4NC1C

Crystal structure of tcda-a2 bound to a20.1 vhh and a26.8 vhh
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
QVQLVESGGGLAQAGGSLRLSCAASGRTFSMDPMAWFRQPPGKEREFVAAGSSTGRTTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAAPYGANWYRDEYAYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell wall-binding repeat protein
publication title Structural Basis for Antibody Recognition in the Receptor-binding Domains of Toxins A and B from Clostridium difficile.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Immune system
total genus 32
structure length 123
sequence length 123
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nc1C00
2UY6A 3MLVL 4ZUVA 2QADB 3QEQB 2VLJE 3MRQB 4CVWA 5HYJD 2BC4B 2OTPA 4LU5H 3LQZA 3MRDA 2YPLA 1IC7L 4PJBF 4P46B 4XBEL 1KLGB 1LHZA 2AJYH 3D85A 3L3IB 3QO0B 1FCGA 1CFQB 1JMZA 3BPCA 1DFBH 3GSOB 4LSQL 4WUUA 5FUCC 5EUOA 4OGAD 4Q9RH 2BVQA 5DD1H 1ZA3B 1IGCL 2BOCA 4XP6L 4DEPC 4LLYA 4OTXH 4HBCH 3W5MA 4FFZL 4OFIA 2DOCA 2WIMA 4L9LC 2CQVA 2A77L 1JPGB 1T04A 4P2RD 2ZOKB 2W65B 1XF5A 2A6KA 4J8RB 5I17A 2ARJA 3VXOA 3U82B 4Z7WE 4C4KO 2X1WL 5HHMB 1BX2A 1GH7A 4NN7C 2MQ3A 4NO3B 2FB4H 5KAQG 3AXLA 3FQUB 1MJ7L 2XFXA 5T3ZH 1EAJA 2E7BA 3VRLE 4NWUL 2A1WL 5ESVB 4MJ6B 1IAIL 2XKUA 5HXMA 4XPFH 2UWEB 1KCLA 2V7NA 5C0GA 2BVEA 1JNHA 2QEJA 4JLRB 5F88B 3IDIB 1P9MA 3MCLL 1NAMB 4WCYL 5GPRA 2D0HA 3D3VD 1YEKH 3HPJB 4BZ2L 2NY4D 3RA7L 2BY0A 3RZWA 1R3IL 2DMCA 4GLRH 3ZT6A 5CD3A 1CDGA 5DS8B 3GSNL 4NBYB 1M71A 4KVCL 1MHCA 1T3FA 3RVVC 1A4JA 4L1DA 3VD9A 4XNUH 2NXZB 4A2MA 3ULVC 3MQIA 3MBXL 1BIIA 1CFNA 3OX8B 4TRPH 3F12A 2ADGB 4PJDF 2J3SA 4XMLH 2CDGB 1GL4B 3H7BB 3OG4B 3KPRB 1EHLL 2A6DA 2X4QA 3PIQA 3VXPB 1QBMH 1U3HB 1Z0NA 2APFA 3IKCA 4HIXH 1NMBL 1X3DA 2GJ6B 3GO1L 3SDXF 1HCFX 1OB1B 3TH4T 3WFBL 2DQCH 5C0ND 1GGTA 1QFHA 1NEZB 3P9LB 2ZUXA 1SY6A 4JFDE 4NN6C 5IHBA 3K0WA 3GJEB 2I5YH 2FX7L 1OGTA 1FN4B 1MNUH 2NR6C 3I3EA 4UT6H 4EVNA 3C60D 1OW0A 5TE7H 1DDHA 3CFBB 1LP9F 2QQKH 1LMKA 5MI0B 3HLAB 1UEMA 3UO1L 4Z7UE 2Z91B 1Q9KA 3X3FH 4Z76A 3SKJH 3NZHH 3A6BL 4ODSH 5E9DA 3KXFB 5F7DB 4OLZH 3FQXB 4I2XA 3VMPA 4JDZA 3MBEC 4NQEE 1I3VA 4FHBD 1DBJH 1S9KC 4N1EA 5T3ZD 1RK0B 1A6AA 5DWUH 3FFCD 3EYSH 4P2RA 5I18H 4LRIA 4MD4B 5I9QC 3PWUB 1T7XA 4LK4A 1B6UA 3HS0B 5IT2L 2VB5A 4NQCB 4H1LA 4NDMA 1KUMA 3MNZA 2W0LA 5DD6B 3D39E 4PJFA 3NIFE 4E42B 3MJ6A 4RBPK 5DJ2A 4NCC1 5SWSD 3HMXL 1FQ9C 2VE6A 2ICEB 1CZ8L 4LF3B 1YEHL 2MSPA 3KYNB 4KK8C 4AK1A 4ELMA 3N50A 5C0DB 2W91A 5SX4I 3OJMB 3RTQB 5D6DA 4YR6A 4NSKA 3BQUD 1DLHA 1RURH 4AQ1B 1DUZA 3PHSA 3ZZ1A 5C3TA 3MUGB 3HCVA 1FO0H 2AABH 2OS7A 4IOIB 5DD0H 5DHVB 4N90D 5MEPB 4D0BA 5BXFA 5IMKB 2FDBP 3QQ4B 5KANI 3IJYB 4GKZA 2AJZB 2DLFH 2WSKA 1V7NL 1NBYB 3PP4H 4X98B 1CBVH 5ELIA 2AQ3A 5ID1B 5F7WC 3ULVH 2BOBA 4OQTH 4JANA 1C5CL 2ZCLL 3UZVB 1D5ZA 1A3LL 2ICES 2G2RA 1BM3H 2BVTA 4MD5A 3CSPA 3O4LE 1AP2A 4Z0BH 2A83A 5C09A 4JO2L 3OKOA 3VXQB 1YY8B 4L8CA 2JJTA 1DQMH 1AD0B 5I16B 1G9MC 5D1QA 4QO1A 5I1CL 1CICB 1EAPB 4MD0B 3N1FC 2CH8A 2XN9E 2CD0A 1CT8A 5IF0B 4A2LA 3MREA 3BKMH 1UM5H 1UENA 1MQKH 4MQTB 4PV8A 4F3FA 2XPGA 2VLJD 1ZHKA 4TULL 4G6JH 3ZHKA 2W0PA 1H5BA 4WFGD 4PRBB 2ORBH 4ETQA 4YQXL 5IVZA 3HAEH 3BKCH 3D0VA 1WCQA 1UGNA 1YJDL 4TNWF 2J8OA 4CN1A 3FFCA 1A5FH 4WDIA 1WITA 1U8HB 5EZJB 2AVGA 2VN4A 4ENEC 1OT2A 2NW2B 1HHKB 2OMNA 4P99A 4XGZB 1TLKA 2OJZL 3QNYA 3T77A 4XC1H 3DRQA 1X5IA 4M7JH 2VO5A 3C9NA 4NQVB 4GBXC 4GKNA 4NFBA 4OLYH 2OK0L 5SWSA 5IV2A 3B43A 2PO6B 4M61B 3D87B 2VMFA 3Q5OA 4YHMH 4Y89A 4JQVC 3AB0B 1AD9A 1CVSC 2ESVB 3IXTB 4Y19B 1WFNA 4NO2A 2RJMA 4HAFA 4MXWL 1EBPA 3QFJE 4G7YH 3ULVD 2JJSA 4FTVD 1QFUL 4HKXA 2CRYA 1ADQH 4RZCB 1J1OH 5CJBA 4RWHA 2Q6WA 4R4FL 4H8WL 4BKLA 3NACL 5ITFA 2D7NA 4L9DA 4QRQB 3GHBL 4H26B 4P3CL 2ZPKH 2VDQL 3HE7C 2PYED 3L3OB 1UM6H 3ZT7A 3MOBH 2LU4A 5KG9B 1NLBH 3L1OL 2FYYB 4JN2A 4U3HA 4PJHA 2AK1H 1QRNE 4XMPL 3WNPA 3SGDI 3BH8A 1CL7L 1FFNA 3WXWL 1NANI 1N3NB 1QLEH 3OR6B 4K9EC 2EDXA 4LLMA 2QLVB 4LVHC 4S1DC 4AEIH 5IG7B 1P2CA 4MNQD 2WWKT 3HB3C 3MBED 2MPAL 4EUPH 3BAEH 1GZPA 3IFOB 2VLJA 1CLOH 5D70L 4LDOB 4UB0H 3MGAA 3VFUA 1Z3GL 1AHWC 1X9QA 2E7CA 1SJXA 5D4QA 3OKLA 2D7PA 4CMHB 1TJHL 4RSVA 1I3RB 1KPUB 2LU7A 1CXFA 4NM4L 4ZTPL 5L7XL 5I8CB 2ZUTA 4Z8FH 2FJFA 1Q9WB 1R3LA 3KHQA 3EYVB 3EOYG 2VOTA 3B2VH 2FR4A 3MZTA 5E08L 3QXDB 1J7VR 1SY6L 4X7SH 4FNLH 3MFGB 2NY6B 3VA6A 4P23B 5CWSB 3I3BA 1RUPL 3L9RB 4HFWA 4HXBH 4LLDA 2OCFD 1LO4H 1MUJB 3GIVB 1QR1A 3ZKQD 2WLZA 4Z7WA 2HRPH 3HFMH 4D0DB 4OD2B 5GHWH 4ZNCD 1T7YA 2V7HB 1G7PA 3D39D 4QRRE 3HC0B 4FTVA 4XNXL 5HYSB 4XNQB 5D6CA 3CXDL 2ERJB 4PTUA 1P1ZA 3MLSL 5ERWB 43C9A 4P5MB 4AIXA 3CU7A 3S37H 3SDYH 3OKDA 3P2TA 3IDJA 3F7QA 3WIIL 4YHLH 1NBVL 3P0VH 1LDPL 5FUZH 2PYEA 3QIWA 3JTTB 3ARZA 4JPIB 5CSBA 5GSRA 3MGTB 4XCEB 4F7PA 1UQSA 1QYGL 1CCZA 3I9GL 4Z7QE 4J6RL 2V2TA 4YBQD 3GSXA 3QIBB 1GZQB 4E41D 2DL2A 4DGVL 1U42A 1EK3A 3V0AC 5H2BA 2CLZA 3T2QA 1AH1A 2HJFA 3AUVA 3HG1B 4IRJB 1JPSH 4MB4A 4J3XA 4OIIH 2EO9A 4K9EH 4MNQA 4JVWA 3MBEA 1I7ZA 4Y7MA 1CGUA 4H1LG 1R3JA 4HUVA 4PJBA 3WJLC 1JGDA 5F8RC 5KVGL 3U30C 4F57L 5GRUH 1UJTA 3HZKA 1T89C 2Y72A 2OI9B 1T6WA 3MLUL 3SEPA 2Z31D 1QKZL 3Q5TA 1REIA 4X8JA 5TFSH 3GMOB 2FATL 4JN1L 3IF1A 4ZS7H 4JZOA 4QRPB 2IGFH 3X11A 1VKXB 1KG0A 1OSPL 3L3DB 2FHFA 1N0XL 2YXMA 1YEEL 1MFEL 3WEXA 1NLDH 3AVEA 3HR5A 1HDMB 4WNQA 3RVTC 1ND0B 4KHXH 1M4KA 3CH1A 2FLBT 4JGJA 2Q86B 1ZEAH 3MNWA 1JWSA 1Y18A 3MOQA 3BD4A 4PJXF 4BQBA 4G43A 5T3XL 3EUUA 2FBOJ 4OQ1A 4U1MA 3R8QA 4PJEE 2JB6A 3SE8H 1B4RA 5DJZA 3LB6C 3TN0C 5GGSY 1XF1A 5JXEC 1D5MA 1KLUB 1J5OH 3ARBC 3C8HA 3ALXA 3I6LE 4MVBD 4Q0XL 1HINH 3KPOA 3M17B 2XQBH 3E2HB 4EOWL 1WBZA 2E6PA 5EBMB 3BI9X 3SKNA 2X4PA 1P5UA 2GJZB 1BP3B 4PJ5A 2OTWA 4PS4L 4P3DA 1HIMH 5C0BB 4HIHB 3W39B 1FLTX 4MAUH 4HKZB 5A16B 5DD3H 3B6SB 3W9DA 3QFJD 4N0UB 2BNUB 3DXAB 1KN2L 4EUPA 2X4RA 1G7LB 4S1DD 5I8OL 4U6TA 2WM0A 1MEXL 4G8EA 3V0VB 3D18B 2K1MA 1PKQB 4E41A 5EOTA 3G5ZB 4TUKL 1J18A 5IMMB 3CGTA 1WZ1L 4YHYB 5C6TL 2LAGB 4MWFA 4PJDA 4DGIL 4M5YL 2R2HB 4D9QE 3MV7E 3SDXA 1EDQA 2XWJB 4JFZH 1FVEB 3BE1L 3OHXB 1NC2A 5BQ7A 1A6PA 3UMTA 1FRGH 3FT3A 4XCYB 4M6AA 3FO0L 4Q9BA 3DBXB 2AP2A 3MODL 2NCMA 3G5XB 1N64H 4GW1A 2H32A 1WTLA 3GNML 1YDPB 3VJ6A 1VEOA 1YEGL 5KZCB 4N8CH 3RY4A 5IQ7L 3G5YB 1D6VH 2ZZUT 3CFKB 3HHRB 2IAMB 4GBXA 3U0WL 5HI5C 1S7TA 4LAQL 2EDHA 1QR4A 4NKQB 5TDNA 3LKNB 3HUJA 4P4RA 4W6XB 3GK8L 4KU1A 3WFDH 5JQHC 1D5BA 4JQVA 1Z9SA 4P4KA 3TIDB 5AAWA 1BGXL 1MCOH 3HE6D 5INDB 4XCCL 1D5IH 1XZ0A 3D25A 3BESR 3LCYA 2OL3L 3MJ7B 1FFPA 4LVNC 1X5ZA 4FMKA 4NKMB 3ZKNC 1I1AB 4MA3B 4PGEB 3NIGF 4F7EB 2H2PC 3UROR 1WIPA 3Q3GA 2C3WA 3ZE2E 5DMIH 4H25B 5IMLB 2XWTB 1DBKL 1GGBH 5DRNB 3HE7A 5JR1L 1KCSH 4Q97A 2X4OB 2DMBA 3QDMB 4RRPA 4CVXA 4XCFH 1NBZB 4I5BA 4YDIH 4O2EA 1FDLH 1MHPL 5CEXA 3KVQA 4HX1A 4NRZA 4NZUL 3PNWA 5IB4A 2P8LA 4LASL 4CW1B 2X9WA 1XF3B 3LEYH 5AG8A 3AREB 3CVIL 4KGLA 3JV4A 4K55A 4BFGA 1CFTB 3KWWA 3K4AA 4KAQL 3SO5A 1YEJL 2EDOA 4HQQL 4NO5B 5KSUA 4PTTB 5FM4A 5F7NC 5DJYA 5FB8A 3KJ4C 3MA7B 3BFOA 1F4AA 2B1HL 3BZDA 2IQAB 4DGYL 1JFQH 5EO9B 4KY1L 4X0KA 1JYVA 1DBMH 3CUPA 5CEZE 4N0FB 3I02B 2GT9B 5ICXB 1T0NB 3GM8A 3QPXH 3ZE1F 1WBYB 3P4NA 3L5IA 4UUJB 4OLUL 3B8SA 2V6HA 3WMSA 5IW6B 4HIJB 1I8MA 3TWCH 1V3KA 3C09C 3GI9H 4GW5B 2DD8L 5BS0E 4PJIF 3SQOL 5T1KB 4XHQA 3TCLA 3TNMA 4YAQB 4E5XA 3LB6D 3TN0D 1NJ9B 2XOTA 3KYMA 3ARBD 1IC7H 3Q48A 1AQDB 4UILL 5C07D 2Y5TA 3V8OA 2X5PA 1DBAL 3GMLA 3VXNA 4YC2C 1BMGA 2FL5A 2AEWA 5FYJD 3CC5A 4L8SB 3QIUC 2IADB 4NZTL 5HVHC 4FFZH 3PGCB 1JF5A 5I71B 2EDLA 5JDSB 5DTFB 2HKHH 3OJDA 2ZKHH 4HMEA 3HZVA 4ZS6C 1NCNA 2Y07L 1UA6L 5HTSA 5CBAA 4LNRB 3F5WB 5CZXC 5JMRA 4JFEA 5C2BL 4GAYA 2DI8A 3DV6B 5F1IA 2EDQA 1U8NB 2EYSA 1JK8B 4X99A 4FXKB 2P5WE 3SGKC 3A0OA 1I7TB 4EDXA 3FOLB 2JIXB 1FNEB 3WJLA 5EU6B 5DJ0B 4FQXC 5B3JE 3RDTC 5BVPH 2LTQC 1T89A 4OD3L 3KPMA 1Y6NR 1S9WB 1LO2L 5BRZD 5HHPA 1U8KB 3PDDA 3RA7H 4QXWA 3MRIB 5ANMA 5HI5D 1K4DA 4O2FA 4DUVA 4XPTL 3TBSA 1T2JA 4IS6B 4L3AA 4MX7A 4OCWL 4JY6A 1ED3B 3RRQA 4D9QD 5JA9A 2B8OT 5ITBL 4J3UA 3MV7D 2C1OB 1MCRA 3BEVB 3NFSH 2PUQT 1G9ML 2JLLA 4M3KB 3DX6A 1BVLA 5ADPH 1QSEE 4UTAH 5DZLA 4HK0B 4I0KA 3FRUB 3QI9C 3ZKND 4KK5C 4PFEA 1IARB 3OZ9H 3TN0A 4LSRH 4NC1C 3WFBH 2H2PD 5JXEA 5ESQA 4Q9CA 3W0WA 2EYRB 3ARBA 2X05A 5EBWB 5C07A 5CEYA 5IKCA 1VFOA 1PLGH 1RMFL 3UBXI 4AH2A 5C7XH 2EIBA 2A6IA 1KIQA 1PKOA 3GB7B 1EUTA 4JB9L 5CEZH 2QQNL 4X6DE 5C9JA 3RIFK 4MXQD 5F71A 4R97C 4AT6A 3WLBA 5CZVL 4EUPG 5EZIH 4MJIE 1QVOA 2NY1B 5LXGH 2WIIB 3MRJA 1QFWI 1ZHBB 5DJ8B 3JWDL 3B3IB 2WW8A 4UDTA 1A1OB 2N7AA 3RL1A 1T7WA 1CD1B 5ESAB 2XICA 3FO1B 2P1YA 4R96B 5B38A 3SDCC 3QZWB 2BXYA 4YDKL 5JMOC 2VWEE 3KPQB 4X7TB 3SKMB 4PRDA 5TGBB 4JCMA 4NQXB 1RIVL 4PYHA 4YHPB 1HHGB 3JXAA 2EH8H 3K4DA 4PY8I 4EJ1C 3BT2H 2B0SH 4PPTA 3SCMB 3O6FB 5FCUL 2CDEA 1YEIL 2XTJE 5HYFA 3HMXH 2QTEA 1CZ8H 5IR1A 1XH3B 3MCKA 1CFSB 3S88L 1IC4H 1YEHH 4L3CB 2EDEA 5FA3A 2L4OA 1MIEH 1RV6X 5LGJA 5GRWA 2HVJB 5CIPA 3BJ91 3OR7A 3QO1A 4Q58C 3ZTNL 1YMME 3O3EB 2EC9T 5BRZA 3DV4B 1FBIH 4M1DH 3NIDE 4Y16D 5E2JA 2H9GA 5DRWB 2BNQD 2OQJB 3BDXA 5DXWA 1SJHA 2EECA 2NZIA 1FYTA 1GGYA 1A22B 2HN7A 3P11H 3O2WL 4YFDB 5HHVL 2V17H 4F15B 3G04A 5AD0B 5CCKL 4KKCC 3GI8H 2CUMA 4YO0B 3MLTA 3MRKB 1L9NA 4S1RL 4X5XB 3F58L 12E8H 1NFDA 3STLB 3RPKA 2BJMH 3V52H 3U7YH 5CEZD 5EO0B 2ED9A 3CXHJ 3DX8B 2PETA 1WTGT 3DX7A 1DCLA 3BP7A 1WK0A 2R1WB 1JWMB 2C3XA 4JFYA 4R0LC 4CU7A 4QHMA 4RRPG 4JFOA 1SQ2N 2BERA 1UM4L 2P5EB 3WO4B 4WEBL 4HUUB 3U1SH 4PGCB 1F4XL 4GMTH 5FGBC 1S5HA 3BZFA 3EJYC 5DJ6A 3DUHA 2VKXA 2X89A 1TCMA 4YQXH 2J8UF 3QR2A 4ZS6D 2RFXB 1IBGL 4O51A 5CGYC 3BPNC 5CZXD 1WF5A 1YJDH 1PD6A 5CP7A 3BP6A 1P84J 2JKXA 2R56H 1Q0YH 1OF2B 5I75C 3BRGC 2BHYA 1IM9D 3T65A 4OCNC 5L88H 3UJIL 3QA3A 4TSBL 4BJLA 3R8BB 3NGBB 2YMXL 3OGCA 4FQXD 3V0WH 2COQA 1ZKAA 1JGLL 1MF2H 3SJVE 4QXTB 4QNPE 1NH6A 4FFYL 3IDXL 1B0GA 1B4JL 1KTLB 4PY8J 1MELA 4U6HA 4UOW1 3WS3A 4XAKE 4HJJH 4L8BA 5CGMA 2VDKH 5LVEA 2VL5A 1ORQB 5I73B 3VXRB 5E8PB 4Y4FC 2BNQA 4U3XA 2HTLC 1S9XA 2WBJD 4F37K 2AXFA 5J6GA 1XCQA 1DLFH 2P5WD 3DUSB 2CJUL 4H8WH 4R4FH 3T2PA 3NACH 4LCCC 3T1FA 3GHBH 3CFJB 3QI9D 2GSIA 4D3CL 5L0QC 1WWCA 5I66B 4KDWA 1MJ8L 4XPAH 2DQTH 1S7QA 1RVFH 2Q1EA 3LN4A 4PJAF 3V7AG 3I3DA 3TJEL 4RDQF 4HKJB 2RAMA 3GDBA 1H3XA 1VEPA 1UKQA 3AC0A 1IGYA 4KRPC 4BUHA 2ZJSH 4L4TE 5F7HA 3HKFA 5DHYB 1KBGH 5AZ2L 3QIUA 2FBJL 4FP8L 1BFVL 3BISA 3S35L 4MNGE 4XCNA 4A6YL 5I15L 3SDCD 5IM7B 5I1GL 3HC4H 4OZGF 3QUMB 1JGEA 2ICWI 3T3MF 1A7PH 4P57A 3FCTA 2FHCA 1P7QD 3R0MA 2MHAA 4I18A 4OGZA 4DW2L 5D5ME 2IG2H 2D9CA 3LKQA 1ES0A 4FQ2L 4ZTPH 1K8IA 3T0EC 1NCAL 3ZDYE 5L7XH 4RA0C 3RWHA 2F5AL 5TQ0H 4K3JL 3WXVH 5TQ2H 3SGKA 3QDGE 4MJID 1Q1JL 5AYUL 4XX1E 3ARYA 2GK2A 5DQJB 3RDTA 5FYLD 5A3IC 2BNRD 4U1HA 3F62A 4ALAL 5GGTL 4X9FA 4IIQA 5JNYB 2W0FA 1N2RA 2FHBA 3PL6C 2YUXA 4HC1A 4YIQB 3D2UB 1J8KA 1A7NL 2H1PH 3IYLW 4JO1H 5GRVK 4JRYB 1CGSH 2IBZX 1ZTXH 4XVSL 1OP9A 1PJ9A 2VZVA 5HD8C 1X4ZA 4QT5B 1GIGH 5KVDH 2XTJD 5D1ZA 2R8SH 1UADC 1AGBA 3FQNB 3KLSA 4M6OL 3G6JB 4GAJL 2A74B 3O4OC 3QI9A 1W72H 1RULH 5J9PA 1NBVH 2F54E 1ZT1A 1T4KA 1YMMD 2FCBA 3L3KA 3I9GH 1G9NC 3WIFB 2VISB 5ALBL 1MIMH 3R06B 1FNSL 1V7MH 4PP1D 1MH5A 2XQYK 25C8L 4RAUB 3P9MB 1INQA 1TETL 4Y1AE 1YPZE 4I0PB 1FPTL 3EJYD 5JOFA 3JWNC 2VLME 3FB5B 3UP1A 4R4BA 4YXHL 5EZOH 4PJIA 3HA0A 3LRGA 1AI1H 4DKFL 1HH6A 2XA8L 4WHDA 2CDFA 1J1PL 5IJVA 5EO1A 4YXKH 2D03H 1HEZB 2R1YB 4AJ0A 1I1RA 4BH8A 3MA9L 1IGJA 2VH5H 1UVQB 4GAGL 2ADIA 3IFLH 5JLZA 1TCRB 4Z0XA 4MXVE 4WV1C 4PB9H 2VDLL 1XGYH 1MFEH 1IZKA 3QUXA 3PHOB 4ORGB 2KZ1B 1RHHA 1S7VA 1MVFA 4JJ5A 5K59E 1KT2A 4M6ML 4CMMA 3BO8B 1Z5LB 5EIIA 2ICWJ 3OKKB 4DN4H 3D0LB 4EXKA 1DBBH 2WLYA 4MCZB 1BVZA 4P0DA 4WHYH 2BNRA 5D7JB 1QPXA 4QYOA 5E5MA 2BY3A 2GI7A 4Y2OA 2HFTA 3LQAL 3QEGL 1BIHA 5HHOE 4Y4FD 2R0ZH 2P45B 1D6EB 1I9IL 1QD0A 1MCJA 2HTLD 2R1XB 3SY0A 3AROA 4XVTL 3TO4C 1T21A 3X3GH 1NL0L 4FQIH 5FO8B 1TTFA 1GGIL 3PV7A 3IFPB 1S9VB 3VMOA 1G7MB 1L6XA 1IKNC 3WUWB 5ISZA 1MRCH 1RK1A 4JG0H 4GRWE 4GRMB 1F4WL 3O9WA 3QUKB 4G9FE 3HR6A 4M1GL 2WBWB 5KVFH 3PP3H 3SJVD 1JHKH 4MA8L 5E0QA 5INCA 2FIKA 4I77L 4PS4H 5DD5L 1R5VA 4JKMA 5ICZB 1SJVA 2I60H 4XAKD 4R0LA 3QWOA 4KRPD 4LPTA 2ZUQC 4LARH 1BQHG 2K7PA 4O9HH 3T4AA 3EYQD 4OGXL 4KQ3H 3QT2A 3G6AB 3IKKA 5GGUA 1D5XB 1G9NH 2NX5B 5F7LB 5FDWA 3EJJX 1ZHLA 3PGDB 1RJZA 5FGBA 5TPWL 4XXCC 2AK4E 2R23B 1DJSA 4UINL 4OGYH 5GRYA 4ISVA 2Y4SA 2YD1A 4FZ8H 1R5IB 4LPXA 1U91A 3QNXA 4AYFA 4ZUVB 5E24E 1AFVL 1C12B 3VXMA 1CU4H 1U93B 4JDVA 4P2OC 1TQCB 3FO0H 3LQZB 1F2QA 3NA9L 3MRDB 3MODH 2YPLB 5F7EL 4ZNEA 3ZE0F 4O2CA 3RGVC 1IGFH 3KLHC 2XRAL 4L4TD 4NC0B 3BZEA 1FZJB 5JORA 5C1MB 4UV7H 4ZFOB 5A3ID 1A64A 3BPCB 5E6ID 4EQ2A 1KB5H 4YNYA 4WUUB 1EGJH 4G8FA 1Z9MA 2H6PA 3F8UB 2MMXA 2ZCKH 2BVQB 5I0ZA 2OXGA 1EFXD 3PL6D 3GK8H 3DVGA 2BOCB 1MCNA 2UZXB 1UXSA 4LLYB 4NN5C 1BGXH 2E8ZA 2W9DH 1T04B 1AGDA 2FO4A 4JJHA 5HD8D 1F6AB 4BUGA 4Y4FA 1XF5B 2CMRL 1JNNH 2ARJB 5I17B 2J88L 3VXOB 2O5ZL 1W72A 4ODTL 1BX2B 1YECH 3RKDC 3TV3H 1FGNH 3AXLB 4LCCA 4XI5C 3FT2A 1J8HD 1NQBA 1DBKH 4HLZH 4FXGA 4I4WA 4LFHG 3QG6A 2V7NB 3E1F1 5C0GB 5FDYA 1WWWX 3NAAL 3HZYA 2X9YA 5KOMC 3P0GB 5CJ8A 3L3HA 4XH2A 1IAIM 5T5NF 5BJTA 1QG3A 1BWMA 1ERNA 3GMRA 3S98A 4S1SL 4NQSA 4HD9A 1BLNA 2Q3AA 3QH3B 5CD3B 1ZT7A 1PVHA 5IWLC 3HI6L 4HT1L 4X7FC 1H8SA 1M71B 5JW3L 2I9LA 1MHCB 1T3FB 3WNMA 1R24A 4HC1L 1YEJH 1BIIB 3O3DA 4PJCE 4IJ3C 3F12B 3H9SE 1M05A 4DKEH 1IEAB 2IWGA 4G3YH 2X4QB 3PIQB 2CRZA 4GRWH 1RU9H 1UG9A 3HI1B 1HYRC 1P53A 2ARJQ 3T0EA 4EBQL 2W1NA 4XBGA 4BQCA 4LCIH 4JM4H 3LSOA 2DM3A 1KN4L 4Y1AD 3QUZC 1IEBB 3BXNA 5CILL 2BY2A 3K46A 1LO0L 4LSVH 4DVRL 1FIEA 4AEHH 1O7VA 3VFOA 4EVNB 1TJGL 1FH5L 1FSKC 3MJ8A 1U41A 3F7RA 3GSVA 3DX9A 2J8UA 1Q9KB 4Z76B 4KI5E 3V79C 2A6JA 1FGVH 2IALA 2IPUK 2J4WL 3L5HA 4I2XB 3WS6C 4JDZB 2GK0B 1YNLL 4D8PB 3C2AL 4HFUL 3CZJA 4DZ8A 4GFTB 4OV5A 1A6AB 5KS9B 1RUQH 4P2RB 1WIUA 2KKQA 2BFVL 4WI3A 4JO3L 4NQDA 2A9NH 3VFRA 3P4OA 3ARFC 4KH2A 3QCUL 4XP4L 5FK9B 3D5OF 4NDMB 3AY4C 3MNZB 4K71B 5F6HI 1IAKA 5GZOD 2I07B 5A2FA 5LBSH 1J8HA 2ID5A 4KMTH 5DJ2B 2JELL 1XR8A 3THMH 4HXAL 4APQC 4NZJA 3MLWH 5DDHA 4RGMB 5I76A 5IB5A 1VB9A 4ELMB 1WSST 3NCJH 4F8TA 3V9FA 4ZDHB 3INUH 4RQQA 4YR6B 4M1CC 4NSKB 1DLHB 2VDRH 5DEGB 3S3PA 3U0TA 4JFFA 3D3VB 3MX0A 5FYKL 4ZFZA 2NY4B 3SBWC 1FVCA 4EXPX 4PLNC 1SBSL 5KVMC 5DC9B 4G9FD 5DK0A 2ITCA 1WAAF 1JHLL 1IC1A 5BXFB 3EDFA 4QTHA 1UT9A 4R26L 4GKZB 4P2OD 5BOZG 1VGEL 4QXUL 4IRSA 5FGRA 1QA9A 4JPVH 4PJAA 3RGVD 1YNKH 2Q20A 5DFVD 5IVXE 3O6MH 3OJ2C 1D5ZB 4MD5B 2R0LL 3WE6A 1LO2H 3ARDD 1KB5A 3WDIA 4WV1A 5E00B 3RHWF 5GISL 1AP2B 2YWZA 3MRPA 2A83B 3B9KD 3OKOB 4WO4D 2W07A 1JGVL 5L6YH 1NC4D 1JRHI 2AK4D 4K3EL 4OCWH 3B9DA 3B5GA 3U0PB 1CT8B 1P4LA 1CXEA 3MREB 1AE6H 3C60B 3ARRA 5JHLL 2EKSB 2XPGB 3VD3A 4F3FB 5MI0C 1G6RL 5MP6H 2Z8SA 1H5BB 3KPSE 3CX5J 4PJ9C 3OKNB 3ZTJH 4PRHA 3IXAA 5IVZB 3ROOA 3TO4A 3WN5A 1FZOB 2F5BL 3FFCB 2ILLA 3STBA 4WDIB 4XI5D 5B39A 3O0RL 4H0GA 5FGCB 5IOPA 1IKNA 1AO7D 3LPWA 1J0IA 1JTOA 1YC7A 3GIZH 3H6JA 1OAXH 1QSFA 2FX8L 4GRLC 4GKSB 2QQNH 3VFGL 3DRQB 1L7IL 2DTML 2HTKC 3C9NB 4GKNB 1CDCA 3LHPH 5B4MC 1VADA 5SWSB 4HPYL 4Z95L 4OCXL 3Q1SH 3BPLC 2FH6A 2CIIB 4ORZC 3E8UL 3EFFB 4LKCB 3IJHA 1LQSR 4TPRH 1AD9B 3PWNA 3BQUB 3U83A 4ZTOL 5F7FA 2CUHA 3EOAA 4NO2B 5F6HJ 1OP5H 1RIVH 1NCBL 4OM0H 4XXCA 1KEGH 5BV7C 4YBLC 3F7VA 1UKSA 3CLEH 5F93C 4MQXC 5ETUA 4BKLB 4J2XA 2DJSA 4HH9A 2W60A 2QR0B 1CFVH 4OM1L 4PG2C 2OX5A 4P2OA 3U7WL 2QSQA 1J1XH 1RUML 4X6FA 4JO4L 3ARQA 1O0VA 2BP3A 3NOIA 4WRLA 3RGVA 4K23L 3QUZD 2JTDA 3MNVA 1OPGH 3VGDA 2CR3A 4PJHB 2I9TB 3VXUA 3BH8B 5ILTH 1ODAA 4LLMB 3ESVF 4RGNC 3MO1A 4OCRH 4GSDH 3LKRB 3TA3C 5HHVH 3WIHA 5MEQB 4S0SD 5DLMH 1P2CB 3TLRA 3H9SD 4DEPB 1T1WA 1HQRA 5H8DA 3QJHA 3FO2A 4LL9A 4MB5A 3UJTL 3EZJB 3HNVH 4L9LB 2VLJB 1E4XL 4ODXA 3BDYL 3SDAD 2BHZA 3VFUB 3HZMA 5FCSH 1Z0MA 5IEHA 4TNVK 3ARFD 3OKLB 4X6CE 3IS0X 4YDJA 3HMWH 4BK4A 2FJFB 1AO7A 2VL4A 2YC1A 5JW4Q 1DSFL 1MWAH 5I19H 2FR4B 3NCYP 4KI5D 4HMDA 5IIEB 5H35A 1KB9K 4WGWB 3FOMA 1WBXA 4CN6A 4U2YA 5SWQA 3RWFB 5E2UH 1FO0B 1OM3L 5GXBB 4WEUD 1RZFL 1MLBA 1RIUL 5IWLA 2WWKO 3WUZA 4Z7WB 5KVEL 3NCBB 5I2IB 1KJ2H 4I3RL 1W2KT 1G7PB 4O02L 3QRGH 4XPBH 4FTVB 2Q7YA 1X5AA 2N1KA 5DQDH 1NMAH 3V4VL 1PYWB 5D6CB 2YEZA 3KJ6L 3KPPB 3QEQA 43C9B 3MLYL 2FLRT 2DDQL 1B6DA 4G5ZH 1CXKA 4JEGB 3OKDB 3IDJB 5DJCA 2PYEB 2E27L 4JFPB 5GSRB 3ARGD 1VFBB 4F7PB 5HY9A 1UQSB 4NM8H 4R2GC 4P46A 2V9TA 4U0QB 4NN6B 2LV4A 3QUZA 3TT1L 3GSXB 3VW3L 3LN5B 4OZIE 3QO0A 3L3IA 5I1IL 3X12B 3FAXA 4LIQL 1NMCC 3V6ZB 4YHKL 1BQUA 2CKBH 2CO6B 1SEQL 1MAKA 4H20L 4UT7H 3T2OA 3VMNA 2CLZB 2CJUH 2HJFB 4PJ9D 1ZA3A 5EIQA 2AKRA 4NQUA 4ACPA 1P5VA 4TSCH 2DWEB 3WS6A 4MNQB 2OP4L 5DQ9A 3MBEB 1INEL 1AXTH 4NP4H 1EO8H 4DN3L 3OPZL 3BD3A 1FFRA 1R3JB 3LEVH 2DYPA 2W65A 4YDLC 4HUVB 1YYMH 2QSCL 3M1BB 1JGDB 5I9QB 2GEEA 2VXQL 4J8RA 5KW9L 4IMKC 3HZKB 1IE5A 3DGGA 3AY4A 4GRLD 2XKNA 1X5FA 4NO3A 5DHXB 4JZOB 5DJDA 3X11B 5ID0B 4LSSH 1KG0B 4Y4KC 2HTKD 5B4MD 4BFEA 5ESVA 1XF4A 4APQA 3WEXB 2FX9L 5GRJL 4Z7UB 2JK5B 5CJXC 2MNUA 1NGYA 3KPSD 2D7MA 4WNQB 1F4YL 1RQ5A 5E95B 3S35H 2P48B 3CH1B 2B4CC 1I9RL 5I1GH 1MFDL 3MNWB 4PJXE 1JWSB 4RMRA 3L95A 4JAMA 5D2LF 2XACC 3TCXA 3OGOE 5SWZE 5DS8A 2CXKA 3TPUB 4M8QA 1RFDL 1NCAH 3D1MC 4NOBA 5DJZB 4MQXD 4G6KH 2XXMB 1D5MB 5K9KB 1H3WM 4X8XA 4QGTA 2EEDA 3D39B 5C0AD 4RDQG 3KPOB 1OTSD 4R7NB 1IT9H 1WBZB 1NDGB 4OCYH 2CDGA 3DRTA 3H7BA 4F7TA 5SV3A 3TVMC 3VXPA 1IGIL 1U3HA 4PJ5B 4BH7B 1UWEH 2GJ6A 3VH8G 1TVHA 1WT5C 4WFHE 5EPMB 3P9LA 1QFWL 3W9DB 1MCIA 4HS6B 2FH8A 4RGND 4ZG1A 4HF5L 3TA3D 4EUPB 2X4RB 5MEOA 2N4IA 4K2UH 1W0VB 4R90H 4G8EB 2WQRA 5EDXA 4E41B 5EOTB 3HLAA 1NGQH 5F1KC 4M4PA 3QCTL 4PJ9A 5B39G 2RGSA 2QKIA 3H3PL 3ARSA 3SDXB 3V7MA 5FIEA 1OWRM 3O6LH 2EE6A 5BQ7B 4MDJA 1RK0A 5JHDE 1KXQE 3T1WA 4MD4A 4Z7VE 3NH7L 3KYKL 5SX4H 4HGMA 5FF6A 4H0IA 1FNSH 2HVKA 4NQCA 2Z31B 1NUNB 3S34H 5EBGA 4GRLA 3VJ6B 2VRAA 5DI8B 4R8WL 3ZT5A 2FSEB 4GBXB 1RY7B 1OARH 4O00A 2ICEA 4LVEA 1S7TB 4JHWL 4KTDH 3T3PF 1FLRH 4YK4C 1BJ1H 1GC1C 3TH2T 3QXWA 1ETZA 3HUJB 4P4RB 3KYNA 3PGFL 1D5BB 3EFDL 3P4MA 2XA8H 3RTQA 1KJ2A 4DFHA 3NFNA 2FO1A 5JQ6L 5TF1H 4LCUB 3WIHL 2B4CH 5TH2A 1VENA 1FFPB 4Y88A 4PRIE 2E9IA 3QFDA 4IOIA 3NPSC 3Q6GL 1DQJB 4WI2A 4XTRC 4M6NL 5IMKA 3CFCH 3W11C 3IJYA 2XZCH 3Q3GB 3WFCL 5C0AA 3MJ9H 4PG2A 1CDUA 2B39A 3QWRD 4I9WE 5ID1A 1VEMA 4R2GD 3IDGB 3KPLA 2EH7H 4CVXB 4XBPA 1EERB 2EDBA 4I5BB 4O2EB 2VDPL 2LQRA 5CEXB 4GS7C 5IB4B 2P8LB 1HHHA 4Q7DA 1I9IH 3UJJH 5HVWA 3MUHL 1CTNA 2DM2A 1A02N 3QFJB 3ULUF 1CLZH 2YD6A 1NL0H 3TA3A 4BZ1H 4MD0A 5CP3H 3ZYIA 1A47A 1WAAA 2F8OA 5IF0A 4PBWD 1KENL 1OY3B 4PB0L 3R1GH 4PJ7A 5F97E 3ROLA 3NTCL 1I4FA 4FQPA 1TZGL 4KKLC 4PRBA 2HKFH 4J3OC 2OZ4A 5KSUB 1AHWB 3FKUS 3JTSA 4DTGH 1JZ2A 2Z35A 3FZUD 4EN3D 5ACZA 4ZPVA 4X0KB 4Y4KD 1PDKA 3HNTH 2E8YA 4AG4H 1V3JA 2NW2A 3LOWA 3MLZL 4GG6E 5A2IH 5E03A 4D2NA 3P4NB 1BAFL 1N8ZA 3B4NA 4NPYB 3TEUA 2ZUUA 2Z8VC 2ZSVA 4XVUD 3FMGH 4X6EA 2LU3A 2PO6A 3RY5A 4LSTH 1I8MB 1QSVA 4TVPE 5IGXH 4JG1L 1AFVH 1LEGB 4P9HL 3TCLB 1HWGB 3TNMB 1GC1H 4WGVB 1LE9A 2GY7B 2Z92B 4E5XB 5HI4D 4X4YB 2ESVA 3IXTA 3VFMA 4LHJB 2YKLH 2Y5TB 5HDBE 5AZEL 43CAB 1VCAA 1KELH 2UYLA 3SGDH 3TVMD 1MCWM 3I85A 1NANH 4L4JA 2VZUA 3WNNA 3QWRA 4HIEA 5FOBB 3WCYA 5DUML 2OBGA 4QF1A 2FYYA 1A3QA 2IPTH 1F97A 5SWZD 1T7ZA 5LQBH 1MCHA 1E4KC 4XRCA 3HZVB 5ICYB 3JWOL 3N06B 3WBDA 3RI5K 4WEMB 2RCSL 4ODTH 1C5BL 1MFAH 5IG7A 3PDGA 2X1PA 1T1ZA 2EYSB 1HYSC 1KJ3H 4X99B 1SMAA 4BSJA 3M8OH 4EDXB 3CVHH 4DJMA 4PLJC 4WFHD 4RFOL 1KLFA 3U30B 5F72S 2ATKA 1FVDB 1I3RA 3I6KA 3MUY1 2JCCF 5HHPB 5I8CA 4OZIA 1Y6MR 1Q9WA 4PGJA 5FA4B 3ULUC 5ANMB 2YK1L 2EKJA 1IAII 4OFKA 4JQXC 4O2FB 5DA0B 4HK3J 4ZAKD 5FHBH 5CJXA 3EO0A 4G7VH 3TBSB 1DZBA 2B20A 4JY6B 5EN2A 3ZDZE 5C0RL 1G6VK 1DQDL 2UVFA 1QBLL 2VTFA 4MGXA 3B9VA 5L2JA 1BFOB 3IS1X 5KSAD 4AL8H 3UZQA 2DRUA 4P23A 5JHDD 3DX6B 2IPKB 1BVLB 4WU5A 4TSAL 3VI3F 3P73B 4OIBA 2ZG2A 1MUJA 3HTLX 2PTVA 3TN0B 4EBQH 4OKDA 3ZYZA 4XTRD 1FZKA 4FABL 2BXZA 3AS1A 5GGQL 3ARBB 5HHXL 1C08B 5C07B 5T5NG 2FNBA 4Z5RB 5IKCB 2PN5A 3W81A 4AH2B 4XNQA 3CMOH 2P46B 3CSBA 3OJVC 2A6IB 1KIQB 1NEZG 3BSZL 1G1CA 5C9JB 3RVWC 1LEIA 1SM3L 5CINH 4AT6B 3WLBB 4EKXA 3LY6A 4XHJC 1QVOB 1WT5A 3JTTA 2F19L 4XCEA 4J4PC 3HPLA 5GRXG 3TM6A 4HWZB 4NJ9H 4PJEB 4PRID 5B38B 4PGDA 3DVNA 3VRJA 4TVPH 4WHTB 4JVPA 1AQKL 1QFPA 3QCUH 4QHNB 4WUKH 4EDWH 2YBRB 3NMEA 4KKLD 1OAUL 3HG1A 3FB6A 4I9WD 4L4VE 2KL6A 1YC8A 4HPOH 4KZEH 5IHZA 3QUYC 2NY0C 4XNZC 1T03H 1RZ7L 4XMKH 1BD2E 3FFDB 3LKPA 4Y0GA 4KUCD 2MQ0A 2D7OA 1A6UH 3OR7B 1IJ9A 5LGKA 5DMJB 2OR9H 4YXLL 5BRZB 1TVDA 3DIFB 5F7MC 3L3DA 3AS0A 1PX4A 1E27A 1MRDL 2E9WA 3BKJL 1SJHB 2AJ3A 1FYTB 4GQPH 4BZYA 2Z8RA 1PW3A 3ULUH 2B2XL 3MXWL 1CTOA 2ED7A 4YX2H 1ACYL 2HA1A 2O26U 3A67L 5FOJA 2Q86A 3MV7B 4UTBH 3MLTB 1NFDB 4K3DL 4DOHE 1MAMH 1ITBB 4ZFGL 1JNJA 1GCFA 1TJIH 2YXFA 4LVNB 2R0KH 4PLKC 3BUYA 5GISH 3DX7B 5D9SA 3BP7B 3ILQC 1F2XK 2OZ4L 4L3EE 5I30H 4QHMB 2GITA 2W9LA 3EYUL 4JQIH 3RVXC 4RCAA 1T22A 4X5LA 5CFHA 4QWWC 1VPOL 4TVPD 2GJZA 1S5HB 2ZSWA 3BZFB 1G6RH 5E2VH 5DJ6B 4F33A 5C0BA 5IHUL 3OF6A 3Q2CA 3WYRA 4ZUTB 3CAFA 5D2LA 5A16A 4O51B 4PD4K 3GJFH 4N0UA 4JE4B 1E6OL 4NKOB 1ZWIA 1BQLL 3BP6B 4LMQI 1CIDA 3PUCA 2N7BA 3D18A 4GG8B 3LZFL 1HYSD 1ZSDB 3NCEB 1I1YA 4KKBC 1PQZB 4XPGH 4CADB 2BHUA 4H88H 2H8PB 4PRPE 1HCVA 2RB8A 3QA3B 3VFGH 2R2HA 5C0CE 4M48L 3KJ4B 1GAFL 4J23A 4OCXH 4CU8A 1NGPH 2Y36H 4XCYA 4NYLA 3MMEA 3ULUD 5TE6L 3I2CL 1SYVA 2XWBA 1YDPA 4YPJA 15C8H 1Y0LB 4L8BB 3G5YA 1FL5B 2VL5B 4Y16B 1E4WL 1SJEA 2BNQB 4OLVH 1CI5A 1MREH 3EYFA 5KOVC 2X4NA 1S9XB 2AXFB 5J6GB 1XCQB 4XP5H 2A2QT 1KCVL 4NO0A 4KJYA 5CMAA 3LMJH 3HNSL 3FQRB 4KRMB 1OSZA 1U2HA 4YFLI 2HFGL 3TIDA 2GSIB 2XZQL 4YLQT 1IQDA 4JO4H 4UT9L 4M7KL 4KTYA 2YD8A 3MJ7A 2YA2A 2DKMA 4OKVA 1GHFL 4YC2B 4GG6A 3F6IA 3KS0J 2ZCHH 3RVWD 3WNKA 4H25A 2VDML 4XHJD 2GJJA 3RUGE 3SO3C 3FO9B 4J4PD 3QDMA 5KBNC 4KKAD 4YJZL 1OP5K 5I1EH 2EICA 2F74B 4XCNB 4N8PA 1CF8L 4OT1H 1JGEB 1CL7I 1IC5H 4ODBD 4WHCA 1MCPL 4NJAL 4P57B 3GRWA 3FCTB 4NWTL 2MHAB 2DBLH 3LN9A 5KSBF 3DMMD 3LKQB 1ES0B 4CJ0A 5EFIB 1K8IB 4XP9L 4F58L 4OI7A 1RIHH 1XT5A 3BP5A 3TESA 1IM9B 2NY0D 3QUYD 4JDTL 2X4TA 5EORH 1A14L 1EA9C 4RMUA 4FQXB 1RZIA 5FUOL 3G6JF 4IOFC 2LTQB 4U1HB 1M1SA 1YEDA 4GXVL 3DSFL 1N2RB 5EO9A 5GJSH 2V5MA 1MY5A 5JPMA 1NSNH 1RZFH 5EULV 1RIUH 3I02A 1OAYH 2GT9A 4RIRB 4JQXA 1T0NA 3I75B 1RHFA 1X5JA 4LCWE 4FFVC 2WBJB 2F53E 2CK0L 1AGBB 1UJ3C 2YHGA 4MQ7B 3TC9A 4MJ2A 2DDQH 1BD2D 5T1KA 1HSAA 1P4IL 3DARA 3QI9B 4PLKD 2G5BB 1ZT1B 4XWOD 1T4KB 2E27H 3ILQD 3LH2L 1RJYA 3RY6C 2IMNA 2O93L 1ZVYA 2R4RH 4HUWA 3PQYE 2EDDA 3QSKB 2KDGA 4ODVL 5FHAL 5MHSE 4JPWH 3TT1H 1OTUC 3NN8B 1PY9A 3RVXD 1K3ZA 2XY2A 3ET9F 1MH5B 5I1IH 5T1DL 1INQB 1UACL 5GS0C 4R97B 5JOFB 5J1AA 2DJ4A 3UYRL 2XTLA 2QHRL 2NY5C 4LLVB 2VC2H 3EHBD 3VFWA 4DN3H 5JDSA 2CDFB 4AEEA 2GFBA 4TOYH 4PYGA 3SDCB 4X7DC 2QSCH 2VXQH 1H9VA 4L3ED 1P7QB 1MFCL 5JLZB 2Z9TA 3H42L 5CGTA 2Y06H 3P30H 4HAGA 3DV6A 4LPUA 1U8NA 5FEBA 2WUBH 2NLJB 4X6DB 5DRXA 1JRHL 1RHHB 1S7VB 1UKTA 3QUYA 4JJ5B 1I7TA 1KT2B 4MJIB 5M95B 2OM5A 3EGSB 3P77A 1UH3A 5DJ0A 2R69L 2BNRB 1I9RH 3O11A 4FMFA 1C1EH 4M43H 1YUHB 5B8CC 5F9AC 2DLTA 3KLAA 1LVEA 1HN1A 1FV1A 1T21B 5DGRA 3QHZL 1J88A 2AGJL 1ITCA 3C2SA 2E5EA 4JFXB 5AWNH 1UZ6F 1G0DA 2XZAL 1ED3A 5C0CD 5F9OH 1J0ZA 3QHFH 2C1OA 3BEVA 2X70A 1F58H 2A9MH 1RK1B 1KTKE 4U49A 4S2SA 2VDOL 3L7FB 4RMVA 1A7QL 1BD2A 4MLSA 5INCB 4B0MM 5HVGB 3RHWK 1R5VB 2JCCA 1DR9A 1YMMB 2ZUYA 4R0LB 1QFWH 5IFAH 3RZCC 3O3BA 3TNNB 3GB7A 5FDWB 1ZHLB 1RJZB 2PNDA 5BMFH 4R9HA 3MLRH 3CZFB 4ISVB 1U91B 4KVNL 5FO7B 1ZHBA 4HHAB 3C08H 4RMQA 1FJ1A 3BPNB 1PZ5B 1YNTA 2NY5H 3VDCA 1CD1A 5ESAA 3ZHLA 4JDVB 4R96A 5KJRH 3QZWA 4WWKD 1P7HL 4UQ3B 3SKMA 5HYEA 1YYLL 3EDKA 5TGBA 5I75B 4O2CB 2X40A 4ONGL 3C5SA 3BZEB 4N0RA 5JORB 5I1HL 4Z7NF 1J0JA 3RWEB 4IOFD 1NAKL 3O6KH 4YNYB 3GHEL 1BJMA 5HDQL 2UWEE 1Q8MA 1R3HB 4JFHE 2YD2A 4FQJL 3PGFH 3DVGB 1ZLVH 2HVJA 1T83C 3MACL 1UXSB 3UTSE 4HCRH 3MV8E 4JPKL 1B0RB 4O58L 1KJVB 3O3EA 2X41A 3BN3B 2FO4B 1AGDB 3BKYH 1FFOA 5F44A 2YPVL 4Y4FB 1KCKA 1WGOA 4FFVD 4LEXH 5HI3C 4IDJL 1W72B 2AEPL 1E6JL 4M6NH 1GOFA 3QEUB 4MAYC 4U0RC 3S6CA 4LCCB 5C0CA 2W59A 3FT2B 4OAWA 3S5LB 5JPNB 3GRWL 5L0QB 3B2UD 2CRIA 4YO0A 4FXGB 2R2EB 2HP4A 4I4WB 3VFSA 1PZUB 4X5XA 4QTIL 1VGKA 4JKPL 4K8RC 3HZYB 4GOSA 4YHNA 1Y6KR 3QNZA 4KK6C 3VGAC 3L3HB 1OTUD 5EO0A 4XH2B 5BJTB 1SMOA 2B5IC 1D9KC 5EOCL 4DQOL 3VG9C 3GMRB 4UBDC 4NZRL 4TUJB 4KRPB 4NQSB 2IQ9H 1DQLL 3MV9A 4IEFB 4DUXA 4G9DA 3R4DA 4KC3B 2BMKA 2P5EA 4LCWD 2HWZL 3E6FB 5HVFB 2I9LB 4JY5L 1KENH 2FEEL 5GS2D 5HGDA 5EA0L 1HK6A 3WFEL 4RGOH 3O3DB 3IAQA 5CLWA 5J12C 3JVGC 4LPVA 3RWJA 4EI6A 1S7SA 2RFXA 3K80A 3PQYD 1BOGA 3OXRA 4W4OC 5MHSD 2WANA 3A6OA 2BDNH 1TQCC 4P9MH 3AS3A 3T0EB 5KS9F 4LDEB 1LE5B 5D1XD 1OF2A 3ISWA 3KDMA 3LSOB 4KZDL 3BXNB 4NOFA 4L4TB 4ZXBC 2I26N 3F7PC 4OLXL 4N5UA 1K3IA 1WISA 1CR9L 3MOAH 3PF2A 1UWGH 3U4BL 5DMGC 1P6FA 4W4NA 3DX9B 4L5FL 1UH4A 2J8UB 4MNGB 3PL6B 1EFXB 2PR4L 2IALB 5BZDA 1DQQB 4P9HH 4G8IA 4ELMF 3MJGX 4UDUA 4TYUA 4DZ8B 2CO7B 1GXEA 3H9ZA 3UBXA 2LAAA 2IBGA 5IHLB 4Q9QL 1ORQA 5J1SC 5E8PA 5KTEL 3RPIA 4HWEH 3VFRB 2VIRA 3P4OB 3GKZA 5BO1L 3QPQC 1O7SA 1UJ3A 1RUAL 4V2BA 3DVFA 4NNPH 5JZ7D 1IAKB 2VXVH 3CFJA 3O4OB 3NBNA 1J8HB 2KQNA 3UTTD 3GKWL 5T1LA 3LPFA 5I1AA 5IB5B 4XNYL 2AAVA 3P0YL 5CJOL 4HKJA 1MFBL 3RZCD 3QAZC 1SBBA 3B5TA 3VCLA 4ZQKA 3U0TB 3JWOH 4ZUSA 2RCSH 5DEFA 4V1DD 1FVCB 1N6UA 3S8WA 1NAMH 4KHTL 1T5XA 4UNVA 4WENB 4X80L 3EOBB 3VA2C 2ITCB 4WI7A 4QTHB 2F58L 1ZMYA 5EUKB 1CLYH 1QP1A 4G6ML 2HT3D 4CJ1A 3U9PL 1QHPA 1QA9B 3BZ4B 1CDYA 5IFHL 4DVBB 1KTRL 3WE6B 1KB5B 5F1NB 4WV1B 3S36H 1IQWH 4JZJC 2FIRT 1A9BB 1QPPA 5LCVH 5DT1H 2IANE 4C57C 2XG4A 1C7TA 3EOTH 4HCRA 2SEBA 1H3TA 5DQJA 5D7IA 5C0RH 1P4LB 5K93A 1QBLH 2D7TL 2VZSA 4WFFE 3RIFF 5I1DA 5F6IC 3KR3H 1T20A 2BVYA 3BVNA 4TSAH 4ZOAA 4KUZH 3FT4B 3IXAB 5KSBA 5E56A 4OFYA 3ROOB 2X7LA 3TO4B 4JHAH 2AEIT 2PYFA 3LIZH 4K94C 1GSMA 6FABL 1AR1C 2VLLB 4YZFF 4Y19E 4MAYD 3C5JB 3BMWA 2YSSA 1AGFA 3DSNA 5AYQA 1MCKA 4XVJH 3VG0L 3VI4F 3G6JA 4JFHD 4KK6D 4MA7H 2A74A 3CPLA 2WUCL 4ODHL 3OXSA 3UTSD 2EC8A 1TITA 3MV8D 1D9KD 2F19H 2P44B 3UTTA 4CKVX 4UBDD 1K6QH 2XA3A 5A2JH 4RGMC 2ZUQB 4J3TA 1U6AL 1EJOH 2VISA 3R06A 1II4E 3BX7C 3IJHB 3WKMH 2R0WH 1K2DB 4TQEL 3PWNB 3T2NL 4C59B 4DAGH 1XCTA 3RZCA 4PJHF 3EOAB 2AJXL 4YHOL 4RAUA 3P9MA 4I0PA 4ZSOE 5F3HA 1FAIH 2NXZD 5M7QA 4V1DA 1U92A 2EDJA 5CLTA 1KEMH 3QZWG 4GRWB 2HFFB 5JIKA 1KNOA 4IRZL 3FL7A 3H9HA 2YPKA 4HH9B 4C4KT 2W60B 3MUZ1 3ZL4L 5IP4A 4P2OB 3L5JA 1ZLWH 2R2BB 5DHVH 4X6FB 4RX4D 4URTB 1S7XB 1UVQA 3RGVB 4LLWA 3I84A 5EZLA 4ZOCA 3MNVB 3ARDB 3GMPB 4ZXBD 4YXLH 3MRMB 1Q0XH 4JVUA 3VXUB 5DVKA 3B9KB 2O61B 5DMGD 1R0AH 4ORGA 2AK4B 2VQ1B 3KPTA 4B41A 1Z5LA 3OKKA 3IFNH 1ZHNA 5I1KH 2APWA 1FC2D 3V4PH 1T83A 1I3GL 1HQRB 4NN5B 3O2VH 3TBYA 4BQ9A 3BPOC 4ODXB 2DQEL 3QQNA 3HZMB 5IEHB 5AUMA 3MYJA 2R1XA 5DC4B 3V95A 3QULA 4ELKA 3QPQD 4GMSL 4YDJB 3PWPD 3LKSB 4DKDC 4Z7WF 4MAYA 1S9VA 1MRFH 1CXLA 4K94H 1AO7B 8CGTA 4I3SL 2YC1B 1ZGLP 3QUKA 4QXGL 4S1QL 5L9DL 3OAUL 3VRLF 3W2DL 2Y7QB 3KNBB 5H35B 1LK3H 3FOMB 4MHHG 1WBXB 3QDHA 5FO9B 5IHUH 5IJKC 4PRAA 4ESKA 5ICZA 1PY4A 4YE4L 4QHKJ 4ZYKB 1MLBB 3G6AA 3LS4H 2WAHA 3C6LC 2NX5A 4GW4A 1A6VL 2Q3ZA 1MI5E 3G08A 5CZKA 2C3VB 4GAFB 1FIGH 4LQFL 2Q7YB 4F37F 4IJ3B 3JVGA 2YEZB 3TJHC 1FORL 2M8XA 1K85A 1C12A 1CD8A 4W4OA 4PGBB 1U93A 3CLFL 5DJCB 2FECL 1J86A 1XIWC 2C7UB 5HY9B 1YA5A 1HZHL 1S9YB 3QUZB 4NGHL 1VA9A 1FZJA 4NKDA 3BJLA 4ZXBA 3H0TA 1CICD 1K5NA 1Q9LB 1RJLB 4QRPE 1F90H 4ZFOA 1FSKB 4LOUC 5A2LH 1AJ7H 2DKUA 3MRCB 4PP2B 3ORJA 4KDTC 3GJFK 1KCVH 2VITA 2WINA 3N9GL 4Z7UF 2AKRB 3H9SB 5DQ9B 4HZLB 5IB3A 3BH9B 5E4IA 5GS0L 1BEYH 1NCCH 1AR1D 1ZK9A 4IOSD 4PJGE 2DQJL 1F6AA 2DYPB 5DMKA 1EEYA 4HKBB 2AEQL 3ARFB 4AMKL 5JUEH 1CE1L 3RGHA 2IAND 3DGGB 5D7LE 1RUKL 2R4SL 4XT1C 3PWPA 2XKNB 5LWYL 1T1XA 5DJDB 3QUML 2L7JA 3C8KB 3NCCB 3NIFF 1XF4B 4GQ9L 4APQB 4NKIH 1NGYB 4HK3N 1ZVHA 3VGGA 4Q74A 3O2DL 1DUYA 3UTOA 1QQDA 4XAWH 3ECBA 1PGRB 4F9LC 3O3AB 3EIFA 2OXHA 5C6WH 1WC7A 1MCPH 4Y19D 5E8DH 4WI9A 1JMXA 2EE3A 3BEWB 3L95B 4LLAA 4JAMB 3QH3A 5C92A 4N0YL 1I8LA 3DXAE 1RZJL 1ZGLM 4M8QB 3N85H 1CK0L 3D6GA 2IBZY 4U7SA 5JXAL 4RWYL 1KXTB 2JF1A 3DRTB 1JNLH 1UB5B 3RVUC 4F7TB 1IEAA 2VSCA 1KIRA 4MZ3A 4GXVH 4I13B 2J6EA 5HYJA 3HI1A 4R3SA 1TVHB 4YHIB 3CSYA 2O5XL 1XGUA 2VLKD 3QCVL 2AXJA 4C56E 4ZD3H 1QRKA 1VDGA 4QOKD 5I74C 4C54A 1IEBA 4DCQB 1KYOJ 5D72H 2ZOLB 5MEOB 1QFWM 4HWBA 3QRFM 3HC3H 4WW2F 5DR5L 3GUTA 3U36A 3UZEA 4PJ9B 2QKIB 1LWRA 3HUJF 3V5HA 2GK0A 4D8PA 3GSQA 5IVXB 1QTYT 4M93C 4F2MB 4MDJB 1FNFA 4HGWA 5KS9A 1UB6A 4WY7L 5FF6B 2HVKB 2OSLA 5FK9A 1F3RB 2DL9A 4GRLB 4POZD 4OJFH 5GSVA 4R6UA 2I07A 2D2OA 3LS5H 5E99H 2V2WA 5E6YA 4LQ1A 5TDOB 1KCRH 2AQ2A 5CUSL 4YDVB 3UYRH 3MC0A 1U3YA 3P3YA 3BPLB 1ETZB 5IBTL 2D0FA 4ZDHA 3P4MB 1KJ2B 4NZDA 3NFNB 3C6LD 5DEGA 2ARWA 4M03A 3TO2B 4ZUUA 3D3VA 3PWLA 4XWGH 1NGWA 5TH2B 4LSPH 5H37H 5ALCL 2C1PB 4YBLB 5BV7B 2DQIH 2BRRL 2VZTA 3QFDB 3TJHD 1FC1A 1L0YA 2YZ8A 1YEFL 4HEPG 3V6FB 2HH0L 5C0AB 1LO5B 1JRHH 2MKLC 5ADOL 5E8OA 4NUGH 1N5AB 1JYWA 4Z18A 2Q8BH 1XIWD 3E3QE 3HI5H 2MCPL 3KPLB 1V3LA 4P2QE 4XBPB 5DZNA 1LO3L 5E00A 2CKBB 3VXSE 3QIBD 1QSZA 2ADFH 2VLKA 1HHHB 1CD9B 1U9KA 4HS3B 4K8RL 4LOUD 3SQBA 1X5LA 4QOKA 1MI5D 4RGNB 4ZSOA 2PW1A 3QHZH 3ZYJA 3I50H 2AGJH 4YBQC 5D7KE 4M7LL 3TA3B 3U0PA 1HILB 3GMMA 3MXVL 4HWNA 4LSUL 3BGFC 2VDNH 3C60A 1X6LA 1I9JH 4MB3A 4PJ7B 3ROLB 2VXTL 35C8L 4LSDA 1B88A 2EKSA 1I4FB 1RPQA 1JPTL 2EDKA 2FJGA 4IHOB 1A6TB 3OKNA 5JW4R 1EMTL 3JTSB 8FABA 3CD4A 3WUWG 2Z35B 1U8IA 2DQUL 5AEAA 3ME0A 5M94B 5T33L 1FZOA 1SEBB 4LRNL 5ACZB 3CXHK 4ZPVB 3SE9H 4QRPD 1VFAB 4L8DA 2BCKA 3EDEA 2Z31C 1TZIA 3SHSA 4ONFL 2APXA 4GKSA 3KLDA 1N8ZB 4R4NC 4WW2C 2ZSVB 5IJKA 5F96L 4X6EB 4Z77A 3UPCA 4KVNH 5FKPB 3R0NA 3DUUB 3QXAB 2CIIA 4ZFOL 5E2TL 3EFFA 3FB8B 4LKCA 1J10A 4OSUL 4J1UA 1LE9B 3BQUA 4X6CB 3OKYA 3FQWA 5D7LD 3C6LA 3VFMB 2EC9U 2EE2A 4G8GE 3DURB 5D7SH 1P84K 5FM8A 4MJ5A 4ONGH 1WEJH 3K2UH 4U6VL 3RVUD 1I8IA 5DUBA 1NAKH 2UYLB 4OLWL 4RNRA 3DO3A 2QR0A 5D93C 4HEME 2GTZA 3CJJA 4AZ8A 4MVBC 3CK0L 4HIEB 4FQJH 1XIWA 1RZKC 4QF1B 3DI3B 4R2GB 5EU6E 1BQSA 2D7QA 5IMOB 4JPKH 5EU4A 1QNZH 4Z7QF 2LFGA 2I9TA 3WNLA 1A0QL 4XRCB 1NMCB 3BIAX 3UXFA 3V5KB 3H3BC 4M7LT 2HFEA 5EC2B 4KDTA 3LKRA 4YUEL 5IESH 1YQVL 4KTEH 5MEQA 3FQTA 4AIOA 5I8KL 2WNGA 3EBAA 1T1ZB 2GIYA 5I1JH 4ZO7A 4L9LA 4YHZL 3MLXH 2KBGA 4KRNA 4OB5L 1KC5H 4RMWA 4YDLB 2ZG3A 4C56D 2X1XR 4LHUD 2ATKB 4JFDD 2NY7L 4AEFA 5DGQA 3T8XA 3I6KB 5TE4H 2JB5L 4Y4KB 4L29A 4OZIB 1DQLH 3VWJC 1FFQA 1R5WA 4LHQB 5D71L 1ZLVK 2IAMD 1R6VA 2J6EL 3KG5A 3SKUD 4D9LH 3EO0B 4JY5H 7FABH 2PCPA 5IIEA 3QJFA 5EN2B 4CUCA 1SYSA 4YFEA 5L2JB 1A3RL 3WFZA 4NQED 4U1KA 1EHXA 1DANU 4M7ZC 3RWFA 3WSQH 1FO0A 3D69A 1OVZA 5L8LB 2WK2A 1ZVSA 1T80A 4WU5B 4HWBL 4OZHE 1MPAH 4EEEA 1CG9A 3HE6C 2VYRE 4PJEF 4MYWB 5D7LA 3OMZA 1A6WL 1FZKB 2BK8A 5I2IA 4O5LH 4HV8A 2AJUL 4OQTA 3DROA 2FGWH 3X17A 1WFOA 3HN3A 1PYWA 1S5IL 3KPPA 5MERA 5DRZA 2DBJA 3TVMB 1OCWL 2K3TA 4Y4HD 4N9GA 1LEIB 3D9AL 2AI0L 4B53A 1SVCP 4YBHA 5HSFA 4LVOC 1ZV5A 2DQHL 4JFPA 4B7LA 4HUKB 4EZMA 1VFBA 3V6OE 3HPLB 1EX0A 1JVKA 5CSGA 3ARED 1GGCH 1OGAE 1RZKH 5IROC 5SWZB 4S10A 3LN5A 4PGDB 4BELD 4Q9QH 3DVNB 3VRJB 3X12A 3TT3L 3V6ZA 1ZANL 1IGML 1Q72H 5D2NE 1UCBL 3HAEA 1HXMB 3FB6B 3TBVB 2ITDA 1TDQA 2DWEA 4QRUA 3T0DA 3VFPA 3RWDA 3FN3A 4KPHL 4P2QD 3JUZA 5KN5B 2H3NA 5IHZB 2MCG1 2IJ0C 3O4LD 2VZ3A 3VXSD 1NFDF 3WD5H 3LKPB 3M1BA 4LU5L 3PDOA 2PTTB 3OAYH 4JFDA 2G9HA 2J7LA 1J11A 3EDDA 2XN9D 1A21A 4LPWA 2DM4A 4R4ND 5ID0A 4X4XA 3H9YA 1E27B 2AJYL 3CH8A 2IFFH 2AJ3B 5J11C 4KHTH 2G60H 3MRFA 4X80H 1XGRB 3G9AB 5D2NC 4ZAKB 4Z7UA 2JK5A 4YK4B 1DFBL 4K7PH 3MLPA 4OZFH 3CDYA 4Q9RL 4KRLB 5DD1L 5E5RB 4NQEA 4OTXL 4HBCL 4L1HA 1ADQA 3DNKA 1X7QB 1FNHA 5IFHH 3JSSA 5CHNA 4K7FA 1R3KA 2YOCA 3BUYB 3TPUA 5CS7A 1KCUH 5DFTA 4KQ4H 3KPNA 5D9SB 3NPSB 4Y2DC 5K9KA 3V6BR 1A7RH 3D39A 2GITB 1CGVA 1BECA 1V3MA 4R7NA 2PW2A 4FQ1H 1T22B 1NDGA 1N6QH 2Z93A 5BVJA 3NABL 2GCYA 1KB9J 4U1JA 4XPFL 1NPUA 4BH7A 2ZSWB 3HRZB 4F33B 3QG7H 4GS7B 4MDIB 2M2DA 5GJTH 2BY1A 5EPMA 4OCMC 3M45A 5D2LB 2EDTA 4G8GD 3UC0H 4HS6A 1DN2A 1N7ML 1YEKL 3FN0H 2LVEA 1ZWIB 2A0LC 1W0VA 2VAJA 1X5XA 4LPYA 3VXRE 1MSPA 3CVHB 2AW2A 2NXYC 1F8TH 3ZHDA 2C3HA 1I1YB 4XNUL 2Z4QA 3GBNH 3V4UH 4KV5E 4LKXA 3VG0H 4QY8B 3BP4A 1KFAH 4D0CB 4XC3H 4XMLL 1T0PB 1EBAA 4FQHA 3P9WB 1DVFC 1QBML 4HIXL 3O4LA 1QRND 3VWJD 4NYLB 5GGSA 3UPRB 3MMEB 2DQCL 3ZLQC 2H45A 1SYVB 2XWBB 3GFUA 2Z31A 3N0PB 5DI8A 2I5YL 2XN9A 5AG9A 1MNUL 4UT6L 4WW2A 1SJEB 4C55A 1CGYA 2FSEA 3EYFB 4O4YH 1FL6A 2X4NB 2IC2A 5TE7L 1OAZH 2LE9A 2DQGH 2QQKL 4NO0B 4KJYB 5T5FL 1LNUA 5CMAB 4UIKH 4WJ5A 3X3FL 3SKJL 1OSZB 3NZHL 4ODSL 5IFJA 4OLZL 2EDFA 4JZNB 1S7WA 2E7HA 1IQDB 1U8MA 4FQLH 4HG4J 1DBJL 2X4SA 2VQUA 4LCUA 3RAJL 4NBZB 5DWUL 1TZHA 5E2WH 3EYSL 4TNVF 5I18L 1CN4A 4OKVB 1NGZA 1DQJA 4K7PY 2AJSH 2X6MA 4GG6B 4M62H 1ROWA 5C70A 5I1LA 2PTUA 5C08E 1I3GH 3MYZA 3IDGA 3OKEA 3PE9A 4UIMA 5K33A 2VAAA 1BHGA 4MXQC 2DQDL 3QXVA 4POUB 3UX9B 3IVKB 4NHCH 2KUTA 2BSTB 1RURL 1ZE3C 3QFJA 4U31A 4AQOA 4QRRD 3RX8A 1OAQH 1EIBA 2CUIA 2CPCA 4JRYE 5F3BA 5EWIH 1FO0L 3U6RB 1ZLWK 1MJJA 4WIQA 3LKOA 3O6FD 2AABL 5DD0L 5C3LD 4LNVA 1E4XI 3BP5B 5K9JL 4ODWB 3VWKC 2X4TB 2O5YL 2DLFL 1AHWA 4WI4A 1CBVL 1RZIB 3ULVL 1YEDB 1EHAA 5B3JF 1OGAD 4PRNB 1BM3L 3GBLA 3UYOD 1QRNA 2DN7A 3VWJA 5JPMB 4Z0BL 3AM8C 1S78C 3ZDXE 5J8OA 1TMCB 4DK6A 1DQML 4W70A 3MRRA 4ZPTA 1H8NA 4OV6F 3PG2A 4Y16C 4NPYA 4LQFH 3BKML 1UM5L 2BVUA 3E6HB 1MQKL 1A1MB 3MLVH 4G6JL 5EG6C 1L7TL 5JW4N 1HSAB 1LEGA 2ORBL 2Z92A 1K8DA 3HE6A 4X4YA 2XNAA 4Y2DD 3BKCL 1RJYB 4HUWB 3A6CL 1L6ZA 1GGUA 5LKNA 4XBEH 43CAA 4P48A 4LSQH 1MQ8A 4XC1L 5J1AB 4X6DF 4M7JL 4TUOB 4OCSL 5FOBA 4B50A 4OLYL 1IGCH 4XP6H 3GGWA 3MRGA 1YY9D 1NCUA 2Y25A 3VFWB 4OZHA 5HYIA 2A77H 3HAEG 5DVMA 5IROA 4ZUWB 2GFBB 4I3GA 2A0LD 5IBUG 4Y5XB 3SE4C 4LGRB 5ICYA 2NXYD 3I6LD 1CE1H 4QRRA 3KYAA 3DMMB 2Q8AL 2EXYD 4PJ8C 3QUMH 1INDL 3DECA 1ADQL 1N26A 1MJ7H 5DC0A 3MGOB 2YD4A 4NWUH 2A1WH 5JA8B 1G7HA 2VABA 5DRXB 1IAIH 1DVFD 3QUYB 2NY0B 1NCWL 4XNZB 2E7LC 2DTSA 4QRSB 3P77B 1UM6L 4PG9A 1F5WA 3O11B 3MCLH 1NLBL 4N8VA 4WCYH 1FVDA 1OGAA 4FQQA 2E6QA 4LBEA 4HZAA 1A4KA 4LMQE 4BZ2H 4ZOBA 3KLAB 1R3IH 2D31A 2AK1L 5FA4A 1KOAA 2D4DA 3GSNH 5ENWB 1FV1B 5D2NA 1U8OA 4HW6A 4KVCH 5J13C 1DTUA 1QLEL 1UZ6E 1GYAA 4AY0A 3TBTA 1BBJB 5E94B 3MBXH 4AEIL 1BFOA 3TBWB 2X70B 2WBJC 3BAEL 1FG2A 2IPKA 1U58B 1CLOL 5J56B 1EHLH 4PV9A 4S2SB 4UB0L 4UOJA 4ZO9A 1BD2B 3P73A 1NMBH 3GO1H 2YN3A 2QSTA 5BW7C 4Y2DA 2JCCB 2W0KA 2YPLE 1C08A 4KWUA 3IDYC 4Z8FL 4Z5RA 3L5WA 1DN0A 2FX7H 1HXYA 4EI5C 3U46B 3WHE1 1QFOA 3NA4A 3O3BB 3B2VL 4NUJA 1PFCA 3MFFA 3BW9A 3RJQB 3UO1H 1F11B 3P40A 5EUOE 3A6BH 4X7SL 1YJDC 4FNLL 4DOHB 4U7MA 1FJ1B 4HWZA 4PY7B 1YNTB 5H94B 4PJEA 5F9WC 5TDPB 1CGWA 1LO4L 3K8MA 3LVEA 4WY7H 3WFHA 4WHTA 1BREA 2CXGA 3HFML 3T4YB 5IT2H 3JV6A 4L3EB 2P8PA 4QHNA 5GHWL 5GS1C 3C5SB 3TIEB 2YBRA 3VWKD 4Q2ZA 5C08D 2R9HC 4TTGA 3RBGA 1C5DA 4NFDA 1O5DT 4XB8A 3S96A 2ICCA 1DVFA 1JV5B 3S37L 3SDYL 2XQYG 3H8NA 3FFDA 3FJTA 2X42A 1S78D 1JF1B 5FUZL 1P7KB 2NQCA 3KS0H 4FN0A 4OD1L 3D2UD 4KDVA 3VGFA 4KJPC 1FFOB 3DIFA 4LCYB 2H26B 2VWEC 4H8WC 2GTWA 3FN9A 1ZS8A 3MRLB 5JTWA 1HKLL 5C0CB 4OAWB 1JPSL 3VFVB 4OIIL 3MV7A 5EU7E 2XTJC 1V7NH 4K9EL 5J57B 2DMKA 3VFSB 1VGKB 1C5CH 2ZCLH 4YHNB 1A3LH 3QNZB 4G80B 5HDOA 5GRUL 4JO2H 1IILE 2WWMC 1MLCA 1G84A 5TFSL 3CFDB 5C2UB 2WP3O 3MV9B 4ZS7L 5I1CH 2IGFL 4G9DB 4QHLA 1F6LL 2BMKB 4ZO8A 3SO3B 1QOKA 4PP1C 2EE9A 1NLDL 4HUXA 5HGDB 5BS0D 5EC1A 2BVPB 4TULH 5LAXB 2FJHB 5C0FA 4Z9KB 4KHXL 1A2YA 5DF0A 1EMTH 4ZUTA 3RWJB 5E9DE 4EI6B 1S7SB 4I2XE 1HNFA 1BOGB 3OXRB 5K9OA 4NKOA 5I0DA 2FRGP 4PJ8D 5D5MF 1XR9A 3SE8L 2HLFC 4GG8A 3ZDYF 1ZSDA 3KDMB 1J5OL 4LP4A 1PQZA 2YD3A 3DOSA 5HGHA 3S3JA 4CADA 2H8PA 3GEWB 3VWKA 2OJZH 1HINL 2XQBL 3IJSA 1I7RA 4PJFE 2OK0H 2ENYA 3VDAA 3IDNB 1X5GA 2P49B 5F70A 2G5RA 3EO1B 1H3PL 1T2QL 1D7FA 4WW1A 1HIML 3AM8A 4CVZB 5BZDB 1IM3B 4ELME 4G8IB 3DVIA 4OSUH 2YUVA 4UDUB 5DD3L 1BVKA 1Y0LA 3UBXB 3N1MC 4MXWH 1FL5A 4Y16A 1MCEA 3TPKA 3RPIB 1QFUH 2VIRB 2HJLB 3RI5F 3RWCB 4MQSB 4U6VH 1FNLA 1UJ3B 4BM7A 3QP3A 1YQ2A 1JPST 3FQRA 3C5ZC 2X4UB 4Q6IC 4P3CH 2VDQH 4JFZL 5T1LB 5I1AB 3L1OH 1FRGL 2BSED 3QQ3A 1I1CA 5DSCB 4EI5D 4PREA 3RWGB 4XMPH 3VCLB 1N64L 3RFZC 1A0QH 4ZQKB 1CL7H 5C09E 1IL1A 4ZUSB 3WXWH 4N8CL 3T0BA 3QHTC 1D6VL 4X5WA 5DEFB 4LCWB 1JYXA 4JRXE 3EYQC 1T5XB 3FO9A 3SKOA 5IQ9A 3NFPB 2MPAH 1QSED 5T3XE 5BS0A 3IRZA 4JREC 4QEGA 2F74A 2C5DC 3WFDL 5FECA 5D70H 4OB5H 5JIIA 2NY2D 3QXTA 1Z3GH 3L3GA 3SE4A 1MCOL 5DVNA 3MSPA 2YPLD 3PQYB 4KK9C 2YR3A 1D5IL 2NY7H 1TJHH 3HMXA 1A8JH 5EFIA 2JB5H 4NM4H 4J3SA 1HSBA 2R9HD 4MXVF 2H2SD 5FGCE 5D1XB 3UEZA 2P47B 3D85D 1AKJD 1VSCA 1HHJA 1JGUL 1IAOB 2JJTC 1IM9A 2DIBA 2SEBB 5DMIL 3LQMA 5D7IB 5E08H 1GGBL 5K59F 2DI7A 4FQXA 1EJ6A 1KCSL 1SY6H 5E6IC 5I1DB 5SWSE 1IAMA 4XCFL 1T20B 4Z7OE 4HJGB 4KJPD 5B8CB 3BVNB 4YDIL 1RUPH 3DWTA 2EIDA 3RKPA 5KSBB 2X7LB 4RIRA 3VFTB 3LEYL 2PYFB 1PG7X 4Y5VC 1HHIB 4YZFE 5FYJL 3I75A 3EYOB 2I24N 4FOMA 1F13A 2X9XA 4XNXH 4Y5YB 2WBJA 2YSSB 1AGFB 3CXDH 1IFHL 2P5WA 3M07A 5JOEA 4MQ7A 4GRWF 3MLSH 5DJXB 4LLUB 1JI2A 3CPLB 5CSZB 3D9AH 2G5BA 3WIIH 3OXSB 5BW7A 1LDPH 4H1LH 4U1NA 2WWMD 3UTTB 1DEDA 1QYGH 5K9QG 4J6RH 1JFQL 4WWID 3NN8A 4EI5A 1DBML 4Y8DC 3X14A 1XCTB 3RZCB 3T08A 2IPUG 4DGVH 3QPXL 1B90A 3TZVC 5F3HB 5FUCE 4V1DB 1U92B 5B38G 4UU9A 3VD5A 4LLVA 5E8NB 1KNOB 4CU6A 1QSEA 3H9HB 3TWCL 2YPKB 2R2CA 3GI9L 2EIZA 1PG7W 3SDCA 3BWAA 2HLFD 4WFGE 5KVGH 4PR5B 4F57H 2Z8WC 2E3VA 1P7QA 3MLUH 4LLWB 5GS1A 5EZLB 1QKZH 2CR6A 2FATH 4JN1H 5HJ3B 1KPVB 1OSPH 4X6BA 1N0XH 2GQHA 1KF9B 1YEEH 2NLJA 4X6DA 3FHAA 1AKJA 3PHQB 1CXHA 1TNMA 4MJIA 2EO1A 1QLFA 5DK2B 1ZHNB 3EGSA 5E9DD 3QDAA 5C0IB 3UCRA 2VZ1A 1MCLA 1RZGA 2OTUB 3TBYB 1YUHA 3U4EB 2HKHL 5T3XH 1UCTA 5FXCH 2ZKHL 5AUMB 3MYJB 1NCDL 3QULB 4ELKB 1HI6A 4JFXA 1EEQA 4MAYB 4U0RB 3X13B 3C5ZD 1T2XA 3ULVE 4Q0XH 3RX7A 5IW1B 4OIAA 1NKOA 4FTVE 3LRHA 4EOWH 5DURD 3OAYK 3OB8A 3NABH 3L7FA 1H3VA 4MSWB 5GZOC 3VGAB 2ICWB 3RIAK 3UTSB 5BVPL 3MV8B 2B5IB 1D9KB 4BFBD 4PRAB 3VG9B 2PYEE 1YMMA 2J12B 4DUWA 1LK2A 1N7MH 1KN2H 3KGRA 4P5TC 4G6AC 5I8OH 5A40E 4ODUB 5JDJA 1MEXH 4GW4B 2X44D 3TNNA 1XF2A 4TUKH 2UV3A 3G08B 5C6TH 1WZ1H 2EEAA 3N1GC 3CZFA 1I1FA 4DGIH 5J12B 4M5YH 3NFSL 5C0JA 5FO7A 4PJCF 2DJUA 4HHAA 4UMGA 4KK9D 4JY4A 3BE1H 4MNQE 4NHUA 4NRXA 1WFTA 5ADPL 1PZ5A 4UTAL 3SN6N 1IGTA 3E0GA 4F7MB 4UQ3A 4E9LA 2ZUWA 1J0KA 3CCHA 1LEKA 3OZ9L 4PJBE 4LSRL 3QIWC 5C09D 4HJ0D 3PXHA 5DFVC 3GNMH 3ARDC 1YEGH 4NKDB 4ZXBB 5D1QD 3H0TB 5IQ7H 1PLGL 4JRXD 1K5NB 3BN9C 1U8LB 1TPXC 3RWEA 2P42B 3B9KC 2ZNXA 5C7XL 4FZEL 4WO4C 5T3XD 3U0WH 1XGQB 5HPOA 4LAQH 4BSWA 1K4CB 5CEZL 5CBEB 1TTUA 2VITB 5T5FH 2WINB 1PAMA 1R3HA 3EJZC 4XZUA 5EZIL 3WNOA 2EXWC 4KI5F 4YH6A 5LXGL 3O8XC 5IB3B 3EO9L 1B0RA 4HLJA 4OUUA 1KJVA 4XCCH 3RAJH 2CKNA 3VXTB 5DMKB 1EEYB 2OL3H 3TYGL 1HOCA 1FHGA 1J05A 3QDGD 3WJJC 1M7XA 2EH8L 3PWPB 1P4BL 1T1XB 3QEUA 3C5ZA 3S5LA 3BT2L 2B0SL 5JPNA 4Q6IA 5A1AA 5JR1H 2R2EA 3DGCR 1DP0A 3SJVA 1U95A 4U4BA 3BGMB 3CFEB 1IC4L 1DUYB 3UTZB 1MIEL 1QQDB 2DQDH 1SVZA 4PJ5E 3ECBB 1MHPH 5I6XC 1NKRA 4NZUH 1QBAA 3QAZB 1QACA 1RSFA 1WC7B 4LASH 4TUJA 3CVIH 3DHMA 4QCIA 5DO2D 1B3JA 3TZVD 5D96C 4M1DL 1FBIL 3E6FA 2FD6L 2GHWB 2R29L 2DWDA 1NBQA 3P11L 4KAQH 4E41E 2V17L 2QJDA 5K9JH 2F54D 2O5YH 4HQQH 2D4FA 1URLA 4PJDE 3BRFA 3GI8L 2WV3A 1KIRB 4CGTA 12E8L 3SDXE 3MCG1 3TGXA 2BJML 1JZ5A 2B1HH 5HYJB 5IVXF 3V52L 4R3SB 3U7YL 3L6FA 4DGYH 4KY1H 1F3DH 1LE5A 3ETBF 3CSYB 4JZJB 1XGUB 5AAMA 4CL7A 2AS5M 1C8PA 4L4TA 5C6PB 2VLMD 3J7HA 4JRXA 3MRHA 3DTXA 4MZ2A 4OLUH 3SGJC 5HHQA 1LP9E 2OR8A 1F45A 5E6IA 3U1SL 1Q9OA 1JPFA 5F6IB 4GMTL 3GUTB 4MNGA 3U36B 2DD8H 1EFXA 3PL6A 5HHNA 1L7TH 3HUJE 1DQQA 1WFUA 3MRBA 3SQOH 3V5HB 2QBWA 3GSQB 1B0WA 2V9QA 4Y5VA 5D5MA 4HGWB 3SDAC 3NVQA 1UB6B 3A6CH 4UILH 3DYPA 1DBAH 3QDJE 4NC2B 2R56L 1MCCA 5IB2A 1Q0YL 2OSLB 1UWXH 4MMZC 2IANB 3QQ9C 5CKAA 3QDGA 5GSVB 5F21B 4KI1A 1C16B 3B9EA 4D94A 4OZ4A 5L88L 2AJVL 2V2WB 3JWDC 3MUJA 3VRIB 1OLZA 2ATPB 4OCSH 1EV2E 3V0WL 4JCLA 4NZTH 1MF2L 2CRMA 4KI5C 4J7RA 5HHOD 5JOPE 4P5TD 1H0DA 5ECJE 4G6AD 2BZDA 1XGTA 3RX5A 1L0XA 3SDDC 1U8JA 4P4KC 2IBBA 2Y07H 1UA6H 5SX5H 4ZUUB 3PWLB 3RVVD 1NGWB 4HJJL 3SOBL 3BD5A 3TZVA 2PXYC 2VDKL 4MA1C 5FYLL 4U1SB 5T1MA 5EU3A 2Q8AH 1INDH 3EOBA 5C2BH 1DLFL 4GUPB 2W9EL 4PJ7F 1IRAY 5EUKA 5E8OB 1NCWH 2F54A 1F3JA 1EH9A 3QIWD 3BZ4A 2V5TA 4OD3H 4XPAL 1CFBA 2GW5A 4DVBA 2DQTL 1RVFL 1G7IA 3CDGA 4MLIA 5F1NA 1EGJA 2NR6D 3BN9D 4W6YB 1BJ1J 2VLKB 1A9BA 3ARGC 4ZODA 5GIRB 4QOKB 4Y1AA 1YPZA 4ZSOB 2PW1B 4XPTH 2ZJSL 3EJZD 3GMMB 2EXWD 1KBGL 5ITBH 3G5VA 3O8XD 1G9MH 2OL3A 3BPOB 2FJGB 4OF7A 1I8KA 3HC4L 8FABB 2BVOB 1I9EA 1MHHA 3FT4A 3V8CA 1A7PL 1U8IB 4KROC 3SGEI 2VLLA 4X6CF 2IG2L 3QYCA 3C5JA 1RMFH 3K1DA 4HDIB 1S7UA 4U7KA 2FWOA 3OB0H 3QEHA 4AIZA 4L8DB 1M7IA 2BCKB 1TZIB 5TQ0L 3WXVL 5TQ2L 4JB9H 3GSWA 3REVB 2ZG1A 4KK8D 1HE7A 5CZVH 3V7AE 2H32H 1ZT4B 4Z77B 4NCC2 3JWDH 2FZ3B 5HHOA 5FFLA 4P5TA 1G9EA 1K2DA 4J1UB 1KSRA 4YDKH 3FQWB 1V5JA 2H1PL 3C6LB 2F15A 3ARXA 4JO1L 1U0QA 1CGSL 1ZTXL 4MJ5B 2XG5A 3H2WA 1B9ZA 1GIGL 5KVDL 2HFFA 5FCUH 4G9FA 4JFEE 1YEIH 1I8IB 5DUBB 2R8SL 2E9JA 5F8QC 5L8JB 4BA8A 3K8LA 4RNRB 3FTGB 3S88H 2GTZB 3D48R 4PJ5D 3IT8D