8H 5SWZB 2CBMA 2RFXB 1EZVX 3T65A 3KXFD 3PY9A 1RK0B 2FX7L 3SJVB 3AABA 2PXYC 3K2IA 2V8LA 3QUYD 4FZEH 3VD5A 1JZHA 2VB5A 3EH5B 1KB3A 2EDMA 5E6ZA 4KUCF 4MJ5A 2FSEB 2LLLA 4JO3L 4FADA 2RJMA 4P2QB 2H32A 1QX1A 4X7TB 5T1LB 1EFQA 4Q6YA 5DUML 1M3JA 3D33A 3O3AA 3O6LL 3H3PL 4YGAB 3WGVB 5KYNA 2BJMH 1NUGA 2CLZB 1MI5A 5IUCA 4ZTPH 4KRPC 5JHDE 3WI9A 2ZOTA 4PJ9A 3LNEA 3SDDD 2CBOA 5CWSB 3QQ9C 5C0CE 3RB5A 4G5AA 3EKCA 2YC1B 2XIIA 3LVEA 4HX1A 4ZO6A 2NYYD 1R0AL 5FUZL 3RGVD 3V0WH 1YVLA 3VXUB 1AI1L 1XGTA 4KKRA 2Y3NA 2W59A 1UH4A 5HYIA 3BZDA 1NC2B 7FABL 5CUSH 1CBVH 1KCBA 1A7NH 4M7LH 3SGEI 3QT2A 3TU6A 1WT5C 4NO5A 3L81A 5F3BB 1VLXA 4FQQA 2N1KA 2BFGA 2APBA 4BZ2H 2Q86A 3S88L 1IBFA 2YQ3A 2DQCL 1NBYA 4KKCD 4IJ3C 1FYTB 4LQFL 3VXPB 4P9HL 4DO4A 2WBJB 4P2OC 2KLTA 4P3DB 2JXMA 4TSCH 1R3JB 1SVZA 2ZYHA 5E2UL 3NJGA 4YDVB 4YFLI 4HXAH 4QHNA 2NCEA 1B9KA 5CNHA 1EAJA 2YLKA 4N8CH 1BF2A 3M86A 1L0QA 3HI1B 1N26A 3UYRH 3UC0L 1W91A 5I6XC 1QRNA 5GZNC 1YN7A 3B5TA 3WEAA 5EBWB 1ZJAA 1SPDA 2XVLA 4Y5YB 3IJHB 3GI9H 4HJTA 4XN8A 4OU3A 3KPLA 4AYID 1MQKL 3O11A 3U2IA 1A3RH 3DBSA 2HT4D 4L4TA 5AKTA 4G7VL 4BQ9A 4NEHB 3KBHE 4QYOB 4BGDA 2JK5B 2CDEA 4IHOA 5H8DA 5FWRA 4QTIL 5HD8C 3CHQA 2CKNA 3MRLA 4IMKA 4F9PC 4MWFB 3RHWF 2AEPH 4O02L 2QDWA 2GJJA 4LHUA 2EUXA 2ZE0A 3MMEB 1YHPA 4FEIA 3SY0A 4Z7UB 1HKLL 3HS0A 4FQXB 5DCCA 5DMKB 3AMLA 2WZPA 4GXVL 1AZNA 1KIUB 5EC1A 3ALXA 1MRDL 5IW1A 3FT3B 4Z95L 1J1OL 1ET5A 1KXVA 4ZPTA 2G2PA 4HKBA 1UOWA 1GYUA 1UURA 1TZIB 1KYAA 4PJGB 3HN8A 2P49B 2UZXB 1I3RB 4YX2L 2NY2B 4HJ0D 3RWHB 1VZGA 3DROB 1LE9A 1IC7H 4JRFA 3FTUA 4YDIL 1MIEL 4E0RB 4PJAA 3VW3L 1AC0A 2DWTA 4XNMA 3BO8B 1DBMH 1CYXA 1DBAL 2W0KA 1M4KA 2PN5A 5C3LD 1A0QL 1IBZA 4JE0A 3K6IA 1T04A 4FERA 1CD8A 1EERB 1Q0YH 4J3XA 4N2EA 4HIXH 2AQ2A 2QSCH 2EH8H 4KDVA 3P4MA 2C34A 2IADA 4A66A 2FLRT 1L9TA 4KK9D 1JHKH 1FP5A 4DF9A 3RILA 2VRAA 3UBHA 4Y16B 3ZQ9A 1HYSC 2P5WE 3H9ZA 2XWTB 2UVEA 2MRYA 3HZKB 1MLBB 4Q6IA 4QI3A 3L1EA 4K94L 4J6IA 3S37H 1YMMA 4L5FL 4NNXA 1RAMA 1O5PA 4IQHA 2XRAL 3NQKA 4OF3A 2HJFA 5JPMB 2XN0A 5K9OB 4J39A 1J8KA 3SBPA 1ROCA 4QCIA 4PP1D 3RWEA 2X2IA 3US9A 3IFOB 1DJHA 5IFHH 3Q9QA 3MYJA 1G1CA 3BEWB 4Q97A 1HHJB 4FG2A 5L0QC 3ZE0E 1D9KB 5ALCL 4L3ED 1D2OA 3K0YA 2LAGB 2Y22A 1F00I 1JGDB 3QA3B 4NQDA 1JZEA 3TIDA 4GH7B 5JHLA 1KZQA 4LBEA 1CDHA 4XN2A 1LO5B 3KGSA 2GJPA 3CNKA 1ADWA 4OFPA 4AW4A 3LXAA 1HFUA 3FQWB 3NCJL 3EGXA 1DSWA 2OTPA 3DWTA 4PJDE 3IN0A 3C09C 4F27A 2NCMA 1CGUA 1TU2A 3MGOB 4J6RH 2ZX9A 5F7BA 3C6SB 2JB5H 2Z31D 3MRQB 3FPYA 2VDLH 2MQGA 4JO2H 1A02N 1BG9A 3RZCC 1CXHA 2ZAGA 1XH2A 1KGJA 1Q72H 5GJTH 4IRSA 2JCCB 3MGAA 3PIQA 3UP1A 3FO1A 2XC8A 3GBNL 4HWEH 3QJZA 3D1MC 2VKWA 2ZUWA 1YEIH 4HF5L 3L4CA 4O9HL 2AJXH 3REWA 2EVIA 4GSDH 4K71B 1WO2A 4OLZL 4ZUUA 4M8QB 4Z3EA 3KLKA 5IP4A 2ZKWA 4OLUH 4PJFA 4ELMA 2YSSA 3M88A 2FYYA 4YE4L 1YY8A 3B8SA 2CGYA 5D7LE 2YEZA 5E9DD 4JRXD 5ESVB 4HOWA 2AEOA 1V54B 4QY8B 2Z91B 4GKZB 3TPUA 4D0DA 4I77L 4UTAA 3D85D 4N2LA 3UPAA 3BEVA 4N0FA 5CLXA 1QTSA 3N9GH 1BV8A 1ZT7B 1WAAA 1J9CT 1CFSA 1JWUB 4N6RB 4XPGL 1LO4L 3G6JA 2F7OA 3STZB 1EAOA 2YRZA 2MQ0A 3EDJA 2CLVB 4G1EA 3BKJH 2E9JA 2CIKA 3GS4A 1ZA6A 3S96A 1XBRA 4BKTC 1V3JA 2QPUA 4NOFA 1I7TB 1P4BL 4QRRE 2YXWA 4JGNA 5DS1A 3VH8A 4LKXA 1BM3L 1Z9PA 2WIIA 3HPJB 4ZFZB 3SGEH 3UTTD 3EIFA 5B3SB 4XMLH 1EGJA 3Q1SL 3ZE2B 5GRWA 5A2CA 4HCIA 1RJZB 2AK4D 2C7FA 4RISH 2EIJB 4HD5A 4UI2A 5I1KL 1S7QB 2OMVB 1Q9KA 1Q9OA 4MLSA 2IWEA 5CAYB 3VRLF 3GUFA 2HSIA 3ZHKA 3E6FB 4GUCA 1NCDH 2P52A 2A77H 1IC0A 3DA0A 2XWXA 5HDOA 4CW1B 4KJYA 5B38G 3PU7A 1UM4L 1BFSA 1N6QL 2ARJB 1GY2A 1DANT 3E80A 2YKLL 5EZIL 1IE5A 1RZIB 4E9QA 1J9RA 3NA9H 5KYUA 4KROC 3FYEB 3WDJA 5H4YA 3WLWC 4KY1L 4PJIE 1ZDQA 4X7EC 5GHWL 4PG9A 1XQ4A 2X70A 1S46A 4NC1C 5EEZA 5T8IA 1J9TA 4MDIB 4UDTB 4KI5D 3LRLA 3B7TA 4JJ5B 2J88H 1ANUA 1J8HD 1TENA 1XAKA 2PXYA 4M5ZL 4W93A 5GS0C 3ECUA 2KH2B 2V9UA 3MCKA 1I3VA 2EEBA 3G6AB 5DLMH 4ZDHA 1A7QH 3QG6A 1HCVA 2XI9A 3KLQA 3DXAA 1G9MC 3ZHLA 4PMEA 1KJMA 4OZGA 4MMXC 1F58L 3GXUB 3IWVA 1NBZA 4PN6A 4ZS6C 5FYLE 1A6TB 1ZOXA 2E8ZA 4L5FE 1X5AA 4EAEA 4XVJL 3CLEL 2ROXA 2K1MA 2PUQT 4IU3A 4K3EH 4PJ6A 3MNWB 4JHAH 3GC3A 4HEPA 5J56B 4Q2ZA 3VWKD 2E6PA 4LGPB 4LLUA 3EYQC 5E1AA 3CXHK 4PJBE 1FZOB 2DEYX 5F7DB 1G7JA 4YHZL 2DDQH 4EF3A 2XFGB 1RZKH 3RFZB 1NFIA 2H3XC 2DQJL 3C9NB 4QRBA 3CUPB 4EOWH 4YSCA 5L2KE 2COVD 4OM1H 1WT5A 3TASA 4TN9A 6FABH 4HBCL 5MEOB 3DIFB 3KZ8A 4JM2D 2DKUA 4FNQA 3H53A 4UIMB 4QPEA 3V5DA 3ZDZE 2MCAA 4QWWD 4A2LA 1I1FB 4OJEH 5LQBH 4MVBD 4M4PA 4P2OA 5E9NA 3O4LA 3TOPA 3ECQA 2QVFB 5JORB 1BYNA 2DJUA 4FQLH 3SJVE 5GRYA 2NUPA 4L8BB 1QFWI 3N1QC 3MJ9L 3VM7A 1RUAH 4U31A 3BDYL 43CAA 3ARBC 3KPRB 5E00A 5GZNA 4HETA 2MHAA 3ULVC 3CVHA 4EBQH 1KXTA 1OAUL 4U2YA 4NN7B 2OMWA 5E5UB 3VD0A 4TNVK 4CJ1A 3ARFD 4CKVX 3WNIA 3OKMB 3S0PA 2PTVA 4XBGB 4XVTL 3RL2B 1BQHA 2Q2LA 4C4BA 3RKPA 4ZD3H 4PRNA 2VMCA 3GSWB 1JPST 2WUBL 1AY1H 3BLBA 4NI6A 3SE6A 3VXTB 4KBPA 4CRPA 5K39A 5F0LB 3VD9A 2VISB 2D7PA 4KZDL 2WO4A 4JQIA 4JVPA 4F9PA 5HHNA 3B2DC 2RIKA 3MCLH 3S8FB 3EF4A 5KVGL 4X99A 2P26A 3F5WA 1CQYA 1ZHKA 3SKNA 2YD5A 3UMTA 2AV1A 4BA8A 3GZQA 2XG4A 1UJTA 3RTQD 4POZC 4NWUH 5D9SA 2Y1AA 4YSQA 3WTVA 4UQ2B 1KXQE 2A9ML 3HLAB 3JT0A 4G8EA 1CG9A 2B2XH 2Q3AA 3O4OC 4Z77B 2FGWH 3PXJA 1WBZA 1MHHA 1ZHLB 4HBQA 4NSKA 1OKEA 1OCWH 1LMKA 1IEBB 1O9WA 3MLUL 5AKVA 4Z0BL 3B5GA 4HIEA 1VZIA 4Q56A 3WIHL 1EJ6A 2VSKB 4WNSA 4Q4IA 4XAKD 1SY6H 12E8L 1SJXA 2FJSA 1DN0B 1IRAY 4FLSA 2E7LC 2GTZB 3IWUA 4PV9B 2DQDH 4A7GA 4KTDL 5EC2B 4IJTA 2GI7A 2WQUA 2QFRA 3U0WL 1U92A 4X6DF 4TL4A 1P4LB 1V3LA 4U7SA 3HB3B 4K5PA 4FFZA 3WXVL 3EO0B 3FCSA 1B4RA 1E5BA 2GIYA 4M5YH 3OKLA 3NJXA 3GRGA 1DVUA 2V5SA 2FH6A 4PWJA 2FTAA 4Z7UE 3S7GA 5F9JB 1M7IA 4J3OH 3DRTB 5F9DC 5AD0A 2HFGH 2D73A 1R5WA 2APWA 2LLGA 2W38A 3F65A 3KH3A 4L3CB 4IGBC 3L5WA 4IBVA 1I9JH 1XF5B 5E6UB 4XNYL 1GSKA 3ULUF 4PV8B 1IFHL 1QLFA 4PJGE 4WWKB 2VITA 3S6CA 3PLYA 2WXFA 3V5HB 1LP9F 4ODXA 5TD4A 5TDOB 1NGQH 3W39B 4NT6A 3CN1A 1BGXH 1UA3A 2G9KA 1RMFL 4GRWF 1J18A 2ADIA 3VXQA 4PIBA 3GJEB 2R69H 2YKKA 3WS6C 2W94A 3D9AL 1SLUA 2C3VA 5BS0D 1XX9C 1EJFA 3RX8A 1ETZB 5CZXC 4CBZA 1WFNA 4WFFD 3TBTA 2UXGA 1FH2A 4GAAA 2TSAA 1CZ8H 2FR4A 3QBTB 2H6PA 3RZCA 4FFWD 4KQ4H 4O4YL 3R8QA 3T04D 1RV6X 4YHIB 4QJ5B 4H40A 1SVCP 4J23A 3P11L 3C5ZB 3ROLB 2BNQD 3CD4A 5I0YA 4I9WD 5DO2C 2E6QA 3PWPA 2P8LA 5JOEA 4GQ9H 3T3ME 5IVXA 1A6UH 4F57H 4ADJA 4PMFA 1CFQB 4UT9A 1JNHA 2M8XA 2MSPA 4OLVH 1KPVA 3NQIA 4X5WA 5LDSA 3TFBA 1UQSA 3GJFB 3DOIA 5E4IA 5CINL 4HGKC 4WKZA 2G5UA 1NQBA 4ONHB 4AG4L 1ROWA 1EH9A 1OGAA 1MWAA 4MAZA 4K8RH 1TJMA 5GGVL 2OBGA 4G6AD 4XOEA 1BOGA 1KLGA 4UYPA 4Z78A 3L5IA 4EDWL 2XKUA 1N2RA 3M8OH 2A6DA 4BV1A 2WINB 1GKEA 2X12A 3KDPB 4P8QA 1SEBA 4N2AA 3M45A 2J21A 4LSSL 3BFWA 5DFWH 2H32H 2ENSA 3UIZA 5JIMA 2CG9X 1ESOA 4OI8A 1YCSA 2GJ6D 5DRNB 2AJ3A 3QQ3A 2JCCE 5DVOA 1BIHA 4MJ6A 3MOAH 2BY1A 5CGMA 4KH9A 3HUJF 2A4ZA 4MB4A 5ERWB 5E08L 4G6KL 4KUZL 1URIA 5A2IH 3EBGA 1PEZA 3SE8L 2V5RA 3R18A 4YNYA 5CZRA 5DRZA 3ZK0A 5KVGE 4LASH 1YEEL 1WZKA 5A2KH 2VXQA 2AXGB 1DBBL 2WB1A 5FYJD 1LK2B 3QUKA 1QFWH 5J3HD 4K7FA 5EORH 1I75A 2CIIA 3WHE1 2F6AA 2DTML 1BECA 1L6PA 2GCYA 2OR9L 3CV5A 3EUDA 3RVWC 4OVVA 1XT5A 3QC5X 4WW2C 2PABA 4KXDA 1KJ2B 1OPGL 5C07E 4H5SA 2Z1KA 4HZLA 1I85A 3QNZB 4RGNB 2LW3A 2CK0L 1PZ2A 4F33A 2VN6A 4Y4FC 2CJ3A 2MOQA 4HIJB 1I82A 4ZSOB 4TNFA 1JHTA 4UINH 1BQRA 1ULVA 4NQQA 1PZSA 1X6NA 1XV8A 2V8MA 3L3HB 3I3EA 1N5YL 5EOCL 1FGVL 1OM9A 2UZYA 3LKRB 1OAZL 5DC2A 2YFOA 1HL9A 1BZ7B 3P73B 2NZIA 2P3YA 3ZE2E 3B1UA 1NGWB 4GUPA 1XF3A 3US1A 2EIDA 2EXSA 3RWJA 2R9HD 3GXFA 4MMXA 5IW3A 4R0LC 3AUVA 7PAZA 3W5NA 3DO4A 5F3HA 2NZ9D 1HINL 1HSBB 2VJXA 1WHPA 5GZOD 3DVGA 4ZXBB 4Y1AB 25C8H 3NCXA 3WCYA 3KYMB 4YPGB 1R6VA 4OCMC 1MHCA 3AB0C 3RLSA 5CJQH 1W2KT 1IVTA 1Z9NA 1CLYL 5KVEH 3MA9L 1F97A 2YAHA 5HYEA 3I6SA 3C08L 3D50A 2WJ5A 3REVB 3KPSA 2QEJA 4XMZA 5IROC 3RIAK 4RFEA 2D0HA 1MAKA 1P1ZB 1IGJB 1YDPB 5C0AD 4NC0B 1TXKA 2X9ZA 2YBGA 1VESA 3ILEA 5C09B 2ESVD 3O2DL 2FO4B 1DL7L 5IKCB 4G83A 5HHPA 1UFGA 2F58L 1KB5B 2ZKMX 4QXGL 1Z6JT 2ZOLB 4Y7OC 1JIBA 2A99A 4M48L 2QGCA 5FF6A 4LMQI 1OZTG 1DBJH 5EF0A 2VLLA 2X3CA 3HHRB 3ARBA 2QKIC 3LZOA 3OXSA 3ISYA 1QPXA 3VQ1C 3MREA 2KZWA 4DKFH 2AK1L 3BWUC 3CC1A 4H0LC 2ICES 3TF7C 3IDMB 3HZ3A 1CWVA 4MASA 1WE5A 3VXRD 3OMIB 2MNUA 1T7YA 4F15C 1QHQA 3IDIB 5MI0B 1AZVA 2YD4A 3POCA 4H0HB 3GB7B 4TLKA 3SDAD 5JNYA 4S0HA 3LQZB 4P9HC 4N2GA 3G04A 3WKML 5L88H 2IAMB 3OQRA 2C5DC 3B37A 4YHYB 1KMGA 2JIXB 2VN3A 3P02A 2W9EH 2JSFA 4JN2A 4JY5L 2YWZA 1CJYA 3GFUA 4GIOA 4U3HA 1TVBB 4DAGH 4JDEB 1E6OH 1O0VA 1OSPH 4K9EL 1TQBB 4PGBA 3H7BB 5JHLH 4D9QD 5I23A 3E8VA 3DETD 4R5VA 1BVNP 4JAMB 5FA4B 3TNMA 4KTGA 3U30B 1C16A 2O6FA 1P7QA 4QRQA 4NJAL 3WFHA 4WY7L 5IK3B 1QBLH 2IC2A 1K6QL 3VSTA 3FCUB 4Z3GA 1G7HA 3BWAB 1ADQA 1F4XH 1GHFH 2L7EA 3NCWA 1DLFL 4Z18A 1MCPL 2VL4A 2CR6A 2OK0L 3P54A 5D70H 1DBKL 2IANB 3MROB 1SYSB 3G5ZA 1T89C 4PAZA 1OP5K 3MNZA 1A9EB 4E9TA 2GY7B 4M6MH 4MXQD 2E7LA 4N2IA 1IU1A 3QZWB 3D87B 5FW6A 2QL1A 2AFNA 3CZSA 4ANWA 2VR5A 1R3IL 2WMPB 2Z8SA 3LRHA 2ZIDA 4IEFA 5DQ9B 2EDBA 3C8HA 1NC4D 4JPIA 3L4TA 3QPXH 1LVEA 2PYFA 3TCTA 2HKFH 5JZ7C 3QFJA 4KKAD 1MNNA 2WC7A 2AJSH 2EEFA 4WWNA 1TNMA 4IGBA 1YPZE 4OD3H 5AVSB 2H1PH 3LRGA 1T1ZA 1BQSA 1ICTA 3MZGB 5H35A 3PAZA 1BAWA 1FSKC 3DV6A 4PRBA 1KJ2L 1LGVA 1N0LA 5DQDH 3X1FA 5TH2B 4HU8A 1TQSA 1FPTL 3V0GA 4RDQF 5KVDH 1M9SA 5F6IB 3WS6A 1F1DA 1EGJH 3ABLB 4ACTA 1G0YR 1EEYB 1A4AA 5ETUB 4XCFL 4YHKH 2N4IA 1BFOB 3BGMA 2R2BA 4K94C 2WGNB 3GXPA 2CE6A 3DV4A 3NESA 5JHDA 3H42H 1JFQL 4UUJB 4A6YA 1MCRA 3A6BL 3MRBB 4LCWB 4YK4C 5C0CA 4S0TD 3LXUX 1VKXB 4N8PA 2X2HA 4LT7A 4OFIA 4BSWB 1BYOA 2EVHA 1J05A 3G5XA 1DE4B 3OGCB 1SVBA 2QQNH 2ZOKA 4G8FB 1DVSA 3GSUB 4U7MA 4X6DB 3R7RA 5C71A 3QHZL 4A2GA 2ZCKH 4OCNC 3BZ5A 4NO2B 1JV2B 2B5IC 4Z3IA 3F84A 2VZ1A 2X0WA 5KYYB 1EMTL 3C6LB 3WNMA 3FOMA 4WUUE 2NY7L 5D6DC 2YPKA 2ICWI 3FT4B 2CH8A 3ERXA 3K0WA 3P30H 4A39A 3W9EA 4G3YH 2ZSVB 3P3UA 2VZTA 1HXYA 4PRAA 4ZMWA 2F5BL 3BE1L 1DHKA 3D07A 4IS6A 2DAVA 5L8KB 1RZ7H 4DGYL 2DQGH 4U1GB 3TL5A 3IGAA 1JTPA 5LGJB 4C55A 1LP9B 5IBLD 4KK5D 1EXHA 3VCLB 3I6KB 4JFQB 3L5HA 5EEUA 4PGEA 3KBFA 2IDFA 3FF7A 4GRWB 2MCPL 4NO0B 4LFHG 4AH2A 5FO8B 3ZLQC 4LCUA 5DR5H 5LCVL 4ZQKA 5C0EB 2CO1A 1JNLH 4YWGH 3U0PA 2MTAA 1CYGA 3TEWA 2MKLC 4DKAA 2Y7LA 3Q3GB 3MBXH 2AI0H 3H54A 3F6JA 3LQAC 5IB1B 2WWMC 5A2LH 1F4WL 3K5RA 1UEYA 5LG1A 1BA9A 1JYNA 4ETYA 2IQ9H 3MTXA 2VDQH 2BO0A 5I75B 3GEFA 2PO6D 1V55B 3LY6A 1CDBA 3R19A 1SDYA 1EUTA 3T9WA 4AE0A 4XI5C 1KTBA 4Q9RL 3FQNA 4Y2DD 4ZZKA 4EDXA 4WW2A 1MVUA 2O26U 4BBWA 1DQLL 3ILQC 5DS8B 1Z66A 4JFSA 4EXKA 3ENEA 3FB5B 3WE1A 4Y4FA 1Z3GL 4L4VB 1GYVA 2PWEA 1D5MB 3GMOB 4YIQB 1DN2A 5EZOH 1H9DA 1MJUH 3TFKC 1EVTC 3PUUA 3S34H 2BS71 1HHGA 3LMJH 3RAJH 3PYCA 4DKEH 3CVHH 3ZKMC 4QLWA 1X9UA 4URKA 2AW2A 1BIIB 1S7SB 4ORGB 1T66D 3LZRA 3GNMH 1UVQB 4MNQB 4EE2A 1A4KA 4NRYA 1CFNB 2V33A 3BIBX 1LEKB 2EYTB 2SODB 4X6FB 3BZ4A 2H1XA 3FFOA 2R0LH 3HKFA 2VDKH 4R0LA 4XCYA 5J11B 2XX1A 4DEUA 1NFDB 2P5WA 3HUJB 4JQIH 4U3CA 3QUZD 1ETA1 3PWNA 3A4AA 4J4PC 1YAIA 1MZZA 4JL1A 4LSQL 1X9RA 3IJ7A 5EOQL 2X1XR 4QXUL 5EO0A 3TWYA 5JMOC 3VWJC 5HI3C 4RGNE 15C8H 1PLAA 2C9SA 5FDWB 2AXFA 5IROA 2NY2C 3TWCL 4ZSOE 1R19A 3VB8A 5I15H 4OFVA 4GAFB 2Y7SA 1KV7A 5FKPA 2ID5A 3QQDA 3ARSA 3VVVA 3UAJD 2Y1VA 2QQLL 4HHAB 1UATA 2YD2A 3WMPA 1EO5A 3A22A 5DMIH 4L37B 3FTVA 1FVDA 4U1LA 4XWOD 3BSGA 1XSIA 4PTUB 1FRGH 1JS4A 3FTSA 2NXZD 3JT2A 4H4NA 4PJDA 2CLRA 2QELA 2X9YA 4QOKD 3W81A 1H3GA 1ET7A 4HK3N 4NQXA 1MRCL 2LVCA 3O3BA 2PR9A 3RVTC 2R0KH 4PB9H 4XP5L 3FONB 4F92B 1OAXH 2UWEB 4L48A 5J12C 2QKIA 5DMYA 5I8OL 3H9HA 2BW5A 5EA0L 3IMWA 3QCVL 2LR4A 2FHCA 2OQJA 4WCYL 4Y16C 5D1XD 5KJ4A 3V5KA 3VVWA 3V79C 1R46A 4P3CH 1H6EA 4FFZH 5G5DB 5DHYB 3ZDYF 3OKNB 1DVFB 4WK4B 4Y1AE 3DBXA 1TOXA 2XACC 5AFAA 5JPMC 3LHPH 3VRLE 3QXDB 3WBDA 1CL7L 1UASA 2UZIL 4MLIA 4NXKA 5D7LA 4Z8FH 1DUYA 1LK3H 1S9VB 2QPDB 2WUCH 4UM9B 5C9KA 3G5YB 5EF1A 1D9KC 3T6VA 3U2JA 1RZGA 1BDYA 3QXTA 2NTFB 1T5XB 3Q1EA 3SKOA 1HNFA 1ZE3C 3T3PF 1F3JB 3B7SA 3ETBJ 1JERA 4I3RH 4PWIA 3LCYA 4KDWA 1MWOA 3L1GA 2FAUA 1YY9D 3F85A 4ZAKB 3FRUA 4R4BB 5C09E 2AZAA 3MCG1 3CFDA 4OCRH 1P5UB 1EK3A 3EJTA 1GYCA 2NX5E 1ACYL 5ID1B 2B1OA 2D3NA 3GZOA 1MLCB 1QI3A 1ZMYA 2PW1A 3K2UH 3MLXL 5CBAA 4QRRA 4KGLA 2EDXA 1GMIA 3OVUB 3X14B 3VRIB 2XPYA 1MSPA 2G5RA 3QXUA 1DQDH 5AOJA 3MLTB 4Z1PA 2FJHB 2DLFH 4FKHA 4AXWA 1N3NB 1KXHA 3DX0A 5E0FA 2YD6A 4M29A 3VU2A 3FU0A 1PSKL 4TXVB 5MEQA 1T89A 5DJDA 5DQJA 2X0VA 3X12B 4DP5X 3DPBB 2V4LA 2ZKXA 1KENH 3TIEB 1AGFB 1QBAA 5FYKU 4I0KA 5MEPB 3QJTB 2JFCA 1KFGA 4JHWL 4UT9H 4NZRH 3WN6A 4X4ZA 1X4XA 2WW8A 1T3FB 3IKKA 3IFPB 1NCCH 4TULH 5JO5A 4H88H 2OW7A 5LNGA 2FBJL 1D6VL 3QHFH 4N2MA 3B9KD 4WO4B 4YDJA 1ZS8B 5JW4M 1MWAH 2AABH 5C0NC 4WHYH 4I48B 3BJ91 3ES6A 3QZWG 3G5VB 4PVLA 5I76B 3WL9A 5I1IH 3S8WA 3TA3B 4PJIA 3PP4L 3SKUD 3FN0L 5B4MC 1RFDH 4HIHA 3UJJH 1FDLL 2VDPH 5E4AA 3G3LA 2GJZB 5FV1L 4PJCF 1P84J 1UG9A 3PABA 1NAKH 2R56L 1J1XL 2VLMD 5B38A 3KJ4C 3GEWB 4G6MH 5EUKA 1E3XA 1RERA 2J12B 2Z35A 3NEOA 3KYKH 4I3SH 2IANE 4KY2A 4NUMA 4I0PC 2DLIA 3QAQA 3F7VB 5F1SA 5HYSA 5GSRB 1BP3B 1PLGH 4OF7A 1IGYB 2ZUXA 4OZ4B 2YXVA 4Y2OB 3T0WA 2VXQH 3SQBA 4CADA 2XIBA 1Z9MA 3Q8AA 1J5HA 4F9LC 4PJBA 1WWBX 1NOFA 2XVKA 3PJLA 2ADJA 4AQZA 4FCAA 6PCYA 3RP1A 3MJ6A 1AD9A 1FZJB 1TF4A 1S9XB 2VDRB 4OUOA 5ALBL 3T0EB 4G42B 5DVPA 2Z31B 3P2TA 1CR9H 4LCCB 3UOAB 3RBGA 3DRQB 5DMGC 3C5SA 3C8DA 4FLHA 2ZWZA 4GO6B 2IBZY 4GMTH 1INEL 1E6JH 3BUYA 4RFNB 4HJJL 4R7LA 3HJEA 2QT6A 3BSZL 4UQ3A 5D6DA 4LHUD 3CLFH 4JLRB 5J6HB 2XN9D 3EZJB 3MRMB 2RFXA 3QO0B 5KYXB 3TJHD 3X13A 3SJVA 4DZBB 2X3AA 1FJ1A 2HT3D 2K45A 2X2UA 4BD4A 2ZKYA 5GS0H 5IOKA 5F1IA 1JYWA 2ZUVA 3SKMB 2EH7L 4PV1C 2ERJB 1MCHA 2ICEC 1M6OB 2FEJA 3JTBA 2H9GB 3ZKND 1G9MH 1RULH 2V17L 4F8OA 4LLQA 5D6CB 4NRZB 1TJHL 3V7AG 4NNPH 5ITBL 4OIIL 1A6ZA 3VXOB 3TO4D 3OHXB 1CPUA 3K6OA 1II4E 2KBGA 2YC1A 3O2VH 1G0DA 4DSYA 1SOXA 1S7TB 1ZY9A 4H7VA 3RVUC 1TLMA 5BUGA 4M5SA 3K8MA 3V2AR 4X6DE 5AAMC 3RFZC 1WFOA 4FFVD 5IGXH 1NC2A 3TN0B 2XPZA 3UTTB 3NT0A 2IPTH 3CE1A 1C5DB 3TNNA 5F3BA 1T6VN 1FL3A 1A65A 7PCYA 4BINA 1OAQH 4WEMB 1SLVA 3PUCA 3V7AE 4DGVL 2WXJA 1U6AL 3VXPA 5ICZB 3SCMD 1BQLL 1R3JA 4U4IA 2Z4QB 3ARGB 1KXQA 2B7DT 2VERA 4NQVA 1IL1A 2AF2A 5BVPL 4AE1A 3RPBA 2K8MA 5AENA 4MCZA 1WISA 1LP9E 2F7QA 3LQMA 1WEJL 4TTDD 4GRWE 2BNRE 4F2FA 1UC6A 5D93C 5BV7C 4EI5D 3ULVH 3IJHA 2H26B 4LCIL 4L2YA 4NN7C 1O6SB 2B1AH 2VLJD 5AOLA 4YSDA 2IG2L 1UKSA 1AHWB 3CAFA 4G9FB 1XR8A 3ZYOA 2WVSA 3QO1B 3RL1B 4X98A 1S9YA 1CBJA 4QYOA 1B3JA 3LNGA 1NAMB 5HYJD 1JRHI 4PRIB 1TCMA 3CFKB 4G6JL 4ONOA 3S9DB 3CU1A 5E6SB 4B5EA 4MWFA 2UYLA 4K73A 1GSMA 1MEXH 4HMEA 2BSTA 3MMEA 4Z7UA 4LAQL 4J4PA 2AJYH 2C1PB 2WQXA 4WGVB 1SXCA 4FABL 2Q8AL 4H20H 1KIUA 3PV6A 1S78D 3FT3A 4N68A 2J43A 1AIZA 2C9XA 1C1EL 2ALWA 1AXIB 1TZIA 4M43H 4PJGA 4L4VE 2UZXA 1I3RA 3VWKB 5CZVL 3RWHA 3DROA 3RFRA 2RHEA 1LDPL 4E9RA 4Y9EA 4XWGH 3LPWA 3O8XD 3QEGH 2NY0D 5AB0A 1M53A 1MELA 1D2PA 3SE3C 3HNSL 2VXTL 3B7YA 4B0MB 1ADQH 3F00A 4NUGH 2DQHH 1MCDA 1WZ1H 4XE5B 1Z5LB 2NSMA 4KXBA 2YPLB 5I1CL 1HQRB 2HLFD 5T33H 3DKHA 3SGDI 3HG4A 2J8HA 3D48R 4UT6L 2XWZA 2YK1H 3SYCA 2A4CA 4MNQE 2GKIA 2CJUH 4Z3FA 1TJXA 5GGRB 4DZ8A 1A22B 3B3IB 3NACL 4HWZB 1OTTC 3OAZH 4XMPH 3HB3C 1I7UA 4IRJC 5GRZA 4Y16A 3HW7A 5ADOL 4GT0A 1SNRA 3HUJE 3LKNA 2AC0A 5C6TL 1N0XH 5BUAA 3L9RB 3U1SH 4HFWB 1UCTA 3DX4A 3QG7L 1EV2E 5K9OA 4BUQA 5JPMA 1OSEA 5EU6A 1AXTH 4M7KH 4Y9GA 4M62L 4ZMLA 3LEXA 3CX2A 4F7TA 5D4QA 3IFOA 4GG8B 2I9LB 3D25A 4CN4A 4Y9FA 1HZKA 3BEWA 2ZX7A 1HHJA 4CKQA 2K70A 4GKNB 4AUYA 1D9KA 2P28B 4JDTH 3L5JA 3MJ9A 4KKNA 5TFSL 1JGDA 1ZVSB 2IPKB 3T4AB 1CLCA 1P2CA 4AV5A 2EVFA 4RQQB 4XPBL 3FQWA 1WPCA 2W07B 2OSWA 4ZJ9A 4LLWA 3CSPA 5DJ6B 1PNCA 2GY5A 3EJCA 3FTXA 4R97C 4FTVB 5I17A 1L0YA 2ZF8A 2ORBL 3PWVB 2NY4C 4OUUA 1YAZA 1RUMH 3AG2B 5FYJU 3UTSB 2D3LA 2DBLH 4A6YH 3PDDA 2PXYD 3DUSB 3C5ZC 3ESOA 1P6WA 3W38A 2WNXA 2X10A 3ROOB 1A66A 4P4KD 2BWDA 1E4XL 4S11A 3P9LB 4BRVA 3DXAD 4R8WL 5H4ZA 3LB6C 2E3VA 3N6YA 2ROYA 4M8QA 1T83C 4TNWK 1ONQB 3UYPB 1LMIA 1F2QA 5JIPA 3VFGL 1A7OH 1QVOB 1UCBL 5C3TA 2XWCA 3E7JA 3N06B 4RFOH 3MRFA 3IDYB 1QKZH 3FO2B 4QY8A 3ZY7A 2CBTA 3OPUA 3D30A 1S7UA 5C07A 2RMNA 2Y07H 1MFCH 4QRPA 1QI5A 2CKBB 1XD0A 3K80A 1T7ZA 2JE8A 1XGQB 3WIHA 2YR3A 2CHNA 1JI2A 3T3PB 2GK0B 3K2MC 3NCFB 4ZUSB 3KEHA 4MDJA 1G6RB 2E7HA 4MNHB 1GY1A 1SM3L 4OIFA 5DDHB 5F44A 5D5MF 2G3MA 3TESA 5KN5B 1ZT4B 4TLTA 4YUEL 4OGXL 3L3OC 2OMXA 4APQB 3MLSL 1G43A 3NJFA 3HMXA 4CMMA 3QDJB 3JUYA 5ID0B 3QXWA 4AJ0A 3EBIA 2R0ZL 3F12B 3R1GH 3ARRA 3HS9A 1S7WA 2Z93B 4I0PA 1JP5A 4JFPB 1KGIA 2IGLA 4JFEB 4XO4A 5DK2B 3NCMA 4GMSH 1GIGL 3DOHA 3EXJA 1PZAA 2WBXA 3MV9B 4JREB 3Q8FA 3E6FA 3T0XA 1H19A 4AQAA 5DK3A 4YDKH 4CW1A 3HZMA 3LDBC 5HHOD 4F9LA 2NNFA 4AM0B 1NAML 3PHQB 5LO7A 5GS1C 1RZPA 3H3KA 1P69B 3N04A 3LS5L 4UB0L 5HDQL 2VMDA 1JPSH 1JNNH 1M1XA 3I3BA 4XPHH 3L13A 4RVBA 4R5TA 5BO1H 1YN6B 4ZS7H 3MACL 4NENA 1LXMA 2GBVA 2WAQA 3DECA 1BEYL 2VW4A 2ZG3A 4JFFB 1QO3A 4XGZA 3N44F 4LQ1A 1T0NB 1IKOP 1CN4A 2GSGB 2BCKA 1U8IA 4DFIA 1A6WH 5I19L 1QLRB 3RNKA 4JJ5A 2XZAL 2VQ1B 5J13B 1YEHL 4MCYA 1XCQA 2A9BA 3JVFC 4YXKL 5CJOL 4AOFA 3AWEA 2H45A 4XPAL 4C54A 4WEBL 4RRPM 3MUGB 2ICEA 2R4RH 2QSQA 4PJCB 1RZJL 3EYFB 4Y5XC 3EJQA 4JKLA 1KSRA 3VNYA 1DZBA 2PCPB 1J1PH 3OPZL 3TH2T 3DHJA 5DFVC 1CLZH 1RIUH 3TP4A 3HNVL 3NSJA 3P4OB 5IB2A 2VGLM 3WUWB 2ICWJ 4ZXBC 3SBQA 1LWJA 2AQNA 4OF8A 5IHUH 2YMXL 1CGSH 1CICD 2K3HA 5T1DH 2XXMB 1UTDA 4YDNA 3RX7A 1XCWA 2E27L 3RB7A 1BQUA 4NQCD 1WCQA 5AAMA 1P6FA 1OEZW 1U58B 2EXWD 3T0EE 4ZMZA 3RFZA 3EHBC 4UTBA 2FD6H 4DQAA 3CUPA 4NFBA 4W1TA 4RDQG 2H47C 3WG7B 3ECVA 1JZ5A 1J87A 2FB4L 1MFMA 3SDCB 3D0VB 3DIFA 4LDOB 3VFNA 3BLKA 3C60C 4GI8A 4WFHD 2VQUA 5AW4B 1B0WA 3KPNB 4UIMA 5HGAB 3NTCH 4NAMA 5J06A 1I1FA 3CSBA 4LEOB 3GM0A 4Y8DC 1AZZC 4BFIB 4MA3A 3O6LH 1NWOA 3KH4A 4W9HC 5JORA 1DFXA 4FYTA 4K55A 4X6CB 3WXWL 2QPEB 1F4YL 5D7EA 5JXED 5KJ7E 4XBEL 1R3LB 2ZG1A 2BVQA 1I1CA 2EDWA 1R0AH 4AWJC 3VFWB 4RNRB 4MCMA 4FJYA 1SUHA 1F0LA 2C8NA 5C0FA 3KYAA 4OCYH 3OKMA 4G7QB 4XBGA 5HVHC 3RL2A 3T2LA 1HJBC 4RAUB 3GSWA 4KTYA 1HIML 1OGPA 3GQFA 2WZAA 4HS6B 3VXNB 1TITA 3VXTA 1FO0B 3FH7A 4K7PL 4PJXF 4LQFH 2VISA 3GRWL 5DC4B 3II1A 1FHNA 3OZ9L 3DPDA 1A3LL 2FK9A 3UTTE 2P80D 4N86A 3ASOB 3RVVD 4WHTA 5CP3A 4G82A 4TPRL 2YWYA 2BHUA 1ZHBB 2Q87A 3QRFM 3FUJA 4BDVB 1A1NB 3QWRD 5TPWL 4OFYD 2OXGB 3K72A 5ACMA 1HZLA 2AK4E 5B1BB 1N6UA 1TQBC 5HJDA 1YPZA 3FU7B 3HN3A 5CEXB 5D4HA 3NN8B 4KNTA 2AJZB 2BSEA 3HLAA 3IDGA 4X80H 4EQ3A 1P7KB 1PD0A 3IS0X 4M03A 5EN3A 4Z77A 1BOYA 3U30C 1U8KA 5EU5B 2WLIB 3U9PL 1X5YA 2BOCB 3N40F 2CKBL 1OGAD 2WXRA 4G7VH 4M9OA 3SE3A 3HCVB 4HQQL 1E9QA 5EUOF 1D5BB 4UZUA 4OGYL 2Q7YB 5KUMA 1DN0A 1G6RL 4QTIH 1YYMH 1CLVA 3WKNA 2GTZA 4PV9A 3UG3A 4HS8L 2XA8L 1B88A 2HYMA 4KRNA 3CFCH 4L1SA 1U91B 4QRSB 3SGJC 1HKLH 3MODL 4IIQB 1I8KB 2ESVB 3LN5A 1P4LA 2PKDA 1VEOA 5EB9A 4IRJA 4KI5E 1MRDH 3EO0A 2FWOB 5IVZA 4KNQA 2HG5A 4Z95H 1J1OH 4RMRA 1NMCC 1AQ8A 4XNAA 4KMTL 5LN4A 5IBTH 4X7FC 1KEMH 4X5XB 1L0PA 1ETJA 2O5YL 1JE6A 4LARL 3CH1B 3IU3B 3X13B 4G8IB 3O2DA 4U1NA 4PJEE 1U8HB 1XF5A 5CBEB 5IFJB 4WUUA 2WHVA 1T2XA 2QLVB 4KV5F 3WFBH 2DD8H 2XBDA 1IAKA 1SN5A 4NN6B 2RBLA 5CR1A 2E9WA 5DA4A 4PLJC 1SXBA 3V5HA 3UAAA 4FQIL 4NWTH 1I9IL 3CK0H 4M6OL 3UYOD 2VN4A 5TDOA 4YBQC 1DJSA 5DJ8B 5TF1H 3KHQA 3W39A 5K33A 4JY4B 1MRFL 1A21A 1YEJH 1O5DT 3GJEA 3MAWA 5F6IC 4OKDA 4XO5A 4HPOL 2XBZA 5E2VH 1PCSA 1MJ8H 4UQAA 3C12A 4ZW3A 5FYLH 5TE4L 1YC7A 2KQNA 4WLCA 1FG2B 1NCJA 3UO1L 4L5FH 1L3NA 3CN2A 1VFBB 4RX4D 5JXAH 2F74B 2XRAH 3KL5A 3LZFH 3NFSH 4QKXB 5LKNA 4WDIA 1PPIA 5HTSA 1T5WB 3L6FA 3GO1L 4YHIA 4LAJH 2E76C 5CLZA 1GC1C 3C5ZA 3ROLA 1U8NB 1P84K 4WNQB 1WFTA 1IE4A 2D7MA 3PXLA 4MQXD 1HE7A 4ZBJA 4IBLT 2BDNL 4TQHA 5ALCH 3O6FB 4PS4L 1T83A 1OQXA 3AM8C 4YVUA 1TIUA 2GT9A 3GJFA 3KL3A 1E8ZA 4LVOB 4ZX5A 3QIWB 3AXLB 2ZNWA 3NUKA 2XFXA 4FE9A 1SOQA 4IRZH 2WKOA 5EZPA 5SWQB 1HT6A 1LO2L 1Y1UA 1ZAGA 4LOUD 1SMDA 4GEJA 1G7IB 3NSFA 1KLFB 1AHKA 4OCSH 4WSJA 4X6EB 1BHGA 4ONGL 2PYEB 5F9AC 4U1GC 5EN2A 2FX8L 2WINA 2KLSA 4N2KA 4JFZH 1ZTXL 4JQXC 3IGFA 3GBNH 5IR1B 1BPLB 4N24A 2H5UA 1ZHNB 3SPGA 2ODHA 2ATKB 5DMJB 2XYCA 4AYGA 2YUXA 4PREB 4HF5H 4JZNB 4O9HH 3L3OA 2BHZA 1UB6A 3PGCB 1IAOA 3ESMA 2LAAA 4GBXD 4KTEH 4OLZH 2Z9TA 2NTSP 3HZYB 2NY1C 3UTSE 2AEQL 1H0DA 4OKVA 5CP7B 3MR9B 3KNBB 4YE4H 5E2TL 1RUKL 3U6RB 3V4VA 3G7TA 4ZOBA 5K9QG 2CAKA 1T80A 2GSIA 1OM3L 1AO7B 3WUZA 5D7KE 3LQAH 4AQEB 2VNCA 2W60B 3L4YA 3MLRL 4I77H 4JJHA 4NZ8A 4YJZL 1U3HB 1UEMA 3OR6A 4LSRH 2ZXDA 5D1ZB 3A67L 2AXGA 4JB9H 2R27A 1BVKB 4KZ0A 4M7ZB 3ZDYE 2VLKB 3EJUA 4XPGH 5IQ7H 3E2HC 4XAKE 3QC6X 1P5VB 3QPQC 5DHDA 4V1DB 2N1TE 2B15A 3MRDB 4L1BA 5B3NA 1CI5A 1UWYA 1OSYA 2A6JB 1FO0L 2CDGB 1AMXA 1P4BH 1BXVA 1I1AC 1KJ2A 2I26N 2QADC 5KS9F 1QSVA 1S7RB 2PF6A 3A23A 3QNZA 3TTYA 4PEEA 3PCYA 4DIXA 3PL6B 3IJYA 3H2WA 5J6GB 4ZSOA 3TV8A 3T3PE 2UY6B 3Q1SH 3UC2A 1J9SA 4G8GA 5GRJH 1S5HA 1EDHA 3ISRA 1BJ8A 3L3HA 1UZ6F 4XBPB 4JRYD 3S3BB 4JCWA 5I1KH 5FK9B 4TOYL 2XTJB 1BZ7A 1DLHA 1T1XB 2GEQA 5D5MB 4JFTA 5DHXB 4KKBC 3F7PC 3H9SD 1R17A 3Q13A 4Y5XA 4YO0B 3K71A 1AGBB 2ENQA 3WY3A 4P46B 1JV5B 5J11C 1UOKA 3RDTD 1RJYB 1HSBA 3MV9E 3B6SA 3QUYC 4I1PA 4OIAA 5I71C 2YKLH 1HWHB 3CC5B 4HKJA 3RTLA 4ZXBA 2D7NA 5EZIH 1PF3A 4Y1AA 5DRXA 1K72A 3KYMA 2VDOH 1O75A 5JIHA 2BVTA 3UJIH 2DQUH 1RVFL 5AEAA 4KY1H 5F9OH 4F7PB 1RPKA 2F68X 3CU7A 3S3JA 4B9YA 5JW4N 3ARZA 1ORQB 4LCYB 3VXMD 3SDDC 2BP3A 4B7LA 3C60A 2P46B 2XQBL 2NYYC 1IGJA 1BSIA 3RGVC 3SDXF 3WUWG 3AGWA 3BVTA 4I9WE 2B0SH 1FFOB 2OP4L 5C09A 2FO4A 5E8OB 4HT1L 2PPEA 2DY2A 1F58H 2NX5A 1QFWM 3BD4A 5FFOA 3LV3B 3N44B 2X4NA 2ZOLA 3HNTH 2G9HB 3ZSTA 2LFGA 2FVNA 2ED7A 2JKIS 1ES0B 1VCAA 1AR1D 1BX2B 1HOEA 4DTGL 1CD1A 1SYVB 2NXYD 1E8YA 3EH3B 3S5LB 5C3IA 2BERA 3L2LA 4J8QA 3SYPA 4U1IB 3IDIA 1IT9L 3QJRB 4HBCH 4OZFB 3V0JA 3GB7A 2VC2B 2H6OA 2GJ6E 4Q9QH 1UOVA 4CU7A 3VACA 2A73B 1AG0A 2DMGA 5EOTB 3GIZL 4LOVA 4CU8A 2F19H 2HT4C 4GXUM 1P4UA 3UTQB 4OLEA 1TVBA 1ZTXE 2P44B 1ZE3H 4LF3B 3MJ9H 1MREL 2K6WA 4YSPA 3BDYH 4I4WB 2IALB 3IBOA 1P5UC 1N59A 4A37A 4BCZA 1N64L 2X4SA 1SJEA 2AQQA 3C2AL 2DYPD 2FEEI 2B16A 3QUZB 4JAMA 1B9ZA 2AJVL 3FO9B 4B9GA 5IK3A 3VXSD 4CC0A 2OTUA 3WFEL 5EFIB 3K46A 1XSKA 4B9PA 2PWHA 3IFNH 2CRMA 4NZDA 1RK7A 1B0GB 1JGUH 1OD9A 2WUBH 2OJEB 1FNSL 3IBEA 4YC2B 2XG5A 1S7XA 2IANA 4EIZC 3H0TB 4NZTL 4KZDH 3E6HB 4R2GD 3QORD 1THAA 3KYNB 5FKAB 2ZPKL 3QZWA 3V6FA 1CF8L 1QQDA 3GTNA 4HJ0C 2X4OA 4M7JH 3VX0A 1NSNH 3ZQXA 4RH4A 3SGJA 1JZ2A 1IO4C 2HPTA 5DF0A 1EBAA 2WMPA 2P8MB 3LH9A 5D55A 4AKPA 3AJ7A 3ZL4L 2YHGA 5FFLA 1GS8A 1FH5L 4NFCA 2NXZB 4NQSA 5DQ9A 3WIFB 4XNUH 3KM1A 1VGKB 4PJXB 3BZEA 3MRKB 2C9QA 1H3VA 4AZUA 1RI8A 1U95B 1XFPA 2QV4A 4KK9C 5C97A 3G5WA 3WIHH 5INCA 5F7LB 3WAKA 3RQ3A 3CBKB 12E8H 4MD4B 4N0UB 3CZLA 1Z9SB 3WSQL 5BRZB 3I2CL 5TQ2L 3QNYB 2WM0A 4XNQB 4KTDH 2GHZA 4YQXH 4AEEA 4PP1C 2DLGA 4QDGA 3GBML 2IV8A 3HMXH 1EEYA 3GKWL 1GKOA 3IJ8A 4MZ2A 4GP8B 5HDRA 1BFOA 3INUH 3WEXB 2QHLA 5EUOB 5I5JA 5G2NA 1H15B 4KJWD 4Z3TA 3QJFB 3GMQB 3IGUA 4JFWA 4PRHD 3H4HA 1NUFA 2ESVE 1RUQL 1PFOA 3L5XL 2PWDA 1PYWB 2X1PA 1AZRA 4AIZB 1VKXA 4U7KA 2F53B 3RIAF 3DGGB 3HTLX 4BSWA 1DE4A 3BD5A 1TQCB 2E7BA 4HVBA 2Y36H 1XDTT 4O2FA 2Z31C 1BBDL 1XHHA 5D1QB 5B22A 4TUOB 4EZJA 3PDGA 2BW4A 2QGEA 2VMFA 1JV2A 1B6UA 4HGWB 3S97C 1BG1A 3BVUA 2DYSB 5KYYA 2RALA 5CEZD 4E41B 4RFNC 1CVRA 1RMFH 3M7FB 4HKXA 4GAGL 5CSZA 2I9TB 1JGEB 2BZDA 3D9AH 5DK0B 5D71L 3FT4A 3U1PA 3NCEB 5HHQB 3H7LA 3FCTB 4DPAX 1F11B 3TBWB 2ZSVA 5TQ0L 3N40P 3POHA 3FXIC 3MV01 1MCOH 1VRSA 1EZVY 1NOAA 4UQEA 4CDGC 4CNIA 3ILDA 4OLYH 4XNZB 3ABZA 3ZPDA 4B3VA 1EEZB 3FDWA 4IOSA 3BN3B 5LGJA 2ERJC 3GSRB 1LP9A 2QTVA 5C0RH 5F6HI 3I6KA 4JFQA 4N2OA 2BNRA 3FHAA 2AHIA 3QZNA 4NKDB 4RZCB 5C0EA 1M7UA 2LABA 4HCGA 4XCCL 1E2VA 2AEIT 4H25B 3IVKB 3NMEA 4XNXL 1SEQH 3VGGA 1COBA 4TNGA 3MBWA 2MEJB 2P5EB 1K8DA 1OALA 1UZGA 2WLNA 3B56A 3OJDB 4A7SA 4D9QE 3HG2A 1FNEB 4R90L 3ZUCA 2I7OA 3V0VB 1GXEA 4AG4H 1MPAL 1KY6A 2A9AA 3R4DA 4UTBH 1JDAA 2E47A 1H8LA 1IBDA 3GSNB 1A8ZA 5BXFB 3LX9A 5GS2H 2EKSB 4EDWH 4M8RA 3EW3B 3IKCB 1OE1A 4JCLA 2Q6WA 4D8PB 2VC2L 3AREB 5PAZA 1NGXB 5A7BA 1I1AA 1HZHL 2DI9A 5DS8A 1T6BX 5I1GL 2WXIA 2KUTA 3FFCD 3MUJA 4KFZC 1Q4NX 3FHQA 4L4VA 1WRFA 1D5MA 2PYEE 4JFOB 5DLLA 43C9A 3KW8A 3HVNA 4BK8A 1AVAA 5DA0B 1Q9WA 1KTKE 1K4CA 4LESA 3GLEA 4UT7L 4G6KH 1ACXA 1NL0L 4GAYB 1Z7JA 3SE8H 3IGKA 2CA4A 5BV7H 1TZOA 4W9IC 4S2SB 1JDDA 1HQ4B 1YEEH 3QIUD 3FTGA 2HVJA 2YJLA 1AHWC 1IC5L 1UVQA 4OZIA 4UQDA 4MNQA 1OAKH 4NYLB 1TTRA 1O9VA 3MV8A 4XHJC 3S35X 2DTMH 2JKWA 4FQJL 4JFYB 1OOAA 4KK6D 4QKTA 1ZANH 2DQIH 2OR9H 4DFHA 2Z6FA 2UV3A 4KI5C 3RUGF 3KXFA 4LNRA 3HE6B 2F5AH 1OOWA 3HUJA 1OPGH 3QUYA 1G94A 1FVCB 1QR1B 2VLKE 4EVNB 5CP3H 4QT5A 4NQED 1VA9A 1G5AA 1GGCL 3FQRB 1Y6KR 3E1ZA 1JVKA 5JW4Q 1E90A 2F8OA 2BRRL 2EDHA 3MBED 4K7PX 4P99A 5C8JB 1C7SA 5KSAB 2VJ8A 1FIEA 2AEWA 5D7IF 5FLUA 4QF1A 4L0ZA 2OMYB 4XH2B 4ALAL 1FGVH 1OAZH 3MYZA 5E1IA 3SDDA 5FDWA 3VWKC 3VGDA 4F3FB 5KS9B 3RGVA 1RZJC 3Q2VA 5KJRL 1OCZB 2FNBA 2MQ3A 4L37A 5BJTB 1UXLA 4ORZC 3N1PC 1SZNA 4M7LT 4PTUA 1AMYA 1Q1JL 4GI6A 3J2PA 2XTJE 5I6OA 1F6AB 1HOCB 4JM2C 5D5ME 3TV3L 4HXBH 3QR0A 3G08B 5LJYH 4XCNB 4QWWC 3BKCL 2A6IB 5I24A 3ZT5A 1F41A 4MVBC 1J5IA 1IMHC 1NIBA 3T5WA 3NIDF 1IM9B 1KCSL 3FUKA 4NPYB 4OJFL 4F2MB 5DHYA 3OKNA 1CLYH 3KJ6L 4GRMB 3MA9H 3ATAA 2NY3D 4G7YL 4IOFC 2V2WB 4OI7A 1MJ7H 4X7DC 3Q6FB 1F13A 4XMKL 3CZEA 3BPNB 2N0MA 4DT2A 1TJGL 3GIVA 3RX9A 4DEPB 3AT8A 1I1YB 4OIBA 3O2DH 1S9VA 1DL7H 4UM9A 4F1SA 2F58H 3ARFC 1FE8H 1KNOB 3N85H 4PJHF 2RB8A 4QXGH 4CUCA 3WEMA 2X6UA 4XC1L 1EAQA 1T5XA 3FUEA 3S5LG 4B96A 1F3JA 1TT6A 4M48H 3WN5B 4HOMA 1T21A 2CRZA 4KXZI 3U0TB 2DYRB 1VFOA 4R4BA 4N2FA 3BZFB 5BZDA 1P5UA 4PLOB 4NZFA 2CNYA 3GHEL 4OZFG 1J86A 2C9VA 2OXHB 5SV4A 5L2KD 1J5OL 3WHXB 3SDXB 3NJNA 5ID1A 1INQA 1MLCA 1IQDB 3RWIB 3I9AA 2D03H 4GW1B 3NZHL 4ZMOA 2YAMA 1ID5I 3ATBA 3X14A 3VRIA 1CFTA 3BH8B 4N8VA 3MRCB 2EUVA 4U1JB 4IK6A 5SWZD 3LN4A 1N3NA 3RTQC 4YH6A 3GS0A 5JYMA 1J0YA 1W72A 3BKML 3MRGB 1KYDA 2VZUA 3AFLA 3DPBA 4KH2A 3UAFA 2BHFA 3BVWA 4WI9A 2BFVL 2VL5B 3TIEA 3DOSB 3V7MA 1AGFA 4PYHA 4JY5H 1JYVA 3EFOB 4P2QD 3ML9A 5T1LD 4OV5A 1PD6A 5HPOA 2ZWKA 3M1CA 5F7MC 4A7TA 1W16A 4Z3JA 3IMSA 3AACA 3NBNA 3I50H 1ZLDA 1T3FA 2YQGA 1KCRL 1P6AB 1AP2B 2LGNA 3GJFH 4N2HA 1HHHA 3IDYC 1I1RA 4KJPD 4R26H 1AG6A 4N1CA 3CZNA 4M1GL 3EDEA 3DO7B 4LL1A 1ZS8A 4P5SA 2C9UA 3VXUD 2X4TB 3RNQB 4I48A 4NJAH 4LP8A 4URTB 2B59B 3GSNL 2GUOA 1NDMB 5F89B 5C1MB