2Y2YA

Oxidised form of e. coli csgc
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
95
structure length
95
Chain Sequence
b'SSQITFNTTQQGDMYTIIPEVTLTQSCLCRVQILSLREGSSGQSQTKQEKTLSLPANQPIALTKLSLNISPDDRVKIVVTVSDGQSLHLSQQWPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CURLI PRODUCTION PROTEIN CSGC
molecule tags Chaperone
source organism Escherichia coli o157\:h7 str. ec4115
publication title Atomic Resolution Insights Into Curli Fiber Biogenesis.
pubmed doi rcsb
total genus 11
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2010-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2420 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y2yA00
2N59A 2XSKA 2Y2TA 2Y2YA
chains in the Genus database with same CATH superfamily
1I3UA 2PW2B 3ZYOA 3IAGC 3WLBB 2BSTB 2LTQC 4HJGB 4B6ZA 5CUSH 2EDJA 4MLIA 3MRPA 4E5XA 1C9SA 3R0NA 4H8WL 1A1NB 2KC0A 2QL1A 4A7QA 4WKZA 2VR9A 4NZ8A 2IQ9L 4LKCB 3ZTJH 2X70B 1YLBB 4L8SA 4WNQB 2FO8A 1FNAA 3D30A 3QDGB 5EN3A 3RKPA 1GY1A 4NQUA 5EUOB 2J1KA 3RWEA 5HYSB 4LCWA 3DO7A 4F2FA 3BGFC 5JHDA 5ALBH 1I7ZA 2RTTA 3KCPA 3U2JA 4QHUA 4MJ4A 3FQ1A 5E4EB 1W9XA 3QIBB 2EACA 2Y6SD 4CC4A 4IOSA 3CSPA 5AVYB 3CFCL 3QIWD 2A6DB 1TZ8A 1R47A 2E4FA 2ZUVA 5D1XA 4JKWA 3II3A 3NIGE 2NLJA 5L4JA 3D0LB 5L8JB 4NO0D 1JNJA 3I50L 1J8HB 3H55A 3D18A 1TYJA 3N85H 1S7XA 3D18B 1Z5LB 2OZ4A 5GSRA 1J1XL 3HVNA 5DMKB 4KHXH 1A14L 3NRFA 5GGSY 3FB8B 1XEUA 3QWQB 2OL3H 2Y25A 2ZG3A 4M4PA 3ZTCC 4NUPA 1TENA 3CSYA 5ISZA 3RDTA 5IHUL 3RWEB 5HYSA 4YSSA 1MVUB 5JORB 2E5EA 4FFWD 4H2AA 5SV3A 5F7UA 4U3XA 1G94A 2K7QA 2YZ8A 2F7IA 5GGUA 4QHUB 5FB8A 1SMAA 4PRIE 4MMYA 3DYMA 5E1AB 3VI3A 5HVHC 3JT0A 1F41A 1U36A 2D9QB 1EHXA 1J10A 3OHXB 4MCYA 1MCDA 1KGYE 3L5XH 3MRMB 1FFOA 4NCC2 3I6KA 3BKJH 3LNEA 4RZKA 4N0CD 4ZSOA 2AQTA 1G9NL 4EUPB 2J20A 4L8DB 1JERA 2UVFA 4PJBB 4U1LB 5KYWA 3T0DA 2HG0A 3HE6B 4N90D 4BH8B 4NYLA 4QXUH 4LLVA 4JPSA 4N2MA 4JLRB 3ZRCC 3O6LL 1XGYL 4Y4HA 3Q8EA 1JK8B 2EINB 1LO4L 1OAXL 2M26A 4BFBD 4TSBH 3U7AA 1H0DA 1NDTA 1DSFH 2UY7A 1LEGB 2P24A 3T8MA 1I1AC 5JIKA 1BZ8A 3FOLA 4XP1H 2V8LA 5C7ZA 4X4KA 3GBNH 5BS0B 4U05A 1ZHNB 3S96A 1VRSA 3T0VA 5MEOA 1RLBA 2DQMA 3E80A 2XLLA 2NZ1A 1O7DC 3UP1A 2R2HB 3K71A 2GUOA 2DQTL 5B8CC 3DX7B 4Z7IA 1A6UL 2IBBA 1I4FA 3UMNA 2XNAA 4BKLA 3SY0A 3NSFA 3IDGA 4ZUSA 4EEEA 4RFEA 4BKLB 4X7TB 5CJQL 1XF4B 3SY0B 4KOCA 5C07E 3RIFF 4TNWF 3MJ8A 3QT2A 4MZ2A 1T66D 4HIJB 4JKMA 3TU6A 2D3LA 2OMYA 4WFFD 3QCVL 4LKXA 4YHIB 4EN2A 3BKMH 4LE8A 4PWGA 5I1IH 1NQBA 3WTUA 3K2UL 3APDA 1I7TB 1IC7H 2RR3A 1BVLB 1LK2A 4XGZA 4X0NA 3GMRA 1A8ZA 1F86A 2YR3A 1U8OA 4MNQB 3UADA 2J5LB 4EKJA 2GJ6D 2DQIH 4HPOH 4HCRL 5D7JA 2FLBT 5DGQA 1YJDC 3L3HB 4G11A 5D96C 2VISB 4NLAA 2QMJA 1UKTA 4PGZA 5I0VA 3AB0C 1WEJH 2X6AA 4CA4A 3IVKB 5C08B 3RJQB 3NOIA 3Q5TA 3IN0A 2B59B 5A2FA 4GP4B 1TLMA 2X5PA 2ICWJ 3LD8B 5E9NA 1ZRUA 1HHIA 3CXDH 4FXLA 4GSDL 4M8UA 3TIEB 4WCYH 4W9JC 2DLEA 5K9QI 4KY1H 1MCKA 3U46A 4BK8A 2WCGA 3ZKND 2BOBB 3DJZA 3ATEA 3BUIA 1CGXA 2WINA 3MRIB 4R6UA 5E6RB 3PCYA 2Y2TA 2G75B 2W81C 3QFJE 6PAZA 2VQ1A 4JGMA 1QZ1A 1A4KA 1GCYA 3OKMB 1CCZA 1U42A 2Q86A 2GT9A 5EO1B 5IJDC 1BF5A 2C9UA 4X8JA 4Z7QB 3DGGA 3B9VA 4GAYB 4K5PA 5DQ9A 2COVD 4LVEA 2NUPA 1FYTD 2CM6A 3MRHA 3VTAA 4LFHD 4DAGH 5HDQL 2YMXL 4YSRA 1I8KA 1SQ2N 2PYEB 4HQQH 2A6KA 1T4KB 2PCYA 5CR8A 1PD1A 1XEDA 4OZFB 1U8KA 5T1MB 4YBQD 3WELA 5GGSA 3D0VB 2X53A 3MSPA 2IFFH 3EHBC 3QUMB 1MPAL 4P2OA 1CTNA 1MFDH 2FBJH 4AVKA 1CE6A 4G8GE 4YC2B 5LBSL 3VXMB 4NNPL 1UADC 4ORZC 3G08A 3N40P 2J25A 3B43A 3ERXA 3M86A 1GPOL 2HKAA 3HUJF 3NCYP 4DEWA 2AK1H 3RPBA 3SEPA 5DZLA 3VFTB 4KKBD 1TT6A 3FTSA 4BUGA 1P7QD 1N12A 2UY6A 3VGFA 4WV1A 4OSUL 4J6RL 1CXFA 1UWEH 4HWZB 5I1IL 3FT2A 1DL7H 5K59E 1LO2H 4WW2F 2MCAA 1B3IA 3HRZA 4XVJH 3BLPX 1N6UA 4M62H 4OV5B 1PCXA 2XWBB 4MCZB 1SEBB 2CBTA 4N8VB 4X9FA 4FQHB 4LPTA 2N56A 4AOFA 5HYJD 1ZA3A 3FQUB 5FA3B 1R19A 4FQHA 2GEEA 1Q0XH 2QVKA 2IMNA 4YR6A 3A23A 4FG0A 5E9DB 2Y7QA 4G1EB 5KBKA 3A5VA 3O4LB 1IIIA 2Q3AA 1T1ZB 2F1EA 1ZLUK 1ZHKB 1A0QH 2X4NA 5CXPA 4PS4H 1DBJH 5AOJA 1NC2A 2W95A 4RIRB 3PWNB 1GRWA 3QEGH 4NQVA 4ZTOH 4ES8A 1U8MB 3DRQB 3OLDA 1OAYL 4XVSL 5TF1H 4NBYB 1SY6L 5DD1H 4GOSA 2DEXX 1H6UA 1UEMA 1OLZA 5SX5H 2ZCKL 1XGPA 4MAYC 5AWNH 4QAMB 4IU3A 2XTSA 1AR1B 4JFZL 1JXFA 4WY7H 4BRVA 2V3DA 5ALBL 5DURD 3MV7E 2TRYA 4Q7DA 1KYDA 3E7JA 3U0TB 3O6KH 2XWDA 2A9NH 5HHMD 2GW5A 3LQAC 4JR9L 5ITFB 2BVUA 2DQGL 1I8LA 5BO1H 1U3NA 3W39A 1H8OA 1UGNA 2D31A 3QQ4B 4LCWD 1GC1C 2P8LB 3QXWA 1RUKL 3HE7B 4AXWA 1CIDA 4I18B 1EEYA 5HDQH 3RVTD 2UXVA 1G7JB 1SLVA 4PG9A 2O26U 2NR6A 3HG3A 4D9QD 1IMHC 1G9NH 3RKDD 3QIWB 4WW1B 3L13A 1A65A 2OS7A 3LPGA 3ZYJA 1JGUL 5E5UB 1UA3A 1RUQH 1U8MA 1ZDSA 4O4YH 4JO4L 2F1BA 1H8SA 4OCSL 2ENQA 2DWSA 1OCRB 5JW4Q 5C0FA 3QYNA 2Y7SA 4XMKH 3AADB 2R0WL 4QRTB 2PETA 2DQDH 3DMMA 4G59C 4QHMA 4R96A 1K8IB 3HN3A 1N19A 2CKBA 2UY7B 2A9CA 5FO9B 3SD2A 1N59B 1EO5A 3QO1A 4L8CB 3L3GA 2X05A 3PUCA 3SBWC 4BA0A 1N2RA 1E5ZA 2WYHA 4BK5A 4K2UH 4J23A 2DWEB 2X89D 3GS4A 4QRFA 1AHWB 4GH7B 5KOVC 1QBML 1A14H 1OF0A 4JM2C 5I1AB 5HHXH 2CSPA 3ILDA 4BCYA 4WUUE 3VJ6B 1SN2A 2OXGB 2XKNB 5FM5O 3LPFA 2VH5L 1WWBX 4M5YH 4Z9KB 1DHKA 2K4AA 4WI3A 2G30A 4PG9B 3U2SB 4RFEB 2D7NA 2Q3ZA 3IJSA 4GSUA 4AVHA 2GTZB 3CH1A 1JWSB 1DN0A 2WWOA 4KO9A 3FPXA 4MWFB 1ZE3C 1XGQB 2GBAA 4LZKA 5TH2A 5TE4L 3DVIA 4CDGC 3ULSB 3SY6A 2WBJD 4LLVB 1I53A 1KYFA 2UVEA 3QUMH 4HETA 4RISL 4CVXB 1F58L 3ASOB 3BAIA 1FL6A 2R1XA 4ZODA 4FXKB 5GRUH 3X14B 1KJMB 1OGAE 1IGIH 4CMMA 5BV7C 5ERWB 3GM0A 3TNMA 3NIFB 3DVGB 4P9HC 3O6FD 4I5BA 3TH4T 4BYHA 2R1YA 3KPSA 3SBRA 1IBGH 2N01B 4OTXL 5I1HL 1IGMH 1B6DA 3CFNA 4WHTB 4IYKA 2H32A 1C08A 4DKFH 4WTXA 4QOKD 5B3NA 3PGCB 2DLTA 4A39A 1BM3L 3G3LA 3VXOA 4Q9CA 2R8SH 4A37A 2Q3XA 3E3QC 4L4VB 4NQQA 2AJYL 2Z35A 4W4OA 5KJRH 5EO9A 4HS6B 3HC4L 2WQXA 1BG1A 3U4KA 3CK0L 1UD8A 3QFDA 3QRLA 3TJHD 3IFLH 3B2XA 1NBYB 2FT8A 1J0KA 4UDUA 1J0JA 2G75A 1GKEA 3C09B 4J3UA 4GW5B 1F18A 3ES6B 1AGCB 1R3IL 1A9VA 1J48A 3W11C 2V5RA 4DSYA 1RZ8A 4DEUA 5I75C 4DCQA 5DFWH 3H3BC 4MQXD 1A0QL 4OIAA 1V7MH 4JDTH 4N0UA 4Y5XA 3RIKA 3VI4A 1SDAB 4BKTC 3D12B 3QQ3B 3O0RH 2NY5H 3A21A 2YD9A 3I2CH 4CC0A 2AFNA 3EJSA 3RDJA 4H4NA 4CU7A 3AMKA 2HFFA 3LPOA 3RUGE 2VISA 2WWKO 3BAEL 1JWMA 3L3DB 1N3NA 3TN0D 2JIXA 2FJFA 3QIUB 1DQDH 2TAAA 5DQJB 3HNVH 4M5ZL 2VRKA 2AAVA 3MCKB 3CVHA 5IJVB 4HC1A 4C4KO 1EJOH 1BBJA 4NQEA 5E94A 3P54A 2Z7WA 4WLCA 4RQQB 2QKSA 4QRPB 3KLLA 4PJXB 3ZO9A 1TYRA 5BRZE 1A1OA 1F1DA 2ZX5A 4HPYL 4KROD 1KPVA 1U8NB 4NUGH 3GLDA 3T0WA 2PPFA 3IJHA 4IS6A 4UM8B 3V4VA 5F9OL 3BRGC 2APVA 3H9SE 2HVJA 1U8OB 2BW4A 4TUKH 3VFRA 1DQML 2BSSA 4HUUB 2JCCF 4UT7L 3RVVC 2CG9X 1SOSA 2RACA 5A40E 4GAGL 4K94C 1KJVB 2L7QA 3MRDA 1MRDH 1O5PA 2M8XA 5E6IB 2C7UA 2QTEA 1F4YL 4BELD 1BFSA 3AXLB 3QO0B 3KEHA 3ML8A 1IEAB 2BIPA 3LZFL 3MI6A 4MA8L 1C16A 3RPIA 2XZQL 2XIIA 4XNYH 4R7NB 4P23B 2DQHL 4K73A 1V5JA 4TKWA 5BV7L 2JIXB 4U49A 4AGMA 3APMA 2DMKA 5KYNA 5FA3A 4QHKI 1YMHA 1V27A 4JFXB 4PUBH 2VSKB 4TUOA 4U1HB 2H6PB 2X4QB 3FB7B 1KV3A 1B90A 1OTTD 4JJOA 1P5VB 4L3CB 1NLDL 2KLSA 1NGPL 2YD0A 3I84A 2VDMH 2DWDB 2OXHB 4MJID 1OTUD 4JCLA 1A1OB 4GSRA 1SRDA 4XPFH 3AG4B 3UZEA 1GMIA 1OWWA 3CPLB 1J8KA 2JTDA 3PWPD 3HC3L 3QPKA 5ACZA 3UPRB 3AQXA 2WZPD 5FO7A 1FLRH 2PWDA 3CBRA 4JFFE 3RX5A 3VFRB 3UTZA 3ISYA 2IPTL 3KLAA 5SV4A 2CUMA 3SDCB 3ECQA 2A99A 2OSYA 4ZMVA 1JZHA 4DP0X 3WTTA 1WF5A 3IJYA 1VB9A 3VGAB 1C16B 1H3UA 3F2LA 3RPIB 1S78D 1BZ9B 4KO7A 3QZNA 1ET8A 5DZAA 3DXAB 4UNTA 3RNQA 4P5TA 1S9KC 2XN9B 1ZS8B 5D1QA 3MAWA 2X7LB 4BK4A 2AQNA 4MD5B 5C0JA 3SCMC 5IREA 1PPIA 1QUNA 4F9PA 3IB4A 4UMSA 3BRFA 3GSOA 4PBWD 4QXUL 4EQ2A 3S97C 3DVNB 5AZUA 1TTGA 3BP4B 1OE1A 3GD1C 4JO3H 2Y23A 3P30H 1RIUL 5F9JA 3AITA 4IIQC 4PRNB 1YAIA 1RV6X 1BF2A 3GO1H 3N1PC 2WZ6A 3R7QA 2QBWA 3MYJB 1DJSA 3OF6A 1QFPA 5MEPB 3WD5L 5CGYC 3ZVVA 2H1PL 3S8WA 3HNSL 5I6NA 1W2KT 1F90L 2FJGB 2HT4C 3PWLB 3HB3D 3FO1B 3GXDA 4YZFE 1P4IL 4BRJA 5DJXB 3ZYZA 4N8VG 4NAJA 5F7YC 1GAFL 2OA9A 3L95B 4KKZA 5DD1L 3QYMA 2MKWA 3HRZB 1S9YB 2IWGA 2VLKD 4QT5B 1ZXKA 2A2QT 5D5MF 5JA9A 1CT8A 4GBXB 1N5AB 5I18L 1F00I 4Y9EA 5AVSB 2XWZA 2Y1ZA 5E7FA 2Z0UA 5CSBA 4YFEA 2ZSVB 2XN9A 1KEML 3BEVB 4FOMA 5CLWA 1EAPA 1EFXB 2NSQA 4M5YL 5I15H 1EVUA 1TFHA 1L9OA 5EU3A 2DW5A 4QXVA 4Z7UE 4I88A 2EEFA 1KGUA 4KKCD 4QRRD 5I8CA 2VZVA 4P4KC 2FYYA 4NENA 4EI5D 3UG5A 1F42A 1FSKB 2F19H 3BW9A 1NLBL 4BGDA 3N41F 3ZDYB 5IHWA 2ZCHH 2YZ1A 2DOCA 3DTUB 3EYFB 1UWYA 2YKKA 3MMEB 1XDTT 4DGUA 4O51B 1XF2B 3GYRA 1E4HA 4Y4KD 4DGYL 2AABL 3O9WB 5EBGA 4JFYB 2Z7ZA 4RGMC 1HKLH 2KLRA 4R9HA 3D9AL 2IXQB 3PG2A 2JXMB 3HZMA 2X88A 2JKJA 3DETD 3EGXB 4FAAB 5B21A 4GUQA 5EEWA 1FNLA 2VLJE 4FQIL 4Z8FL 4ZPVB 1A3LH 1S9YA 3GT6A 3A24A 4HJ0D 5DC2A 5C0GA 5C71A 3UJJL 2R7EB 1SGKA 5ETUA 2DWEA 4LCYA 4GRLA 3SPVA 5JQHC 1TJMA 4LCYB 4W9KC 2AQ1A 1HDMB 3LRKA 3WKML 1X7SA 2R8SL 1Q94A 1YJDL 2AK4B 1M6UA 3GFUA 5KS9A 5CEZD 1O6VA 3NCBB 4KK8C 1ADQA 1CZ8H 1WCBA 3LEYH 3O3BA 1OANA 3CK0H 2C9AA 2MFNA 2YSTA 3IFOB 3N1GC 1K5NA 1E9PB 5H4YA 1SXNA 2BK8A 2W65B 1MQ8A 3LTVA 4OQTH 4U6TA 5KOMC 1T7WA 1KC5L 1I3RB 3OX8B 2VDKH 1MFMA 3DXAD 1E50A 4P46C 3HPJA 5TDPB 2OK0L 4KKBC 3PJSA 4LVNB 3HMWL 4BFIA 4F9LA 1T89C 5F7BA 4DZ8B 2A74B 2VN4A 3J27A 4KFZC 4AC2A 5E4EC 4XB3A 4PJCE 5KBNC 5CBEA 1ZLWK 2BVPB 4OTXH 2IANB 1DBAL 1YA5A 3CFIC 4HHAA 4XHQA 3CVIL 5EU5A 1LO5B 2VDML 3FQNA 3UAAA 3MV9E 3LKNA 1UJ3A 3DX2A 5EB9A 2YD1A 4LCCB 6FABL 4UTBA 3OR7A 1UJ3B 4KH2A 2CNYA 2D7TH 4AL8H 1X7QB 3O2DH 4M8QA 2WJ7A 1HJBC 2IDSA 4OFDA 1KEGH 2VIRB 1AG6A 3BP6A 5B3SB 2PKDA 5LN4A 3TO4D 4E9SA 2WPGA 5I2IA 1T5WA 4CADA 4MTMA 3ZDXE 2R69A 1LJMA 3R7RA 3OD3A 4LVNC 1INQB 1NCBH 2X9YA 4FEIA 2F68X 1QSEB 3D87B 4MB1A 4FI8A 3FQTA 4N2EA 5FO2A 1DDHB 2WCSA 5KYXA 5EOTA 4B50A 3S0PA 4JM2F 4IIQA 4MXVF 2V17H 5I74C 4UQBA 2ISDA 2Q7NA 4NWTL 3RY5A 4QRQB 4TQIA 4FZ8H 1E2ZA 5AB9A 2GG1A 3SPJA 5FEBA 2HLFD 1MFEL 3V0FA 3A4AA 3WTYA 2RFXB 5DFVD 3BVNA 1KJVA 3RTQC 3V7AG 2X44D 2DQUL 1ETZA 4GIOA 3UC2A 1WWWX 2ADJB 2NPLX 4PR5B 2WSDA 4KK9C 3VB9A 4UQIM 4OFIA 4GKLA 1UH3A 5D4HA 2L7EA 1A1MB 3LX9A 2V4LA 5E0FA 1GTFA 3BPCB 3GKWL 5I8OH 2PYFA 3O9WC 4PJ9C 4M7LL 4OV6F 3LRLA 1YQ2A 5LGJB 3GLEA 3L6FB 1VGKA 1KTLB 4YK4C 1W0VB 4YDKL 1OY3B 4K9EC 5GS1A 2NX5D 2HZHA 1AZZC 3EFFA 4J5VA 3SD5A 2IGFH 2IQ9H 5HYQA 2NX5B 4OLYL 5HYQB 4ORGB 2H41A 2FX7H 3DO3A 4NO5B 5K5YA 4YVUA 5JPNA 4BWTA 1CG9B 1A4KB 4RX4A 2G3MA 4UQ3A 1Z3RA 3C08L 4YQXH 4YWGH 1XGTB 4W4NA 3EUUA 5FUCE 2D3NA 3DSFH 3ZE1E 2JLPA 4PJ7A 4HEME 2ADGA 3T3MB 1XH0A 4LOVA 1O7DE 3HHRB 2J43A 2EXSA 3SE8H 4H20H 3D8MA 3NSDA 3GB7B 1RUPL 5D7IF 5DMJB 3N85L 2MOQA 3DJRA 1JV2B 4KJQD 4LVHB 5CBAB 3MV11 4W9IC 4IRSA 1GW0A 2VXQA 3TEYA 3Q2WA 5GRUL 3OZ9H 2NDFA 1OZUA 3EH3B 5DQDL 3EFOB 2EDWA 1WA0X 4NKMA 4ELME 2O6FA 4KHTH 1OTSD 1PZAA 4JGJA 1UM5H 4HCFA 3T3PE 2VDPH 5D1XB 5FV2A 1OP5K 1OOAA 5FK9A 4MAZA 1X5GA 4KDTA 2Z92A 1T0MA 4POZC 1X5IA 1F90H 3JZYA 3OXRB 4N0UE 3VI4E 3CIQA 3WL9B 4G8GD 1XF1A 4KMLB 3OJDB 3RLSA 4Y9CA 5GSRB 3BAYA 4OLWL 1S7QA 2BWQA 4XNMA 2DM3A 3ARBB 3HS9A 2W9DH 2A6JA 1CDUA 4PVNA 4FADA 1LO0H 3K0WA 4A6YL 2HRPL 5IFAL 4G8IA 3HI6L 1KTRL 2R0LH 5F9WC 3TBVB 1I7ZB 1YPZE 1SJEB 4AKPA 4KQ3H 3OXSA 3QQDB 3PWJB 5IFJB 5BRQA 5E1QA 3KDMA 1R3JB 2G5UA 1JZIA 4ZZFA 4JRYA 4HFUL 3RNKA 3IJ7A 4KKNA 2YPKB 3DDFA 2WYZA 3F01A 3FH5A 4CC4C 1P5VA 3O6MH 3RVXD 1BYNA 2Z7UA 1DQVA 4RAVB 3DYOA 5DMIH 1JK9B 4AQOA 3O41B 4DO4A 4HEPA 3D3VE 1UM4L 3PV6A 1YEIH 2VZUA 3H9ZA 4XOCA 4XWOD 4KI5D 2KLTA 2Z92B 3CV5A 4NQDE 3GJEB 2C3WA 3L3IA 3OM3B 1QSVA 4NT6B 2XPGA 4PRHE 1L0QA 1SVZA 3ASWA 3ARBC 4LEXL 4NT6A 4RGOH 1MJ8L 4PJAF 2HTLC 1DQQB 1OT1A 2VLLB 4R7DB 1FJ1B 1RI8A 2J73A 5D9SA 3SDCA 3ABLB 4FL4C 3L4WA 1DVFA 3GMNA 3C60B 3WD5H 5KSAC 3BC9A 5I6XB 2NTFB 2A7BA 4M7ZB 4Y5YC 3NAAH 4HJIA 2E75C 3UBHA 3TTSA 1MRCL 3ESOA 2VERA 3O4LD 4EUPH 1QSFA 5JLZB 3PWPA 2OMXA 3ZPDA 5KTEH 3IJ8A 4X6EB 5ALCL 4IBWA 5T3ZE 1H5BB 5C7XH 4LPVA 3QULB 3VFPB 2F53B 3G04A 4JPIA 2G3ZA 1DQTA 3MV8A 3CZEA 4K7PY 4HIHB 3QS2A 3P2BA 1CFVH 4A2EA 5FFLA 2P8MA 1UZ6E 4DP9X 3T3MF 4HG4J 1ZJBA 5F1SA 4KK5C 4PCKA 1AGFB 2B3RA 4KK6C 3TV3H 4F93B 5L2KD 4XBMA 1A6VL 1WICA 5IHLB 2UV3A 5I1CH 4EOWL 1OM3H 3FSZA 3ARDA 3AFLA 3OKOB 3MJ9H 2ZOOA 4MNQA 2P5ED 3QZLA 2X3AA 4M7KH 3QCTL 2BINA 4DEPC 4QT5A 5E9DE 1FNEB 2OMWA 1H6EA 1ILSA 3HI1A 3HNVL 3HPLB 2UUDH 1CLOL 1ODAA 1U8QA 4OLWH 5C0EA 3PL6B 5DFVC 2N1TE 1XH3B 2WVTA 3R4RA 1P2CA 2CO6A 5GRWA 4HJEA 3M46A 1I82A 4PG2C 4MJIE 2OYPA 3QXDB 1PY4A 3ABMB 4MMZB 3LRSB 4HXAL 4ZTPH 3B9KC 3HMWH 4KROC 5TGBA 3I6LD 3DHUA 3MJ7B 4X9BA 3V5KA 4FA7B 1ACXA 3HLAB 3RUGF 3V4PB 3CU1A 4CN4A 3FOMB 5B1JC 4WK2B 3MOQA 3VWJB 3CZLA 4N6RA 1ZHLB 3GI9H 1JHTA 2X0VA 4G6JH 4UCFA 4N6RB 2BDNH 4F24A 3PHOA 1T04B 5JUEH 4G1MB 5A3ID 2NY1B 2CO3A 3H9HA 1H6TA 4X4ZA 3F12B 3H85A 2HSIA 3O2DA 3K6IA 4XN1A 1R3KB 1BZQK 5I1GL 3N0AA 2NY3D 3PL6A 1WBZA 1NPNA 4MA1B 5E4OA 3UG4A 3IXAB 3HMXH 3JWDC 3FUMA 5FLVA 5DHDA 1W6LA 4PR5A 1PTZA 4AGNA 5HY9A 4JJ5A 3K46A 5SX5K 1R5IB 3EOYG 3SDDC 4AENA 3FRPG 1SOQA 3LN4A 5I1KH 4KKAC 4WW2B 3G6DL 1MWAB 2FHFA 2FO1A 3N44B 1FGVL 3BPCA 2VM9A 5E6ZA 3RYMA 1A6TB 3E6HA 1IX2A 4PV1C 1NAML 2FJHB 3EH4B 2YA0A 3L6FA 2Z64C 2WTOA 1KBPA 3QXTA 4KZDH 4AM0B 3AAZB 4IRJA 1E8WA 3O3EA 5IG7A 4OZIF 3AQYA 1MFEH 3L4TA 4TM9A 4F7KA 4Z3HA 1KB9K 5BOJA 2MQ0A 5EA0L 5BZDA 4QTFA 3F5WB 1KYUA 5EV7A 1NGXA 1WJ3A 1B4LA 3W2DL 3PDGA 4FFZH 3QIUD 4G6ML 4DCQB 2VWEE 5JXEC 1BF8A 4PTUB 3MV9A 1JPTL 3IFNH 3IXTB 1H5BC 3PV7A 2RFXA 3C2AL 2A6KB 3PDOB 1U8IA 4HKZB 3ULUC 3O6FC 1M53A 2LHAA 4LSVL 4MCZA 2X6BA 2X1OA 4N8VA 4HCRH 5IB1A 4BEIA 3TYFB 1LEIB 1QEWA 2QVTA 4ZZKA 4LQ1A 5I66A 5ANHA 4YDMA 4XO3A 2QVMA 2ICWA 1OAYH 4FCHA 1JGEB 1KY6A 1OT2A 2Z0BA 3K4DA 3SKJH 3W1ZA 1LK3L 4KRLB 5BMFH 1HEJC 1QLRB 2BZDA 4G7RB 3C5JB 5E8NA 1S3RA 4DPBX 2MEJB 4JFFB 4X5XB 4KXZH 2Q6WB 5L0QB 5CAYB 3U0WL 1ONQA 4APXA 1QFWM 4WEUD 1A9EA 3LKSA 2H0EA 4JQIA 1CK0H 3GJFA 1WWCA 4NO5A 4DP2X 1JI1A 5F96L 5F7NC 1FH5L 4NXKA 3FDWA 5ECJE 1IT9L 3MRRA 2XBZA 2B3IA 1IGTA 1ETZB 1JFHA 1M05A 3B1UA 4N4YB 4GS7B 1NL0L 3TBVA 3GSQB 1KLGA 3F58H 1KYAA 1KB3A 4M1GH 3UXFA 2CD0A 4F8OA 1A7QL 4I0CC 1JGDA 3QXAA 1DSFL 2YS4A 1Q8MA 4X9GA 5J1TC 3E1ZA 4ZUUA 2Q8AH 5DD3L 3S98A 4W70A 4JHWH 3NCXA 4UUJB 4NKMB 4NQVB 1TETH 1YUHA 5AB1A 1ID2A 4GXUM 1KT2A 2BNRB 3CZUB 4Z7VE 5I17A 2FBJL 3GMLA 2HH0L 3SGEH 3EZ8A 3BHBA 5HDBF 2Q6WA 1PZUB 3B9DA 4PV8A 5H94A 3C6EA 1LVEA 1J8HD 2EYSA 4OZHB 1NFDF 1Q72L 2CU9A 4XBPB 3OF6D 3LNFA 2FQFA 3KXFE 4F15C 4GXVH 2N1KA 1KBKA 1KPRA 3KLSA 1CGTA 3OLEA 5EF0A 2IGLA 4AIOA 2WIIB 1TTAA 4PWKA 4A2GA 3RA7H 5T5FH 1DSWA 4PJFE 4UDTA 5EMYA 5FDWB 3E8UL 2IPUG 2F7OA 1Z5HA 4QRRB 1T7YA 1VACA 1N4XH 2VLRA 1L5GA 3ZL4L 3I9AA 4FULA 3V6FB 2Y1AA 1NCDL 1SFDA 3GNMH 4FABH 3W9DB 4AW4A 1HFUA 1U92B 2NT0A 4N90E 1GA2A 5JW3L 2BCKB 1W72B 1AQDB 4Q9RH 4WQOA 2B1AH 2F53A 2ZWKA 1OP3K 4R4NC 5DC0A 1BJ1J 3T2QA 1OB1B 3CCHB 3C6LB 1N8ZB 4PY8J 3HB3B 5DLMH 5C2BH 2Z3FA 3HE6A 4QR7A 4D2NA 1NDGB 3U83A 3UG3A 2F5AL 3AQDA 2E8YA 3KYKL 4YL9A 1JNLH 3TBSA 3ZKQD 4LIQE 4P5SA 3WMPA 5IKCA 5MHSD 2HYMA 4K3DH 5CJXA 2IH8A 1GHFH 5FKAB 2LAGB 4FG6D 5EU4B 4HCGA 3N1MC 4PJ9B 1UTDA 4JBSA 4KTGA 2BZ7A 3IKKA 1FJ1A 4GQRA 5ISZB 3VD3A 2F0CA 4K2UL 3O8XC 3DX1A 1SYVA 3AWFA 5F7EL 3DWTA 3HI6H 1PIFA 4AE0A 4LO9A 2HX7A 4OF6A 4GEJA 5AW2B 4YX2L 1YYLH 1U8QB 4DKEL 4X9YA 4ZQTA 2LU3A 43C9B 1CLZH 2CBOA 1QVOB 1JD7A 4CRPA 3LNGA 4O02A 3UABA 1T22A 4GI8A 3J2PA 2NXYC 3MV8B 4HMEA 3QGVA 4DKDC 4YGVB 4NM8L 2GJ6E 1ZA6B 2IGTA 3GJEA 4JM4H 4Y4HB 5FHAL 4QWWC 3FT9A 3JWNE 2JLLA 4IJ3C 2AGJH 1AGDA 2GSMB 5FOBA 4ETYA 5GISL 4YUEH 2K9FB 4CVWA 1X5XA 2K7PA 2R2BB 5HYJE 4LF3B 4HHGA 2J88L 1ZHBA 2NXZB 3NZ8B 5KBMA 1OGAA 3AZUA 3RTQD 1QPPA 5AQ0A 1LILA 3IS1X 3NZ8A 5I71C 3AY4C 4YHLH 5CP7A 2BIHA 3VXRE 1QHPA 2V9TA 2Z6FA 3FRUB 1EEZB 5GGUB 2BWIA 2FO4B 2FD6H 2GB2A 1FVDB 1N8OE 5BXFB 3BP5B 2IC2A 4JG9A 3WKNA 4P2CG 4QXTB 3VXPB 3QIUC 1KTDA 3SYAA 5F96H 3MNZB 4XX5A 4MQ7B 4ZW8A 5EO9B 2WQUA 4K07A 3RUGA 4E41B 2J8UF 4DGWC 3NJMA 1XF4A 2OYMA 1PNCA 3II1A 5L4IA 2NYZA 4FZEL 5DJCA 5LG1A 1ZA6A 2Z1KA 4N8CH 2UXFA 4AUJA 2QPUA 1OAZL 4EBQH 4WSGA 2Y2YA 3ZKNC 3IGAA 4N1EA 2J1XA 4XGZB 1PL3A 3LMJH 1HHHB 3N55A 1ZLWH 4J8QA 4G3YL 2CXGA 2VJ8A 4UBDD 1EHNA 5IQ9A 2NSMA 1C5DA 4MA8H 3RGVC 4X8XA 1X4XA 2XXMB 1AQMA 1JAEA 4QIRA 4HIQA 3WDHA 1IFHL 4K3DL 1BPLB 3ARFA 5E6IA 2GVYA 1B0IA 4GG6A 4PP1C 2PR9A 1CXKA 3WS6A 1N3NB 2GKIA 2J8UB 1GIGH 4DGVH 4L3ED 4FE9A 1I4FB 4OCRL 4PJGA 1IBGL 1JYVA 2G2RB 4GW1A 3LKPA 4YHML 2QR0B 1BWWA 3MV9D 3AGVA 4L8SC 5IJVA 1MFCH 1DQDL 4K7PH 4TNEA 1U6AH 4UNIA 4PBXA 4D9RE 1BZ7A 2ZUYA 4HVBA 1ED3A 4J6IA 4AQ8C 4F1ZA 4NQEE 3J07A 1VERA 1HI6A 3RWGB 1EA9C 3UO8B 1EJ8A 2XVLA 3QORD 5IW6B 1BW8A 1UVQB 5BRZA 3US1A 3VRJB 2BNQA 3BVDB 3OMIB 2VQ1B 5DUML 4OLZH 1ETB1 3P9LB 1ZOXA 4Z23A 3EKCA 2WUBL 2UZIH 4TTDD 1JPFB 1D7CA 4HCIA 2EDNA 4POYA 2UWEE 3KGSA 3UTTD 2KQNA 3GXNA 4R2GB 3FU9A 1T20B 2WZ0A 4LSUH 3UBXB 1CD1A 5DMGC 4QRQA 1OSZB 2J2ZB 6TAAA 3OWEA 4PJFA 1IEAA 1PJWA 5D7JD 5DQ9B 3VQMA 4FKEA 3DX9B 4YIQA 1SNRA 2JKLA 1BQLH 2CO7B 1GGIH 1P9MA 3E9UA 1T4KA 2DDQL 3LZNA 4FQQA 2C8NA 2HRLA 1X5JA 4YHLL 1PY9A 4M8RA 1O9ZA 3O3AA 2XN1A 1WZ1H 2C9PA 1DTUA 3CJJA 5AVWB 4KI5C 2R69L 4EDXB 3H2WA 4XVSH 5TF1L 1J05B 2FD6L 5FYLE 3SGKC 5J56B 1TETL 2GJPA 2QMKA 4FQ1H 4L8BA 3WKMH 3S2AA 2FRGP 3VXMA 1TZAA 5C07D 2MCG1 1GGCH 2I24N 1RZFH 4JPVL 5H35B 4AH2A 4K3GA 3EYSL 2OR7A 3PP3K 1A3QA 1NUFA 5K9KB 2NY0C 3EZJB 3EFFB 4LASH 2IPTH 4JFFA 4X5XA 3CDGB 3F00A 1WZAA 3PWLA 2PO6A 3GHPA 3DSNB 5I30H 5IMMA 4B60A 2Z93A 3TL5A 3P3YA 1CE1L 3BIAX 1OVZA 1Q9KB 3O6LH 1T2QH 4DUVA 2Z65C 4LLWA 3MRHB 4JFPB 1IKNA 1P4LB 4ZOBA 1AVAA 2ATKA 3QDJE 3VDAA 3AXHA 2WQWA 4OJEH 1MG3C 2NY0D 4N26A 1ZTMA 2RALA 3H54A 1JF6A 3MR9B 4MS8D 3T6ZA 4P5TC 1F97A 4KNQA 1H9VA 5I9QB 1AACA 1Z5YD 1FZJB 3QUYA 1FFRA 3S9DB 5FW8A 1RHHB 1WE5A 3TBYA 2P8PB 1MQKH 5AOIA 5I1DA 1M3IA 1M71B 1MY5A 1H15A 3O45A 2OW7A 4DGYH 3FUNA 1BQHB 4EOWH 4IOSD 5C0RH 3CC5A 1E6JH 5CINH 5DJ2A 3V7MA 3OC8A 1OSPH 4HA1A 4XNQB 3FH7A 3KYKH 4UV7L 4OCNC 1ORSA 4ZQKB 1NAKL 5IEKA 4RNRA 3SQBA 2EEXA 4ZQKA 2DQ6A 5FUCC 3VI3F 1NCBL 5JMRA 1FAKT 4U6VH 4Y4KA 2W59A 2ZKXA 1MHHB 4XC1H 4DK6A 1ZSHA 4GSQA 4XOBA 2Y69B 4FG4A 2NXYB 2ZXGA 4NKDB 3IDMB 4YO0B 1W91A 3QCUH 3WO4C 3ZN6A 5CGMA 4HLZG 2OULB 3ECBA 5ISZE 4FXTA 3PGFL 2ICEB 3WN5C 1Y6NR 1E40A 3CDZB 4FKKA 4HXBH 3UZEC 2BPBA 3U79A 3DX6B 3EJZC 3OAZH 5BZXA 3MCLL 4JGNA 1R3JA 3KPRD 4H1LG 4MMZC 5E8OB 1DBAH 1HL9A 4QLRA 4YN3A 5I76B 2X9XA 4IBQA 4LLAA 3W3BA 1JTPA 4I18A 1KENL 3WIIL 1HWHB 2NXZD 2Y5EA 3U48A 1EEUA 3K2KA 3NH7H 3I6KB 2BY3A 2IQAA 2YPLA 4J3OC 5C6PB 3QIWA 4WW1A 4I3RH 4HKBB 4A7TA 2JKSA 5I1JH 3DI2B 3ZU8A 1IGYB 2DYPA 2KI6A 4YE4H 5AAWC 1KGCE 4GAAA 1FRGL 1D5XB 3PJSB 4PJEE 3EAKA 1G0DA 4YDJA 4PJDB 3AT0A 3PQYD 4OD2B 5E99H 4WHCA 5AVRB 2XFGB 1Q4NX 4YHZH 3EJYC 5AOLA 2J4WL 4FFZA 1FO0L 5L8LB 4Z3GA 4W6YB 1CJYA 3KBHE 3MU3A 5C0GB 2X70A 3MBED 4FERA 4L8SB 4WNQA 3U6XS 3IM1A 2GK2A 3ESPA 2WWMC 5KUMA 3GMNB 1F6LL 4O02H 5AD0B 1BGXL 1SYSB 4JE4B 4L1TA 3DECA 5E9DD 3GIZH 1AXIB 3SN6N 4JKNA 4MYPA 2APBA 4NQSA 1NGPH 1DLHB 3RPKA 5BVPL 4OLEA 3ARGC 4H5SB 2UZPA 1OXYA 2VC2B 3WKYA 1OARH 4HEPG 1SXAA 1DCLA 4EZLA 4IRJC 4QHPA 1WGOA 1D7DA 5MENB 4YZWA 4F2EA 2DQJH 1CFBA 3BEWA 1ZV2A 4C55A 4E41A 4KZEH 5EU7E 2AXHA 3FHAA 3D4ZA 1GJWA 4OB5H 3GMOB 2QZQA 1OPOA 4Y2LA 1MHCB 1BQSA 1PQZA 2FQDA 2HJKB 3WFDL 1J0ZA 3MRBB 4JRWA 2W9EL 4NPYA 4UTBH 3FUJA 1CFNB 4KHTL 1CDGA 2IANA 1JHLH 1JK8A 5DURB 5IVXA 5J6GA 1BVNP 1LTXA 3HBQA 1GOFA 4UV7H 4GIAA 4M9OA 4NHCH 3MNWA 3MRQB 4FQCH 4CU6A 3BP7B 4ODTL 3E0GA 1YG9A 3ULUE 2YN5A 5HI5D 3GSXA 2J8UA 4Y8AA 5CIPA 2P47B 3L1GA 1A1MA 1BIHA 3QQNA 3LKPB 3NJVA 4OKVB 1UQSA 5DZNA 4RFOL 1J9QA 2PYFB 1JWSA 4K8RC 2O6EA 1FZKA 4PGEA 4E9QA 2WQ8A 3BESR 4HWEH 2EXWC 1P5UB 3F6LA 3FCBA 5D96B 5EFIA 4RQQA 5SWQA 3VMNA 1S3KH 4N28A 3QUKA 4YHKH 3M17A 4F7TA 4E68A 5IJBC 2A4ZA 3L5XL 1BQHG 5C0IB 3ATBA 1S8DA 1S7UB 2D7QA 4ALAH 1DVXA 1OGPA 1AP2A 2BP0A 2ZKYA 2IOIA 4AEIL 1RKRA 4I77H 3TJEH 2ENSA 1E3ZA 5I1EL 1VFBA 4X8JB 1WLHA 1RZKC 1MI5D 2B1OA 1IBFA 2QSVA 4OQ1A 3SJVB 1S7WB 2HFFB 2NUPB 1BXVA 3STBA 4RWHA 2H26B 3ILQC 4FMFA 5E6IC 3RWIA 3CN1A 3CGTA 4ANUA 3L4VA 5C08A 4UU9B 1BMGA 3S4SB 4X5WA 4B9ZA 1IM9D 1R17A 4WCYL 5I73C 4G42B 3C8KA 1QSZA 4P8QA 4F58H 1VGKB 3K4AA 1WFUA 2PPDA 3FU5A 3L5JA 2X4QA 5BO1L 4B7IA 4WWID 2CCWA 4MVBC 3GGWB 1TSRA 3W9EB 3FJTA 1U8NA 1Z2KA 3RWCB 5D93C 1CBVL 4W81A 4WHYG 3BUDA 4K8RL 2FUTA 3P0YH 5FS5A 3UC0L 5BRZB 5IGXH 4ORGA 1N6QL 1FGNH 4MNGE 3T4YB 4DHLA 4ZUTA 4P57A 2F9BT 3WL9A 1YY8A 1CTMA 4JM2D 3P77A 4FLHA 3I9GL 5I5MA 1QBLL 2BSDA 3NTCL 4L37B 4UM9B 1DEEA 1LGVA 1F13A 1UT9A 2EEAA 4ISVB 5DEFA 5FM4A 4WU7B 3L3HA 1S9XB 5E1HB 2ZP8A 4ISVA 3DHPA 5J3HD 4NUMA 2ZX9A 2YPVA 4OGAD 4M6NH 4WKXA 1YNLL 3DXAA 4XPAL 1OOWA 4LCIH 3IDYB 4APQA 1KJ3H 4IRSC 1FAIL 3EFOA 2RH0A 4HKJA 3MLVH 2DI8A 2W0PA 5SWZB 3IRZA 4M4RB 2PF6A 4JPKH 2Q7AA 4LHUB 1AY1L 3BPOB 3LVTA 1X5FA 2E7CA 3KS0H 4L3EA 5DD6B 5E51A 1ZVSA 3UPAA 2GCYA 3IMBA 2RGSA 4JG1H 4W9GC 1P1ZA 1X9LA 2YUZA 1XHHA 3MC0A 3Q44A 4ONHA 3CPLA 1DCEA 4I9WD 4Y9BA 3SQBB 3FFCE 2HJFA 2Y5TA 4K9EL 4OLVL 3BQUD 4P9HH 1MCIA 1S5HB 2YWZA 3BIKA 1Q90A 2B8OT 5LBVA 1J8HE 1BM7A 3T9WA 1WFMA 4AJYV 3M1BB 1EO8L 4PCTA 5HGDA 5F6IB 5T1KA 4GKZA 3V52L 2EKJA 3ZHLA 4BFOA 3MUY1 3FT2B 1JGVH 2IOMA 3NRPA 2FQEA 1JS4A 1FVCB 4PWEA 5IV2A 4R2GC 1ET5A 3KG5A 4TL4A 3VXNA 4MVBD 1CQYA 2NW3A 5IV2B 3HCVA 5F1IA 1JZ2A 1H3WM 4PB0H 7FABL 4MB5A 1BZEA 1F4WL 3GMQB 2NR6C 4YPJA 1AS6A 3ZL1A 1KENH 3WIIH 2NNFA 2WLZA 3RURA 1BFOA 4WFGD 4OCSH 3NSJA 4NENB 5EEUA 1JF5A 1WBYB 2AK4D 5DYFA 4U0QB 3DV4A 3D3VA 3CHPA 3E6FB 3P02A 4KKQA 5IESH 4NNXB 1JZEA 1P1ZB 1UJ3C 2YBRB 4JFQA 4Y2OA 1XF5B 5GJTH 4AVIA 5CEZH 4PRHA 1EXUA 4FGMA 4IMLA 5K9OB 4YAQA 4NO3B 3TCLB 3E9TA 2VLLA 2Y6TE 2ZYRA 3HC4H 4R7DA 4YDJB 4PJIF 5BS0D 1MCRA 4Y5VC 2H8PB 3WXWL 4JK0D 2DQFB 4XBPA 1MFCL 2ADFL 2LTQB 3QS3A 1I8IA 3K2IA 3QXUA 2Q1EA 2DWXA 3DX8B 5CEZE 4XC3H 4H8PA 2EXWD 3SOBL 3LS5H 2V2TB 3O6KL 1NH6A 1FCCA 1HHGA 3BAKA 5KVEH 3KXFD 4P05A 4XCCL 2JH2A 3BZFA 5AOZA 5KN5A 2OX5A 4YHOH 1N64L 1HH9A 5DGRA 4F8PA 4GP8B 3SQRA 3G5XA 4HALA 1NCNA 5D1XD 2NY5C 3P2TA 1H15B 3O45B 3RHWF 1EEYB 1MFBH 4YEEA 2EC9T 5DEGA 4WU5A 4GMSL 2H1LM 1EFXD 4HH9A 1DQLL 4CSPA 2Y2WA 1KJ3L 3V0EA 3WFEH 3RBSA 4HW6A 2OYLA 1NICA 3VFUB 3WE1A 2GFBA 2EH8L 3L5WA 4HULB 5HYJB 4XCYA 4OI9A 1RP9A 5DXWA 1G6RH 4JDZA 5HPMB 5B8CA 5CN1A 1Y0LA 4QRUB 2YO3A 2H2PC 2CRZA 5TE6L 4RBPK 2C3HA 4LLQA 1Y0LB 2FIRT 2BVPA 4QRUA 4ZK8A 3JVGC 5IM7A 1AXSB 4LP5A 4PJBF 4PJ9A 4YDLC 5J11C 3Q01A 2CDGA 3CLEL 4G72B 3LZOA 2WGXA 4BZ1H 3KH3A 4G5AA 1F45A 3U4EA 3CSYB 1TQVA 3FT4B 1KACB 3VRLF 5EORH 3QEQE 5I1AA 4JL1A 1N26A 1AHKA 2GSGA 5D72H 4IRJD 2FATH 5AW1B 2WP3T 3BUYA 5DRZB 5JPNC 1ZGLM 1Z9OA 5AVVB 2NY1C 3MFFB 1WG3A 2DQGH 3T04D 4HMDA 2BVYA 3IS0X 3T5WA 1R3LB 1RVFL 1IAKB 1NMBH 3LKRB 3WEBA 3MO1A 3ZZQA 3CE1A 4F7EB 3DV6B 4YMPA 5C7XL 2HG5B 3C5XA 3T0EC 4I2XE 5J6HB 1UZ8B 3RAJH 4YHPB 3SKOA 1IBYA 3BZ5A 1KY7A 3QQ9C 4HQQL 4HGWA 4OF7A 4CGUB 4G8AC 1E5CA 4M00A 4KROB 1U93B 4WI7A 1HH6B 4X6CE 4X80L 1WSST 4JDEB 2K45A 5DJ0B 4LT7A 4HGKC 3BAXA 3LEVH 4AYFA 1OP4A 5I1EH 1VFOA 3RZCB 4P5MA 5FF6B 2VDLB 3TESA 1SVCP 1R3KA 2E6JA 1TCRB 2Y7OA 3COOA 3FOLB 2VW7A 4N2BA 4GXFA 3VD1A 4K15A 4Y19B 4J12A 1E6OH 4KJPC 2XI9A 2BFVL 2UXTA 3MTXA 4MZIA 1BMZA 4YDIH 5BZZA 4DVRH 1KCVL 2XKNA 3SOTA 2J55A 1MFAL 1UM4H 4E9YA 1M57B 1DJHA 3OAUL 4JE0A 5FGCE 1BJ1H 4OLVH 3GZOA 2ZE0A 1MWAA 4UU9A 2F2HA 4PJAB 4PSRA 2WJ5A 3VA2C 4AMKH 3PQYE 1VFUA 3BUQA 3EJZD 1L6ZA 2NSXA 4CNIA 1WHOA 4PJHF 3T6QC 3PAVA 5CR1A 3U1SL 3TT3H 3GGWA 1G7HA 4MXVE 5J6HA 2IJ0C 3S3PA 1M1XA 4BUHA 3HRPA 4JFDE 3M7OA 4WFGE 3EOBB 3UTTE 3ZW3A 3LS4L 5F7FA 1YEFH 2H9GA 3FO2B 3HAEA 4YC2C 1XBRA 4YDNA 1Y6MR 2X4UB 3IAPA 1QI4A 2GUYA 2I07A 3OQRA 5E1GA 1AGCA 4MBRA 2DLIA 1IGFL 4ONFH 5KSAD 3TP4A 2JQMA 3B5TA 3BT2L 4FDWA 5I6MA 1BAFH 5EU6E 2B4CH 4JRLA 2IVFC 2ZXAA 3EJUA 3PDDA 2JJUA 1EUUA 2I5YH 1LD9A 1M6OA 1YY9D 1I1AD 2L7UA 1WAEA 4LSPH 3OB0H 4MNQD 4WHTA 4OZHF 3IDIA 2BSBA 3FONB 3QDJB 2MPAL 1YNLH 4M93C 2QKIA 3ULVH 1IKFH 2CGRL 2BW5A 1INDL 4M7ZC 1UJTA 3QC6X 4FYRA 2B1HH 5ESAA 1PAMA 4KV5F 2P5WD 3S35L 3VFVA 4U3SA 3VVWA 5GPRA 3ZE0F 4X5WB 4DTGL 2WXOA 2FEJA 2VXUL 4AQEB 3IPBA 3KEDA 2DQTH 1E65A 4ES9A 3RKDC 2P45B 3MV01 1BVZA 4KJYB 4N2CA 3FO9A 4R84A 2XKSA 3MLYH 32C2B 1TPXB 1KT2B 3QJZA 1E4XL 4YSOA 4MRBA 5JPMB 3SKMA 1AKJA 4Q9BA 3IJHB 4UM8A 1E5AA 1J87A 1TVBA 2R56H 4AGPA 4GS7C 3WLWC 4RAHA 2AHIA 5DS2A 2YPLD 1P1VA 4XNMB 5L8KB 3DGGB 4GAYA 3WEXB 1KJ2B 5JQ6H 3QIBC 4QO1A 4P0DA 2QLVB 4HWNA 5DEFB 4QOKA 1XGYH 2ARJQ 4IEFA 3JVGA 3SGEI 3VFOB 2V6HA 1QA9B 4P06A 4Y0GA 4JO4H 3MREB 1M9WA 3LSOA 3V55A 2CO2A 2IAMD 2CHNA 1OGSA 2BX5A 3QUGA 4E9TA 2EADA 4MHHI 1A9BB 1JTOA 3TEXA 2JKWA 1NFKA 4MQSB 1UKQA 1SDDA 3H1ZA 1JZJA 4PUBL 3BDYL 2BP8B 2OJEB 1D7FA 3QUML 4RISH 3FN0H 4X4XA 2XICA 2K9UA 4LSTL 4WUUB 2XCMC 2CK2A 1MJ8H 1MNUL 3ZE0E 4PJ5B 4ESKA 1K3ZA 1CFTB 2XSKA 1X9QA 1CF1A 1C5CH 3LCYA 1OAKH 3VXSB 3ALPA 1CYXA 3GUFA 1E2VA 3MCG1 3HNTH 2V5MA 1DVYA 5IKCB 4L0PB 4MDJA 3TWYA 4J3WA 2WVVA 5E70A 5AYUH 1G0YR 1FI8C 2DM2A 2WIIA 4PTTB 4NLHA 4P46A 2JQZA 3GF8A 4OGXH 2VN6A 5T3ZH 3VYPA 2EVHA 3C09C 1OE3A 3MLUL 3M1BA 5HGDB 3M1OA 2X09A 3LQMA 3WIAA 2ZTBA 4AE1A 4OUUB 1G5GA 4BFNA 2J7LA 3QUHA 1U92A 2DYSB 2WB1A 2FX8H 1AKPA 2QPEB 3OXSB 3ZGIA 4DT2A 2MNUA 1O9VA 4IW4C 1ZLSH 2FEEL 5AKTA 4OCYL 5IROA 4JRYB 3RNKB 5IQMA 4BA8A 5J89A 3BVWA 2YD7A 3R0MA 5DVPA 4R3SB 3N1FC 5IJCC 1OW0C 4OCMC 3CPUA 1RPKA 3GLAA 1EZVX 2AEIT 3QUZC 1A4AA 2O5ZL 3TVMA 1SLWA 5GSVA 4HFWB 1GY2A 3ZZ1A 5ADOL 5C0AD 4JFQB 5FKAA 2EDQA 1G6RL 5HJ3A 3O0RL 2BNUA 4DQOL 4ZOAA 4X9HA 5KS9F 1XIWA 2C4FT 1I9IL 5HVHB 1BVKA 2XWTB 3ARVA 1DQQA 4ZMPA 1FSKC 3EOTL 1EX0A 5IHBA 2ZUWA 2IADB 1ZSDB 4BINA 1PSKL 1CI3M 2VR5A 2P28B 2D0FA 1QEXA 2HVBA 5DYOB 4Q4EA 1CVRA 5B38A 3QWOB 2DS4A 3QUXC 3OKEB 1U3HA 3WJMB 2XV0A 4DZBA 5ITBH 1QUNB 4ODUA 4XCEA 1N70A 2XTJE 2WTRA 3MNMA 5DI8B 2DIBA 3WE6B 3ZKSD 3SBQA 5ISZD 2XDHA 5KVEL 4UZSA 2LR4A 1A6AB 3CFDA 4PQXA 4U3HA 4U4IA 4YGVA 2Z31D 5KANG 4FFZL 1J8RA 1TTRA 5MP6H 2J8OA 3Q2LA 4W6WB 3CZKA 3L3IB 1RIHL 2ZKMX 3NFSH 4JZNA 4M5SA 1I3RA 3HLAA 2QPSA 5FW6A 1U8LA 5TDPA 3U82B 1GJUA 5J5EA 1AGFA 3LB6D 1DJGA 2G2NA 3JYBA 4PMEA 4DZ8A 4M56A 3I6GA 4PP1D 4UANA 1FZMB 2ETWA 5C09E 4JFTA 2VO5A 1TZHA 5CS7A 4BWWA 2WSPA 2WXJA 1ETA1 4HHAB 2X42A 1NEUA 3BWUF 4PG2A 1JVKA 3C8HA 2QQKH 4YFDB 4LNRB 1CFMA 2HLFC 1EV2E 4OLZL 1HCZA 1NM4A 1JXDA 3HLKA 5L7XH 4OAWA 1QBBA 4EUPG 4YXLL 1HS6A 4X7TA 1KCUH 3L1FA 2CLZB 1YMME 1CDIA 3UZVB 1HESA 1KB5H 2EZ0D 1R1CA 3JV4A 5T5NF 3TVMC 3OGOE 2WO4A 2V2WA 3SDDB 3VH8A 2G60L 1NGZA 3LKRA 3SODB 2WLLB 3BWAA 4F8LA 1JBJA 1IM3A 5DJAA 5D1QD 5GGTL 2ZOLA 5DR5H 4Z7OE 1IIKA 3KR3H 4P9ML 3K6NA 2Q8BL 2X9WA 1ZHLA 3KL3A 3I6SA 3NPSB 4FD0A 5JHLL 3RL2B 1KPUA 1TVHA 1IJ9A 3PNRB 2VXVL 1AR1C 1FYTA 4HU2A 4HZLB 4JPWL 1TZHB 4MXQD 4Q6YA 5FWRA 5FYJE 3FO0H 1TPXC 4J3XA 1DFXA 5ANME 4JZOB 5A2IH 1IFHH 4L3FA 1CU4L 3QHFH 1KMGA 2FCBA 1IE4A 4Q9RL 4OU3A 2XN9D 4GW4A 3IVKA 5C3TA 2YMXH 2AKRA 2YQBA 3WAJA 5IF0B 1HC1A 2J6WA 1XWVA 3LHPH 5DHXB 5HY9B 2D7TL 4UIMB 2ED9A 4PREA 1D7BA 3KDPB 3V0WH 5EHFA 4K3HA 1DQKA 3AGWA 3UPCA 4AC4A 2BFVH 1M9SA 3C75A 2BOBA 4JZJB 1YEHL 3L2LA 1YEFL 2X6VA 4P46D 1R4XA 3AU0A 2WLLA 3APNA 3GIVA 4M61B 2EKSB 4QYOA 1VESA 4KVPA 2BNQE 4U4BA 4HS3A 1WFTA 4WWKC 5A7BA 3G6AB 1CGUA 1GYWA 2PXYC 3ZIMA 4FYTA 1FYTB 2H9GB 4HWBH 4M5TA 1T20A 3H53A 3V5HB 1NCWH 3FFDB 4LHUD 2BSRB 5FUOL 2Y9RT 3V5HA 1BD2B 2NZIA 2EDYA 5JOPD 3EH2A 1Q9WB 4PTUA 1FRGH 4OF8A 3AREB 5CLYA 1OAJA 2H47C 1FO0H 3DGDA 3H56A 4W9DC 2A0LD 5AW9B 4UAOC 2WXRA 4JFZH 5IBLC 4H8QA 2DMHA 3CHSA 2XVGA 2VZ3A 5FGBA 2QELA 3NMEA 1LE5B 4B96A 4JM4L 4FI7A 2YHGA 1QPKA 1GS7A 1YECH 2R2EA 4DWHA 1GGBL 1U4EA 3VG9B 1MKFA 5FYLL 4JY6B 1TCMA 4DJMA 1SJVA 4H44C 4XCNB 1IE5A 4HOWA 2IALA 4KDVA 5KYXB 1QKZL 3DMMC 3W9EA 4PGJA 2B0SH 2AEPH 3K72B 1NCHA 1Z9SA 2SODB 2B16A 4P4KD 2PW2A 5MERA 3QVAA 3ARGB 4LEBA 1CICD 4DFHA 2PO6C 3HN8A 1MXDA 1UWXH 2YC1A 2EO7A 4FQ2L 4F1SA 5FDYA 4FA8A 1HOEA 1RZJL 2HVKA 4XMLL 5K69A 4OJFL 5BVJA 2OTUA 4HD5A 2B4CL 3STLA 4OZFG 3RTQA 3WG7B 3OJMB 5DMIL 4R90L 2I5YL 1JYNA 2MJWA 2CGYA 5D7IA 3LZPA 3RVWD 2OSLA 3QDGA 4YDVA 3MV7B 4JRFA 1KJ2A 1ZLDA 1I7UB 3PXJA 5D7IB 4EXKA 2FECL 3MFGB 4GRWE 3S8GB 1S9VB 4IOFC 2EIBA 3QZWB 3AMLA 5FR3A 1PLGL 2P8PA 3NGBC 4RMBA 2BHZA 1UATA 2M2DA 2ESVB 4P23A 3T08A 2I32A 3TURA 3HZKB 1TKWA 5KBLA 4M3KB 5LXGH 5CJ8A 5C0BD 2A1WL 2YPKA 5DJ2B 1UUNA 1Z3GH 1E6JL 5CINL 4Z7VF 2DYRB 5LDSA 3NZUA 1KFAH 2I9LB 2IALB 3Q7JA 4X4XB 3AB0B 5DRXB 3VWJD 5I17B 1MN4A 4OZFH 4XHJC 5CZVH 2B39A 1NZRA 1R5WB 2VOTA 1MCOL 3KPQA 5KTEL 3S37L 3TCXA 2XPGB 3PJNA 4KRPC 4RH4A 4A2LA 4PV8B 6FABH 1XIWB 1AZBA 1CGYA 2DAVA 2WN2A 3GKWH 1CL7L 1J12A 1D9KB 4HDIA 4XMPH 4HK3N 3FB8A 1LEKA 1UYWL 3AABA 4QO1B 3JTTB 1M2OA 1RUKH 4NS0A 4Z3TA 4XNXH 5IVXE 4PLKC 2IBZX 3P4NB 2YXVA 5F88B 4KKLC 2G9KA 4ZFZB 2RD0A 2VSDA 5DK2B 1L9TA 2NW3B 1W72A 4GINA 4AXWB 4ZMYA 4WO4A 4J3SA 3VACA 3QFJB 1ROCA 4Z5RA 1BXAA 4EI6B 1V05A 2E9BA 5EPMA 3QFJA 5D1ZI 3RGVA 3P4OA 5MENA 5GHWH 4XBEH 5MP6L 3ZDWA 1J5DA 4KFMA 4DP6X 5AYQA 5CM1A 2W60A 2X4SB 3KPQB 1BV8A 5DD0L 3B2UD 1QYGH 4JZNB 4CDHA 3T65B 3B7RL 4OLXH 4UI2A 2AQPA 1OSPL 3NJLA 4NO3A 1LP9B 4FQCL 1L9RA 3DNKA 1MCWM 3KGTA 3L3KA 3SYQA 1L7TL 3LRGA 5M95B 4MQXC 2A6JB 4ZMXA 4K0OA 2FLRT 4FQJH 3VD4A 2VMDA 4GRMB 4ZMLA 5KSBE 1J11A 5AENA 1VCAA 1HZHH 2GI7A 3EJTA 1T21A 4H1LH 4NM4L 3WFCL 4NRYB 3FTGA 4KVNL 4NO2A 1SYVB 1KV7A 3HKFA 3WY4A 2ROXA 3H0TA 1W6WA 1XCQA 1N5AA 3N42F 4V33A 5AKRA 4F91B 1LYQA 1O6SA 3U0WH 4G8GA 1FHNA 1EDHA 1FO0B 2IWEA 2B14A 3GRWL 2GUOB 1K6QL 3T4AC 1E5YA 1UXSB 2OX5B 4R8WH 5GRVL 4JN2A 1V3MA 2J1ZA 1PKQA 4RAUB 4XMZA 4P04A 2HT2C 2CKBH 4I2XB 1Y1UA 3FRPB 4JQIL 2XV6B 4KKAD 1J7VR 2PUQT 3JTSB 1EZLA 5HHOB 1NAMA 2ZX8A 1EHAA 1W0YT 3V6OE 2EIEA 1B0RA 3EYFA 2IEPA 5I6OA 1UWFA 4EF3A 2EVFA 2VXVH 4JPWH 2XKUA 1SXCA 1O9WA 3T0EB 4XP5H 4AZUA 3KLHD 2YGPA 4NZRH 4RVBA 4TULL 5HHVL 2AP2A 4G1MA 5EU6B 3UBGA 5A3IC 1QW8A 4P2OC 1ADQL 2EIZB 2LLGA 4G43B 3H0TB 3QR1A 3J8F7 1QZNA 4H13C 5BXFA 4TQEH 3UAJD 4IGBC 4EZJA 2V9QA 1TR7A 3L2MA 4ZI8A 3M45A 4Z7UB 1UXSA 4ZNEA 4XP9H 2NCEA 3IF1A 3NFNB 2IH3B 3QULA 3VFPA 3N2JA 3TX4A 3EYVB 1ESOA 2CPCA 4MCMA 4AYMC 5CHNA 5FX3A 2BWDA 2Y1YA 2X1WL 3EBAA 2YUWA 4NN5B 3WXVL 1T2QL 4U1LA 4UOW0 4CVZA 4QEGA 1BOGA 4NFDA 4JR9H 2CHXA 5C9KA 1XH2A 2KKQA 3QDHA 4UQ9A 4OGYH 1MAJA 1M3JA 5KZCB 3IFLL 4TUUA 4LF3A 1YSOA 4ZX5A 3RRQA 1OSYA 3K1DA 2D7PA 5FUOH 1J9SA 4U6HA 2BSRA 2XHNA 1B3JA 1QRNB 2XTJD 1CXIA 5JUEL 5CBEB 4A04A 2CK0L 1FIGL 1PDKA 4M48L 2XG5B 4MXWH 3WNLA 1UCBL 3MRFB 3ZKMD 2D3JA 4JX0A 5IHZB 5CO1A 5J57B 3W37A 4TYUA 1LDSA 5HDBB 1PD0A 3ZE1B 1IGML 2AKRB 2JVUA 3MRJB 3QWRA 5AAMC 3S4SA 4AM0Q 4AMWA 1I85A 3TZVA 3K6SB 2GYSA 3MRJA 4YJZL 4NIYE 3CVHB 3B3BA 1SHSA 3QJFA 4ODTH 1JIBA 5I66B 3S5ZA 3QJFB 4XAWH 5HDLA 2NY7H 1B4TA 1L9NA 2R2EB 3V0WL 3LY6A 2ATPB 4CILA 1A6WL 4R0LA 1SMDA 1QO3A 4L1SA 4H8WC 3WFHA 4LSDA 1CFQB 1QO3B 1RJCA 3CC1A 2WLIA 4IHOB 4M1CD 4PJ5E 4R8WL 5FIEA 3WKPA 4E9VA 2CDEA 3MZGB 2I7OA 3P77B 5D1XE 3I9PA 1MCCA 2ZUQC 3E2HB 2N3JA 4Y1AE 4OFQA 4ZYKA 1DQLH 2I07B 4UIKL 1WPCA 4WUKL 4Z7UF 2ZICA 1OHZA 3U36B 1AC0A 4ECNA 1NLBH 3C5ZA 1BD2A 3QNZB 2OTUB 4JPQA 4LP8A 4WSJA 5J1AB 4X7SL 2H4EA 3MRFA 2A6IB 1I8KB 2PYEA 3REWB 2JJSC 1RJLB 4FQXC 1VZGA 3CX2A 5KVFH 2W80C 3CUPA 3QI9D 1RJLA 5AG8A 3F7YA 4ZUVB 4LSVH 4D8PA 3KWUA 4LK4A 1WT5A 5JO5B 3TIEA 2MCPH 3VUAA 4PLJD 2CLRA 2K1MA 2JELH 5JO5A 15C8L 1YO4A 5DJZA 2ZKHL 4IRSD 5IVZA 1F8TH 1DP0A 3EW3B 1XX9C 1B0GB 3QNYB 4CKVX 2AS5M 1ZXQA 3CC5B 1FNFA 4WI8A 3IJ9A 5LGJA 3H3PH 3ROLB 5HPOA 3BZ4A 4FEMA 4XE5B 2QQKL 1JHKL 2ZP0T 3VE0A 3VXTA 1FGVH 4TTDC 4XPTL 2W0LA 1QSED 1JPFA 3GHBH 4P23C 5DRWA 3U9PH 1RK1A 3Q05A 1TU2A 3FCTA 3DRTA 3SE3A 3VFMA 2W1NA 4WGKA 4BE6A 1W0WA 1E0OB 3VRIA 1JCVA 2J44A 4WWKD 2EDXA 1XD0A 3BKYL 1XFPA 4TNVK 2VAJA 3WUWG 2JCCB 3BCDA 4N1HB 3FQWB 4JY5L 4R26H 4IU2A 1Z66A 3MLTA 3ARSA 4IBSA 1XGUA 2BIQA 4D3CH 5C0JB 1F4WH 3O9WD 3FH8A 4NC1C 3ZKMC 4POZD 3CFUA 4PJ8A 4XRCA 5HHOD 1HH9B 5LLIC 3BD4A 1ML0A 3AT8A 5DC4B 3L4XA 5CCKH 1E5UI 4ELKA 2F58L 1NC2B 1WFNA 2ZG1A 1CU4H 3QHFL 1FDLH 4GUCA 5EIIA 3RGVD 1NFDA 1NBZA 2H2SD 1RMFH 2AV1B 2NY4C 4P9HL 5CLZA 3N0PB 5LHDA 3I50H 3VU2A 4HCRA 4HZ1A 1PEWA 1R5WA 2FATL 4IRZL 3CFQA 5EOCJ 1T0NA 4WKZB 2AJVH 2MQ3A 4UT9H 4C4UA 1PZ3A 4C56D 3IDMA 4M5ZH 2RQ8A 5GZNC 5EU4A 4NNYA 5D1ZA 2AJUL 4R90H 4ZTPL 5BQ7A 5K1NA 1RUMH 2XX1A 3SKJL 2FIKA 1FBIH 5AG9A 3UZQB 5BMFL 3GMPB 3BKML 3GNML 3DUUA 3LH8A 3N6YA 3FQUA 3K2UH 4OUUA 5F3HA 4OM1H 1DUZB 5ILTL 1DBBL 4P3CH 4P2YA 3TYGL 2P5PA 4FFYH 2OQJA 4XZUA 2VDRB 4Z5RB 4N5UA 1T22B 2BY2A 1L9MA 2JWYA 4JY4A 3QEQA 3DTXA 4GYBA 1NINA 3ZJAA 3NIGB 3AQZA 2ERJC 1MEXH 3GO1L 1QBLH 3NTCH 5C0BA 1DZ0A 4KRMB 4TOYH 1L7TH 1F56A 3P11L 2N7SA 4B9IA 3KYNB 1JXGA 3V6BR 3ZXAC 1GHFL 1ZMYA 2VR6A 3VXSD 4O9HH 4QWWD 1AGDB 5DU7A 4MNHB 1A1NA 1SDYA 5HJDA 1JZ3A 5DMKA 1P5UC 2QADD 4Y2DD 1BDYA 3UBFA 3ZMNA 1W8NA 4WEMB 3ZMEA 1A4JB 3MKGA 5DD0H 1DSYA 1AZUA 3EO0B 3QDGD 4QF1B 1PG7X 3C5SA 3V0DA 3NZHH 1F4XL 4F33B 4XWGL 2J88H 4N2LA 3T6XA 3GUTA 4JANA 4TXVB 3CFMA 5IQLA 1YJDH 1CTOA 2IAAC 3G5YB 5J13C 4YSPA 3GBDA 5MEOB 1AAJA 4AEEA 1CICA 5ADPH 4G80A 3WNKA 3BKYH 5AZ2L 1G6VK 1S7VB 1UXWA 2FWOA 4MSWA 2VL5B 4BZ2L 3Q2CA 4NRXA 5I30L 3O2VL 4KQ0A 5CSGA 2OZ4H 2VL5A 3PU7A 2CHWA 2J5LC 3CAFA 3CQFA 5INDA 3VA6A 2OL3A 1PKQB 1KB9J 4RAUA 5FOJA 3JV5A 5GRVK 2JKRM 12E8H 4GKOA 1XCTB 1KCRL 4UAHA 4Z78A 35C8H 1WAPA 3PQYA 3PP3H 1PJ9A 2DF3A 3O6ML 3NP4A 1IKFL 2CGRH 3L45A 3LXAA 5L88H 1MCPH 3JWOH 5A6MA 1J0YA 3DETC 1G6RA 3PNWA 4X80H 4APQC 3OV6A 2JELL 3Q2VA 4L9LB 4HWBA 3EGSB 5DT1L 1I75A 5IVXB 3WN6A 2XN9E 3G5VB 4NZFA 3WJJA 2WOBA 4KGLA 3HTLX 5AOMA 4KZ0A 4H1LA 3RX7A 4GG6E 1RZIB 2I25N 3RWHB 1KLUB 4PIBA 4IKJA 4P48A 2BRRL 3UBXG 1D5IH 3SCMA 4K94L 2LU7A 3HPLA 3EYQD 4KTEL 4KRNA 3BP6B 3WEOA 4EI5C 1J5IA 4MMYB 2XA8L 5FC9A 4N0CC 3CSFA 3R18A 2A4EA 4PJIB 3CBJB 1HHIB 1I1AB 4IKKA 1D5MA 2XUWA 5JHLA 2OL3B 1KLFB 3ETBJ 3IWVA 4L1HA 1A7OL 1SY6A 3UYRH 1KXTB 3WXWH 3OGCA 2AXWA 2O4EA 4F2ME 4Z78B 4PGEB 3QFGA 1RURL 4B9FA 2VLJA 4CBPA 3MRKB 1MQKL 2YD6A 2OR8A 5TQ0H 2JJTC 3OZ9L 1MCFA 1XMEB 3D3VD 3NQKA 2BNQD 4BQ8A 1NANH 1NGWA 2E74C 2EDEA 4IMKA 4RRPG 2JFCA 1ECZA 2VDPL 2EO9A 3IGFA 3P0VL 5G5DA 3GMRB 4N0UB 4Y5XB 3VI4B 3CVIH 2R9HD 3L1EA 1JRHL 1FG2A 1CD1B 4MX7B 4LSTH 4P2RB 5TE7H 4O5LL 4G43A 3KYMA 3X3GL 3UCQA 4N0YL 3MUHL 4PLJC 1C8PA 4MZRA 7PCYA 2A38A 2H45A 3ECUA 4P49A 4S1QH 3DX7A 4F3FB 1ZIAA 4Y4KC 2GITB 2HH0H 3HZVA 3ESMA 3EJQA 2OZNA 3WSQH 2XQBH 2E7LC 1WAAE 4RMQA 3V9FA 3MXWH 4QHNA 5GRXG 2LLNA 4UM9D 4OGXL 4RESB 3NJKA 5T5NG 4WW2A 3PHAA 3HG0A 1TJHH 3GBLA 5B7MA 2BC4B 4LBEB 2AXGA 4JHUA 5KYYA 2PO6D 2ZWZA 1B0GA 3AM8C 5FLUA 4ZMTA 1QI3A 2AXGB 3LH2H 3QG7H 3A6CH 4F27A 4ACPA 5KSBB 2MMXA 2VLJD 2LE9A 2R56L 1LL1A 5KSBA 3Q6GH 4NJAH 3MLSL 3B56A 3VCLA 1V7NL 4HIEA 4Y16D 3HG4A 5I6LA 4JFOA 4P3DB 4XPHL 2HFGH 3CQQA 3F7VA 3QNZA 2O5ZH 5E5RB 3D7PA 5J1AA 3TN0B 3VFOA 5LKNA 5IB2B 3QAZB 2CBPA 4R7NA 5D4IA 3WHXA 2Z8WC 4Z7OF 2NY6C 5AEAA 4DQOH 3CUPB 4JFEE 3CVBA 2G2RA 3GSUB 4GW1B 3BSHA 3K5RA 3IK2A 4TUOB 3DBXA 2ZSWB 4PVMA 2JB6A 1LE5A 3ZBMA 4M4RA 4M7KL 1W8OA 5B38G 3ABKB 4L1BA 2JB6B 4HKJB 3QCUL 2CM5A 2P46B 2ZX7A 1T89A 3MGTB 2WNGA 4K3EL 1BLIA 4L3EB 3VFTA 5I5RA 1UKSA 3DO4A 4IS6B 3P0GB 4JRXE 1NBZB 3V4VB 1M4KA 3CMOH 3ARDC 5C0RL 1E4KC 1OCWH 1GIGL 4X6FA 4FN0A 4NDMB 2PW1B 1IC0A 3PL6D 4FTDA 4DNLA 2YAHA 5AAMA 2LW3A 1IAIH 2O93L 4X0KB 2YAEA 5DMGD 1LP9E 2HCZX 4WUKH 2GJ6B 1FORH 2EECA 5IBTH 1MOEA 1WDAA 3FQRA 3MLUH 5EBMB 4AITA 1UD6A 1T80A 2GIMA 3V4VL 1DEDA 2PTVA 1P9MC 4HAGA 4IU2B 1ZVNA 4NB7A 4EN3B 4OD1H 5I5IA 3FUHA 3S5LG 5DUPL 5JIPA 4UQCA 3F3HA 3HVDA 1UASA 4U1MA 2VR4A 1MW0A 1X9RA 3ZE2E 1JZFA 2OMZB 4L3CA 3O4LA 4PU2A 5F3FA 3S8FB 4L8BB 1FPTL 2OBGA 3H3PL 3MGOB 3TJPA 3ARDD 4CGTA 3VXTB 2I9LA 1MREL 5JIMA 5F97E 3FCGA 4TVSa 1ZT7A 3LZRA 5A16A 1U95A 3HJEA 1HQ4A 4BFKA 5GS0D 3MJ9A 4XXCA 4LOEA 1I7RB 1SHXA 4J7RA 1RZFL 5D8JH 5I19L 1JFQL 1XR8B 4LLQB 2VUOA 3QJUB 4BQBA 4XWGH 1CT8B 1SZNA 4GBXA 4A38A 4NNYB 5D1ZB 5JHBA 1I1YB 3RVVD 4Q0XL 4Z7WE 1BJ8A 2CUAA 3CZGA 3Q8AA 4U1IB 4Y4FC 4D0DB 4PJ8D 1ZTXE 1LMKA 4W9ZA 5ITBL 2X0UA 4PJ8B 4G80B 4GBXC 4FXGC 1RHHA 3TBYB 1Q0YH 1JGLL 1KCLA 2A9ML 5GRZA 3W56A 4OZIE 2KL6A 5D2LE 4ABWA 1S46A 5HSFA 4KU1A 4PYGA 1NC2D 1BP3B 3KLDA 5IUCA 3MBEA 1TTUA 3ENEA 2VDRL 4KAQL 4PRNA 1JXJA 5EZIH 3W0WD 1IC4H 3ZYIA 3X3GH 5CSZB 1A7RL 1CB4A 4OFPA 3WS3B 4BQCA 4TLKA 1HNGA 3IT8D 5E2UL 1HN1A 1QHOA 5L2KB 2PR4L 3WS3A 1P7HL 2YGQA 3CSTA 3TCLA 4DN4L 5I26A 3HMXA 4LCIL 2AJ3B 3VFNB 1JZ6A 3WJLA 1I7RA 3D25A 4NPYB 2Z7YA 4KK6D 3KYNA 5CD3B 1QSFD 2PYEE 2W8CA 4YHNA 2VDQH 4AGOA 2WANA 1FL6B 2R1XB 3X14A 1KIUA 1HOCB 3FHQA 4L5FE 5E8EA 4BGLA 3LHPL 2CDGB 3ABZA 2W38A 4TMPA 4AYFB 4UAOB 4HIXL 3F65A 5F8QC 1RCYA 4NX0A 2C3XA 1XAUA 1JNNH 3DO7B 1D5IL 2PWFA 5FYKD 1MCQA 2EP6A 4GT0A 1VADB 4NO0B 1KLUA 2AK1L 4KMTL 3P2DA 4EVNB 4LSQL 5DRZA 1CYGA 2OCCB 4N2NA 4KKLD 1Y6KR 4TVUA 3VU1A 3U2SA 1YNKH 2GSGB 2VIRA 2NXYD 3WTSA 4PFEA 1M7IA 2WIMA 2IMMA 3V8CA 1IAKA 5FYKH 5DEGB 2R29A 5B39G 3ESUF 2DL2A 2EVGA 3BMWA 3NEOA 1CXLA 2ZONA 3D33A 1OD9A 2OMTB 5EWIH 3KWTA 1VEOA 4OI8A 3BCFA 2YEVB 5CMAB 5BV7B 1TO4A 2HTLD 2B1AL 3TS8A 5D5MB 1FN4B 2BHUA 1XCTA 4PWIA 3RL2A 3MRKA 1Z32X 2YXFA 1II4E 5HPMA 5T1KD 4FQLL 1T6WA 3HR5A 3BWUC 1K8IA 2DD8H 2XFXA 3HS0C 4S1DD 1HOCA 2YGNA 4WWOA 4HC1H 2E59A 4A6YB 2HLEB 1U91A 3DVGA 2Q76A 4ADGA 3L1OL 5IM7B 3FQNB 5GGVL 5B4MC 1XIWD 3BD3A 4G9FB 1U8PA 2P5WE 5E5MA 4TNGA 2V37A 3MRQA 4N2FA 4Q6KA 5TDOA 1C7SA 1QR4A 1Q72H 4HJ1A 3ILEA 2QKIB 3TWCL 5ID1A 5KS9B 2K4WA 2NR6D 2CWRA 2RAMA 1KSRA 1AGBA 2ADFH 3MXWL 3LIUA 2AZUA 3VFVB 3IJSB 4JUTA 4U2ZA 3CSBA 2J8HA 4ZUSB 3S5LB 4FHKA 1I85C 2EDMA 3U4BH 3VO0A 1JJUA 3GWJA 1HXKA 4Y16B 5JR1H 5TH2B 1E4KA 4R0LC 1T1YB 2WBKA 5C09A 3CZJA 1TQCC 2Y4SA 4HGWB 1SM3H 3AY4A 4GQ9H 4F57L 4PJ5D 1KN2L 4Y5VB 3EXJA 3MJWA 5LBSA 3QH3A 2Q76B 3PIQB 4EIBA 2P9RA 3PUUA 3CH8A 1R6VA 1I1FA 4OZHE 5TK4A 3BVUA 1I3GH 2ZUTA 1URLA 5GZOD 4P3WA 1J9RA 4CU8A 2Y07L 4WO4C 3CFJB 5H37A 1MW3A 3Q8FA 4A7VA 1LD9B 1M6OB 1QFWH 4M8QB 5TK2A 2E6QA 1UACH 2ITDA 3TXAA 4QOKB 1YN6A 3MUGB 2Q87A 1S9VA 2B5IB 4QRPD 2JKNA 1HXMB 4UT6L 4N87A 2XIDA 3JV6B 4KPHL 1IV8A 4LEEA 3UL4A 1HXMA 2R9HC 4LLMB 3V6ZB 1K3IA 4M6NL 5D7KE 5SWSD 3KW7A 1SJHA 5CCGE 3UJTL 2YAQA 2HTKD 1BZ7B 5FFOA 4PJXA 5GS1B 3VI3E 3F6JA 1PZ2A 1SXBA 2CJUL 4IJTA 2R15A 3MLSH 1S8DB 5LAPA 4Q2ZA 3WENA 2BNQB 4N9OB 4HKXB 5JOFA 4Q9QH 1RZQA 1R34A 1YDPB 1IVTA 3IDNA 2WXGA 2CKBL 4LDEB 4AUUA 1D5ZA 1EAJA 1ZVYA 2IV9A 4BIKA 3O6FA 5KSVB 3T6WA 3D4CA 1DVTA 1GR7A 1ND0A 2E9WA 4FG2A 2W94A 4E5XG 4JM0A 3FQ2A 4L37A 3GEFA 4UM9A 1MJ7H 3MRDB 4WI6A 4IIZA 1HILB 3OR6B 1UGKA 5FYJH 2ZWLT 3EYUL 3ILPB 5D1QE 2ZOKB 1ZT4A 3L9YA 1D5BB 2X7LA 3A3YB 2CJTA 5DJ6A 5JQIB 2I69A 4Z6AT 2ZSWA 2FDBP 5DJ6B 1XTMA 3AROA 5DZJA 1MFVA 1RZJC 1OM3L 1YUHB 5FYJD 4N9GB 1PBYA 3ZE0B 3U25A 4B97A 1A6ZB 3H6AA 4J3BA 3RGHA 1EAQA 3OXRA 3ELAT 4FJYA 2X4PB 4LDCA 1PG7H 4NHUA 1HHKB 5C0DB 1MW1A 3X11B 5MENE 3BYYA 5K9OA 3AS1A 3BKCH 1MF2L 4R5XA 5EZOL 4K5NA 4LB8A 4K9EH 3M8OH 1WZKA 3TBTA 3KH4A 4RMVA 3P4LA 1JFQH 1N67A 1Z1WA 2NZ9D 2Z4TA 2J8UE 1G9ML 1VACB 1MWAL 3V0GA 2ZXCA 3SBPA 1WRFA 2NQ3A 2M1KA 3C6SA 4AEHH 3QRFM 1Y18B 2WGNB 2R0ZH 1XGUB 5F1IB 4N25A 3FU7B 4ODBD 4BFJA 5ES4B 4JFXA 4GG8B 1T0OA 5JHLH 4YSCA 5B1JA 4FQPA 1K4DA 3GBMH 3QUYB 4LVOC 2A6DA 5DWPA 3KS0J 4ODWA 4Y2DC 4FI6A 3CFBB 3PFQA 5GGVH 5CCHE 3UTQA 3UP6A 1A66A 3WO3B 1Y1DA 3NBNA 1NCUA 2EH8H 4ODHL 3TH2T 2I9TB 1GVIA 4C56B 1CFTA 2HLAB 1RQ5A 5I1LA 4I2XA 2QVFB 4XN5A 1DZBA 3LXBA 2MPAH 1YN7A 1AQHA 5C0DA 1M7DB 4X8GA 4I1PA 2ZXBA 4S0HA 2IDQA 4J4PA 1FL3B 1P7QA 1XSJA 4YAQB 1J8SA 3HZ3A 1JYXA 4HZAA 2BJMH 3X12A 1O7SA 3QNFA 2GJ6A 1KNOA 1FZMA 5EH1A 1ZD6A 3L9EA 1PMYA 1UM6L 1WBXB 3IDUA 3RDTB 3K8KA 1B4RA 1EQWA 1IRAY 2LFEA 3OMAB 5FYKU 3STZA 4LCVA 4HS8H 4NKOA 2NY2C 1T7ZA 4RRPA 1I8LC 3VXRB 3SPIA 1F3JA 2ALAA 5J0BA 4KTDH 4TRPL 1N64H 1AS8A 2IH1B 2G60H 1FA4A 2CPUA 1T5XA 2VCOA 3FU8A 3L3OC 1QRKA 2FBOJ 4IJ3B 2WTRB 3K8MA 5DMYA 1JK9A 1PKQE 3B3IA 4KQ4L 2FYYB 5I76A 2H2PD 3H4HA 2I9TA 3UIYA 4A7SA 4NNXA 4BCXA 2RCSL 2WLKA 3L3OA 1VAHA 2DJMA 2EDBA 2J71A 5EOCL 2JE8A 2P24B 1E9OB 1NBVH 4P59H 2XWTA 3IMSA 4K5MA 5G4MA 3V9EA 1TJIL 4R96B 3RL1A 3FYEB 1R75A 1ITCA 2OP4H 3FULA 4FNUA 1LO5A 1GGUA 2VXTL 1DVFC 2HWZH 1OK0A 3NCFB 4GW4B 5IQNA 3WDJA 2CO1A 3VD9A 1OIOA 4XC1L 4JM2A 3B7SA 4LU5H 4DKEH 1MAKA 3PL6C 5B3JE 2ORBL 3CZFA 3BOVA 3IETB 4ZO9A 1XZ0A 3P3TA 4L4VE 1IEBA 4QJ3B 2VM4A 4QOKE 1D2OA 5SX4H 3GSVB 4GI6A 3B3IB 5F7MC 2W07B 3R1GH 1P84K 2W65A 1G84A 4KBPA 4PW3A 4TUKL 1ET7A 1R3LA 2DRUA 4HWBL 5T1LD 3ZO0A 4HFUH 3KXFA 3EDDA 2HJLA 4BFIB 2OMTA 1IARB 4D9QE 3JBG7 4PRPA 5EBLA 2F18A 3AS3A 1I1CA 4GMTL 1TQTA 4NI6A 3NFPB 5EO0B 3EGXA 4NN5C 1HHJB 1S6NA 2VR7A 1MVYA 5I8EA 5EZJA 4AT6A 1RMFL 4X7EC 4MNGB 4AIZA 4Z3EA 1P4BL 4PGBA 4NZUL 4P2RE 2XG5A 4YBLB 5TF0A 4ZO8A 6PCYA 1Q9WA 5F0MB 1JCKA 3TNMB 5KVFE 4JPKL 5T1JA 2PABA 3KPOB 4XI5D 2A6IA 5DC9B 1YVLA 2CRMA 4HSCX 3TFBA 5JXEA 2ROYA 2LGNA 4R4FH 4YXKL 1L7IL 5J1SC 5GGRB 1UACL 3TNNA 3POHA 4JCWA 1RL1A 5ESVB 3ZLQC 4XWOC 5FYLH 4XMTA 1CDBA 4XVUD 3IETA 4Z0BH 3VFWA 4PRIA 2Y6SC 3QJOA 2FNBA 2V9RA 1T3FA 2K6YA 2VGLM 4JO2H 2AEPL 1G1KA 4RX4D 4XNUH 3ULVL 2FEDC 1A3RH 3IU4H 5HVWA 3FPYA 2EH7L 5KVDE 4OCRH 1G7QA 4ODSL 4Q56A 1EDYA 1JDCA 3K6OA 1XXDC 4QPEA 1NJ9B 2EIKB 2Z91B 3I3DA 3IJEB 5LXVA 3WNIA 3JWNC 3IJEA 3CHQA 4XC3L 1KPUB 1TVHB 1BXUA 4IDJH 5JR1L 4NJ9L 5A1AA 5GQBA 2P80A 3HW7A 1XB8A 3I9IA 4C47A 4AT6B 2GBUA 1QR1B 4NQDA 4QJ5B 4G3YH 1GGTA 2J57A 5EU5B 3ME0A 4GQ9L 4F57H 4ENZA