4NC1C

Crystal structure of tcda-a2 bound to a20.1 vhh and a26.8 vhh
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
b'QVQLVESGGGLAQAGGSLRLSCAASGRTFSMDPMAWFRQPPGKEREFVAAGSSTGRTTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAAPYGANWYRDEYAYWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell wall-binding repeat protein
publication title Structural Basis for Antibody Recognition in the Receptor-binding Domains of Toxins A and B from Clostridium difficile.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Immune system
total genus 32
structure length 123
sequence length 123
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nc1C00
4OJFL 1L7IH 3IVKA 3U2SA 5T3XL 4LBEB 2R23A 4S1QH 4JKWA 3MGOA 3FQNB 3PP3K 4U1GC 5DEZA 4HIIA 3VG0H 2ZUWA 3WHE0 5HYQB 2BVPA 3EO9L 3VXSE 3JV6B 2K3TA 3RTQB 4AL8H 3JVGA 2X4QA 4MDJA 1AI1H 1QLEH 5EOTA 5IB2A 5TH2A 3GSXA 3JTTA 2EIEA 3RDTA 5IB1B 4F3FB 4NN7C 1L9NA 4PJ9D 3OR6B 4R2GC 4KAQH 3WS6C 1Z6JT 3VG9B 2YUXA 3W9DB 1OW0A 5BVPH 2XY2A 2HFEA 1TTUA 2ZCLL 4MNHA 1CU4L 5FYLD 4WTXA 1Z3GL 4XVJL 4W6XB 5D7JB 2HRPL 4X6DA 3LMJL 1XH3A 4XX1E 5DC0A 3BPOB 5GJTH 5D7JC 4HCRA 5D6CA 3S35H 1ZAGA 4OZGB 5TQ2H 5I75B 3S96A 2OK0L 3W39A 2DM2A 2J6EH 1IAOB 4Z7UE 3FO2A 1F90L 1H3GA 1LEGA 2DJ4A 2ARJQ 4OCMC 3HPLA 5GRVL 2DIJA 5CLTA 4F80A 1JFQL 2P44B 4MZ2A 4DGYL 3TYGH 5L2KE 2RBLA 5K9QI 4ONGL 4J8RB 1CGSL 4HEPG 4XAWH 3S37L 4EDXB 3VRIB 3O8XD 4W68A 3GUTB 3GMNB 2F8XC 4Y1AB 1MNUH 2Y7QA 4KQ4L 1IC4H 1FDLH 4KMTH 3I9GL 5IVXB 1G0XA 2FEDD 2XTJC 4KKAC 5F9OH 1WBZA 1TVBB 3IFLH 3S88H 4BSVA 1RULH 4JO2H 5EBMB 1HDMB 4DZBB 5HSFA 4HS6B 2EO1A 3FT4B 3P0VH 2JJSA 5IB4A 5I8EA 3RWDB 4F37F 3JZ7A 3UPAA 1OSPL 4G8EB 1NFDE 4P4KB 4MHHI 1CXLA 1E4XL 2OSLB 3ARQA 4IMKA 3P4MA 5MEND 1EHNA 3M8OH 4WFFD 3BKJH 2EXYC 5F9JA 1DL7L 4FFYL 2LTQC 1YEIH 5TGBA 4K2UH 1A5FL 3Q1SH 1B2WH 1HSBB 3IDGB 3FQUB 2ZP0T 4I9WE 1LDSA 3DXAE 2J88L 4YNYA 4F7EA 3FZUC 4FG6C 4TNVF 4HUMB 3FFDA 3B8SA 2RCSH 4N8PA 1UGNA 5DVMA 3RUGA 1P69B 2WMPA 4YPGB 2PTUA 3DUUB 1I3VA 4JO3H 2HH0H 1OTTD 4ELKB 1VFBA 5EWIH 4Z7VB 1KGCD 4R0LB 3L3IB 1SEQL 4WWKD 3MRFA 1UJTA 2ZNXA 2P8PA 3OJDB 1H3XA 1GZQB 4FXLA 5GGVL 2ZZUT 1HIML 4G6FB 1AE6H 4AENA 1HQ4A 5C7XL 1AGFB 3RWIB 2EDYA 3MLXH 3SGJC 1IGMH 4F7PA 1DQTA 1A21A 1BAFH 1JGUL 4PGDA 1LP9A 5FECA 4XWGH 2V7HA 1BFOA 2DMCA 5GQBA 5I15L 5GS1C 1NLDL 1A4JA 1H3WM 4FP8H 3BI9X 5CJOH 4HCRH 4LSQH 4JFYA 4ONHB 4J1UB 1O0VA 3SGKA 5CP3A 2BJMH 2BNUB 1T0NA 1JF1B 3GI8H 3CK0L 3H7BA 4ZUWA 3RGHA 5CFHA 3ARGA 3ORJA 5CBAB 1F02I 4KU1A 5SWZA 3MRKB 4NQCE 2C3VA 3RWJB 5B8CB 1VSCA 3REWB 4PJFF 5J0BA 4RWYL 5FB8A 1A1NA 2X4OB 4AG4L 5DHXB 4U1JB 3RIAF 3V0VB 3G6DH 5HI3D 2YS4A 3BN3B 1FYTA 3DBXB 5HHQB 1WBYA 3GHEL 5D1QD 4APQC 2R15A 1J1XL 1M4KA 4WFGE 2X4UA 5EN2B 2WW8A 4FS0A 3S34H 2ZWLT 4F57H 2D0GA 1EXUB 2PR4H 4PRAA 1ZLSH 3LZFH 3CFKA 5JMOC 3OHXB 3WNOA 1DSFL 1XEDA 3FKUS 3FRUB 4AJ0A 2FR4B 3H8NA 3I84A 1NCBL 1U8MA 2WBWB 1NDMA 1Q1JH 5B39B 1M7DA 5ISZA 4OLUH 2BNRB 2YOCA 4FQPA 1I3RA 1W0YT 4HWBA 4XNQA 2XY1A 3L3DB 5E6IA 3INUH 5EO0B 4NN5C 3VWJD 5EFIB 4KTYA 1QFWH 3RAJL 5SWSE 3TBVA 3QXAB 2YPLB 3EYUL 5TPWH 3PHSA 2C7UA 3KLAB 1U6AH 3HRZB 3FFCA 3MA9H 3L5WB 1H5BA 1P6FA 4ONFL 2YA1A 5IV2B 1K4DA 1JZ7A 3MJ8B 5I74C 5ITFA 2PYEB 2FD6H 3SDXF 1IGFH 5GHWL 3FOLB 1XGTB 5GGSY 4CN1A 3H9HB 5JPMA 2ZCKH 3BP7A 3IRZA 3MBXH 5KSBB 4NOFA 5CEZH 1MCOH 4TVPE 1XIWB 3ARDB 1A6WL 1KCVL 4YDJB 4U1IA 3NBNA 1FN4A 1VADB 2W60B 1DUYA 1S7QB 4XPGH 1D5ZB 1Q94B 2H2PC 4NT6B 2PO6C 4JRXB 4JDTL 5A1AA 4PRPD 4ELMA 1BWMA 4LCIH 3BPLB 3BPCA 4TSAL 4ETQB 5HHNB 4HIXH 1U8JA 1IGYB 3FN0H 3QIBD 1QKZH 2JF1A 4I0CC 1IQWH 5CP3H 5GGRY 4Y5VB 4AEHH 3DO7A 3KPMB 4XNZB 4P99A 1ADQA 3OKOB 5CBEB 1K4CA 3IKKA 1T21B 4G80A 3NN8B 4PJ9B 4O5LL 4Z0BL 3P9MA 5BS0D 2PETA 3L1OH 3ZE2F 5KG9A 4HH9A 3BUYB 4TUJA 2ARJB 2EDQA 2NY1D 2YUWA 4Q6IC 4MA1B 3C5ZD 3QIWA 3QUZD 4ZXBD 1N2RA 4K3DL 5E8OA 4GKSB 5D70L 5TFSL 5DQ9A 2IC2A 3FO1B 4HGWB 1CGUA 1AO7A 5FGSA 1F42A 2IAMC 5T1DH 2N7AA 3BP5A 3VXQA 3UBXG 4RAVB 4P2QE 3NFPB 4WY7H 1AXTH 1UFUA 5D2NA 1XCQA 4OF7A 4JDVB 3UAJD 3DWTA 3X14A 2OBGA 2QQKH 1ZHKA 4GW5A 5CJ8A 2EDWA 5T33L 2XIDA 4WNQA 3KPSE 3O8XB 1I7ZB 2GSIB 1KYOJ 2Y25A 1NSNH 4HWBH 1D6VL 3V5HB 3NFNA 3KS0H 1T04A 5IKCA 1CLYL 2VIRB 3MFGB 1M7IA 4R97B 4HG4J 5F7DB 1V3MA 2VDLL 3T0VA 3QUYC 5H37G 5KSUB 5AWNL 3WFZA 1F6LL 5KW9H 1IM3A 4RGOL 3MJGX 4LSVH 4PIRF 4PTUA 3GSRA 3NZHL 5HTSA 3GKWH 3AVEA 4X6FB 4XMLL 4X4ZA 3GJEB 3H7LA 3QNYB 1QFWI 3ZKSD 5CEXB 2X1WL 5IIEA 5F9WC 3PWLA 4IRJC 5TF0A 4GRWF 5MENB 5IHUH 5E7FA 3REVA 1PBYA 3HC3H 3T0EC 1A6PA 4S1DC 3P4NA 1KYOK 2FO1A 2G60L 3NIFE 1OWWA 4JRYD 5ERWA 3VFGH 4G6MH 4HG4K 4NHCL 3LQAC 4EI5A 2FBOJ 5EBWA 4HLZH 2NTFA 4EN3C 3KJ6H 4X5WB 3ULUL 4LHUD 5DEFA 2LQRA 4JCMA 1F4YL 4GRLC 1F3DJ 1KNOA 3CCHA 1JHLL 4XVUC 4HS3B 3MODH 2D7PA 3VGBA 2VZOA 2XWBA 3L7FA 1CT8B 1UCTA 4HUXB 5M95B 3LS4L 3C09B 5EUOB 2MSPA 2ICWA 1ADQH 4WWKB 5EZIL 2F74A 3LRSA 3K0WA 4FN0A 3GNML 4LVNC 2C1PB 3TIDB 5IQ9B 3PWNA 4N9OB 4HPOL 1CFQA 5MHSE 3DYPA 3P77B 1A1OA 3FQTA 5T5FH 5FCUH 4OD3L 5ESAA 4LVOB 1VEOA 3M1BB 5BCAA 1CLZL 4Z77A 4JO4H 4JY4B 1VGKB 2Z35B 2CKBB 2A73A 1GC1C 2GFBA 5HDLA 2Y36H 4HS8H 4S1RL 4DVRH 5IJKC 3NCEB 5EPMB 3VGDA 1NCCH 5E9DD 4ODUB 4WHTA 2HJLB 4YHPA 3DUSB 1IM9A 2B0SL 1NGQL 3O0RH 1T20A 4U1NB 1B90A 3EO9H 1MCKA 1XR8A 2IH3B 1MCWM 1XR9B 1ZWIB 3PGFL 1W0VA 1QHOA 1E28A 4HIJB 3WO3B 4PJ7B 1S5IH 3O2WL 5DUPL 3D0VB 3KPQB 2XFXB 4HUUA 3PDOA 1K8DA 3VFWB 4NCC2 5D1QB 4P4RA 1JNJA 4WTWA 2YC1A 1X4XA 1PX4A 3F7VA 5K59E 2P7TA 5HHMD 2HMID 2ZCLH 1P84J 4NC2B 1QBLL 3UYRL 1CU4H 3L95A 4GO6B 1PZ5B 5E2TL 2PN5A 1Z3GH 4XVJH 1OT1A 3EOBA 4HIEB 5IROA 1BF2A 3K7UA 5DGRA 3NCYS 2OK0H 3R1GL 4PRHE 4GAYB 5D7LE 1YMMA 1F90H 2BHUA 2OS7A 4UUJB 4LFHD 2W92A 1JFQH 2C26A 3AY4A 1I7RA 3D39D 3GMLB 3HS0B 4ZO9A 1IGCL 3F5WB 3U6RB 2NXZD 4YLQT 5TE7H 4ONGH 3VWJB 3ALWA 1CGSH 1YN7B 2XYCA 4PBWD 3QUKB 3FCTB 4GKOA 1AKJD 5D72L 5SV3A 1MOEA 4PV8B 3FTGA 5HHVH 4XXCA 4L4TA 4JN2B 4D2NA 2D2OA 1INEL 2K1MA 4JPWL 4KQ4H 4P23A 2CPCA 3O11B 1ZSDB 4DFIA 4JPKL 2Z91B 4JREC 4MXWL 3VXUA 4HKZA 1UM5H 5D7IA 3U0TA 3WEXA 1DEEA 1KCLA 3CXHJ 1A9EB 1VERA 3DOSA 3RBGA 1LEKB 4CW1B 1QFUL 5DJYA 5E8NA 4LLWB 4P59L 1AQKL 3WNMA 2VZ1A 2R9HC 3EYFB 3F12A 2YPVH 4PJXE 2DKMA 1YMHB 3I85A 4R4BA 1FNGA 1E4XH 1UYWH 5I1LB 3NGBB 1WJ3A 3C08L 1DL7H 4FFYH 4YHLH 4FQIL 1ZLUK 4PRPB 2HJFA 4JVUA 1RHHA 3DVNB 4NCC1 1CTOA 1MCCA 5J12B 3LD8C 5HGHA 2VL5A 3QIBB 4Q97A 2BMKA 2J88H 4UDUA 5GGUB 3ES6A 3Q5TA 3VXRE 2UVEA 4NYLA 2E8ZA 4HK0A 2Y4SA 3T2QA 3CXHK 4I0PD 3H9SA 5HDQL 1NMBL 5E99L 1X9QA 3ARTA 5HJ3A 2C9AA 1H3PH 4MS8C 3MMEA 4PD4K 4M4RA 5HYJA 1P9MA 5DS8A 4KK5D 5BS0B 2WUCH 3X12A 1QR1B 1SEQH 5DHVH 2E9JA 1IGIL 2NY1B 4UTAH 1ZLVK 3C5ZB 3MLUL 3QUZB 4ZXBB 1T83A 5GGVH 1OF2A 4L3EE 5CEZE 5C7XH 2NY3D 3ILQC 4Q2ZB 3RX5A 1JGUH 3VI3F 3FMGL 3EFDL 3OQ3B 3D0LA 4I18A 3VFOB 1D9KC 1LO0L 3HE6A 1DQQB 4OZHF 1H3VA 5EC2B 3HNVH 3WN5B 2D9QB 4RGND 1L6XA 5I15H 3OF6A 4F2MA 1G6RB 1NLDH 3OB8A 2ZUSA 5F6IC 3GKZA 3PV6B 1Y6MR 5F93C 3MXVH 5GSRA 1KJ2L 3C60A 3ULVL 5A2LH 4QRPE 3MLWL 3CSGA 2HFGH 4PFEA 4N0CD 2GCYA 1T1ZA 3CK0H 3ISWA 4JKMA 1N59B 2EECA 2VLLA 3FL7A 4OCXH 2GT9A 1YC8A 5IVOA 1S7WA 1RUML 4GOSA 2CLRB 3UBXA 4RWYH 4GW4A 4MX7A 1UB6A 2V5SA 2VQTA 3VXME 4AG4H 3TH2T 4JZOA 2EZ0D 5F44A 2P24A 2QEJA 1F4WL 4RIRA 3RWHB 3KYNB 3GHEH 3IDXL 1NGYA 2IFGA 3BP4B 4FRWA 1J1XH 3BEWB 4G9DB 2IPKB 4RSVA 4KHXH 2CGRH 1VGEL 1BVLA 4U7KA 3U0PB 3SDCC 1WK0A 3GMOB 4K7FA 3SDAD 4GG6F 3MJ9L 5FA3A 3UMTA 1X5AA 1KIRB 1NCBH 4PG9A 5DMIH 5TDPB 4JRYB 5E5MA 3BE1L 4NP4L 5JW4M 2ICWI 4XPBL 4K3JL 5C2BH 4YK4C 4IOFC 4E0RA 1BQLL 3C6LA 1M71A 4LHUB 5I8CA 1FG2B 4R8WH 5ICZB 3OGCB 3I6KA 4H8WL 1ZT4B 1TZIB 2A74B 4DUXA 1SJVA 1E4XI 1NMAL 3I3EA 1CF8H 2WM0A 4YEEA 4BH7B 2D7OA 3RUGF 5F3BB 2JCCF 4FNLL 4JZJC 2BY1A 3MNWB 3GSQA 3ROOA 4F37K 2EDBA 3T2NH 4CRPA 5EC1A 4RNRA 1NUDA 3TIEB 3TJHD 3HUJF 3QP3A 5INCB 1L6ZA 1QYGL 1FE8L 1QBAA 4RZCA 5DTFA 3QWOA 5GHWH 3UTSA 4RAUA 1D5XA 2CR6A 4XP9L 1MY5A 2VLJD 2DN7A 4FQLH 5I1DA 2CLVB 1CICC 1HILB 4PPTA 1UWXH 9CGTA 1A6WH 5I0ZA 3OXRA 5DK0B 4LLVA 3TN0D 3V7AE 4TNVK 1KIUA 3GJFK 4H88L 2MMXA 1AR1D 1BX2A 5E9DB 1QRNA 4KJPD 5KSAA 3IXTB 5K9KB 3VW3H 3LEVH 4TSAH 3FQRB 1U8NB 4RX4D 3PQYA 4PP1C 1KG0B 4WU7A 1Q9WA 4PG2C 3V8CA 4HIHA 5I66B 3HA0A 2VXSL 3W11D 2UY6A 3Q6GL 4YDVB 3OAYK 3X13A 4XC1L 1R3LA 3AXLA 2J8UB 2DQEL 2BSTB 5ECJE 5BZDB 4O5LH 5IBLC 1BIIA 4Z0BH 1ERNA 1E27B 3DX6B 4LF3A 4P2OA 4EDWL 3MUY1 4Y5YC 2YRPA 2F58L 4K3DH 5HHMB 3HR5B 5D70H 3EJJX 1QLRB 5TFSH 3U30C 2A6JB 5L9DL 1BQHG 4RMSA 5KVMC 3L3HB 2OZ4L 4AIZB 1S9YB 3UP1A 2AK4D 4FQXD 1OAYH 2EEAA 1C7SA 3QEQD 4ODWB 5I2IA 1MRFL 1F58H 2KPNA 3EOTL 3GMPB 4I3SL 3EYQD 4X5LA 5JW4N 1BD2E 3D39B 3IJYA 1U3JA 3HN3A 2NXZB 5H37H 4B41A 2E7LA 1YYLL 5T33H 4IIQA 3VXPB 1KPUA 1WTGT 2X89D 1W72B 1AKJB 2DQTL 2ADFH 2QADD 1NEZG 2YK1L 1CLYH 1QPXA 5IJVB 2OTUB 1AC6A 3EO0A 2VDLH 4CUCA 1MCHA 1S9VA 4L9DA 5AWNH 3VFMB 5GS0C 4DGVL 4Q6YA 2V2WA 2APFA 3NZHH 3UYPA 4QHKI 4OLXL 4XMLH 4MQSB 5LGKA 3DTXA 1SJHB 4Y4HD 2FB4L 2ZOKA 4GAGL 3WNNA 1SBSL 4MD4B 4C58B 1JZ4A 1K5NA 3HB3D 4OUUB 3KPRA 1I7UB 1KOAA 1X7QA 1S7UB 4OZIA 4Y89A 3DVGA 1N5YL 4MA8L 2G60H 5CJXC 3QEHB 4V2CB 2AQ3A 4X4YA 5F88A 3PWUA 4HXBL 2PTVA 4FQCL 4LPUA 3HZVB 2MHAB 4I1NB 3GSNL 3ULUH 3SCMA 2VUOA 2X5PA 3ZDYE 1KPVA 4I0PB 5D7KD 1RK1A 4XZUA 5D1XC 3FN3A 4XNXL 5EU6D 4Q0XL 3CSYB 2BSSA 4U31A 3IAGC 2OP4L 2FGZA 3X3FL 1XGQA 4P5TA 4P46A 1OAUL 2VXTH 3I75A 2ADGA 1QZ1A 1B0RB 2X2YA 5EZIH 5HI4C 1RAMA 4XCFL 3GNMH 5F1SA 1DVFC 4J3XA 4ALAH 1WWWX 5BMFH 4RISL 3LHPH 1FL5B 1QSED 4PJCF 1H15A 2NY3B 3VFTA 7FABL 1KTRL 3TT3L 3A6BH 1CLZH 5F3HA 1KBGL 5H2BB 3ULSA 1UXWB 4RDQG 1A7OL 5AAWA 2B2XL 4FXKA 1CG9B 4LLYB 1RZGB 5F1KC 5IF0B 4RGNB 3NCCB 4YFEA 1NC4B 4S1RH 3RDTD 2YA2A 1PKQB 3UBXI 2VQ1B 4OGXL 4H25B 5DT1H 2W9DL 3ABZA 5F7UA 4G8GD 4C56E 3S98A 1WT5C 2I5YH 3LN5B 2WLYA 4JEGB 4LLUB 4R3SA 2B0SH 1NGQH 1IILE 1S9XB 5E8PA 4U49A 4KDTC 3P9WB 4GKZB 5IT2L 4CU8A 3MFFB 1G7JB 5T3ZH 5T1MB 4WW2A 3OKEA 5DUPH 5GGSB 4IOIB 2G75B 5IBUB 1MLCB 2VC2L 3OSKA 4OFKA 3LPWA 1MJJA 4LRIA 3RI5F 4M7ZB 1X5KA 2XKUA 4GS7C 1QBLH 1IEAB 5E2TH 2P5EA 3UDWC 3NABL 3SDAB 5J7CC 4U1MB 3VD4A 1YEJL 5J13B 1KJ2A 3R1GH 2W0FA 4PREB 3K8LA 4OLVL 5CD3B 2AQ2A 4CNIB 5GGRB 3H3PL 2DLTA 1KLFA 1DBKL 1Y6KR 2V7NB 2DKSA 1JZ8A 2PYFB 4NO0A 3B9KC 1IL1A 3CFDB 3MREB 3BWAA 2HKHL 3BZDA 4OLZL 2C1OA 3GIVA 5D72H 1G0DA 3OG4B 1INEH 3MRLB 5CZVH 2DM3A 4JPKH 1F8TH 3KHQA 1T1WA 2GTZB 2VRAA 1PSKH 2V5TA 3TPUB 3OZ9L 4CVXA 1HI6A 1ND0A 4HJJL 32C2A 5DZLA 3SBWA 3T65B 5BV7H 1FZJA 4NC1C 5C0FA 5D1ZC 2A6KA 2AEQL 5IW6A 1H8SA 2VLJB 4G9FE 1JNLL 3KWWB 4LDEB 3QDAA 4P59H 1AQKH 1DCLA 1OGAA 3E6HA 3MJ9A 4JGMA 3BVNB 3P0YL 3RWCA 3TN0B 1RIVL 1RUQL 5HD8C 1CBVL 1P1ZA 1WWBX 2W07A 1CK0L 3EGSA 1NJ9A 4FQIH 4P57A 4N90E 2IQ9H 4OCWL 2F53D 2YBRA 5ICXA 3DETC 1RFDL 1KT2A 3QDGE 3A6CL 4NWUH 4ZOBA 3T4AA 4Z78A 2Q86B 4DAGL 43CAB 1A7BA 5F70A 4LPWA 2XG5A 1D6EA 5EUKB 1D5MB 4KKBC 1P5UA 3BFOA 3HI5L 2Q20A 4PJ8C 3PDGA 4EQ3A 5E99H 3FQWB 4OGZA 1FPTL 4QNPF 4OCNC 1MCPH 3CH1A 3QO0A 2F54E 3AM8A 3I02B 3MV7E 1F6FB 4J4PC 3WFHA 3OJ2C 3NTCH 1JV5A 1IGIH 1C16A 2AK1H 4NBZB 5DEGB 1HINL 1V8HA 3D18A 4YXKL 4OFDA 2AJXH 3CDCA 4DQOH 4E9LA 3HZMA 1MAKA 4J2XA 3MCLL 5FGCE 2AK4B 4FQXB 4HPYL 5MEQB 3FMGH 3RZCC 3VFNB 4RRPA 3QEQB 1LO0H 1GCFA 1QR4A 4TUOB 2X4SA 2YXFA 4KTDL 4PRBB 1KJ2H 4PYGA 2XRAL 1X6NA 1I9JL 3GB7B 3PWVA 3OJVC 2ZPKL 4OCYH 2Y72A 4QGTA 2R2EA 1UQSB 3QI9A 4YUEH 4OLYL 3QZWA 2BVTA 2QADB 2IBBA 5KVGL 1BQHA 1U36A 5CGMA 3HLAB 4LLAA 1P6AB 3N1PC 1H8OA 4H0HB 1BLNB 2MWCA 5ISZD 4UOW1 3HPJB 2PXYA 4F15B 2Z4QA 1F4WH 2X09A 3TZVC 1TMCB 3D3VD 3O3EA 2OZ4A 4Y4HB 4U6HB 5E6ID 3QHZL 1LD9B 3BH9B 3ZKMC 2HVJA 2X10A 4PJHA 1V7NH 4GMTH 1VGEH 1NEZA 1T7WA 3V4VL 4JFDA 3LDBB 2EXWD 3MCG1 2ESVE 3MJ9H 3LDBC 3FFCD 3U9UB 2CDGB 1LO4L 1A2YB 1N0LA 1ZKAA 3BE1H 4NP4H 3P73B 1MFDL 4G7YL 5IFJB 4HV8A 4XPBH 5HGAB 1G7MA 2N4IA 4YBHA 1ZGLA 3CU1A 1I9IH 1BQLH 3QDMA 4UINL 3MRNA 2DYPA 5EU5B 3AUVA 1DP0A 1LGVA 4WJ5B 4K8RL 4H8WH 1MJUL 4K9EC 4UBDD 4KZEL 1S8DA 3HKFA 3GRWL 5EU6B 3QEUA 3WIIL 2D03L 3EOYG 5BRZE 4NKIL 2YEZB 4PJIE 2WK2A 3TLRA 1U8QA 2VDNL 4ODSL 3TT1L 4D8PB 5EZOL 4JQVC 1SY6H 4U1HB 5FCSH 2J8HA 4K71C 3RX7A 1EBAA 4TSCH 4FNLH 1LEIA 1RJCA 3JTSA 4PLKD 2EIDA 3U46A 3IVKB 4RGMC 1WFOA 1XF3B 5HI5D 4TTDC 4NQDD 1QSEB 1XF1A 3MGOB 4P3DA 1QYGH 1CZ8L 3SEPA 4UOW0 4XP9H 3FB8A 4WU5A 4XCYA 3MNVA 4E41A 4JQXA 2AJSL 4Z7UF 1KPRB 1J0JA 1W8OA 4MDJB 1U92A 3CPLA 2H9GB 3JVGC 5EOTB 4AM0A 1ZLWH 2NNAA 4Y5XA 5IB2B 1N64H 5D2LA 3BEVA 3RDTB 1OLLA 4H88H 1XGUA 4LGRB 4PJDE 1RU9L 3GMQA 5GRYA 3FT2B 4G8GB 3S8WA 3GSNA 4NHUA 1LK3L 3DECA 1A3LL 5D96C 4OV5A 4KH2A 3HE7D 3HZYA 5E08H 5I30L 3EZJB 4MNHB 2NY4C 4Q9BA 4UIMB 3GO1L 2RJMA 4YO0B 1DLHA 2JE8A 2VXSH 4XCNA 1AO7D 1WCBA 4X7CC 1SMAA 4X6DB 1PFCA 1AGDB 5J57B 2LFGA 5D6CB 2GHWB 4XMPL 4XC1H 5I1EL 4YDKL 2XXCB 5FV1L 3DYMA 3ZYOA 3PWPA 2DQEH 5FGRA 5I1HH 1V5JA 3K8MA 1MCRA 4URTB 5T3XD 2R1XA 3DO3A 4RA0C 2E9WA 4WI9A 5EU7C 4EDWH 2MTPA 1ZT1A 2RQ8A 1NFDF 1R5IA 1UWEL 1IC5L 5CJQH 4NKDB 2A2QT 4NNPL 3MRHB 2OZ4H 5GZOC 3VGGA 1FP5A 2GITA 1A6AA 3QXDA 2J4WL 3NVQA 3ZSTA 5ADOL 4QXGL 1TPXC 2CIIB 4DOHB 1MRFH 4X8JA 3IJHA 4JFZH 4I3SH 1TQCC 5LCVL 4BSVB 2CDEA 3L3KA 1A22B 5DZNA 1XCTA 5CP7B 4EOWL 1U8PA 5LWYH 1YYLH 2KKQA 4GG6B 3SE9L 3FB6B 4JQIL 5I8EB 4KKLD 2DQTH 5IB4B 3CLFH 3PP4L 4MD0A 4PJBE 5T3ZE 2IPTL 2YK1H 3RA7L 1JMZA 4N9GA 3KVQA 4MZ3A 5A2JH 3WIFA 3DV6B 4QOKE 4YX2L 5TGBB 3DI2B 3MLTA 4ZQKB 4PGZA 3QG6B 3O3AA 4GH7B 2VLRE 2JJTA 4ODVL 4G6AC 4F7EB 4EI5D 2GSGA 4OLXH 3FFDB 2ED9A 2GY7B 2OTWA 1SBSH 2ZJSL 3RUGB 4DKAA 4GAJL 1P7HL 4X5XB 5IR1A 3WLBA 4LPCA 2CKNA 1IFHH 2JTDA 1A9BA 4JM2A 2KUTA 4TUKL 5LG1A 5B39G 4MWFA 5IG7B 4OUOA 5LXGL 4JKPL 4CMHC 5A3IC 1NAKL 1VFBB 2P5WA 4FQJL 1N5YH 4G6KL 2IMNA 5KOVC 3K3QA 4MAUL 4V1DA 3ZKQD 5CKGA 1TNNA 4PJ5E 5MERB 4YFDB 3RIFF 1YNTA 4OI7A 1A4KA 4FQCH 4HXBH 4MJ2A 2EC9T 2W91A 5H8DA 4AENB 3VGAB 3WDHA 1RK0B 1EFQA 4M7JH 1J0ZA 3IU3A 4YR6B 1FBIL 2HTKD 1U93B 3FRPG 5DQDL 1LP9B 4XNXH 3S36L 1BFOB 3QIUC 4OAWB 2OP4H 3X3FH 5GRUH 2VO5A 1A4JB 3ARVA 1TXKA 5BVJA 1OAUH 3MLZL 4KROD 4XPAL 3MRIA 4JFYB 4FQ2L 2BHYA 2DL2A 5I1AB 1S7SB 5I1KH 3LKPA 4XCFH 1CIUA 4CN4A 4JN1L 3NH7L 1JTPA 3RVWD 1QFHA 1IM9D 4KTEL 1WC7A 2VB5A 4ZUWB 7FABH 2DD8L 3TT3H 1KELL 3ARGC 2C3VB 1EEQA 2VLKA 1GGUA 3GSWA 1KBGH 5AUMA 1DQLL 2B2XH 2HAZA 4MJIE 1A1NB 1IMHC 4JR9L 2OI9C 4BYHA 1L9MA 1IVLA 3IDIA 4OGXH 4Q58C 2VJXA 1D5BA 1FYTB 3T3PF 4F9PC 1MCIA 3GDBA 2KL6A 5DJ2A 4U2ZA 1IQDA 5EO1A 1JK8B 2EIZA 5DMGC 2X4UB 4ZFOB 5LBSL 4DUWA 1E4WL 4QF1A 4K94L 5GJSH 3KXFD 3NA9L 3WCYA 4XPFL 2LAAA 5FYLL 3TBTA 3WIHL 4D9QE 5HPMA 1DANT 5EOQH 4XAKE 2ICCA 2ILLA 4AMKH 3HC0A 5IT2H 3E3QE 2OTPA 3TYFB 4Y16A 1J5OH 1YJDL 1NDMB 4EZMA 1HHJA 5FDWA 5ISZB 1CCZA 5C08A 2ZSWA 5EIIB 4P0DA 3D3VB 5HYQA 3L3OA 5E6IB 4L29B 2J7LA 1T1XB 3JV6A 3BZ4B 4NPYA 2NY0D 3TBVB 4ENED 1G0YR 3ECBA 5DD1L 5AG9A 3Q0HA 5HVFB 4LSPL 4WCYH 4L4TD 2C7UB 2UZYB 4LLDA 3WUWB 3E8UL 3FFCB 3OR6A 4PGBA 4O51A 2DQIL 2M26A 1GIGL 1I1FA 3W9DA 1NKOA 1H5BB 3OB0K 4OLVH 4TVSa 1K4DB 1U95B 3H3PH 5FA4A 4KPHH 1DBKH 1ZOXA 3NCYP 2RIKA 5J6HA 5JPMB 3BP7B 3RY6A 4OLZH 3QJFA 8CGTA 2CRYA 4X4XA 4U1IB 3MLVH 1FN4B 1UJ3B 5EDXA 5DD0L 4L1DA 1DUYB 1PYWA 4RMUA 4ELMB 1MI5E 1OTSC 3RVVC 3OZ9H 4HJJH 4G43B 4HX1B 4EDXA 3A0OA 4IMLA 5DXWA 3T3ME 3GUTA 1MFAL 1NLBL 4JPVH 4BQCA 2AEQH 1B6UA 5F89B 1ZVSA 1JNLH 1HHIB 3UZEA 3D48R 4DVBA 5IM7A 4HXAL 3RKDD 4UNUA 3DO7B 4A6YL 4LIQL 4M00A 2GK2A 3LIZH 4L4VE 3O3BA 3P0YH 1K4CB 4B7LA 1RUQH 2XTLA 3NZ8B 4G80B 1CBVH 4U33A 3DYOA 4PJCB 3P9MB 4PJAE 1MCDA 3CLEH 3LKNB 1CK0H 4KK9D 5KG9B 5EBMA 4HH9B 1HDMA 4B50A 5IMMB 4HJGB 5EU4B 5FHBL 1FSKC 4R90L 1SBBA 4RQQA 5FKAA 1N2RB 3BUTA 3A6CH 5E8OB 3QIWC 1KB5B 4Q9CA 4DAGH 3GRWA 4J6RL 3B2UD 4M7KL 3PP3H 1AO7B 4YIQB 1GH7A 3HI5H 4NC0B 1WAAE 1JRHL 2J8OA 4KJYB 3KLDA 4Y4FD 5DUBA 3MACL 5HGGS 3VXQB 2R0ZL 1NFIB 2XKNA 2YD2A 3O4LA 3FHQA 1NCWH 3BKYL 4KI1A 2BX5A 5JOFA 5D2NB 1OP3H 3OF6D 5FXCH 2AVGA 3X14B 2EYTB 1FNEA 1ZHKB 2EC8A 3QUXC 1DN0A 4WDIB 3C60D 5DMJB 1A6UL 5I18H 1HINH 4LQFH 3QO1B 1WF5A 2AEPL 3DUUA 3NFNB 5DFWH 2HT4C 1T04B 2J1KA 5IKCB 4NZRL 3MCLH 3HR6A 1HE7A 3RY5A 1BJ8A 4K07A 4YWGL 4QHLA 3L3IA 3R4DA 1IM3B 4HGKC 2DMBA 3DX9A 4DUVA 4XT1C 1ONQA 4UB0H 4KTDH 4G3YH 4PTUB 5DURD 1I1AD 3PG2A 1I9JH 4GKNA 3B9VA 4ZSOB 3G5ZA 1PW3A 3RWIA 4BZ1H 3S3JA 4OLYH 4I9WD 2XN9E 2BVYA 3DXAD 5IMLA 1J1OL 2IBZY 4U0RC 1P2CB 1OQOA 3PWLB 5CHNA 3NACH 2VKXA 3MRRB 5C0AE 4RMVA 3P4NB 4ONHA 5F7KC 2UWEA 4J1UA 2VWEC 3RI5K 4F9LA 3B3IA 5FO8B 2B4CL 4PBXA 5ERWB 5I8KH 2AI0L 2VITB 2NY7L 1FC1A 4M4PA 5C0NC 4EI5B 1BZ9A 4OCRH 4Y2DC 2NTFB 5CBAA 5F1NA 3MRKA 3EDEA 4YBQD 4B0MM 4JCLA 1YEHL 1KNOB 1N3NB 5JR1L 4OZ4B 1E6JL 2X4OA 2XWBB 3V4VH 3L7FB 4I13B 1GVIA 3HI6L 2BNQE 3V0VA 1CE1L 3DI3B 3VMPA 1LO4H 1BFVL 3LRSB 1MFDH 4G7YH 3G04A 3PWNB 1CFQB 2BK8A 4EXPX 4KK8C 3QPXL 4UINH 1A1OB 3FQTB 1CFVH 1JNHA 3UTSD 1OD7A 3OHXA 1FJ1B 5C0BE 2H26A 5ESAB 3ESUF 5DK2A 4Z8FL 4U05A 4K8RH 1MJUH 4LCCC 4KZDL 4D3CL 4KZEH 4M6ML 1OWRM 3GRWH 3ARUA 3X11B 3WIIH 1XGPB 2D03H 1FHGA 2A73B 4NKIH 2GFBB 3RU8L 1RZJL 4JFPA 3T08A 2VDNH 4LSSH 3TT1H 1HWGB 1I8MA 2CRMA 3P11L 4XTRD 5FO9A 3SKMA 5K59F 1IC7L 5B4MC 1EV2E 4HZLB 3V6OE 4WHTB 3PGCB 1B6DA 4OI8A 3ULUD 5EO0A 4YHPB 3BD3A 2E6QA 5EFIA 1KXVC 3JBG7 3MRQA 4NQEE 1IM9B 3PQYD 1CZ8H 2JK5A 5C0JA 3IAQA 2YPLA 3VA6A 2HWZL 4GT7A 3N06B 4YAQA 4FZEH 1XR8B 3GBML 4NBXB 2ZUYA 1YY9C 1W0VB 1LK2B 4WEBL 3U82B 1E28B 3L5WA 3DIFA 3O3UN 4LVHB 4K3GA 3DURA 1XF5B 3MJ8A 4N0UE 1NGXA 3HNTH 4HUUB 4ZMAT 3PDOB 4P4RB 5EOCH 1S3KL 1A3LH 3DPBA 5CUSL 2IG2L 2YC1B 1I9RL 1L4IA 3TNMA 3F7VB 4E42A 1JGEB 3KXFB 1U3HC 4KUCF 3MLRL 4FTVA 2HG5A 5ESVA 3GO1H 2VXVL 3P30L 1KCRH 2IPUK 1F13A 1LNUA 5IROC 4XMPH 1ZA3A 3U9PH 1Q94A 3G6JE 5SWSD 1YUHA 3CMOH 1INQA 1ETZB 2AGJH 3CUPA 5DRNA 2VLME 1RZ7L 3G5VB 1B4RA 1IGYA 2DRUA 4YXHL 1I7RB 2DQGL 1NFKA 1OCWL 2F8OA 1Z0MA 4PJXF 4X9HA 1UWEH 1IC5H 2NY0B 1YECL 3OKOA 1UZ6E 3BMWA 3FTGB 5CBEA 5CMAB 4L4TB 1T21A 4BH8A 2Y9RT 3MRGA 3OXSA 4PB9L 4LCWA 4PR5B 4P23C 1JPTL 2Z9TA 1T0PB 4HKZB 5ADOH 3BUYA 2ARJA 5D7IB 1C5CL 2DWEB 5F8QC 1S7RA 3P4OA 3U0TB 1GGBL 1YNLL 4JY6A 1X44A 5LCVH 5BJTA 3SKJL 3D69A 4ZTOL 3FO1A 4HGWA 4EOWH 1KSRA 3WIHA 2FRGP 4I2XA 4KGLA 5E8NB 2HT3C 4C4KO 2P8MA 2F5AH 3SE9H 1GZPA 4EJ1C 4O2FA 5K9JL 1CN4A 1U8HA 3F12B 4RAVA 3PP4H 4MAYD 5L2JA 1TTFA 5GXBB 2IPTH 4NO2B 4UTBH 3RA7H 1FNGB 1YPZE 3KPRD 1YEGL 2BRRL 5T1KD 1Z9MA 4WFEE 1U41A 4YX2H 3EDKA 5BW7A 5FGBA 4O58H 2VKWA 5B38B 2VL5B 3MLYH 2BMKB 2GSIA 4UDUB 3ES6B 2NZ9C 4NYLB 4PGEB 5H35A 3IDUA 3SCMD 3KGRA 1PY9A 3N9GL 2ZJSH 4GAJH 4KJQC 3X17A 3VDAA 5KSUA 4TUKH 5JA8B 5LXGH 4KKBD 1IZKA 5DS8B 3T0DA 4P46D 4JFFE 1P9MC 3X12B 1NAKH 1FLRH 2EDRA 2HFFA 4FQJH 3PV7A 4G6KH 4P2QD 4LHUG 4MAUH 3WL9A 3W9EA 3UROR 4Z7WE 1ZEAL 2OR9L 5A40E 4I3RL 5JDJA 1OF2B 4JGJA 5AYQA 2X6MA 4HBQA 3PL6C 4EBQL 3RNKB 1P4BL 4Y4FB 3KPSD 1JPFB 3D0LB 1JMXA 4I18B 4J3OC 3W0WE 1QOKA 5FYKU 2YRLA 1TZHA 4RCAA 3HE6C 2O5ZL 2Z31A 1IGTA 4J7RA 2Q8AL 3MLZH 1FO0L 1MFNA 3BIBX 4XPAH 4FQ2H 5GSRB 3FB7A 3C60B 3BHBA 5DVLA 1JGLH 1FZOA 4JN1H 2GJZB 3NH7H 5DMKA 2MJWA 1OAXH 4A6YA 1AXSB 2EKSA 4KTEH 5D5ME 4HS3A 4G8FB 2MKWA 1XGYL 1MH5B 2DD8H 1HH9A 1KELH 1PLGH 4CVZA 2Z93A 3MGAA 2GT9B 5DRWA 3G5XA 3AFLA 3F7RA 3MBEC 3EYSH 4J3SA 4LGPB 4WWKA 4GW4B 1UB6B 4OBSA 3RGVD 2C1PA 3TIDA 1BQSA 1FFOB 4BUGA 5DRZA 5DURB 1NGPH 2P24B 1SVCP 3C9NA 1I1AB 3F65A 4JE4B 4RIRB 2I07A 4QXWA 2VE6A 3F58L 1GYAA 5CLWA 5ENWA 5I6XB 3KPOA 4P2CG 5LBSH 1E4WH 5MI0C 4K94H 3NCJL 3DVIA 3DXAB 3NA9H 1JVKA 1FVCB 1BBDL 4DGIH 4LCYA 4XPFH 5FYLH 2A9NL 1KIQA 2ERJB 1WIOA 1YEKL 2O5YH 4K7FB 5F7EL 2J5LC 4IRSC 5FA3B 1PY4A 4CDGC 4PG9B 3MRMA 4MMZC 4EUPG 1HK6A 1HCFX 4ODUA 4U6VL 5DFVC 5DZOA 5E5MB 5FM8A 4MLIA 3ULVD 1OPGH 4OCSL 3WFCL 1IARB 3DUSA 4OZFB 1BQUA 4POZC 1M71B 1VENA 4U1NA 3UJJL 4DEPC 3C6LC 5I8CB 4GBXD 3LB6C 5LKNA 2X41A 4NO0D 1UACL 1OB1B 1W72L 3I6KB 4NNXA 3QCUH 5DD1H 4JVWA 4JFEA 2H1PL 4YH6A 3NCBB 4PJ7A 5IGXH 2VN7A 2J12B 4UU9A 4LFHG 1NDGB 2DQIH 3BAEH 1GIGH 2B1AL 3QFJE 3VFWA 3GSQB 3ROOB 4LSDA 3H3KA 1PD6A 5JLZA 3E2HC 2CMRL 3OTTA 1G1YA 2AV7A 5DTFB 3UTSB 3QWOB 4TYUA 2ATKA 1PZ5A 2I9TA 1RZIB 4N5EC 3WSQL 1QA9A 2EDNA 2Q7YA 5I1DB 1OGAD 1ZVYA 5DWUL 4C57C 1RUKH 3L3GB 1JIBA 2AABL 1YEEL 4OZGE 3OXRB 4U2YA 5DD0H 5FYKL 4LLVB 1QVOB 4HH8A 2FEEL 3SO5A 2W9LA 4QXUL 3H0TA 1UH2A 5CSZB 1KCUH 1P4IL 5KSAC 3CGTA 1YN7A 4Y16B 2XOTA 4ESKA 5C0IB 3PQYB 4WU7B 1MFAH 1NLBH 1Q9WB 2YKLL 2ED7A 4M1GL 4HIHB 4Y1AE 1OP5H 1AP2A 3EZ8A 2NTSP 4HXAH 4UV4L 2DBLH 3O11A 4A6YH 2Z91A 4LIQH 3X13B 5I1JL 1R3LB 3SGEH 1C12A 3S5LG 4X4ME 5IVXE 3F8UB 3UTTA 3WYRA 2GKIA 3RIFK 3C2AL 4O02L 3BGMA 1BIIB 3U36A 1A9EA 1F3DH 3IFOA 5FHBH 4PRHD 4P2OC 5D7LD 5CGYD 1C5DA 5KVFH 3NCMA 2EO9A 4J6RH 1CD1A 3FN9A 1YMHA 5JHLL 4M7KH 3MPCA 1JRHH 4XXDB 1NUFA 3MACH 1ZTXL 1JHKH 2R0ZH 2YPKA 5SWSB 4L8CA 2CKBH 5I2IB 3DVNA 2Q87A 3S37X 4NN6B 1U2HA 4KUCD 4HSQA 1A6VL 4WEUD 4YBLB 3UXFA 4IIQB 1KPUB 1QSFE 1A6UH 3QI9D 3DMMC 5L88L 1YN6B 1T5WB 2NR6C 4IDJH 2AP2A 5H94B 3RJDA 3EO0B 4YWGH 4Z7VE 1S9VB 4QRQA 3C5ZA 3SPVA 4S1SL 4FQ1H 3FONB 2V2WB 3ZDYF 2PXYD 2QHRL 5IW1A 2ZUQC 2XV6B 4AEEA 2ZOKB 3GBNL 4MAYB 1J1OH 1DDHB 1M05B 4JPIA 4LL9A 3KPRB 5T1KB 4JFDD 5ANMA 3PV6A 5C8JA 4OZIB 2BY3A 3DVGB 5IBUG 4CBPA 1Q72H 1EJOL 5CD5D 5JXAH 1UG9A 4C55A 2AI0H 2B5IC 2NY7H 5JUEL 2NY5L 3AS2A 4O9HL 3QDMD 3BESR 5C09E 2DYPD 3SCMB 4JHZA 4PRDA 2A83B 3V6BR 2AS5M 3ZT5A 1RK1B 2YMXH 5JR1H 1DBML 2BSSB 3BN9D 3MNZA 3BD5A 5FKPA 4IEFB 3RNQB 3HI6H 1TJGH 1XGQB 2M2DA 4P46B 3I75B 1CE1H 2ADGB 4LAQL 4H26A 4P5TC 3V4UH 4M6AA 5DC9B 4H1LG 5BV7C 4AIXA 3KYNA 1BFVH 3ZTNL 1ZLUH 5MEPB 5HYFA 3TVMA 3NPSC 1SYVB 1AHWB 3HI1B 4G9DA 2IPKA 1J9CT 5JZ7D 5IOPA 3QPXH 4LKCB 3RL1A 3VFTB 3T0AA 5A2KH 3JSSA 5EBGA 15C8L 4WUUA 2YWZA 2VDKH 3IU4H 4Z8FH 3GMOA 5F3HB 1A6TB 4Y19A 3SGEI 4M6MH 4FXKB 1T7VA 4OF6A 2BNRE 1MAMH 4DN3L 3P11H 1RIUL 3D5OF 4XVSL 5HVGB 5IWLA 1FG2A 3O9WC 3GMRA 2FGWH 1EHLL 3OGCA 3I3BA 5EZJA 1ZT4A 5AAMA 1TZIA 2A74A 3HG1E 4R3SB 2M8XA 1UB5A 4PP2A 4PGJA 5E8PB 1JRHI 2HWZH 3SOBH 3D9AL 1XGRA 2C3XA 2VQUA 1NCNA 2FNBA 4JKKA 1Y0LB 4WEBH 3GJFA 3L5HA 5F3BA 3RGVB 4WW2B 3CX5J 3AAZA 3PWPD 4R4NC 3OKEB 4FFVC 3TIEA 4DCQA 1HOCA 5EIQA 2PYEE 1ZA6B 3C6SB 4GW1B 3B9EA 1S3KH 3SJVE 3F62A 3EDFA 4HUWB 1I9RH 4LHJB 5CILL 5KSBE 4LRIC 4NNYA 3IDYB 3P30H 2O26U 3GK8H 2IH1B 5DK0A 3V8OA 1A64A 3V6ZA 1FO0A 4KC3B 4LPTA 2BXYA 1KCKA 2APXA 2W0FB 5CJBA 3FAWA 4M7LL 4JRXE 5K9KA 3M17A 5B22A 1RZ7H 1MF2L 1HYSC 3JV4B 2AKRB 3WD5L 1F5WA 1BM3L 3CX5K 5JORA 4GBXB 4O4YL 1OCWH 4NO0B 1IL1B 2C1OB 1YECH 2GJ6E 2J2ZA 4WI3A 4NQXB 2LU3A 1IAKA 1RZKH 3DX7A 4GSDL 2APVA 1JPTH 1R3KB 2B20A 1E27A 1XF2A 5C0RL 1MPAH 1XT5A 4EUPA 5JXEA 4CVXB 1C5CH 1HI6B 1ND0B 1MREH 1GGBH 32C2B 4G5ZH 3WHXA 1P7KA 4PJFA 3SKJH 3SBWC 1FZJB 4ZTOH 2A6KB 3IGAB 2LV4A 5IW6B 1MUJB 6CGTA 2DTML 2YHGA 4XWOC 3L3HA 2DQHL 4LNVA 1OGAB 1S9YA 3OAZH 1RMFL 4YFLI 2VL4A 3E6HB 5K9JH 2P43B 3G5YA 2QQNL 1SJEB 2BP3A 4JM2D 3RWCB 3K2UH 5DJ6A 1YEGH 2BRRH 1VFMA 3MLPA 1P1ZB 1K6QL 1FV1A 4Y7MA 5DHYA 1ZHNA 3EGSB 1NJ9B 2P5WD 4XC3L 5CEYA 2YBRB 5FAAA 3VXPA 4R7NA 1HQRB 1KT2B 1W72A 2YD8A 5E03A 4Z78B 1PG7L 4CDHA 3QG7L 1L0QA 1D6EB 3DARA 2WANA 3N9GH 3T2PA 1Q38A 3QNZB 3U7AA 1GJIA 4L5FL 5SX4H 2DQUH 2BHZA 2VABA 3IS1X 4GRMB 3BKCL 5HDOA 1RQ5A 3WO4B 3ETBF 4CU6A 3QO0B 1JTOA 5F71A 4OKVA 5F97E 3AM8C 4PRHB 1C16B 5D7LB 1MIEL 1G7IB 1SJHA 3U79A 3DHMA 2OR9H 2EYRA 4PLOB 3IXAB 3BPNC 3BDYH 4JFOA 1TIUA 3OL2A 3D18B 2EE2A 3TV3L 4YC2C 1BD2D 5C0CE 2I27N 3HZMB 3MOBL 3ZDXE 2IANE 4ZUTB 4L9LA 3T0EE 5MENE 3LCYA 4WFFE 3SDXA 3SY0A 5J1TC 3KYOB 3RVTD 3S5LA 3OAYH 3QEHA 2O5ZH 4KRNA 1KN4L 2A6DB 1FO0H 2X4SB 4NKOA 4KVCL 3W5MA 5IVNA 2MHAA 3KDMB 3PWVB 1W0WA 3KLSA 1WISA 1KEGL 1CD9B 2R2EB 3QI9B 1MWAB 2BZDA 3QZWB 1S7XB 2XQBL 2FX7L 2H3NA 3O6FA 3O4OB 4RFNB 4CJ0A 3C8HA 3B6SB 1UM4L 5EUOE 1B0RA 4RFNC 5JOPD 2A77H 4PJXB 1Q8MA 4NJ9L 4MNQA 1EIBA 3I6LD 1YEFL 2MNUA 1M6OB 1LO3H 2PXYB 3SKOA 5IB5A 5C08D 4WEMB 1FL5A 5JIIA 1J1PL 4EUPH 3F58H 2UZIH 3WXWL 1GHFH 3O3EB 1NCUA 1WUNT 3RL2A 2NXYD 4X7TB 2HVJB 4PJIF 1UXWA 1NGZA 3R8BB 4PJHB 3ZHDA 1H0DA 2A9NH 4WRLA 2VSDA 4JFDB 1YEKH 3OKKB 3WLWC 4RFOL 1LDPL 4U6VH 2V5RA 1RY7B 4HV8B 5FO7A 4OCSH 4ODXB 5A2FA 4BFGA 2GTWA 3LN5A 1ZGLB 1AFVH 4LLUA 3G08A 3QDMB 4WUKL 5E4IA 1S9XA 2DYPB 3UJJH 4KJWD 1UACH 1W72H 1RZFH 4XH2B 1A3RH 4NRXB 4ZNEE 5D6DC 4QLRA 5T1MA 1FFQA 4PRIA 2VISA 1EAPA 2H1PH 4PJDF 1VACB 3L6FB 5DD5L 2WWMC 2E3VA 4PLJD 1U8QB 1BVKB 1F97A 4M1DL 3MRJA 4NRZA 2OJEA 2FJGB 4IOIA 4TQEH 4TULL 2XACC 2G75A 4ZS7H 3EJYD 2C4XA 3QAZB 2B1AH 4JY5L 1MLCA 3QAZC 1EZVY 3U46B 3V6OC 5CZXD 1Z9LA 3JXAA 4UAOC 2CMRH 4P3DB 1QQDB 3QQ3A 2NY2C 1IE5A 3FB8B 4UI2A 4WU5B 3WSQH 4Z76A 4XCYB 4U1MA 3MNVB 3VXTB 4QHUA 5DWUH 5SX4I 5FFLA 4QHMA 4MJ4A 4HWUA 1U92B 4FMKA 1YEEH 4Y5XB 2F8VA 3H9ZA 4QWWD 5CD3A 1CS6A 4FOMA 5FYKH 4QO1A 1XGUB 1KN2L 4QXUH 3GMQB 4H1LA 4ZFZA 2EEDA 1P4IH 3GSNB 4NHUB 2PYFA 3CFDA 1T03H 4OV5B 3HZYB 1XAUA 3RPIA 2YKLH 4M1GH 1MCQA 4MXQC 3V4PH 4XCNB 2H6PB 1WCBB 3MRLA 3AS0A 1F11A 5I1JH 2NLJA 1GSMA 1MHEA 4CKVX 3PWPB 4LAJH 3O4LD 5JHDE 5HHPB 3C2AH 4KRPD 4O02H 2EE9A 2R1XB 1ZMYA 5FYJU 3NAAH 3B8YA 3IKCA 1E0OB 3HNSH 3KS0J 4UNVA 2XICA 2VLJA 3KWWA 3O45A 4PJBF 2OL3L 1R5IB 5I76B 3S4SB 1CWVA 4UT6L 5JHLH 2Q76A 5FK9A 1BJ1J 2A6IA 2GITB 1A6AB 1ZTXH 4PY8J 4ZS6C 1K9TA 3QYCA 4UT7L 5JW3L 3BGFB 2UYLA 1IAMA 4PRPE 3U7YL 4X8JB 3IJHB 3EJZD 4RX4A 1VFUA 1FFRA 1A6VH 3L3KB 1Y6NR 3TO4C 1XCTB 1U8PB 2F19H 3ZE1E 4ZFOL 2VTFA 4JB9L 3EBAA 5I1IL 5L88H 4KK6C 2DAVA 3FQWA 2YD5A 4MD0B 2JIXA 4LSTH 3WJJC 4N9GB 3WIFB 4WWID 1UXSA 2ITCA 2XZQH 5BS0E 1J8HE 3MLTB 1HKFA 3O3AB 4Z95L 4S1SH 3DNKA 4KI5D 2EICA 5HHOA 1OL0A 4BK4A 5C9JA 1EO7A 2QHRH 2WBJD 5E5RB 1TTGA 4JRWA 2KZ1B 2OTWB 5D8JL 4ORZC 4G42B 2AK4A 5IEKB 3QDGD 1EMTL 3MRBA 5IR1B 4LEOB 3K4ZA 3QEQA 4JM2B 1A9BB 2KH2B 1DE4B 4MWFB 4TUOA 4YHML 3QRGL 4BELD 5KTEL 2P5WB 1Z5LA 3VD7A 3ZKND 5I71B 3IJSB 2Z8RA 1HNGA 1T0MA 2X89A 2JELH 3MV8A 2XPGA 1UQSA 4MSWB 3SKUD 2NY5H 1A4KB 3LKSB 4O9HH 4H1LH 1A8JH 1DUZA 1BOGB 1PEZA 2YZ1A 3K1KC 4Y4KC 3WUWG 1NMCB 2Y6SC 5LGHH 1DBBL 1DBMH 2WINB 2WP3O 2Z92A 4F58H 3HPJA 4LAQH 3MOAL 3MRIB 3JUYA 5FYJL 3MROA 1FORL 3ZTNH 1GC1L 2RFXA 5ALCL 1U3ZA 1UA6H 3PGDA 3VA2C 1LD9A 3BH9A 1MRCH 1WC7B 1BD2B 3AB0C 5DRXA 2Y06L 4JFHD 1NCDL 3TA3D 4TRPL 5BQ7B 3GSWB 5DVKA 3P40A 3S3SA 1IGJB 3SO3B 4LQ1A 4JRYE 5L0QC 2R39A 5IFJA 5HGAA 1WFUA 2X7LB 3IDIB 1FL3A 4DN3H 1D5BB 1RIUH 1ZT7A 4XVSH 4BSWB 1OSZA 43C9A 1FL6A 5EU5A 3J8F7 1IQDB 5KANG 5EO1B 2EIZB 3CIQA 1KJ3L 3D87B 2UUDH 1KB5L 1GPOL 3BIAX 4FTVD 5HPMB 3KG5A 3MA7B 2NX5A 3D9AH 3SGJA 4DKFL 2YEZA 2DQJL 4N0YL 4U1HA 3HC0B 5AD0B 5INDB 4M6NL 2JB6A 1HHJB 5FDWB 2O5XL 4Y16C 5GS1A 3AGVA 1CR9L 1D3CA 1XF3A 5C08B 2ZSWB 1QSEA 2W59A 5GSVB 3U4BH 1FYHB 3L3OB 2NXYB 4R7DA 5D4QA 2HVKA 1KPRA 4NPYB 3RTQC 3ECBB 2H9GA 4YXLH 3SGDH 3ZDZE 2FHBA 1X5XA 3VFPA 4LLDB 4KRLB 4LCWD 1JL8A 1AJ7L 4PGBB 4O51B 4K3EL 4HULB 4KV5E 1G9NL 1I1FB 3FT2A 4G8GA 2FIKB 4M7LH 5E9DE 3T3MF 3VG9C 2GJJA 3PDDA 5E7BA 5C86A 2V2XA 5FA4B 5GRVK 2R0WH 3WD5H 4FFWC 4OZHA 5C6TL 4W6YB 5CGTA 1JZ3A 2VAAA 4UIMA 1K3IA 1BM3H 5J6HB 3FT3A 4YO0A 5HVHB 4O4YH 4APQA 3TH4T 2CDFA 3ROLA 4YE4H 2HTLD 1HHKB 3LEYL 1AGDA 3QJFB 3RY6C 2VH5H 3TFKC 1G84A 2DI9A 1EH9A 3BPOC 4X4XB 1PKOA 2OQJA 3LSOA 3BJ91 2K7QA 4PJAF 2J8UE 5I75C 4HWZA 3ZHKA 1S78D 4X6CA 1KLGB 5J3HD 3TEUA 5J11B 1PYWB 3QJHB 1OAQL 1XF4A 5C0RH 3VJ6A 2IBZX 4GLRH 2EDFA 4MA7L 3C8KA 1BREA 1X3DA 1Z0NA 4IMLB 5HHME 1WAAF 4D9RD 4OGAD 4NKDA 3MYJB 3LV3A 1E4KC 4OD1L 1ZVSB 2DTMH 3EO1A 2DM7A 3MRHA 3HZKA 2DQHH 4DVBB 5IM7B 1RMFH 1DQMH 1UVQB 1OTUC 2QQNH 3GSOA 4B5EA 3O3BB 2MCPL 2CIIA 4AH2A 3DSNA 1K6QH 1IKFL 1AGEA 5DD6A 4MQXD 3D39E 5CP7A 3D6GA 4XC3H 1EX0A 4LASL 4GG6A 4RQQB 5FKAB 3VFVB 3LY6A 2YD4A 3FB6A 4K8RC 4O2CA 4OT1L 4HHAB 3KYAA 3VXOA 4P4KC 5DUBB 4M93B 2XQYG 3DV6A 2AXHA 4L5FH 2XKNB 3O4LB 3BKCH 4ZQKA 2M1KA 4KRPB 3QG6A 5JOFB 5DC4B 2DQCL 3HC4L 2Z31D 1EHAA 2Q7NA 1FNEB 2PO6A 1DN0B 3T4YA 5DD3L 1AXIB 5IQ7L 3LEXA 3O6MH 3F6LA 2WIIA 3N0PB 2JCCA 4X5XA 5I73B 5I17B 5E4EB 4PGCB 3TP4A 5C6WH 5IG7A 3FO0L 3HUJA 1FNSL 2DIAA 4FZ8L 4EQ2A 5I0DA 4QHLB 1AD0B 2F53A 3KPLA 4R0LC 1MEXL 1WVZA 2ENSA 3H42L 5MERA 3DX9B 3ZL4L 4XNMA 1ONQB 4KVCH 4DKEL 2VUYA 4P48A 2XNAB 3Q5OA 4GKNB 5CIPA 1N6UA 1RK0A 3G5ZB 4LMQI 4YR6A 5TE4H 1U93A 5D71L 3ARED 3SGDI 3U0WL 1N5AA 5FUCE 4QRRE 5IMLB 4OAWA 4OFVA 2FX7H 5CHNB 1GGIL 5BOPA 1CFBA 2A9ML 2IAMA 1UM4H 1QBML 2UWEB 4P3CL 1EK3A 5I1AA 3B3IB 4JJHA 1S7SA 4NJ9H 1IKNC 2OL3A 1BVZA 1J1PH 1BZ9B 2WBJB 5KN5B 2R69L 2IWGA 3SDDD 4X9GA 3WXWH 5F1NB 4MNGA 4N0FA 4FXGB 1VKXB 1JYVA 3THML 1C5BL 2DDQL 4PJGA 5B8CC 4S10A 3I50H 1OAZL 3CX2A 4JFED 4BZ2L 2VDPL 5K33A 4BSJA 1PKQE 2PCPA 4RFOH 4GLRI 3QUYA 1LDPH 4YHOL 4XB7A 3OR7A 1JK8A 3G04B 4ZFOA 3H9YA 4OD2B 4HBCL 1R3HA 1JNHB 3BQUD 2H26B 1FNLA 3MLSL 5DK2B 4XBEL 1T66D 3J7HA 1CL7L 5GZND 3QDJA 5GS2H 3D85D 3DVFA 3TYFA 1CDYA 3LN4A 4IRJA 1L0YA 5DD5H 5DJAA 4JFPB 3O2VH 4TULH 5FGCB 1JZ2A 4ZFGH 1I8MB 4ISVA 5FO9B 3SKMB 2NY6D 5EIIA 1LO5B 2H8PB 3D3VA 3RVXC 4PJEA 2R56L 4L29A 3WNKA 1T1XA 3BZ4A 3MRQB 2JK5B 5C0JB 4XBPA 4YAQB 3TA3B 3G6JF 2VR4A 1Q9LB 4I77L 5J8OA 3WUWA 4AT6A 4GRLA 3MXWL 1UWXK 3TBYA 3MO1A 3UTTD 2AERT 3DIFB 5M94B 5B38G 3DURB 1U95A 5J6GA 3NPZB 1NGXB 3KYKH 1UZ6F 4LSRL 3TNMB 4E42B 1J88A 4FTVB 2HG5B 3HMXL 5ESVB 1XIWC 3ARDC 1UJ3A 4JANA 3MGTB 1LNUB 4XX1G 2IBGA 1CFNB 1ZA3B 2AJ3A 3W2DL 1ZV5A 3BZFA 1YUHB 5HVWA 2YSSA 1CXIA 1INQB 3CUPB 5DRNB 5AZEL 5IJKA 4G43A 3BPLC 4HX1A 4NQDA 4NC1E 5IBTH 3KLHC 3AMLA 5F89A 4W70A 4HWEL 4IJ3B 1HHIA 5C07E 5GIRA 4Y5VC 1YPZF 1P7QA 1UZ8B 1F4HA 2LAGB 4R9HA 4R96B 4XNZC 4W4NA 4UT6H 3RWFA 4BH8B 3CZFA 1LWRA 3MRGB 3OXSB 3NZ8A 1KJMA 4LCWB 3Q48A 4PJCA 4PJ9C 4UT7H 4PY7B 5JW3H 3LKNA 4XPHH 3V7MA 5IMMA 1MAJA 2EDXA 2VXUL 4HJGA 3S7GA 3U7YH 5EU4A 5F7FA 1S7RB 3P4OB 4PJIB 4HJ0D 1J11A 3HE7A 4JY6B 4MA1C 4PS4L 2WBKA 4ZAKD 3UEZA 5BJTB 1KB5A 1WWAX 3UPRB 3D69B 4K94C 3C87A 4I2XB 5E94A 2P8MB 1NCAL 2IFFL 4YIQA 5GS0L 1GZPB 4KJYA 4WENB 2VN4A 4O2FB 5I1IH 2P1YA 1U8HB 3BD4A 1JWSB 1NFIA 5L2JB 4UZGA 1PVHA 2QBWA 2ZG2A 2EYSA 3N50A 4DJMA 2WZPD 1PGRB 2EYTA 4Z7WF 2NW3B 4WDIA 1QHPA 2KZWA 4XP4L 1FC2D 3OB0H 4M1CD 4QCIA 2HT2D 3TJEL 3QO1A 4U6YA 1K2DB 3O8XC 4LOUD 1EFXD 2IGFL 2ADIA 5H35B 1T2QL 3EAKA 1FVEB 1RUPH 1INDL 3OBAA 1FGNL 1EMTH 1RJLA 4R97C 4K7PL 1P5VA 4QTHA 5DUML 4B7IA 2NMSA 3QULA 2FEDC 5IFAL 4KUZL 4LSUL 4YHMH 1NEUA 1EDQA 1HH6A 1RZ8A 2LABA 5KTEH 4OZFG 2HFFB 3FHAA 1E6OL 3ARBD 4ZSOA 5I9QB 3WL9B 5D5MF 3W9EB 3TVMD 5I9QC 4CVUA 5EO9A 1HSAA 5FM5O 4FFZL 1P2CA 1TQBB 4WUUD 5A16A 3MRRA 1DBBH 3T8XB 4Y19D 5E2WH 4X6EA 5FO8A 3MV9A 3UTPE 3IETA 1TZHB 1NGWA 2Z31B 1IGTB 2ZOLB 3BKMH 2VITA 1DQJA 3MOAH 4KKCD 4LP4A 5FYJH 3FB7B 5KS9E 3BHBB 5ID1B 1FORH 1FZOB 3RVUD 2V9TA 5ALCH 3EHBD 1NAML 5DMKB 4ZFFA 3ARRA 4A6YB 1TCRA 2EKSB 1N3NA 4HF5H 4OZ4A 4AY0A 1JCKA 4CVZB 1HH9B 4JFQA 2Z93B 4OTXL 5DRWB 1WZ1L 3G5XB 4WO4D 1OTTC 4M61B 4Y2OA 3C09C 2VXQL 1X5FA 3BDXA 3DROB 2D4DA 4WWKC 1B88A 4NZTL 4HK3J 2SEBB 5DRZB 3C9NB 2HA1A 5C0AD 2I07B 2C3HA 4W4OA 2VE6B 5ENWB 1B4JL 4WI4A 2QSTA 1FJ1A 1PQZA 3KPOB 4OIIL 5DO2D 4DN4L 1CDBA 1GGYA 1KJ3H 3AREB 4GXVL 4LVOC 5D7KE 1KB5H 1GPOH 2GIYA 3D25B 5E8EB 3X11A 3FO9A 1XGPA 3HMWL 5EU6E 4LCYB 1J87A 1JGDA 1QO3B 1KIQB 4MVBD 4XI5D 4DKFH 2D7QA 1GGCL 4S11A 4N0YH 2XT1B 3QCTL 1N6VA 1BFTA 1FRGH 3MRMB 1IJ9A 1D9KA 4M6NH 4OB5L 1X5ZA 4HZLA 4OJFH 1EBPA 3PGCA 2O5XH 5T3XH 3N85L 3OG6B 4ZUVB 3MR9B 3ARFD 3CSBA 3SDDB 1S9WA 4C54A 1MHCA 3V9FA 2XG4A 4NNXB 1AGCA 1LK2A 3UC0L 4JFEB 4P2RA 4QY8B 3CVHL 1KTLA 1XF5A 4WHYG 5C0BD 4UU9B 5DA4A 1I1YA 5HI3C 1Y18A 4K3EH 4TVPL 4X7SL 1G9NH 5JXED 1FNFA 2ZKHL 5D1QC 3V5KA 5JLZB 2DLEA 1JGEA 3V5DA 1BBJA 1H9VA 3KXFA 2NYYD 5C6TH 2AV7B 3HTLX 2VNCA 1BHGA 3UZQA 1CDIA 2ATKB 2I9TB 4X7DC 5I1GL 3BISA 1CLOL 1QA9B 5IVXF 2Q7YB 2HRPH 3LMJH 3LEYH 4X6DE 3FOMA 4XHJD 4MD5A 3D85B 4YEFA 4EI6A 1ETZA 1G7QA 1FAIL 1TVHA 3G5VA 4WHDA 1CE6A 1OAQH 1Q9OB 1U8IA 4LLMB 4X80L 2NY6B 3H0TB 1J05B 5EU7E 4A2MA 1OT2A 2VDQL 4DGYH 4OM1L 1VHPA 5KJRL 3S37H 5A2IH 3VWJC 1KTKE 4QRTB 4OD1H 2XZZA 2AAVA 3QXWA 5CMAA 3ZO0A 1AP2B 2IALA 4GAFB 3IDMA 1B0GA 4PR5A 4UIKL 3I9GH 1C12B 2MCPH 3B5HA 4JZNA 4S0TD 3UTTB 3R8QA 2DWEA 3SE4A 4DOHE 5IK3A 3BGMB 2A0LD 3U36B 3IF1A 2R1YB 2KDGA 3IFOB 2O61A 3CDGA 2BVQA 4LASH 4PD4J 1L7IL 1C5DB 4L8SB 2VLMD 1OSPH 4OT1H 1CD1B 4S1QL 5KANI 4NO2A 2DLIA 3VXSA 5FYKD 3VMOA 3MTRA 1CICA 4HKJB 3NGBC 2YPKB 2DM4A 1A5FH 4L8CB 1AI1L 2DQCH 1KACB 5B38A 5M7QA 2YWYA 3PIQA 5J12C 5TDNA 1OLZA 4QYOA 3QIBC 5DD3H 4PGEA 3VD3A 4ERSL 1HEZB 1HHHA 5BVPL 3VWKD 2E7HA 1N26A 3RUGE 3V95A 4IM8A 4PG2A 4RWHA 4FQHB 4LPXA 3UZVB 1OP9A 2Q8BL 5CWSA 3M07A 3FO0H 1HCVA 3O6FD 2R8SL 1OGTA 5E2JA 3S35L 4QRQB 1MEXH 2LU7A 3H42H 4MNQD 2NY1C 3SPVB 2J6EL 4LPYA 4Z7UA 4ZAKB 3ZL4H 1MVUB 3C5ZC 3QUZC 4WFED 4DKEH 1HIMH 4ZXBC 4OBRA 2QL1A 3AU1A 5TE6L 5ACZA 1SEBA 3HMXA 3Q2CA 5IW1B 3CFCL 3BGAA 1A6ZB 3RNKA 5L2KA 3T77A 4Y4FA 3R0MA 4QRSB 1JPFA 1LP9E 4XAWL 3RX8A 4JPIB 1DJSA 1S5HB 2BC4B 3LPGA 4ZG1A 3U4AA 1GGIH 3WN5C 2A9MH 5ANMB 3T0BA 5C8JB 3CFJA 5DJCB 2IEPA 3UAJC 4JM4L 1QBMH 3KPNA 1FDLL 2R2BA 4P3CH 2PTTB 2GJZA 1HYRC 1W2KT 3R0NA 5F9OL 1FAKT 4X6CF 1I9EA 2AEWA 2WWKT 1JP5A 1AXSA 4PJAB 1EFXB 3S88L 1ED3B 2R69H 4HKBB 1QNZL 4G8FA 1YY8B 1MH5A 4ZYKA 4CJ1A 4PRDB 5SWZE 3THMH 3QPQD 1RZKC 5BO1L 1WV7T 4ONOA 1OAZH 4JLRA 4PRID 3MNZB 1NFDA 2VDPH 5FKPB 1FFOA 4K9EL 4H26B 4PRNA 1I1AA 5F21B 3BKJL 1FYTE 4YHOH 2JJWA 4Q74A 3TNNA 2QKIA 4K2UL 5HDBE 1QD0A 3Q1SL 3TVMB 3GSUB 3JWDL 1EPFA 3QQ9D 3S36X 5KZCD 3DXAA 4HBCH 5IOPB 3TBWA 1FVCA 4U3CA 3RL1B 2CXGA 4WUUB 1DSFH 3MLSH 1CTNA 4Y19B 2FCBA 2OR7A 5ISZE 3BYYA 1RJYA 4OZFA 2CJUL 5CJXA 4K55A 5F6HJ 5KSBF 2R56H 3GMRB 1OB1A 5IWLC 5EZJB 3RAJH 1UB5B 4PP2B 3EYUH 3W5NA 2IQAA 5KBNC 3TESA 1XGRB 3VU2A 4I77H 4WO4B 3RJQB 1HXYB 3MXWH 3FFCE 1IGML 1A1MA 2AJYL 1NDGA 1BAFL 3D2UA 3GJFB 5D1XA 4AQOA 4HUVA 5F1IA 5C2UB 2V2TA 5D93B 1ZLWK 1OVZA 1CYGA 3AAZB 4XWGL 4ONFH 5E2VL 2H45A 3ILPB 5DJDA 4DCQB 2WIMA 5C0AB 1F6AA 1HOCB 4BZYA 2HLFD 1KXQE 3KJ4B 1RZIA 12E8L 1LHZA 4S2SA 1DVFA 4LSRH 2BJML 4U3HA 1MFEL 5DSCA 2DLGA 3L3GA 3HMXH 4NNYB 1KCVH 3RY4A 2YD1A 1S7TA 4ODBD 4NQCA 1QVOA 3P9LB 3V6ZB 1FO0B 5SX5H 2DL9A 3W2DH 2HP4A 4JDTH 2Y23A 2W0LA 5CSZA 1ES0B 4ELME 3QDHA 3M17B 1AY1L 1NAMA 1JTTA 3L5JA 3ARFB 5C0IA 4R2GD 3G6DL 5JA9A 3WFDL 3O41A 1HNFA 5JORB 3MRCB 4HWEH 3QFJD 3G6AA 1LE9A 3KR3L 2QR0A 1MWAL 1NC2A 4RRPG 2QSQA 2J3SA 2EDDA 2JIXD 4KDTA 5C0BB 1IAKB 3DX7B 5D7JD 1X5IA 2K7PA 4PJGF 1XF2B 5JW4R 4EUPB 1NPUA 2VXUH 4MJ6B 2H32A 1Q1JL 4NUGL 1VEMA 1P7KB 3WHXB 4PS4H 4PJFB 3QZWG 4OLUL 5HHOD 4RBPH 2HMIC 2EDEA 4XVTL 4U1SB 4CU7A 4E5XA 1AO7E 4XXDA 3INUL 3G5YB 4M3KB 3ZKXB 4LCUA 5SWSA 1FZMA 1RV6X 1A7NL 5DJ6B 1IAIM 2XZAL 1IAIL 5D2NE 3UDWA 5T3XE 3A6OA 1FV1B 5DHYB 1ZHNB 4YHIA 2EDKA 4XCEA 2R0LL 3MA9L 5CEYB 2XTJD 1MJ8L 1O7SA 4KKAD 2NXZC 4G8IB 4R7NB 4P9ML 1MHHB 1ZGLM 3MV8D 3TJEH 3ZT6A 4N0UB 3ZDXF 4OZFH 1YN6A 1T5WA 1D6VH 5FUZL 4DW2L 1L7TL 5H94A 4HLJA 1IGFL 2HN7B 4YDLB 1T2QH 3B9KA 3CVHA 1INDH 4PJEF 3Q6FB 1FGNH 5DJ0A 2N1KA 3MBXL 5DUMH 1AIFB 3WKML 5CEZL 1MCOL 2VABB 3PF2A 1MCFA 4MQTB 5IFAH 2EKJA 3IFPA 4LSUH 4I8DA 4RGOH 3FONA 4OKVB 2EXYD 1J0HA 4XPGL 1VB9A 5LVEA 2EIBA 2EYRB 4OV6F 4JFOB 4PB0L 3CD4A 3M45A 4MAYA 1DDHA 1M05A 5D1ZA 5EUOF 3FZUD 1CGVA 1CQKA 1WSST 1QKZL 4FG6D 1EZVX 2E27L 1IQWL 5T1KA 2OCFD 3GSVB 4L9LB 1QSFD 3SDXB 3SY0B 4NBYB 1F2XK 2LE9A 2VWEE 2OM5A 3VMNA 3S5LB 4CMMB 1BF8A 1T22B 4BM7A 3L5IA 3BIKA 4WFHE 1EA9C 3TF7C 4NHCH 4NKOB 1U91B 2BCKB 1FVDA 1F45A 1W0WB 3VCLA 1F4YH 2A83A 2EH7L 4M48L 4I0PC 3MJ6A 1JHLH 4UDTB 4Z0XA 1U42A 5FUCC 4Y8AA 2NX5D 3RNQA 2H3NB 3O6FB 1WZ1H 3LS4H 4PJ8A 2EDJA 4KK5C 5T1DL 2VXQH 2XA3A 3GHBL 4P2QA 5MEPA 2FJFA 2PW2A 4MNQB 5C0GA 1YPZB 4WY7L 1N8ZA 1AHWA 1SYVA 4RMWA 3HI1A 4HPOH 4OQ1A 5IB5B 3SKOB 4J4PA 2I60L 4LKCA 4YHZL 3KNBA 1B4JH 5DJXA 2NY3C 4OIIH 3RL2B 4OD3H 2H2SC 5C3LD 3KPSA 4GXVH 1A6TA 3VRLE 1NGZB 1CXKA 1H0DB 3OAUL 4J3WA 5C09D 1GGCH 4RGNC 3F7PC 4Z6AT 3RZCA 3QCTH 2I25N 4OB5H 3IT8D 1R5VA 2R0KL 1G9MC 3I3DA 3N85H 5FO7B 1Z2KA 3WFEL 2GTWB 4WHYH 1A3QA 3S4SG 3G08B 4QNPE 2CD0A 4LSVL 4N0CC 5DA0B 1MJ7L 4JHBA 1ORQB 4APQD 2HFTA 4LU5L 3PGFH 4M43L 1Y0LA 4LEXL 3MJ7A 4PRIB 2VISB 1EAPB 3RGVA 2MOVA 5F9AC 1OY3B 4RAHA 1JYNA 2ARWA 3O2WH 1WITA 3VFRA 2J6EA 3MRJB 4NRZB 2OJEB 5E00A 3TM6A 5IHUL 3WMSA 2EZ0C 1I8IA 1X4YA 2QSVA 3HC3L 4X7SH 1H8NA 1ZA6A 2YN5A 2VAJA 1YQVL 3C6SA 4GW1A 1G7PA 1OOAA 1J8KA 4HUWA 5KZCB 3WHE1 1X5YA 3TZVA 3UYRH 3QQ3B 4M7ZC 4LARL 4LHQB 5I1GH 1CLOH 4DFHA 4TN9A 2IH1A 4Z76B 1UCBL 4RFEB 3LKQA 4QHUB 4QHMB 3SDAC 3KPPA 3HG1D 5TQ0L 5J13C 3B9DA 4P9HL 4YQXL 3MODL 4X99A 1FAIH 1EO8L 1YMME 3JV0A 1WBXA 2IJ0C 3FB5A 4X80H 3JV4A 3GIZL 4QT5A 2AKRA 4H1LB 5HHXL 4GRWB 4ZFZB 2NY5C 1A0QL 1IGCH 4ZNCD 4OM1H 5KJRH 4GBXA 4S0SD 3WV0A 5FUOL 4YHYB 2OR8A 2APBA 3UJIL 2X4TB 3RPIB 5GS2D 2PYED 5T5FL 4JPWH 4NQXA 4L4TE 4GG8B 2L7UA 3SJVD 4UIKH 1JF6A 1F11B 1R3KA 5DF0A 2NLJB 4MXWH 1MHEB 4N1CA 2DI8A 4JO4L 3VXUE 2BERA 4IRZL 5D7IE 1VFAA 5BXFB 5JTWA 1JWUA 2Y36L 4JQVA 4DVRL 1WWCA 3TJHC 8FABA 2D3VA 3IKCB 3JWOL 2H2PD 3IGAA 2PO6D 4NGHL 1MUJA 1QFUH 1NCCL 3EW3B 1JPST 3O45B 2Z0BA 1N0XL 2Z8SA 4XPTL 1SJEA 4WI2A 3KLHD 4U1GB 2Q76B 3O0RL 4MJ5A 2FHFA 5FK9B 3PJSB 3D1MC 3RWEA 2A6IB 3TN0C 3C08H 4MB4A 4TNWK 5C0DA 2UYLB 4POUB 2GJ6D 1AR1C 4KJPC 1OP3K 3CFBA 4NN7B 1HQRA 1S5IL 4R2GB 2B8OT 3RHWK 1WGOA 3QFJB 2WUBL 2PKDA 4ERSH 3W11C 5HDQH 3QNZA 1NMBH 3H9SE 3ZZ1A 5L7XL 2JIXB 4GRMA 4GMSL 2Q8BH 1ZGLP 1J10A 3SQBA 5JMRA 4TPRL 1UXSB 2R8SH 2ITCB 5HYJE 4J12A 2IAMD 4L8DB 1C08A 3PWJA 1NUNB 1MIML 4OGYL 4PTTB 4PRHA 5D7LA 3MLUH 2E7CA 1G7IA 1EEYA 3V6FB 5HHOB 3IXAA 5DR5L 5TE6H 4Y88A 5C9JB 4LLQB 3CFCH 3B43A 4ZUTA 4TTGA 4NO3B 2FYYA 5TE7L 3EFDH 3MRBB 1WICA 3NIDE 2OMNA 3CDYA 3KYOA 4FQXC 4M8QA 3VXNA 5HHVL 2A6DA 5LQBL 4JM4H 3EYQC 1Z5LB 3ULVH 3QUYD 4NZUL 3MLWH 2XTJB 3KDMA 1UM5L 5C71A 1T0MB 3MV8B 2XPGB 1MWAA 1SM3L 2QSCL 4L4JA 2YD3A 1DUZB 1S7XA 1QNZH 5F7LB 2QADC 2Q6WA 1I1RA 3EYOA 1GOGA 3B6SA 5KAQF 5BO1H 1RUMH 3QDJD 2DF3A 3VDCA 2YPVL 4PJXA 4IRJD 5CCKL 3DSFL 5C0CD 1FNAA 4K9EH 2Z92B 2IAND 1M6OA 1UYWL 3T0ED 2LTQB 4S1DD 4F15C 3IDXH 3MROB 4YHLL 1Q9KA 2RFXB 3L9RB 1CXFA 3PGDB 1HZHL 4X7TA 4KKNA 4Y4HC 3JWDH 3QUML 4KHTL 3NFSL 5DRXB 3WJLC 4JFXA 3VXRA 3HB3C 4EN3D 2R29L 1XMWA 3OKKA 4I0KA 1JPGA 1QSFB 3KYMB 4GRLD 3CFIC 4XVUD 1VPOL 5DLML 5EOCJ 1R3IL 4K3JH 1H3PL 4ODXA 1FL3B 3ARXA 2ZG3A 1ZT7B 5F8RC 1WZMA 1OSZB 43C9B 4J3UA 2Y07L 2CJUH 2WUCL 1FL6B 1JUFB 2XWJA 1XZ0B 4D0BA 3ZDZF 4UTAL 1JYWA 4JDZB 3VDBA 3NMEA 4XH2A 4NRXA 4L3EA 1NMAH 2NX5B 1VACA 3L6FA 4KV5F 4XHQA 4LNRA 1BVKA 2FJGA 2X4RA 4C59B 2AJYH 4U4BA 5FYJD 4HKXA 3QIUA 2JB6B 5E2VH 1V3KA 5GS1B 3HNVL 3ARZA 1FE8H 1QQDA 3UX9B 3BYTA 2WQ8A 4GFTB 3MXVL 3UTSE 4X83A 4QRPA 12E8H 3MRDB 4N8VB 4R7DB 2J8UF 2HVKB 2HFGL 3VXTA 1MFEH 3ZTJG 1P7QD 4KQ3L 1JPSL 3H2WA 4ZO6A 5C09B 3VFPB 4YJZL 4K7PY 2W1NA 3RDTC 5FEBA 4OCXL 4OSUL 5IMOA 1FZKA 5HGDA 1ZS8A 1QRNE 1AY1H 1G6VK 3VXMA 5JNYB 3ULUE 1OW0C 4R6UA 2FECL 2V2XB 3PQYE 4OZHB 4F9PA 3WFDH 2VAAB 4NWTL 4YGVB 5FIEA 3FT3B 4APQB 2YD7A 2GAZB 2H6PA 3KR3H 2CDFB 3BSZL 4YZFE 3Q6GH 4H20L 3ROLB 4Q9RL 1MWAH 2GQHA 1QUNA 4KHXL 2OQJB 4JAMA 3LSOB 4OQTL 1GOHA 2CGRL 5IP4A 5HHPA 4HWZB 1BIHA 3RPKA 4X6CB 4IS6A 1XF4B 4QHNB 3VJ6B 1IBGL 5DMIL 2F58H 3PNWB 3C8KB 3OMZA 3MCKB 4NUGH 3SE8L 5I76A 1A02N 2X70A 1JBJA 3S4SA 3VFUA 5C2BL 5TJWK 3LV3B 5L9DH 4XVTH 3EO1B 2ADJA 3HZKB 4NN5B 3MRPA 4ORGA 4R8WL 3GSOB 3T3PE 3HG1B 3BW9B 1U8OB 4AH2B 1A7NH 2Y5TA 4D0CA 2XZAH 1IAIH 4L8BA 1CF8L 3EOTH 2CO6B 1AGEB 2PF6A 1J0KA 5DD6B 2R0LH 1MJ8H 4L3AA 1ZHBB 5JHDD 4P9MH 1RURL 3T2NL 2XZCL 1BECA 5I74B 1RD6A 2AJVL 2E5EA 4O2CB 4OF3A 2JJSC 3QQ4B 5FUZH 4DW2H 1L7TH 3CC5B 3VXOB 3SJVB 3UTZA 3EFFA 4FQLL 4IMKC 3DRTA 2YA0A 2R9HD 3WKMH 3MSPA 5EBLB 3MV9D 4UQ3B 1J7VR 4NUJB 3C5SB 4DGVH 2PO6B 3ZLQC 3T4YB 3VW3L 2FB4H 3LEXB 3LEVL 4GAGH 5DVOA 4G42A 4PB0H 2WIIB 5IEKA 2JCCB 2RHEA 4LEOA 1DE4A 1UC6A 1JZ5A 5DK3A 2E27H 2DQDL 2BSRA 3KPRE 3BZEB 1YNKL 3HUJB 1I1CA 5D9SB 1JJUA 3IDJA 5I8OL 4OZIE 5JIHA 4MA8H 1WQVT 2GJ6B 2CK2A 2F53B 3KPLB 1JWMB 1WEJL 3IJSA 2JB5L 4MS8D 4XNMB 4MSWA 2FATL 3LKSA 1BOGA 3GSNH 2CRIA 5CIPB 1J8HD 1KF9B 3VGAC 4Q6IB 1RPQA 5HYSG 2FO4A 2EH7H 4M48H 3MX0A 4IHOB 1N5AB 4QRUA 4Q0XH 3DUHA 1QFOA 1F2QA 5ACMA 2Z8VC 3ILQD 1LE5B 4TSBL 2WINA 2IAMB 4ZPVB 1U0QA 4N1EA 3GHBH 2R1WA 4AEIL 1OAYL 1D9KD 5JPNA 2CXKA 4DWHA 3SGKC 2OL3B 4L1HA 4RISH 1F58L 2I60H 2LVEA 2W38A 2W0KA 4YHZH 3QUXA 1BD2A 4MNGB 4N0FB 2VZTA 4H0GA 2PW1A 5BQ7A 1MFCL 4PJGB 1A7OH 4P49A 1BEYL 4KMQA 2ADFL 3OAUH 3BJLA 5EG6C 1IGJA 4P2RD 5I1CL 5B3JE 2BDNL 4HMCA 2X7LA 1TNMA 4I48B 4OF0A 3TBSA 5IHLB 2PCPB 4BSWA 1MLBB 2W9DH 3QUYB 3LQZA 4QXTA 2R0KH 3OR7B 3WFEH 4NO5A 3LOWA 1DFBL 2DICA 1BJ1H 3G9AB 1R3HB 1MJ7H 2CIKA 1U3YA 3MA7A 1KCSL 4JHWL 2XWTA 4LU5H 5KVDL 1SVZA 4M43H 4LEXH 3QDJB 4OCLC 5INDA 5F9WB 5AD0A 2DMKA 1UADC 3S9DB 2X4NA 1IAII 3LN4B 4IRJB 2FZ3A 5DJAB 5C0CB 3SDCD 2IANB 3T0EB 4ISVB 2VC2H 1RJZA 4GJTB 5GSVA 1YQVH 5E95B 1BZ7A 4PJEB 2W0PA 5BOZG 4RMTA 5IVZB 4KVNL 5E6IC 2GI7A 3VH8G 4IOFD 4Y2DA 3MV01 2WNGA 4XBPB 4LARH 4EN3B 2R4RL 3CVIL 3AC0A 3WE6B 2P5EE 1UCBH 3NABH 1R5WA 2VZVA 4AT6B 4GRLB 2EXWC 4XNYL 1YEJH 3R06A 3CXDL 3TBYB 3MO1B 5TQ0H 2FIKA 3EKCA 1JYXA 1I75A 4P9HH 4YQXH 3OKNA 3ULVE 3O6KL 4LGSB 1EO8H 5HBBA 1H5BC 5SV4A 3PUCA 5J6GB 3GIZH 2BOBA 3ZYZA 1PG7W 2AJZB 2VXTL 5HHXH 1A0QH 4Q9QL 4FHBD 1GRWA 1FLTX 4LVNB 2HKHH 1HHKA 5FUOH 4ALAL 4HFWB 5CINL