2Y2YA

Oxidised form of e. coli csgc
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
95
structure length
95
Chain Sequence
b'SSQITFNTTQQGDMYTIIPEVTLTQSCLCRVQILSLREGSSGQSQTKQEKTLSLPANQPIALTKLSLNISPDDRVKIVVTVSDGQSLHLSQQWPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CURLI PRODUCTION PROTEIN CSGC
publication title Atomic Resolution Insights Into Curli Fiber Biogenesis.
pubmed doi rcsb
source organism Escherichia coli o157\:h7 str. ec4115
molecule tags Chaperone
total genus 11
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2010-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2420 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y2yA00
2XSKA 2Y2YA 2Y2TA 2N59A
chains in the Genus database with same CATH superfamily
1T21B 2CBPA 5DHDA 1NGXA 3KAAA 3G04B 3NSYA 3X14A 4G6KH 1SLUA 3O2DA 3Q43A 3ZMRA 4WUUE 3LOWA 2LVEA 5H35B 3GSWA 3QQ9C 1S9WB 3HPLB 5DC4B 4M93C 5AW3B 2IV8A 1E4KA 3VDBA 4FI7A 2IDQA 2R1YB 1TZIA 2FZ3B 3MV7A 4NQDD 1LM8V 3FFCD 4FQQA 2FD6L 4TN9A 4YHNA 5IVOA 3FB7B 3RIAK 4F15B 1BEYH 3O3BA 1MCCA 3ARBD 4HLZH 5L2KB 3FO2B 4ZW6A 3FAWA 5ISZD 1FYTE 4WGKA 1RZQA 4K7FB 1T6BX 4XN5A 1YEDB 3KPLA 4CC4C 5TDNB 3S8GB 1XEUA 5BV7L 3V4PL 2LU3A 4PG9A 2HSIA 2QQLH 4JO4H 5SV3A 4UM9D 4UBDC 5E6YA 3NYKA 4C55A 4NNYA 4M3KB 4XXWC 4DF9A 4G6MH 1ADQL 2ZOOA 2XKNA 3VI4B 3Q2LA 4LRNH 5DMKA 2MKWA 4CNIA 5C9JA 3S48A 3K2KA 5D7IF 3MJ8A 5DVMA 4FFZH 3UPAA 4X9IA 2K9UA 1EAQA 3QUYC 4P4KC 4F3FB 4L1LA 3BIBX 2YEZA 3AZUA 4DVBA 1G7HA 4CN1A 2W0LA 2HWZL 5C0JB 5EF3A 3D08A 5EU4B 3BO8B 4KDTC 5FF6A 5TE6L 4PJ9C 3V6FB 2F9BT 1A4JB 2MTPA 1DJSA 4S1QH 5BS0A 2Y5QA 1S2EA 4HCGA 3PWUA 4PY7B 3LZRA 3UACA 4JLRB 3BAKA 1G1KA 12E8H 4PJAA 4H1LB 3QEHA 4AIEA 1JGUH 2LLNA 1YMHB 1F8TL 1OAZH 2A1WL 4LCWE 3O81A 4JFDB 5EOQL 1FZOA 3O11B 3VVWA 1XF4B 2VE6A 5EU5A 3NIDB 3DRTA 2JXMB 4K23H 1C08B 1N6VA 3M8OH 1G1YA 2BDNH 1BXUA 4MA7H 1JZDC 3CFIC 1L7IL 4HX1B 2MNJB 4K55A 4JM2F 2BVEA 1MJJB 3J07A 4HPYL 4JW3A 4GLRI 4NJAL 4I13B 3MLVL 1S7VA 2A83A 3SDCC 4DGIH 1QLFA 2BY3A 5LBVA 2FTAA 3TYFA 3BUDA 1D5XB 1USZA 3FQ2A 5IVZB 5D5ME 4PRNB 4TVSa 4LCCC 3X1FA 3ATEA 3GPSA 3VFRA 2X6VA 4IRZL 4OCNC 1ZLUH 1SHXA 3F00A 2W60A 3BAJA 3GMMA 4HWZA 4YSRA 4AV5A 3X12A 2W1NA 3KNBB 3MBWB 3VGAC 1MHHB 1P69B 3NJVA 5IW1B 4UOZA 1J1OH 4PLNC 4LHUB 1QACA 1E6JH 2FATL 5I0VA 4XTRD 2VL5B 5FGSA 4I5BA 4GG6F 1KJ2A 1DHKA 5HVFB 1KCKA 2BHUA 4LSTH 5I1IL 4JM4L 4GSRA 3S88L 1GZQB 1MLCB 5EOCJ 1KEGH 2HT4D 3VB8A 4LVNC 3CFNA 3HJEA 5DXWA 3ZZQA 1WWWX 2MSPA 1EO5A 1E6OL 3BD4A 1TETH 1WCBB 3IDYB 1J48A 2BCMA 2YSSB 1E2ZA 2NY7H 4X0KB 2EXTA 2HAZA 2AEQL 3UG3A 5FYKH 1HYSD 3S3SA 2X70A 1JL8A 1JMXA 2FSDA 4JPVL 4F2ME 5DFVC 4ZMOA 3GUFA 4XMPL 2YKKA 4PJGB 3H4HA 4U1JB 5D7SH 3OHXA 2Y06L 3BPOB 3T3PF 4IOFC 2APFA 3HG2A 4XP4H 1W9XA 3MXVL 2G9HA 4KJPD 3HZMB 1JZ4A 4HWBA 4QT5B 4H2CA 5B1BB 2IANE 5F7UA 1RMFH 3EGSB 5GISH 4OV5A 4Z7OB 1E4JA 5CLTA 2NW3A 2V8MA 4PV9B 4QGTA 5KBNC 1J8RA 2DQGL 5H2BA 4ZXBA 3LV3B 3ULUE 3C5SA 5ANMA 1DLHA 1E4HA 2ARWA 2OMYA 5TK2A 3NGBB 3RVUD 2AV1A 1D6EB 2IAAC 3QUYB 2CPCA 4LAJH 4N2EA 4ZSOB 4RAHA 3BSZA 5ELIA 1GH7A 4Y2NA 1P5VA 4XNAA 2OL3L 2OX5B 2ZJSL 3ABKB 2I69A 3D1MC 2A74A 2YWZA 4PJ9B 3WIFB 3H0TB 3GSNL 1B3IA 1YDPB 1CBVL 1MJUL 3GMOB 4AUJA 3CTTA 4P5KB 3P4NB 1AQKH 5IIEA 3BN9D 5KN5B 1YEWA 3MODL 4IEFA 3F04A 2K6WA 1MY7A 3B3BA 1BOGA 3Q8EA 3UG5A 3PWLB 3NFSH 2XG5B 4PJ5D 3PV6A 1WZ1H 4HAKA 1LJMA 2GC7C 4NQEA 3QQ9D 3ZPDA 2JJSC 2NNXA 4PJEB 4O51B 2QLVB 3C6SB 4P2QA 2Z7WA 4ODUA 2X89A 4XMVA 1FIGL 3WHXB 2FBRA 2XTJB 2JK5A 4J2XA 1HYRC 3KM1A 4F2MA 4DOHE 4OJFL 1MLBB 2IDCA 2QKSA 4PJBE 3SDCB 3OKNB 3MV9A 5BRZB 1L9SA 2TSBA 3U7YH 1UOLA 4LCCB 3SOTA 3TBWA 3G5XA 2ADJB 4UNVA 1G9NH 2IANA 1J5DA 4PWHA 5I1CH 4ZK8A 3WFCL 4ALAC 3I02A 4HF5H 3KWTA 2FSEA 4I3RL 4UBDD 3U30B 1YY8B 1U58A 3VGAB 5D96C 1QHPA 3HVDA 3SBWA 3IBEA 1E9QA 2UVEA 5AENA 4KXCA 4HYTB 1N70A 1WGVA 3N43B 1OTSC 3QXTA 4NUMA 5CHNB 1BZ7A 4ANKA 4C56A 3JWDL 1BAFL 1IE5A 4AUUA 4L8CA 4N8UA 3QUYD 4P4KD 3ZK0A 2IFFL 1OPGH 1DQJA 2QKIA 4LVNB 4POZC 1OP3K 3H2WA 4Y5XB 1G9HA 1IBDA 4FQHB 4J5VA 5FX3A 2NZIA 4TSAH 5DYOB 3U1SH 2CPUA 4QPEA 4PJ9D 2BSRA 3R19A 4MX7B 5AW7B 3ZXAC 2GPZA 1IFGA 1VFAB 4RFEB 5E5RB 3PIQA 2VXQH 3FOMA 4L3AA 4XPHH 2HUEA 4MJ4A 3MTRA 4Z95L 4P59L 3UAFA 4A2FA 4HS3B 4HU8A 4M00A 5J6GB 1XIWA 1OGTA 2YD1A 3VXQA 1KWKA 5ILTH 3D39A 4XXCC 1QPKA 2K1MA 1OLZA 1N5AA 2CBMA 4AMKH 1YNTF 3MUJA 2ADFL 2IPTH 1RZKH 2E9BA 1T7XA 4KXZH 4ZO9A 4NO3B 5EZLB 1NCWL 3EYUL 4NO5A 3ZE2F 1BPVA 4KXDA 5C0EB 3BJLA 4TQPA 1TJGH 2P7TB 2VNCA 1V8HA 4RVBA 2XWXA 3EDEA 3EXJA 1C5BL 3SDCD 4G7QB 3WNMA 2JELH 5HJ3B 3Q3GB 5I0WA 2CK0L 4NRZB 4W9KC 5T1DH 4XH2B 2R8SH 1INEH 4OGXL 1PSKL 3L95A 5IG7B 3B2DC 4N0YL 3IAGC 1OAUL 1BBDL 4YGVB 3LZFL 4RH4A 5FOBB 1IEBB 1U6AH 2ZOLB 4QTHA 3QDAA 5H94A 4HFWB 4EI5B 4L37A 1TMCB 2HP4A 1QRNB 1RV6X 1AQ8A 5I16A 3AJ7A 5BOJA 1DBAL 4G5ZH 3NZ8B 4NBXB 3PQYA 4KTDL 4W9GC 3VA2C 2DKUA 1MRCH 3VFOB 3KVPA 1XF5A 3BWUF 5SWSB 2BW5A 2H26A 1J11A 2WXQA 2ATKA 3W9EB 3UEZA 2G3MA 3MLZH 1E7VA 1R3HB 3ZQXA 1URLA 1UGKA 1T3FB 2EEDA 2COVD 3TL5A 4DQAA 3UDWC 5F7FA 4KC3B 3VXOA 1OXYA 5CN1A 3NFPB 5E2UL 4H0HB 1E9OB 1OGAB 3FH7A 3Q5TA 5JOEA 1GJIA 3P1VA 4LDEB 4KGJA 1PNCA 5FDWA 2NY0C 3MRLA 3MGOA 1XGTA 4PWGA 3DPDA 2JKLA 4UB0L 5DFVD 5MP6L 1H3GA 1KYDA 3T0EC 5JR1L 3BEWB 4YL9A 4IOFD 2JKSA 4M61A 3E8UL 3HS0B 4XCCL 1E27A 3UTSB 5KVGL 1L7TL 4L23A 4OZGA 3K7UA 4AQEA 3PWJA 2YAOA 4JRFA 4AJYV 3QZBA 3AQDA 2R29A 1L9QA 4QHNB 3ZR5A 5JW5B 4NX0A 1BSIA 2FD6H 4JVWA 3AAZB 3K81A 4IOSD 1RLBA 4IJ3B 3GXDA 5C86A 4JKWA 4IOIB 7TAAA 2EDDA 3AG2B 5IB3A 2VLLA 2BNQE 3G6DL 3VFSB 2DDQL 3BEVB 3LQAL 4Z3TA 4FYSA 3NK3A 3MR9B 4N9OB 4X8GA 3V4PH 3PGCB 4PVMA 1U3JA 1PCSA 4XPAL 5BV7H 5DJDB 4FLSA 3V5KB 1EDHA 4TVPE 1QRND 4HOZA 3OAWA 2EYTB 1ADQH 1A7OL 1S7UA 4NRXA 3TBYA 1FVCB 2BXZA 3BQUA 2X88A 3GSOB 3S96A 4HIJA 2XY2A 4HXBL 3EO0B 3ARUA 3LH2L 4MJIB 3KCPA 5KSUB 1X9QA 3ZYIA 2HWZH 4LBEA 5FM5O 2XYCA 3MRQB 2AQNA 3E9UA 1QHOA 2EIBA 1OGAD 2W5PA 3E9TA 3EFOA 4POUB 1NFKA 4FCAA 2QPDB 2OZNA 3WU1A 3TA3B 5EC1B 4CDHA 2FJHB 3EYOB 1WICA 4ZS6C 3DO7B 1IM3B 5CNHA 3RWFB 5FM5M 1IQWL 3CU1A 4HUXB 3ULVL 1PLCA 5D7KE 5F7WC 1F8TH 2A1WH 4H0GA 2HMIC 4S0SD 5EOQH 3NFNA 2IALB 2XYBA 4PR5B 3WL9B 5AYUL 4A7GF 3ULAB 1S7SB 2XETA 4TUJA 3T6XA 1L7IH 2J8HA 3GS0A 1Q9LA 3B2UC 4NQTA 5EZIL 4DGVL 1OTSD 4HPYH 1KT2B 2VLJE 4NJAH 3OR6A 3QEQE 3MLVH 2YGPA 1IAKB 2DD8L 3JTBA 5HDLA 2A38A 1G7JB 3L3DA 1M9SA 5E1IA 3NSDA 1LE9B 4P07A 1HCFX 5GJSL 4XB8A 3ZE0F 1HHJA 3W38A 1AI1L 4IRZH 5C1MB 3I3EA 2BHYA 1BZ8A 4FMKA 3SOBL 4HVBA 5HXMA 1ONQA 3QRBA 4P5MB 1S8DA 4DTGL 5D93C 4DK6A 3SJVE 1KN4L 5TF1L 2FATH 4N26A 3QH3A 4H8HA 3LZLA 1L3WA 4WO0A 1R46A 3RFZA 3LIUA 1J5CA 4AEEA 1XMWA 4HV8B 5I1IH 1BFSA 3T0EB 4JM4H 1BMGA 1TTFA 3K71A 2UYLA 1L0QA 1M05B 3WS3A 3S88H 2M2DA 2HVBA 4NKIL 1Q9WB 2DH2A 3MUZ1 4CDGC 3T71A 4CRPA 1G7MB 4E9RA 1E6OH 3TF4A 1ZGLB 2CDFB 2J1KA 2Z9TA 3Q8CA 4I9WE 4DZBB 5J1AA 1W15A 4D7PA 3SY0A 2TRYA 1TTCA 1H3PL 4X99B 2AEQH 1ASPA 1MWAA 4MXVE 3NRFA 2WK2A 1E5YA 1IM3D 3L1EA 1J5IA 1DP0A 3R7RA 4JPVH 3GSXA 4XMPH 2ICWI 4YH6A 4HGKC 4S0TD 2Y06H 4FF9A 4U1MB 1NWOA 3MXVH 2HFFB 4GKSA 1JUFA 4WJ5A 1MCDA 3AC0A 2VLJA 4DGYL 5EA0L 3BAWA 4G82A 1O5DT 2ATPB 2IADA 3HN5A 1LP9E 4YZFF 2R23B 5G4MA 3L5IA 4XXDA 2Q8AL 2UY6A 1X5GA 3FRUB 2DQGH 1HXYB 4XX1G 5JDSA 4XE5B 4L3CA 4LOFA 4OFYA 3IXAA 5CCHE 3PAZA 2WKOF 3FONB 3FFCE 1JI2A 3BP5B 2OL3H 2ZJSH 1B9ZA 1LEIA 2BCKB 4JFHD 2DYRB 2FO1A 4Z7VA 3GSNH 3QIBA 1CBVH 4YHLL 1MJUH 4GP4B 4OZFH 4DT2A 5ISZE 4L0YA 2GSIA 3CPUA 3P4MA 3OKKB 1D5ZB 4WFGD 5ESQB 2B4CC 4ZPVA 1ZWIB 1F4YL 3MODH 3ZY7A 1X6NA 5LG1A 4HH8A 3T0ED 4KQ4L 4NXSA 1AGDA 1YMMD 1YC7A 3QRLA 4HCRL 2WLZA 5B22A 3CAFA 3GZKA 1S9KC 4ZW7A 4HGWB 4ENEC 3AUWB 1DL7L 3C09C 3SPHA 1FIGH 3N9GL 4H8WL 1UZ8A 4KVPA 2MCMA 1EXHA 5AZ2L 1X7QA 4F92B 3FT0A 2J8UA 4OJFH 3FYEB 5IFAL 4RSYA 4XNQB 3BFOA 5I6PA 1XGRB 3SCMC 2H41A 1CFTA 1Y0LA 2I85A 3LEXB 4CVZA 3DJRA 4Z7QF 2XVBA 4FKKA 4OLUL 4D0CA 5DK0B 5C3IA 3UTZB 1URIA 4ISVA 1U8OB 1D5IL 5EU3B 4MS6A 1LO2L 5FR3A 1QYGL 2VLMD 3SE6A 2JJTA 3WFCH 1DUZA 1M2VB 1MSPA 4I3RH 3LNHA 4L4TB 5ANHA 4UU9A 1A0QL 4I7ZC 5D93B 5DRZB 3QRGL 1WRFA 2PW2A 2NCMA 2JE8A 4HBQA 5B1KA 2J12B 3VE0A 5IOPA 3JBG7 1GTNA 4CN4A 3JWDH 1OO2A 1BAFH 2BLFA 4NQDA 2F8OA 4HIQA 2Z1PA 1XEDA 3L4XA 2BX5A 1QSFD 2IFFH 5AVYB 3ARBA 2KI6A 1F3JB 1ET8A 3KPMB 4LDLB 1MEXL 1JZ6A 4OFVA 4E9VA 2ZSVA 2FWSA 4YSPA 1HSAA 3DGGA 3HI6L 1UXSA 3KR3L 2R2EB 4E9TA 1RZIB 4QRPD 2ZD0A 1CF1A 4ZS6D 1T80A 3DYMA 5ITBL 4Z95H 4P59H 5CEXA 1JHKL 1CXLA 4RIRA 2HMID 3SKMA 4WRLA 4OH2A 4PM1A 1FH5L 3S98A 2ADFH 3PWNB 1I9RL 4R5VA 1DUYB 3PWPA 1OOAA 4V2BA 2VISA 1FFPB 4MJ6B 2C3VB 1F1GA 3TN0C 1E8WA 2CUHA 3PWVB 1NCWH 3EYUH 3B2UD 4OQ1A 5ACMA 1ZLUK 2KLSA 3UEQA 1H6TA 2V8LA 1ZRUA 4PN6A 1FNGA 3GHEL 4HHAB 3C08L 4JS7A 1C5BH 2CK0H 3QA3B 3CV5A 4OGXH 5FO7B 4UT7L 1EEUA 4N0YH 3DMMC 1OAUH 3KYOA 3ZL1A 1T21A 1CVSC 4NQCB 1BBDH 4KQ0A 3LZFH 1JF5A 2WLIB 3BVWA 3G04A 4Q52A 2VDKB 4L4TD 3WV0A 2K3HA 1EAOA 5H35A 1S9WA 3HPLA 1AS6A 2VKXA 5BZDB 1DBAH 3ZX1A 2AV7B 3LCYA 4KTDH 2APVA 2FZ3A 2YKLL 4YLQT 3GJFH 4O00A 2QL1A 1DJXA 2P5PA 3CHRA 6FABL 5L2KA 3MV8D 3FO2A 2DIBA 5LDSA 4B5EA 5GGSB 3K80A 1V10A 3JUZA 1OOWA 4K7FA 1YEDA 1FC2D 2FO4B 5TDNA 1KXQE 2VDLB 1SHWA 5E2UH 4E5XG 1LO5B 4IBTA 4PJFB 2DJMA 2VC2B 4P46C 4UB0H 4CSPA 4L2LA 2OV0A 3VI4A 4L9DA 5MP6H 3EH1A 3VGHA 2LU5A 2OSYA 5JR1H 3ATFA 4I85A 1BWWA 3GRGA 1BMZA 3E8UH 1BZOA 4D9QD 4XCCH 4K9EL 3QUZC 1BD2E 3KPRD 2R0LL 3LB6C 1U33A 5KVGH 1L7TH 4Y2DC 3NPSB 1GRWA 1N0LB 5C0JA 1VESA 4PJ5E 2N7AA 2ZKMX 5FGBA 1TUPA 3NP4A 2AMUA 5EN2B 3GMNB 1A4JA 4LGRB 1UWXH 4PY7A 5IFJB 4W6XB 1RK0B 2BP0B 3F7VB 5DA4A 4JLRA 1G43A 1FAKT 1R5IB 3LZNA 1YMHA 3PFQA 4HKXB 4HIEB 3TESA 5ABAA 3ZQ9A 3G6DH 4JFDA 2DDQH 1E3FA 3O11A 3QDMB 1TVDA 2IDSA 3F7PC 3LQAH 3HMXL 3ECQA 3QZNA 4UCFA 3W11C 4XPAH 3IGUA 1HK6A 5DS8B 2YGNA 2JXMA 1C08A 1KB9J 3L4WA 4HX1A 1FP5A 1A7OH 1MJJA 3VXRB 3UZVB 1PD1A 4BFJA 1FLTX 4HMEA 3BW9B 4IBYA 3RB5A 3T6WA 3IEAA 4HXBH 2UY7A 3LH2H 1ES0B 3CPLB 4BUGA 1CXIA 1D5XA 1NBZB 5IVZA 3O41B 4JY6B 2CXKA 3MLWL 4LSDA 4PRNA 1WFNA 4ENED 4YVUA 5JW4N 2GITB 1X5IA 3CXFA 4L2YA 4FTVB 1M2OA 4Z7NE 4ADGA 3MCLL 3HCVB 4EDXB 3KNBA 5FYJD 1MHHA 5IW1A 1LYQA 5GJTL 4K8RL 3SCMD 1JGLL 5DHXB 4IBUA 3EH4B 3STZB 2VL5A 5JXAL 3ULVH 1IQWH 1OK8A 3IJYB 1D6VL 1LWHA 2R51A 4G2AA 4X8XA 3GPEA 2YMOA 3JTSB 1GZQA 1MLCA 2QMJA 2YQGA 1YYCA 1FO0L 4YOKA 1G1CA 1PYWB 1B6UA 4GYBA 1PZCA 5AYUH 4FG0A 3C6EA 3NQKA 2OLDA 1OT2A 2MNWA 1WCBA 2YWYA 2YSSA 3ETBJ 2YO3A 4DGVH 1VAHA 4I9XA 5FAAA 3RVWC 3C60C 4YLCA 5I6XB 5JHDB 4W9EC 3KJ4C 4OI9A 2DD8H 5SX4H 4J3WA 4IHOB 3SQOL 4ODXB 1QOKA 5B1AB 3AG3B 3ZTJH 5IK3B 4NOBA 4N25A 5GJSH 4PJGA 4U1JA 3RIAF 1PZUB 1AI1H 3QDMD 4LRIA 5SX5H 2CJTA 3AQYA 2XA3A 2DRUA 5GSVB 4CC4A 2AQQA 2WKLA 4LLUB 3RZCC 3HZMA 3SOBH 2RD0A 1AG6A 3OL2A 3WEMA 4PJCE 4QT5A 5DJCB 4DTGH 4GBXB 4ACTA 1KN4H 4U3SB 4QAWA 5TF1H 4HALA 4XXWA 4P46B 4YGAB 3L1OL 3EGSA 4MHHI 1BQUA 4PV9A 1IBFA 3T2NL 3BH8B 2H45A 3LV3A 2GG1A 3KDPB 4X2UA 5T1KB 3CFUA 2NY4B 4YHZL 1XH0A 4NKIH 3HZ3A 3QUYA 4X5PA 4ZSOA 1UJ3B 5M7QA 3AITA 3IMSA 3ZT6A 3TN0D 3ABZA 4XO9A 5B21A 2OX5A 4KI5E 2OBGA 2Y3NA 4PJ9A 2ERJB 3DUUB 4LP5A 4QOKB 3WIFA 3H0TA 5I5MA 1H3PH 1YDPA 3VXMB 3GMOA 1MFAL 1BVNT 4LT7A 4P5KA 1MCOL 2CO2A 3P4NA 3UGEA 5EUOE 4DUWA 4PJDF 3HG5A 5KN5A 3UTTB 2GJ6E 3DMMD 3K1DA 3FTXA 5F0JB 4EIZC 5JOFB 1HDMA 1PZDA 1SLXA 3PWLA 3QFJD 5F3BB 2XG5A 1T03L 2NLJB 5B3JF 2W07A 3NESA 4H26B 4YO0B 5EA0H 4DGYH 3I75A 4PJEA 2OJEB 4O51A 3ATAA 1UJTA 4X8JB 3WHXA 4RGMC 2Q8AH 1CWVA 4A37A 3AT8A 4AI7A 1MLBA 5EDSA 4AH2B 3SDCA 3OKNA 2V7NB 4AQ1B 4Z77B 5BRZA 3ARYA 4TRPL 4LCCA 2PXYC 2ADJA 1NFDE 1MFUA 4PJCA 3S8FB 3VD7A 2EIEA 4JO8A 3CSPA 3OLEA 5E51A 3KPNB 1DN0B 1OL0A 2V9RA 5B7FA 3IGKA 4PLJC 4YHLH 2XI9A 4TQEL 4XCYB 3PP3H 3BSHA 4P46D 3WO4C 3BUYB 3N1PC 1A3QA 1F4YH 3DHJA 5CHNA 5F70A 4W1TA 4Z78B 1FV1B 4KQ4H 2WZAA 1KB5B 2K7QA 3GLAA 1I8LC 3HRZB 4HCRH 1K5WA 2B1OA 3QUZD 4JFPB 1I7UB 1XGYL 5D1QB 3LB6D 4Y2DD 4LPTA 3OAYK 1DL7H 4UDUB 5DYOA 4FQJL 1LO3L 3UZQB 4H8WH 3N9GH 5DJAB 4MX7A 5KOMC 4XN4A 5EUOA 4E41B 1VFAA 4OV6F 5AZ2H 1ZDQA 1MDTA 1V27A 3FHEA 4RFEA 3B43A 5JIKA 4PSPA 4UQCA 5IFAH 4ZNCD 1B4LA 1CMOA 3VFVB 4U0QB 4DP5X 1X7SA 2ENJA 3NMEA 2W9DL 3K0WA 3G7TA 4HS3A 4BZ2L 4F2FA 5J6GA 4OLUH 4HOWA 2NNCA 4PCSA 2C7FA 2ALWA 1D5IH 2H3XC 1LO2H 1QYGH 4KJQC 1AC0A 1EBAA 2FUTA 4YDJB 3W11D 3RZCB 4U1SB 1KGWA 4A67A 4ZOEA 1A0QH 3QRGH 5H8DA 4MKTA 1E65A 4NO3A 3US1A 5EZLA 5IHUL 2VMEA 2VABA 2P24B 4OBRA 3V52L 3V0WL 3ZE1B 5C0EA 1PZAA 4R7NA 3LIZL 5C09E 4ABWA 3HG0A 2PWEA 3FTUA 1H15B 1NFDA 1YEFL 5HJ3A 3IMTA 2YAMA 4NRZA 4XH2A 3VGDA 1OM3L 1DVXA 1VCBC 3FTWA 4ABQA 4L8SC 2ZOKB 4X6FB 3HAEH 5IG7A 2WUCL 5EUKB 2PWGA 5DS1A 1MEXH 4YGVA 3BAYA 2FEEL 5FOBA 1IEBA 3APMA 3H9SD 3HI6H 3UROR 4ZDHB 3KR3H 4EI5A 1D7CA 1DVFC 1Q0YL 3QO1B 1KTDB 4U2ZA 3S3JA 3V9FA 1QRNA 3EOYG 5ITBH 1GTFA 5C7XL 2XKUA 4OZIF 1JHKH 1WDAA 3NZ8A 1AO7E 2DQ6A 5E95B 2ETWA 1L0XA 3HNVL 4HK3N 1FH5H 4NKMB 3VFOA 1WBYB 2QVTA 5C0CE 2KKQA 5SWSA 1KBVA 1I9RH 1NFAA 2H1PL 2YZ1A 4QRQB 1ML0A 5EC2B 5FGRA 3W9EA 5MENB 1R3HA 2D31B 4FNPA 4TLUA 1T3FA 2ZF9A 3SYQA 1W72A 43CAB 3FRPB 3O0RL 3MJ7A 4YDIL 2HH0H 3NFPA 3RVWD 3C60D 1E9OA 1OGAA 3GHEH 3C08H 3EKCA 1J12A 3PAYA 1TTUA 1UENA 3BWSA 3MV01 3N42F 1J1XL 5F44A 4DKEL 4IMLB 1WAAE 2YOCA 3BXNA 4UT7H 2G4GA 1QSZA 3BEWA 3F2LA 3P3YA 5IVXE 3VRLF 3RZCD 1I1CA 1U21A 5I17A 4QYOB 4BKLB 1CU4L 2VW7A 4OD1L 2X1XR 4XNZC 4K7PY 4U1NA 4X4KA 1ODUA 4ODWA 1NCNA 1ED3B 3KLLA 2YKLH 2GBUA 5JW5A 3TF7C 1FYHB 2ZWYA 4D0BB 2SODB 3AAZA 3W39B 3IN0A 2G5RA 2X2YA 6FABH 1AMXA 4IOIA 2QQQA 3EOAA 1MY5A 3VFSA 4Y5YB 1XCQB 3BEVA 1EZLA 3BRGC 2ITFA 5DUPL 4LDCA 5LQBL 3GSQA 3PGCA 5CGYC 4P05A 2R15A 3TVMB 5ACZB 3FUJA 1P1VA 2EYTA 4JFHE 4M1CC 2W65B 3JWOL 1FVCA 3HN8A 4WLCA 3VD2A 5JLZB 3GSOA 3P3TA 1DANU 2AXGB 4MQXC 4ELME 4Y4FB 2PF6A 5I26A 3HE7B 3K46A 4WFGE 5HP5A 4LLVA 3GTTA 4QLWA 4K9EH 3CX5K 1DBJL 1W91A 5KSUA 1NEUA 2R0LH 2XPYA 3T0EE 1USQA 4RX4A 2W80C 1OD7A 1YMME 3MRQA 4HHWA 4BELD 3DX9B 3MUHL 4OCYL 1QI3A 2D0GA 2VAAB 3DJSA 2ZOUA 1PZ5B 4MD0B 5CJXC 5EC1A 3TONA 3OX8B 2FJHA 5GRUL 2EIMB 3T0WA 4JPIA 3DO7A 1IM3A 4QJ3B 1CFSB 4M3HA 3RWFA 4HUXA 2PXYD 4WI0B 5A6LA 3VNZA 1F5WA 3MGTB 3CZLA 1IT9L 5I18L 4FL4C 1G7PB 1M57B 2F8IA 3HMXH 4CW1B 3ELAT 2IALA 4XZ4A 4PR5A 3WL9A 4PLJD 5DHMC 5AKVA 5ESAB 4B50A 2FL5B 1HINL 3O2DL 4HG4K 2VLME 5IT2L 1CI3M 2OM5A 4J3OH 3BP4B 1HVXA 5DWUL 1KT2A 2QPEB 5ADOL 5KS9B 3GHPA 3OLDA 1IAKA 2P26A 1NCAL 1G7JA 2EO7A 2MQ0A 4ZTEA 5AAMC 4P3CL 1LE9A 4OIFA 3MLWH 5DGQA 3U2SB 1JZ8A 4PS7A 3NJXA 3QJXA 5I24A 1NDGB 1WITA 2QJDA 1QSFE 3HNSL 3MCLH 1GGYA 1ZVYA 2HXAA 4K8RH 5GJTH 1JGLH 2JB5L 5FXCH 2WN3A 4L29B 3OMZA 5JXAH 2X41A 2BXYA 1K4CB 2WQXA 3QDJB 1D6VH 3KMDA 4HV8A 3N1GC 3T0EA 3ULSB 4KJQD 2GUOB 2P8LB 3NOIA 4QRPE 3O9WB 4N0UE 1M05A 4L4VD 2A2QT 2HX9A 2YHGA 1FO0H 4JPWL 3PNRB 2O72A 5F7NC 3D2UD 4OM1L 4XNZB 1G7MA 1IEHA 2HVKB 2ZAGA 4U7MA 1ZGLA 5IBUB 5KTEL 1RI8A 2CDFA 2X5PA 3GXUB 3RLSA 2ZWZA 2LU4A 4DZBA 1UA3A 4KRPC 4Z3GA 1J9RA 3IS0X 2G4EA 4X99A 3SQOH 3EH3B 3ELQA 1JPSL 4AL8L 4F91B 1NCCL 4E5XB 2PUQT 1OK0A 1SJMA 3MRCB 2IIJA 2DWSA 3VYPA 1WJ3A 4YC2C 5CGMA 4U1MA 3ARXA 4HG4J 1XQ4A 2HFFA 2WSPA 4G7YL 1K6QL 1DVFD 2YRLA 1CT8B 1X5FA 1ACZA 3WE6B 3CVBA 3L1OH 3Q9QA 1MWOA 1INDL 2R23A 4I1NB 3DX0A 4Y2OB 1CD1B 3INOA 4LKCA 2FYVA 4YSTA 3T2NH 2H4EA 3FRUA 1HXYA 2XXGA 3DDFA 3RY6C 3S37L 2XPGB 1T89C 3AY4A 1AXTL 3K6NA 4YHZH 2J1ZA 3U1PA 4W9IC 3VXSB 5FB8B 3IGAB 5DC2A 4A7SA 1H3UA 3FUMA 3V6OC 3FONA 3DRQB 3T0VA 3BP5A 2BCKA 2V3DA 4JY5L 3S5ZA 1K8IB 2HT3C 3MV8E 3DV4A 2D2OA 1HWHB 1MFAH 2F74B 2EVIA 3UABA 1MCOH 3OKKA 5CU9A 1D5ZA 4PJ7F 4ZG1A 4QRPA 5ESQA 1ZGLP 1Z3RA 2XVKA 1ZWIA 5E9AA 4B9CA 1MHPL 1ZHLA 4QHKJ 3K6FA 2CM5A 1KJ2L 4PJIB 1JDCA 1U41A 4QCIB 2F53B 1T03H 4OF3A 1IC0A 4N0CC 4YHPB 4ZRGA 2X2UA 5CSBA 2VM9A 4UQ9A 3ZZLA 1JXFA 1FORL 3T3MB 5CBAB 3GT6A 2VDQL 4D9QE 4KVNL 1R17A 2BY2A 1FN4B 3KPRE 3HTLX 1XH2A 4XNQA 1R19A 2DEYX 4F9PC 2V3FA 1XGRA 1URZA 1GYCA 3G6AA 3X3GL 4FQIL 3LEXA 3ZBMA 2CKBA 1AHWC 4NI6A 1IGML 3FZUD 4TRPH 5DK0A 3LMJL 3K2IA 3UTZA 1Q9KB 1OT1A 3NCBB 2LV4A 3H9HB 5IV2A 1M2VA 5CGYD 1T66C 2VZ1A 3K6DA 3EHBC 4HA1A 4L4TA 3WGVB 5IGXL 4WWNA 5DRZA 4TQEH 3NQIA 4PJHB 3ERXA 3HC2A 2R4RL 3FSAA 4HWBL 4JRWA 3QPQC 4M1CD 2R7EA 5DEGB 4TUOA 1ZLEA 1TZOA 3ECWA 3QIWC 4B96A 5AVVB 5IJBC 1HQ4B 1MI5E 1I7TA 4MQXD 4MBOA 1UWXK 4UV7L 1SXCA 1H9DA 3VXSD 4ZMNA 1XGYH 2BH0A 2VYRE 2XJKA 4Q58C 1F3JA 2WMPB 4I77L 1IARB 3KPMA 4FQJH 1LO3H 2JCCE 4NCC2 3WTSA 1TLMA 4KRPB 5KSAC 1GGIL 4NN6C 1I75A 1NGPL 2R2EA 4AJ0A 2GBVA 4F58L 1RZIA 2PPCA 3ILPB 2WZ5A 2W9DH 4BZ2H 5FYJE 2JKRM 3SE4C 1QLEL 3FTVA 4F7EB 4YC2B 2PW1B 4GB9A 3L3HB 4H40A 3PWNA 1GMIA 1KPVB 1DUYA 5KEZA 4WIQA 1CE1L 2Z93A 2B5IC 1BQKA 1FFPA 2Y69B 4MJ6A 2C3VA 4WWPA 5F7AA 5DHEA 3PWVA 5IHUH 3FSZA 3B9KC 4F37K 3FCUB 3V52H 3V0WH 3WXWL 1KIQB 3LIZH 4XVSL 2Z8RA 4GKOA 4HHAA 5D2LE 1YEFH 4DESA 4B9KC 4E9QA 1F0LA 1JWMB 2BK8A 3C5ZC 3QA3A 2WANA 2ZYHA 1OM3H 5KSBE 5FO7A 2EJ1A 4X83A 3IPFA 2WUCH 3WLBB 5E23A 1RUQL 1NDMA 4QRFA 3RRQA 2WQVA 1F3DH 2WLIA 1R9FA 2WAQA 5BZZA 3IPEA 1Q0YH 2QLYA 4NO0B 2PYED 1BJMA 5BZDA 5C7XH 3TPKA 3F01A 1A1MB 2K3TA 4FJ6A 2AV7A 2N4IA 4N8VG 3HNVH 2LGNA 5B38G 5CP7B 3CVHL 5F9JB 5DJ0B 3NIGF 2H1PH 3V0HA 2XOTA 3ARRA 3GDCA 5JIQA 1LO0L 5GGSA 3VFNB 3O0RH 3MJGX 4N86A 2FO4A 4YDIH 5SX5K 4P0DA 4IKKA 4KRPD 1TJXA 2P44B 1LO5A 4PJFA 3VX0A 1QFWL 2ZKXA 4PLKC 2EE6A 3V2AR 1I8MB 2CBTA 1BREA 1ORSB 1H6FA 1P7QB 3IWVA 4Q9CA 1AHWB 3L2LA 4FD0A 1J1XH 5HDOA 4DKEH 1FWXA 2F5AL 1AJ7L 2YFNA 5H37G 4AIXA 5JIDA 5DTFA 5DT1L 5FKPB 4DSYA 3AGVA 5GS1C 1LVEA 3EHBB 4LEBA 3ZLQC 1CU4H 4NGHL 4OD1H 4X6DF 3EFFB 3SKUD 1AKPA 4AVHA 2HLAB 1G9ML 3AT0A 3QFJE 2O6FA 3FSWA 5EN2A 3GMNA 1SLWA 4BCZA 3GGWB 4ES8A 3NIFE 4FN0A 1VFOA 3MRRA 4L9LC 5KAQF 5IFJA 5DC0A 2BP0A 3WN5B 3AUVA 4WGVB 2YXVA 3L9BA 1QKZL 1R5IA 4HKXA 2C4FU 4HIEA 4JQXC 3UBHA 4HZLB 3LRGA 3QDMA 3DUSB 5DUPH 5T3XD 5LGYA 5LQBH 4Y88A 2CHNA 1ZD6A 2HT3D 2AJYL 4RDQF 1KJMB 1NCDL 1R3JA 2XZZA 5KSAB 1QG3A 5DS8A 3ZIMA 2DJSA 4NN6B 2BY0A 2OCJA 4NO0D 4YBHA 1L6ZA 4B6ZA 2IXQB 3JWOH 3UZVA 4X80L 1IAIM 5LN8A 5EF1A 1SGKA 3BW9A 4X6CE 4XNXL 3AACA 5T3ZD 1FFOB 4N0CD 3CPLA 2Y0SA 3MZTA 1NBZA 3CFJB 1DBJH 3CSGA 3O41A 3PXLA 4JY6A 3DGCR 2P5WE 5JW3L 2B5IB 3OAZH 3FUIA 2GITA 1IKNC 1LD9B 3P3RA 1NEZG 4FTVA 4YR6A 4RETB 1NJ9B 1HNFA 4G9DB 3TBVB 3CDYA 3GXNA 4OCYH 4OZHF 4X6BB 3HCVA 4EDXA 1G87A 2B08A 4FNUA 3U6XS 2EACA 2XACC 2RMNA 3ORJA 1JOIA 2GIMA 1ZVSA 3PP3K 4RZCB 5GRUH 3IMVA 3H4FA 4OGQC 1TQTA 3C5ZB 1JNLL 2P80D 3FUFA 2CGZA 2XFGB 4MHHG 4BV1A 4BKTC 1IT9H 5I18H 3EDFA 3JTSA 3KPOB 2EEBA 1T66D 3B2VL 1Q90A 1PYWA 2YBRB 3EHBD 3QUMA 1WISA 5T5FL 3V0FA 4NFCA 3MZGB 1HINH 3O2DH 3QPQD 2UVFA 4F1ZA 5IT2H 1U8PB 3QIWD 5DWUH 3E6HB 4ODSL 5ADOH 4JAMB 1U8HB 1NCAH 4IHOA 2R29L 2X0UA 4ODXA 4HP5A 5K9OB 4P3CH 5DS2A 3VNYA 3FDWA 1N18A 2RQEA 1DO6A 4DAGH 5GSVA 4LLUA 2Z8WC 3HNSH 5LG6A 5KSAD 1QR1B 4BKSC 1S46A 2D8KA 3NRPA 5DJCA 2Q76B 2ENSA 4HHGA 2JB5H 1KYFA 1SEQL 4U3SA 3U0PB 4P46A 4NCDA 4BM7A 2QTVA 1IGIL 2V37A 3H9SE 3V0VB 3VI3B 3BH8A 5IQ9B 5C92A 3KLDA 1O9WA 4I2XE 5T1KA 1EHLL 4W9ZA 3R7QA 3US9A 5GS0L 4JPWH 4K71C 1UJ3A 2ENPA 4F7CA 4OM1H 1F58L 5H4YA 1TJHL 3B9KD 5KTEH 4YXHL 2Z4QB 4NNXB 2DM4A 1EHKB 3DUUA 4WW2F 1MFMA 4NZUL 4U7KA 5DD1L 3V8OA 2QHLA 4JZJC 2FH8A 3VXMA 4AL8H 1C9SA 1A8JH 1JPSH 4GEJA 1NCCH 3WJLA 3C5ZD 4P4RB 5FCSH 3UTTA 2VN3A 2XZAL 4AYFB 5JOFA 4WI7A 2ZKHL 1LEGB 1G9EA 5F3BA 2NLJA 3GTNA 1KLGB 4MYWB 4DEWA 3U9UB 4JK0D 2JLPA 3DI2B 4ODHL 3D8MA 1ECZA 5DJXB 4G7YH 4H26A 1I8AA 4YO0A 1K6QH 2WZPD 1QZNA 5GS3A 2OJEA 4XOEA 3OZLA 3LNDA 2HFEB 4G9FB 2Z65C 4OLWL 3MOQA 1TU2A 2F54B 4X8JA 3SQBB 1INDH 2DV6A 4HJ1A 3O4OC 3A6OA 4BHUI 5GRXG 3TEZA 1RSYA 5I2IB 4NFBA 3IKKA 5DJZB 3S37H 4AH2A 3IKCB 4AQ1A 1MXGA 3RWGB 4XMWA 2ARJQ 5KSVB 4LHJB 4DN4L 1Z32X 4KRNA 1Q1PA 1A1OB 4CSZA 4OCLC 4JY5H 3QHZL 4Y8DC 3BVXA 3KPNA 4UQBA 4NKDB 4TVPL 4PLKD 4XCYA 1Q0EA 2D03L 3N91A 2ZUQB 1ZPLA 3TNNA 3BUYA 5D7IE 4R97C 5KUKA 1E3ZA 3R4DA 4ZMWA 1MHPH 2WXMA 1F2QA 4Q9BA 2UZIL 1PF3A 3PP4L 1FV1A 4Z78A 1KB5A 1KJ2H 1NUDA 3FT9A 3HRZA 4X7DC 2C1OA 3AWEA 2J57A 4E9WA 1M56B 4JFPA 1I7UA 2AK4B 4LLDB 4Z18A 1UEMA 5D1QA 4WHYG 1WT5A 1TF4A 2XVLA 1YYML 2OSXA 1FORH 2VSDA 3DPBA 2YD0A 3E1F1 4UDUA 4W81A 5IMMB 3UZQA 3N40F 5DJAA 2VDQH 4KVNH 4E41A 5CU5A 3UTOA 3VFVA 1M3IA 2ICWB 3T4YB 4RLDA 1SEBB 4G8AC 3R8BB 4FQIH 3VTMA 3X3GH 1MWAL 1IGMH 3LMJH 4Y8AA 4JR9L 3RY4A 1Q38A 4MGXA 3VX1A 1KELL 4GW5A 1NUFA 3MUY1 3RZCA 4U1SA 2N0MA 2WJ7A 5IGXH 2AC0A 1MRDL 2CJ3A 4G9FD 4OCSL 2Y2TA 2CXGA 4PRIE 2XWJB 2R4RH 4HISA 3DLQR 4HWBH 4E2OA 3NJIA 2P24A 4FE9A 3GK8L 2VSMB 3EIFA 2HFGL 3NRQA 2OK0L 4PJXF 1H15A 3AU1B 3FCGA 2E7CA 4JJOA 4TNGA 4UV7H 2BSDA 3TPUB 4CBZA 4J4PA 3QEUB 4JKPL 5EU6D 3TZVC 3ISRA 4P2AA 5DFWH 2ZOKA 4X6FA 3DO3A 5AW2B 3RWEB 3K4ZA 2Q86B 4I77H 5EUKA 1JZJA 2IH9A 4MCNA 1NGWB 3FW6A 2PP7A 3N3EA 1U2YA 1QBAA 1GGIH 1SMOA 4ZDHA 2BP8B 1GC1L 4GG6E 4F58H 1NGPH 3QO1A 4J8RA 1KTDA 4DFIA 3TBSB 4JKMA 2LR4A 3KBFA 3EOBB 1ET5A 3AMKA 1QLEH 3Q6GL 2UUDH 2GI7A 2ZZUT 3L5HA 4NKMA 5E4AA 4JVPA 3QNXB 1WBYA 4YE4L 1A7QL 4W4NA 4NJ9L 5MENA 1VEPA 5EC2A 4FG2A 4YDZA 5DK2B 5GGSY 2D31A 3FRPA 4L4VE 5JMRA 2TSAA 3WXWH 4XVSH 1ZLWH 3ZDYB 1WHOA 5GGUA 5JYMA 3CFEA 2VO5A 2YPLB 5HDWA 3OMIB 3GM8A 3P11L 3LVTA 3F85A 3D69B 3T3PE 4IMLA 2PXYA 1IC5L 3FB8B 4IRSC 2C9RA 2FIRT 1RUQH 1LHZA 3SO3C 3PL6B 5DLLA 5AOIA 4GG8B 4QYOA 4BKLA 5BPPA 4X9BA 4MNHB 3EO9L 2A6JB 1AOZA 1ED3A 1F1AA 4R97B 4Y1AB 5K9JL 5JQIB 4OCMC 3UH8A 3WIIL 4A2DA 4D0BA 3LPGA 3CVHH 1I8LA 3QO0B 5BOZG 4P2OB 3W39A 2A73B 3O3UN 5DEFB 4FADA 3WNLA 3GJFB 5CFAA 5E1AB 1LO0H 25C8L 4GG6A 4R4BB 4Y5YA 1SMAA 2VLRB 4LVHC 4DCQB 4HS6B 3UAAA 3W0WB 3MV11 5C97A 1QFWH 3I85A 3TVMA 5ACZA 4JANB 1EFXD 4KH2A 2W65A 4YJZL 3NJKA 2X10A 1J0IA 2F5AH 5JLZA 1N10A 1AJ7H 2AXFA 2O93L 2AXGA 5DT1H 1WTLA 4Y4FA 4ZT1A 3HE7A 1IBHA 5IB2B 1IGYA 4YHML 3LYRA 4Q0XL 3MCKA 4NGHH 1QWUA 4Z7WB 5DWPA 1E4XI 1G9MH 1NL0L 3CVDA 1A4CA 1MCHA 3DX9A 4G11A 1ZSHA 1YPZB 4JKKA 4YFLF 4NZ8A 4UTCA 5HYEA 2VAAA 1AIFB 1PZ5A 3MNZB 4J27A 4Q6IC 4Z3FA 2B59B 1VIWA 3OX8A 5FYJU 3TZVB 5K1NA 4JZOB 4WI0A 1I3UA 1QKZH 4L8SA 5EMYA 2FLBT 3MGTA 3U9PL 1OEZW 5KVEE 5IHZA 1BVLB 4WTZG 1MFCL 1JFQL 1G7PA 5KG9B 3UTQA 5FGCB 4CW1A 1KPUB 2AJYH 1NCDH 3WEXA 2FL5A 4G8IB 3OR7B 4XAKD 1NUNB 4BINA 5JXEC 3P3SA 3CX2A 4KWUA 3BP4A 3P40A 4U05A 2BS8A 5KS9A 4X80H 2E8YA 4XNXH 3POHA 5JZ7C 1KF9B 4TTGA 3FQUB 1A9EB 2LAGB 4GRMB 4M3JA 5JW3H 1VACA 4QHKI 1P1ZB 1OB1B 2CALA 2X4PA 2XQYA 3PGFL 4HQQL 4W9LC 3U2SA 2HRLA 2IGFL 2FB4L 2VLKB 4IBVA 1E9PB 2YA0A 1WWAX 2X38A 2YUVA 1IIKA 1EWHA 1NDGA 1QTPA 2QR0B 3BSGA 3VXSE 3W0WD 2MQCA 3RURA 4CGUB 2CHZA 2YD9A 4L29A 4QIRA 2DQMA 1JNLH 1K4CA 1ZS8B 3QDJA 4NDMB 2PKDA 4Y5VB 4U6TA 3ULSA 2GUOA 3T1FB 5HHOB 2CRYA 2ENYA 3B2VH 3IN2A 4AZUA 4N8VB 5D4JA 2OJ1A 3IDJA 5T5FH 3ZE2E 4PJIE 2HVKA 1UFUA 1PEZA 3KVDD 4JKLA 3VMPA 3KW7A 1GZHC 4HLZG 2K4WA 1P84K 2I24N 4ODSH 3GI8L 3U4EA 4BA8A 1NANH 4YDKL 5BQ7B 2R29H 3QCTL 4ZMQA 4E5XA 4WNSA 5IHLB 1BVZA 3TZVD 3MRCA 4DK5A 3D34A 3VXUB 5AVRB 2WD0A 2F15A 5JQHC 2ATAA 2HLFC 2F7RA 2H1LM 1QO3B 3OMNB 2APSA 4BE5A 1CT8A 4GFXA 1SEQH 4DJMA 3OTTA 5BUPA 4Y2OA 4AV0A 3TEWA 1CD1A 1R75A 1IGIH 1J86A 1DJZA 5KAQG 2XPGA 1EHLH 4GSDL 5GS0H 3ECUA 4B41A 1DBBL 3BE1L 2PYEE 3UZEA 5A2CA 5C71A 3VXSA 5FB8A 3IGAA 5I1AB 2QPUA 1KACB 2JLLA 3EADA 3TFKC 1F58H 2VLKD 3IYLW 1TJHH 2DPKA 5L2JA 1YQVL 3DRQA 4Z7AA 4OJCA 4YXHH 1DQIA 5JHAA 1K8IA 2QTEA 2ZUUA 5DD1H 4NZUH 4HDIB 4Q6IB 4JFEB 3T09A 4EKXA 5T33L 1OV8A 1A5FL 3K0YA 1ORQB 1LDPL 1NMBL 3D18B 2LU7A 5IMLB 3AM8A 4IRSD 3OG4B 1NICA 2XZAH 4ZX4A 3BQVA 4PJIA 1AZZC 2ZKHH 4QCIA 2F53A 5DQJB 5E1GA 4ZMTA 4MNGE 2RQ8A 4S1DC 4YHPA 4HCFA 5HBBA 4ODHH 1RFDL 2B2XL 3LNEA 4JBSA 3LN5B 1Z9PA 2OQJB 4P48A 1P84J 1U36A 1UD4A 2E3VA 5CBAA 4OLWH 2WO2B 2ZCZA 3MLUL 1CL7L 1FN4A 1NEZB 4U1HB 2K7PA 1YN7B 1IBYA 3W5MA 1AD9B 5EO0A 4L1SA 1P53A 1CJYA 4TLKA 5I8KL 3SDYL 3VD5A 4YE0A 1BVNP 2R4SL 5LN4A 3QJQB 1LK2B 3CUPB 3DOSB 4DN4H 1Q9KA 1MW1A 3TBCA 3H9HA 2WQRA 2BC4A 2MNUA 3QHZH 4F5CE 3O8XC 3I2CL 4TVPH 3H2QA 1MCJA 3VQ2C 4PJHA 4BK8A 2D03H 3TJEL 4JJHA 3MNMA 1P4IL 2A3TA 4N3TA 5T3XE 3DHMA 5DEGA 1XSOA 5EIIB 4AMXA 2UZIH 3PP4H 1HQ4A 3A4AA 1RL1A 1I53A 2G30A 3H7BB 2GJPA 2EDJA 5GGVY 3EJPA 1F3DJ 3WUWG 1YYMH 3OKOB 1ZT4B 2WMPA 1RH8A 3MFFB 1ZHKB 5T3ZE 2Y25A 3O6FC 5HHMB 1QP1A 4KHXL 3T04D 1A6AB 4PS3A 3ILPA 2AJUL 4BFEA 2HVJB 3WENA 1MWAH 1EQWA 2VXQA 2N7SA 2DMHA 4F7EA 1TQCC 1WZAA 4TV3A 4JR9H 4YAQB 3VGGA 3MREB 1XH1A 2PW1A 2X3BA 3L3HA 1KELH 1L9RA 2QSTA 1KPVA 1QI5A 1JPEA 4R2GB 5IEHB 3HBZA 1GJUA 1MRDH 2CA4A 1DVUA 4OCSH 2X1OA 3OAZK 5JXED 3CHQA 1ZV9A 1OAXL 4Y7OC 1KIQA 3GK8H 4MQSB 2HFGH 3CN0A 1XFPA 2OK0H 3Q8AA 5J11C 2WM0A 5FFOA 3QZMA 3LKNB 5JZ7D 3II1A 3RY6A 1T89A 3ZE0E 2WCSA 1JWMA 4JKPH 1P5UB 1KCLA 3IT8D 4GAJL 3GQFA 3V6OA 3ARFC 2P48B 3WLBA 1WYJA 3IFNL 1JZEA 2RBLA 3EBAA 3R0NA 5LB1A 1GC1H 1A9VA 3KYNB 4F8OA 4NO0A 4OCWL 1M7IB 3VG9C 3FTSA 1UTDA 1A1MA 3ZL4L 5K59F 3Q6GH 5CP7A 1CGTA 5DJ0A 1H5BC 1I8KB 4E9YA 4FMFA 4PV8B 4B9FA 4YE4H 1A7QH 4K73A 4NJ9H 1KSRA 4XVJL 1N64L 2VXUL 1FSKB 1XL4A 3B9EA 3IFPB 3VFNA 4BIKA 5HHMD 2F61A 1HAUA 3N55A 1B3JA 5K1VA 4UF7C 2UX7A 3MU3A 2Y7MA 4G7SB 1AP2B 1L9PA 3MROB 3P4OB 1ORSA 1P7QA 3P11H 4HEMA 1AHWA 4JFVA 2EKSB 1CYGA 2P80A 3LKPB 2B14A 2M26A 2Z0UA 3O4LB 4ETQB 1IC5H 5IJKC 3N44B 5FKPA 3F05A 3CMOL 3OKMB 4X9GA 1FG9C 2HLFD 3BZ4B 2P47B 3KLKA 1I1AC 4NEHB 4R2GD 2AQ2A 5C08D 4YZFE 3DVNA 3EFFA 3EO9H 1SZNA 2HLAA 2P52A 4B3EA 1XO8A 4KBPA 4ABUA 5K9JH 5INCA 2WXHA 3QIWA 3GGWA 7PCYA 3WIIH 2CLZB 3E8VA 1YEGL 3QIUC 4H44C 3WN5A 4WKZB 4ZFGL 3RILA 3TFKD 3CFBB 5D7LB 3LX9A 25C8H 4HZLA 5DD5L 3ZUNC 1DCLA 4DK3A 3DUSA 4J1UB 3C5XA 4Z3IA 5KSAA 1PVHA 2FVNA 1OP5H 4X4XB 1ROCA 2H6PA 4A38A 2ADGB 1BAWA 3TWYA 1OZTG 2IXQA 4BGLA 1OAYL 4AJVA 1E4WL 4KH9A 3C9NB 2CZNA 2O1AA 3ARWA 4NT6B 4QKTA 4S1DD 3WGUB 2ZX6A 4YHMH 1J9CT 5AEAA 2B77A 4Q0XH 3VI3E 5IMKB 4KNQA 5HHXL 3S3DB 1LD9A 1KTBA 4OFKA 5FCUL 1NL0H 3NBNA 1NJ9A 1AZCA 2QGBA 3PRZA 4G9DA 4MLIA 3BGAA 1TXKA 2EDBA 1W72L 2JIXB 4PUBL 4X6BA 2CUMA 4Z5RA 3DX2A 4KO9A 3WXVL 4BE6A 4K94C 5J11B 4Z7QE 5E9DE 1BJ8A 1OTUD 2GHWB 1F4XL 5I71B 4RZCA 3V0IA 4F37F 4HULB 4EBQL 3C5ZA 4PBXA 1A7NH 2CGYA 3O4LD 1KBKA 3ZGIA 2FEDC 4JGJA 3U9PH 1J7VR 4HK0B 1MIML 1MFCH 3F3HA 1JFQH 5T1MA 1SOSA 2QFRA 3KPOA 2H3NB 2BMKB 3O8XD 3ULVF 2YBRA 3CIQA 4L48A 2WZPA 1HOCB 4OIAA 5DZ9A 1U8PA 2JKIS 2ZOWA 3BAEL 4BK4A 1AIZA 2PABA 3E6HA 4JAMA 1BCIA 4X7EC 2N1KA 2C34A 1U8HA 2Z7UA 5DVKA 4I18B 1GKOA 2K8QA 5K9OA 2I5YL 5D7LD 3D3VD 1JGEB 3PGFH 3IDNA 4HQQH 5LGHL 2IGFH 3RGHA 2FB4H 1A2YB 3O6FD 3MX0B 1VDGA 1J87A 5EU6E 1QR1A 3HUJF 1B0RB 1YG9A 1A66A 5GS2H 1GW6A 2AJ3B 4PYHA 3U0PA 1UD2A 2DM2A 3OKLB 5ICXB 5KANG 4DIXA 3V0VA 1WA2X 3M86A 4JRYB 4JMXA 1MCSA 5B39G 5FW7A 5IQ9A 3VI3A 5IESL 2H47C 1H8SA 1A6UL 2M83A 3DETC 3HC4L 4JE4B 1ZTXE 4MRCA 1NCHA 3FH5A 1V7NL 4A66A 3M07A 3UADA 1KG0B 1J5HA 2Z4QA 4NNXA 4J2QA 3GDBA 2WIIB 1B88A 3VD4A 2ZX7A 3GI8H 4L0PB 4YDKH 2ZTBA 3F58L 5C6TL 3QCTH 1EO8L 5BXFB 4M5YL 4P4RA 3ARGC 4FC3E 3ARFD 3AS2A 2IOIA 4MLSA 4AYFA 1QTSA 1LEGA 5IUCA 1MCWW 1UH4A 3U9UA 4ZFOL 3V6ZB 4R7VA 2Q9OA 1V05A 3HZVB 5F3HB 4FFVD 4G9FA 2F8VA 2HFEA 3QQXA 4XCNB 3SQBA 2F54A 4GAFB 4N3UA 5I73C 4YDVB 3P3UA 2BRQA 1ZLWK 5B8CC 4JGNA 1I3VA 2ZXBA 3E2HC 5DJZA 3LRSA 1DBBH 3BE1H 5DUJA 3SE3C 3RWGA 5SWZB 2XN9B 3DTDA 5I0ZA 4NUJB 2EYRA 4K7PX 1RUPL 4P2YA 4U1KB 3BLPX 1AHMA 2RALA 1YQVH 1A1OA 4L3EB 3RIKA 3HLAB 4BFBD 3WY4A 2BJML 2FQEA 1JBJA 3P9MB 3MA9L 1QD0A 3BYYA 5L8KB 5GIRB 3DK0A 5T33H 2R1XA 1A5FH 4G83A 1LDPH 1NMBH 2CM6A 1MCQA 3S2AA 3DC0A 2NR6C 1MCPL 2IWFA 2P8PB 3O3EB 2VW6A 1I1AD 3SO5A 2AK4A 2N59A 1RFDH 2B2XH 1OSZB 4Z23A 1KIPB 1V3LA 2GY5A 4XMTA 4ZAKC 1GCYA 2G3XA 2UXFA 4OLYL 4P5TC 5IMMA 4UAOB 2G0KA 3MLUH 1CL7H 1RERA 1SMDA 4WO4B 1OCZB 3ATDA 2ICWA 3T4YA 2XFXB 5I8KH 3L3KB 4GS7B 3SDYH 1CF8L 2R4SH 2NDGA 3KXFD 2GFBA 4Z3EA 1BAGA 2VXTL 4PGDB 1EX0A 3I9IA 3FU9A 1P6AB 2E9GA 3BKJL 4DETA 3I2CH 1CFQB 4MD4B 5BZXA 3ZZ1A 5AW1B 1V54B 2QADB 1NPNA 2XWJA 4QGYA 3TJEH 5FUCC 4HJUA 3HS8A 4U2YA 1UD5A 3QDGB 5C3LD 1BF2A 3AU1A 3ARVA 1C16B 3DROA 4XAKE 3OZKA 3TPUA 1DQVA 1H8LA 4A7UA 3QEUA 4R84A 1HESA 3NK4A 3HG3A 2XICA 4LNRB 2Q86A 4Y1TA 1HL9A 1CQKA 3KYKL 3ZL2A 2C9UA 4OTXL 1XGPB 3L2NA 2GK0B 3VFPB 4O2FB 4KHXH 2BP8A 3CJJA 2NUTB 4HLJA 3FKUS 1CICC 3TBSA 3JV4B 4J3UA 5KBLA 2AJUH 3UJTL 4G70B 3EOBA 2AITA 2FEDD 3DARA 4KY1L 4GT7A 5GRVL 3VWJC 1IAMA 3QNXA 4CVUA 1B4JL 3I3BA 3X13B 4HKJB 1J05B 5DK2A 4MB5A 3C6LC 1OAXH 4IIQC 1UA7A 4QHPA 1JVOA 5HGHB 2XXMB 3WJJA 4FZEL 3RDTC 1TQUA 4R0LC 2W81C 1XTLA 3GHBL 1TSHA 3IRCA 3KH4A 2C3HA 5B8CB 3E2HB 3PGDB 2OA9A 2YPLA 2VDNB 2WZ0A 3QXDA 4LSPL 4XPGL 1BLIA 3D69A 4D9RD 3HC3L 2R83A 4GAJH 2CKBL 4OZFG 3FB8A 4KZEL 5JNYA 3ME0B 2YA2A 1YY9C 3IFNH 5I74C 2UWEB 5C2BL 3PL6A 5A6IA 4WEMB 3VD1A 2KZWA 4GG8A 2ZQKA 4URTB 4MNHA 2A6JA 4LFHG 3WCYA 1S7XB 3T6QC 4D3CL 4OCWH 5E2WL 4WI2A 4S1SL 1H0DB 2V9TA 3QDGD 3RGBA 4M5TA 3ZDZF 3ZL4H 5ABZA 4LVOC 1EEZB 3QO0A 1QBBA 4P2OA 3DETD 5AB2A 1W8NA 3RVTC 5DEFA 4NSKB 3K74B 3GJFA 4XVJH 1N64H 2VXUH 4YEEA 5E1AA 4ZAKB 4OW6A 3L5XL 4MQ7B 4R4BA 5E00B 1L5GB 2ADYA 3II2A 2VLRA 3CNKA 6CGTA 4DCQA 4HS6A 3W0WA 4PJDE 3ZDXF 3MNVB 4JANA 1ZSDB 3D6GA 3GLZA 3ARGD 3GZQA 3P69A 1TZ8A 5LO7A 1DJWA 1UC6A 1O7VA 5B3JE 5CSGA 1UKQA 1A22B 1WBZB 3CMOH 1KDJA 1I4FB 3FT3B 5IB2A 3U46A 4XN9A 5D72L 3D85B 4P06A 4AEHL 5JDJA 4Z7WA 2X2IA 4NNPL 4QHUB 5LJYH 3CGTA 2KL6A 3P77B 3VUAA 1I1YB 2Y9RT 2MCPL 5ESVA 1YPZA 3WUWB 2VZTA 1U8MB 4JN2B 4LXFA 1AIFA 2EQDA 4X5WB 4HEPA 2XIDA 3MNZA 5L4IA 4KKZA 2WHVA 2B59A 4PRHB 1YEGH 3TZVA 4ZFGH 1XL6A 2AEOA 4JZOA 1GY2A 2CJSA 2X4TB 4XAWL 5DI8B 2OYLA 2MOVA 1PQZB 3FB5B 5AYQA 1BVLA 4HMDA 1RZKC 1LK3L 5KG9A 5L7XL 4IBWA 2GJRA 5K39B 1KPUA 1MKFA 3S4SB 3DWTA 4XZUA 1KYUA 3N5AA 2I32A 2X09A 4G8IA 2VDKL 4PW4A 3OR7A 1CICB 1UD6A 4JO2L 3BKYL 3RX5A 2NR6D 1OAYH 1E4WH 2B4CL 3G6JF 5I19L 1JXGA 1BF5A 4B9YA 3K5RA 1IGTB 1A3LL 1A9EA 3FU7B 1KOAA 1G5AA 4GRMA 3B8SA 3ARQA 4ZO8A 3I6KA 1P1ZA 1OB1A 2J25A 4ZAKD 5HHXH 5HPOA 2CWRA 3TYGL 5HYJD 2VLKA 4P5TD 5FCUH 2IOOA 3RJQB 3V6BR 2VR8A 1OAQL 3WXVH 1W72H 3G9AB 4PUBH 3S9DB 4ZYKB 2VDLL 1SF5A 1F4XH 5FYJL 3QNZB 4JG0L 2VC2L 4YHOL 4EBQH 1JDAA 4JPKL 1B2WL 3K8KA 1ZS8A 4NDMA 2NOYA 4Y5VA 1HHGB 4IRSA 1MIMH 4JFFE 4LF3B 3T1FA 5HHOA 3MO1A 3AREC 4N8VA 3TNMB 3KD4A 3D85D 2CO6B 2FJSA 5B38A 1ZEAL 3L8QA 3IDGB 4NO2B 3LRMA 2R56L 1NGXB 1CFBA 3ATBA 3BAEH 1KY7A 2Q2EB 3VQ1C 1PW3A 4HBCL 5BQ7A 3EJCA 4PRHD 4PS4L 2EVJA 4PD4K 4BFGA 4NQUA 2XX0A 2I5YH 2FHFA 1BF8A 3LKQB 2WCPA 2JI2A 4JRXD 3VXUA 5LGHH 3VMNA 2R0ZL 2RJMA 4ELKB 4J3TA 3ZU8A 4KJWC 3FCBA 3HG1B 1H3WM 1JN6B 1QO3A 2AVFA 4EXKA 4AM0B 4WHTB 5ICYA 4OZIE 1CICD 3QCUL 1DZBA 2H32A 3DBXB 1UFGA 5HSFA 1J0YA 2FLRT 1J0ZA 1UWGL 3KJ6L 1IZKA 4V1DB 3VWJD 5IESH 4J3BA 3ML9A 1GJWA 1A6UH 3TO2B 3D52A 4G8GB 4KX8A 3HC4H 1SYVB 3FFDB 5I1AA 3T6VA 1EIBA 1PKOA 2KERA 5CF3A 1D9KC 1V7NH 1ZV2A 2F0CA 1A1NB 3C6LD 4KKNA 4BSVB 3CH8A 5C9JB 1CO1A 2UZYB 3H3PL 5GSRB 2RB8A 5J89A 3RDTD 1AFVL 1RZJC 1ZS2A 3OWRA 4JB9L 4HDIA 2YEZB 4Q6IA 4JFEA 2EZ0C 3F58H 2XBDA 2XNAB 5C6TH 2J20A 4GEIA 1EO8H 2VGLM 4M5YH 4IKLA 3BPLC 2CBQA 3D18A 3FBKA 5IMLA 2XV2A 2NYZA 3O6KL 1YY9D 2YFOA 1JYWA 1IM9D 2QT6A 5DQJA 1KBGL 2XTLA 3UYPB 2YEVB 2E7BA 3LN5A 2OQJA 1A6ZB 4WUUB 2AP2A 3QUML 5F7YC 5JXEA 2FJUB 2C1PB 5GRJL 1AYOA 4QF1B 1JYVA 2RHEA 5C08E 3I9GL 3RUGF 1NEZA 4H7VA 1MVFA 4U1HA 5AZEL 4G1MB 1YN7A 1AD9A 3OQ3B 1FVEB 3RVTD 4R4FL 4DHLA 1LILA 1HSBB 3NSCA 2RA1A 1AD0B 1LK2A 1VFBA 2WV3A 2XZQL 3CUPA 3DOSA 3LDBB 1RUPH 1ZDSA 3K8LA 3MBEC 2Q10A 1GGUA 4DP9X 1FYTB 4KJYB 3UBXI 4Y7MA 2BJMH 3B3IB 2V9UA 1BHGA 3DSNB 3MA9H 4GSXA 4WFED 3SDXF 1NFIB 4IU3B 4A39A 2YPKB 1W8EA 1U0QA 4QTIL 1QWHA 5EIIA 2FLMA 5BO1L 1MCPH 4DPBX 3H7BA 4WWID 3ULUC 3AREB 3SGKC 4MMXC 5IUSA 1FZJB 4JQVC 1KJ2B 4IW4C 3OKOA 1ZT4A 1J9TA 5AVWB 4OLYH 1ZHKA 1O9ZA 4CKVX 3MUGA 3I9PA 1GZHA 3HVNA 3ZTJG 3E7JA 2DLEA 5E1HB 1RURH 3W82A 2EDNA 1A6AA 1OP5K 2OMNA 5CGBA 3PS6A 1QSED 1F4HA 2HVJA 5HGDA 5C8JA 1CF8H 4H8QA 3AS1A 4LP4A 3BWAA 2JV6A 4CVXB 1MUJB 3ENEA 4Y16C 4YAQA 1MFDL 2G9KA 3MREA 3ARPA 4LCWB 4TUKL 3VFGL 3TM6A 4CC0A 1MJ7L 2HRPL 3BKJH 5ALCL 4RQQB 5IEHA 5LAXB 2IWKA 1KXVC 1TPXC 3AABA 1SHSA 3RHWK 5I76A 2F1AA 3K6IA 2Q7AA 1N59B 2IGTA 3LKNA 4MQTB 3WUZA 5DZVA 2IO5A 1P5UA 1GMEA 4NWTL 3Q05A 3BPNB 2HJLB 5D5MB 1D9KB 1CG9B 1FYTD 3QFDB 5E0QA 3CLFL 3KYKH 4OTXH 1TQSA 3D3VE 4MCYA 1TKWB 5PCYA 1ZIBA 4Q2ZB 1VGEL 4C58B 2FR4B 3KYNA 3UJTH 2R59A 1M7IA 3F84A 4XODA 5TJWK 4L5FE 4KY1H 1B4RA 1GAFL 1HAWA 3ARED 1LE5B 5E5LA 1KB5L 3NCYS 4PV8A 1B4JH 4ZW3A 2XXFA 3QXAB 4UQIM 1L3NA 4EN3C 4IEFB 2YBGA 3IFPA 1UA6L 1ZLVH 2B39A 4LQFL 2BSCA 4QNPF 4YHYB 3T2QA 3PV6B 2VR9A 3F6JA 1CLCA 3C75A 1K4DB 4ORZC 5F71A 5DUBB 1AP2A 3MROA 3P4OA 5C0BB 4LSPH 4XPGH 1A21A 2C8NA 4R5XA 1PX3A 2EKSA 3HC3H 1BQ5A 3LKPA 3Q2NA 2CKBH 3O4LA 4ETQA 4F2MB 4KZEH 3MBEB 2A9CA 3ALWA 3HW7A 4KJWD 3UO1L 5C2BH 5F9WB 5L0QB 3QUXC 4TQHA 6PAZA 4A2LA 1FAIL 5AKRA 2FE0A 3G5XB 2VN7A 2X6MA 3PU7A 1CC3A 4D3CH 5E2WH 4S1SH 5IOKA 4IDLA 2GVYA 4P2RE 2WVTA 1H3TA 4HZAA 1T7VA 3NJJA 1TVHB 2CLZA 3FN0L 3ZYZA 1GS7A 1X44A 2N7BA 4MMXB 4QRUB 4WKZA 3WAKA 3FL7A 1E9QB 4C54A 4BWWA 3CFBA 3D3VA 5D7LA 1D9KD 3CVHB 2KPNA 4WHDA 4L1TA 2D9CA 1BZ7B 3BAXA 5GGVL 3L5XH 4MD5B 3DGDA 4ELDA 1V3KA 1C5DB 1EH9A 4J1UA 1K3IA 4PJ7E 1KXHA 1P7BA 4ZO7A 3BZ5A 2EZ0D 4X4XA 4WV1C 2ADGA 3D87B 3FF7A 4FJYA 2B20A 4HC1A 1FL6B 1ASOA 2ZX9A 4J6RL 4OD2B 3C9NA 4YFEA 1IU1A 1NIDA 4NT6A 3B2XA 2X4RB 4ONHB 2WWOA 5D72H 1XB8A 1PIGA 5IMKA 4L1BA 4AEHH 4NNPH 4DKDC 1N3NB 4DO5A 2MCPH 3IBOA 4MAYC 2JIXA 4QXUL 3WO3B 3HAEG 3FO9B 2AFNA 3OJDB 3AXLA 2UV3A 3WDHA 3PJLA 5C0BD 4DOHB 2EILB 4PJBB 3RB7A 5JPNC 4LSUL 3MLRL 5I75C 4XAWH 3MBED 3U82B 4HK0A 1EAPA 5L7XH 4YDLB 1LK3H 2NXYC 4RFNC 3U4AA 4DERA 3WY1A 4LASL 2ROXA 2H3NA 2BMKA 3NJHA 5GZND 3T8VA 2CDEB 2MH4A 4LSQL 3KXFE 4APQC 4MMZC 4XNYL 1JRHI 3THMH 2VDKH 5CJOL 1ROWA 4ETYA 4JO2H 3BKYH 4MXQC 4YDNA 2V5TA 1RIHL 2YAQA 3D07A 2J88L 1ZLSL 4OVVA 5E03A 2DJ4A 4OR1A 2B4CH 4PJ8B 3WI9A 5I19H 5C9KA 1PG7W 1KIUB 3ULUD 4I18A 4WGWB 3QC5X 1A3LH 3M17A 2DL2A 5FDYA 4GRLB 2ZP0T 5D2NC 5I16B 1JGEA 4PJ7A 1CBJA 3CZFB 1MCWM 2WB1A 3TYGH 4YHKL 1A2YA 1AAJA 1IC7L 1OIOA 1A25A 3MX0A 1OAQH 1GYVA 4AGOA 5EEUA 1Z5LB 2R2HA 2VDLH 4JZNB 1OLLA 5E9NA 1B0RA 4D8PB 4N85A 2AJ3A 5FYJH 4JG0H 2VC2H 4YHOH 5ICXA 5BZWB 1JZHA 1B2WH 4JPKH 4LIQE 3JQOB 4Y16D 2E9IA 3KCWA 4Z1PA 4JRYA 1T7WA 1EXUB 4KK6C 4BSJA 1G0DA 1DANT 2OR8A 5D70L 4AK2A 3QUXB 1I1AA 1O6SA 2ZXQA 4PY8J 1CR9L 1ZEAH 3HEIB 2JQZA 5DEJA 1KG0A 2LTQB 4PWFA 2RAMA 2R56H 2WIIA 4KV5F 4HBCH 5BVJB 1GY1A 4XHJC 4LAQL 4PS4H 1RJLB 3AROA 4Y9EA 1O0VA 5BXFA 1D3CA 2AEWA 2JJUA 4XRCB 3N41B 5CN3A 3MQIA 2FX7L 4MDJB 4KTGA 1AGEA 1YAZA 2R0ZH 3L9EA 4AE1A 2Y7NA 4ODBD 4ZNEA 4I0KA 3X11B 3I9AA 4XMZA 4ZMZA 3V6ZA 2Z31B 2BPBA 3HZVA 5F3HA 2MIZA 3QCUH 3TLRA 2VLLB 5IMOB 2D3NA 4PJAF 4XCNA 1XCTA 1N8ZB 3VJ6B 4YDVA 4RMSA 1UWGH 3DTUB 3KJ6H 4PSRA 1QW8A 4DZ8B 5TGBA 1B0WA 1E5UI 3NIGE 4UM8B 3RY5A 1T1WB 2CLVB 5EWIL 1F41A 5AVZB 1JWUB 4J3XA 3C8DA 4PMEA 5ABDE 5SWZA 2XN9A 5K69A 4EN3D 4NUJA 1T2QL 3FO1B 4U1KA 3IDIB 1HKLL 4WDIA 5CINL 3V0JA 4HIJB 4L3EA 3HLAA 1TJMA 3H3PH 3KBHE 5AW4B 1TQBB 1AFVH 4R96B 1KLFB 1SRDA 3P9MA 4JB9H 4WTZA 5CZKA 5GIRA 3VWKC 1BFVL 3T8MA 5I1EL 5D1XE 3ZQWA 1ID2A 4DNLA 1A7RL 4LFHD 1E90A 4O2EA 2X53A 3SDAC 5B1JC 2ZXGA 3O6KH 2WGNB 4NZDA 4JKNA 2NXYB 2P8PA 2WXRA 3FCTB 4X6DE 1WGOA 1KBGH 5FPIA 2E7LC 3DSFL 3QUXD 4ZX6A 3P2TA 3QZWB 4NZFA 3VSQA 1OSZA 3KZ8A 1KIPA 3LH8A 3ET9F 3QUMH 5EIQA 4LGPB 3TA4D 5GRJH 2WO3B 5F6IB 4LARL 3FQ1A 3I9GH 1G84A 4WO4A 5AZEH 4E42B 1LTXA 5DR5L 3W5NA 3ULVC 2XFXA 2AQ1A 3L3KA 1CZ8L 4R4FH 5KVEL 5CWSB 1UB5B 4OIIL 2XZQH 4QMEA 4WWKC 1ETA1 3BLBA 4PGDA 1IVTA 1OAKL 2BNQB 5CAYB 1SYSB 1SXZA 5F1IB 2IBBA 1P6WA 1CFQA 1XZWA 5GRYA 1EZVY 3L9YA 4G59C 3LAFA 1UM6L 3V10A 2VN6A 1GOHA 4S2SB 4QTIH 1R47A 1X5KA 3QDGA 1E7UA 3U7AA 4GJTB 5BO1H 1C16A 2VL4A 5IZ7A 3QYCA 4I87A 4MJJA 1KGIA 4LNRA 4OZHE 1BQRA 2GK2A 3LY6A 1BGXL 5K93A 3GXTA 2W38A 4MAYD 4F24A 3ZOAA 3VFPA 1XGPA 2GK0A 4O2FA 4KZ0A 4CU7A 5L9DL 1RQ5A 2AXJA 2NUTA 1NM4A 4NZRL 5HYJE 4HUUB 1ZXQA 3JV4A 1FFNB 2BWDA 4LLMB 5J1AB 4Y4KC 2FX9L 2JQMA 2DQHL 2NXYD 1OGSA 4WI5A 2F1EA 1L9MA 3IJSB 1MFDH 3A4FA 3VFGH 4TUKH 5C0AE 3ABGA 1MJ7H 2HRPH 3B8YA 3GBDA 5ALCH 4APQD 4HKJA 1OF0A 1CLYL 4MXQD 2LT9A 5AOKA 3V5DB 5HGHA 3ESMA 3QT2A 1TZGL 1OANA 2B1AL 3CZJA 4KVCL 2VLJB 5B8CA 1CDBA 3QEQB 3PGDA 5FUCE 4I1PA 3ISYA 2IADB 4ZX5A 3RVXC 5FYKE 4FYQA 4NWTH 2Y36L 4A7VA 1CXFA 3ME0A 2UWEA 3CLFH 1E50A 3PUCA 2A0LC 4QRRD 5ID1A 1RHHB 4JRXE 3IXAB 2VXVL 1WP6A 1NH6A 1VGEH 1WVZA 4JCLA 5E4EB 3RI5K 3VWKB 1S7XA 1ITCA 3F8UB 3SJVB 1LEIB 4G1EB 1H8NA 1H0DA 1JNJA 1Z1WA 4CADB 2NR6A 3QDHA 1GAFH 4KK6D 1EEZA 4E36A 3UIZA 3ASNB 1JTPA 2CNYA 1KB5H 5TE7L 3GBLA 1O75A 5EBLB 2L4OA 2NY3B 3BT0A 3RJOA 4ZAKA 4GUOA 1L5GA 4MQ7A 5E00A 1UA6H 3TTYA 4E68A 1R33A 4LQFH 1CUOA 2LE9A 3NAAL 4KY2A 1RY7B 4FQXC 3CG8A 2X4NB 2G3ZA 4XHJD 1CDIA 1P0SE 3MNVA 5AW0B 2ESVB 2WBXA 3T6ZA 1ZSDA 3NEXA 3VQMA 4YNYB 3LXUX 5GZOC 4TLTA 1EUUA 3OXSA 2EABA 2QVKA 1X7QB 5D7KD 2OAAA 4GQZA 5TH2B 1WBZA 3UO1H 1DO5A 2BIIA 1JGVL 2P45B 4LKXB 1CFTB 1JZGA 1KJVA 3BFQG 4GSUA 4I1RA 2C3GA 2DS4A 4KXAA 1FAIH 4NPKA 3D85A 4H8WC 1BVKB 4YZWA 4PMFA 4QHUA 3U2JA 2GSGB 1E8ZA 3P77A 3QULB 1I1YA 3M7FB 3WUWA 1LP9B 4PGCB 1U8MA 2B1HL 4JN2A 2AAVA 4HUVB 5JA8B 4X5WA 4UU9B 3ILEA 3QJRB 5DJ8A 1UD8A 4PRHA 3FN0H 3GRWA 3T2PA 2OW6A 2IG2L 2X4TA 3ZHFA 5I6MA 3GFUA 5DI8A 1PQZA 4JPQA 4Q9RL 5GGVH 3FB5A 3QE5A 4DGUA 3FFCB 4UV4H 5K39A 5K33A 4M7LT 3TBTB 1UCBL 1LQSR 2J72A 4A6YB 2A5UA 3Q5OA 1WWCA 5T3XL 3VWKD 3OJMB 3BISA 4MBRA 1CICA 3SJVD 5ISZB 3IRZA 1NCIA 1KY6A 1MJ8L 3NJGA 2O6PA 3SDAD 1HSAB 3HIZA 4J6RH 3OC5A 4UM9B 3P9WB 2NX5B 4J23A 3VWJA 1IGTA 3P9LA 1T83A 5DURD 5T3ZL 5IJVB 1U92B 4JCWA 4IGBC 2VN5A 4IIQA 4QWWC 5HDBF 5JHMA 1A8ZA 1SVBA 4QXUH 3UMTA 3U4KA 3RDTA 4R0LA 4ZYKA 3ULVD 4U33A 1NGYB 1GVIA 3VGEA 2ESVD 2WY3B 5AB9A 2VISB 1BQHG 2DLIA 1X3DA 4Y4HC 1QFHA 4LE8A 1HXMB 1F42A 5I8OL 2BHFA 5IF0B 4LSUH 4ATWA 5DJ6A 3MLRH 2VQTA 1U2CA 1HHGA 5J0BA 3KLSA 1NKOA 3DURB 4LF3A 4PWKA 2GTQA 1UURA 1IM9A 1QSEE 2QZQA 4JUSA 4LASH 1ZIAA 1A6VL 3TNMA 5MI0C 4LSQH 4EMZA 1ZA3B 4XNYH 4F9LC 2ED7A 2Z7YA 1NSNL 2KDGA 3CLWA 5CJOH 4OF0A 4PJXE 1RKRA 4NO2A 5EO9A 1ZLSH 1RIHH 2IF7A 2J88H 1EVUA 3QJUB 3BMVA 3VH8G 4DQOL 2Z4TA 3TCLB 2ZAIA 1Z7JA 2W0FB 4Z0XB 5IJDC 3QXWA 3JV5A 5FO9B 4YPGA 4NXKA 2DEWX 4OZGF 3LNIA 3LKQA 4PW9A 5B1CA 4YHKH 4ELKA 1J8KA 2YJLA 1IC7H 3HE6C 4JL1A 3QJHB 2C4FT 2BRRL 3HG1A 2YD3A 4CMHC 5KVFL 3WFZA 1JN6A 4OSUL 4AM0A 4WHTA 5EG6C 2CU9A 2GEEA 2CHDA 4QR7A 2VZ3A 4K2UL 3AWFA 1MHEB 3DBXA 4J7RA 1ETZB 1W0YT 2OMXB 1EK3A 4HAGA 3PHOB 2ICEC 1MHCA 4Y4KD 3MRDB 2O5XL 4ZMYA 1BIHA 1OCRB 2NX5D 4V1DA 4E9LA 4N2BA 3B9VA 3APCA 5E5MB 3FU0A 3TO2A 4G8GA 2WUBL 1HILB 5D70H 1SYVA 3FFDA 4XP6L 2DY2A 3R1GL 4A2MA 3KGRA 1CR9H 1YEHL 5FUZL 2W94A 4BSVA 1DSFL 1A1NA 4Q14A 4K3JL 2IPUK 2VCOA 2UZYA 4N20A 2MHAB 5CLXA 5GSRA 1MVUB 1XSJA 2DWYA 2B8OT 4X7FC 3UBXG 1KCUL 3L3OB 2XNAA 3NDYE 3KLQA 4LAQH 5AG8A 1OQXA 3RVXD 1BZEA 4LCVA 2A77L 4FQLL 2FX7H 3T4AB 3LS4L 3Q48A 2NY6C 4TL4A 2A0LD 1RVFL 3UYPA 3LNGA 2BVQB 3R8QA 2VJ8A 1A6ZA 2HUHA 3ESPA 3FQRB 1HT6A 4WUUA 2DAVA 3X2QB 1SOKA 4JFTA 2C1PA 1ZLVK 4Q6KA 4QF1A 1ZTMA 2N01B 4G1MA 3NN8B 1T0MB 1KFGA 1OHQA 2D3LA 2IWEA 1F6AB 4PBVC 5EWIH 1FVEA 3ROLB 5FFLA 5FHBL 4BQBA 1BXVA 1HSBA 1N5YL 1AD0A 2ZPKL 2NDFA 1T2QH 3P0GB 3FCSB 1HKLH 4IMKC 5CINH 2WQUA 3E0GA 1KCSL 4IGBB 3ZW3A 3DA0A 1FYTA 3WE1A 3NVQA 4KJYA 4FQXD 3UJIL 2UY7B 3B3IA 3QORC 1AE6L 3DSNA 4NIYE 2WXJA 4N1HB 5CCKH 1ODAA 3QQDA 1NFIA 4IU3A 5AKTA 4C83A 1BFVH 5GZOD 1HOEA 5TDOB 5I1EH 3DXAD 2YPKA 1JZ3A 1A7RH 3MRJB 3F6IA 1ERNA 3K4AA 2IC2A 3AREA 3DSFH 2B7DT 1FZJA 5MI0B 1BM3L 2P5ED 4N2CA 4WU5B 4G8EB 4E9SA 1KXTB 1BD2B 4XP9L 3ZHLA 1JD7A 2DWXA 2DIJA 4ANVA 1CQYA 4Z0BH 1KBWA 4KI5C 4LARH 2ZX5A 4PJ5B 4HWUA 3SYAA 1RPUA 5HVHC 1HEZB 4FFTA 5ETUB 4I3GA 1CZ8H 4M93B 4N90D 3FQXB 5KVEH 1HH9B 2JTYA 4YK4C 2MCAA 3JWNH 4FXLA 1FNLA 4OIIH 4CVXA 1KGCD 2JF1A 1MUJA 1T1XB 3EJUA 5C0BE 2ZIDA 2CIKB 3HE6B 4XNMA 1F97A 1OAKH 1SN2A 2WINB 4LCWA 2YD4A 4CMHB 2VR5A 5B39A 1G7LB 3LJ3A 2VERN 4BHUA 2H8PA 4RQQA 3QJTB 3LN9A 5LAXA 3LD8C 1UM6H 1KDIA 4WTQA 1Z3GL 4GLRH 1EEYB 2X3CA 1KB3A 4X7TA 1N59A 4D2NA 2MWCA 4UQ3B 4ZUVB 2BWQA 3BI9X 1Q1JL 5LAPA 2HJLA 3DV6B 1IVLA 5D5MA 4IGBD 1D9KA 1BGXH 1SUJA 1CG9A 4QWWD 5F89B 3QFDA 4BXSV 5IHWA 3L3GB 5CLYA 1KTLB 1SUHA 3BKCL 5DCCA 3RGVC 2HA1A 1OD9A 4P4KB 1TKWA 3UBFA 4EF3A 4Z7NB 1DJHA 4F1SA 4CJ1A 5L9DH 4J39A 4Q2ZA 4NZRH 4Y4HD 2FR4A 1JMZA 2H2PC 8CGTA 1J9QA 5I0DA 2GJZB 4FG4A 2ED9A 2KZ1B 2QVIA 2FX9H 1DVQA 2DQHH 1SN0A 3IMRA 5F9OL 4Z7VF 2NY6B 1LE5A 3OKDB 2X4QB 1ZPUA 3QXAA 1BD2D 2EIZA 1CLYH 4XOCA 1JHTA 1U8QB 3QGVA 4FXGC 2X28A 1HDMB 4PWEA 3Q0HA 2WYZA 3FS9A 1ZA6B 2DLHA 4D0DB 2W07B 4FNRA 1K4DA 1TZGH 2ZP8A 4NC0B 2B1AH 4KVCH 5DUBA 2YZ8A 2HZHA 3I75B 3NA4A 3QZOA 5C0BA 4ESKA 1EO7A 3H7LA 4AY0A 1DSYA 1X6LA 3WNOA 1AVAA 4JUTA 4MXVF 2PTTB 2Y36H 4K07A 4LL4A 3CZGA 5F0MB 1AHKA 3MBEA 3HE6D 1J0HA 2J1YA 4IRJC 2J8UF 2AMGA 5J9PB 5GZNA 1A9BB 2VXVH 4AIZB 5KUMA 3VRIB 4PJCB 4ENZA 4NQQA 3GB7B 4IBZA 1OP4A 3FUKA 1WTGT 5IROC 1THAA 2C5DC 3KWUA 1TVHA 3DVIA 5TE7H 1BFOA 4MMXA 4QRUA 1N68A 3HBGA 3MAWA 1RK1B 1ZAGA 1AKJD 1C1EL 4UT9L 3CVHA 5IM7B 5I6NA 1ET7A 4MD5A 2DBLL 1C5DA 3NAAH 5L4MA 1VJSA 5D6DC 1PJWA 4PY8I 1T1ZA 4N87A 3NCWA 4I48B 5CEZD 4TOYL 1T2XA 4N1EA 4QRSB 4TF4A 2HYMA 1TYEB 1FL6A 4NM4L 4YK4B 5EUOB 3IWUA 1IBZA 1FZMB 2YS4A 4OD2A 2NY6D 4UIMB 2GJ6B 1IAOB