4NC1C

Crystal structure of tcda-a2 bound to a20.1 vhh and a26.8 vhh
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
QVQLVESGGGLAQAGGSLRLSCAASGRTFSMDPMAWFRQPPGKEREFVAAGSSTGRTTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAAPYGANWYRDEYAYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell wall-binding repeat protein
publication title Structural Basis for Antibody Recognition in the Receptor-binding Domains of Toxins A and B from Clostridium difficile.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Immune system
total genus 32
structure length 123
sequence length 123
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nc1C00
1ACYH 5JW4M 4Z6AT 4U49A 1C12A 3BIAX 2ZPKL 3VFTB 1VEOA 3KYOA 4LSSH 4O00A 2OJEA 2CKBL 1MFCH 3HZMB 3CFBB 4OFVA 1QSEB 5F97E 1JI2A 5MI0C 4RGNB 3MR9B 1RVFH 5T1LB 2ZOKA 1MHEA 3BPOC 2VITA 5ITBL 2AK4D 5IB1B 3OB0K 4NFCA 3T0BA 4HUUB 4FTVB 3U0PB 5EOTB 3EYUL 1QEWB 4YDKH 5ERWA 3V4PH 5MEPA 3MC0A 2DICA 2EC9T 3WUWG 1ZSDA 1Q94A 4JG1H 4N5ED 4Z95L 4X7TB 4FG6D 4XBEL 3GI9H 4FXKB 4H1LA 3MGTA 2AK1H 3QJFB 4JVUA 4YFLI 4NJ9L 3S6CA 3LKPA 3TO4B 3AVEA 3G04A 4M7KL 4U1LA 2Q76A 1BREA 4NQUA 3QULB 1MI5A 1T1WB 2FJGA 4Q0XH 5IMKA 4FS0A 3BFOA 3VXRA 1CDIA 4QHMA 4PRPA 3F7VA 3PGFH 3PF2A 4U3HA 1K2DA 4X5WA 5CILL 1NBQA 2DBJA 2X4QA 3MSPA 3QHZH 4QTHA 5DD5H 1U8NA 3MOAH 3MRPA 3ILPA 1CYGA 3PDGA 2XIDA 2Q7YB 4YXKL 2VWEC 4JQVA 2XWTA 3VI3F 5AAMA 1ES0B 2NQCA 2HN7B 1NGZA 2JB5H 2NZIA 1OF2B 2NTFA 5JHLL 1JPFA 2KH2B 4L8DB 1UXWB 5GGSB 2A0LD 4PRHD 5LCVL 3IDGA 4F58H 2FX8L 4OLUL 1GL4B 1I1AC 3Q6GL 2GSIA 4EI5D 3EYFB 2XY2A 1AD9B 2PXYC 5I1IL 1I9IH 3DVNA 1XF4A 3D1MC 5CEZL 4JFHD 2E8YA 4OV5B 5EOQH 3ESUF 3OXRA 1MREL 4NSKB 1L7IH 5DJZA 2EKSA 3W9EB 1IRAY 1NMBL 1XF1A 1NCWH 3UBXG 4KHTL 2FECI 3KYMB 4YEEA 1TJIH 4QRTB 1SMOA 1GRWA 1KNOA 3VWKC 5D1XB 4YHPA 1X4XA 1TJGH 2BVEA 4R2GD 1K6QH 4WW2F 4OQTA 3AUVA 4B0MM 5DVMA 3IXTA 4Y4KA 3N50A 4P57B 4R90L 3BDBA 4PG2A 3VXSD 2BVOA 1T22B 1TVBB 3PWPA 3BYYA 4D9QD 5CD5D 3LN5B 4IIQA 1NQBA 5DMIL 1DQLL 2CKBB 4LLQA 3BWAB 2R15A 2NPLX 1FLTX 4KTEL 2CRIA 4XI5C 3SDCC 32C2A 3GMRB 3W0WD 1JFQH 1F11B 2Z8SA 1I9JH 1MHCB 4PJ7B 5EWIH 1Q0XL 4F7PB 4PGBB 4HS3A 3M17B 4XTRD 3RPIA 3S34H 1DQQA 2P45B 4JHZA 1MNUL 1A4JA 3K2MC 5H94B 1BBDL 4ZNCD 3LN4B 3A0OA 2D7MA 4LCIH 5K93A 3MREB 1PY9A 4D3CL 4MXVE 3IDIA 4AY0A 3UTPD 1K4CA 4N8VA 4JVPA 3MRFA 4PGJA 1I8LA 3K2UL 2HTKC 3EUUA 4KRPC 1YNKH 3S3JA 4RFNC 5DEFA 4DUWA 5I1DA 3PV6B 4S11A 5B3JF 5EA0H 4PJEB 3BPOB 3BZFB 5DRNA 1BWMA 4EUPA 4LU5L 4XBPB 1IC7L 4OZHB 1XZ0A 1OGAA 5F89A 3G5XA 2W59A 2V7NB 3PP4H 4IMKC 4YHML 7FABH 2IPUG 2RIKA 3EOTL 3QEQE 4Y5YC 4MJ5B 3DMMC 5LKNA 3OF6D 2HWZH 4OB5H 3U9UA 3QO1A 4BQ9A 2B1HL 2P5EE 1ZA3B 4LIQH 3T1WA 4PJHB 5EUOA 4XC1L 2APVA 4PJGB 3UJJL 3MRIA 4N0CC 4PRAA 2WBKA 1Z0MA 1QBBA 4DKAA 2I07B 3MV9B 1U3HC 4XPFH 5I18H 3VXPB 3KPLB 3TFKC 3D3VA 4W4OC 4UINH 2JJSC 4HWBH 2JIXB 5EZLB 1J0JA 1H3TA 5F88B 4X4MA 4C56D 3NIDF 3FQRB 4NZDA 5EFIA 3W82A 1MJUL 1F02I 1U3YA 2PXYB 1F13A 1RULL 1SBSL 5D7KE 5GRVL 3MRRB 2A9MH 4X98A 1JHLL 2QJDA 1B3JA 5D7IB 3D18A 1ZEAH 5EIIB 1WAAF 2XZAH 3E3QE 1TZIB 1FNAA 4GRWF 3O6FA 1FFNA 2EZ0C 3TBYB 3V6OE 3ILQC 3HE7D 4HBQA 3VWKB 5C6TL 1T0PB 5I73B 2CXKA 1A6TB 1LE9B 5J89A 4TUKL 4XCYB 1N6QH 3HI1A 4CKVX 1FZKA 4P9HH 4I0CC 2AKRA 1XGYH 5DDHB 3FL7A 4U7MA 4JO1H 3V6ZB 3GHBH 3Q3GB 3B6SA 1ZHBA 2IC2A 4MD5A 1NBZB 4P46D 1T0MB 4N9GB 5C0BE 1YNTA 4YZFF 3LEVL 1INEH 2EDXA 2CXGA 4AMKH 3B9KB 4XC3H 3L5WB 4K07A 4MCYB 4TULH 1JGDB 3TO2A 1FL3A 3FB8A 3WL9A 3RVTD 4JM2F 5JW3L 1JGUH 4KY1L 3S36L 3ARUA 2LFGA 1A1OA 2EE6A 3QWRA 3DURA 1B6UA 5FO9A 4M8VA 1YEFH 5GJTL 1D5ZB 4HZAA 5D6CB 3QSKB 4K8RD 3BO8A 4U7KA 3VFVA 3MMEA 4GW1A 5E6IB 2Q8AH 3S4SA 1CE1L 2PW2A 4D0CA 3TA3B 5E6YA 5KOMC 1B4RA 4M02A 4RFNB 2XN9D 4GAJL 5KSBB 4OZ4A 3ISWA 4Z7UF 1P7HL 3BKCL 1O5DT 3V5DB 2VDOH 4HS6A 4ODVL 2WIMA 4N0RA 3RWIB 1EHXA 1OQOA 5DJ2A 1MJ7L 3MJ8A 3QXDB 3BP5A 3WFDL 5J11B 2BOBB 4JY6A 1WWBX 1BQHA 1FE8H 4WUUB 4P2RA 1WSST 4MCZB 5KS9E 3HS0B 4Y5VB 4LLWB 3N1PC 5DJ8B 2BERA 4DFIA 4QHLB 2F5BH 3QCUH 3I6LD 2QBWA 3BH8B 4OLYL 5FECB 3DMMB 5FGBC 5IMOB 4CU8A 3DX6A 2WW8A 4BFEA 2YKLH 4QWWC 3SDXF 4X4YB 4QRQA 1W8NA 2WWMD 1BQUA 4NDMB 3GRWH 1QFPA 1I7RA 2EH8L 4Y2DA 4MXQC 4U3XA 4XPAH 1HQ4B 1QRNE 3OAUH 2FB4H 4JJHA 1U3HB 1RIVH 9CGTA 2H1PH 5FO8B 1UKSA 4P2QA 2DQJL 4Z7WF 5DZNA 5E1AA 4PJXB 1INQA 2VIRA 5DR5H 3RAJH 5EN2A 1W0WB 4QRUB 4YHKH 1JTPA 1WBXB 4U33A 3SDAB 2IWGA 3JSSA 3MUJA 3ZTJG 3MXWL 3U7WL 1PDKA 2GCYB 2X89D 4J8RB 1S7WA 3WFCL 1EHAA 2ATPB 3L95B 5CP7A 3O0RH 4CMHC 1I1YB 4KROB 1FYHB 1QA9A 1BD2B 3E1F1 3T0VA 1XGPA 1RIUL 5FGCE 3L3KA 3X3FH 3S5LA 5ADPL 3PGDA 2WANA 2I9LB 1F90H 4PJCE 3OJDB 3JWNC 3FCTB 4WWKC 4G6AD 3TBSB 5HHMD 3REVA 2PYFA 5JPMB 3BRGC 3DROA 5I75B 1EEQA 4JJ5A 3QFJB 3WN5C 3PIQA 1AO7D 1BIIA 5HY9B 5EO1A 3TT3L 5FYJL 4HWBA 3KXFB 1KYOJ 2G75A 5AYUH 5F9OH 3NTCH 3C9NB 2HJKA 4EN3C 1NGXA 3MBEC 1OM3H 1LP9A 4PJ8D 2HT3C 2VAAA 5MENA 4KZEL 1UM6H 4ONHA 4HWZB 3RIFK 1IT9L 1E6JL 2Z8WC 1YEHH 3P73A 4IRJA 1XR9A 4R97C 4NO5B 5IK3B 2APWA 3TN0C 1A3RL 4PLKC 5DRWA 5FYKD 3F5WA 1RUQH 2DTML 1MFBL 3PXHA 2C1OB 2BY0A 3KPQB 5CIPH 2V5TA 1FNHA 1FIEA 5E9DD 3KLSA 4UTAL 1CDHA 5EZJA 4RWYL 1JK8A 2X4TB 4JPVL 3ULSA 4ALAH 4PV9B 2RCSH 2ERJC 3MCG1 6FABL 5KSAA 2C7UB 2GJZA 5DK0A 1R3IH 4LGPB 5ALCL 2VXUH 4K9EL 3QEGH 4G7YH 1KN4H 4YBLC 1MQKH 1EEZB 5HYJE 1YEDB 4JPIA 5L2KB 1QLEL 4U6HA 1TNMA 4MNQA 5IFHL 2R0ZH 1KIQA 2LVCA 1T04B 2WBJD 1F97A 1I3GH 3NACH 1OTTC 2OX5A 1MCWW 3L3OA 3L3IB 3O3DB 1J8HD 3SDDD 1IL1A 3WFHB 4JDVB 4FQJH 5ALBL 4MAYB 1FLRL 1U95A 2V5MA 1HK6A 3UTTE 4X5XB 4K94C 5BRZB 4LCWE 2BRRH 4PJFE 3ZE1E 1WLHA 4X6DB 3QG7L 4HS8H 4JO4H 4RMWA 1EXUA 3VD5A 3GUTA 1NANI 1DBAL 4I1NB 2AK4A 3LCYA 3VMNA 2A73B 1GGUA 4FFYH 4LCUB 5C0FA 4JM2D 1LILA 2G60H 5EH1A 4G3YL 5JZ7C 3PQYE 1DSFL 1P4LB 1YZZA 2DQTL 1V3KA 5ELIA 2AXJA 4BQ6A 4XNMA 4AEHL 5BQ7A 4DFHA 3STLA 1LK3H 5IB2B 4N8CL 1T03H 1R5IB 3DV4A 4G9FB 3VFWA 4JM4L 3ARED 4NM4L 1A7OH 5D7JB 3GSUA 2FD6H 1FVEB 2YK1L 2IQAA 3D0LA 3KLAA 3Q6FB 4R4FH 5IHLB 2BNQD 4RAUA 1EVTC 3BXNB 2CGRL 2EXYD 5C0AE 4CMHB 3D48R 4NWTL 1LK2B 1JF5A 1O0VA 3GRWA 3DVFA 4OZFA 1DE4B 1I7UB 4PJAF 5AZEH 1J1XL 2EIZB 4FFZL 4PRHA 4WWKB 3E8UH 4KVNL 5I1CH 5JOFB 2V2TA 2YSSB 4JO2L 4EI5A 1VGKA 4G8FA 3SE9L 4QXUL 2HLAB 4NM8L 2J8UB 1IAIL 5FKPA 3T2NL 3CFDA 3I6GA 4FQLL 1MVFA 2VXSH 3LIZH 3LKRA 3R06B 4UDTB 4Z7VE 4K7PX 1F6FB 2XKUA 4KZDH 2UY6A 3CDGB 1P6AB 1X5HA 4JFED 2EIEA 1KFAH 1KC5H 3V95A 3U4EB 3QHFL 4K7PH 3PV7A 5E8NB 1T3FB 2J8OA 3SQOH 2X7LB 4UQ3B 3RY4A 4YHZL 4JFYB 1GGTA 4QXGL 1BVKA 4R97B 4HQQL 4JLRA 3TN0B 4QY8A 2Y1VA 4K23L 4MGXA 3ULVF 2ITDB 2PKDA 3BH9B 4RFEB 5I2IB 5E8OB 3BJ91 3WKNA 3VXSA 3ES6B 1PQZA 1AI1L 3W81A 5EC1A 1PZ5B 2XI9A 4ZNEE 3OGCB 3TYGL 3ZYZA 3CMOH 4F37F 3ALXA 3ZE2E 1CS6A 5EU6D 5KTEL 5HDBF 2D3VA 3QEUA 3ZYIA 8FABB 4K8RH 2GK0B 3LRSB 4LPUA 5JW5B 4I77L 5IP4A 2C3VB 4DQOH 1H0DB 1RJCA 4BSVB 5JXAH 1IE5A 1CK0L 2BVUA 3Q1SH 3W0WA 1CTOA 2HRPL 1SM3L 5C0IA 2VE6B 1KLGB 3OX8A 1CZ8H 4OI8A 1M05A 1J1OH 4HPYL 5TDNA 1IGFL 4X9FA 3PWVA 4JPWH 4F8TA 1U36A 4CNIA 1WT5A 4JKWA 3WS3A 3P9LA 4U1NB 3UYRL 1T83A 3EOAA 3U4AA 2X70B 4O4YL 2M2DA 2BVPB 4PJ5E 5CEYB 3T0DA 5HHOB 4QT5A 3MLSH 1IGTB 1PKQB 4NFDA 3RWGA 3CH1B 2NXZD 4OKVA 5HHVL 1UJ3B 4W6WB 3T65B 3T3MF 3J7HA 4YFEA 3BQUC 1UWEL 4JFQA 2GIYA 5IUSA 1U41A 2XKNA 2XZZA 3LN9A 1YPZA 2O61A 3L7FA 3RWJB 2CLRA 1OAYL 4WVRA 5JUEH 3EAKA 3MV7D 5ISZE 2V7HA 4X9BA 4WW1A 1IGIH 4OD1H 4OLZL 4JAMA 1M7DA 3C6SA 4KJQD 3OF6A 3WNNA 1CXLA 3MOBH 1HDMA 4U1IA 2QQNL 4OZGE 2BRQA 4ZFGL 5D7LD 5ADOL 1AHWB 2GFBB 4NQDD 1D9KB 4HIJB 1V7NH 4PV8A 4YHNA 2CO7B 4QTIH 1HIMH 1P5UA 4RCAA 1A0QH 4Y19E 4YEFA 3ZYOA 3H9SD 1ORQA 3SO3B 1KN2H 2R4RH 2AABH 2O26U 2OBGA 3WXVH 1DEEA 2AJVH 1IM9B 4UOJA 4TNWK 3QR2A 5C7XL 5B39G 1JYWA 3LQZA 5EO9B 1LE5A 4NQEE 1YC7A 2DQIL 2W0FB 3PL6D 2KBGA 4M3JA 3NPZB 4C56A 4PR5A 4L3ED 4RIRB 5IJKC 4KK5D 4K7FB 1W2KT 2P8MA 3EOYG 5BS0B 4OCMC 3B4NA 2IG2L 3SPVB 4OAWA 4KI5E 4LAQH 4QRRD 4D8PA 4TSBL 3QDMB 5KSUB 2AEWA 2ESVB 1JWUA 3ARVA 3MLYL 4YGVB 3N9GL 3SDYL 1CXKA 5FUOH 5J13B 4Y4HC 5I1EL 1LO3H 2DWEB 4JKMA 3MLPA 4W81A 3HE7A 2DYPD 5C9JB 1KLUB 3L5IA 3UYPA 4XVTH 4Y5XA 1QP1A 1S7TB 4RZCB 4HAGA 4JHBA 4S0SD 3LEYL 1NLDH 4O5LL 3O6KL 4Z5RB 2BXYA 1X6NA 2VISB 4KJWC 3NIFF 4MNHA 4WFGE 1BEYL 3AY4C 1UZ8B 1DUZA 5HVWA 1G9NH 3S35L 2AEQH 1CE6A 4P46A 4PGDB 1PAMA 5TJWK 2A1WH 2D7PA 2CIIA 2EDKA 4XCNA 1G84A 5IQ9A 4QRSB 5DQJA 4ZPTB 1BHGA 5HXMA 2VQ1A 4WI3A 4LCCA 2ZCHH 4L4VE 5GGVH 4POZC 3DX7B 1NJ9A 4YDLB 1ND0B 2VO5A 1I8MB 1T2XA 4NKIL 2VLME 4L4TE 2LVEA 1GAFH 3ROOA 3SJVE 4NKQB 2E9BA 3OB8A 3ZE0F 3OTTA 4YXLH 1AFVL 2R2BB 4J1UA 2IBBA 2ADJA 2HLFD 3VRJA 4R4BA 4NO0B 5DT1L 3QUMH 4H20H 3FT4A 3WHE0 1CR9L 1QFUL 1ZWIB 3P77A 4GAYB 4ZOAA 1RZJC 4PLJD 2XN9A 3N1GC 3N85L 1ADQL 2Y9RT 3D69A 3IAPA 3GSWA 5C8JA 3QH3A 2PTTB 5CMAA 3N0PB 4POUB 2BMKA 1INDL 4UQ2A 1XGUB 1OTSC 2FJHA 4U1SA 1KIPB 1EA9C 4K94H 1U8OB 4P23C 3VGBA 4FP8L 3ULUC 5HGDB 2VYRE 5L8LB 1JUFA 3QWQB 3CMGA 4OLEA 3MYJB 5IQ7H 2YEZB 3MV8E 5EORH 4JO3H 5FYLL 1HINH 1WK0A 4GKZA 4OGXH 4OM1L 4GG8A 3KPRE 3JVGC 2CK2A 4L9LC 5I1AA 1D5IH 1JPGA 4PJ7F 3KLHD 4LLVA 1SJEB 2UZIH 1UXSA 1RZJL 3GKWH 4ZYKA 2OR7A 1RK0B 5ESAB 1IGML 5DK2B 1ZMYA 3LRHA 5FDWB 2OQJB 4MA7H 1SJHA 4XZUB 1JNLL 1G7IB 4KKBD 4E41B 2IFFL 2QKIA 3SGKA 3B9DA 1P4IH 5I9QB 1QBML 4JRYD 4QRPD 3G6JF 2X89A 2NZ9C 3M45A 1OHQA 3IVKA 1EK3A 5DRZA 2OP4H 4M6OL 1JMXA 3FO1A 4PJEF 4YR6B 2ED7A 5GPRA 5GHWH 1IAMA 5JDSB 1Z9LA 4GW4A 2GTWA 5IVXE 3RHWF 3TVMB 3KS0J 4CJ1A 4ELMB 3DO3A 3KLDA 2VDKL 4OZHF 1I9RL 4G8GE 1S7RB 3PG2A 2H2SD 1DLHA 3GSVB 2K7QA 1ZS8B 5H35B 1FSKB 4GRLC 1YMHA 1AO7A 2WIIB 1YN6A 4X4XB 3UMTA 1TVHB 5DVLA 3TT1H 3OR6B 1YJDC 1G7HB 4S1DC 2YMXH 4PJHF 4F7MB 4KKAD 4R7DA 2BC4A 1D6VH 2HJFB 2W0PA 3LZFH 4PJGF 1MOEA 2AJZB 2XTJE 5K59E 3AS3A 3MRQB 1KCVL 4NQVA 4PJ8A 3KVQA 1QO3A 1QYGH 1U58A 1T66D 3HUJB 5EBMB 1T5WB 3JWOL 3S37L 5BZDB 4KGLA 3MV01 3AC0A 2VUOA 4NQXA 4U6XA 1QSED 4JY5H 3QUKB 4RGND 5ACMA 1LO4L 2BSSA 3WO4C 5HGHB 4KK6D 3CUPA 1X9QA 5T1LD 5DURB 1IILE 1UKTA 1HN1A 2MJWA 3BAEH 1YEEH 5GSRB 5JXED 5E4IA 3GMLA 5F7NC 1MLCB 4FTVD 2P8LB 5J4MA 5E2TL 2I9TA 1G7QA 3RUGF 3MBXH 4D9RE 1C7SA 1LDSA 1A6UL 3TZVB 1HH6B 2QADC 1F6AB 1RZ7L 1WZKA 2DS4A 4QOKB 2E3VA 3L5XL 3CVIL 1JZ6A 2EDOA 3EYQD 4NN5B 3N06B 3K4AA 4EBQH 1KB5L 3QWOB 5LGJB 3LEXA 4FMFA 2E7LC 1J8KA 1R5WA 3MRCA 3ZKMC 3TO4D 2JB6B 1FNSL 2UZYB 5J0BA 3IDMB 1CFNB 3WUWB 2WNGA 1K5NB 3DVIA 2L7UA 4G9DA 3H7BA 4O2EA 1CF8H 5B38A 1J8HA 3SDDA 2D7TH 1KXTB 3QZWA 2V9QA 3NCJH 2XZCH 3MRKB 4ETQA 5E03A 4O2CA 5DJCB 3VGEA 1I75A 3FO2B 4NBXB 5D93C 5ESVB 1F3JA 2H2PD 4P23B 2DQHH 5JORA 2E7BA 3NCYP 5CHNB 3G5VB 4J3UA 2BFVL 1F4WL 5J3HC 3BI9X 3NABH 5EU4B 1AXIB 1RJYB 3H9ZA 3Q0HA 4EXPX 1RUPH 2XXMB 4JB9L 4F2MB 3WUZA 2X42A 4LEOA 3X3GL 1UB5B 3IU4L 3QRFM 5DSCB 1WBZB 2XPGA 2KZ1B 3JWDC 4DVBB 1X5GA 2Z31C 1C1EH 3KAAA 4AEIH 1NMCB 1YEJL 2ZUSA 3C60C 3BZEA 4OQ1A 2EDHA 2ARWA 3DBXB 5ICYA 4L8SC 1WFTA 4PD4K 5D1XD 1FBIH 1RZKL 3E6FB 3EJJX 4HG4J 4R9HA 35C8H 3AREA 4NCDA 4OIBA 5D9SB 5C0JA 2ORBH 1WBYA 5A2LH 3ECBA 2QHLA 4Z7UA 1G6RL 3NPSB 2BNQA 2JE8A 2JLLA 3C5SA 1BX2B 4PS4H 1I3RB 5KSBF 3UBXB 4JZOB 1MHHB 5AUMB 1R24B 3M1BA 3BN9D 2EDNA 5EOCL 1RJLA 5TF1L 3ABZA 1QR1B 2GT9A 2N7AA 3P0YH 5DVNA 3LDBC 5KANI 2A6IA 1Z9MA 1A9BB 4X8XA 2IADA 3DO7B 5E2VH 5HHQB 4GRLB 3LQAC 3U79A 1AKJB 2WK2A 3SDXA 5IBLC 5BOPA 1UM5H 3V7MA 3QYCA 4HMEA 2XG5A 4GUPA 2O5YL 4QXTB 3U0TA 3OKEB 4NYLA 3VRIB 4KQ3H 4CW1A 4JFEA 3MRGA 1PYWB 4YAQA 3FQNB 4Z7WA 4M6AA 4U6VL 4OGYH 4WTZA 4HMDA 4U0RB 2LTQC 3FFDA 4M6ML 3GJFB 4NKOB 1MIML 4PJXF 1NH6A 1Q9KA 3V6OC 1KLFA 1F2XK 5E2JA 4EVNA 5TQ0H 4IOIB 3G08A 4AQOA 4NQSB 5D4QA 1JHTA 3AAZB 4TOYH 4X8JA 1BAFL 2CMRL 3MGOB 3GSOA 3MNWB 3WFBL 5EU6A 3ETBF 4OUUA 3RZCB 3ZT7A 3FMGH 1Q9WB 1PEWA 3ULVH 1UEYA 4FNLL 1JNHA 3B2UC 5CGMA 2XACC 4Y4FC 2LAAA 5HDQH 2EE2A 3KGRA 4M7JL 4RMTA 1DN0A 2VDRH 4UILL 5CEZD 1AQDB 4UAOB 1LDPL 3MUGB 4JFDE 3M8OH 1VFAA 3IFOB 2WINA 5BJTA 3UJTL 3MV9D 3VGFA 5MEQA 3CC5A 1K8IB 1G1YA 1TZHA 2CIKA 5LGHL 4LLAA 4M1CD 3QNXA 5D93B 4M7ZB 4POYA 1YUHA 4OCRL 2ZJSH 1G6RB 2X4NA 3LSOB 2JIXD 3GM0A 1MF2H 2IAMC 2F19H 2YUVA 5EU3A 1ZHNA 3H0TA 1A6WH 2AVGA 1I1RA 2PXYD 5FO7A 2DM3A 1AR1C 5I66A 4UT7H 3ARYA 1BOGA 3CGTA 1U8LA 2AJYH 3FB7B 4ONOA 3KHOA 1SHMA 4P59H 3MV7A 1OSZA 2R0KL 1UCBL 3CH8A 3QPQC 1U91A 5DD0L 4WFEE 5MHSD 1C16B 1CQKA 4BH7A 3BDXA 4HCRL 1M6OB 4Z9KB 4EIZC 5DHYB 2G5BB 4LEXH 4NC1C 5HHXL 2FO4B 2DLEA 3VWKD 5D5ME 3TC9A 3MXVH 4NKMA 3QFDA 4JHWL 1BZ9A 5D7LA 3QEQB 5KN5B 4NQDA 4RGOH 4WUKL 1N64H 3TLRA 1KG0A 5D1ZA 2PW1B 1L7TL 5I8KL 2VR9A 5EU7C 3EYVA 4O02L 5BOZG 4LHUG 2P5EB 4B7IA 1HZHH 2VLRE 3H9SA 2BVQB 3CSGA 5GGRA 2EDTA 3FO0H 4LP4A 2HKHH 2FX9L 3O2VL 5TE4H 2GW5A 3NA4A 3AGVA 5T3XL 4Z0BL 3FQUB 5DJ0B 2E7HA 1NDMB 2AJSL 3PL6A 3H42L 4X6DF 1A4KB 1DUYA 3AFLA 3B9KD 4OLWL 3IXAB 1BJ1J 5D70H 4L3EA 3QNZA 4ZFZA 1T7XA 5HI5C 4F7CB 2FGZA 4XP9H 1JPTL 3JUZA 3WDJA 4QRRA 1QVOA 3QIWC 1U8KB 3ARGB 1W0YT 5DTFB 3KYKL 4PGEA 5INCB 1QPXA 1CD0A 4LKXB 5AG8A 2ZUQB 2GSGB 5DUBA 3I75B 5DHVA 4OCYH 3MLXH 2DYPA 4X7FC 5E6ID 3T77A 1YJDH 2BP3A 1SBBA 4MB5A 3TA3D 3NAAH 4I48A 3FQXB 4ZSOA 1CXHA 2W60A 5CBAB 4IMLA 3NH7L 1WZ1H 4Z7OE 3O45A 1I7TB 4KDTA 2DQUH 4X5LA 3IRPX 4KMTH 4M5YH 5A3IC 5IM7B 1TETL 1JN6A 4WUUD 4MD4A 4PJAA 3TPKA 1SYSB 4DW2L 1VSCA 4PRDB 4JZJC 1KJ2L 4Y4FB 4HUVB 1CDCA 2R0WH 2Q8BL 5C0BB 3WHE1 4XWGL 1S7VB 5K9OB 5IMMB 2Z35B 1BGXL 1J1PL 3CSBA 1FQ9C 4LVNC 4ZUUB 2J8UF 4MD0A 4YX2L 3CVHA 1HCFX 1J05B 3QPXL 2IJ0C 5CEXB 4KJPD 4Q9RL 1EMTH 2MNUA 3EO1B 5KG9A 4N0CD 2IPTH 1EZVY 1A6ZA 1LD9A 1VFUA 3ZHKA 5J1AB 3W5MA 1U3HD 2V6HA 1E28B 1UB6B 3RDTC 3DRTA 4H0HB 3VD9A 1N59A 3TFKD 2DIBA 3BP4A 3BP6B 1FVCA 5ICXB 4PYHA 1KJVB 4PJIE 3QG6A 3SDAD 1V3MA 2HMIC 2ZP0T 4Z77A 3ZDXE 1WZMA 2MCPH 5GGTA 2J3SA 4KROD 2EH7H 3J8F7 4X6FA 1BD2D 5J6GB 4G6FB 1XH3A 2PR4H 4BZ2H 3L3JA 5HJ3A 5BVPH 3U7YH 3VE0A 2ICWA 4EEEA 5F96L 3UZEA 1CXIA 3KPOB 1YEKL 2KKQA 5TQ2H 2YUWA 3G6DH 3UO1H 2VXVH 2EXWD 3TIDA 3BW9A 3BPCB 3QFJD 5KS9B 4ZUWA 1PLGL 1AC6A 3FN3A 43C9B 3JWDH 2ZPKH 3KXFD 1T6VN 1OW0C 4NNPL 4WGVB 2VR5A 3FONB 2OZ4H 4M8QB 5D72L 1GSMA 4IEFB 4MLSA 2V17L 4NIKB 4P5KB 3PWLA 3RQ3A 1DQDL 1DQJB 4LRIC 3INUH 1HCVA 1P1ZA 1IKNA 3BGAA 3IJYA 1A22B 1QRNB 1T0NB 3ZHLA 4GO6B 1CD9B 3EYSL 1KTDA 2XT1B 1MRCL 4KAQL 4YHOL 2YUZA 4QRPA 2N1KA 3JTTA 3VFRB 1KTRL 5GIRA 4ZAKC 1VFMA 1D5MB 4AQ1B 1S9WA 4KFZC 4NP4L 3O3AA 4XCFL 4M7KH 4GLRH 2C4FT 3HZKA 1AXSA 4I0PC 1YC8A 5BZWA 2EDLA 1OLZA 1KJ2B 3MRDB 4XPHL 3IETA 2X40A 5CILH 5L2KD 1LO5A 3V2AR 1RSFA 1T20B 3TBTB 4AH2A 1EBAA 2EICA 4PJCB 2FHBA 3O2DH 4YXKH 3GSNA 3V5HA 1DFBL 5IBTL 1XR8A 1JYXA 3HRZB 4QHUB 5JHLH 3GSXA 3CLFL 5C3LD 4MAYD 5LCVH 1J5OH 2FX8H 4OLUH 4M62L 3BSZL 4OIIH 3V4UL 1UWGH 1MFNA 2R69L 4UV4L 5HGBB 4AIOA 3HPJB 1TTFA 5BRZD 3UTSE 5A2FA 3BESR 3HZMA 3CFBA 1QSEA 3VFOB 2YA1A 5CEZH 3MR9A 4WCYL 4Q9BA 2I60L 1MREH 1MRFL 5T1LA 4CADB 5GS1B 2Q3ZA 4HT1L 2VN7A 5IB1A 5JXEA 4KHTH 3NFPB 4HPOL 4HUUA 3QQ3B 4FTVA 3U0PA 5EOTA 1QEWA 2EYSB 3TBWB 4GSDL 4NRYA 4ZPVB 5T3ZE 1B0RB 1YY8B 2H8PB 5EDXA 1NAML 3VDAA 4GBXC 3MYZA 4X7TA 5JHDE 1H5BC 2J12B 4FXKA 5FYJD 5AWNL 3QJFA 5TE6L 1ZVSB 3RDTB 3RL2B 2VERN 5LXGL 4G9FD 4AM0B 3TO4A 5DMIH 1OL0A 4XPBL 2BNUB 1NCDL 1DQLH 4OTXL 3QULA 5D7JD 1CTNA 2QLVB 3F6IA 5HYJB 4NBZB 1N4XH 3OKMB 4XVSL 2W9EL 3X11B 5DI8B 2IEPA 4MZ3A 4L4JA 1UH3A 2XWJB 3WFZA 4LVHB 3LKQB 2Q7YA 1MWAB 3QUZC 4UBDC 4ERSL 4K3JL 1Q0XH 1TJHL 4XVUC 1ES0A 2HN7A 2ADGB 3L5HA 1OF2A 4HSQA 4DTGH 2FZ3B 2ZOLB 4L8DA 2BNRE 1UXWA 1BBDH 4M3KB 5GGSA 3VGDA 4P4RB 1SQ2N 4D3CH 4LCWB 4PJFB 3KJ6L 3EYFA 3HI6H 3DX8B 1AD9A 4GOSA 3HE6C 2Y4SA 4HBCL 4FFWD 1PY4A 1ZTXL 1Z2KA 2JJTC 4PB0L 4DUVA 4RBPH 2XRAL 2X41A 3K2UH 4G6JL 4OV5A 4NSKA 1CDJA 2HT3D 2YHGA 4P5TC 2AQ2A 1BOYA 2VDQL 3KYMA 4QRTA 5D1XA 2NY7H 1J9CT 2R2EB 1GC1C 1LEIB 4LSDA 2MCG1 1U2CA 4P57A 2NY5L 3T0AA 3EOTH 3O6ML 1IGCL 1T22A 3CXDL 1FO0H 1TVBA 2GITB 5I1JL 4OLVH 3LN5A 4ZAKB 1CQYA 3VH8G 1N7ML 3TJEL 3FT2A 2CKBA 2B1HH 1QNZH 1GYAA 5C0AB 3QDGE 3BWAA 2A77H 1PG7X 2Y07H 2MHAB 3JV4B 4M43L 2VN4A 1PBYA 2D9CA 3SGJC 3GMRA 1TTUA 1F11A 2J8HA 4MQSB 4Q9CA 3T4YB 1MHCA 4PJ7A 5B21A 1LMKA 1YN7B 5HVFB 3DHMA 1PG7H 4F7PA 3G6AB 4PGBA 1E27B 3M17A 3HC3H 4LPCA 5B8CC 3O2WL 1NAMB 1ZGLM 3EJZC 5H94A 3LN4A 1N0LA 5C71A 1FJ1B 4S1SL 3MREA 3ZDYF 4HLJA 4OCNC 1K3IA 4G42B 4Z7VB 1F58H 3K1KC 1DBJH 4MS8C 5BCAA 2ZKHL 1RULH 1N0XL 5HHOD 3HFMH 3OKKB 5AYQA 5I1GL 3T0EC 4Y7MA 3PV6A 4XP6H 1Q1JH 4PJEA 3BZFA 4LF3B 1EEUA 5AG9A 1A2YB 2HJLB 3A6BL 4XBPA 3SE4C 1CLYL 2YPLE 5GRUL 5C6TH 5JZ7D 5C0GB 4OZHA 4G7VH 3IYLW 2V7NA 4TUKH 4GBXB 3RVVD 4EKXA 3H3PL 3U1SH 3S96B 4MJ5A 1GIGH 1J0KA 4PP1C 5HYEA 4ZTOL 3WIHL 2ZG3A 4BFGA 5DLML 3MZGB 4KUCD 1ZA3A 4PJHA 1D9KD 4XPGH 2X9YA 4P0DA 4EDXB 4NC0B 4PJGA 2OMBA 3T2PA 3RPKA 3LEVH 4FQIL 4U6TA 4GMSH 4PP2B 2I07A 1Q0YH 3MV9A 2V5SA 4FQXD 3VXPA 1L0YA 4OD3L 4DGYL 1HNFA 3KPLA 1IM9D 4PJ9C 3ARPA 1A47A 3W11C 3HUJF 1ED3B 3OQ3B 3VXUE 2V5RA 1ZANL 3WNLA 3QT2A 4KY1H 2JIXA 3IKCB 5EZLA 4CU6A 5F88A 2VZVA 4W70A 1WEJH 3FQRA 4CMMB 1WCBB 2MQ3A 5FA4B 1N3NB 4OM0L 2PXYA 5BS0D 3UTZB 3MRRA 3ROLB 4H25B 4UU9B 3NCBB 3QDMD 5B39B 2OI9C 3IDNB 5EIIA 2ESVD 5HHNB 2APBA 3IAQA 5CJXA 4GAJH 1JF1B 1TZIA 2GYSA 4MLIA 2IQ9L 2R4SL 3TBYA 4X6CF 5ISZB 4L5FL 3VWKA 4P2QE 5LGKA 1MJ7H 3K7UA 4UV7L 3WFDH 1A6TA 1LE9A 1I8IB 4XCYA 4U1HB 4TUJB 3NCCB 3QDJB 2SEBA 3O3EB 4OLYH 3N1MC 4XNZC 4XP5H 2QR0B 5DDHA 4LIQE 3RTQB 5KANG 3U36B 2OYPA 3V6ZA 4P5MB 3Q3GA 5EZIL 2C4XA 4Y19B 1NBZA 1FZMB 1T0MA 4N9GA 2ARJQ 4PRID 5T33L 4AK1A 4M61B 2ZZUT 2YPKB 1XGRB 3B9KA 5D1QB 3L5WA 3D0VB 5DWUL 3VMPA 4MCYA 2ZNXA 4NQEB 1JGDA 5D6DA 3HG1E 5DJYB 2GTZB 1RJZB 4YWGH 1MFEL 4Y1AE 5B8CB 5LBSL 2BHZA 1NBVL 3U4BL 1P84J 1RUMH 2PO6B 1R3LB 5F9AC 2NYYC 3U7WH 4TYUA 1N5AB 1GGYA 2HAZA 3WFCH 2BZDA 2C3XA 1D5ZA 5I15L 5D6CA 2P42B 4NO0D 1ZHKB 3ZKQD 1GGBL 5E6IA 4FRWA 4WY7H 3TA3A 1RIUH 3NMEA 3DUSB 2MFNA 5KSBA 1CFSB 1TQCB 1W72B 2E6JA 4N9OB 1A1MB 4WI4A 3NBNA 1IC1A 1NL0L 5DEGB 3V5DA 5EU5B 2VKWA 3RWIA 1S9XB 5E8DH 3QXDA 3TT3H 1GZQB 2BOBA 3TIEB 1J12A 4WUUA 4RQQB 2GAZB 4MCZA 3OKDB 3WD5H 3HS0A 4Y5VA 4LLWA 5DJ8A 4QHLA 3BH8A 5HSFA 5KVDL 3HNSH 2EEDA 5FECA 4XHJC 3DMMA 2P47B 3RU8L 4LSQL 1G0XA 1Q72L 1NCUA 1UGNA 2AJXH 5EZOL 5IMOA 1B4JL 1FL6B 1AGEB 3KPMB 2YRPA 5JOEA 5EG6C 4X4YA 1D3CA 2B2XL 4BZYA 3QO0B 4NDMA 4IRSB 3ARBB 1A3RH 2DJSA 1HQ4A 2DTMH 1MFBH 4F33B 4L4TB 5CLWA 1U3HA 4KPHL 2GUOB 5FO8A 2Z92A 3SJVB 4RWYH 2HTLD 4JPVH 4PJXA 2Z9TA 1G6VK 4NCC1 2WMPA 1A6AB 6FABH 1W0WA 4QRUA 1WBXA 5C0CB 5ALCH 3SDAA 1VGEL 3RGVD 2GCYA 4H8WL 3GDBA 4J8RA 4YC2B 3VFNB 1YNLL 2AK4E 2ATPA 3L95A 3ARWA 4Z0XB 1I1YA 1S5IH 3SBWA 5C86A 3P0GB 1BD2A 3PWJB 1U8MB 1P4BH 4LDOB 3HR5A 3F62A 3TVMD 2RAMA 1CIDA 4GAFB 5F44A 5E4EC 2OI9B 2I9LA 1FNFA 4OJFL 2RFXB 3OJDA 4LGSB 1U2HA 3FCTA 3C8DA 3TBSA 5JPMA 3QFJA 4HIXL 2X4RB 5HY9A 5J9PB 3K4DA 2DKSA 5FB8B 3MV8B 3KXFA 1J7VR 3KPRB 3C9NA 5F7EL 5LAXB 4MSWB 5DZOA 5I6XC 4MDIB 4G80B 43CAB 1DBAH 3CZFB 4HWZA 3EDFA 1EO8L 1KCUL 5I8OH 3PHQB 1VENA 4TSCL 2I5YL 3V0WL 4YQXL 4NO5A 1DSFH 2NY3B 5IK3A 3ARDB 1WICA 4ZTPL 2HVKB 4FN0A 4G5ZH 2NR6C 2DQTH 2DQDH 5DGQA 2IGFL 3WXWL 2Y5EA 2C1OA 1XF3B 3KPQA 4AEHH 1SVZA 3ZKNC 4N8CH 3U6RB 3ARSA 4PV9A 4Z76B 4JM4H 3DXAE 4NM4H 1NGQH 3TZVD 4D2NA 2C7UA 3EJYD 2NW3B 4JFHE 4ONFL 3Q5TA 3MOQA 5IROA 1RMFL 4LOUC 4QOKD 2FX7H 5FYLD 1EEZA 5IVXB 1RK1B 1YEDA 1JWSB 2VWEE 2R23B 5L2KA 2G9HB 3SCMB 3C5JB 5DS8B 1T04A 2VDPL 1AD0B 2KQMA 4G8GB 4LFHG 4NO3B 5E99L 4AG4L 1IEBB 2HFGL 4JANB 1A7PH 3L3IA 4HH9A 5IB3A 3O3DA 4D9LL 3WFHA 4JDVA 3ZKSD 4MAYA 4FFZH 3B9VA 4OLXL 2IALB 3VA6A 4LQFL 5IESL 4NM8H 4P23D 4X5XA 5BRZA 1IAIH 2XTJB 3L7EB 2Y6SC 4M5ZL 5IHZB 4X6DA 3DJ9A 5IW3A 4IOSD 3S98A 4PJBE 4O58H 3W0WE 5FGBA 3MRJB 3ZZ1A 3H7LA 4PY8I 4TVPE 1OTUC 2A73A 2XNAB 1MH5B 2VR4A 3QHFH 4LCUA 5KW9H 1MEXL 4NN7C 2ATKB 1BF2A 1P4LA 3I2CL 4YHZH 4Y8AA 4QXGH 1P9MC 3C5ZC 4HQQH 4K23H 1CFVL 3VGAC 4G6ML 5CGYC 1SEBB 1Y18B 1OGTB 2JF1A 1FCGA 4YNYB 1E4WL 5IB2A 1AI1H 2OLDA 5IBUG 4XVJL 3GM8A 3V4VL 1FGNL 1R5IA 4G9FA 4XP1L 3TYGH 2UWEE 3UTOA 1GGIL 5D7JA 1X5KA 3BT2H 5KTEH 1FVEA 3Q6FA 4I77H 2A83B 2ZUYA 4NBYB 3BXNA 4X6EB 4RNRB 1CK0H 2CR6A 4A2LA 1FG2B 4HD9A 4EQ3A 5FHBH 1LK2A 4XAKE 4NN6C 4LNVA 2VLKE 4LBEB 4WU7B 1IAOB 2X1PA 1DE4A 4BQ8A 3FRPG 1I7UA 2J2ZA 2GHWB 2EDEA 2EIZA 4WWKA 1QLFB 5JOFA 2YSSA 4KVCL 2W1NA 3RVWC 3UYRH 4GRLD 3QUYD 1N8ZB 4H88H 1AKJD 2HLAA 1MFDL 2J8UA 4O4YH 5DMJB 3T08A 3R06A 4N0UE 4ZUVB 4LRNL 2I27N 3CDGA 4L29B 2PUQT 1G9MC 5ABDE 1EERB 5I6XB 3U4EA 4ODHL 3QXTA 5GRJL 2AI0H 1CWVA 1UWEH 4OCLC 1T3FA 3CSYB 5E8NA 2X7LA 4UQ3A 3MJ6A 5IB4B 1CD1B 4JFYA 3OHXB 3TN0A 1GPOL 3FHAA 2ITDA 3CDFA 3BH9A 4RFEA 5DYOB 5I2IA 4MXWL 5GS2D 3SOBL 5E8OA 4JDTH 4MQTB 3ES6A 3CFKB 1IBGH 1PZ5A 1TDQA 5IVOA 3OGCA 3HC4H 2DDQH 4K3EH 2QQNH 4ZFGH 4NHCL 8FABA 1G0YR 4R8WL 3BOVA 5DUML 2GK0A 3LRSA 4K71C 5JW5A 3RZCD 4Q74A 4YHYC 4BJLA 5IOPB 3CPLB 4BSVA 1IAKB 5DC0A 3ZKXB 3FHQA 4MA3B 2V5YA 2VE6A 3EFFB 3TJHD 5KS9F 3ZKMD 1KLGA 3DTXB 4F37K 1A5FH 1ETZB 1KJMB 4P4KB 5F6HI 5C7XH 4GKOA 2K9UA 2DN7A 2DQIH 1U92B 3O11B 4FQQB 1KEGH 3MLZH 3QUXD 4U1NA 5E00B 1JBJA 2X70A 3KPNB 4ESKA 2CK0L 1FAIH 4B7LA 5CSBA 2BVPA 5CEYA 2I24N 4HGWB 5HHOA 1MCOL 2IG2H 1IGTA 1PKQA 4ZDHB 2ADFL 2X05A 4M4RA 1Z0NA 2OL3H 3CH1A 4WFHE 4M48L 1UJ3A 3T65A 3MLYH 3WIFB 3N9GH 4KHXL 3OKLB 1PKOA 3F58L 5I1EH 4IS6B 3I3DA 4CVUA 3NGBC 3BKYH 5FYKU 4NN7B 3RWJA 5SWSE 1MAJA 4PB9H 4O5LH 4P2OC 4HEME 3VGAB 1DLFL 3DOSA 3PWNA 4AIZB 2H3NB 5C2UB 4LNRB 1UM4L 3W5NA 5CWSB 1NEUA 1U8HB 3SKNB 1BEYH 2FYYB 3R0MA 3QEQD 1AHWA 2HT2D 2GFBA 3K81A 4PJCF 1D9KA 1FIGL 4HIJA 3S35H 5FM5M 4DKDC 2Y7QB 5F7YC 1EIBA 1MY7A 2P5ED 4FQXA 3U2SB 4LDEB 3F65A 4JFDB 1X5FA 3SKJH 1IM9A 1S78D 5GS0L 1NCAL 2R1XB 1DR9A 2VH5L 1AC0A 5EO9A 2W0FA 4GKNB 1C5DB 4LHUB 4RIRA 2FEDC 4K7FA 5BS0A 1H9VA 4PLOB 5DT1H 1UYWH 4JEGB 3SPVA 3ARGD 3QDMA 5KSUA 1HXMB 4X6BB 2O5XL 2ESVA 2YC1B 5IF0B 5D7KD 1NCCL 3N85H 1ADQH 4YGVA 4MA8L 4M1GL 5JNYB 2DWEA 1QBLL 1Y0LB 1INDH 4HXBL 4I2XE 3EO9H 1WJ3A 5C9JA 1KLUA 1S7TA 3O3BB 3NN8B 4FP8H 4RZCA 3V6FB 4LSVL 1MCLA 1JV5B 2R2CA 2PYEE 1QKZH 1FG9C 3QIBC 3HZVB 1TCRB 5B3JE 1UZ6F 2OTUB 4Z5RA 1A7QH 4JQIH 5D5MB 1CGWA 2J6EL 4WI7A 3UZQA 5HYQB 5FYLH 4F7TB 1A6VL 4OCXH 4TVSa 1UZ8A 5B3NA 1GZPB 3VD7A 1TZGL 4PGDA 3KS0H 2VLRB 3AM8A 4K71B 4NGHL 5C0NC 3V0AC 4X4ZA 1S5HB 4QRSA 4XPTH 4ZD3L 4ZPTA 4JQVC 1IGMH 1NPUA 3OXSB 3DX7A 5C0BD 2EE9A 1AO7E 2ITCB 2NX5E 1ND0A 2V9RA 3ZE1F 2DIJA 1I8MA 5L7XL 2CUIA 1NMAL 4GRMB 2FWOB 3RKDD 1HH9B 4JPKL 5LQBH 5ITFB 4UT6L 2H32B 4ENED 5D2LE 5HPMA 2ZSVB 2R2BA 5DD1H 4M6OH 1QFWL 5KVMC 4NO0A 2YD4A 1OVZA 1MJ8H 1ZWIA 1JRHH 2VDKH 5F9WC 1I9RH 4S1RL 1G0DA 1NCTA 3P11L 3RVUD 2PTTA 1IQDB 3CCHB 1XGUA 4Y16B 5E9DE 2GJ6E 3I6KB 4G6FD 4D0BB 4Y4KC 1U8OA 2R56H 2XQYK 1DANU 3BIKB 4XP4L 5T3XD 1J18A 4PG2C 5HGDA 4HIIB 1V7ML 1L0XA 1WAAE 3LV3B 2XG4A 3MYJA 4IIQC 3K1DA 4P2OB 2YEZA 2DI7A 3QPQD 2L4OA 1OAZL 1SJXA 3PHOB 1FFPB 1TPXC 4ZO8A 4P3CL 1B2WL 1N5YH 1CLOH 4LCYB 3JWOH 3C2AH 5F1KC 1SJEA 4MQXC 2VXQL 1QQDB 1WVZA 2MPAL 2VZOA 1LO4H 1J8HE 1RK0A 5ESAA 2OK0H 3CSPA 5LG1A 3VD4A 5DK2A 2E6QA 3P4LA 4GLRI 3QHTC 1NLBL 5FDWA 2OQJA 4Z7VF 5E2TH 5DD6B 3QQ9D 2V9TA 4WV1C 5DQDL 1QRND 4XZUA 4YZFE 1G7IA 3DRQB 1UVQB 5L9DL 4XMKL 2R0LL 1RZ7H 2WUBL 3MRHB 5JQ6L 1X5IA 2W0LA 4NRZB 3RGVA 3L5XH 3CVIH 1I8LC 4F9LA 4GXVL 4YPGB 2IH3B 4PJIB 1ORSB 4YR6A 4EIGB 1KB5H 5JDSA 1H3VA 1FNSH 2F53E 3TVMA 3D85B 2V2WB 4C54A 4ELMA 2HA1A 1S7RA 3RX8A 3D9AL 3TCLB 1HILB 1ZS8A 3TH2T 5H35A 1M4KA 3HAEH 5GS2H 5EULV 1GHFL 2DQGL 2LABA 5T3ZL 2VQUA 2WIIA 5B38G 4X4XA 5J6HB 1TVHA 4R7NB 3OR6A 3RHWK 1G7HA 4IDJH 1OARH 1KENL 4P3DB 1MCEA 3QIBB 4HWEL 2HJFA 4Z7UE 4F7MA 2BFVH 2J88L 5E2UL 1G9MH 4ORGA 2AJZA 5IT2H 4APQC 2VRAA 3MRQA 4YFLF 4JB9H 2CPCA 3D5OF 3X3GH 3HUJA 5A3ID 3IU4H 1K85A 5D8JH 5EBMA 3NA9L 5BZDA 3D39E 3QUKA 3I9GH 4DK3A 4PFEA 4GS7C 5JW4N 3HPLB 5HGHA 3C6LB 1HYSC 1WITA 1CGYA 1YEJH 1AY1L 3EGSB 3CXHK 5GSRA 1MLCA 2P8LA 5I74B 1JIBA 1ACYL 3B3IB 1MFAL 5SX5H 2KDGA 3SY0B 4ZXBC 3TZVA 1HH6A 2VJXA 3EFDL 5FOBB 1F6AA 5I71C 3AROA 4DEPB 4MVBD 4QOKA 4WHYG 1G6RH 1IGJB 4AZ8A 4JFEE 4OFIA 4JQXC 1MFCL 4K3HA 4DGIH 1NEZG 1JGLL 3TNNB 5LGJA 3QWOA 2FJFB 3MZTA 3H9YA 4M1DL 2JB6A 5EOCH 4ODXB 5FFLA 5TF1H 3IDMA 4HKXB 5HYJD 4DKEL 1CFNA 2R9HC 3WUWA 1K5NA 2NY6B 3MCKA 3RX7A 4W6XB 2ZCLH 4S2SB 1QR4A 3V4PL 2HMID 5CINL 3U48A 4HUNB 4JE4B 3UPAA 1IMHC 3O8XB 3MRKA 1I8KA 2V2XB 1NAKL 3B5HA 5DJCA 2EDRA 4O2FB 3FO2A 1EFQA 12E8L 2DB8A 4P23A 2NY1B 5ESVA 1FV1B 4XXDB 5DO2C 1KPRB 1UKQA 3CIQA 5CHNA 2O5YH 2K7PA 3G5VA 2VDMH 1CLZH 3C2SA 3IJSB 3UTSB 5EU4A 5H2BB 3WKMH 1RJYA 4DK6A 4F2MA 1ZGLB 4Q0XL 3JVGA 1UB5A 1NUFA 5DSCA 1JZ5A 1WBZA 4U6VH 3QHZL 4JKKA 4DVBA 2DLIA 2IBZX 3DI3B 4RBPK 4M6MH 5DRXB 1MIMH 4I3SH 3N1QC 5J57B 1G7LA 2YRLA 4YLQT 2JB5L 1YA5A 5E94B 2P43B 3STBA 3DBXA 4KI5F 5L88H 5DFVD 2DRUA 2CMRH 5HGGS 3E6FA 4WV1B 3RWEB 5D9SA 2WUCL 5JHDB 3TYFB 1IZJA 4Z7NF 5HI4C 3T3PF 2QQLH 3RIAK 5TDPB 1BX2A 1I3RA 4MX7B 3UBXA 3HMXL 4JZOA 5AUMA 1R24A 4QEGA 4ZAKD 1L7IL 5SV3A 1QR1A 1ROWA 5C0AD 1TJIL 1LDPH 3R4DA 1TJGL 1A9BA 2Z91B 3DO7A 3GO1H 5HHQA 4BKLB 1EBPA 4GRLA 2OMNA 2D31B 1AKJA 2CDEB 2BNRB 1U42A 3VH8B 3I3BA 1SEQL 1DP0A 3OKEA 2ZUXA 2GY5A 1LHZA 4Q9QL 3VRIA 3NZ8B 1JI1A 4APQB 3O4LE 1KB5A 1BF8A 3FQNA 2YD3A 3KPPB 3VG9C 4UOW0 1T7YA 3RA7L 5GRVK 1JFQL 5CP3A 2B7DT 3GK8H 4H1LH 4NKOA 1I9JL 3FFCB 5FGRA 4PD4J 4GS7B 4R3SB 5J8OA 3SHSA 3KPSE 3MGAA 2B4CL 3IDJB 1UCBH 4IOIA 5DD0H 4RRPG 4NQSA 3AAZA 3MGOA 4LCIL 4HK3N 3MNWA 3BISA 4JHWH 4YHLH 1JHKH 3DYOA 5CJQL 5I76B 4ZXBB 3STZB 4WUKH 4IOFC 2C4FU 3RZCA 2RQ8A 1L7TH 5H8DA 5I8KH 1Q9WA 4GBXD 3GSNL 4WRLA 3VXOB 1CGTA 4Y2DD 3QDGB 2YBRB 1JJUA 4XT1C 1FYTB 4QHNB 3O2VH 1AQDA 4B50A 3DETC 1NFIB 3C87A 3MUGA 4KKLC 4OI9A 5T3XH 4Z0BH 1R5VB 3IFOA 1S7XB 3H42H 1T1ZB 4FZEL 1K8IA 3PP4L 3O9WB 1F2QA 4HIEB 4V2CB 1PZUB 4XVUD 1G6RA 2HWZL 1JNNL 4OB5L 5I19H 3LSOA 3BMVA 4LIQL 2AV1B 4U4BA 4IRJC 4OCSL 4J23A 4C55A 1WWWX 3QA3B 4DZBB 1QOKA 2VZTA 4OQTH 4I9WE 3VW3L 2C3GA 1ZV5A 3DUUB 1A7NH 3UAJC 3FB7A 1UEMA 4MNGE 2JKXA 2YPLB 1C16A 3TV3L 1FGVH 5KSAC 1M6OA 5DHYA 2G5BA 4WI8A 2FO4A 4P9HC 3QEQA 1TETH 3DURB 3BPLC 1RZFH 2DM7A 2PW1A 3ULVE 4MJIE 4LPXA 4XXCA 3BEVB 4LKCB 4KUZL 4JN1L 1PJ9A 3QDJD 2P5EA 3S88L 3P3YA 1KXVC 1ZEAL 2BVQA 3RTQD 3GIZL 2ED9A 1BGXH 1J1PH 2AGJH 4GKSB 5J12C 2JJUA 4YX2H 3FQUA 5K59F 3R1GL 2XV6B 1NDMA 2D7QA 3QPXH 4Q9RH 4XNQB 2WBWB 4CAGA 1A4KA 2IMNA 1KCKA 2XA3A 2VZSA 5D1QD 3RY6C 3TBVB 3VXUB 1X6LA 1CGSH 4NQED 4F8QA 3TESA 2L0DA 1ZOXA 4F7CA 1MQ8A 5J1TC 1R3JB 3EHBD 4LVEA 1P53A 1U8KA 3ARGA 2BOCB 5EO0B 5DTFA 1EGJL 2PO6D 5INCA 4LKXA 3UX9B 1VPOL 1BQLL 4KI5D 1I1FB 2GSGA 2YD2A 1OAKH 4WO4B 3I75A 1NCBH 1RUKH 2FDBP 3ULUE 1INEL 1LO2L 4MS8D 2EECA 4N5EC 4AMKL 4R4NC 5GJSH 4ZFOL 5I0ZA 4FG6C 2C3WA 5E1HB 1MCIA 1CU4H 1ZLUK 2C5DC 3FQXA 2DL2A 3V6OA 5F96H 3T3ME 4JRYE 4Q6IC 1YEKH 5CBAA 1IC5L 4WFFE 3SE3A 1KELL 3B9AA 3LS4L 1I7TA 3AB0C 5IM7A 4TQEL 2PNDA 5HDLA 2MSPA 3QXAB 5C08E 5C0RH 2ZG2A 4CGTA 4NNPH 1SYSA 5K9JL 4R0LB 5A2JH 3GJEB 3P9MB 4FXGB 3SGDH 5D72H 1XGPB 2V17H 4PRDA 4HUVA 4UNUA 2QTEA 1DQDH 5C0BA 1S7VA 5K9OA 5IMMA 2Z35A 1NC2B 3S3PA 2A0LC 5CZVH 4ZUUA 4E0RB 1J05A 3IAGC 5CEXA 3RIFF 3EYSH 4IRSD 3EO1A 3ARBD 1MRCH 4KAQH 3HG1B 1ZLWH 3KJ4B 4KU1A 5K9KA 5GZOD 2JTDA 1FE8L 4HCRA 5J1AA 4HWNA 4L4TD 3FQWB 4KKNA 4Y1AB 3EO0B 1E28A 1UB6A 3WO3B 4CUCA 5TPWL 5BV7C 3IU3B 2Z0BA 3N1FC 4WHDA 1DVFB 3IGAB 3LQMA 3BP6A 4NP4H 5A2IH 5ICXA 4X7SH 1KJVA 5C0CD 4N0FB 4HGKC 2QSQA 2YKLL 4L9DA 5D96C 1M7IB 5C6WH 1B88A 4R2GC 5IGXL 4XH2A 4XPHH 3JV6B 3NCMA 1NFDE 5DRWB 5J6GA 4XPAL 3OAUL 2FB4L 1VERA 1RIVL 1JYNA 4XMPL 2H1PL 3P4NB 3KPOA 4NO2B 1I3VA 3KR3L 3CLEL 3CLFH 3MJ9L 5DR5L 3EYOB 3C8KB 1U3JA 3BPCA 4YHKL 5KS9A 4M62H 3BSZH 3V4UH 4KH2A 2D4DA 4PTTB 2R1WB 4JREC 3KPRD 1D5BB 3FONA 3B83A 4M8QA 3X3FL 4P5KA 1MRFH 4HFUL 4XTRC 1F90L 4RMVA 1DQJA 4HPOH 4ZFOB 3T0WA 3I84A 1WT5C 1QRNA 1T0NA 4X0KB 2NY3D 4CVWA 3ARDD 2AEPH 4JRXE 5M7QA 5E95B 3DNKA 4B53A 1HHIB 4RDQF 5JOPE 1TXKA 5AYUL 4ZUTB 3NTCL 3VFRA 4JKPL 5AWNH 1I85A 1D5MA 3LD8C 4LQ1A 4HMCA 5H37H 4XPBH 4OTXH 4DGVL 3ET9F 3ZE0E 1YEGH 4XVSH 4TVPL 4I18C 4GXUN 5C09E 5E8PB 1KJ2A 3MRDA 3QI9C 3B5GA 3DVGB 1FRGL 1T20A 3TBTA 1WIPA 3SCMD 4JY4B 2HFTA 1NGYB 1RUQL 4PJCA 3QRGH 4PLNC 4NRXB 3UPRB 4ERSH 2F8OA 2X6MA 3BKMH 3HRZA 5JIHA 4Q6IB 4PGZA 5EBWB 3DV4B 3VFWB 4ALAL 5MI0B 5IEKB 3HLAB 1F8TH 1N26A 2VXUL 1EUUA 1B6DA 4G7YL 5HGBA 3KJ6H 2JCCE 3HPJA 2XTJD 4PB0H 2XRAH 3VFOA 1CL7L 3IDXL 1GGCH 2X1WL 4G6JH 2NMSA 2FR4B 2BSRB 1I4FB 1CBVH 5GS1A 1JZ7A 3G5ZB 3NFPA 2VDQH 3QQ3A 5FKAB 3WDIA 1K4DB 3TBWA 2EYSA 4RAVB 2UUDH 3K74B 1P5VA 4GQ9L 3UROR 4ZPVA 2XQYG 1B0RA 5HPOA 1RY7B 1YY8A 2H8PA 3GBML 3GMQB 4TSAH 4D9RD 2NY5H 3DXAB 3O6MH 1IGCH 3RNQB 1ZVSA 3CXDH 3RL2A 4HS8L 2OXHA 3H3KA 4AM0A 1EFXB 1N7MH 1XCTB 2BNUA 1FVDB 2JELH 5HYJA 4UDUB 2X44D 3OKMA 4UIKL 5IKCB 3G6JE 3HE7C 2G60L 3X11A 5DI8A 2RHEA 5GGQL 5D96B 3CU7A 5D5MF 2XWJA 2J1KA 3LKQA 4Q2ZB 1KTLB 1MWAA 1I1AB 4ZQKB 5DJXB 5IBUB 2AXHA 4E42B 4IJ3C 3JTSB 3VXME 2ADGA 4QXWA 3O2WH 1T03L 2ICES 2FZ3A 1F45A 2ZOLA 4P4RA 1CFQB 2FD6L 4LCWA 4PJFA 4R4FL 5SWQB 3DX8A 4ZO7A 4P2CG 4PG9B 1H15B 4PJBB 1N0XH 1RU9L 3W0WB 2OM5A 1D6EB 1QACA 2R1YB 3KHQA 1ZK9A 2YD7A 1EPFA 4GW5B 3OX8B 2VQTA 1KCLA 2FIRT 3RVTC 2E27H 4LPTA 2YRZA 1G7MB 3PNWB 5AZEL 3A6BH 5CIPB 4YK4C 1HE7A 5FM4A 3GMPB 2R2EA 3MRLB 1X4YA 5F93C 2YPVH 2NR6D 5D7SH 4X99B 4K8RC 4WW2C 2UWEB 2VXSL 2GITA 4WGWB 1MRDH 3RUGE 5CZKA 3JV0A 2F54E 3SDCB 4ZAKA 3WIHH 4TTGA 5DLMH 1KFAL 4HULB 1BFTA 3LD8B 2O93L 4QF1B 5C0AA 4RSVA 5IW6B 4Z7OF 2HKFH 1BLNB 4LOUD 2Z4QB 4CVZB 2MHAA 3JV4A 4GG6E 4I18B 1F42A 4FQIH 1TITA 4K2UH 2IH1B 3QI9B 3L7FB 4KRNA 2RJMA 4UOW1 2VLKB 4HAFA 3T4YA 5F3HB 1YN7A 2FH8A 3GMOB 3G6AA 5IVNA 1E27A 5DMGC 5GISH 4P4KD 5KZCB 2BSED 1NAMA 3RY5A 1MCPL 4W68A 5AAWA 3OAYH 3JV5A 3CD4A 3L9RB 4KRPB 1L9MA 4TNWF 1FJ1A 15C8L 1KBGL 3FAWA 4M4PA 5ID0B 4G42A 2WWMC 4N0UB 4Z7VA 4XNXL 4DQOL 1URLA 4XX1E 4F80A 5JXAL 3C8HA 4FZ8H 1NDGB 3OKKA 3ZMRA 4OD2B 1OSPH 4HZLA 4LL9A 3IFNL 3BGFC 4NC1E 1J1OL 4I0KA 4LF3A 3OG6B 4FQPA 1PVHA 1A2YA 1AGFB 2IQ9H 2HJLA 2VLLB 1MHPH 4HKBB 4JPWL 3SGKC 4G43A 4Y5YB 1KPVB 5F6IC 4PJIF 5C0GA 2AXGB 4UV7H 1Y6KR 5EU7E 3V8OA 1OPGL 1CXEA 3KYAA 4GBXA 4V1DE 4ZNEA 3S96A 1H3UA 1T80A 4MHHI 4YPJA 1IKFL 3TH3T 3MACL 4AT6B 4OZFH 1FDLL 1UCTA 1JWUB 2FIKB 4G6AC 6CGTA 4NPYB 3UTQB 2VOTA 4EDXA 4BFIB 5DF0A 5INDB 4EI6B 3VWJC 4XX1G 3PHSA 3FAXA 3BD4A 4OFPA 1G7JB 4PP2A 5JUEL 4DN4H 5DWUH 5L2JB 4JFDD 5EPMB 3VFMB 3WLBB 5BV7H 1CICC 2P5WE 5IV2B 1IGIL 4OD1L 2CRYA 1ED3A 5MEOB 2Q86B 1U6AH 4PJ8C 5DMKB 2DM2A 3IKCA 3RWHB 5LBSH 3OKYA 1NBVH 3EW3B 5GZNC 1V7NL 4LHUD 4CMMA 1WCBA 5FA4A 1N3NA 3UTZA 4JFXB 3ROLA 5DEZA 2JJTA 1KN2L 4UU9A 2AABL 3WLWD 2NW2B 1IC4L 5B39A 3WXVL 3IDNA 1ONQB 2AJVL 5HHNA 2J5LC 1JF1A 3PXJA 5DD3H 2WLYA 5CLTA 5SWSB 5HD8D 1KXQE 5ISZA 4HUKB 3ZYJA 4WFED 1OWWA 1FZJB 3BX7C 3WIIL 2VLJE 5JA8B 4U0QB 5MERB 1I8IA 3L6FB 3VI4E 1V8HA 1G9NC 4U1HA 5FYJU 2WBJC 4TUJA 1KTKE 3QDJA 4WW2B 4LAQL 5KVDH 3O3EA 1BIHA 1KT2A 4WI6A 4LSQH 2QR0A 4DWHA 3RTQA 5EZOH 3U36A 4GXUM 2CDGB 3LMJL 1B4JH 3SDDC 4P5MA 1LO3L 1NSNL 4Y19A 1FZMA 2BJMH 2VLRD 2B2XH 2AV7B 2HG5B 5DJ6B 2DF3A 1GOFA 4PJDE 4M61A 3WFEL 3VFGH 2YPKA 1XGRA 5D1QA 1ZKAA 1IEAB 2H26B 2YN5A 3D0VA 3FB6B 4NT6B 3QFJE 4NQEA 4KPHH 3IT8D 3MNZB 1JRHI 4R96B 5DJYA 2GTZA 3I3EA 1RJZA 5ICZA 5B8CA 1C8PA 4B41A 1BQSA 3P4OB 1P2CB 3CJJA 3QEHB 1G9NL 4RFOL 5DA4A 2PO6A 1R3LA 1VGEH 4JM2C 1ZVYA 4RA0C 5JDJA 3QCTH 3WIHA 1YNLH 1U93A 2F9BT 1TQBC 2ZCHL 5F3BB 1NGPL 3CNKA 4NKDB 2C3HA 2HP4A 3DUSA 4I2XB 1MJJB 1UG9A 1W72A 2RGSA 4OJFH 1A1MA 3AREC 1SJHB 2NY0C 3M07A 4HGMA 5DEGA 5I1HH 1F4AA 1Y6NR 1KIUA 2PYEB 5EU5A 4Y16D 5GS0D 1S9XA 4HIXH 5F6IB 1I9EA 2CR3A 2DTSA 1GZQA 3TIEA 4RQQA 2GAZA 2EXYC 3FQTB 3OKDA 5IIEB 3LY6A 4RMQA 4P2OD 3QUML 2H6PB 1MLBB 5CUSH 3ZT5A 5L2KE 5MP6H 4ZMAT 1KCUH 1FL6A 1IFHL 1AGEA 4KMLB 3KPMA 3FT3B 4FQCL 1HHGB 4TSCH 2DQCH 2BVTA 3MLRH 4JFZL 3V0WH 3QO0A 3VWJB 4IRSA 3ARBA 4K94L 4ZTPH 2NX5B 1CDYA 2VDLH 4JFFB 4F33A 2IGFH 4L4TA 2YZ1A 1Z3GL 5CCKL 2GUOA 5IQ7L 1S3KL 5FA3B 1H3GA 1CICB 5EORL 1T89A 3MRNB 4JO3L 1B9ZA 4OGXL 5D2LB 1A6AA 1QSFE 5JLZB 2EDWA 4NWUH 5C0CA 5L0QC 1D5IL 4ONFH 2P1YA 1RMFH 1G7PB 5ENWB 3VFNA 2UZIL 1FNGB 4Z0XA 4LLMB 2FEDD 4F9PC 1F4XL 1FH5H 2CLVB 1W0VA 3PWJA 4I5BB 4S1QL 1U8MA 3WN5B 4AG4H 3ORJA 3MA7B 3D85D 3QXWA 4N1EA 2Y36H 2ZSWB 5E9DB 4MA7L 2GJ6B 2OS7A 2RFXA 4U3CA 4D9LH 1S7SB 3U46B 2BCKB 3W39B 4EN3B 4OLXH 3MBEB 3RWDB 5J9PA 2X4RA 4XAWH 5FB8A 5TGBB 2Q6WB 4MZ2A 5IESH 1JTOA 2NY4C 1H3PL 4ZS6D 4M5ZH 5IWLC 3KPRA 3QIBD 5F21B 2W07A 5GHWL 2WBJB 2NCMA 5LAXA 4MSWA 1ZHLB 4MDIA 4G80A 5FAAA 43CAA 3CZFA 4KRLB 4HJGB 3PHQA 5GS3A 3V7AE 1AR2A 3V5KB 3IFLH 1OP9A 3SDDB 1XMWA 5B38B 1VKXB 5F9DC 2IPKB 1KCSL 4U05A 3ARDA 1SMAA 3I2CH 1PGRB 2HVKA 3BHBB 2ERJB 1WTLA 4HK0B 3C6LD 1KF9B 4I13B 1U8JB 1A7RL 1CFVH 1XF3A 1NFKA 2YMXL 2W0KA 2CH8A 3GMMB 5HVHC 3WNMA 2QSTA 1D6VL 4YBLB 4ZS7L 3LZFL 1QFOA 2J8UE 4F57H 2EC8A 2NXZC 4OKDA 1UADC 3U6RA 3V4VH 1QTYT 2MWCA 4Z76A 5SX5K 1KIRB 1EO5A 2NW3A 3QUMB 2YS4A 3L3GB 1FN4B 4JM2B 5B22A 1P7QB 4X9HA 4EZMA 4DAGH 5IVXA 1RK1A 2F53B 1JWSA 3ELAT 2R23A 2G9HA 5DMYA 3SCMA 5T5FH 3C5JA 5DS8A 4G8GA 1AD0A 4NO3A 1V5JA 4P9MH 1IEBA 3BAEL 4WDIB 3W9DB 4NZRH 1TQBB 4JANA 5C9KA 2NY6D 4KJQC 3V7AG 3MBXL 1KJ3L 3BE1L 4ODSH 2NY0B 3O8XD 3CK0L 4WENB 4M6NH 1NEZB 2IALA 2GEEA 3ECBB 3LB6C 3P30L 1DBBL 3SE8L 2HFEB 1CG9B 1MFDH 2NY1D 3L7EA 5IHZA 5A2KH 3RWFB 5HYSG 3T1FB 4EBQL 1A14H 3UTSD 1BMGA 4K55A 3GSQB 3QISA 2GT9B 1AJ7H 3D39B 3MRJA 2IANE 5J7CC 5KVEH 4HKJB 2XNAA 1MH5A 3DSNA 1CF8L 3OKNB 2D7TL 3PL6C 3WEXB 2DM4A 3NCJL 2XZCL 4FQHB 2ATKA 1AXTL 1VA9A 5DFWH 1RZIB 3WS6A 5FK9B 1GPOH 1KGCD 3LHPL 5D1ZD 5HYFA 4E5XB 1SEBA 1Y18A 4ZOEA 1OGTA 4MXWH 4YNYA 5T3ZD 1WF5A 3P4MB 3GNMH 3NABL 4JFEB 5JHDD 4NHCH 1JWMA 5IG7B 1YY9D 3AXLB 1E6OL 2A83A 2MQCA 3LKSB 1U8QB 4KDVA 4WEBH 4X6EA 4RNRA 4CBPA 1V05A 1C1EL 1HOCB 1FG2A 4FXLA 4AEIL 2OR9H 4WU5B 1KB9K 1T7VA 3MX0A 1D7FA 4KDTC 4LBEA 4WU7A 1IAOA 4NQCE 3ME0A 1FBIL 4RGMC 2B1AL 4BQCA 1QLFA 4HUXB 1U9KA 4HF5L 1N8ZA 2GI7A 2BNRD 5FYKH 3WE6B 3OR7B 2MOVA 1OCWL 5A43C 2CK0H 2NY4B 3T0EE 1QRKA 3I50L 5DA0B 1MAKA 1KOAA 4ZUVA 1LWRA 4L29A 4UTBL 3W2DH 2X2YA 2MKWA 4APQD 1EH9A 2X5PA 1EO7A 4KHXH 1A3QA 3F58H 3F7QA 4GRWH 3CSYA 2FEEI 5IB4A 4F15C 3OHXA 5I16B 3FFCD 4D0DB 3IB4A 1UM5L 1F6LL 2CSPA 2HLFC 4LVOC 5DYOA 1RUAL 4QKXB 1MCRA 4PY8J 3MQIA 3ULVC 3CFKA 4PLJC 1BVZA 4DN3L 1UM4H 4DKFH 4KQ3L 5M94B 4NNXB 4YE4H 3HZYB 4HJ0D 4JN2B 4QCIB 2CQVA 3VJ6B 1FIGH 4OGYL 3O6LL 4OZIE 1RI8A 3IDYC 5IOPA 3CPLA 1IAKA 1VDGA 3GIVB 3C08H 4U1GC 4MMXC 4MA3A 3QDGD 5BW7A 1FYTD 3EFFA 5GRWA 1GJIA 2XA8L 1NUGA 5C07E 3RI5K 1ZE3C 1YYML 1DL7L 3DTXA 3FOLB 1ETZA 1PSKL 1KJMA 1NCAH 4P4KA 2VH5H 4IBLT 4TOYL 2OCFD 3OL2A 1U92A 1WTGT 3O11A 4HXAL 5JQHC 5E00A 3KLHC 4PBWD 4XMLH 3O9WD 3KPNA 1Q38A 3ZL4H 3BQUB 5FIEA 2VC2L 4HGWA 3O4LB 3T0XA 4ZDHA 4XB8A 5I17B 1A7BA 4PRIE 2O5XH 1AGDB 1IKNC 4EOWL 3O3UN 3WIFA 1MY5A 3OKLA 4KKBC 4KK9D 4J3SA 1HWGB 4XB7A 4IS6A 3FO9B 1GVIA 1QBLH 3KPSB 3ZTNL 4ODTL 5T1MB 5I8EB 3TWCH 2YPLD 1WCQA 1VFBB 4AIZA 4UZGA 4JZNB 1A6VH 3GBLA 1A02N 5CWSA 1U8HA 3SKNA 4HJJH 5F7UA 2F19L 5D2NE 2FYYA 3R8BB 3PGCB 2H2SC 2LE9A 1A6WL 2Q20A 1K8DB 1TZGH 2Y7QA 4FA8A 5HI4D 4NGHH 1SVCP 1MELA 3ULUL 2QQQA 4UT7L 4ETYA 4HKZB 4KRMB 1A21A 5F7FA 3U2SA 2Q1EA 4KKAC 1YMME 4JGJA 4JFDA 1SJVA 3DSFH 3DV6B 4YH6A 2R1XA 2X1OA 4XBGB 4H5SB 5DHXB 5GRYA 4LHJB 4ODWB 4BH8B 2VNCA 1T66C 4RGMB 4DOHE 3BIBX 4GKNA 2D9QB 4JPKH 1F4YH 1V3JA 3G5YB 4UT6H 2IFGA 1C5DA 3VXUD 4MMZC 4LHUA 2A6DB 4N90D 4RGNC 4Y4HB 3OJ2C 1QFWH 1JGVL 1KPUB 5F6HJ 1HZHL 1JPSH 5IHUL 5JXEC 1HXMA 4JCMA 4X6BA 5TE4L 2YC1A 5IF0A 3ZDYE 1XAUA 4S1RH 4M03A 1S9KC 5JNYA 1NC4B 4MDJB 4WO4D 3TM6A 1Y0LA 2DQEH 4YDIL 4MNGB 1X5ZA 4R26L 4XP4H 5DUPL 3O3BA 3NN8A 1OWRM 3V6FA 4WI5A 3EYQC 1JV5A 2P8PB 4LHQB 3FB5B 3HZVA 1TCRA 2OTUA 5D5MA 2A6JB 4XP9L 1Z5LB 5HYQA 3EDJA 1OAZH 4F7TA 4ODBD 1RIHL 1MAML 4MJIB 3SN6N 4KMQA 4HK3J 4UIMB 5CSGA 1R0AH 1GZPA 2FGWH 3CZJA 4IOFD 2VLRA 2EIBA 2VXQH 2MPAH 4NUGH 1S5HA 4O51B 3IDYB 1YJDL 2ZUWA 3B43A 4J3XA 2VL5B 5D7IF 3OXSA 2ITCA 1NC2D 1WZ1L 2AXFB 4ISVB 4LASL 1JL8A 2W9DL 1T6WA 3QDAA 4GRMA 2FLRT 3GBNH 4KMTL 5L9DH 1HH9A 4PJBF 1VADB 3HG1D 2WUBH 1ZLWK 3WSQL 2JK5B 5JQ6H 2H32A 2QSVA 1A1NA 5IHBA 2F15A 4Y1AD 1MCHA 2ZSVA 4UT9H 4XGZB 4GXVH 3SKOB 3HUJE 1FHGA 2R29L 1DVFD 3BN3B 2R0WL 4HUWB 3O4OC 1XCQB 3LKOB 1OD9A 3VXQB 5BMFL 1CD8A 2APFA 5D1XC 3D9AH 4M9PA 4LLUB 4QGTA 1IQDA 2F5AL 1LVEA 1ACZA 1EMTL 3U7AA 3CCHA 2UWEF 4EDWH 1BFOB 4Y16A 1O7SA 2DQGH 3I6KA 4D0BA 4JRYB 2GJJA 3BIKA 2H45A 2NY2C 1J0IA 2YD9A 4HIIA 4L9LB 3UAJD 4MHHG 3MJ7A 1FCCA 1ZGLP 5CKGA 1FNLA 3BN9C 4P2OA 2J88H 5SWZE 2DKUA 4X6CE 3VA2C 5C08B 5TE7H 1AXSB 3DGGB 1FFPA 4LCYA 1MCJA 1OP3H 1QQDA 2WQ8A 4X7CC 3ZO0A 5E24E 4ELKB 1QLRB 3HCVB 5I8CB 2XWBB 4BZ2L 4CDGC 4XWOD 3CDCA 5BVPL 1Q8MA 1ZLSH 2DAVA 1T1YB 5KAQF 4FFVD 4U6YB 1T2QH 4E9LA 4OFDA 2FBJH 5E08L 1YECH 5DD6A 1NGWB 5TQ2L 3G6DL 1JZ3A 3FKUS 2VXVL 4UB0H 4H0IA 1MFAH 1UVQA 3DRQA 3EFDH 5IVZB 5DHVH 3MRHA 3JWDL 4MA1C 2J6EA 1AQKL 4ZO6A 3NCEB 4NRZA 1QBAA 4YPGA 2OZ4L 2IH3A 4PJIA 1JGLH 1ORSA 1HKLH 4RMUA 4M1DH 4HHAB 1BFVH 5BXFB 3H6JA 3I85A 3D85A 2V2WA 4R6UA 5LWYH 4DKEH 3INUL 1E4XL 1CDGA 3MRMB 5CZXD 3MCLH 1NFDB 3TCLA 4A2MA 1HILA 5HI3C 5T1DH 4J3OC 1MIEH 4NRYB 5LVEA 1N6VA 5CINH 1E0OB 4YDVB 1J0ZA 2Z8VC 1NAKH 4R4ND 4M7LL 4Q58C 5J6HA 4R7NA 12E8H 4YGAB 1QD0A 1MCDA 2KL6A 4P3DA 3QIBA 2FH6A 1UA6L 5F9JB 3IKKA 3WJJC 3CVHH 3WO4B 4ZFFB 2ZCKH 4D94A 4LFHD 2J4WH 4GAGL 4YFDB 1T5XB 4YBQC 4LSTL 1DANT 3LQAL 5F1IB 3TPUB 2VAJA 2ENYA 4M1CC 3HPLA 1JPST 2HT4C 2QADB 3C6LA 3O2DL 4PUBH 1WC7B 3T8XB 4Y2OA 4X80H 4ZO9A 2ZWLT 5E7BA 3EGSA 1T7ZA 4LARL 5AD0B 4JRXB 3HC0B 1I3UA 2X9XA 3R8QA 4B5EA 1DN2A 2FATH 4CVXB 3B3IA 2CRMA 1DQTA 1J5OL 2UUDK 3SY0A 3I02B 5GGTH 4OIIL 5FOBA 1LO0H 1UWGL 1YYLH 2WUCH 5FUZL 4BZ1H 2VSDA 3D2UB 4HDIA 1IGJA 3B2VH 1F3DH 3KDMB 3T2QA 1M71B 3GHEL 3DXAD 3TNNA 3HMXH 5K33A 5CJXC 2FJFA 4FABL 1IARB 1EFXD 3KG5A 5C09B 1RURH 5IR1B 4ODXA 4HKXA 2HVJB 3O4OB 4S2SA 2DI9A 2DJ4A 4BUHA 2DQFB 5I73C 2Q7NA 3O8XA 3BGMB 5J56B 2V2XA 3CFEB 1I1AD 4O2FA 1CI5A 2EYTB 3SKMB 1FV1A 5FM8A 4XXDA 1KPRA 2NY2B 2QHRH 1EUTA 1SEQH 3MLTB 1AP2B 4MAUH 2Z31B 5IMLB 3PJSB 2JCCB 3IJSA 3UTSA 2EDJA 3FT2B 1U3ZA 5E5MB 5H2BA 4Q9QH 5KVFH 1MPAL 1N4XL 1ZGLA 3C60B 1N2RB 5DQ9B 4L8SB 1EEYB 3B9KC 3CXHJ 4OCWL 3RA7H 4WI2A 5GSVB 1LGVA 5DRXA 5E6ZA 4TVPD 4A6YL 1VACB 4BFBD 5D6DC 4K3GA 2B4CH 5E94A 3E2HC 4DTGL 3HAEG 5IFAH 5JTWA 4WV1A 3KWWB 3RWEA 5JHDA 5CJQH 3VDCA 4NJAH 3HI6L 3TYFA 1KCRL 4MA1B 3RRQA 2BX5A 3LDBB 5TDPA 1H3XA 3GB7B 3GSNH 5E6IC 4DJMA 5FHAH 3TA3C 4MX7A 1ZA6B 3KYNB 4XI5D 3SDCD 3G6JB 5GGUB 2X4SB 3DI2B 2H41A 1BM3H 1EHNA 5AZ2H 3F7YB 3EOBB 4BUGA 2NY7L 3P0VH 3P2TA 2Z91A 1UFUA 4WIQA 5J11C 3QI9D 1CLCA 4XAKD 4U2YA 4BKLA 2VLKD 3KNBB 2WP3O 3VXMB 4FZEH 3OKOB 4Y5VC 2D31A 2CDEA 4OT1H 2BNRA 4MJ2A 4J2XA 2DLFL 1UQSB 3VH8A 5KZCD 2WWKT 5EUKB 1FO0L 3OJVC 4OLVL 1JNNH 2LTQB 2KUTA 2HTKD 3OAYK 4KRPD 3NZ8A 1QNZL 1S7QA 3HTLX 4APQA 5CS7A 4OCSH 1OB1B 1BJ8A 2A77L 2Q3AA 4KJPC 3WHXB 2Y07L 3KPPA 1A3LH 1HEZB 3K8KA 4PRBB 5F7MC 3VW3H 3Q5OA 1AGBB 3FFCA 2D0FA 2WQRA 5D2LF 4R3SA 1PG7L 3IDJA 3HC3L 5IW1B 2XQBH 3TV3H 3DMMD 3SDAC 4U1KB 1TFHA 1DJSA 4LLYB 3NFNB 2RBLA 1FFQA 1JVKA 1TLKA 1F58L 3STZA 3CFCL 4ZXBA 5I76A 1JGEB 1DBJL 3S7GA 4KROC 3SBWC 3RUGB 1PW3A 1ZT7B 2F54B 3EDEA 1P84K 4KUZH 4JN1H 4AL8H 1FORH 3HFML 4JQXA 3REWA 3VXOA 4IHOB 2FL5B 3S88H 3VRLF 1XGTB 5ANME 3QDGA 2YBRA 3RFZC 1FYTA 4XP6L 4QHNA 3CFJB 2R8SL 1Q1JL 3GIZH 4KKCC 1JTTA 4GG6B 2X4PB 4TNVF 2CO6B 4Q6YA 4A6YB 4RX4D 5I75C 1NFIA 2EXWC 3UCRA 3UJIL 3LH2L 2VABB 2H9GB 3R1GH 5C2BH 1R5VA 1IQWL 1XIWC 1S7XA 4OF0A 4G7VL 1T1ZA 3PUCA 4KXZH 3BYTA 2IAMB 4QNPE 3MUY1 3O9WA 2HYMA 4JKLA 5JR1L 4LK4A 4PREB 4HIEA 3QIUC 3U1SL 1GIGL 2BY2A 2SEBB 4BELD 1OAXH 4WTWA 1UJTA 2AV1A 1EGJH 2QSCL 4XPGL 3HMXA 3QA3A 1VPOH 1BQLH 4DZBA 2P7TB 3MFGB 4HLZH 5JIPA 3GGWB 4WFHD 1LO2H 4GMSL 2VL4A 2EZ0D 3ARQA 3RVXC 1Q0YL 3ILQD 3DUUA 1T21B 5TDOB 2HFFB 4LSPL 1MI5E 2CKBH 2YPLA 3VXRE 1IC5H 3H9HB 4PRPE 4LPWA 3ARZA 4KGJA 3E2HB 1KELH 1OY3B 5SWSD 3LS4H 4CN1A 2GY7B 2AJUL 5IROC 3QBTB 4V1DB 5ITBH 2ID5A 2BXZA 1FO0B 1WEJL 4TQEH 3VFUB 4XNYL 1TCMA 3EYUH 1MWAL 1XT5A 1S9YB 3BEVA 4LKCA 5K9JH 2VSCA 3X12B 5E5UB 3QB7C 1T1XB 4Z95H 4F3FB 3JUYA 4XBEH 1MCQA 3V0VB 5T3XE 5DVOA 3IS1X 4MAYC 4GKSA 4NJ9H 3NCFB 1AIFB 3UDWC 2OTWB 4H1LG 4XNQA 2P5WB 3ZSSA 3QIWB 3U0WL 5JW4R 3TBVA 3VXUA 3GSRB 3PABB 1AE6L 5FGCB 5TPWH 5DMGD 1J11A 3K3QA 3IFPB 5SV4A 1R3JA 4XP5L 3ZDZE 5E2WL 2BOCA 5EO0A 3A67L 3CAFA 4KUCF 3GMNB 1MCFA 3RWCA 1J0YA 1I1FA 4WO4A 1CVSC 3UP1A 5CAYB 1LQSR 3S97C 2PCPB 3PE9A 3PWPE 3Q6GH 4P48A 3SGEH 2CD0A 3VFTA 5I1IH 4XMPH 2Z92B 3QCVL 4BYHA 3NIGF 3KR3H 5IEHB 4YWGL 1LNUB 3CLEH 3EZ8A 4FQ2L 5D7JC 3MJ9H 2DIAA 4URTB 2VLJB 2PYED 5ID1B 1RUML 1NMBH 4JZJB 4AIXA 3QXAA 4PY7B 2JJWA 2D7NA 1KUMA 4LVNB 4QWWD 4R0LA 3F12B 3GJEA 3P9MA 4FXGA 4BSJA 4DUXA 4WY7L 1RZGB 3HR5B 4HFUH 2R2HB 4MXQD 4R90H 4PJDB 1FFOB 2GQHA 1NC2A 2RB8A 4E0RA 3TP4A 4MB3A 4I4WB 3VWJD 3OGOE 5I30L 2EYRB 5E8DL 2NX5D 3HG1A 1T1WA 4XNUL 1XIWB 4JFFD 4FFWC 3FQWA 4WEUD 4Y1AA 3WD5L 4KTEH 4K9EC 3EO0A 4JKPH 1VB9A 5DC4B 1CICD 1S9VB 2D03L 3GFUA 3IU3A 3QIUB 3HNSL 5KSVB 1L6ZA 1DVFA 3IGAA 4DCQB 2AJXL 4JR9L 4NHUB 4DGVH 4N0FA 1OGAE 4TVPH 1M7IA 5GZND 1MNUH 5SX4H 3UTTB 1PEZA 4WWKD 1FRGH 3JV6A 3D87B 4ONGL 3V79C 3MODL 4C83B 4JVWA 2EDBA