5GS2H

Crystal structure of diabody complex with repebody and mbp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
236
structure length
231
Chain Sequence
VQLVESGGGLVQPGGSLRLSCAASGFNFSSSSIHWVRQAPGKGLEWVASISSSSGSTSYADSVKGRFTISADTSKNTAYLQMNSLTAEDTAVYYCARYGHWSWGRWWNYWVALDYWGQGTLVTVSSDIVMTQSQKFMSTSAGDRVSITCKASQNVRTAVAWYQQKPGQSPKALIYLASNRHTGVPDRFTGSGSGTDFTLTISNVQSEDLADYFCLQHWSYPYTFGGGTKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein/immune system
molecule keywords Maltose-binding periplasmic protein
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 47
structure length 231
sequence length 236
ec nomenclature
pdb deposition date 2016-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gs2H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gs2H01
1MCQA 3OWEA 1DLHB 4GKSB 3SDYH 3INUL 4TVPH 3P77A 1JGVH 1WFUA 4Y4FD 3FO2A 3HNTH 4QY8B 4NO2A 1RZFH 5CEZD 3CFEA 5KZCD 4HAGA 4FMKA 5KANG 1MH5A 2EH7H 5EO9B 2HT2C 1KCUH 2GFBB 1ZHLB 3KPTA 2EDRA 3L3DA 1PGRB 3PIQB 3ULUF 1BFOA 1NPUA 4WW2C 3MRCB 1A4KB 2NYYD 4L4TE 1F2XK 3IDNA 2H2SD 2O5ZH 3P0YL 5DJCA 1U95A 3L95A 1B2WH 1VEOA 3VWKB 4OSUL 1YMHB 2WBJC 4ERSL 1KNOA 1CF8H 3B9DA 4XAKE 1OSZA 5EU5B 4ETQA 4JREC 4TUOB 1DL7L 1OSPL 4ZS7L 1U6AL 3EDKA 4ZTOH 5FHAL 4NZUL 3ULVE 3NTCH 3W2DL 1SJXA 4XNUL 4RIRB 1UH2A 4K7PL 4MYWB 1UKSA 4KPHH 1MREH 2ZSWB 5F72S 3SY0A 1UACL 1G7PB 5K9KA 4P4KC 4KTDH 2BX5A 1MUJA 5KS9F 3RWJB 4YPJA 2GJJA 2W0LA 4NM8L 5DT1H 3HI1B 3ZKMD 1LDPL 4H88H 1I7UA 1DSFL 1HHIB 4RA3A 5AUMB 3SE9L 1J8HD 1Z9OA 3FB5B 3B2UD 4ZTPL 1U9KA 2C7UB 3FB6A 2IAMA 2R15A 2AEQL 3PWPE 1X9QA 3MFFB 1CFQB 4QRRD 1IARB 1OTTC 5C0BD 2QSQA 2VQTA 2LVCA 1XF3A 3T2OA 3GIVB 5SX4H 1E6JL 1CL7L 1EFXD 2X9XA 4LL9A 4S2SB 1ETZB 4D0DA 2UVEA 3GGWB 1T0NA 2CLRA 1QO3B 3AM8C 3IKKA 1ZK9A 2IBZY 4ZPVB 3T8XB 4HAFA 3S4SA 1F00I 1F4HA 4XP4L 5IW1A 3W11D 4V2BA 1J0YA 1NDGB 4PJDA 2Y9RT 3UTSA 4ZFZB 1TMCB 2Y5EA 3GMOB 4OCYH 1MHEA 4JRYD 5C0AE 3SDAA 4YC2B 4F7CB 4OLUL 3HS0A 2VUYA 3AMLA 3DHMA 4PJGA 1DQQA 3FTGA 4WY7L 5D7LD 5C0JB 5ERWB 2OJZH 3RHWF 3C2SA 3KPMB 1Q1JL 4F7EA 4ODTH 4KDTC 4U6XB 3T4YB 2GQHA 3QUZB 4TNWK 1KJMB 2EIBA 2DI8A 4Z8FH 2NTSP 4OUUB 3PABA 4YEFA 4P2CG 4PTTB 3B5TA 2IFFL 3V5KA 5TF1H 3BIAX 2VZUA 2IQ9L 3D1MC 3MXWH 4CVWA 5EU4A 1XGTA 3O4LB 1FNGB 4HF5L 2VDPH 1U3HA 4XWGH 1FV1A 2WWKO 4X5XA 4Z78A 1UA6H 5DZOA 3O6LL 3CZJA 4P5TB 4N0UA 4CNIA 5E24E 2VDMH 2H6PB 4G8GE 1DN0A 2V7HA 2R39A 2XPGA 3FQWB 1JNLH 2ADIA 3RPIB 5GZOD 4LVHB 5I1KH 4KGLA 3HE7C 1BAFH 3OPZL 1B9ZA 3P4LA 1JYWA 4OQTH 4X9BA 5GISL 2BFVL 5IK3B 4FQCL 4IJ3B 4GMSH 1S7RB 4MXVE 3FAXA 4QXTB 2BSSB 4WGWB 5GRZA 3C6SA 2YSSA 2EDEA 1OVZA 2WUBH 4N8CL 4X6CA 4DEPB 1C12A 1FGVL 5FCUL 4G80A 1EMTH 5FYLH 5IFAH 4A6YB 3GM8A 3SCMD 4HWZB 4XRCA 4Y16B 1LEGB 4N9GB 3QDJA 2IAND 2L7JA 3S9DB 3LKNB 3QNXB 4HIJB 4R96A 4NRYB 5EUKB 4PRIB 1MSPA 2FL5B 2DL9A 2A77H 2IJ0C 4Y19D 1MI5A 4PB0L 2G2RA 2H2PC 3UPRB 4Z7VB 2C1PB 1A64A 2PXYA 4EXPX 2VL5B 2HRPH 1ITBB 1JNNL 2B1AL 4EDWL 3JVGC 5CILL 2WIIB 3I6KB 2YRLA 4F7TA 4EXKA 1RJZB 3QP3A 3O81A 4PJ9B 1UM5L 4TUKL 4JJ5A 3HUJB 1UCBH 2EDYA 2JE8A 1VGEH 3MLSH 3BUTA 3P11L 2VABA 4XBGA 4C55A 4QXGH 3ES6A 2AXFB 3IDIA 4WJ5A 3UBXG 3EYVB 1JGDA 2HWZH 1YUHA 4LP4A 1J5OL 5FDYA 32C2B 1SY6A 3V0AC 2BNRB 4Q9CA 2NY0B 3RKDD 3S35L 4RAUA 3VXUD 2Q8AH 5D7LA 4UV4L 3WJLC 1TNNA 2Q3AA 4POZD 3GKWH 4PR5A 2DYPB 5F93C 1XGYL 3L3GB 4ZFGL 1SM3H 5TPWL 3T77B 3UPCA 5BMFH 1NSNH 3WFDH 2FH6A 1EEUA 3WFZA 4C83A 5ESAA 1JF5A 1CN4A 4XCFH 5FO9A 5IEHA 3NCJL 2QQKL 1NLDH 4YZFE 1A9BB 3I6GB 3IDYB 1MCDA 4QF1B 5ENWB 3GUTA 1FYTE 3QCTH 1YZZA 1CFNA 2VXSH 4L8DA 3P4NB 4K55A 3FFCE 4KQ3L 3RNKB 3S36L 2OQJB 5A2JH 2Q7YA 3PV7A 4HDIB 2ZCLL 1F3JB 5GS0D 1UXWA 2OCFD 1CXEA 1H5BA 4X7SH 5FA4B 1OF2A 4XMLH 3QWQB 1ZT1B 3KLHC 3QDME 1HQRB 3QUZC 3PE9A 1AGDB 4MD0A 1FFRA 3WV0A 1P9MA 5KG9B 4A2MA 2CLZB 4KI5C 4J3OC 3EJYC 5DEGA 4DQOH 8CGTA 2D7NA 2NY2C 1RI8A 3B9KC 4JO2L 5BZDB 3SCMA 1P1ZA 3SDYL 5ITFA 4R0LA 2VJXA 5D7IF 1LD9B 3TT1H 1JGVL 4LSVH 3D18B 3HNTL 2BXYA 4HUXA 1IM9B 4MZ3A 2NCMA 3QUYD 3OG4B 1RZFL 4AY0A 5T3XE 2R8SH 5FYLE 3ZYOA 4Y19A 2EH7L 3SHSA 1KC5H 5LQBH 2RHEA 2FJGA 3KVQA 5FUCC 3EBAA 3IFNH 1MJ7H 2ZJSH 5FGSA 2O5ZL 5J13B 3HE6C 1HKFA 5HYJA 2FNBA 2ZOLA 4G9FD 3E3QC 1SYSB 3RZCC 2LABA 1T7ZA 1FRGL 5JUEL 3WKMH 1FAIH 2MHAB 1RZKH 2V9QA 3O3BA 3NH7H 6FABL 2NY1D 2X89D 3NTCL 4TN9A 3ZDZE 3FN0H 2EYSB 5C0FB 1A1NA 2BP3A 1K5NB 1ORSB 3GSXA 4LSRH 5CWSA 2NW3A 2WK2A 4XVUC 1MREL 4AG4L 4HV8B 4Y4KB 2APVA 4WEBH 5CZVH 4X6CF 4CN4A 4U1KA 1CXFA 3REWA 1UZ8A 1OAQL 1I9EA 3LEYL 4O2CB 5DT1L 2KQMA 2NXYC 3DGCR 1L9NA 3AAZB 3QDHA 2YKLH 3C5SB 4G6AD 3RVWD 1QKZH 5D1ZA 4POYA 2BXZA 3RHWK 2XQBL 3D5OF 3SGKC 4OI8A 4PJ7B 3U2SA 5TE6H 2WWKT 2JTDA 1NFDE 4ZS6D 3UTPD 3QQ3A 4U0RB 1ZSDA 1OPGH 1T6VN 2VLRD 4IRSB 4XTRC 5D4QA 5H35A 4U6VL 1CFSA 5ESVB 4HPOH 2AKRB 2XV6B 2VDKH 2YPLD 3HC3H 4FQPA 2YRZA 1BFTA 4N0YH 5EC2B 3IT8D 3W9DB 2Z9TA 1FZKB 5A1AA 2AXJA 2J6EH 1NGZA 1JPFA 5JORB 1WISA 4Z7WF 1NC4D 3PWJB 3SGDI 1I3RB 1K8DA 3QIBD 2XZCH 3LQAC 4QHMA 1MCWW 3TZVC 3CXHK 3V4PH 4X99A 1T0PB 1LE9A 4OCYL 5DI8A 1EVUA 5FOBB 2Q86B 2WM0A 3ZLQC 2BOCB 4MQ7B 4Y5VA 3MREA 5E2WH 3VXSD 4PJAE 4KUCD 4ODTL 5FUOH 4Z8FL 2A1WH 2CMRH 1YEDA 3EFDH 4HJGB 4JJHA 5D6DA 3NBNA 3VE0B 1LO5A 3NVQA 3QO0B 3E2HC 5TF1L 1IJ9A 1HEZB 1A47A 4K3DL 1KCLA 2VDPL 3QUYA 4XWGL 1TTUA 1PY4A 3G6JB 4H0HB 3PDDA 2J8UB 4U6YB 4NWUH 4R97B 1YY8A 3VXMB 1B0RA 4BK4A 5L0QB 1UM4H 2VDML 2CO7B 4BQ8A 5J0BA 3QWRA 4JB9H 4QRTB 1JNLL 2H8PB 3IRZA 4KK9D 4PRPB 4YWGL 5DC0A 5I1KL 2FHFA 4M4RA 1ND0A 3DJ9A 1QSZA 1T80A 4HKZB 3RJQB 2FR4A 4OQTL 2ERJB 5HGGS 3DTXB 2YUZA 5CBAB 2XN9E 5FYKH 1SJVA 3BGMB 4PJFB 5SWQB 4WO4B 5ICZB 1CXLA 4XGZB 3P4MA 1OAZH 4P2YA 3KPSD 4HFWA 2SEBA 2X89A 3MRKA 5AAMA 2BNUA 4DK3A 1FE8H 1X4YA 1N5YH 5EU6A 1I8KA 1J86A 2EDKA 3OXSA 1KLFA 3VDBA 4C54A 1EMTL 2J3SA 5CSBA 5FYLL 4ZUVB 5IFAL 4XNQB 4LLYB 4CJ1A 4YBQC 5B38G 5ETUB 1FFNB 3OMZA 2HVKA 3GSNA 3BSZH 3GJFA 4G5ZL 1YEIH 1BX2B 3OBAA 3LDBC 2DDQH 3LKQA 1FJ1A 2A77L 3KPQA 4YIQB 4R2GC 2W59A 4P5KA 5F7WC 4OZGE 1ZV5A 4JG0L 3E6FA 5K9QG 2HRPL 1OAYH 5GPRA 1NMAH 4OFIA 1BVLA 2YPLA 1AQKL 3KYAA 3MGOB 4U1LB 3BW9A 5C0GA 1MCPL 1B90A 2DWEA 1KIUA 4OM1H 1EUTA 5DJXA 2FEEL 1J1OL 4Y4KC 2OLDA 2MPAL 5HYQB 3P0GB 4BJLA 3QIBA 3PWUB 3TVMB 5IG7A 2ICEB 1WK0A 4QXGL 5KSAC 5BRZA 4C57C 3PWVB 2DMBA 4X83A 4P2RD 4WFHE 4OIIH 3R06A 1R5IB 1T83C 5ISZD 4P49A 5A16A 3GFUA 5CP7B 1FNEB 3QHZH 5HHNA 3OGOE 4EVNB 2XTJD 1WT5C 5FYKU 2Q8AL 5DJYA 5IW6A 5L88H 4HFUH 4RQQB 5IVXB 5FM5M 4JFEE 1MCCA 3A6BH 4JY5H 1SM3L 3VXSA 4JY6B 3JTTA 1IT9H 4XC1H 3WS6A 5DR5H 3L3JB 4UMGA 4L9DA 4C56B 2P47B 1P4LA 4O5LH 2ZCKL 1KIPA 1NLDL 1RVFH 1U8QA 2I07B 3E8UL 3H9HA 5T1MB 2FX8L 2GI7A 3CNKA 5C2UB 2GUOA 3IDJA 3SDDD 3QCTL 1LMKA 3JWDC 4FQLH 4LGRB 4EI5A 4APQB 2P8MA 1IGIH 3DO7B 1JIBA 1CGYA 2ZUXA 5EIIB 3ZTJH 1GGBL 3U1SH 1N5AA 1AXSB 4OCWL 4MD5B 4X7SL 2ADJB 4R4ND 1YDPA 4XAWH 4KHTL 4EUPG 4MVBC 4XMLL 1W0VB 5I2IA 5D71H 2Q7NA 2V6HA 5EA0H 3L3KB 3CK0H 2OJEA 4IHOA 1RPQA 3RWCA 1YYMH 5C70A 5FYKE 5DC4B 5A2FA 3VG9B 5JR1H 1CD1A 5I66B 1JVKA 3QUMA 4DQOL 4J6RH 2CRYA 4UQ2A 1Q0YH 4HSQA 4FG6C 3FMGH 3PUCA 2XXMB 4Y5XC 3MBEB 5L0QC 1MWAB 4MDIB 4NQCD 2E9IA 3TT1L 2J5LC 3S98A 3F7YB 5FM4A 5DRWB 3CSBA 3FOMA 5EWIL 2C3VB 1KC5L 5LQBL 3UPAA 2CDEA 15C8H 3F8UB 5TDPB 3TEUA 4Z7QF 5GXBB 2D0HA 2PETA 3BQUC 3P3YA 1NCCH 3L1OH 5D2NA 4M1CD 2P49B 4CVXA 3LB6D 3HG1E 1FAIL 1IILE 1CFTA 1RZKL 5DA0B 3T3MF 2DQTL 3NH7L 1P5UA 1S9VB 3MV8D 4XI5D 5LAXA 1V3KA 3FN0L 2AJYH 5I8KH 1KJ3H 4RMVA 4LHJB 3JTSA 3GK8H 1JF1B 4H25A 4EDXA 5CZVL 1G6RH 4TSAH 3NCMA 1IAOB 2GT9B 2PCPB 3H6JA 5CIPA 4B0MM 1MF2H 2RQ8A 1QLRA 2XKUA 2YKLL 1F8TL 2YMXH 4G43A 1QKZL 4XVJH 3WL9B 5J57B 2C5DC 2X4QB 3C9NB 1RK0B 2Z8WC 3VD3A 5FF6B 2AJSH 1OPGL 1S7VA 4ODXA 2GTWA 1T7YA 4NP4H 2HRLA 3S97C 4ZSOA 1G9EA 4LHUB 3P9MA 1NBYB 2HFTA 3AB0C 1DBKL 1MJUH 2VDKL 3BO8A 3HC3L 3KLAB 3TVMC 4RFNB 4G8IA 3WE6B 2BJMH 1Z9LA 1EZVX 4WCYH 1EUUA 1N4XL 2J6EL 3LRGA 4HKXB 1NMCC 2AK1L 1KG0B 1JK8B 1G7HA 3T2PA 4JGMA 2XZCL 5K9OB 3HAEH 2R23A 4HH9A 3V4PL 2X4PB 1FVCB 4OF8A 3T0VA 4DZ8A 5JQHC 2Z8VC 2HVJA 1BD2D 1T1ZA 4NFDA 1RUKH 3W0WD 1S9WA 4YHOH 3QQ4B 5C0CB 1IZJA 3V7MA 3EO1A 5H2BB 3ARED 4PLJD 5EBGA 5C3TA 5FO8B 3ZKSD 1FORH 2ZUYA 4JHAH 2VSDA 1XF2B 4DFIA 2A1WL 1A3RH 2CMRL 2XY1A 4Y5YA 1HYSC 2X1OA 3N0PB 3ZT6A 3VFWA 3UX9B 2BZDA 1OGAB 2VH5H 4NQCA 4KUCF 1MAMH 4ELME 4XPBH 5DD6A 3TO2B 5SWSD 3VXRA 4APQC 2X4UA 1D9KA 1KYOJ 4M1GH 4MCZB 1XIWD 4KDWA 4M62H 4O2FA 1HHGA 1ORQB 2DQUL 5LGKA 2EXYD 3LQAH 4JB9L 1QFWI 4GG6E 1KN4H 1KGCD 1CGSL 1QFPA 2WINA 35C8L 4J4PC 2NY6C 3O2VH 3NA4A 3L6FB 5FYKL 3V6OA 5INCB 5T33L 3VG9C 4KKCD 3MJ6A 4WHTB 1DQJA 4PJ5B 1JGLL 2YWZA 3UJJL 3ECBB 1EH9A 3D2UB 5F6IC 3ROOB 5IMKA 1O0VA 4AENA 5I9QC 1A3QA 3MRGB 3PQYB 3PWNB 2NZIA 2J7LA 1AFVH 4MAUH 4D8PA 1FE8L 4NKIH 4KI5E 1EV2E 2ZOKB 2L7UA 3TIEA 1CGXA 1PKQE 3D87B 5HHMD 5E5MB 1ONQB 2EE2A 1PJ9A 2W0PA 4P3DB 2IPTH 1EZVY 5E9DB 5L2KE 4L8SB 2O5XH 3O3AA 5GJTH 5KVGH 3WDIA 3O0RH 5E8OB 4L8BB 1JGEB 2WW8A 3TBYB 3MYZA 2V2WA 4YHIA 4OGZA 1P4BH 4DJMA 4JRWA 1YN6B 5GGTH 2BC4A 4PJCE 3ARWA 3B5GA 3K81A 1OAYL 5FUCE 4D94A 5I16B 5CEYB 2ICCA 4OGAD 1ZOXA 4NO3B 1TJGL 2DLEA 4ZFOL 1JWMA 1V3JA 3E3QE 1CLCA 4HZAA 3CU1A 4OM1L 2B1HH 1CTNA 3RX8A 1A02N 5HHOD 4JFOB 5M95B 4LCUB 2X05A 5L2JA 4L9LA 1JWUA 3NFNA 5FYJE 2AEPL 3O3EB 1YC8A 4G3YL 4U7SA 1ZLUH 4OIIL 5KANI 4OCSH 3HZKB 4UDTB 3SDAC 4OAWA 1QQDB 1IE5A 1MRDH 3W0WA 5DDHA 3RVTC 1WC7A 5L88L 2GJZB 3LPWA 2VB5A 4HFUL 1DANT 4RWYH 4BSWB 3QFJE 3EOBA 4JY5L 3A6BL 5TGBB 4EQ3A 1IT9L 2E6PA 5FO7A 4XC1L 4U1NA 5HPOA 4HJJL 3QNZB 1QFOA 3U4EA 5IOPA 5DR5L 1P6AB 4F9PC 5KN5B 1HH9B 3WO4C 3QISA 5F7MC 4RFNC 4O5LL 3DRTA 1EX0A 3WD5L 3LEXA 4UILL 4L4JA 4HG4K 4JKKA 3D3VD 3RWIA 3I9GH 5HDQH 4G6FB 1X5IA 5JPMA 1RZ8B 3FT4B 4FQLL 2XZQL 2R56H 1IGIL 2HMID 4IDLA 1U58B 1WBZB 3ARTA 1IGJA 5DHYB 5EUOB 2PYED 3LAFA 3U1SL 2UZYB 2QQQA 1V5JA 2XWTB 4XAWL 4RGMB 4N0CD 1A0QH 3MRBA 4KDVA 2LU7A 2WP3O 3OKNA 5D71L 3UZVB 5AG9A 5EA0L 4HXAH 3TO4D 4HWBA 4H26B 3CK0L 1I8LA 1SJHA 3VFUA 1YYML 2DL2A 3OX8B 3L3OB 3SDXA 1NEZA 5JR1L 4G6KH 3VJ6B 4J6RL 4NBZB 1INEH 1Q0YL 1XCTB 2AK4E 5CSZB 5E6ID 3U30B 3ORJA 3D0VA 2PN5A 3TBVB 2V2TA 2XKNB 3BPLB 1DFBH 4FMFA 3VI3F 3D39A 2DQJL 1NC2D 4G9DA 3DPBA 1T66C 4MQXD 5JXEA 4Y7MA 5HD8C 2Y36H 1OTUC 2HH0H 3C2AL 3H9SB 5DQDH 1AR2A 2PXYC 1WZKA 4UTAH 3DVGA 4N5EC 4CW1A 15C8L 4MA3A 3LQZA 5D70H 4DN3L 3TN0B 4AIOA 4PJEF 3GJFK 4NRZA 2YD5A 3L1OL 4R90H 3E6HA 1ZEAH 4V1DD 4RNRB 5HVHB 4X0KA 4MJIA 1MQKH 5I17B 4QRUB 4B41A 4LSTH 3DROA 3OL2A 4OLZL 5GRVK 3DLQR 1EO5A 5KAQF 1HXMA 1UJ3B 2LU4A 5MENE 1MFDH 2AJYL 3FRUA 3KR3H 2W1NA 3OKKB 1H0DA 1QACA 2ATKA 1KJ3L 3TCLA 5LGJA 1G6RL 4TSAL 3OKLB 4I48B 2NY4D 1RUMH 1UWXK 2VDRH 1HH6B 5EO1A 4IS6A 4PJXE 4HUWA 4LARH 3ARDA 4YH6A 3EYQC 1P5VA 3M17B 1CVSC 1R5WB 4PS4H 5DGRA 1MLBB 5C08B 4MAYD 3PGCA 5DJ0A 1G7MB 4YGVB 3FONA 3KS0J 3U9UB 1CDUA 4NQSB 5F21B 5ESQA 3MV7D 4K3JH 4KUZH 2R1WB 1DLFL 1ACZA 1AY1H 3D3VA 4OFKA 1MJUL 4H5SA 4GW4B 4K8RH 3RTQB 1M6OA 2CH8A 1R3IH 5FYJL 4BKLB 3VWJC 4OD2A 4Q9BA 4CMMB 1AHWB 4OI9A 4PJHA 2ZUSA 1XF4A 1D5ZA 4PPTA 3KPRD 3MV9B 2CKBA 4DZBB 4E41E 1BQHA 1AGFB 2X4OA 1IBGH 3FQXB 4X4ZA 3X3FH 1TZHB 4WI5A 4X6DA 4EN3A 2W0KA 4MHHG 3H3BC 3IDXL 3TT3H 1Q9OA 4IEFB 5TFSL 4YHKH 1CDIA 3TO4A 4RFEB 4PYHA 1P9MC 4PJ7E 4YHOL 2IALA 3FQTB 3IF1B 2FRGP 1T1XB 1CK0H 1YPZA 4HUVA 1D5MB 1H3VA 3LRSA 3VG0H 5DHXB 4HWEH 3B8YA 4JHAL 1KCRH 4OZIA 4K9EH 1S7UB 2BRQA 2UWEA 3S37H 2CXKA 3U83A 5I1GL 5D96C 1X7QB 4QHUA 5CJOH 1M05B 4DK6A 2VH5L 5JIHA 3Q3GB 1MAML 2W9EH 2UY7A 3D25A 4M1GL 1NC2A 3WSQL 1DBJL 4E42A 3GBMH 3BKJH 4M62L 4WV1C 4S1SH 4MNGA 4ODWB 4AMKH 3NA9H 1E27A 5AEAA 1XR9A 2E9WA 3LQAL 2C4FU 3UTTE 1KN4L 4Q7DA 4D9RE 4WI4A 3HB3D 3BUYB 3O2VL 3A6CL 3KDMB 1X5LA 3H8NA 4V1DA 2JK5A 4PJBE 4JQXC 3I02A 3VCLA 3F12A 5DSCB 1IL1B 5HHQA 2VQ1A 5INDA 3D85D 4WFED 3GMRB 5IHBA 1T7WA 1CXHA 2CR6A 4FXLA 2IBBA 4ODBD 5HI5D 1AFVL 3OR7A 4JM2B 2D7PA 4L4VB 4YXLH 2EEBA 1ES0B 3JV4B 4L3EE 5ICXA 4GRLB 3GSRA 1S3KH 3ILPA 3VXME 2EDBA 4OIBA 1QSEA 4Z7NE 1DBML 4OGYH 2X2YA 5D1ZC 3BP6B 4JANA 5GJTL 5KVGL 2BVEA 4LU5L 5L6YL 2WWMC 1K4CA 4CN6A 4X4YA 3TN0C 3RNQA 3OHXA 1A1MA 1ADQL 1BHGA 2F54B 3MV7A 5FCSH 4AK1A 4PB9H 4XCNB 3MJ9A 5GGTL 1Y0LA 1FH5L 5MEPB 4HZLA 2CRMA 3FZUD 1G9NC 1SJEB 2OSLB 4ZD3H 2LAAA 2Z92B 1CICD 4JN2B 4ZOBA 5GGVL 2B1HL 1NMBH 1VSCA 5I8EA 4JPIB 3QEHA 2ADGB 2WP3T 3MSPA 3I50H 1K85A 4U1JB 2P45B 3SPVB 1L7TH 1ZGLM 4JFDB 1U8JA 2EC9U 3SBWC 3SKJH 4GO6B 3RL2A 3F58H 4P2OD 4OCSL 4NQEE 4NFCA 2OP4L 1LO0L 3ARBB 4UUJB 5IB2A 4GAGL 4J23A 3RQ3A 5C07A 3D69A 4UV7H 4Y2DD 1U8NA 4MDJB 1R0AH 3MMEB 3C60B 1I1YA 2B5IB 3BIBX 3CFJB 3QA3A 1W72B 1LEKB 1Z5LA 3T09A 5GJSL 2CGRL 3T2NL 1C5BL 3QQ9D 4FQ1H 3PHOB 3DETC 5AZ2H 4LCWE 2FSEB 4UINL 3I9GL 1A21A 1JI2A 1HXYA 1S7XB 1AD9A 4FQQB 3RL1A 2P5WB 5KJRL 4I0PD 4GRWH 3OJ2C 2J8OA 2HJFA 4P57A 4KK8D 4S0TD 4PJIB 5KAQG 5IV2A 5MP6H 1VFAB 2F74A 3MLWH 3GNMH 4NCC1 1U8KB 5FGBA 3Q5YA 1IEHA 4NOFA 4H20H 3MRRB 4HS3B 4R9HA 5D2LE 1FL5B 4J3UA 1A0QL 3AXLB 3D85A 4HXAL 4LLWB 2A73A 4OD1L 3BZEA 5DMIH 1OM3L 4JFFB 2I26N 4R4FH 1V7NL 3V6FA 3H42H 3ZDYE 1CBVL 4G6KL 1FO0B 4KZDL 1A6ZB 1WJ3A 5CEZH 3GSUA 2Z4QB 1JPGA 1T04B 1INEL 3OAUH 2H41A 3DI2B 2OK0H 4UT7H 5DVNA 3CVIH 3OKDB 1E6OH 3JWDL 1DFBL 3MRPB 4Z76B 2X4RB 1CIDA 2Z31D 1RUAL 4MA7H 2HH0L 3WIIL 1JZ8A 5D5ME 1OQXA 2Q6WB 4UTAL 4BSJA 4YGAB 4NO5B 5IHUH 2JB5L 2XZZA 1JNHA 5D70L 2HP4A 1UJTA 5J89A 3FQNB 2X09A 5DJDA 3N85H 3FN3A 3JUZA 3U7WH 4BH7A 5ADOL 5TE4L 5DEFB 3V52H 1KT2A 1CICA 1PG7L 3OTTA 4ZNEA 1RIHH 4FFWC 1MQKL 4NQXA 3NIDE 3MRDA 4LSTL 1XGRA 1JN6A 2VLMD 3DURA 4QO1A 1MCNA 4YPGB 1MFDL 3LCYA 3KR3L 3W9EB 1F42A 5CGTA 3X13A 1KCSH 1DTUA 1DQLH 5HGDA 3GSQB 3D6GA 4AIZB 2A83B 2HTKD 4P46A 4ETYA 2EKSB 1NFIB 3BRDA 2EIZA 2D3VA 3WS6C 1U0QA 4D9QD 4JLRA 4PS4L 2ESVB 3G5YB 3SGDH 4MXQD 4XNYH 5E6ZA 3FQUA 4K3JL 4KMTH 5FFLA 3VMNA 4YQXH 3WLBB 5D1XD 4HX1B 4J1UA 1LP9F 4JVUA 5E8PA 1JHTA 2ED9A 4LLQA 5ADPH 5DUML 2PO6D 4I0PA 1QLEL 3U7YL 1KFAL 5DF0A 4WDIA 5I19H 1SY6H 5GRUH 1YMMA 4QWWC 3UROR 1W0WB 1IBGL 5C9JA 4QNPF 3X3FL 3VRJA 1GHFH 1WTGT 4PJDE 3ARGD 4LQFH 3RWGB 4IMLA 3K4DA 1F90H 3MGTA 4YHKL 1A5FH 3JWNC 1VENA 4PGCB 2XWBB 1DQMH 1K6QH 5KSBB 1ZVYA 3VG0L 1OGTB 4HWEL 1KCRL 3QPQC 2JIXD 2KZ1B 1XT5A 3HLAB 3VXPB 5F70A 3EYFB 3O8XC 5SV4A 2PTVA 3QUKB 5CJOL 3RGVB 2VXTL 1PKOA 4L4TD 2VLKB 1UQSA 2W9EL 3PDOB 5DA4A 4U1MA 3RWFA 1U92A 2Z31A 4S1SL 3VFTB 3HPLB 3VDAA 1DUZB 1AQDB 4S10A 4AMKL 3NA9L 3DBXA 4XAKD 1EHLH 3GMLB 3MQIA 1JUFB 4HC1H 4GT7A 1T7XA 4M3KB 4MNQD 5H94A 4ZXBA 4P2QB 1FVEA 1OD9A 3DV6A 2NY7H 4TNVF 3DSFH 3DX8A 3O45B 3WHXA 3BOVA 4KRPD 5D2NC 3U0TB 1KJ2B 5DMYA 4Z0XB 3QUXB 3VH8A 4WFGE 2Y6SD 3TBTB 1KPVA 4HEPG 4P4RB 5IROC 4PP2A 1JRHI 3KGRA 4TOYH 1JHLH 3U6RB 3QIUD 5DHVH 4PG2A 1NBZA 4XPFH 2NNAB 4Y1AB 3BXNA 4JZNA 2AVGA 1JCKA 4DWHA 5L9DH 4YXLL 2OTUB 1AE6H 4KROB 3WFBL 3PWPD 5C09B 1R3KA 1I8MA 3OKOA 1CDCA 3BP5B 1KB9K 2RGSA 2VLJE 2W0FB 5DYOA 2YA0A 5EZIH 2F53A 1MHCB 3QDJE 5CZXD 1E0OB 1DE4B 4XBEL 4HUUB 5CAYB 1GVIA 1MI5E 1AC0A 1KXVC 1OW0C 1MRCH 2XG5A 4PB9L 4JCLA 3B6SB 1T1YB 2IADB 5I30H 1KLGB 3UBXB 3QO1B 5C9KA 5EN2B 3BJLA 4MJ2A 5IT2H 1OT2A 2PO6A 3MO1B 5C0AD 1O7VA 2A6JB 1FSKB 1OY3B 1O5DT 3OR6A 5BXFA 5AZEH 1NCBL 1F4AA 1L7TL 4W6YB 3SKJL 1WSST 5E9DE 1IM3B 1ZS8B 3MRIB 2DLHA 2RIKA 3STLA 3EIFA 1UB6B 1QRNB 4UV7L 5DK0A 2YN5A 1XCQB 1NGYA 2FWOA 5LCVH 3MA9H 1U8OA 4NSKB 3EJJX 4D3CH 2F8XC 4L1DA 4G8GD 4Y5YC 3R8QA 3U46B 4KK6C 4UNTA 2EEAA 4I3SH 1G9NH 3MUGA 4ZUSB 4L4TA 1ZT4A 5FDWB 3QFDA 3NN8A 1D9KC 4MA1B 5GGUA 4MNHA 3UTQA 4PRAA 5D7JB 1YEJH 5DD0L 4AT6B 1FNFA 1BQLL 5GS0H 1OP3H 1MFAL 4LASL 4OUOA 1UFUA 4KC3B 5IBLC 5KS9B 1P4IH 1KB5L 4ENEC 2PW2A 3HZYB 5B39A 4YDLB 3S88L 3T0EA 5DD1H 1NL0H 3CFCL 5MP6L 3MLWL 3GNML 2IQAA 2VR9A 1ODAA 3V6OC 2XT1B 3BE1L 4H20L 3RVUC 3X12A 5CS7A 4KKAD 4PP1C 4GXVH 3MLXH 4E0RA 5FM5O 2UYLB 1KPUB 1FG2A 5JO5B 3K1KC 5E8DL 5DMIL 1FNSH 4YHPA 1EEZB 3V4UH 3VGAB 3MX0A 4OV6F 2W65A 5JNYB 4R4FL 5J4MA 1QSFB 5DMKB 3H42L 2X6MA 1UB5B 4ZAKA 1I1AB 1N6QH 4N8VG 3PV6B 3OAUL 5IEKB 3OQ3B 1Z2KA 2EDQA 3CU7A 4MQSB 1E6OL 1Q94B 3CSYA 1ROWA 4P9HC 3G08A 4M7ZB 4CGTA 4NQDE 4G42A 3S96B 3IRPX 1AR1C 1J8KA 5IB5A 1GXEA 2FIKA 4MA7L 5D9SB 5JQ6H 2FO4B 4XB7A 2GK2A 2ZZUT 2HKFH 3V8OA 4I18A 5IHUL 2YBRB 2GCYB 2AABH 4JFPB 5IWLA 5HYJE 5ICYB 5C0AA 1ZA6B 4I5BB 4GKNA 1RIHL 3KXFB 3FAWA 4X9HA 3GMMB 3P73B 2FEDD 3MPCA 2LVEA 3T08A 3QI9D 3BPCB 3HRZA 5HI3C 4M5YL 4NKDB 5IB4B 12E8H 5BOPA 1SYVA 1IC7H 4Z7UA 1KCSL 2G5RA 1A6TA 5I73B 4F9LA 1KJVA 2IH1A 3MLYL 4GUPA 2XA8H 3GJFH 1UXSA 1QOKA 1XZ0B 2R0KH 2PYFB 4UB0L 4L5FH 2YC1B 5J12B 4NYLA 4BFEA 3X3GH 3IJHA 1UKQA 3FFCD 2FJHA 3UMTA 3L5XL 2JJWA 4KMTL 4MQTB 4F7PB 1FSKC 1EK3A 4X98A 2QR0B 2DI7A 3VFPA 2H1PH 4G7YL 2HT4D 2CQVA 3BZFA 3EO9H 4WUKL 5HBBA 3V5DA 1C5CH 3B43A 5ADPL 3ULUC 4YBLB 4NN5B 3BEWA 3ARYA 4RGNC 4LAQL 1R24B 3QHTC 5I19L 1SY6L 5GRUL 2BVYA 3RVVD 3WLWD 4LKXB 4JFXB 1GHFL 3EZ8A 4XH2A 2IH3A 1AD0B 4OKVA 4LQFL 4GKZA 4CVZA 4CADA 1AIFA 3LKPB 3MUHL 1F90L 2NX5A 4KY1H 3R0MA 1A5FL 1DQDH 4HKBA 3BIKA 1S8DA 5EOTB 3LKRA 1NUGA 1K6QL 1D5IH 1AJ7H 5T3XD 3C6LB 4XP9L 5FYLD 5DJCB 1L7IH 1U95B 2E9BA 1QFWH 3TNNB 3DHJA 3RX5A 3GMPB 1SEBA 2PKDA 5D7JC 5GSVB 1ZLVH 1DDHA 3HR6A 4WUUA 3MFGB 4F3FA 1OSZB 3EGSB 1L0YA 1KIQA 1YNLH 1NGPH 1GGCH 1E4WH 4FQJH 2DB8A 3MV9E 4U7KA 1HSBB 3ARFC 1WIOA 5JXEC 4QCIB 1CXKA 3TCXA 5IJKC 2HG5A 1HHJA 2PR4H 2NQCA 3JWOH 3N9GL 4JO3H 1W0YT 1MUJB 3PL6B 3WNLA 2NY7L 2Q1EA 3DSFL 5ALBH 7CGTA 1TPXB 5DURB 2A0LD 2A6IA 3ZE1E 4JRXD 3VA2C 5FKPB 4R7DA 3BN9D 4JDZA 3CCHB 5B38B 5E94A 4QOKB 2IAMB 4TOYL 4XWOC 3O6KH 4MJ6A 4M48H 3QI9A 3MNVA 3QH3A 4NNPH 1JTTA 2EE6A 4RX4A 3O6FD 3PGDA 4GXUM 5EU6E 5L9DL 2P46B 2X5PA 1XF3B 4X8JA 4ZO9A 2X70A 1MCKA 3ULSA 4D0DB 2I9LB 2VZTA 2QQNL 1PLGH 3GRWH 1T89A 5DD3L 1U2HA 4PJFF 4OQ1A 3ETBF 1T0NB 3NCYP 3QDGE 5IQ7L 4OZFA 1INDL 3ARDC 4DVRH 1I7TB 1EJOH 1FYTA 3S4SB 4F8TA 2V7NA 3PJSB 4LEOB 4GBXA 4DCQB 4GRWB 1YYLH 5MHSE 1UH3A 5H37G 1P7HL 4M7LH 2LFGA 4MS8D 3I85A 4NHUB 5IMOA 1MRCL 3HS0B 2OTPA 1EIBA 4PJGB 3FTGB 1UH4A 4PV9A 1UM6H 1RJLB 4F8QA 2VMFA 4JHBA 4F7EB 5D7IB 1JWSB 3HRPA 5IT2L 2AJVH 3QDMA 3RIAF 1JGUH 1U3YA 1Y18A 2BVOA 4RAHA 2NXZD 3MJ7B 5T5FH 1ULVA 3HR5A 3PABB 3RZWA 3CFKB 5B8CA 1ZVSA 5IR1B 5E2UH 4ZUWA 4Y4FB 5AZEL 5A3ID 4EN3C 3V4VL 1XGTB 3LV3A 1I7RA 5CIPH 4HBCL 1WIPA 5D7SL 5IHZB 3MTRA 4Z78B 5KZCB 2MMXA 1CGTA 1U8MA 2CDGB 2DIBA 4ODSL 3UO1L 4PRBA 5T3ZH 1U3JA 3R0NA 4CNIB 3Q6GH 2D0GA 1G7JB 1QR1B 4TYUA 4NN6B 5LCVL 2HLFD 4BZ2H 3VW3H 2G9HA 3KAAA 3MA9L 3IDMA 1WFNA 3GSOA 4JFQA 2ZNXA 5HJ3B 4NUGH 3C09B 4D3CL 4YO0B 5HHPA 4WW1A 5EO0A 1LVEA 4I3SL 1G9NL 3CD4A 4YBLC 4NN5C 4X4ME 2R9HC 3BGAA 3L7FA 4FFVC 2YSSB 1Z3GH 4X6CB 2XN9D 2DKUA 4EUPB 4X7TA 5IVXF 1P4IL 2R1XB 1CDYA 1D7FA 3VFSB 3UZEA 4FN0A 1MAJA 4U1SB 3Q5TA 3DOSA 3VFRB 1IEBB 2EYTA 2BHZA 5C0DA 5CGYC 4PTUB 2V2XA 3SJVA 4XRCB 4MXVF 3EDDA 5IMMB 1MRFH 3MCKA 4JM4H 1J8HB 4GXVL 5K9JH 1GOGA 5L8LB 1VPOL 5ANMB 1N3NB 3V8CA 3O9WA 4QRRB 4GXUN 1FNSL 1QZ1A 3V4UL 2YK1H 2VDOH 4FFZL 5C0BB 3O6FA 3AFLA 1NFDA 1HOCA 3TBSB 1VFMA 3OKYA 1EFXB 4QRPA 1MQ8A 1U91A 5IMLB 1N6QL 2HT2D 3QDAA 5I1HH 5I75B 1S5HA 1DVFC 4D9LH 3FQRB 2D4FA 4JJ5B 4GW1A 5EZLA 2VABB 4XBGB 1ZKAA 4MHHI 2H32A 3PL6C 1QD0A 4GOSA 5EB9A 4JRYB 1Q38A 1WVZA 4DTGL 4RAUB 2HKFL 5D7LB 1P84J 4PR5B 4WFHD 4HUKB 3QEQA 3QEUA 1P7QA 1YEGL 2G75A 5D2NE 3V95A 1T0MB 2X4NA 1H3PH 4JFFE 4M8QA 4P4KD 2ZSVB 5FO9B 3CUPB 1ZHBA 5MEOB 3QJFA 2HYMA 2L4OA 4I2XB 1C5DA 4N0RA 1D3CA 4PJAA 3KPNB 4PFEA 3Q1SL 1BVKA 3DWTA 2A6DA 4P9HH 3GSNL 1KENL 2XA8L 1CFNB 3I2CL 5KVMC 4QGYA 2XQYG 1MELA 1A14H 2R0LL 2R0KL 1OTTD 1H3UA 5I71C 4LHQB 5JHDD 1A7PH 1MY7A 2DQGH 3TA3A 5T3ZE 5GRVL 5J6GA 5I1AB 3X3GL 2P8PA 1F3DJ 4YZFF 1JP5A 5EFIA 1X44A 1YEHH 3T04D 1QA9A 5JIKA 1AP2B 1EHNA 2VDQH 1IKNA 4ZSOE 5JOFA 3WJJA 4RZCB 5GGQH 2R4RH 1M7IA 1NUNB 4MD0B 3WUWA 5JDSB 2H1PL 4PREA 1VADA 3V0VB 1FPTH 1H8SA 3EO9L 4Z95L 5HGAB 2DI9A 3C5JB 3G5ZA 4EOWH 1C5CL 2XQYK 5DEGB 3KLDA 4YK4B 1W8OA 5DHVB 1CYGA 2R2BB 4WWKA 3SCMB 2JELH 3DV4A 5FYKD 3RTQD 1A6PA 4Y2OA 2MSPA 3TBWB 1UVQA 2IANB 1VKXA 4N0FA 3QQNA 2AV7A 1T5WA 1T4KB 1UWEH 5DMGC 5DVKA 1EEQA 1D6EB 2D31B 4Y19B 3NFPA 3BDBA 4KY1L 3U4BL 1CDBA 2G5BA 1NBQA 3DIFA 4L1HA 2I60H 2XYCA 5IVZA 2NLJB 4W4OA 43CAB 4R8WH 3C5ZC 2ESVE 1KOAA 1D5IL 3QWOA 1AO7A 1FZMB 4LSUH 1QFWL 2ZOLB 3EO0A 2YA1A 1I1RA 1NANH 2P24A 4WU7A 5HYEA 1T2QH 2HFEA 4OZGA 3LZFL 1J0HA 3LD8C 4NRXA 1YNLL 4DGIH 1GGCL 3VXRE 1E4WL 3S5LA 1V05A 3O3BB 2X7LA 5GRXG 2R2HA 3MR9B 2HJLA 2WBJA 1FZJB 3FFDA 3SOBL 2ARJA 5DO2C 3FCTA 2PR4L 3PNWB 3MLUH 1RUQL 4XXCC 3VXUB 5J11C 4RFOL 4U1KB 1UZ8B 2KKQA 2P44B 5ALBL 4U3CA 5FIEA 3RVXC 4JFZH 2CXGA 1IC4H 5HPMA 3V6OE 3ZDZF 3U2SB 1BOGB 2HJKA 4P4KA 4Y4HC 3QUML 4XNMB 5GSRA 5FB8A 4OZHE 1TZGL 4YHYC 3RIAK 1G0XA 3O6KL 4JFEA 2OR9H 5I75C 1S78C 4ZDHA 3BAEH 1U8HB 2VLKE 1FP5A 3FJTA 1E4JA 2FD6H 1BQUA 3K8LA 5F9JA 4P46C 4PY7B 1OTSD 3BP7A 2CR3A 4ORZC 3ZSSA 4B7LA 1V7MH 1JPFB 1RIVH 3DYOA 1WEJH 2VIRA 1NFDF 4PJ8A 1HWGB 4DVRL 4EIGB 4JM2D 4KJYB 4MX7B 3UP1A 1EJOL 3I75B 4QHMB 1YYLL 3NGBB 2ZPKH 3MACH 4M7LL 5J1SC 3AM8A 5EZJB 3RUGE 2AGJH 4BH8A 1CWVA 2EDJA 2AJ3B 3IB4A 1UM6L 5ITBH 2C9AA 4KJWC 4NT6B 4PG9B 1QEWB 4KK5C 1FVDB 4FZEH 4Y5VB 3W81A 3V5HB 5IFHL 5IKCA 5ACMA 4XPTH 4UI2A 1NGWA 3BT2H 1N59A 4Y1AE 4XBPB 4NKMA 1JV5A 4KJPC 5SWZD 4NZRH 1LO5B 5HHXL 3DVNA 5KSUA 1MHHA 5DS8A 5AG8A 1LE5A 2QKIB 5F7UA 4KDTA 3QUYB 4F80A 4P3WA 5T3ZL 2XG4A 3Q6GL 1OAKH 1RAMA 3DUUA 2H3NA 1WZLA 5J1AB 5EIQA 4F15B 1TQCB 4BZ2L 1F97A 1WZMA 3VW3L 2GSIB 4HGMA 2FR4B 4G9FB 1I3GH 2ZG2A 3LN4A 1CLYH 2D03L 5IVOA 4OLEA 2VDLH 3TNMA 1CVRA 2F58L 3QZWA 3ZMRA 3P4MB 3NPSB 1T3FA 5LWYH 4LGSB 3HE7A 4NO0A 1YA5A 2MTPA 4QRQA 2CKBH 4YDVA 2NY1B 2SEBB 3SE8L 5IGXL 3MLPA 3HG1A 1KTKE 3OXSB 3L3HA 5JW5A 4FS0A 4CAGA 4ZXBC 3T0XA 4RGNE 1WBYB 4YR6A 3BH8A 3QXVA 3DX7A 1HI6A 3FO9A 4FTVA 1DLHA 2YS4A 1S9XA 2C3WA 4FXKB 4XVSH 2HVKB 1MRFL 4KI5D 3EJYD 3GJFB 4F57H 4Z77B 2R0ZH 1PD6A 2NY2D 3B9KD 4GAJL 1FJ1B 2UZIH 2MCPH 1CFVH 3KPQB 2VLRB 1Z0NA 4S1RH 1G7IB 1BGXH 5L2KD 2GFBA 1ZHLA 1NGQH 1HQ4A 2VDOL 1MJ8H 3SDXE 5I18H 5F1NB 3MRCA 1A4KA 2YPLB 5KVEH 3BW9B 2ED8A 3VWKA 1YMHA 2O5YH 5I1HL 4D9LL 5DJXB 1NC4B 5EU5A 3D39E 3QIBB 4TUOA 3HE6D 3MJGX 5BRZB 3RZCD 3OF6A 4RIRA 3S37X 1RULH 3VGGA 3R06B 4I77H 4WW2F 1ZHKB 2ZSWA 3QCVL 4H8WC 5FYJD 1G7PA 4LHUG 3VXQA 4NJ9L 5DJYB 4OLVL 5GS2D 4LDOB 4X7DC 4LBEA 4PRNB 1MFBL 3VXSB 4HIEB 3DMMD 2OI9B 3EOTH 3HI1A 5FUZH 2X1XR 5EPMB 4LCCB 4M6OH 5E2TL 1I8IA 2BNQE 5AUMA 3SGJC 1HILB 4MJIE 1P4LB 3WJLA 4YNYA 1KIPB 3QFJD 4LPTA 3H9HB 3MFFA 1HYRC 1CFQA 2ZUWA 3BKCH 4IRJC 2NXYD 5IJVB 3DX6B 5MI0C 2ITDB 4P23C 3VD9A 4P9HL 5HDOA 4M4PA 3O3DA 3JV5A 4M6NH 4S2SA 4XTRD 1NKOA 2BSED 3ZTNH 4Z7OE 3MYJB 4PGDA 2NY5C 3WUZA 3MJ9H 5I15H 1A7PL 2DQGL 2ILLA 2N7AA 4ZPVA 3VXNB 1IMHC 4JKPH 5F9WB 5JIPA 3CX2A 1NDGA 4JFHE 2C1OB 3GMOA 4LCIH 1ZTXH 2VDQL 1BBJB 1OLZA 3KPSB 4P3CH 5F7KC 5GGQL 2R4RL 4PBWD 1I7ZB 2KL6A 5ERWA 3TZVD 1BF2A 4ZOEA 3KPMA 4EOWL 2FCBA 4FQXC 3G9VA 4PJHE 1NUDA 4U6XA 3P40A 3T4YA 3T0EC 1KEGH 3QUZA 1KJMA 4JG1L 4LF3B 4OUUA 2JELL 3F7RA 4ZYKB 3JUYA 4HIHB 4WI3A 4X6DE 4LGPB 1N26A 1UWEL 1FNGA 3O4LA 4I4WB 1Y6NR 1PKQA 2A38A 3WFCH 4HUNB 1H3TA 5L2KA 4M1DH 2H6PA 1OARH 1GCFA 6CGTA 1CGVA 3FQWA 3RPIA 1YPZE 2B7DT 4OZIE 4LSUL 4ZAKC 3ILQC 3KYKH 2LTQB 4YUEH 2NY1C 2RCSH 4X5WA 1RK1B 3NMEA 1T2QL 4IRZH 5ID0B 1S7RA 1CFTB 1UC6A 1H15B 2V5RA 1WWAX 5BV7C 5TDOB 4NCC2 1A7RL 2ENSA 1IFHL 4P2RB 4LVNC 4XPAH 1JRHH 1WCBB 5ISZB 4P59H 2E8YA 3JTSB 5F6HI 1G6VK 1YEFH 3C8HA 4EDXB 2XTJB 3GBNH 1HNFA 4ZS6C 4JEGB 5MEND 3T2QA 4XC3H 4HWZA 1MIML 4HWBL 2F5AH 1LEGA 4G43B 2CK0H 5DMJB 3LKNA 3QNXA 4HIJA 5EUKA 3R8BB 4HBQA 4PRIA 2FL5A 1S7VB 4ODXB 3QHFH 3FOLB 3UPRA 2OR9L 2XKSA 2YD3A 4Z7VA 2C1PA 2V5YA 3P9MB 5CJQL 2VL5A 3IETA 4TULH 1L9MA 2B0SH 3SGKA 3BO8B 2ICWA 3BAEL 2BY3A 3SDDB 1FC1A 4D0BB 3I6KA 4R2GD 1GGUA 4PJ9A 2APWA 1PZUB 1WEJL 4MLIA 1QSEE 3HUJA 3U0PB 3LN5B 2WV3A 3WDJA 4ZFFB 2GKIA 1JL8A 2AXFA 4Q6IC 4LLAA 3EYVA 3BI9X 5FOJA 4PY8I 2ZPKL 2KBGA 4JM2F 3SDCC 4E41D 2QADC 32C2A 4OTXL 2PNDA 3IS1X 5DJZB 1S9WB 2DN7A 3THMH 5ITBL 5KSAD 3MCLH 3LHPH 4FZEL 2P5EE 2Z8RA 3L3GA 4XPTL 4UIMB 5CHNA 5GZNC 3OJDB 3BT2L 1EO8H 4N68A 3S3JA 3HI6H 2VXUH 3ET9F 4NQCB 2P8LB 4TSBH 1U36A 5DD6B 3QJHB 4KK9C 2X4UB 1QFWM 1A9BA 2NZ9C 1A1OB 3I6GA 3BEVB 1A6WH 1RURL 2AK4A 5ENWA 4RBPK 3BVNB 3JZ7A 4D0CA 3U9PL 4PJEB 5C07E 4DVBB 3P4NA 3CDCA 3BFOA 3RNKA 2WINB 1F3JA 4HS6B 2OS7A 5DJAB 4ELMF 1I3GL 2YXMA 1XGQB 5FA4A 2X4TB 2AV1B 2VDLL 3H3KA 1X4XA 3UTTD 1DQJB 3W5NA 3SN6N 4D9RD 1ZT1A 4DOHB 1JMXA 3TFKD 1AGDA 2CKBL 3MV8B 4OSUH 5IMKB 2AJUH 4GG6F 3CSPA 2ID5A 8FABA 5KG9A 2CLZA 2OM5A 4MVBD 1X5HA 5F6HJ 1OSPH 1MEXL 4ZS7H 2VISB 1BFSA 4OFYA 1JBJA 4XNUH 4JAMB 4K7PH 2Q8BH 2JJTC 4GH7B 4JKMA 4UOW0 2YWYA 3LKOA 5E08L 1K2DB 1LD9A 1F11B 4L3ED 4XVSL 3D18A 2X1WL 1U93B 4F57L 3DUSB 2R0ZL 4KTYA 3QRGH 4ODVH 2UZIL 2MCPL 2LTQC 3B3IA 4K23L 5DUPL 4K94C 2VTFA 4PJXA 4S1RL 4YHIB 2Y1VA 1DSFH 1NGQL 4ZQKA 4KAQH 4BZYA 1VGKB 2NY3D 1SVCP 4R3SB 1CZ8H 1JTPA 2O5YL 5IFJB 1SYSA 1BJMA 5JZ7C 1PQZB 4TPRH 2MHAA 4L9LB 3NFNB 1E6JH 3BQUD 4G8FB 4YHNA 2EYSA 4PJCF 4PY8J 1RULL 1K5NA 1ORSA 4I77L 3VMPA 1EXUB 4HKJB 2JJSC 4HV8A 1BD2B 4Y4KA 3W0WB 5DDHB 5CINH 1F45A 3UZQA 5C6PB 3AREB 3CDYA 5JW4R 4O2CA 2I25N 5F9OL 4NZTL 4NQED 5FO7B 3EOTL 1T83A 5FUZL 1MIEH 3AAZA 4M6OL 4OLUH 4W4NA 5C0BE 4WY7H 4FFYH 4KXZI 4PJ7A 4Z7WE 1WT5A 1MLCA 3GMNB 4IRSA 5SWSB 3DRTB 1MPAL 5L7XL 3BKCL 1XIWB 1WWCA 5L8JB 5ESVA 4QHKI 3MLVH 3RWIB 5C0ND 2AKRA 5EBWB 2IFFH 1T03L 4JKWA 5AYUH 1DEEA 4KJQD 2EKJA 1RSFA 4M6NL 4R4NC 2IQ9H 3GJEA 5EC2A 5HDBE 3W9DA 3KPLB 3ZTNL 4LCWD 1MCIA 4MA8H 1LK3H 3RWEB 4HH8A 1ZLWK 5JPNB 4FQ2L 3PWJA 3MJ9L 3O6LH 4FQHB 4JHZA 1U8LA 1R3HA 3IFPA 1FNHA 2GYSA 3VD5A 1ZTXL 3UJTH 2HTLD 4P3CL 2Q86A 4LSPH 3VFUB 4QHLB 2BOCA 1LO3L 4MQ7A 1PG7W 4J3XA 3KYOB 4XCYB 1GC1C 3L5WA 3H9ZA 1KEGL 2OYPA 5TH2B 5HHMB 2QHLA 4HJGA 3VRIA 4KU1A 3VE0A 3OKMB 2Z93A 2V2TB 2QSVA 1FGVH 3QO0A 4HPYH 4ACPA 3LKSA 4L3EA 5FCUH 1HEZA 1CU4L 5J06A 5MEQB 1FN4A 2NY5H 3G6JA 2JCCE 3EKCA 1G7QB 1HYSD 2J8UA 4U6YA 2ITCB 3CH1A 3VXMA 2GTZB 1F4YH 2K7PA 4BA8A 5A40E 5CEXB 1YJDH 4MA3B 2XTLA 4LOUC 4HKZA 4YUEL 2VSCA 2RCSL 4NRZB 5DFVC 2QQLH 3BPOC 5CBAA 4ZOAA 3N50A 5SWQA 4WO4A 5I1IL 2GITB 5HHOB 2B1AH 4IRZL 2X9WA 2D7TL 4J4PD 5HVFB 3DROB 2DMKA 2FB4H 4LFHD 3ULVH 4LPYA 1QBMH 1RV6X 1UM5H 1CXIA 2QBWA 1JRHL 4XPAL 2CIKB 2PUQT 4P59L 2Q76B 5KW9H 2KQNA 2IANE 3TCLB 2GJ6E 1ZANH 3CZFB 3IXAB 3MRJB 1YEFL 3GBNL 3STBA 2WLYA 2COQA 4XNQA 4XC3L 1J5OH 5ETUA 1FFNA 2F5AL 3UTZB 2CK0L 2ZCHH 4DFHA 3PGCB 1CLOH 4NN7B 1BX2A 4LVOB 1G9MC 4XCCH 4YIQA 3QHFL 1B88A 1MVUB 1DEDA 5TPWH 1NEUA 5I6XC 2OL3A 3K4AA 4QHKJ 3D3VB 4TULL 4WFFE 3PHQA 3MGOA 1R3LA 4PJXF 1GYAA 4OD2B 1RHHA 2GSGB 1T1WB 2QQKH 5BV7H 3IDGB 1D5ZB 3VFOB 3RY6C 4RSVA 1FG9C 3F6IA 3TA3C 2F53E 2PYEB 4UT9L 1QR4A 1A2YA 1YNTB 3H0TB 3KPOB 5HYQA 3PWUA 3TVMA 4K7FB 4X4XB 4KQ3H 3AREC 3PWVA 5IIEA 3S36H 1J0ZA 1IKNC 1Q9OB 1A3LL 1T5XB 5CP7A 3TO4B 1FNEA 4JHWL 1SBBA 3HHRB 1NAML 4YBHA 1A8JH 3WFEL 4EVNA 3W39B 2IALB 1BIIB 3UTSD 3FT2B 3LRSB 3P4OB 3OAZK 5FGRA 3HZVB 4JY6A 3SDAD 5JDJA 2UWEB 1EO8L 3HI6L 5E6IB 3LMJH 3RVTD 5F7DB 3IJSB 2EICA 2VXUL 4F7MB 4QHUB 4C56A 5GRYA 4TSBL 4ZO7A 1A7QH 2OTWA 4K3EH 3Q5OA 1NC2B 3MZGB 5I74C 3CVHL 5T1MA 3QXWA 1YNKH 1X5FA 4MNGB 1A6WL 2DTMH 5DLMH 4W4OC 4OIAA 4APQA 3ISWA 1BJ1J 1U3HD 5AYQA 2E7HA 1U2CA 2I27N 5EIIA 3GDBA 5JA8B 4NFBA 1AXSA 1H3GA 5D5MA 1AGEB 4MD5A 4OJFH 2ADJA 4V1DB 3RI5F 3ALXA 3F12B 4NBYB 3RDTC 2WIMA 4U7MA 5INDB 1W0VA 4NQTA 4E5XB 4XVTL 4J4PA 3L3KA 2X1QA 2AJUL 1QFUL 4WFGD 3SKMB 1FRGH 5JUEH 5F88B 5EORH 3NZ8B 4UAOC 1IAII 5I66A 1TZIB 4M9PA 4P0DA 3T0EE 5E4EC 2OBGA 3L9RA 6FABH 2NY4B 5C71A 2YD8A 4PJBF 1LNUB 2Q8BL 3IVKB 3HAEG 3MBEA 3TGXA 1MWAA 4AG4H 3QULA 1KULA 2FBOJ 3K4ZA 4N8VB 3GBLA 4MAYB 3LSOB 3ZKXB 1LP9B 4GQ9H 3QRGL 1ZLSL 4ODVL 1QUNA 3OHXB 4OGAC 1A9EA 1OAQH 3MV7B 3LEYH 2C3VA 4YFLI 3MLZH 2VLJD 3QDJD 2RJMA 4BUHA 5CMAB 2XQBH 4KAQL 1MFEL 5TDPA 1CZ8L 1QP1A 3P9WB 4Z7NF 2A9MH 1MI5D 3HN3A 5HD8D 1OTUD 4M6ML 2PXYD 3MRMB 3KPRB 1BFVL 4U6VH 5HGBB 4PJ8C 4TPRL 5I8EB 5T1KD 4L8CB 3QEHB 5D1QC 4MWFA 1NQBA 1S9VA 1XGUA 3O11B 4BFIB 1KLUA 1YQ2A 2X9YA 3IFOA 3QIWC 2JJVA 3CH8A 4TRPL 3CFBB 1V3MA 1JF1A 3CX5K 1KB5A 4W68A 3GIZL 2DBJA 1U8NB 5CINL 1E4KC 1IAOA 1I1YB 2GT9A 2PCPA 2NMSA 5FKAB 1TQBB 1MIEL 1Z5LB 1KPRB 4FFYL 2X4QA 3C9NA 4TQEL 1RK0A 3UXFA 1JFQH 5FF6A 1QNZH 2C26A 3EYQD 4I3RL 1NBYA 4OZFH 3MLVL 4Z7UE 4H0GA 4F9PA 2EDHA 5F1SA 1HXYB 1F6AB 4LMQI 3MNWA 4K71C 4W81A 3RL1B 5AYUL 3KHOA 3FO1B 5E03A 1U42A 3WE6A 4N0CC 3UYOD 5BS0E 4K3DH 1WBXB 2WQRA 3QAZC 1A22B 4MA8L 1LK3L 5J9PB 4HIXH 2BVPA 4ONFL 1KG0A 1JK8A 4H8WL 3FL7A 3Q2CA 3VWJD 4GAYB 5K9OA 4AEIL 4YWGH 2BERA 2X4PA 1CGWA 1GL4B 3BGFC 3D85B 3RX7A 3UJTL 1F58H 4WTZG 4OM0L 2EDDA 5FGCB 4YAQB 4LSPL 4OF6A 5E6IC 4U1IA 3QQ4A 5C0CA 1CE6A 1IGTA 3T0WA 5H2BA 2CLVB 1KTRL 2Y72A 5FO8A 3UDWA 1XF2A 3EFFB 5D2LF 1NBVH 1Q72H 1OGAA 4ONGH 5DK2A 4HPYL 3TPUB 1VESA 5T3XH 3ELAT 1JZ6A 4FZ8L 2NW2A 5C6TL 2NY5L 3UC0L 2NX5E 5DTFB 1RJCA 1NDMB 4WRLA 3ZDYF 4BQ9A 1F4YL 2VLJA 4QKXB 1HSAA 1YJDL 3CDFA 3ZL4L 1D6VH 1OAUL 4G5ZH 4NQDD 5CCKL 3GI8H 3AGVA 3UYRL 3VWKC 3I3EA 2QQLL 4UTBL 5DRNB 4BH7B 4WUUE 1AH1A 5CD5D 3L6FA 1KT2B 1BECA 1CICB 1WZ1H 5INCA 4JG0H 1ZLUK 5T1KA 5F3HA 4LDEB 1GC1H 1AQKH 3MRDB 2DBLH 2FB4L 2AXHA 5HYJD 3ULVL 2B4CC 5D5MF 1MCPH 2NY4C 3K8MA 4AEEA 2A74A 3D2UA 3ROOA 1QBML 2ICES 1YQVH 1LEIA 3MRGA 3PQYA 3PWNA 4P2OB 3X13B 4BZ1H 1J1OH 3G5XB 5HGDB 5KW9L 4QTHB 3CC5B 3KG5A 2MPAH 2ZOKA 1ZANL 4MAYC 2MJWA 4Y2DB 1ONQA 2C4FT 5E9DA 3NIDF 2VZOA 3F5WA 3WNMA 4NQVB 5BQ7A 5E2VL 2AERT 2ZCHL 5E8OA 4L8BA 1JGEA 1CLOL 2F9BT 2OX5A 4XCCL 2W9LA 2VUOA 4NM4L 4OCLC 5DUBA 5D1ZD 1YN6A 2WWMD 1UEYA 2EIDA 5CEYA 2ZCKH 4LLQB 3NCEB 4NO3A 2H32H 2DD8L 5BV7L 4I0PB 3IS0X 3E8UH 1FC2D 2AAVA 2FX8H 4JVPA 1VHPA 5ISZE 2GAZB 1YMMB 4QXUH 4JFOA 3N1PC 4LCUA 1WWWX 4LPXA 3VRJB 3JBG7 3P2TA 3O3EA 3VWJA 1A4JA 1UADC 3AROA 1KIRB 2AJZB 3V0WH 2IPUK 3HZKA 3MGTB 1A6UH 1OAXH 4YC2C 1GGBH 2IC2A 4XCEB 1QQDA 1QSVA 5D6CB 4OCWH 3RI5K 2JB6B 2GJZA 4KHTH 3LIZL 1RD6A 2QSCH 3MRFA 1OT1A 3REVA 1FNLA 3QNZA 4PJDF 4JQVA 4X6FB 1C16B 4DKAA 4DUVA 3LMJL 4GRWF 5EU7C 4N8PA 1HH9A 4ALAL 1A7QL 2EDWA 4K3EL 4U1MB 2EE3A 3RWFB 4PJGF 1YNKL 2Z31B 4OD3L 2DTML 4M7KH 3OXRB 4P5TC 1HHKB 2EC9T 3F7QA 5DLML 5F1IA 1RZ8A 4J8RB 3FT4A 1PY9A 4Z0BH 4LVHC 3DETD 4LNRB 2IMNA 5H94B 4NQDA 4YLQT 1RQ5A 1OB1B 3CFDA 1U58A 4WV1A 3K2MC 5DHYA 5EUOA 3DX8B 5EWIH 1C8PA 3QWRD 4OJFL 2XWTA 1KPVB 4IJ3C 3IU3B 4QEGA 4RBPH 4PP2B 3HNVH 3VI3E 3UEZA 5FV1L 3VFMB 3U36B 2X10A 1HE7A 4H26A 5LXGL 1E4XI 5E4IA 4DEPC 3OX8A 3L3OA 4JQXA 5EORL 3K74B 3BPNB 3ZHKA 1IAKB 1SMAA 2DQTH 4I9WE 3FB8B 3OKOB 1IC5L 1I8MB 1XCTA 5CSZA 3SJVE 1LO4L 3CPLA 4Y16C 2YXFA 5DYOB 5EU6D 4LLDB 4JPKH 3QG6B 4PYGA 2JKXA 2V5SA 3O2WL 4M00A 3NCFB 3TESA 2V9TA 2WZPD 3MNZA 4GQ9L 3FZUC 5T1LD 3Q48A 3QDGD 1BQSA 3H9SA 3MLZL 2MCG1 5BJTA 1F8TH 1TJHH 3TJEL 5HY9A 5D1XB 2YA2A 3GI9L 3NABL 2CRIA 3TN0A 1TTFA 5MHSD 2A9ML 4QRPE 4UOW1 2PO6B 4PJ9C 4G7VL 4PRHE 2DQCL 1WLHA 4RNRA 1DBKH 4QRUA 5BXFB 1ITCA 5KOVC 4X80H 1UJ3A 3ARGB 1N4XH 1X6NA 3AS2A 2AK1H 5KVDH 4LRIA 4FFWD 2NY0C 3BX7C 2FBJH 4MCYB 4M9OA 4PLNC 4IMKC 4QYOB 3OKLA 5BRZD 4N5UA 3VRLF 2MNUA 3BESR 3SGEI 3QEQE 3SBWA 1HH6A 4K94L 4FXGB 4AM0A 2EXWC 2JIXB 4OF5A 3M17A 4PD4J 1R5WA 2VKWA 5JLZA 1MLBA 4YGVA 1GIGL 3U9UA 1JFQL 3X11A 4L4TB 1ZT4B 3TF7C 3QFDB 3NN8B 1F6FB 4MNHB 4LKCB 4DKFH 1QNZL 3IDYC 4RMTA 2APXA 3GSWB 2M1KA 4OGXH 4XNZB 1DZBA 1IGMH 4XP5H 4GQPH 4GW4A 4KHXL 4JZJB 4CU7A 2PW2B 4CMMA 5B39B 4RA0C 4MNQB 5EOCJ 3MV9A 4ZO6A 4HIXL 3NIFF 4U33A 1AGFA 3ZKNC 1BD2E 3FQXA 4KRPB 2DQUH 1EDQA 1TZHA 2N56A 3X12B 4EI5D 4H1LB 1TVBB 4E0RB 1CGSH 35C8H 3QIUB 1F58L 3BZDA 4QWWD 4RFEA 5C6WH 3O41A 4YHPB 3IDUA 4ORGA 3FQTA 3IF1A 5T33H 1T1XA 3WHE0 1ZLWH 1D5MA 1QG3A 1JGLH 5DQJB 25C8H 4KKLD 4JVWA 5C8JB 3DXAE 3PWPB 1S7UA 2EO9A 3UJJH 2Y7QA 1BBDL 1D5BB 1M05A 1NBVL 3IGAB 1Q72L 4ONGL 3Q3GA 3G08B 3QPQD 2OZ4L 5T3XL 3O8XD 2APFA 5T1LA 3QDGA 3LS5H 3HNSH 1MCSA 1RHFA 3EDEA 3OAYH 4RDQF 1D6VL 1AO7E 3GI8L 3HCVB 3RAJH 4NKQB 5J13C 1UGNA 4BQCA 3KDMA 5C0AB 5C0IB 1UWGH 5F89B 1C7TA 1WZ1L 4GKNB 3BPNC 2B2XL 5DSCA 4Z6AT 1EHXA 1GC1L 2DBLL 5E7FA 5DRXB 3SKNB 3GMRA 3KYNA 3S4SG 1ZGLP 1TJGH 3EJZC 4GSDH 4LRNL 1YQVL 4WI6A 1VEMA 4BZ1L 1A6TB 1WICA 1WTLA 5CKGA 1KJVB 1CS6A 1ES0A 1I3UA 3JV4A 1UXSB 2AEPH 4G3YH 4R26L 4GRLA 4FQIL 4MXQC 1XF1A 3SO3B 5H8DA 1YEKH 3BP6A 4G8GB 1CD9B 3IJHB 1T22A 2EH8L 4WVRA 3MJ8B 2FJHB 4OCXL 4U0RC 2DOCA 1I75A 4IRSC 1I1FA 2F54A 1MCFA 5T3ZD 4HJJH 4NNYA 4CN1A 3VFPB 1ZWIA 3M1BB 5TQ0H 5MEPA 4NPYB 4LSDA 3S34L 4NCDA 2B4CH 4X4MA 2OSLA 4LIQE 2ZUQB 3WD5H 4UILH 5EDXA 2Z92A 3F7VB 4JN2A 1M7DB 2DQDH 4JPIA 4QXUL 2ADGA 2WBWB 4F2MB 2DQHH 2VDNL 4U1JA 3SPVA 4AZ8A 2UY6A 2XZQH 4JFDA 4OKVB 4L3CB 3V0WL 5B4MD 4CADB 2VLLA 5E00B 2APBA 1A6UL 1OAXL 5HYFA 4HS8H 4UUJA 4HKBB 1S8DB 3BHBB 3LKRB 1RU9L 5GGRB 1G9ML 4MDJA 3MMEA 1TENA 4HT1H 3RWHB 2QSCL 4NJAH 3G5VB 3VGFA 4IOIB 3CFJA 1W72A 3JSSA 1LEKA 3ZE2E 5F1KC 2XFXA 4GG8B 5JW3L 1DQTA 3B9VA 3EOAA 4PBVC 2Z35B 3JV6B 3MRHA 1Z9MA 4LP5A 3VFNA 4UDUB 3O8XA 1IEAB 1B6DA 4R97C 4M7KL 4KRPC 5HYSA 3OAZH 3TH4T 2C3XA 3K7UA 4KK6D 4FQQA 3M45A 2P5WA 2RAMA 2FGWL 3LOWA 3VXRD 4Z0BL 4ELKA 1BWMA 4HMEA 1D9KD 2DQJH 3AUVA 1Q9KA 4PJIA 5AD0A 5AWNH 2O61A 4PRDA 3BWAB 1VFAA 3QIUC 2VAAB 1U8IB 3VGDA 5DJ8A 2ERJC 3C2AH 5F97E 2A6IB 5EC1B 4O2EA 1PYWA 4HS3A 4WO4C 2V9RA 1FL5A 3AXLA 4NHCH 2BRRH 3HNVL 3UAJC 4DN3H 4WENB 5IB1A 4V2CB 3QI9B 4LLWA 2W38A 1CIUA 4BUGA 1RJYB 5FA3B 4JFFA 3RVUD 1WCQA 1HDMA 3LPFA 1VFBB 4PP1D 1MCOH 3GO1H 4U3HA 1FO0A 5IROA 4OLZH 3ULSB 2X41A 3ZE1F 1T04A 4OBRA 4FTVE 1LO2L 1CLZL 4OZFB 3OKDA 5TDNB 5CZKA 4JPKL 5ECJE 4LLMB 4Z76A 2V7NB 2F19L 4HCRA 2X4RA 3FFCB 2AEIT 1WAAA 4N1EA 2WNGA 4KFZC 2E7CA 1FQ9C 5I0ZA 2DWDA 2Q6WA 2DJSA 1TJHL 1EHAA 2DIAA 4PV9B 1MCJA 4NO5A 5B21A 5F3BA 4G8EB 5F8QC 4MB3A 1AR1D 5E8EB 2FO1A 1OW0A 1FIGL 1Y18B 1DLFH 2D4DA 5DJ2A 3HR5B 5B8CB 7FABL 4UT6H 4EI6B 5FYJH 4ZUWB 5ACZB 2WANA 4X80L 5GS2H 5CBEA 4KXZH 4YPGA 4Q2ZA 4EEEA 1UEMA 3W9EA 1U8MB 4PRBB 5KVDL 4X6EB 1DUYA 4QT5A 1CDJA 5TE7H 2FBJL 4AIZA 5I76A 2ATPB 4JE4B 2Y07H 1PEWA 2EKSA 1NFIA 3IDXH 5TFSH 1N2RA 3T65A 1L6XA 2EDTA 3U82B 3HTLX 1T21A 2QHRL 4WW1B 3UJIH 3RPKA 2ESVA 1BJ8A 4QGTA 4LIQL 2XOTA 3L7FB 5GRJH 1KXQE 4DKFL 3B83A 4OGXL 3TWCL 1HINL 4NZJA 4FABH 5I1GH 1IGML 1N6VA 4XP5L 5CGMA 3GHBL 3MUY1 1NLBL 3SKUD 3PP3K 4W70A 3BP4A 4KKAC 3WSQH 1AGCB 1DBJH 3G6AB 5C0DB 4OV5A 3A0OA 1W0WA 4Z5RB 5KSVB 5FHBL 3WIFA 5FM8A 1L6ZA 4JRXB 2BMKA 3C8KB 4RGND 4QRSB 3RWGA 1EFQA 1XGPA 5F8RC 4Q0XL 1Q9LB 3A6CH 4PGCA 1CDHA 2XWBA 3AU1A 5IM7A 3O6FB 5KSBA 3WN5B 3ARUA 4KVCL 1NFDB 2N1KA 3HPJB 4OZHA 4BQ6A 1OGTA 5FYJU 3ZYIA 25C8L 3HLAA 5HHVL 3VXPA 4LLUB 1BJ1H 4BFBD 1RZGA 1NGXA 3MBEC 5EU7E 2KPNA 1JZ5A 1S7QA 4OFPA 2BVQB 2VLKA 4GW1B 2H26B 3O4LE 3ESVF 2H32B 1X5AA 1L0QA 3HPLA 2C4XA 3VXTB 1NCDL 1FL3A 3EYUH 1N0LA 1DBMH 5IQ9A 1IQDB 3LS5L 3HNSL 3GMQB 3TV3H 3GMLA 1JUFA 3D39D 1N0XL 3DECA 1NCWL 4LU5H 3SQBA 4P2QA 5L6YH 3P9LB 3RAJL 3ARFD 3GB7A 5JXED 1FL6B 4NGHL 4WFEE 2ARWA 1ADQH 2G75B 3U0TA 1KJ2A 4CDGC 1UWGL 2X4NB 4Z0XA 2NXZB 3RUGA 1FH5H 3TBTA 4P4RA 1EBPA 1ZHBB 3D0LB 1C5DB 3NZHL 2NNAA 4GSDL 4Y1AA 2BNQD 1BVKB 5E8NB 5GGVH 1P2CB 4AH2B 3QB7C 4MJID 2OTUA 3X14B 4H0IA 4XWOD 4CDHA 2MQ3A 4Q9QL 3C87A 2YEZB 2W0FA 4ZPTB 1MHCA 1LO0H 1YEKL 2OP4H 4GAGH 2P8PB 3GM0A 5E6YA 4HUUA 5EFIB 1JZ7A 4PRIE 1OP3K 1KEMH 4K7PX 4Y8AA 4Z7VE 4W6WB 5JOFB 3ARDD 1N64H 1T1YA 2IADA 3WUWB 2O26U 5GJSH 2XA3A 2XN9B 5TQ0L 3UBXA 3QO1A 1VADB 3RVVC 2CGRH 4JFHD 5EN2A 1PZ5B 3TYGH 3T2NH 2KZWA 1C5BH 4RGOL 2B4CL 1HCFX 4HHAA 1U8PB 4UINH 1PX3A 3HUJE 4YFEA 1X5JA 2DQDL 2P7TB 4WHYH 2DQHL 3UTOA 2FYYA 4JKLA 4U6TA 3ME0A 1KYOK 1NUFA 4PLKC 5GGSB 5BVJB 5KJRH 2AV7B 4ZUUB 4XP1H 3ARZA 4BSVA 2XZAH 3LY6A 2HN7B 3RBSA 3VU2A 1IM3A 3NFPB 1ZS8A 2BNRE 3MRIA 3ZSTA 3DIFB 4HS8L 2A9NL 4YHLH 2F8OA 1RFDH 4EN3D 4UU9A 2FATL 2VE6A 4AEHH 3QR2A 3UDWC 4HT1L 4NJAL 3RBGA 3WS3B 3EO0B 4OI7A 2XRAL 4OD1H 2ZUTA 1MJJB 5J6HA 1LK2B 1OM3H 2AQ1A 1V7NH 3U46A 4NRXB 4WW2B 1R6VA 1CBVH 3L7EB 2Y25A 4JFYB 4P99A 4PGEA 4KZDH 4OLXL 2HJLB 5D7JA 4HK3J 4AT6A 1JPSH 3FCTB 5DFWH 1QLFB 3JWDH 3QEGH 2R9HD 1H3WM 1WFOA 3BN9C 4FFVD 1OCWH 1X5XA 5AWNL 1J0JA 4FOMA 4OFVA 1IAIH 3ARFA 1RUAH 5IF0A 5IJKA 3H7BB 4JQIH 3WIIH 1TDQA 1KF9B 1XFPA 1FCCA 2HJKB 4P4KB 5JW4Q 4QTIH 2JB5H 1OP9A 3KJ4B 43C9A 4NHCL 2BRRL 3RY5A 2Z91B 1KPUA 5CGYD 1FAKT 1XF5B 5JO5A 1R5VB 5FECB 1EAPB 2Y23A 4K7PY 5ADOH 5TE4H 2BNQA 3LPGA 1PG7H 3TJHC 5JNYA 1CG9B 4ZDHB 4IDJH 1QSFA 3TIDA 1MCOL 3GO1L 1UB5A 1I1AA 5F9JB 3KPPB 4P9MH 3BP7B 1ZGLB 2BSRA 3PV6A 3BKMH 3QPXL 5IEKA 2W60A 4FNLH 3MOBL 3ARPA 4LAJH 4L8SC 4OZHF 5JHDB 3L3IA 1CD8A 2FZ3B 4M7LT 3S96A 4KKBD 5C0RH 1DVFD 2P42B 1QSED 3OV6A 2DJUA 3CDGB 3WEXB 4BH8B 4O51A 3WXVH 4JFPA 5A3IC 5ICYA 4G6JH 4DAGL 1JHKH 3HC4L 3TYFA 1ZA6A 3PWLB 4I5BA 4M6AA 1Q9WB 4UT6L 5HYIA 3DRQB 3KXFA 3GMMA 3P73A 2LU3A 2P5ED 3C08H 1LE5B 5DUMH 1N7ML 1QLEH 3U7YH 4A6YL 1KFAH 5TQ2L 3G6DL 3RUGF 4ZNCD 4NKDA 5IB3A 5IB4A 4CVUA 2DM4A 2QTEA 2K1MA 4L29A 5TE7L 5E99H 2AS5M 1ZLVK 3MLTA 4AIXA 1XZ0A 2Y07L 2PYFA 1S7SB 5T1DH 3NAAH 4KRNA 2OL3H 2YC1A 5BZWA 5ID1B 4JQVC 5C07D 2DQIH 3UJIL 1R3JA 3RWDA 2WAHA 1IGFL 3NACL 3QZWB 4M5ZH 5E0QA 1X6LA 1SBSL 5GRJL 4QRQB 4BELD 3OZ9H 4F7PA 1XAUA 2PW1A 3S35X 2QR0A 4NWTL 4FABL 4GRMB 1NAKH 4HLZH 3HG1B 4NDMA 2VXTH 1RZKC 5LKNA 3UBXI 2R1YB 3DX7B 1R24A 3FO9B 5D72L 4ZFOB 4LKXA 1S9XB 4JFXA 3DYMA 4RGMC 1NCAH 5A2KH 2CUMA 4HK0B 1AD0A 1BM3H 1HHHA 4I0KA 3LKPA 3V6ZB 5EOTA 4R4BA 1HQ4B 3HC0B 5DMGD 3S36X 3C6LA 3TNNA 3GMPA 5GSVA 5B3NA 3U30C 3C5ZD 1GRWA 3BPLC 1LHZA 3EGSA 3MUJA 4MNQE 1M4KA 3WFBH 2Q87A 5FK9A 1ZT7B 4XPHL 1HSBA 2ZUVA 4QCIA 3G6JE 3J7HA 2J8UE 3SDXF 1DVFA 3EYUL 3WHE1 4HMDA 4GMTH 3TV3L 5TF0A 3TH3T 4PRPE 5CKAA 3VXQB 3MZTA 4XBEH 4EIZC 3KJ4C 4HGKC 3PL6A 4LBEB 3FT3B 5DO2D 4I8DA 1BEYL 1I8IB 5BOZG 5HVHC 5JTWA 4PJFE 5FKPA 5SWZB 3CCHA 5FEBA 1E28A 4YNYB 5B38A 4QOKA 2J12B 2P5EA 3HI5H 3MOQA 3VI4F 1UJ3C 3RVXD 3LEVL 1MWAH 4LRIC 3W82A 2X1PA 4Y4HD 2Q20A 1KTLB 4GJTB 3O3DB 4ELMB 1NCBH 2I9LA 4HGWA 3DX9A 3WO3B 4PGDB 1MVFA 1S78D 3L5HA 2Y5TA 1I7TA 3PJSA 4LEOA 4KKNA 4NZDA 4P46D 3VMOA 4GG6B 4DCQA 2WUCH 1TFHA 5I0DA 4LMQE 1KEML 1XR8A 1XEDA 4NHUA 1N64L 4U2YA 4DUWA 4F33A 1M71B 4YHML 1S7WB 4Z7OF 1LGVA 3RTQC 2AQ2A 3IXTB 1RJLA 3I84A 3TYGL 1S7TB 4GW5B 3MROA 1AHWC 3EDJA 3IKCA 5D7IA 1JWSA 3ZDXE 1CT8A 5DEZA 1F4XL 3LQMA 3MJ7A 1MFNA 5DD0H 4KRMB 4AQ1B 1BQLH 3CFKA 1MFAH 3QXDA 4LASH 1OP5K 5IR1A 5M94B 4DN4H 3P30L 4KJWD 4KK5D 4XXDA 1KB5H 1A6AA 4Y4FA 2R2EB 1QPPA 2GK0B 3EYOB 1YN7B 3S88H 4XP1L 4DW2L 1PKQB 2XZAL 3CFCH 5IHZA 2NY2B 3B9KB 3SQOL 2CDGA 1YMMD 1RMFH 4KJPD 4TTDD 3ROLA 5L2KB 4YHLL 1BLNB 4TVPE 4PJHF 3BE1H 2IPKA 3WXWL 1RFDL 1G7JA 1QR1A 4AEHL 5IVXE 1G6RB 1EVTC 3Q6FB 4OZ4A 1QVOB 2RFXA 4Y88A 5HJ3A 4X5WB 3RY4A 4XNXL 1REIA 5E8DH 5EOCH 4YO0A 4X6DF 3U0WL 4G6MH 2NR6D 1GZPA 2EDNA 4PJCB 4C56E 3PGFL 3C5ZA 4YXHH 4OT1L 4R7NB 4HMCA 4MSWA 3HE6B 1K8IB 3T1FB 3RZCB 1JPSL 1YPZF 3QBTB 4EUPA 1UG9A 3IFLH 2R1XA 4OZIF 2CDFB 3QEGL 4XMKH 1E4XH 3V7AG 3VFSA 2UWEF 3LN9A 2MKWA 4U1SA 1OCWL 3VFRA 1IEBA 5GRWA 1QFHA 5I1DB 1IAIL 4PTUA 2QEJA 3DMMB 4JQIL 1J05A 5IMMA 1UZ6F 2GJ6D 1KBGH 2H9GB 1ZA3A 1J8HA 2VRAA 3GHEH 4XXCA 3LRHA 4ZXBD 4QTIL 3WCYA 5ANMA 4XP6L 2NTFB 3HAEB 1N3NA 3QFJB 4XHJC 1OTSC 2ENYA 4QRRA 1H8OA 2NXYB 2PTTB 3IETB 3PXJA 1NAMA 4LLVB 4JM2C 5C0BA 2ICWB 4IDJL 4Z7WA 4Y4HA 5GGRY 3TBSA 1EFXA 4S1DC 4GRLC 4P9ML 5EH1A 5IMLA 4EBQH 3BKML 4LPUA 2W9DH 3FQRA 4M5YH 1I9JH 4FNLL 4WFFD 1UT9A 3MLYH 1G1YA 4M8VA 1G0DA 3EDFA 1RZIA 4P48A 1TVHB 5IBUB 2V17L 2DQEH 4RWHA 5C0RL 5JIIA 3CVHA 4UB0H 1B0GA 3A67H 4JRYA 2F53D 1YY9C 2QSTA 2QLVB 3TZVB 3WXVL 3CFIC 1KN2L 3L5XH 3VXOA 3ZYZA 1FFPB 5K93A 1NJ9B 5CHNB 4AQOA 4G6JL 1F4WL 1JHKL 5J3HC 1T0MA 1TNMA 4M61A 2VR4A 5DFTA 3SGEH 1FZOB 2W91A 4G7YH 1BOYA 2ZSVA 1LWRA 3H7LA 5DRZA 3CUPA 4WUKH 5MEOA 4I2XA 2YOCA 3C08L 1IRAY 3W5MA 1T20B 4LAQH 3KPNA 3AC0A 2AK4B 1H3XA 3ARBC 1JNJA 4D0CB 3H3PH 5E99L 3OGCB 3E2HB 4YE4L 5C0EB 5F7HA 4X7CC 3C60C 4IRJD 2DAVA 3CXHJ 2B5IC 5DJ6A 5CFHA 1NEZG 4P23D 5T1DL 3NAAL 4KI1A 2JCCA 2OL3L 4ZO8A 1N6UA 1RIUH 4GKOA 5I1AA 2DQIL 4HC1A 5K9QI 4XB8A 1VDGA 5DXWA 4XP9H 4M5ZL 1AP2A 3VFVA 4WU5B 1RUPL 3OZ9L 4RZCA 4YDIL 2CK2A 4P5MB 1S9YB 1KV3A 5JDSA 2DLFH 3V0VA 1NAKL 1BZ9B 1YECH 1DBBH 8FABB 3BD5A 5HGAA 1V8HA 3C5JA 1BMGA 3ZZ1A 3GSVA 1OLLA 5DHVA 2R2BA 3WNKA 2CIIB 5MENB 5A2LH 3LKOB 4TVPL 2X44D 1ERNA 1AGBA 3TBWA 1J1PH 3DGGB 4FQXD 2IANA 1NCAL 2GJ6A 2NPLX 4HEME 2BSTB 1T4KA 3TPKA 3N9GH 3T0ED 3ULVD 1BM3L 1D6EA 2D31A 3BN3B 3B3IB 3PP3H 4PJXB 1KCUL 3KWWB 2FECI 3VD7A 2NLJA 4YDJA 3PXHA 5C0CE 43CAA 2N7BA 4ZQKB 1FZMA 3LDBB 4TSCH 1B2WL 4NNXB 1AKJD 3CAFA 4R2GB 5I1EH 1CF8L 1OGAE 1A7OH 5CJ5A 4IOFD 4ZAKD 3ILQD 4ZTOL 4MD4A 3MR9A 2QQNH 2YRPA 5CD3A 4YHNB 1FZJA 3AY4A 5DD3H 4JDTH 3DMMC 4KPHL 4E41B 5IQ7H 1INDH 3WFHB 4GMTL 3PNWA 4JRXE 2HT3C 3VXUA 4KTDL 1N8ZB 1A7NH 2DQFA 5KSAB 3T1WA 4MLSA 3N1GC 4H88L 1DJSA 1K4DA 3QXAA 4QLRA 3P0VH 1BOGA 4HIIA 3JV0A 1MLCB 1BQHG 4XNMA 4PJ5E 3MRLB 2E5EA 3HI5L 4J3VA 1HZHH 1MWAL 3PQYE 4IIQB 3GEWB 3SGJA 3DNKA 2DMCA 1U8HA 3T4AB 1DEEB 2AXGB 2F5BH 3GJEB 5I8CB 4PY7A 3V4VH 2EEDA 4HBCH 4IRJA 5D7SH 1EBAA 3QNYA 3IJYA 4ODSH 4P23A 2XWJA 3UO1H 3H9YA 4KJYA 4MX7A 1U8LB 3I75A 1C08B 1R3HB 4Q6YA 5BS0D 2CKNA 4A2LA 2EE9A 3IFPB 2WUCL 1EA9C 3UTTB 2BHYA 2EDOA 5EZJA 2YPKB 5HDBF 2HFFB 4M02A 1J18A 2AJ3A 1P7KB 2OJZL 4PJBB 4NT6A 4PG9A 1QEWA 1FVDA 3V5HA 1BZ7A 2OR7A 3R1GH