4NC1C

Crystal structure of tcda-a2 bound to a20.1 vhh and a26.8 vhh
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
QVQLVESGGGLAQAGGSLRLSCAASGRTFSMDPMAWFRQPPGKEREFVAAGSSTGRTTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAAPYGANWYRDEYAYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Cell wall-binding repeat protein
publication title Structural Basis for Antibody Recognition in the Receptor-binding Domains of Toxins A and B from Clostridium difficile.
pubmed doi rcsb
source organism Clostridium difficile
total genus 32
structure length 123
sequence length 123
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nc1C00
3L5XH 5J6HB 3DGGA 3ZKSD 2Q6WA 5ADOL 4IHOA 1KCRH 4UTAH 2ATPB 4PJ5D 3VCLB 4MA3B 1YPZB 2Y6SC 1JGVL 3WLWD 2VYRE 3IDNB 4Z7WA 5TQ2L 1PJ9A 5LWYL 2HT2D 2BSSA 4G43B 4GW5B 5MEQA 4HPOH 3WS3A 4KWUA 3BHBA 4JQVA 2IMMA 3TIEB 5F1IB 4JZJB 4G6KL 4BFIB 1U41A 4KROB 4EUPA 1RSFA 2PCPB 4RZCA 4YHPB 1OGTA 4RFNB 4GRWH 3GIZH 3DVFA 2XYCA 4MAYA 5JIPA 1B2WL 2LABA 1N3NB 5T1LD 4OM1H 3KPQA 3RWHB 3DECA 4KK5D 2J8UB 3QXAB 2XICA 4OUOA 3QQ4B 1PX3A 2J6EL 1PG7H 3V6OE 3CDGA 1R6VA 2HFFB 4NRZA 4OGAD 3AMKA 5DUPH 1FVDA 1F4WH 3GM8A 3LEYL 3P30L 5HTSA 1C5CH 4YFDB 3JV4A 5KSAC 5I74B 4GG6B 4TULH 1EDQA 3FT2B 3HKFA 1RUKL 4HS6A 4YXKH 1VKXA 1X5ZA 4P4KA 1AO7D 1QBBA 3GO1H 1MIML 3C9NB 1HSAA 3BP6A 1AGCA 3I3BA 4ODVH 5FIEA 5EIVA 5BVJA 2ZG3A 1E28A 4Z76A 1C16A 1QR1A 3U2SB 5CJBA 4L4TB 4P0DA 3MGOB 1QHPA 3QNXA 2BXYA 1U3HB 4JRYA 2W9EL 3EO0A 4KC3B 3PV7A 3HZYA 3BGMA 3WYRA 3BDYH 5DDHA 4EI5C 3FT3A 1NL0H 3ECBA 5FGCB 1MQKL 2GJ6E 2EDHA 2DWDA 3C6SA 5JMOC 4GRMB 1BPVA 3KPMB 2BY3A 5IFJB 3TBSA 4R4ND 1GOHA 4GH7B 3QXAA 3CNKA 1LP9F 4XPGL 4OUUB 2WBJA 4NZRH 5AD0B 1IMHC 4OCLC 4JO4L 2F19L 4WHCA 4OZGF 1MVUB 2F74A 2V5TA 1RURL 4LSVL 3O6LH 4ZO6A 3DPBA 5DVOA 5D96C 1AGFB 2XWTA 4XXDB 3TT1H 1ITBB 4KVNL 4NKIH 2P8MA 3U7YL 4OLUH 5EUKB 1BX2A 4OM0H 5DO2C 4ZUTA 2WUCH 4WEBL 4QXGH 3FB5B 1VADB 2F5AL 3AB0B 2H6PB 4K8RH 1A47A 1ETZA 5ACLA 5HHOE 2VLRB 4OLXH 5LKNA 3VRLF 4LARH 4GBXB 2P44B 3D69A 2ZUVA 1T1YB 4MB4A 1FL3B 3V0VA 3NCEB 2QV2A 1FDLL 1UFUA 3DX9B 4KI1A 1PAMA 5MHSE 2AXHA 2AEQH 2VWEC 2G9HB 3G6JB 4FG6C 3GSNL 3ZYZA 4NCC1 1I1FB 3FQRB 5HYQB 3WUZA 3BZEB 4RMVA 3ARQA 4KROD 4XMPH 3P73B 4R7DB 4DGVH 2EDRA 4WU7A 3DIFB 3N06B 1LEIA 3F7RA 5ALBL 1KLGB 1X6LA 1CZ8L 3DROA 3MA9H 1ZWIA 1CR9L 5JQ6H 1T2QL 4DZ8A 4XBEH 5ECJE 3IFLL 2WBJD 4WVRA 1M4KA 4S1SH 2A0LC 3BUTA 1SEQH 5GRJH 1CWVA 4DGIL 2H6PA 4RAUB 4KAQL 2R29L 4QRTA 3FRUA 1A3LH 2AEIT 3WIIL 3DSFH 1JPGA 3VD3A 1X3DA 3RUGF 4A6YB 4B5EA 4V2CB 4WHDA 5CMAB 4LF3B 2EDFA 3JVGA 5SWSA 1A2YA 2P1YA 2J1KA 3SKOB 1QR4A 1OL0A 2J8HA 1PW3A 4I0PC 4HIIA 3ZMRA 2BCKA 3ZKXB 1XMWA 4L4TD 4OBRA 3QXUA 1MI5A 4NWTL 5A3IC 3QJHA 2XKNB 3JTSA 4OFYD 1JGDB 1U36A 2CMRL 4XNQB 1T0NB 1NCTA 4XRCA 1E4XH 2E9IA 3CVHA 4XBGA 2FGZA 4YFEA 4KKCC 4M6AA 1QO3B 3KLAB 2V5MA 5KSUB 5H94A 5GRYA 4DWHA 5KW9L 3MXWH 1ZLSH 2X4SB 5F72S 3UPRA 3RU8L 1NAMA 1TZIA 1UKTA 1KEML 4S1QL 2IQ9L 3RNKB 4P2CG 4HIEA 1NCAH 3LIZH 4J3UA 1ZEAL 3MLVH 4GRLA 3TV3H 2ED9A 3ZDZE 5DLML 3KYOB 2DTML 1GGBH 2XI9A 2C3VB 5K9JL 3B6SB 4Z7OF 2MKLC 4E5XB 5TE6H 5HGAB 3F5WA 2MWCA 4RGND 1RK1A 1RI8A 2ARJA 3WXWH 2RBLA 4G7YH 5TDNA 3SDCC 2VLRD 2DWEB 5KSAB 1S9VB 1TENA 1PLGL 5IB1A 4YBLC 5EBMB 4P9MH 1UENA 3SO5A 2G60L 2AJ3B 4KKBC 5F7KC 1TVHA 2X42A 4ESKA 3L3JA 4HXAL 2V5SA 2D31A 2WIIB 3LN4B 2GHWB 1MFBH 3OPZH 1Z9OA 3MLYL 3FN0L 1U8KB 4L3EA 5IB2A 5F1OB 5CP7B 2BZDA 1EH9A 2BDNL 4LLYB 1KYOJ 2O5ZH 1KPUA 4R0LB 4EI5B 2DQUH 5CEZH 1I8MA 1N5YH 1K5NB 1KB9K 1H5BB 4HBQA 1WEJH 4F8TA 4Q58C 5HYJB 3OAYH 2VZVA 3Q6GH 2IQAB 3QWRD 4LSQH 4U3CA 1RJZB 5GSVA 4HUXA 3ESUF 3DV6A 2QR0A 2ATKB 4XXCA 4GRLD 1KCUL 1W0WB 3ARGA 3NABL 1BIHA 5BVPL 4LCCB 4KRLB 3BZ4B 1A6VH 5CEYA 3OKKA 1O7VA 4KDVA 4U0RC 2NX5A 2FJHA 2APWA 7FABH 3MRRB 1AIFA 2MPAH 4IOIB 3IFOA 3G5ZA 3ZKND 4K9EC 3ZT5A 2EDTA 4TTDD 3GMPB 4JHAL 4A6YH 1A4KB 3VFMB 3ZTNH 1AXSA 1BQLH 4M1DH 2VABA 4S2SB 1BGXH 2R0LH 1WWBX 1RZGB 3DTXA 2VQ1B 3P4OA 4L4VE 4ERSL 1N2RA 1F00I 1QSEE 1R3HB 2AKRB 3WNNA 1A7RH 5BJTA 1QPPA 2Y6SD 3V4VH 1DSFH 2CRZA 5EOCH 2HN7B 4KQ4L 2X5PA 5CCKH 5KSBA 4R96B 3MV8E 4NPYA 1P7KB 1V05A 3BPLC 3SQOL 1A6AA 1X5HA 1QRKA 3REWB 1JPFB 2HJLA 5MEOA 5E00A 4M48H 3PHQB 1UM4H 4WWKC 1IGTA 1IKFH 2DQIH 2HRPH 1ND0B 1X5YA 2P8PA 3IU4H 4BFEA 4D0BA 3GSVA 3EYQC 2I9LA 4I3RL 3CFBB 5KOMC 3QZWA 4E9LA 3BIKA 4ZQKA 4KK9C 1S78C 1YN7A 2J88H 3CC5B 1DDHA 2XXCB 1EZVY 2EYTA 3KPOB 5FKPA 2ADJA 3D18B 3TZVA 4MJIE 3U0PB 5GISH 3TM6A 5EZIL 4PRHE 2IH3A 4Y1AB 5KSAD 4YR6B 1NMAL 1P9MC 4FFYH 5DA4A 2AKRA 5ICXA 4NN5C 3T3PF 3TYFB 3OJMB 4U7SA 4I3GA 2GY7B 2HN7A 4MD4B 1NKRA 3DO3A 1IC7L 3FN9A 2QSTA 1NGZA 1BOGB 4GLRI 1P6FA 1AP2B 4YK4B 5A2KH 1B0GA 4EI5D 5IHBA 4LSPH 2O5YL 3QNYA 1C12B 4EZMA 4OZHF 3T2PA 3G9AB 3HUJF 4JRXE 5AYQA 4Z7VA 1D5BB 5HYJD 3QHTC 5K9QI 2DF3A 3NGBB 3ZTJG 1XGRB 1EMTH 4X5WB 4YQXL 5JNYA 3LS4H 3UZEA 5MEPA 2HVJB 5LGHL 5FV2A 5C70A 3FTGB 5D7JC 2W60A 3U9UB 4WHYH 1KJVB 4DUVA 5CZVH 5AZEH 1G7PB 2BY2A 1PZ5B 5B3NA 1VFBA 1I4FB 1X5JA 3IDJA 3H9SB 2Q8AH 3V79C 2X4NA 3TO2B 3CPLA 4D9QE 1P5UA 1M7DA 2FJGA 3EFDL 5IVZA 1CLZL 4I18C 4U1JA 1M6OA 1D5XA 4TUKL 3G5XB 5ESVA 2PXYB 2BHUA 4C59B 4U6YB 3K0WA 4DTGH 5DFTA 2VQTA 3FFCB 4PGDB 1EVTC 5DVMA 4U49A 4I0PA 2MQ3A 1EIBA 5DVLA 1QLFA 5E8PB 3B9VA 3CLFH 1FVEB 1ZAGA 3QEQB 3SDCB 1YNTA 1NSNH 3W5MA 4P3DB 2PTVA 3MA7A 5BRZA 4HUVB 2FD6L 2WNGA 1T7ZA 3K7UA 3PXHA 4YBLB 5DMIL 3OKEB 2APBA 5EIIA 1I8IB 3O3UN 3HN3A 4PJXA 2H45A 1NFDF 3VFOB 2EKSB 1REIA 3T04D 2DICA 1FL6B 4P23C 4EXPX 1CXKA 2JCCE 4HZLA 4FG6D 3DV4A 2YUXA 2UY6A 1WBXA 5DHVH 5TF1H 5BO1L 3MLPA 1F13A 1N8ZA 1ZA6A 2W9DH 5KOVC 1VACA 3P4MB 3GBNL 1PQZA 3GSRB 3RA7H 5KVDH 1LE9B 4OQTL 3ZKQD 3PUCA 4IOSD 3ARUA 3CZFA 5E9DB 4ZUUB 3UYOD 1R3LB 5EO1A 1Z9LA 4OCSH 5BW7C 5GS0L 1CICC 1N6UA 1TVBA 3NMEA 4XCYA 3HCVA 2X7LA 1NFKA 4IRSA 4Y1AD 5I17A 1WZMA 2P5EE 3MODH 3VW3L 5D70H 3S5LA 3MZTA 3P11L 2X4TB 3QFDB 3KS0H 4M43L 2ITDA 4U0RB 2BVPB 3IETA 1AQDB 4ZUSA 5C07B 1J8HE 4LSSL 4OTXL 2NXZC 4MB3A 1EV2E 4I0PD 3S98A 5T3XE 4XAWH 2YHGA 1ZLUK 5F7DA 5A3ID 2YZ8A 5BRZD 4KQ3L 2VZUA 4IEFB 1DTUA 3IXTB 4PGEB 4X9FA 4F3FB 1LE5B 2R1YA 3TCLA 3V9FA 1LO5B 4KKCD 3SDXE 1F3DJ 4HC1L 4HQQH 4NSKA 3AREC 3D25A 1FORH 5DMKB 4MCYA 3I2CH 1DBKL 1R3LA 3HMWL 3O4LA 3D87B 5IBUB 4OFKA 1DQJB 4YO0A 4JPIA 2GUOA 4CU8A 3QG6A 5ICZB 4WWKB 2ZCHH 1JZ5A 1CS6A 1CFBA 3N9GH 4JHWL 2FLRT 1J8KA 4Q0XL 1D7FA 3QXDA 2X4TA 4XP6L 2PXYD 1ES0A 3QFDA 1DQDH 1YEDB 2I07B 1HE7A 1N4XH 2VDLH 1UWEL 5C07A 3THML 3Q1SL 5HHNA 3FFCD 4ZFZB 1FBIH 4HDIA 2QTEA 2I9TB 1XAUA 1MCPH 4MQXD 5DR5L 1KF9B 3QEQD 4FZEH 4I0CC 3SDCD 5BMFL 2XWBA 4LLWA 4OLWH 5E7BA 1A0QL 4KV5F 3H8NA 3BT2H 4PGEA 3QO0B 1LE5A 3UC0H 4NN5B 5DJYA 1HK6A 3BWAB 4KKBD 3C5JB 3QDGA 5I19L 1MCOL 4DGYH 3BH8A 1EXUA 1Y6NR 4OD1H 5KVGH 3UO1H 3PQYE 3RJQB 5E1AA 4RIRA 4KTDH 1T66C 5IESH 2ZCKL 1FZJA 3QPQC 1N26A 1KJ2L 4PTUA 2DQGH 2A9ML 5T3ZE 1NANI 3O3AB 4YXHH 1BQSA 3IGAA 1D9KC 5DJAA 5C71A 3SE8L 5FYJD 4LLMB 2ZUQB 4ISVB 1XF4A 2ZNXA 4C83A 3AS0A 5JLZA 1R3IL 4ZOBA 2P8LB 3O2VH 5E5UB 3O4LD 4BJLA 1B0RA 2UWEA 4XHQA 4UNTA 5D7JB 2CKBL 3INUH 4HBCL 1GC1C 2QSCH 3GKWH 3QDJB 3WNOA 1FNEB 1RUAL 1MCDA 5ESQA 1EZVX 3MCLL 2UVEA 4FFWC 4AT6B 5GQBA 2GCYA 4I18B 5FXCH 4WFHD 5C07D 3K8KA 3S35H 4N1CA 4NN7C 5D5MB 1JV5A 4Z9KB 3H42H 1AJ7H 3G08A 1YECL 4EBQL 3FONA 4PREB 1X4XA 4K9EH 4KHXL 3T08A 1L0XA 3FB7A 2ZOLA 5E8OB 1YEJL 4N8CH 2X40A 3MOBL 4ORGB 4DVRL 4GXUN 1IEBB 1PVHA 2GFBB 3KYMA 4NM8H 5GJSH 4LFHG 1A5FL 4EDWL 2A74A 4LCUB 1RUMH 3RZWA 5DD6A 1RIUL 2CO6B 2DIBA 3QDGD 3UBXG 5BZDA 2W9LA 4MGXA 4DKFL 5L2KE 3NIFF 1U2HA 1QFWH 4P23B 5KS9B 2OSLA 2K9UA 2YR3A 2GJZB 1MCWW 3U0WH 2ZUYA 4BZYA 4K2UL 2BMKB 5HYEA 4WWKD 2QJDA 2PTTA 3HMXH 3EYQD 4JFDB 4TPRH 5TH2B 5FO8A 3G5VB 4KK9D 1S78D 4HS3B 4NDMB 4NKDB 5T1KB 1OPGH 4WJ5A 2Y07H 3BGFB 4AIZB 3T77B 4P2QE 4JY5L 3RY5A 3WMSA 4ZPTB 2H8PB 4C56E 3DETC 3L5IA 4FN0A 3SGEI 1CICB 3JBG7 3P0VL 2B4CH 3C08H 4XNXL 5C0AE 1EGJA 2XTJB 4NQSA 2OK0L 1QQDB 5CLTA 4X80H 1RZ8A 4O2FB 4LHUA 2JK5A 4PR5A 1QNZH 1B4RA 2V2WB 4F7CA 4BQCA 5DVKA 4WDIA 5ITFA 3PP4H 4TVPE 1MCCA 3EYOB 4M61B 2NXZB 4P59H 4AQ1B 4RMTA 2ZKHL 3FB6A 5LXGL 1BLNA 4PP2B 4RFEA 2O61A 3GSWA 3I3DA 4CJ0A 4LOUD 1S7RA 4O51A 1MUJA 1WCQA 3BUYB 3EW3B 3RRQA 4F7MA 1EHXA 4U1HB 3VG9C 4R26L 1F4HA 3SPVB 1A6ZB 3NFSH 5DEFA 4ZMAT 1Q9OA 4IS6B 2APXA 3DNKA 1CGSL 2XXMB 3KWWA 3MRJA 1ZT4B 1K8IB 2HFGH 2R2HB 1KEGH 4FQQB 3V52H 2F8XC 3GUTA 5DT1H 3N1GC 4AIZA 43C9A 4P5MA 2MJWA 5D7JD 5BW7A 3QUXB 5I66B 3MLXL 3RL2A 3OKNB 1T03H 2WV3A 3WL9B 2DLTA 1MJUH 4LAQL 1BM3H 2AABL 2HTKC 4JCLA 1VESA 5DUMH 3MRPB 1XR8A 1AQKH 1FLRL 2H26A 2RR3A 2AGJH 5CUSL 1VGKA 3QHFH 5HDQH 2IADA 4N0UB 4HWBL 2R0ZL 1KNOA 3ZZ1A 32C2A 3T65A 2DI7A 4BQ6A 2CH8A 2VN4A 5BS0B 4R7NB 5C86A 1PBYA 3O2DL 4QYOA 4XVJH 4LVOB 3MRNA 1HWGB 1G0DA 1QA9B 4AENB 4GRWF 1DE4A 4NZTL 3KLSA 4UV4L 4BQ9A 3HAEH 4F33B 4PJIE 1KTLB 3BN9C 3O8XC 1J1PL 3MNZA 5I6XC 4K23L 5FUCC 4P23D 4J4PC 3AREA 5DRNB 1Z6JT 2N7BA 3BO8A 4FQQA 1M7IA 2NZIA 3UP1A 3IS1X 5ANME 2P42B 5C0IB 2WANA 4UINH 1D9KB 3A6BH 4Z6AT 5GZNC 2H9GB 5I16B 1KSRA 1J11A 3I6LE 2Y1VA 2ZJSH 4W6YB 1L9MA 4NQTA 5T1KD 5B3JE 1EFXA 3WEXA 1RJCA 1KN2L 4KZDH 1F97A 2Z35A 1FGNL 1CICD 4YHZH 1YQVH 5F6HI 4D9LL 1X4ZA 5CINL 1JZ7A 5I15H 2CLZA 3IDYB 3M8OH 1FN4B 2QQLH 3D39A 3HC4L 1WK0A 3TBTA 4KTEL 4JO3L 1QLEL 4PB0L 1QA9A 4Q7DA 2P5WA 3QRGH 4YBQC 2YMXH 1Z9MA 4K94L 4RISH 4NN7B 1IE5A 2NXZD 2VOTA 4JVUA 1NBZA 4H0HB 2EH8H 4LPWA 4XNZC 4Z7WF 5JXAH 2NY7L 1LO3H 2E9JA 5HY9A 3CXDL 1IARB 1JMZA 4L1HA 4G42A 3PL6C 4P57A 2IPKA 1FYTE 5FA4B 1FQ9C 4AEHH 5C0IA 4Q97A 3VXNA 1D9KA 4QO1A 5HYSG 5TJWK 3UTZA 3NA9L 3REVB 2Z93B 3QEHA 5IHZB 1MFEH 3WFCL 2YBRB 1AR2A 1XH3A 2I5YH 3EYSL 1S9YB 1A1NA 3QIBA 1DEDA 3T2NH 1CD1B 3LEXB 4X8XA 4PY7B 5L8KB 1HHJB 1MHEA 5CZKA 5I2IB 5KVEL 2JJVA 1GXEA 5JMRA 4R8WL 2OXHA 4ZUWB 3R8BB 3BP4A 2PO6C 1C5DA 5T3XH 2VR9A 1EFXD 1NGWA 3ARPA 3MRKA 4DJMA 5DJZB 4PRNB 2GSGB 2R1WA 5LGKA 1G9NC 1XIWC 1YPZF 4J6RH 4F58L 2C1OB 3KR3L 4PRDA 4X98B 5DK2B 4NQDB 3WNKA 1HZHH 3RWCA 1U6AH 3ZHDA 3D39D 3DX6B 2AV7A 2F5BH 5BS0D 4CADA 1D5IH 3RQ3A 4M5ZL 5D71H 1CXFA 3RWFB 1EBAA 3TO4C 2MHAB 4XVSH 4X4ZA 1UM6H 2E6PA 1B6DA 4LIQH 1NMBH 3VG0H 2HWZH 1T66D 3U36B 1FFOA 1PYWA 4F7PB 3QPQD 4JO2H 5JOFB 2IALA 3VRJA 5CD3A 3VJ6A 5IEKA 5SWQB 3QJFB 4EXKA 2VDRH 1XF5A 1D9KD 1AKJB 2KQNA 4WUKH 1T7YA 3CFEB 4PJAB 3PJSA 3HI1A 4PJ8C 5HJ3A 3QQ3B 1HH6A 3EUUA 1Z0MA 4MNQA 5IMLB 2Y23A 3RX8A 3EYUH 1RFDH 4GG6F 3I6GB 4P5TC 1G7HA 3T4AA 4PRNA 2UYLA 4WENB 3FMGH 3ZYOA 3MNVA 4TSAL 5EU7E 3CFKA 5TDOB 1BJMA 3BPCB 5EZLA 2EIDA 3V5HB 5DK0B 4ODWA 4LLDA 1HHIA 1ZHKB 3S34L 1I3GL 1WBZB 4TN9A 4MZ2A 4TQEL 3VXSA 5F9OL 3OL2A 1AD0A 3ILQC 3WE6B 3MRMA 4DN3H 1A7OL 1RJYB 2VITB 4TNWF 1J9CT 1NUFA 4S1DC 2DM3A 2G2RB 2YD2A 2ZZUT 5T3ZH 4M7KH 2LAAA 5ADOH 2FIRT 5KSVA 1WFUA 1ZMYA 3HZMB 4IOFD 5E6ZA 4HH9B 3O2WH 1YMHA 4DUWA 1JGVH 1A7QL 3VXRB 4U3XA 5TQ2H 5I1DA 3GSNB 5LWYH 1A6TB 3VFWA 2AV1B 1WAAE 1M71A 3O8XB 4Y19A 5I6XB 1QSFA 2DN7A 4D9RE 5KVFL 1XT5A 2KPNA 1D6VH 2BJML 2E9WA 5E2UL 5AG8A 5EO9A 3NTCL 2I60L 1T80A 4TRPL 1B2WH 5H2BA 5FO9B 4Y5VA 1V7ML 3RDTC 5JW4M 4NRYB 5F7FA 1W72H 4P99A 5FYKL 5IHUL 3OAYK 3MV9E 2J6EH 5DJ6A 2P46B 3RGVC 4YDVB 3BVNA 3CFJA 2F9BT 2X1WL 3DETD 2W38A 1XGYL 5CAYB 4ZFGL 1RUKH 4NQDD 2DBLL 3LKSA 3LV3B 1MIMH 1GPOL 1JRHL 2DMBA 2AI0L 1KULA 4QRUB 5F3HA 3VXRA 3G6JF 1OD7A 4IMLB 1LO4L 3BEWB 1KIRB 3V6ZA 2VDML 2YKLH 5E1HB 4D94A 1YY9C 4X6EB 3LSOB 3OAZH 3Q5YA 1P1ZA 3O3EA 4LDOB 3QCVL 4KJYB 1T7VA 3L95B 2W9EH 4EVNA 1IM3A 4FS0A 2N7AA 3LKRA 4OQ1A 5JA9A 1A6WL 2YXMA 3ZSSA 3PL6B 2A6IB 3X14A 1MQKH 3L7FA 2EYSA 1AKJD 2ZSWA 4MQSB 4X6CA 3CUPB 4XB7A 3DX7A 4JLRB 2JB6A 1QBLL 4XPGH 3QIUA 4W6XB 2C4FU 4PJGE 4JO4H 2F19H 4BQ8A 5IF0A 1G7MB 1NCBL 3T0XA 1YNKL 1RURH 3ZLQC 4LSVH 5SWZE 1U3ZA 2F53A 3LKQA 2LU4A 4OCNC 1I8KA 1CDBA 2E5EA 5F6HJ 4R4BB 4M4RA 3M07A 2F54A 2VC2L 3WXVL 4KVNH 2IH1A 3U7YH 3VFSA 3MLSH 4R90H 1QRNA 1CVRA 4WEBH 3NPSC 4IMLA 1I75A 4PJCE 4YDJB 2XQYK 1KFAL 5H35B 1SJVA 4G8IA 1ZGLA 5JR1L 5HGBB 4KK8C 4M8QB 4X8JB 3O0RL 4I3SL 1KB5A 4HKZA 4ETYA 3FQXB 1QPXA 4Z7NE 1QZ1A 2KDGA 1HOCB 1UXSB 2KH2B 3VXRD 5LBSL 1FDLH 3DJ9A 1U8JA 5D7KD 3VFTA 1IL1A 3LPFA 1ZK9A 4LVNC 3MFFB 4QOKE 3GSNH 5EORL 1I7RB 3BN9D 3O8XD 3Q6FA 3NIDE 4I5BA 4LKCB 4J4PD 2C4FT 1YY8A 1IGYA 5FKAB 5ALBH 1WGOA 5JDSB 2CRIA 4PJFB 2EC9U 2XA8L 5BXFA 4O2EB 4PY8I 2I26N 3L3IB 4N8VG 1P84J 1CR9H 2QKIB 4PJEB 4BSWA 1T2QH 5GZND 3WCYA 3IFLH 1ZLWK 2NY0B 1JUFA 5DFVC 1G0XA 4PJDB 4OCRH 3RPIB 2PO6A 4DGIH 4HSQA 1N6QH 2Z9TA 2XG4A 2DQFB 4KAQH 2R29H 5IM7B 5C0FA 4P5TB 4R3SB 5HI4C 4CUCA 3WIIH 1CD0A 4WUUA 4JPWH 4M8QA 3SGKC 1XIWA 5EO0A 5TQ0L 1CDJA 2F54D 4IDLA 4JQXC 1JTOA 5C08B 1ZVHA 5F8RC 1HOCA 1KG0B 3P9LA 1QRND 4JFOA 5DQ9A 1HHGA 3BKYL 1LGVA 1FRGL 1OWRM 4OZFB 2V7HA 3TO4A 4YBQD 1DQMH 1RVFL 4NWTH 1S9XA 2GITA 4GKNB 2CMRH 4X4XA 1MJ7L 1SYSB 2VXTL 3QUMA 2YEZB 4B7IA 3PL6D 3T0EC 2XY2A 1HKLL 1G6RA 2C4XA 2VE6B 4W6WB 3B9KC 1BWMA 4O2EA 3KYNA 1MWAL 4NT6B 3TVMC 2EC9T 2QKIA 5KW9H 5C2UB 1F90L 4PJ8A 1FPTL 2FB4L 4D0DB 3RU8H 4PRPA 3P4NA 1KEMH 4S1QH 1LEGB 2X4RA 4AM0B 1QKZL 1P7QA 3RAJL 1ZEAH 2DQFA 3BRGC 4NYLB 3H7BB 5DLMH 3MRHA 2DTMH 4FXGB 3OAUL 5K9JH 3CH1B 5D8JL 4QKXB 1UJTA 3I75B 2C9AA 3NPZB 3QDAA 2E3VA 1A1OB 4L9LC 2E7HA 4X4ME 1N64L 3PWPB 1U8IB 3V4UL 3FAXA 1XCTB 2YRPA 1IBGL 3RGVB 4OZIA 4YIQA 1OTSC 1MF2L 2Y25A 5DD1L 1XIWD 2B8OT 2A77L 3MYZA 1BD2B 4PYGA 3KDMB 1PLGH 4NRXA 2K3TA 1J05A 5EBWA 5CP3H 4ZD3L 5HPMA 1J1XL 4PGJA 2G60H 4RQQB 3RZCC 3WFEH 1VFUA 1SJXA 1JPST 3U9PL 3TO4D 4HXAH 3D9AL 1TZHA 1D5ZA 4G6FB 3ULVE 3MLYH 3ARVA 4PPTA 1P2CB 2KQMA 3C60A 3FN0H 1SY6H 5T1MA 4RDQG 1RMFL 1LEGA 1NLBL 2FEEI 4Z7VF 2BDNH 4F9LC 4I2XE 1AGDB 3IDIB 5I1AB 1A7PL 4M6NL 4NQXB 3RWEA 1PGRB 2YZ1A 4IIQA 5DMGC 4UB0L 4CVXA 3RDTA 4XNMB 4HX1A 1S8DA 4PRPD 1T7XA 5C0EA 5I8EB 1U8IA 3RL1B 1J0YA 1XCTA 2EIEA 1YMME 4P5TD 3GMMA 1KACB 4QHNA 1CE6B 1KCUH 3KPRA 4L5FH 2BOBA 4ZO7A 1FGVL 3NABH 4DOHE 3OKDB 3VMNA 5T5NF 5BVPH 5I71C 2R69L 4S10A 1FO0L 3UDWC 1HILB 5ESAB 4XP1H 3PDOA 4X6BB 5FGSA 5C08D 1F6LL 4OAWB 3SGJC 4MX7A 4RQQA 2FSEB 4LSTL 1URLA 3ILQD 3NPSB 3EJJX 1Q94A 3RWJB 1KCLA 3V7AE 4S1DD 4ZNCD 3L9RA 2YXFA 3P77A 4OZFH 1NDMA 4DEPB 4HHAB 4NUGL 4PJXF 1JGEB 4GJTB 4WRLA 4RBPH 4ERSH 4XZUA 1G6VK 2Y7QB 5CEXB 1MH5B 4MJ4A 3O6FB 5DWUL 5J13C 4JJ5A 5IGXL 1T21A 5EUOB 4DAGH 4KQ4H 2D0GA 2AJSH 3UYRH 3IT8D 4LVNB 4HPYL 5DSCB 2UZYB 4H88L 4U6TA 5EWIL 3SQOH 1BZ9A 2WP3T 4KKNA 4DZBB 2FO4A 5C8JA 2FL5B 5IFAL 3QUYA 4BELD 5F7NC 3TPUB 1JNJA 4I3RH 1DLHA 4MMXC 4NC2B 3RDTD 1KPVA 4X6BA 3W9DA 3UCRA 3ULSB 3PWPD 3HNSH 2NYYC 3STBA 1INEH 4OCYL 1AHWA 4P2YA 3RGVD 5IMMB 1YJDL 5LAXB 1NBVL 3DMMC 4ODXA 3JV5A 4XWGL 1MCKA 4WW2A 1Q0YL 1U8MB 5EZIH 1CFNB 1F11A 3NZ8B 2Q7NA 4ELMB 1NMAH 4HGMA 2ZSVA 4WV1B 2VLJB 4WFEE 2W65B 4JDZA 2Y7QA 4YHKL 2QSQA 1JE6A 2ICWB 5A2FA 2ADGB 1BOYA 3TWCH 2HMIC 4EN3A 4XNYL 4CW1A 3IJHB 2GJ6A 3BYTA 4UIKL 1ZT7A 4G6FD 4M93C 3K2UL 1IC7H 3ELAT 3P0GB 1UJ3B 1L4IA 4ZFOA 4X6FA 2J4WH 5J1AA 3MROA 4L8CB 3ARBC 3RWDB 4LEXL 2O5YH 3T0EB 5ICYA 4JN2A 5DHVA 4QRQB 1U91B 4YQXH 4RMQA 5KAQF 5LGHH 3QEGL 1P4BL 2IANB 3S4SB 3LN9A 4OIBA 3W82A 4CNIA 2HVKB 4JY6B 3IFPA 5J56B 4MA8L 1F8TH 4JAMB 3V8OA 4PJBE 3SGKA 4HCRL 4XCNA 5HHOA 1HH9A 3CFDB 3OXSA 3EFDH 1CLZH 3MREA 2JKXA 2VLKB 5ALCH 2R2BA 4L9LB 4QXUL 4UTBL 2ZPKL 5EU6E 4EJ1C 5GIRB 1H0DA 3HI6L 1U8NB 2ADGA 2MCPL 1BWWA 1HQRB 3HC0B 1U58A 1UVQA 1C7SA 3T1FA 3OJ2C 2MNUA 2PR4L 2D9QB 4HG4J 2FD6H 3HPLA 5DMIH 4Q6IC 4PRAB 4O02H 5EZJA 4UU9B 4P9HL 3RZCB 4I1NB 2A6KA 3FFDA 1FZKB 2SEBA 3B9KA 3K1KC 3TVMA 3VRIA 1KJ2B 4B7LA 1CK0L 1LK3L 3MR9B 1MEXL 1UYWH 5BO1H 4RRPG 1L6XA 4MA1C 2AK4B 4H26A 2JB5H 2HVKA 4YHIB 4HZAA 3GBNH 2XV6B 3ARFB 5E5MA 3BEVB 4OQTH 1OARL 2UWEF 3TIDA 3NACL 4NIKB 4KRMB 1EHLL 2CKBB 2V7NB 5E6IB 1VPOH 4JB9L 5DFVD 1RZJC 5A2LH 5GS0H 2A73B 1CFTA 2V6HA 5HI4D 1ZA3B 3UTTB 1CDYA 1KUMA 4N1HB 4O5LL 5I71B 3VW3H 3OR7A 3VXTA 4BUGA 3AAZB 2VLJD 3ARDC 3GGWB 4K94C 4XP9L 3P11H 3ZDXF 4X7FC 3V4PH 4M43H 1LP9E 4OB5H 4LSSH 4OTXH 4DKEL 3G6DL 4OZGE 4GUPA 2CLRB 4EUPG 2F8OA 1JPTL 3VFPB 1MAJA 2FJFA 2YD7A 3RBSA 1DN0B 5JOPE 5IBLD 4KQ3H 3TNNA 3U7WL 2OTWB 3TBYA 5E8DL 4JANB 5F7EL 5TGBB 5C6PB 4NQVA 5F70A 1SQ2N 1TJGL 4XPFL 4YHIA 4MJ5B 1J5OL 2GSIA 3F12B 4HIHB 3T0ED 1GGYA 5DYOA 1JNLL 2EE3A 4Y5XB 4HC1H 3TVMD 3OKMB 5DHYA 5C7XL 4AIXA 1DBKH 4KKLC 5EN2B 1W8OA 1BFVH 3VRLE 4PD4J 3HMWH 3KLDA 1WTLA 4BSVA 2IAND 4WEMB 3FT4B 4YHYC 5EIQA 3JV6B 3V7AG 5EDXA 5FHBL 3QXWA 3QA3B 4JHWH 3OX8A 3B4NA 4JGMA 4Q0XH 3LOWA 1H3XA 4PRBB 2VDQL 2VLKD 3OF6A 4ONHA 1JYVA 5DS8B 1IGFL 3OKOB 3THMH 3SGJA 1UWEH 4U1MA 3Q1SH 2X1OA 4DN4L 5I1LA 3OSKA 3VXUE 5IK3B 3STLA 5EC1B 2OL3A 1RU9H 5GSRB 4KDTC 2CKNA 5DR5H 5EOTA 3R8QA 1OTSD 4HKXB 4XMLH 5BMFH 3WUWB 5J1SC 4KDWA 2F8VA 1A0QH 2OJEA 5FOBB 1KGCD 4Y5YB 3H9YA 3DRTB 1K8DA 4EI6B 1JZ6A 5D1XB 3RZCD 6CGTA 2UZIL 5I19H 3H3PL 4PRIE 1MCOH 3OKMA 4MNHA 1OAZL 2L7JA 1KIPB 4M93B 4QRRB 2ZCKH 4OKVB 4UDTB 3VI3F 1KJ2H 2AK4D 3RUGE 4G5ZL 3BESR 3S96B 3ARBB 1ZHBB 1II4E 5B4MD 4RWHA 3ZHLA 5DMGD 5H8DA 3C87A 5IV2B 3LKPB 1NGXA 1WICA 2HH0L 4EIGB 3LRGA 1EEYA 4LHJB 1U8PB 4JQIL 4NO0B 3HMXA 2CKBH 4HBCH 4BZ2L 5BQ7B 3DMMA 1CE1L 5J6GB 1RUAH 1TDQA 1B9ZA 3ZE0F 5KZCB 4LCIL 1DBJL 1T5WA 4AY0A 4HK0A 2Y5TB 3GNML 1JNHA 2BNRE 5JPNB 4EIZC 4L4VA 3BOVA 2Q8BL 2DDQL 3QG7L 4XCCH 4Y16C 1ZHLB 3EIFA 4N5EC 2RQ8A 1YECH 4EBQH 4PGBB 1ED3B 2AEPL 4JHBA 3CLEL 4KHXH 1KIPA 1OB1A 3CSYA 1RZFL 3B2VH 3MOBH 3MV8A 5E94A 4C54A 1CQKA 4LCYA 4DVRH 3QIWC 4X83A 2BVOA 4ETQB 4Q6IB 3LKNA 3ARBA 1A5FH 4EDWH 4LK4A 3ORJA 4ZPVA 3S7GA 1RIUH 1ERNA 3UTQA 1KENL 2X10A 1KC5L 4DKFH 3BD3A 1XGUB 2AJXL 1WWAX 2A83A 2VXQL 3I3EA 3RWIB 3EFFB 2BSTA 1K4DA 1OSPL 2G5RA 4Z0XA 4MA1B 2WQ8A 2FECI 2LAGB 4RGOL 1U3JA 4MJIA 3C8HA 3MJ6A 2EYRA 4XP5L 3VFVA 2YN3A 1CGWA 1XGPA 4U1SA 3VFGL 1Q9LA 4PRHA 3MRGB 3VGBA 3O6KL 3ROOA 3FO1A 1ADQL 4LSRL 3UBXB 4E41B 3IKKA 1T1WB 2NYYD 5F7UA 2NY2B 4JY5H 2MQCA 1NC2B 3B5TA 2BNQE 4CVWA 3DMMD 3GI9L 3OJDB 2Y4SA 4QT5B 5FF6A 4H1LG 4XNXH 2DQHL 1TITA 2HFEA 3F65A 3GMQB 1FNSL 1OT2A 2RFXA 4QRPE 1Z3GL 2CDEA 4PJ7B 1T1XB 1W0VB 1J12A 2NW2A 4CAGA 2DQDL 2HMID 2ZKHH 5LXGH 1FAIL 3QI9C 5ERWA 3K81A 4JRXA 1TNNA 4GAGL 4QRRD 1ZVSA 3WFDL 3EOAB 2DJUA 4XC1L 5GHWL 3KJ4C 2UV3A 5HVHC 3A6OA 3HAEA 1XF3A 1N6VA 1Q9KA 3ARBD 1AGBA 2E7BA 4R26H 1GOGA 2R8SL 3MV7B 5E6YA 4CMMB 5JORA 3KG5A 1HDMB 3TBWB 2IPTL 3AS2A 1CGSH 4OJFL 3ROLA 3MRQB 4M1GL 3UAJC 3LKOB 3ALPA 1F6AB 3W39A 3D48R 3JSSA 2Y36L 3ME0A 3GB7B 3MLXH 3KHOA 3HNTL 3QEUB 1WIOA 4PRHD 1SBBA 3ARDA 1WWWX 4LAQH 2AABH 4JZOA 3C5ZA 4HXBL 4EQ2A 1UB6A 5A2JH 3FOMA 4TNVK 2VO5A 5CUSH 4PJ7A 1Y0LA 5IB4B 1YDPB 5ID1A 4RX4A 4HWBH 2R0ZH 2JJTC 2ICEA 4HUMB 1INQA 1FJ1B 1NEZB 1U8QA 1HCFX 2JCCA 3O2DH 4FQIL 4QHUA 1H3PL 1JGLL 2NTSP 5KJRL 4NZTH 2AP2A 5HI3C 4UV4H 1NH6A 1JJUA 2B1HL 4NUJB 4U2YA 5FM5M 5IG7A 3OAZK 2X70B 4K23H 8FABB 4E42A 1G7JB 3L3HB 4OF0A 2HG5B 1IAOB 4RFOL 4QCIB 3OKLB 4F7EA 1JFQL 4FRWA 1MIEL 5HHMB 3SJVB 5JO5A 2FHFA 3T3PE 4FQJL 1F3JB 1BFOA 3QDME 4LFHD 2P5EA 2X4PB 3ZE2F 4E41D 1VHPA 1FFNB 15C8L 1NC2D 3CSPA 3EOBA 3SKNA 1FGNH 1J8HA 2YC1A 1AY1L 5CINH 4OZHE 3LHPL 5JPMB 3HUJE 4P2RE 5LGJB 4YC2C 1FJ1A 3HC4H 4ONFH 3ARDD 2ORBH 4KTEH 2PF6A 1TCMA 1U8LB 5FHAL 4PB0H 4RAVA 5DFWH 3VXQA 4O58L 3M17A 3E8UL 2V17L 1KIQB 4LQFL 3B43A 2A6DB 3SDXA 4YJZL 4HJJL 5D6CB 4YHNB 4YNYB 4AEIL 3F62A 1CU4L 3OKLA 4PJHB 3QZWG 1DN2A 1CGXA 3UTSE 5FUZL 1F45A 3MV7D 5ISZE 3ARXA 1FCCA 3CVHL 5D93C 3NA9H 1YC8A 3WS6C 4M7ZC 3WFCH 3MLWL 3WD5L 1BAFH 2YPLB 1RQ5A 4KKLD 3EYSH 1T5XB 4J23A 1NAML 3VD7A 2CGRL 1FHGA 3MUZ1 4JPKL 5CGMA 2J7LA 2Z91A 2AERT 3X3FL 3OWEA 1X5IA 2YK1L 2PUQT 3DRQB 4QTHB 5F93C 5MERA 1NFDE 4ZFFA 4R8WH 5IW6A 3T0BA 5HYSB 5BCAA 4U1GC 1CG9B 3PWUB 3SCMC 5I1GL 5DJ8A 3BH9B 3IVKB 4Z7UB 1J8HD 4Y16A 2LVEA 4F58H 1G84A 2ILLA 4APQA 3FOLA 1KPRA 5GGVY 1J18A 4U1LA 3KXFE 3KPSE 1CN4A 3PQYA 4M5ZH 1MLBB 5GGRB 3ILPA 4YUEL 1T1ZB 3QIWA 4N90E 5AWNL 4UV7L 4X7TA 2NLJB 4N0FB 5FDWB 3QI9B 4J3WA 3FB8A 3RVVC 2IPUK 4LASL 4ZO8A 5IMOB 4X6CF 3CVIL 3SDAB 5JDJA 4G80B 4P5KA 5HHMD 3SJVD 3KJ4B 1FVCB 2PYEB 4KJQC 3GZKA 1CT8B 4OD3L 1PSKH 2WW8A 1HNFA 5SX5K 5ILTL 3UEZA 1LVEA 4WTXA 4JFHD 4WWID 5AUMA 5JTWA 3RVTC 2V5YA 2AJVH 5I75C 1P84K 5HYSA 1MHCA 1OGAB 1YEHL 4U6XB 1CDCA 2OTUB 4JFQA 5BZWA 1IZKA 2BVEA 3BXNA 3NCFB 4HUUB 4BSJA 4TSAH 1W72A 3EBAA 3U6RB 1T89C 5LQBL 4LVEA 4WY7L 3NN8A 2BOCB 5CJQL 3S34H 1I3GH 3RP1A 1X7QA 4TQEH 2P43B 1OCWL 5F9OH 4K71B 4UQ3B 3DOSA 5DURB 2OMNA 4Y4HA 2GY5A 4G8GE 4NFCA 4OIIH 4Y2DC 3MRDB 5CKGA 1A7OH 4H5SB 2DLIA 1KCVL 3D3VB 1R5IB 4Y16D 2NNAA 3O3BA 5JHDB 5DMYA 4N9GB 3QI9A 1TTUA 3N1QC 2VR4A 3PHOB 5L2KA 4L3CA 2ESVE 2X9YA 4X9GA 1A7QH 3L3DB 1WC7A 3IDMA 2X1XR 3QIWD 2P7TB 4HEME 1QFOA 4XGZB 1Q72L 4G9DB 2EDXA 3L6FA 3F7QA 2WINA 1I7TB 3E2HC 2XN9B 2YPLD 2BJMH 5E2UH 3PABB 3NTCH 5E99L 4Z77B 1CXEA 5C0DB 4P2QA 4LGPB 4TRPH 2R0WL 3U7AA 4NZDA 4C56A 1F6FB 4Y88A 2NTFB 3OZ9L 1YJDC 3VD9A 1J0ZA 3BMWA 5FYKH 5IHUH 4LLUB 5C0AA 1ACYL 4MD0B 2V2XB 3HTLX 4LLVB 5F88A 4KMQA 2D7PA 4KUZL 3S9DB 3OMZA 3AU1A 2XKSA 1I9IL 1XGYH 2R15A 3U46B 4ZFGH 3GMOA 2CXKA 2JJTA 3SE3C 4WEUD 5JW5A 3FO9A 1GPOH 4Y8DC 1QLRB 4YC2B 1JRHH 6FABL 2AI0H 3PWLA 3V5KA 3U83A 4BK5A 3LPWA 3VGAC 1LO4H 2P7TA 1FLTX 1EEZB 3BKCL 1HKFA 5IMKB 5J57B 2BSED 3MCG1 1UWGL 4NBZB 4HKJB 3QCVH 4JFYB 3QI9D 4L29B 4NNYA 2HA1A 4PJFF 1DANT 2ERJC 2DBJA 1A6WH 5L2KD 1YUHA 1KB9J 1MWAB 3DXAE 4PJEF 4RBPK 1NJ9B 3FO2B 3PABA 4Z77A 2NW3A 2PYED 3GHEL 4GSDH 2E8ZA 3BD4A 2AAVA 3HC3L 4PTTA 5I8CB 4U1KB 1SJEA 2YD3A 1SEBB 1QBLH 2DJSA 4BKLA 1MPAH 1IILE 4QWWC 5MP6L 4LLUA 1JF1A 5DQJA 1J0IA 3MNWB 1NCBH 4M7ZB 4S1RL 4MMZC 4BFGA 2Z4QB 4JG0L 3HR5B 3UAJD 3KNBA 4P2QD 3E6FA 3UMTA 4IMKC 5E5RB 4C56D 1UACL 4JFFB 2VC2H 3WXVH 3PGCB 3G6AA 5HDBF 4OZIF 3MACL 4FQ1L 4ZTPH 3MCKA 4G9FE 5IVXE 5DURD 5C0AD 4J12A 5K93A 3TGXA 3NIFE 4U1GB 5L7XH 2AJZB 5TDPB 5K9OB 1KFAH 1UZ6F 3SCMB 3RI5K 3D3VD 4ONOA 5JR1H 5D1ZA 5JHDD 1ODAA 5FYLL 4KMLB 4MNGB 2PW2B 2YSSB 3O0RH 5DZLA 5F1NA 4X9HA 4PJIA 1QVOB 4LCWB 4P9HC 1LNUA 2QSVA 1K6QL 1R5WB 2Q76B 5LBSH 3FO2A 1YA5A 3NCYS 2ADIA 5D6DA 2FH8A 5H37G 1BQUA 1G9ML 4PG2A 3U0TB 4UUJB 5I8CA 4F7TB 5ANMA 1QBAA 5EORH 5D2NB 3C8KB 3ZSTA 2WWMD 5C0NC 5IR1B 1C5BH 5C0BE 2BC4A 3EOYG 4LMQI 1A1MA 5FECB 4EOWL 3PV6B 2WIMA 3RFZC 1IT9L 1M1SA 4UT6L 1SYVA 2AXJA 2XA8H 5EBGA 3MC0A 2FIKA 1FYHB 1KJMB 5CBAB 2WUBL 3FQTB 3MJ9A 4HFWB 1VSCA 4NQCE 4OD2B 4JM2C 5I75B 4U1IA 4YAQB 1MJ8L 2AJZA 1FO0B 2X09A 1KT2A 2CLVB 2VKWA 3O41A 4QHKI 2X4OB 3AC0A 3BRDA 1CGUA 1BEYH 1DEEB 5GGVL 5TQ0H 1DBAL 1S5IL 4V1DE 5D2LE 1H3TA 1R0AL 4CVZB 1BBDL 2W91A 2DLFH 3R06B 4N8VB 3ZE1F 3H9ZA 3C6LC 3U4EA 5I0ZA 4NBYB 5EPMA 4M3KB 1FYTA 2BVQB 1S7TB 3ARYA 4K7FB 4Y2DB 5CP3A 1RVFH 3PWNB 1XZ0B 1JBJA 1C08B 2XZCL 4X4YA 3BP5A 1K3IA 4CJ1A 2VXTH 3L3OB 2X4UB 4FQCL 5D7LE 2OR7A 1I1AA 1HKLH 1HHHA 4M62L 5CJ8A 4I77L 4O00A 1MWAH 5CIPB 2FZ3B 1SY6A 4K55A 4UT9L 1QEWB 5ABDE 4GMTH 3L5HA 1FPTH 5GGUB 1C1EH 1UKSA 1UCBL 2XNAB 5FYJL 3E2HB 3B83A 1DVFC 1MREL 4QHMA 1H8OA 3GMRA 1NLDL 3OAUH 2CJUL 4MAUH 1T89A 3QH3B 5IQ7L 4PJ9B 1IM9A 3BQUC 5D8JH 4GRWE 3IFNL 2X44D 2FYYB 1E6JL 1NAKL 5INCB 3GSUA 4UDUA 1N64H 4HT1L 4YHML 1V5JA 5C0CB 3V4UH 3AUVA 4PS4L 1EUTA 3JV0A 1IBGH 5FM8A 3SCMD 4YHLL 5C6TL 5GGSA 1UH2A 1CBVL 4MWFB 4OLVL 4K7FA 1MF2H 1YEGL 3HLAB 4MDJB 1XZ0A 1K9TA 4QHLB 5FO7B 4LCWD 3B3IB 2WBWB 4GAJH 5IEHA 4ZD3H 4PB9L 1J1XH 2VZ1A 5C09B 1X5LA 1XGQA 2ZUSA 3WKML 4Q2ZA 3U9PH 4HGWB 3VGAB 4X9IA 5F71A 1QEWA 1AO7E 1JK8B 1YEFL 1X5XA 2ZUUA 4MCZB 1NLBH 2XNAA 3RVVD 2ERJB 2M1KA 1A7PH 4M6NH 5JUEH 3B5HA 1GCFA 3KPLB 1N5AA 1BZ7A 2OI9C 1KN4L 1EA9C 2XT1B 4LSUL 3QH3A 4UB0H 4CN1A 4KJQD 1SM3L 1TZGH 4YZFE 1ZANL 4NZUH 3VFRA 2FYYA 1HINL 4TSBL 1HQ4B 3HNVL 4HLZH 3W9EA 3E0GA 3GBLA 1DQTA 3RVTD 3DVNA 1U95A 4ELMF 2BHZA 3L3KB 3O11A 1LDSA 2NMSA 3P9MB 2R69H 5GS2D 1FO0H 4NHUB 2ADFL 4J1UA 3TESA 1JPSL 4AEFA 2IBZY 4RNRB 4WIQA 1PKQE 3VWKC 1AGEB 5TPWL 4FFZL 3EO9L 4GS7C 3EJYC 3GMLB 4IRJC 3M1BB 2QQKH 1GGIL 3LQAH 1IEAB 4Y2DD 3IKCA 1MJJB 3B5GA 1NMCB 1JK8A 1K2DB 1QYGL 5J8OA 4NUGH 3PF2A 1QFWM 5ENWA 1WAAA 3K4AA 1FC1A 3WN5C 2A9NL 2EDQA 5DWUH 3C5SA 4F80A 2FBOJ 5IGXH 3OR6A 3QNZA 4HIXL 5GZOC 4X99A 4X6DB 5K9KB 3GSXA 2JELL 1ZKAA 5J1TC 2AEWA 2XWJA 4HPYH 1XCQA 4H88H 5EWIH 1YPZE 3HZKB 1IGJB 5CIPH 4WO4C 1NGYA 2H32A 1S7QB 4FTVB 3O6ML 3MV9A 5IFAH 2VUYA 2YPKB 3F6IA 4MAYC 2EDWA 1X5FA 4OLYL 4QF1B 3ES6A 4PJ9D 4CDGC 4RWYL 3VGHA 3WNPA 2D4FA 4G8FB 1VEOA 1E27B 2DKSA 3HZVB 4Y4FC 5E8EB 3RY4A 5C0CD 1MCSA 4JFPB 3T3MF 1BVZA 2M26A 1YJDH 3DYMA 1BJ1J 1NBVH 2CSPA 5IQ9B 2Z8RA 1QSZA 5F9JB 1INDH 4XWGH 1Q0YH 2J8UE 1OF2B 3IJYB 4C4KO 4P4KC 1K2DA 2D03H 4JFEB 2BXZA 3HE7A 3MMEA 4P4RB 1NCDL 4YHKH 3GJEB 2V2TB 3PWVA 5C09D 1LEKA 3I6KB 1EGJL 1YC7A 4U1NA 4GG6E 3MRBA 2KZ1B 2D7QA 5L0QC 1RV6X 1CL7L 3QHZL 3GSOA 3PGFL 4EDXB 3K2UH 3ULUL 2VIRA 2W0FB 4U3HA 5HD8C 4Z78A 3W0WB 4MSWB 5ID0A 4PJGA 2DMCA 3Q5TA 2B7DT 4MHHI 4LEXH 4ZSOB 4L4TE 4Z8FL 4NQEB 2I25N 3QUKA 5SWZA 3Q0HA 5IT2L 5I1CL 3MJ8B 5BV7L 3UJIL 2VAAB 1JNNL 5I73C 3NFPB 3F7YB 4LP5A 3RNQB 5KANI 4JZNB 3MQIA 4HKBB 1R3JB 3DARA 5MENB 3PXJA 4QWWD 5EBLB 3QEGH 1AE6H 1IAKA 5FGCE 4JM2A 2E7CA 1U92B 1VFAB 4OI8A 2DL9A 3HG1B 4PJCA 4QHKJ 5CS7A 1HSBA 2X4QB 3VE0A 1OF2A 3VFUB 3BZFA 4QGTA 3AXLA 4HCRH 2DQTL 5DJCB 1FC2D 4NNXA 3BQUB 1IKNC 2X89A 5DJ0A 3T0VA 5F21B 4P4RA 4KRNA 2ZPKH 4XCEA 3EYFB 5GGTA 1XR9B 2XOTA 3ARSA 3HI6H 3K74B 3DGCR 3C6LA 4N9OB 3TJEL 2OMBA 1JZ4A 2PW1B 3VXPA 4JM4L 1DQQA 3PHSA 2PR4H 4OLEA 4Q74A 1LK2B 3OXRA 2X9XA 3MX0A 3X11A 4QOKA 1S7VB 4FQHA 3H9HB 4PJ5B 3RKDC 1Y18A 4ODBD 1T04A 2GTZB 2OQJB 4ONGL 5D7SL 1BBJB 5HHXH 4P9HH 2VLRE 2VAAA 3RIAF 1UB5B 4XX1G 3DVGB 1CK0H 1TETH 1LK3H 5MENA 3KJ6H 1KLUB 2BSRB 2R56L 5D7IB 3VH8B 4M7LT 1RJLA 4FTVD 1HIML 3AM8A 2OLDA 3IDGA 1DVFA 3VFNB 4CMHC 5SWZD 3G6JE 2VL4A 4GKSB 1OARH 5F89B 2P48B 3NACH 1OLZA 1A4JA 3O9WC 2C7UA 1CDUA 5CEZE 3VXMB 3WIHA 1FV1B 5DEZA 4JREB 5J12C 1SJHA 3JTTA 5E8NB 4Z7QF 4JB9H 3IXAA 4JM2D 5C9KA 1WUNT 2Q87A 2OS7A 3ZT6A 4I48B 5B22A 4M9PA 4MJ6B 1RUQL 1Q1JH 4QXWA 2B1AL 4O5LH 3MRLB 4LNVA 1IAIL 1LK2A 2EDBA 3DI2B 4JFED 4JGJA 4XP9H 2VXUL 2XZQL 3MZGB 3JVGC 5EU3A 3VWKB 1J0JA 1N0XL 4DKEH 4LU5L 1Z5LA 4H20L 3G6DH 4GS7B 4WW1B 1VFOA 3E3QC 3C6LD 4IRJB 4ALAL 2GKIA 5IIEA 1L9NA 4YXLH 1JPTH 3PP3H 2FWOB 3C8DA 4RMUA 3VGDA 2R2EA 1HEZA 1VCAA 2VQUA 3DGGB 2Q6WB 3U7WH 4IHOB 5E8DH 3W0WD 4P46A 5E2WL 1TJGH 4XPFH 1J5OH 2G75A 3WN5B 4Z7WB 4NQED 2BSSB 4WTWA 5MEQB 1JNLH 3WS3B 2QHRL 3BHBB 1UG9A 2DIAA 1FZMA 3VXMA 5C7XH 1P4LA 5MEND 3QRFM 4EUPB 1CXHA 43CAA 4RZCB 4X4MA 1A14L 1OGTB 1ORSA 1MFAL 1DVFD 2FCBA 3HG1D 4K7PL 3UJTL 2WQRA 4MAYB 1ZS8A 2XFXA 4MJ6A 3KPQB 3QPXL 4H8WH 3BQUD 4ELKB 5IBTH 1GC1L 1MRCL 2W07A 1IGFH 3FL7A 1EHNA 3CDGB 4DN4H 4NRZB 3RHWF 1UQSA 5TE7L 4K7PX 1FVDB 5E0QA 5HI5C 1U8OA 1YYLL 2HKHL 2YD5A 3PDGA 3JV4B 1LDPL 4UT7L 2GYSA 4HS6B 1GGTA 1VKXB 2Q20A 4P4KB 3RTQA 5IOPA 2JTDA 1HSAB 3EZJB 4P3CH 3BP6B 1AGCB 4ZG1A 3TNMA 3WN5A 4L8SA 3N85L 2ID5A 2COQA 5BVJB 4KJWC 1E28B 4Z76B 2NY3C 2UZIH 4X7SL 5IW1B 1C16B 1QR1B 4WGVB 2EXYC 3H3PH 5L0QB 2P47B 2CXGA 4K3JH 3M45A 2E7MA 3QNXB 1OAZH 4GAFB 4JRYB 4YDKH 1FNLA 5FOJA 2OJZH 3EO0B 3RJDA 4C55A 4NWUL 3HZYB 3WDJA 3TN0A 3BGMB 3ZDYF 4WNQA 4WO4A 5DDHB 3FT3B 3V2AR 3QWOA 4G5ZH 3ECBB 3MLTA 3VWJA 2DWDB 3C6SB 4N0YH 4XVTH 1YMMA 1ADQA 1ZT1A 4HPOL 5DJDA 3TBSB 5J9PA 3GJFA 4ELKA 2CDFA 3VXMD 2WBJB 4NO2A 4ZXBC 2NR6C 1PD6A 3BMVA 1Y6KR 1YEIL 2HH0H 4Y4FA 2F74B 2JJWA 4XXCC 2Z8WC 4JQIH 3ARGC 4BZ2H 3SO3C 5HYJE 1CE1H 2XWTB 4GKZA 4I4WA 1DUZA 1T3FA 2NPLX 1I7ZA 4LCIH 1DBJH 5FK9A 2P8MB 2VDOH 4PJ7F 5IROA 2VXVL 1BX2B 3GNMH 3VWKD 4ZUVA 5JW4N 4ZUTB 2Q8BH 2VL5A 2YWYA 2DDQH 1CFVL 3QG7H 3EJYD 4IRJD 4KXZI 4EKXA 1C5CL 5IW1A 1ETZB 4LBEA 1AXTL 2AEPH 5LG1A 3D69B 5FA3A 4HUWA 3V0VB 2FBJL 4FA8A 5HGDB 1RZKH 3HRZA 1OTTC 2W1NA 2X41A 1ONQA 3GDBA 4OFIA 1KENH 5GZOD 1KC5H 4DFHA 4OCXL 1WZ1L 3W2DL 2EDEA 4Q9RL 4PV9A 1WZKA 2LU7A 2VXQH 2XIDA 3DURB 2LTQC 1I3RA 4WO4D 4WU7B 5A43C 3BDYL 1OSPH 1BMGA 1LEIB 5J11B 3ARWA 2EEAA 1XF2A 4EUPH 5IW3A 5F1KC 4MAYD 1YMMD 3DROB 2VWEE 3OJVC 1ZWIB 1BF8A 3VFGH 4MZ3A 4DZ8B 1W8NA 1IKNA 3O6KH 5ADPL 5J89A 3TZVC 4LSRH 2WWKO 4RGNB 4W4OA 5J12B 1ZTXL 4L8BA 4QRTB 3FRUB 4CN6A 3LQZA 1MOEA 3GI9H 5AZ2L 1JPGB 2ZUTA 5IP4A 4P4KD 3R1GH 2DQHH 1K4CA 4FMKA 5HGDA 5SWSB 1A2YB 1FNSH 1RIVL 2E9BA 1Z3GH 3CXHJ 4HIIB 4POUB 4TOYL 2BCKB 4Y1AE 1GGCH 4K8RL 3MGTA 1MI5B 3KGRA 3QJHB 2CRYA 4X5XA 3JTSB 4JRYD 3ZHKA 3DURA 5HD8D 4XC1H 4XRCB 3CVHB 4XBGB 1JHKL 3OHXA 3OGCA 2E7LA 2R8SH 5H94B 2AEQL 3I02A 2NXYC 4IBLT 3UPRB 2IPTH 3O9WA 1XF1A 4KK6D 1NAMB 1TZIB 4Y4KC 4PJBA 4OJFH 4UAOC 4XMPL 4HIEB 4AQOA 3S6CA 4M1GH 5I8OL 3GRWA 4GRLB 5EU6A 1KTDA 2Y36H 4FOMA 2MOVA 5A16A 2H1PL 2DM7A 2DYPA 2C5DC 3HNTH 1KOAA 1S7XA 1LO0L 3O4OB 1JYNA 5I18L 5CSZA 4XCFL 4DCQA 2LVCA 3F5WB 2YUZA 4HXBH 1OAQL 3RX5A 1RK1B 2B2XL 2ARJB 3H9SE 1MRFL 5TDNB 4PJHF 5EU4A 3EDJA 1G9MC 5IB1B 5B38A 3FFCE 1T4KA 1KB5L 1R24A 4H1LA 1H3PH 4JKMA 5KJRH 2IG2H 3DWTA 1TVHB 3QEQE 4ODUA 3DBXB 2VISA 2NY3B 1ROWA 3L3JB 3EO1B 2B1HH 2D31B 4NO5A 4LVHC 1PDKA 2A1WL 4L3EB 5IB2B 4RFOH 3O81A 1JFQH 5KG9A 1E4XL 4UQ2A 1KPUB 2XQYG 3ARRA 1IQDA 1JVKA 1I8MB 1S5HA 2OCFD 3WJJA 3PWJA 3OQ3B 5C0RL 4MS8C 3MXWL 1G0YR 1C8PA 1BIIA 3O9WD 4Z7UF 1J0KA 4N0CD 5GSVB 3S8WA 4HUXB 3DV6B 2QR0B 5I8KH 3UPAA 15C8H 3LIZL 5FDYA 1LP9A 5EU6D 3QXTA 4IRSC 1AY1H 2FX9L 1OWWA 3ARGB 3OB0K 4XC3L 4OZGA 2DYPD 1GGBL 5E9DE 3LHPH 2H3NA 5CEYB 5M94B 3OKKB 2EECA 1JCKA 4F15C 1ZGLM 5I76A 2NX5B 4MD5A 2FJHB 1G9NL 2N56A 1AIFB 5SWSD 5FHAH 3IFOB 3G5ZB 1JI1A 2HLAA 5IWLC 1LILA 3LRSA 4DKAA 1AXSB 3VA6A 2VABB 3DBXA 3EO1A 1MI5D 3ZL4L 3P0YL 4O58H 1X5GA 2V17H 4IRZH 3DTXB 5LVEA 3P4OB 4HJJH 4WFHE 5CFHA 3Q3GA 4KVCL 5C07E 1BP3B 4AEIH 1N2RB 1CU4H 5E03A 1TJHL 4P9ML 4G6AC 5CGTA 5BJTB 5EOCJ 3HE6C 2AXFA 4TUOA 3QUML 1QHOA 1FCGA 1NFIA 1JHLH 3CVHH 2CD0A 1YN6A 5KSBB 4NPYB 1G6RL 1RIHH 3NVQA 3MLWH 1I1CA 4ZXBA 1A6AB 2AQ2A 1NQBA 2LTQB 2HJLB 3RVUC 1P69B 5E00B 1NAMH 2O5ZL 5MEOB 1WFOA 1IGTB 3ARTA 2P8PB 2VZ3A 4D0BB 3VXUA 3X3FH 5C9JA 1Q8MA 3GSVB 2I9LB 1WEJL 5D96B 2YK1H 4K3DL 3QZWB 3BIKB 4ZQKB 1YN7B 1DDHB 2EYTB 3SGDI 4J8RA 5FKPB 3NCJL 2ADJB 3TZVB 5I1GH 3SE4C 1DJSA 1B4JL 2AXGA 1NBYA 1FL5A 5C0JA 5HI5D 1F58L 1RZIA 2EDKA 4I0KA 2IH3B 4NJ9H 3X12A 1EUUA 1S7SA 1A6VL 4PRIA 3LS5L 1G7QA 4QXTA 4PBWD 4GW4A 25C8L 4Z95L 5ICXB 4H0GA 4YUEH 4YPGA 3RUGA 3ZTNL 2Z92A 2A2QT 4UV7H 1NC4A 2NY3D 2D0FA 5F1SA 2EXYD 5I1HL 4QRSA 5HXMA 1DUYA 3DYPA 4L3ED 5L9DL 4LASH 1NGZB 4HJGA 3CVIH 4OZ4A 1V3MA 3BW9A 1B0GB 4LPUA 3ZDXE 4WFGD 3QNYB 3BDXA 5IJKC 4Z7VB 1RHHA 2C1PA 4O2CA 1H8NA 1QFWI 5E2TH 5ILTH 1VENA 1I8LA 5JNYB 2NXYB 5MEPB 4Y4KB 1YEHH 4K3GA 3CX2A 4I9WE 4Y0GA 4ZXBD 3KPNA 4UAOB 1G7IA 2BY0A 2W60B 4NP4L 2CQVA 1UXWA 2VDPH 4UI2A 2BNRA 3T0WA 1FH5L 4NBXB 1IKFL 1VFBB 3ARGD 3IDJB 4KXZH 5LQBH 2X4NB 3CPLB 1L7IL 4WY7H 2MCG1 1M7DB 2L4OA 4JHZA 3DO7A 2FJGB 5IVZB 4EEEA 3BX7C 1M6OB 4U1JB 1D5XB 2NX5D 5ESVB 2J88L 1OCWH 4G3YH 4JKKA 2JE8A 1HXMA 3LB6C 1G7LA 3QDJE 1EO5A 1AC0A 4I0PB 2G5BA 4QGYA 1QLFB 3T09A 1YNTB 4LAJH 3MA7B 4PIRF 5BRZB 3IS0X 1M05A 2PN5A 3SY0A 5D5ME 5EIIB 1MCIA 5FB8A 4YLQT 1OTTD 4PJXB 1U8HA 3NZHL 2ZWLT 3VXOA 1NC4D 1Q72H 3F7PC 3AFLA 4NKOA 4U33A 4HZLB 4BQBA 3BDBA 4TUJA 3DV4B 3O45A 2R23A 4Y4KA 3MXVL 5DD0L 1WBXB 2FATL 3GSQA 1N8ZB 2FGWL 1ZA6B 1VACB 5HHPA 5E99H 1PQZB 3BN3B 2R0WH 1VGEH 4HUKB 5DEGA 5KS9E 3OZ9H 1B0WA 2BNQA 5FEBA 5D1QC 3CZFB 5C0GA 1S9WA 1ACYH 5EO1B 3BSZL 2DI8A 3TZVD 2F58L 1CFSA 4KUZH 4HV8A 5DO2D 5KN5A 3VI3E 1TVBB 5CD5C 5AZEL 4XCYB 4Y7MA 1I9IH 3MJ7A 3HCVB 1WBYA 4QRPA 2X7LB 4JFDE 4IRSB 5I17B 2OYPA 1MHHA 1P6AB 3S5LB 3KS0J 2VZOA 1HCVA 3GHBL 6FABH 2ITDB 4XPTL 4F15B 3IETB 4RGMC 4ZUSB 3ULUC 3RVXC 4WI5A 2ED8A 1FNGA 4NZJA 4YWGL 1YEEL 1TFHA 5E56A 3MO1B 2XTJE 5F7DB 3MBXL 4HJ0C 3HPJA 1NSNL 4W81A 5B8CC 2OZ4A 2CDGA 5BV7C 1I1RA 3QULA 4ZS7L 3TEUA 3TFKC 5CJOL 4ZFOL 3EHBC 2R1YB 3TCLB 3GHEH 3GK8L 3HC3H 2FR4B 2K7QA 3HE6B 4I13B 3B2UC 4NSKB 3D25B 4MCYB 3HHRB 2NXYD 3P3YA 4Y4KD 3O4LB 2A0LD 1H15A 1T6VN 1WJ3A 3RVWC 2J5LC 2W9DL 4YO0B 4JG0H 4JPIB 5FGBA 1UZ8A 2GUOB 2VH5L 5L8JB 3VDAA 4ZDHA 3QG6B 1UACH 3DVIA 3ALWA 1GZQA 5C2BL 1S7WB 4EQ3A 4JVPA 3MACH 4FQ1H 3QXDB 1ES0B 4NKMA 2X1PA 2EDLA 5DXWA 5FYLD 5HHNB 3SBWA 4JEGB 4R97C 4OCSL 5IWLA 4HDIB 5DI8A 1U2CA 5IKCA 3MO1A 1AR1C 1WT5A 5FYLH 4NO3A 2XWBB 4LLWB 4LNRA 1YEKL 5INDB 1OQXA 3E6HA 1A6PA 4KMTL 4LLQA 4ZYKA 2R39A 4N0UE 5DJYB 1S7UA 1G9MH 5FCSH 2FR4A 3HE6A 3N1MC 3QDGB 4XAWL 5DD5L 3BH8B 1EXUB 5BS0E 3BKJL 5E1AB 4RIRB 1GRWA 2WLZA 1ZHNA 4ZOCA 3LCYA 5TF0A 3QDMA 1FZJB 1VB9A 3BPLB 5IB5A 4ZO9A 1GYAA 3D6GA 4EOWH 4PTUB 4LIQE 5F7HA 2DIJA 1IT9H 2YUVA 3BJ91 3IGAB 4UT6H 1U9KA 1WIUA 5CHNA 4YBHA 5DJAB 1LD9A 1GSMA 4YFLF 1S7WA 3W5NA 1XF4B 5CGYC 4C83B 1JIBA 1FORL 2WUBH 5JLZB 4OZHA 2C3WA 3HUJA 4P2RA 1A9BA 5HHVL 1B0RB 2UWEB 1MJ8H 5DRWA 3TA3C 1J88A 4OSUL 3SE4A 3AY4C 1D6EB 4IRSD 3WDHA 5ESQB 2XTLA 1DBAH 1S5IH 4R6UA 1T2JA 2QADC 1R0AH 5F9AC 1BBDH 4U6VL 5INDA 3DUSA 2GCYB 5K9QG 1GZPA 3CIQA 4JPVL 1JV5B 2XZAL 2NY4C 4WI9A 2GK0A 3UTSA 4NCC2 3G08B 1MCPL 5A2IH 4ZAKC 2XZCH 5F44A 3FONB 2LFGA 5ISZA 4WHTA 3EDDA 3FB7B 2ZOLB 3FCTA 5FM5O 4OLWL 3VMOA 3MBEC 4JR9L 5DJXA 4FQCH 3KYMB 2E6JA 4G6AD 4P48A 1AXIB 5DTFA 4O4YH 4M62H 2A74B 5EA0L 4I77H 5DD6B 3HE6D 5IJKA 4UT9H 5BZDB 3EDEA 1OAYH 3X13A 2PYFA 4DGYL 1HN1A 3H0TA 4KTDL 2OSLB 4RDQF 5FYJH 1NFDA 3QIBC 4NOBA 2VKXA 3SGDH 5ELIA 1OHQA 1LMKA 1MREH 4YXHL 3RVUD 1NLDH 2CJUH 1D6EA 5IQ7H 4JVWA 3CFCL 2PTTB 3IFNH 1UWXH 1E6JH 1NAKH 1WSST 2Y06H 5FO8B 4F2MA 3CH8A 4HT1H 4YHMH 1CLOL 4P2RD 4PS4H 3KXFA 1ZSDA 3KPSA 4WJ5B 5CWSA 1T83A 2XACC 4YHLH 5D72H 5C6TH 2BHYA 1JTPA 1CBVH 1TQBC 3INUL 1YEGH 3GKWL 1IAMA 3ZT7A 3HAEG 4FQ2L 4GAYA 1DLFL 4D0CA 2AK1L 2OL3L 4NQSB 2ARJQ 2CK0L 4PB9H 1HI6A 1RZ8B 4X6DF 3ET9F 4LHUB 1F5WA 2C3XA 2JK5B 4PR5B 4H25A 4MXVE 4F7CB 2DAVA 4WDIB 5ITFB 3WKMH 3ZE2E 1TIUA 4FQXC 1NUGA 3FAWA 3R4DA 3CX5J 4NQDE 3UTSD 1I9RH 2HJKA 3FB6B 1MCNA 1XEDA 1U93A 1BLNB 2GTWA 3PP3K 4BYHA 1NDGA 4RFEB 2O61B 3GSWB 1TCRA 1GJIA 1S7RB 1BVKA 4O51B 1MUJB 5BV7B 3A67L 5IJVA 4F7MB 3V6FA 2EEDA 4LSUH 4J3OC 1SM3H 3S37L 5DEFB 1DZBA 4KRPC 4AZ8A 1Q9OB 1V7NL 4JM2F 1HINH 4TSBH 5IVOA 3HNVH 5F3BA 4YGVA 4JFXA 4PV8A 5D1QA 3KWWB 3MRJB 3GUTB 43C9B 4P5MB 1OP5H 4MVBC 3FQUB 4UMGA 3MRCA 4PJAE 5JIKA 3S37X 2BNUA 3IYLW 3WNLA 2UVFA 2R9HC 5KBNC 4KK5C 4XH2A 2ADFH 3RL2B 1CF8H 1FFPA 1JPSH 3HMXL 1WVZA 2ARWA 5TPWH 4FFZH 3EO9H 4M5YL 1XR8B 2ESVA 3EGSA 2H26B 3LB6D 1GGIH 4YE4H 2IF7A 1VGKB 2MSPA 4Q6YA 4N90D 3QYCA 4M3JA 2IADB 4JDTL 1KNOB 1UC6A 32C2B 3T65B 1QYGH 1P4IL 1EAPA 5B8CA 3LPGA 4QYOB 2RJMA 3MRNB 2A9NH 3J8F7 4JKPL 1MFNA 2EDNA 1DE4B 3GIVA 4HIXH 4E0RA 1NCWH 2BY1A 4OF7A 2JELH 5CJXC 2FRGP 3MNZB 4XNUL 1Q9WB 4M03A 3AREB 3VXRE 3WIFA 3BO8B 3O3DA 3O6MH 3UTPD 3MLZL 5D7KE 1M7IB 3FQUA 4DVBA 4Y5VC 3T2QA 4OLYH 3BJLA 3QO1A 1A9EA 4R4NC 5FUCE 3QSKB 4PGCA 2Z8VC 5D1QD 3WNMA 1EFXB 3WEXB 1YNLL 1A22B 3KPPB 5DRXA 2Z35B 3TA3B 1UM5L 4P2OA 5CD5D 2GAZA 3GMNA 1YQ2A 2NQCA 4R9HA 2CLZB 4YPJA 1IFHH 5GRVL 4B50A 3D39B 3MYJA 4KI5C 4K8RC 1OSZA 4Q9QL 2QADB 3TBTB 4LHUD 1NCDH 5F96L 3MTRA 1EGJH 2P5WB 4BH8A 5B39A 3ULUD 1HYSC 5TFSL 2ESVD 3RVXD 1OP9A 3DXAA 4M00A 5D7IF 3L3GA 1CL7H 2DQJL 1N59A 3QHZH 1ZLUH 2NY4B 3PGFH 4Z5RA 4G6ML 1NBZB 4HWZA 3SOBL 3ULUH 1Q9WA 5HY9B 1JWSA 4HJ0D 1F4YL 4YEEA 3EYVA 4G42B 4U6HA 4QY8A 2DOCA 1BECA 2IPKB 4P57B 3TFKD 4Z8FH 4LEOA 4FXLA 3VXNB 2R0KL 1TPXC 3EHBD 5IT2H 1G9EA 3WFHA 5BV7H 3UJIH 1JNNH 3QIUC 3UTZB 4PLJC 3QEHB 3B2UD 3D0LA 5HYFA 1XH3B 4OFPA 2VXSL 4V2BA 1A1NB 4G9FA 5IVXA 3KPPA 3QIBB 2UY7A 5EC2A 1ORQA 5EU5A 3TA3A 1S3KH 3AY4A 5L6YL 4NFBA 2V9QA 1MHEB 1RZJL 2DQTH 3FQWA 5EULV 1MLCA 5D9SA 12E8L 3QXVA 3BP4B 4U0QB 2A6JA 1C5DB 1NGWB 3MRKB 2R1WB 3LZFL 3TJEH 1FIGH 3VA2C 4R4FH 4F57H 4GOSA 3STZA 1MY7A 2IJ0C 4JM4H 1TQBB 4PRDB 5JHLL 4NGHL 1R3KA 1AR1D 4ZAKA 5I15L 3RWCB 2AV7B 2QQLL 4CADB 2Z31C 3MBEA 5D7SH 4ONGH 3MJGX 3QFJB 5C0BA 1KBGL 4LKXA 4CGTA 1C7TA 5BOPA 4OT1L 1U3HC 2HJFA 2B5IC 3ARED 1MQ8A 2R56H 4NHCH 3TH4T 3EOTL 1Z0NA 5E2VL 1FFOB 1HIMH 1PYWB 4WI8A 3MUGA 7CGTA 1W2KT 2IALB 3VRJB 5CD3B 1TTFA 4NQCA 3VJ6B 5IEKB 1GAFH 1MCLA 4X0KA 1XF5B 2Q86A 3H6JA 3PJSB 3HI1B 5HJ3B 2YRLA 5DUBA 2VTFA 3CDYA 2DM2A 1HH6B 4ZODA 4KRPB 4MNQB 2EIZA 5CGYD 1UT9A 4ZOEA 1CDIA 4C4KT 2EKJA 2GQHA 3D2UB 4V1DA 5D2LA 5GRUL 1XGTA 2I5YL 1G7HB 1RZ7L 4PJFE 3T4AB 2UYLB 4UOJA 3PIQA 4F37K 2DRUA 2DJ4A 3TA3D 3MNVB 3CFKB 3L5WA 4PJEE 4MDIA 5EZLB 2P24A 1RUQH 4OV5A 4ODWB 4LLDB 2B1AH 1HHIB 1CVSC 1IAIH 1NEUA 3MRIA 1JWUA 2VXUH 4PJDE 2XZQH 1PEWA 2QADD 3VXSB 4FABL 1AD0B 5T3XL 1N0XH 3AB0C 3FO0H 3QFJA 3MRMB 2P5WD 4H20H 4HH8A 1AD9A 1MCHA 4ALAH 3KYKL 5D7LA 4M7LL 4FQXA 2NY4D 2CRMA 3BP7A 1P7HL 1SBSL 2ZUXA 4GBXC 2YPVL 3HI5H 5C08E 5AAWA 3CXHK 4ZAKD 5KSVB 2C3HA 4UILH 4BM7A 3MBED 1YMHB 5HDBE 5E2WH 1MAML 5DRZA 4F37F 5I1DB 3WFBL 5FYKU 2FX8L 3NOIA 1NCNA 3LVEA 3VGFA 3VG9B 3VFWB 1CTNA 3PNWA 4JY4A 4TNWK 1FG2A 2QHRH 5I1JL 1M71B 5ITBL 4Y19B 5ACZA 5ETUA 1QSFB 2ICES 3D2UA 1S9KC 4XBPB 4AH2A 4GW1A 1DQLL 1A14H 3QIBD 1MFAH 1OAXL 3NCBB 5EO9B 4K7PH 2VDRL 5H2BB 5FGRA 4Y5VB 2MKWA 2BRRL 3RKPA 5T1LA 3QPXH 4JE4B 3BKML 4FFWD 4PG9A 5DJ6B 1GC1H 2H2SC 4D8PA 1MRCH 4V1DD 3EYUL 1RFDL 3GI8L 2GT9A 5TE7H 3BVNB 1OLLA 3CFJB 1YYLH 1U3YA 2HKHH 4XPAL 1LDPH 3Q48A 1T22A 2X6MA 2DQEL 3LKSB 3PWPE 4XAKE 3EJZC 3ZKNC 5F3HB 3QFJD 3N85H 3K80A 3UXFA 3V6ZB 4C58B 4FP8L 5D7LD 4X7SH 5CSGA 1BD2E 1PKOA 1P1ZB 3O3EB 1FZOA 2XPGA 2XQBL 3C60C 5CJXA 3ZYJA 4G6KH 5T3ZL 4WGWB 4EVNB 1IM3B 3CCHA 3LKRB 4NWUH 4XBPA 1PG7W 3F7VA 5E4EC 3MRFA 3O2WL 3NFNA 4IIQC 3X14B 3L7FB 2EYSB 3ZE1E 4PJBF 2ZSWB 4X6CB 3T8XA 1TPXB 1R5VB 3DX7B 4U7MA 2JB6B 4JJHA 2R1XA 3BI9X 4KRPD 3QIUB 8CGTA 4MNQD 3LN5A 4MXWL 3T4YA 1E6OL 1YEIH 3D2UD 5IF0B 1KTRL 1PKQA 3LEYH 3P30H 1D6VL 1HXYA 2F53B 3LKQB 1BQHA 4MVBD 2DM4A 1I8KB 4HIJA 2VLLA 3ZKMC 4GG8A 2R9HD 2F54B 1J87A 1T20B 2IPUG 2IH1B 1W72L 2ZG2A 4K3HA 3VFSB 5GS1A 3VXSD 2VXVH 1QRNB 3IU3A 1CFVH 4PBVC 4POZC 3SKUD 5HHQB 1K85A 3G04A 4G8IB 1ZGLB 1H3GA 1ZGLP 1AXTH 1KB5B 3D85A 4HKZB 5CBEA 5JOEA 4W4NA 4XNZB 5J6HA 2X2YA 4XTRC 5GGSY 2FBJH 2ATPA 5GRWA 3VCLA 4MA3A 1YPZA 2Z31B 1U8JB 2VERN 3IDNA 3T0DA 4KUCD 3VFTB 1IL1B 2YKLL 4G43A 4GW5A 3WHE1 3K8MA 1L7TL 1R5VA 2GI7A 1WZ1H 2NZ9C 4OCXH 3W2DH 3Q6FB 4Q9RH 4Y19D 3TIEA 2RIKA 3IF1B 5F1IA 4JZJA 4I5BB 4BFIA 1QSFD 2B5IB 4WI7A 2WSKA 1YY8B 1IGYB 2PCPA 5JA8B 1UKQA 3V6OC 3QUYC 4R0LC 5EUOE 4RMSA 4YHPA 4WCYL 1MHPL 3DHMA 1H5BC 5BXFB 3JZ7A 1N3NA 3RWHA 4BSWB 5EG6C 1T20A 2J8UA 4LPXA 3QQ4A 4A2LA 3JWDL 5ADPH 1JUFB 1AHWC 2LE9A 2IGFL 2PO6B 2HFFA 2AW2A 2HTKD 1ZTXH 2F5AH 5C0FB 5HHQA 4WW2C 2CR6A 2PKDA 4LCCC 4WUUB 5AZ2H 1MY5A 4GG6A 1XIWB 1N0LA 2ZCLL 3FT2A 5EO0B 1FAKT 2LQRA 1AI1L 1F02I 3C9NA 3MLSL 4R90L 4KI5D 3OG4B 4K8RD 3P9LB 4TVPL 4JFOB 5DQ9B 1HHGB 2Z31A 2ZUWA 1RIVH 1X44A 1FSKC 4EN3C 1HYSD 4TOYH 2V7HB 3TO4B 5HVWA 3U1SL 3U2SA 4ELME 4L4TA 1MCFA 2CUIA 3MGOA 1S9XB 2VLJE 4NC1E 2GITB 3D85D 1U3HA 3IF1A 4OFYA 4X4XB 5B21A 3QUMB 1KELL 2WLYA 3U4BL 4MXQC 1JHKH 3RY6A 1DBBL 1G6RB 1CZ8H 4GRMA 3KPMA 3KYNB 5IFJA 4MQTB 4OGYL 2C26A 4M6OL 4PJ8B 3QIUD 4D3CL 4PLJD 4TSCL 4OUUA 5AEAA 5AD0A 4PRPB 3P4NB 1JZ3A 5GRZA 1HHKB 4OV6F 2X4RB 1MVUA 3K4ZA 1P7QB 3WDIA 3T0EE 1V3LA 5I8OH 2F53D 2Q3ZA 3L1OL 1IC1A 3MRHB 2H1PH 1ITCA 1AGFA 2NY6C 2DLHA 3QB7C 1LO0H 4XXDA 5I18H 2IANE 4OZFG 4XCFH 5EUKA 2FX7L 1OAQH 1FNFA 4OCRL 2B2XH 3FB5A 1VADA 1N6QL 4OZIB 4YIQB 1MRFH 2VLRA 1AC6A 5EFIB 4JPWL 2VLKE 4GBXA 4NRXB 3DLQR 5DA0B 1J05B 1T1YA 5EBWB 1FL3A 3LH2L 5HPMB 2GW5A 4YDLC 2EE9A 5KSBF 1KB5H 3JUYA 2Z31D 1EO8L 2W59A 3DX9A 5HBBA 2ICWI 4KZEL 3T0AA 3T3ME 4KU1A 2A38A 1DQML 1TZHB 1D5ZB 2G9HA 3G6JA 1NGPL 1I1FA 1U3HD 1Z2KA 2A1WH 1KGCE 3C60B 3FQRA 2B39A 2IQ9H 5HVGB 5T1MB 5HYQA 1HHKA 3BZEA 3AGVA 3P73A 4R7DA 4YK4C 3U82B 3DIFA 3D1MC 3RWEB 5EOQL 5E4EB 2WWKT 1KLGA 4IIQB 4XB8A 4LGSB 3TCXA 3TH2T 3NGBC 5FUOL 4CVXB 5C0RH 3RDTB 4HX1B 1S8DB 2AK4E 3QWRA 5C0EB 2PO6D 3NAAL 4RAUA 5HYIA 4IDJL 3GMMB 2HFTA 3MJ9L 4QHNB 3KPRB 4WUUD 2BOBB 2FX9H 4XC3H 2APFA 3QAZC 5EFIA 2WP3O 4HWNA 3PDOB 4MB5A 4A6YA 2PXYC 5CMAA 1G9NH 4MX7B 3BPNC 4LF3A 2CR3A 1TQCC 1QACA 3DUHA 3SKOA 4LPCA 4G8EB 3UTTE 2W0PA 1Q94B 2VLMD 5IFHL 4MQXC 3ZL4H 3P0YH 1Z9SA 4B41A 3L9RB 2XKNA 1WQVT 3QUZC 4GBXD 3P77B 1JGDA 1NDMB 2DLGA 4UOW1 3SQBA 3TPKA 4HD9A 4KVCH 1HYRC 4XNQA 1T0NA 3TF7C 4XZUB 2QLVB 1TJHH 5DK3A 3WFEL 4JJ5B 3QUMH 1T21B 2VDKL 2R4SL 1QO3A 3KLAA 5KSUA 4PJ8D 1G6RH 2X4SA 1BZ9B 2WAHA 1F2QA 1SY6L 3RNKA 1PX4A 5CEZD 1P7QD 2FO4B 4P3WA 2P45B 2YD8A 5C8JB 4YGAB 3QUYB 3KYOA 3SE9L 2C3VA 4ZOAA 3B6SA 1DLHB 4K3DH 4E5XA 1KPVB 5GGQL 3W9DB 5HGAA 3MGAA 3QCUL 4DW2L 2H2SD 3NCJH 1AHWB 4JHAH 1B4JH 4G8EA 1FNHA 3PGDB 4ODXB 1F58H 3T2OA 2CIIB 4L5FL 4NJAL 4WW2B 3BRFA 3VU2A 2DWEA 1F11B 5KSAA 1S9VA 2ZSVB 3LS5H 4XP1L 4N1EA 4JDZB 4PFEA 5EBMA 25C8H 4Z95H 5GXBB 3EJZD 2AJ3A 2GJJA 3R0NA 4KGJA 4Z7QE 1A02N 4EN3B 1FSKB 4CW1B 2GJ6B 5I1HH 1PZUB 1ZT7B 2WIIA 3LN4A 4ZFOB 1PFCA 4X6FB 3C60D 5J1AB 5L9DH 1U8KA 4KGLA 3MROB 1IQWL 5CP7A 1VFMA 2XRAL 4LLYA 3V6OA 4R0LA 1JZ2A 4EI5A 1RHFA 2P49B 4DAGL 4YX2L 1K5NA 3DHJA 1H5BA 4JN2B 5ICYB 5HYJA 5DHVB 4QRRE 2AJSL 1IVLA 3UYRL 2IQAA 4R2GC 5BOZG 1RJZA 5TE4L 4NP4H 2ATKA 4CNIB 3PGDA 5DZOA 3U4AA 1FH5H 2CIIA 3KPRD 2Y72A 3IFPB 1W0WA 1CI5A 4DKDC 4LCCA 1L7IH 4JFZL 3BZ4A 4XCNB 1HH9B 2NY6B 3NIGF 3OXSB 3MREB 3ZKMD 5HHOB 1UADC 1UWXK 2R2BB 3MRRA 3HNSL 2B4CC 4IOIA 1H0DB 2D3VA 2DTSA 1INEL 1ACZA 3GMPA 1A4KA 3VFMA 1KJ3L 2H41A 2GK2A</