5FV1L

Crystal structure of hvegf in complex with vk domain antibody
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords VK DOMAIN ANTIBODY
publication title Novel Interaction Mechanism of a Domain Antibody Based Inhibitor of Human Vascular Endothelial Growth Factor with Greater Potency Than Ranibizumab and Bevacizumab and Improved Capacity Over Aflibercept.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 108
sequence length 108
chains with identical sequence M
ec nomenclature
pdb deposition date 2016-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fv1L00
3H9SD 2ZSWB 1XFPA 3RGVC 1CF8L 2UZIL 3OPZL 2VH5H 1UJ3B 4M00A 2BOCA 4HT1H 4ZUSB 5EBGA 4F7CA 2AI0L 3MBXH 1HYRC 4RBPH 3GMPA 4XC1L 4MAYB 2Z8VC 1OM3L 1JN6B 2Z91A 3BGFB 1WVZA 3V4PH 3MA7B 3U46B 5GGSB 3CXDH 1ACZA 3LQZB 3TP4A 1TTGA 4XNXL 3MJ7A 4I13B 2LAGB 1U3HD 4MNQB 4YDVB 1NLDL 4MD4A 2JK5A 1QD0A 4LLMB 4Z95L 4RRPG 1NCUA 4AIZA 4NQUA 3BGMB 4ELMA 2CLVB 1L0QA 3EFDL 3QA3A 4JEGB 5CINL 4X6CF 5L2KE 5E94A 1Y6MR 4UAOC 4ODSL 2F58L 2CXKA 3VG9C 4BQBA 4IRJA 4YGAB 5BQ7B 3LKPA 4U7SA 5F7FA 2VIRA 5CSBA 1YYMH 3AAZA 3CFEB 5I8CB 5EULV 1J87A 3WFEH 2FX8H 3BP5B 1MJ8H 4FHBD 5A2IH 1T83C 3MRRB 5IMKA 2W9EH 4QRRD 1T0NB 1G9NL 1S8DB 1CT8A 2JJSA 2W92A 2DQJL 3GJEB 3VXSE 2VABA 5T3ZH 4DN3L 4I1NB 1T7ZA 5JHDE 4HS6B 4YHKL 4G8EA 1PSKH 2XKSA 2BSSA 1BJMA 5SWZA 3TT3L 5B39A 3MGTA 4G80A 4NDMA 5EC1A 1G7MA 4R2GC 1IM3A 1EHLL 4UIMB 5GXBB 3TBVA 2XG4A 5TF1L 4NUGH 3LZFH 4PGDA 4N90D 4UV7L 4R97C 1JGUH 4NO0D 1KCUL 1K3IA 1GPOL 4LLVA 4EN3A 3LS4H 3VWJC 2Y06L 3FB6B 5GRJL 3S6CA 3ARDA 1A7QH 4JDTL 1JV5A 2X4TB 4LBEA 4UDTA 4XPTL 4HUUB 3UTPD 1EV2E 4PGZA 1WAAE 2Z93B 3ALXA 3P0YH 2FEDD 3GO1L 2APWA 3L6FB 5C09B 2HLAA 3NACH 3T4YA 4JY5L 3X12A 4FTVE 3C6SA 2FWOB 3DYOA 2QR0B 2OR9H 3KPSE 4G43B 1JNJA 1KBGH 1A6TA 5E8DL 4HS3B 3CFDB 3MRNA 1SVCP 1RJLA 2FLBT 1T21A 4G7YL 5DURD 1KPVB 2NZIA 5D7SL 3IF1B 1RVFH 3EHBD 4PJGA 1AO7A 3TBWB 4DTGH 4JREC 5EOCJ 3HZVB 3S37H 2I07B 2OTUB 3D85D 4Q6IA 5J3HD 2VL5A 1IAKB 1T20B 5B3JE 1SJEB 2JJTA 3FAWA 3CDGA 1N7MH 2WP3T 3VXRB 4MJ4A 4M7KH 1J0ZA 1FL5B 4YPJA 4BJLA 1H3GA 3IKCA 4MJ2A 3ROLA 2VDML 4HV8B 2VXQL 3U0TA 1EEZB 1P4BH 3K1DA 1NLBL 5SWSD 3N85L 5FUOH 5MP6H 3D39A 1TPXB 4X80H 5IFAL 1J1XH 1I1AA 1I7TA 4HMEA 1D5MA 2IH3A 2D7NA 5DUMH 5HYEA 2YEZA 1MRCL 4QOKE 4XP5L 1TVBB 4BA8A 2BC4A 1NCDH 4K7FB 2VZUA 3GMLB 1G0YR 2H3NA 4GUPB 2F54B 1XF5B 4JM2A 4LU5H 1H5BB 1HXYA 4DJMA 1HSAA 3L3JA 2GSGB 5ID0A 4P99A 4E41A 3QXDA 2X9YA 3D9AH 2VZ3A 5GGVH 5ACLA 5ITBH 1MOEA 1OAQL 3MV8B 4K07A 4LCCC 4F2MB 4JKPH 4TPRL 2E7CA 5HGBB 1A3LL 5DJ6A 3BD4A 3R8BB 5E00B 1QEWB 4RNRA 5GS0C 1P4IL 2EDDA 1KCVL 3KR3L 1ORQA 3JWNC 3SKOB 3ZKXB 1R3HB 5C2BH 4MZ3A 2IGFL 3J8F7 3HE6C 2AK4A 4Y5XB 3TVMA 4FABH 1JNLL 2UZYB 5HHOB 4HUWA 4ZUSA 1KULA 4J3OC 4YIQA 5D2NC 3LB6D 3DHJA 4MAYA 5C9JA 5CILL 4RWYL 2QADB 1WFNA 4M62H 5I1IL 3FHAA 5EIQA 1F4AA 4ZFZA 2HVJA 1EIBA 3GIZL 5F6IB 1YEEH 2K7QA 2XNAA 5JOPE 3X3GH 5DVOA 4QNPF 3N1GC 4HIEA 5FO7A 4PV9B 1QLEL 2EIBA 3VD5A 5D2LB 5KVFL 4Y2DD 3AS3A 4Z7WB 2CGRH 1SEQH 4NNPL 5D9SB 4QY8A 4NQTA 1K6QL 3WHXA 3W11C 1CGXA 1UWGL 2Q7NA 5CCKL 1IC5L 4UB0L 4AENB 3MJGX 1GOGA 5BQ7A 2XZCH 3MLPA 3QNXB 3GGWB 5DRZB 2MQ0A 2VDNL 3MOBL 3HNTL 2GJ6D 1NC2A 3MRRA 3MOQA 4JZJA 3OF6D 4IIQB 1S8DA 1S7RA 1D5XB 1I8LA 4RGOH 3K8KA 4G6AC 1SBBA 5L88H 2OJEB 1DQLL 4QHNA 3RX8A 5F3BB 2VQ1B 3WO3B 1UZ6F 4PRBA 1Z9OA 2D03H 1RUKL 2ZZUT 5KZCD 1PY4A 4JFFA 4HGMA 2XZAH 3W5NA 4NKMB 3OKLB 1S78C 4JR9H 1WK0A 1OT2A 5FGCB 2Q20A 3VI4E 4WI3A 3FTGB 3SJVE 3KHOA 4KUCD 2E8YA 2DD8L 2WUCL 3QDJE 4P49A 2FZ3B 3DX6B 4LSUL 3TBTB 3V5HB 1NH6A 2YUZA 5BXFB 3MLRH 5I18H 3K2MC 4FQLL 2ESVE 1IC1A 3KG5A 1F5WA 3VGAC 5EZIL 2Z8SA 1ZHBB 5JQ6H 4BFBD 2ATKA 3ZE2E 5C09A 4FFWC 5FCSH 2V2WA 4IS6A 4WEUD 4PRPE 4K2UH 1X4YA 2W0PA 4DOHE 4FZ8H 1S9KC 1UH4A 2R0LH 3X3FL 4Y8DC 5EUOB 1F4YL 4KKLC 1EUTA 3QI9B 4AM0B 4G7VH 5AZ2L 2UY6A 3IF1A 1FRGL 4F37K 4ZNEE 1H3XA 4ZNCD 3RWIB 3MV7A 1LILA 5IQ9A 1E27B 4YZFE 3TIEA 1QR1A 3FHQA 2EE9A 2ZPKH 3DYPA 1QSZA 1FG2B 2XV6B 1SYVB 4ODHL 5J56B 3LKNB 4P2YA 3T65B 5EU7E 1MJJB 5JW4R 1CD1B 3MLYH 2J6EA 1CU4H 2XY2A 2H1PL 3GZKA 5GHWH 1DJSA 1TCRA 1DQDL 2Y23A 3WYRA 1MFEL 1EMTH 4EBQH 4EOWH 5ALCL 1UB5B 1LO2H 5B8CA 1IC4L 3ZZ1A 1DVFD 1FO0A 5IUSA 4FFZH 4LCYA 5T33L 4LAQH 2B39A 4CL7A 3SDDB 3D3VE 1XAUA 1YMMD 3FT3A 2NW3A 4JFDA 1J8HE 3QCTH 2GSIA 4EDXB 4XWOC 4O00A 4KZEH 2YXFA 2A77H 2F54A 2X4SA 4XNQB 4GRLD 4M7ZC 1H5BA 2G9HB 2QQLL 4G5ZL 4G6KL 1UG9A 4HGWB 3BW9B 5JW4Q 4MJID 3C5JB 5E8OA 1MUJB 5C9KA 1Q94A 4OUUA 4YXLL 3HG1D 5KANG 1MFBH 1ZA3B 1A9BA 4GMTH 3D18B 4JO3L 3O9WB 1Q38A 2LVCA 3TCLB 2DQIL 3HUJA 1QBMH 4R26L 4OZ4A 3WN5A 4IDJH 1D9KB 3QP3A 2F19L 1A6UL 2X4OA 4KMLB 5DS8B 5C0JA 1V7ML 3DPBA 1C5CL 1JJUA 4WV1B 1R3HA 1DUZB 4FQXA 3G5ZB 4PJDA 3SE9L 1SJHB 3QUZC 5D2LF 5E99H 4Z7WF 1F6AA 1FGVL 1JUFB 1YY8A 4HF5H 1CGYA 5J12B 4WEBL 4GS7C 3IFOB 5FGSA 1MHPL 3FN3A 4MXQC 5IMOA 2NYYC 5AYUH 3UXFA 3DRTB 5F9OL 3ZDYF 1P4LA 3QXAA 3KLDA 2EH8L 4P5TC 2Q3ZA 2B4CH 3A6BH 5D93C 1UVQA 2MCPL 4HIHB 4MMZC 4OLEA 3G9AB 3U9PH 3WIHH 4FP8H 5AUMA 2MSPA 1IGFL 4FQ2L 4Z7WA 4IOIA 1MCRA 3BPNC 2GHWB 5LWYH 5D5MB 3RA7H 4APQC 25C8H 2BCKB 1GVIA 1A7BA 1R0AL 5E6YA 5K59E 3MRFA 4HJ0D 3Q6FA 5FHBH 4Q7DA 1Z3GL 2GY7B 3BO8A 2VSCA 3RBSA 1UA6L 3ESVF 3MV11 3GGWA 1J5OL 4TUOA 4NM4L 4XXCA 1WICA 1JNNL 2BFVL 3IJYA 4XP6H 1LEKB 4LVNC 1BWMA 1D5XA 2WW8A 4JG1H 3LN9A 2P5ED 3ZHLA 1O5DT 1A7PL 4NKQB 4OGYL 5F3BA 2VQ1A 3CMOH 1QYGL 4U31A 4JRXA 3A6OA 1HQRB 5CIPB 3V52L 1R3KB 4HIIA 5CIPH 4A2LA 3OAZK 1OOAA 2M2DA 3FZUD 3T4AA 1MLCA 1IGYB 3ARQA 2J8HA 3LMJH 5CWSB 4RGND 4OM0H 2WP3O 3C5ZC 3KYNB 1UZ8A 2XKUA 4H20L 3TBTA 1GAFL 5ISZE 5HI4C 2Y25A 3CXHJ 5EFIB 1MCPH 4YBLC 2IADB 4Y19E 1FGNL 4L5FL 4H8WC 2DBLH 5DA4A 3TT1L 2MFNA 3R0MA 5H94B 1DBBH 4OQTL 4Q58C 4OD1H 4YHNA 3WNNA 3IB4A 3BP7A 3THMH 1FZOB 1FVCA 3KPLA 4NWUL 3BHBB 3GUTB 1L9NA 3OL2A 5DA0B 3F7QA 2WUBH 2FNBA 4K3EL 5EUOA 3Q48A 3RZCD 1QKZH 1N8ZB 3HNVL 4M6MH 4ZAKB 4X99B 3ECBB 4S10A 4JHAL 1T5WB 3L9RA 5JW5B 4NN7C 3DIFB 4XBEH 1E27A 3VXSB 4PIRF 4DAGH 3NCMA 3ZYJA 5I74B 4MD0B 4AEEA 5JHDB 2VLJE 1MPAH 3TA3B 4RMUA 2DJSA 2H41A 1ZT4B 2YXMA 4M5YL 5DRXB 4IOFD 4AQOA 3IETB 1I1RA 3DXAD 3PHOA 4H25B 2E7LA 4JE4B 1FYTB 3BQUB 4LSPH 3PWPE 3QG6B 1NC4A 5B21A 3MRQB 4EKXA 1JI1A 2DL2A 4LL9A 3HB3D 1QA9A 5F9WB 3WXWL 5LCVL 4CMHB 1WFTA 3E2HB 1NGQL 3MNVB 4HWBA 3UTSB 5ICYA 4HIXL 3CU7A 1G7JA 2AJSL 2OI9C 4M61A 3LKOA 4KK5C 4X0KA 3RX5A 3QIWD 4MA3A 4LNVA 5HDQL 5HPMB 1DUYA 4D9RD 3B3IA 1VENA 1F3DH 1CVSC 5T1KD 3DI2B 1KIRA 5IJVB 4PJIA 4P3CH 4FTVB 1PFCA 3H3KA 1V7NH 3NFSH 5GSRB 2R4SL 3KPSB 4J3WA 4Y4KD 3BW9A 1BECA 3QDGD 2N1KA 2NY2D 1K8DB 4CVXB 3RWFB 3LRSB 3HE7B 4YHML 1YEKH 5TDNB 1YYLL 2CRMA 2I27N 1KTDA 3C60C 2HT2D 2DLFL 4FNLH 3SDXE 1DEEB 1D9KA 2ZNWA 3D1MC 3LH2H 3QFJA 3QXWA 2Q86A 2CDEB 1L7IL 5F1IB 2X44D 4LSTH 3C5SB 1DUZA 1CS6A 1BLNB 4GBXC 4K9EH 2CJUH 2X4UA 3TO4B 1PKQE 2R2BB 1CXFA 3DYMA 4MJ6A 5D5MF 5GGUB 2X10A 1KJ2L 5EG6C 5F7UA 2J8UB 3F7VB 4MSWB 1IEHA 4MNHB 5EWIH 3SKMA 2YPLA 3QQ9D 1DLHA 3DRTA 1CICC 1WZ1H 4MVBC 4WI8A 3WIHA 1KCUH 1BJ8A 1XCQB 3K46A 3T2NH 3GSQA 1W72B 5KG9B 3FQNB 2V9QA 3DUSB 1J12A 2FIRT 4KTEH 4HK0B 4XPTH 1S9VA 1W72H 3I2CL 4Z7UB 4OLUH 4WWKA 3CFKB 1BZ9A 3ILQC 5DJ8B 3O4OC 3B9KD 2VUYA 1TTUA 4RFNB 2PCPB 3QWOB 3U0WL 5IVXE 2XQBL 4C54A 3ZTNL 3VH8A 4GH7B 5JR1H 1QLFB 2GT9B 3NN8A 4JG0H 4YFLI 1GC1H 4BZ2H 1UCBH 3GRWH 4KDTC 1K3ZA 3CSGA 2H32B 1EJOH 2HTKD 5D7JB 3WNOA 1UB6A 4KKAD 1FFOB 5D1QA 5HGDB 4OZHA 4PRID 2H32H 1IEAA 5EBWA 4G8GB 1MF2H 2GK2A 5JPNA 4IRZH 4TULL 3G08B 3U4AA 5DF0A 3S97C 2XN9B 2X4RA 5L2JA 1BVKA 4NCC1 3I02A 3RI5F 2SEBB 1K4DB 2H2SC 4Q0XL 1U3YA 5KSUB 3BZFB 1ETZB 1G7PA 4X5XB 4KQ3L 1XZ0A 1NCAL 3EUUA 3MOAH 5FHAH 1AC6A 4FQJH 1OQXA 2B5IB 3VMNA 3UJTL 1T2QL 3B8YA 3GBNH 2CMRL 1QRND 1G0XA 2F53B 5I1JH 3K74B 5BZWB 3NVQA 1YY9D 4NQDD 2J4WL 3WS3B 4XX1E 2I9LB 3OKDA 4ZPTB 5FA3A 4L3ED 3DROA 4WEMB 4DZ8B 3SQOL 1IQWH 1HDMA 1MRFL 4KXZI 5IFJB 1ZGLA 1MHHB 1IAIH 5MI0B 3D0VB 4L3CA 3TH4T 3RX7A 2BXYA 1BWWA 2NXZD 5DSCB 5KSBB 3BOVA 1CDYA 3D69B 3CD4A 5HDBF 5L2KA 1U3HC 1F90L 5C0EA 5I75C 5F6HI 4D0DB 3NGBB 4M6NL 2P5WE 1X6LA 1PG7X 1ZT7A 3OKNB 3CLFL 5IG7B 1A3RL 2CXGA 3N9GL 5H94A 5EOTB 4G8FA 4QRPD 4RBPK 4KAQH 2XPGB 3BHBA 4U05A 3VG0H 3U2SA 4WHCA 3OR7B 4NN6C 1W8NA 3RWEB 2DQDH 1I7RB 2L4OA 4MA8L 1A5FL 1N8ZA 3EO1B 4OLZL 2EEBA 3S3JA 3D87B 3MJ9A 2BY1A 3MBEB 3UYRH 3MRDB 3VXSA 3RWHA 3MACH 4L4TD 3V7MA 5HHQA 3BP6B 4TQEL 4MD0A 1LEGA 1VGEH 4OLWL 1U91B 5LGJB 3VCLB 1NGXA 5EU5B 2DWDB 1I8KB 3ULVL 3I50L 1J8KA 4P23B 1KTKE 1WAAF 3S5LG 2YZ8A 3S35H 3L95A 3MROB 2GY5A 1OAYL 2K7PA 2V5TA 1EXUA 1LO0H 4PGBB 3H9YA 1Z5LA 1U58B 3CAFA 2XY1A 5I8EA 3BEWB 2L0DA 3O8XC 1TQBB 1I9IH 1JRHH 1U8LA 3AXLA 3LPWA 4XGZB 4XVSH 4L4VE 1DANU 3GMRB 3F6IA 1P84K 4Y4FD 4RIRB 3QUMB 4AIOA 3V6FB 3DX9B 3C09B 4U1MB 1IJ9A 1AIFA 1RFDL 3L5XH 4MZ2A 1ZE3C 1WAAA 4H0IA 1JHTA 3H9SE 3QUMH 5FA4A 5ID1B 1AP2B 3UDWA 4X98B 5E24E 3TIDB 1Y6KR 1TJHL 4PRPB 1TENA 4G9DB 2D0HA 4FTVA 1BOGB 2VE6A 2F5BL 8CGTA 5CCKH 4WGWB 3KPSA 1P5UA 1OLZA 1J0HA 2FEDC 4CVXA 5JQHC 3QIUC 4DKEH 3U4EB 4X6FA 1ZEAL 2J8UF 3BKYH 2LFGA 1RQ5A 1NANH 4ODWB 4AMKH 3W0WD 3KPRB 2R69H 3HAEB 4P48A 3LV3A 4LVOC 1DEEA 1OWWA 3DMMA 1YZZA 1AGBA 1AGDB 4ONHB 1Z9SA 2JLLA 2ARWA 4BH7A 3ULVE 3EOAB 2GKIA 3HAEH 5FM4A 3ZHDA 1RIHH 1HQ4B 3EHBC 5IMMA 2BVQB 4Z7UF 2PNDA 1N26A 1KNOB 4ZS6C 1A0QL 3P11L 5ESAB 4P2RD 4U6YB 4U1IA 1B0WA 3UBXG 2HJFA 4EIZC 4NO3B 3G6AB 3EFFA 1DDHA 2NY0D 4KHXH 4OD2B 4NJAL 4QRSB 4ETYA 4V1DD 5J3HC 3I9GL 2C9AA 4PJAB 5EZOH 1FVEA 5C0AE 3RWJB 1YN6A 4M3KB 1CVRA 1LP9B 4QRRE 3FT2A 1XF2A 3DBXA 2OJZH 2EH7H 4QOKA 1IAOA 3DVNB 1G0DA 3OKEB 4HK0A 1NBVL 3WFBH 4JVWA 5I8KH 4HCRL 2HWZL 4G6MH 4PJFB 3VWJA 4OZFG 3EYSH 4S1DD 2G75A 4U1HA 1E4JA 5CMAA 5KTEL 1Q0YL 2PR4H 4N90E 2XA3A 1JZ5A 5TQ2L 1BFVH 1OW0C 1CDUA 1FFOA 4NQCB 3Q6GL 4NZRH 3WNKA 4DUWA 4M1DL 1XIWD 5DC9B 1HIML 3D6GA 2AABL 4LKXB 3RBGA 2KZWA 3D25A 2F9BT 1KEGH 3PP3H 4XHQA 4Y4HD 3ZKSD 4XPAL 3UTPE 1ZHNB 1LDSA 3PL6A 3OKKB 2VLKD 35C8L 1ZSDA 2Y7QB 2UWEB 4PD4J 4DGIH 3UPRA 1S7WB 5HHVH 3QG7H 4WUKH 3MRJB 1B2WL 4UDUA 5KSBF 4NGHL 1HEZB 1AGFB 4JFXB 5E9DE 1U42A 1WWBX 5EC2A 1U8IB 4NFDA 4FQCH 4X7DC 1MFEH 3WS3A 4K94C 4X7TB 1IBGL 3RHWK 4G42B 4IRSB 1JZ2A 1ORSB 3GI8H 1JHLL 4OFYA 2BNRB 4OV5B 1RAMA 1P69B 1MHHA 3U1SH 5FCUH 5EO9A 2CRZA 4XNYH 4LLAA 4DGYL 3FFDB 5EPMA 4C56B 4XCFH 1MREH 2FGZA 1FFPA 2NR6C 3A67H 2P49B 4LHUB 4YWGL 5DJXB 3HMXH 4UTAL 4K94L 5DUPH 1RUPH 5IW6B 3EYVB 1URLA 3BH8A 4JO1L 5L0QC 1VFBB 3OKMA 2M8XA 1EDQA 1F11B 1I7RA 1EERB 5B4MD 5KN5A 3P4LA 4E5XB 2XWJB 3VU2A 1Y0LB 4G8IB 1LE9B 3V4VH 1NKOA 2FJFB 4LLQB 3C6LD 2GUOB 3IDGB 3MRDA 5DD1L 4GXUN 2A9NH 3UTQB 3BP6A 3PHQB 1MJUL 3IGAB 1U6AL 1ZAGA 3C2AH 4O2CA 2DQFB 4K7PY 5KVDH 4LCCA 5EA0L 2YN3A 5ACZB 3L7FA 4HBCH 2VXSH 5CD3B 5I15L 1YQVH 4X6DB 2MMXA 1S5IL 3ZE2F 4P2OA 4Z7OE 2IAMB 5MEPB 1XF4A 3CFBB 2DM2A 3TESA 4I5BB 1Q0XL 3SJVA 4JN1L 3U7WL 5DJZB 1WZKA 3BKCL 3GMRA 3QDJA 3ARXA 5FECB 1BP3B 1F3DJ 3S36X 1C5DA 4JQXC 2MCPH 5FGBC 3RZWA 1N5AB 2ESVA 4YNYB 1H8OA 5GJSH 3F8UB 4JFZL 1H15B 1IGFH 4YZFF 3HZMA 4OT1L 1CIUA 2Q7YB 2NY3D 4IM8A 1OTTD 4PJ8B 3TIDA 3X11A 4PRPA 4WWID 4N9GB 1R3LB 2W91A 1BOGA 5ERWA 3CZJA 5MHSE 1T03H 2NY7L 2R2HA 5DEZA 4D94A 4XWGL 1BBJB 1ZLVK 1UKSA 1ACYH 3U4EA 1UA6H 3QEHB 1C16B 3FRPA 1R5IA 3PDOA 4ZNEA 5FF6B 4KJWD 2H26B 4GKNB 3BKML 3IFPA 4PJAF 1D5ZB 2VLJB 1LP9F 5GISH 4X4YA 4CDGC 1N59A 1S9XA 5C3TA 2KL6A 1I4FA 3P73B 1KN4L 1HYSD 1X5XA 4U33A 3IU4L 4CU8A 1IQDB 4NKDB 1KPRB 3V52H 4X7SH 1RULH 4PJFF 3GB7A 2P48B 3TZVA 4HJJL 4QRSA 4HW6A 1E6JL 5FUZL 4P57B 5DEFB 1BFSA 2FJGA 1C12A 5EZJA 1TDQA 3MRMB 5E6ZA 2BVOA 2GJ6E 4OZIE 2Q8BL 4Y0GA 2QKIB 5DHVA 3D3VA 3OAYH 4OM1L 5M94B 1JP5A 3EOTL 1CK0L 1LNUB 1J8HA 5CJOH 4G6FD 3ARTA 4O2EB 3SGJC 1DVFC 5E8EA 3HMWH 3FMGH 1YEJL 2BJMH 3NIGF 4LF3A 5LGKA 3L5WB 5DDHB 3FT4A 2PYEB 2UWEF 4HG4K 2WIIB 5BJTA 1P5VA 3VDCA 4I3SL 4JRYE 2XTJB 1LDPH 5IVOA 3RWCA 1RZIB 1MVUB 1A8JH 1IKNC 4JPKH 4M8QB 3L3OB 3LS5H 2VDOL 5C0FA 4PJXE 3OKYA 5BMFL 4LSQL 4RSVA 4YUEH 4RQQB 5FYKH 1FAIL 5FYKU 4LVHC 1W0VB 2OK0H 3KLSA 4HPOH 4NSKB 1LVEA 4AH2A 3OKKA 4OSUL 4CMMA 2CDFA 5DQJB 4PY7A 3VFMB 2EEAA 2DKSA 3G6JE 1ED3A 3VFWB 1EAJA 2WBWB 2D7OA 2NTSP 2OMNA 4HH9A 4TYUA 2DF3A 2O61B 4ZUWB 1YDPA 5CZXD 4PJEE 2QSCL 3R4DA 3KWWB 4EXPX 3SO3B 3ZKND 3OX8B 1B9ZA 4TUKH 3WXWH 2A83B 1KXVC 3JWOC 3BMVA 3BP4B 3BUYB 5JPMB 2YC1B 3KYMA 3PJSB 3VXNA 1I7ZB 4XNZC 2JB6A 3MZTA 4POUB 1NCBL 1RSFA 2V5SA 4WTWA 4R4BA 5ADOH 3BZEB 1QHPA 3QQ3A 5C07D 1JWUB 5TE6L 4NOFA 3G9VA 4JJ5A 4L29B 5I0ZA 2BVEA 4OFDA 3JWOL 1KCRL 4M4RA 5A2KH 2OLDA 4X6DF 2NY5L 3MRHA 2CRYA 3OXSB 4HJ0C 3BISA 3ARBC 4LLQA 4KJYB 5E2VL 1YMME 4E41D 3DO7B 1OWRM 1G7HA 5EO0A 4BUGA 4RAUB 5CBAB 1IAIM 2DQFA 3MCLL 1RIUH 1Z0NA 5IIEB 2ITCA 5GS2H 3DURA 3SDYH 4I8DA 3PWNB 2J12B 4MJIE 4JANB 2QQQA 1VFUA 3KPQB 3IVKA 4X4XB 3ES6B 3UCRA 1N6VA 4PG2C 3QUZA 4NWTH 4Z18A 9CGTA 3QXVA 5HI3D 1CTNA 3ZLQC 5E03A 4QGTA 4M1CC 4MAYD 5ISZA 3FZUC 5IEHA 2W59A 3E8UH 4P4KA 3NCJH 3RPIA 3VXUB 3WE6A 5JW3H 4PRDB 1ZHLA 2CR3A 2JELL 3DVGB 4Y19A 4RGNC 2Z9TA 2E7BA 5DR5L 2B1AL 3LN5A 1U93B 4MNQD 1YEGL 4ODVL 4P5TA 5DJAB 1YEIL 4EI5B 2VLME 2VTFA 2HTLC 4Y5YB 2R1XA 3P4NB 3CDFA 1OF2B 1FE8H 5F21B 1KCKA 5D7IE 4JZOA 4HLZH 1I9RH 4APQA 2QLVB 5KOVC 3P2TA 4HKJB 2AEPL 3RI5K 4ZFOL 1D5ZA 1R3IH 5F7WC 3RZCC 5F3HB 4PR5B 2CDGA 2E3VA 3BPCB 3UTZA 4K7PX 1NC2D 1XGQA 1T22B 4WHDA 5T3ZD 5IW1A 5MEQB 3H0TB 3QIBC 5GRVK 3MLZL 3TN0B 1NCAH 2AQ2A 1L0YA 3QUYC 1WBXB 1S3KH 3PWPA 4OKVA 3T2OA 1JPFA 3NZ8A 1T04B 5BVJB 4LGPB 3WD5L 2D7MA 4PJ7E 3T3ME 2ZKHL 3ABZA 3CVHL 4JHZA 4IOFC 4H88L 3V5KB 5DQDH 2ATPA 1JGVL 3QBTB 4UUJB 1A64A 3ZKQD 5GGRB 4A6YL 5DLML 1M6OB 1AJ7L 1BZ7B 4LQFL 4M9OA 3IDMA 5AEAA 3STLB 3KPNB 4HJGA 1AXTL 2W0FA 2P5EE 3VRIA 1MRFH 4KRLB 3HB3C 3RVWD 3HRZA 3MJ6A 3P9WB 2MQ3A 2OZ4H 3BZDA 4OQTA 3ULSA 1UYWL 2JB5L 1ES0B 4LSSH 3NFPB 4XP1L 2A6DB 3L3GB 2IPUG 1A7RH 5FM5O 2ID5A 1IVLA 5JMOC 1JYXA 3QIWC 4NC1E 5E2TL 5ESQB 4F7TA 2W07A 1HCVA 5C0BE 4M8QA 3M17B 1NEZA 3LEYL 1CD0A 2EDLA 5C09D 2OL3L 4QRUB 1HZHH 3QEUA 4U1KA 4E0RA 5CP3A 1DCLA 3QO1B 3SDXA 1VSCA 4D9LL 1IKFH 1UWEL 4NUJB 4P59L 2NY2C 3VI3E 3DVIA 3LCYA 2J7LA 4DKFH 1OPGH 3WXVH 3S96B 4F57H 1PKQA 3VFMA 1NMAL 5IESL 3TWCL 3DARA 5F89A 1JMZA 4LEXH 3ULVH 3DSNA 4FRWA 2HT2C 1NPUA 1R24B 5DRNB 4WY7H 5IQ7H 1DBJL 4R90H 2CKNA 5TDOA 2O61A 2IG2H 4P9ML 4GLRI 1P9MC 1BD2B 4Q9QL 4F7PB 5C0AB 2EDHA 4GMSL 2HRLA 2XT1B 3VXRD 4JRWA 1PZ5A 2ZG3A 4KJQD 1J05A 2IBBA 2AV1A 1QSEB 5BRZB 4D9QE 4OTXL 3F7YB 3QQ9C 2E5EA 3BUYA 1IM9B 2RHEA 3PJSA 1JMXA 4TSAL 1FFNA 1I7ZA 1HE7A 4MA7H 1T1XA 2VQTA 4S1SL 5IVXA 3DETD 3WIIL 5BV7B 1KIPB 2F74A 1T7VA 2FHBA 5HYQA 1OARH 3OKOB 3VFUA 4ACPA 2BMKB 1CE6B 4GW5A 4F15B 3T0EC 1TJHH 1YEHH 4L29A 5BV7H 1R5WB 5HVHB 4P46A 3O6FB 1U8KB 1WISA 4NZJA 4OZGE 1OP3H 5IW3A 4I3RL 4JLRA 1T2XA 2F5AL 2F54D 1UQSB 3MUGA 2HTKC 4I0KA 2FB4H 5C0ND 4XPFH 2EXYC 2YD9A 4OCXL 1PBYA 3CJJA 3SE8H 3E6FA 1G7IB 5HHNB 4RAUA 1IGCL 6CGTA 1TJGH 1PJ9A 4D9RE 2R8SL 4JO2L 4LARH 4K71C 2DIAA 1JZ4A 1KJ2A 3QEGH 3B43A 3FQUB 1WBYA 4GRMB 1H3UA 4N8CH 3C60A 5CHNB 3O3AA 3KLHD 1JTPA 2FEEL 3G04A 5E9DB 3T8XB 5A16A 5C0IA 1RK1A 2RR3A 4NHUB 3K0WA 1CFBA 1BBDL 5FM8A 2OMBA 3KPPA 5HD8D 4O58L 3WFHA 4KQ4H 2CH8A 2BX5A 4BSWA 4J4PD 1JF6A 3HC3H 1YPZE 2QADD 1YY9C 1UENA 2EDKA 4X5WB 3ILPB 5B3NA 2P5WA 4JFOA 3U36A 4CVZB 1HKFA 1F13A 5IT2L 4I4WA 4ALAH 3D2UB 3GMQB 1TCMA 3L5JA 4U3HA 1Q9LA 1H9VA 1P6FA 1PG7W 2NXZC 5KVGL 2VZTA 3TYGL 1S9YA 3BXNB 5KSAB 3JV0A 4KY1H 1AR1D 4R7NB 5TJWK 1LK2A 2LTQC 4M7LL 1CFVH 1TQCC 3JTTA 5IB1A 5BW7C 2KPNA 1G84A 1IZKA 4KDTA 4P9HH 2MKWA 4JFQB 4J1UB 1I7UB 4QXGH 1FC1A 4RRPA 3BE1H 5CJBA 3EAKA 2VXTH 4D0BB 4PGJA 4ZQKA 4ONOA 5E2WL 5DRWA 1DBKH 4WENB 1G7LB 4LP4A 3UROR 4KK6C 1U8OA 4UZGA 1RJYA 3AB0B 3NIDE 2LVEA 2CRIA 4OAWB 4HQQH 2VLLA 3EDKA 1HWHB 4ETQA 1FNLA 3IDJB 3O6MH 4PRIE 1NFDE 4OLYL 4RMSA 1IL1B 4L4VA 4I48B 5DD5H 1NCNA 1KJ3L 1ZK9A 1A6AA 3WUWG 4BFEA 3DRQA 4YHPA 3B9AA 3H9SA 3SY0B 4P5MA 5ESVA 5MERA 1F4XL 4Y4FC 2APVA 3DGCR 5JLZA 3HC0B 1NCWH 4YE4L 1OAXL 3SKJL 1QRNE 1XGYL 1LO3L 2AEWA 1X7QA 5BO1L 4ZO9A 5DYOA 4NQDE 1G9ML 3R1GL 2EDNA 1VPOH 1F6FB 1U3HA 3GEWB 4L3EE 4BK4A 2LQRA 5HYFA 4LLUB 4NP4H 2R0ZL 2ZCKH 3P4OA 4MA1C 4NUJA 5DQ9A 1TVHA 3QI9D 3GHEL 4H5SA 4OFIA 3K2UL 4OGAC 4N8VB 4MCZB 2WINB 4EXKA 5CFHA 3BN9D 3S37X 1VFMA 1N6QL 4XNUL 2GJJA 1R24A 4QRPE 1M7XA 3GHBH 4RFOH 3PNWA 1HH6A 3V0WL 5IB4B 1U8JB 3MREB 5C0AA 3WFZA 4M7JH 4XMKL 3ISWA 5L7XL 5CEXA 1ZS8B 3RGVB 4QRRA 4X9FA 5EUKA 4ODTL 3VFNB 2JE8A 3VFOA 4N0YL 2BP3A 2AAVA 1AD0B 2DB8A 3BKCH 1GGIL 1DE4B 2CIIA 4L4TE 1XGUB 3OMZA 5IR1A 4GG8B 4L9LC 5DI8A 1NAKH 3MLUL 4YQXL 5FB8A 4ELKB 5ITFA 3O2WH 3V6OC 2AJVL 3SDDD 4JRYB 1A6ZA 3SPVB 5GGTH 3GSOA 1A47A 4GKZB 1M7IB 3IXTB 3O6FA 3HFML 4NO0A 3C9NB 4KPHH 4NQSA 4FQHB 3WLBA 5EO1A 4S1DC 3UAJD 4XBGA 4JAMB 2RAMA 1KEML 4N0CD 4QHMB 4UAOB 2EC9U 1CTOA 3QCUH 5K9OA 2G60L 3G6DH 4J3TA 3VG9B 5C7XL 1XIWC 2H6PA 5INCB 4GG6E 3P9LB 4R96A 3G6JB 1KSRA 3AVEA 1AFVH 3O9WD 1OVZA 3NCYS 3H42L 4GRMA 2LU3A 1D9KD 2EDWA 2AJXL 2P8PB 4JKMA 5E9DA 4DZBB 5JA9A 1I9EA 2XACC 4JPIB 4XP4L 2LABA 5I1GH 3SKNB 1A1OA 2GITA 2IQ9H 4JB9H 3NH7L 5DJDB 1QFPA 2C1PB 4LSRH 5FUZH 3VXQB 3OZ9H 4AEFA 4GAYB 5CSZB 5GS1C 5I66A 4CW1B 4WJ5B 3PP3K 3W0WE 1KELH 4MB4A 2Q8BH 3GSXB 1C08B 4R2GB 5BOPA 1KIUA 1NBQA 4HCRA 3O3BA 3D85A 1GHFH 2QJDA 2I5YH 2CKBB 1L7TH 2EYTB 3CX2A 2FX9L 1OB1B 2A74B 3CUPB 1OGAE 3RIAF 1R5VB 3W81A 3QH3A 1S7VA 4CVZA 2C3VA 1MWAB 2UVFA 2CKBH 3C87A 4Z0XB 3QPXH 2DKUA 4BKLA 1LGVA 4QRTA 4V1DE 5EOCL 3RY4A 1MWAH 4LLDA 1ZTXH 2C3HA 4ZS7H 4MXVE 1KIQB 4XCCH 5BMFH 3MYZA 5GRWA 5JOFB 3IFNL 4IMKA 4AIXA 4J1UA 3PWVA 5B4MC 1OW0A 1HKLL 1FG9C 4MQSB 2O5XH 1KUMA 5ACMA 4D0BA 1TETL 5E8PB 5AZEH 1QBLH 3QISA 1U8MA 1MI5B 2QHRH 5A3ID 1P6AB 2DKMA 3C6LC 3ESUF 4ERSH 4PS4H 5C0DA 4JPVH 1FIEA 3BRFA 2FJHB 5JHLH 2HFFB 3HI5L 1LO4H 1A6VL 1EO8L 4UIKH 1Y6NR 5DFTA 1Z9LA 2AGJL 3QT2A 3WFCL 2DQTH 1IL1A 4HULB 3V6BR 4FXGB 1HHHA 1IFHL 1GGBL 3GSUB 5C6PB 1AH1A 1SJVA 1CYGA 4ZOEA 2VLKE 4EEEA 5FKAA 1ERNA 4LCUB 4YDJB 5DUBA 3DV4B 3RIFF 1MH5A 4PRNA 4GW4B 2R2EB 1J1PL 5EOQL 4LIQL 1QOKA 3FB8A 1MCJA 1YEFL 1S7TB 1C7SA 4PB0H 4HUVA 3HLAA 2DYPB 3M1BB 1CLYH 1FVDB 2D4FA 3DHMA 1C5BH 2NY3C 1OTTC 3CC5B 5C0RH 1KJVB 3MX0A 5D7LE 1ROWA 3BGAA 1I9JL 1S9WB 4Y2DA 3T77B 3JV4B 4DVBA 4BQ8A 4LEOB 1FSKC 2CLZB 3C8KB 3CX5K 4ZAKD 3EZ8A 5DT1L 2OSLA 1X5IA 4MJ5A 2VR9A 2VDRH 1DL7L 3ZL4H 1JPST 1BHGA 4RMRA 3TPUB 3KAAA 3VXSD 1HHKB 2YA1A 1J0KA 3KYKL 5I76A 5JHDD 3G5VB 1SYSB 3NFNA 5KSVB 3QAZC 1G7QA 4QEGA 1A6PA 1HYSC 2MTPA 2GJ6A 4OZIA 1OAKL 3QRGL 4K3DL 5EORL 4NZTL 5H2BB 1I3UA 4QXUL 5GS0H 5L6YH 4ISVA 3HE6B 2DOCA 5JZ7C 1FYTD 5I1CL 3BQUD 1CE1H 2OYPA 3RVUD 1FNEA 1F58H 3GSWA 3QXTA 1T6WA 4FQ1L 4OCRL 5D2NB 1RZKL 1DQML 1T3FB 5C6TL 4OCWH 5CZKA 3KPMA 2JELH 4RFEA 3UTSD 3E3QC 3WO4C 3ULUE 4I2XB 4ZSOE 2HFGL 1AQKL 2KUTA 4JRYA 5FFLA 3G6JF 4LCIL 4JQXA 4YHZH 3O2DL 4EN3C 2FGWL 1VHPA 3MO1B 2E9IA 3ARDC 3VXPB 5HYIA 4PJXA 2DWEA 3KGRA 1MCCA 4FTVD 1PYWA 2ORBL 1KYOJ 5TE4H 2Q6WB 3KPOB 3KPSD 1B6UA 1OSPL 3BH9A 2FYYB 5F71A 3HE7D 3J7HA 4ZFGH 2FH8A 4LASL 2HKFH 4NO5B 5F9AC 3G6JA 4R7DA 1FLRH 3OJMB 2CQVA 4UILL 1X5FA 3AFLA 4QYOB 1RJZA 3PABB 5ANME 4AG4L 5FDWA 2GAZB 2C26A 2P8PA 2VKWA 2X9WA 3CSYB 1TZGL 1EA9C 5D72L 4PJEA 1GGTA 1ZANL 5D8JH 4N68A 1ULVA 3TO4D 3B2VH 1NBZB 4GAYA 5CSZA 4PJHE 1J1OH 1XH3A 4PLNC 3PV6B 3DSFL 5CZXC 1WZLA 2DMCA 3MLXH 2JJTC 5TFSL 2CK2A 3ZKNC 1WWAX 4ZTPH 1I3RA 2JIXB 4L8SC 4H1LB 2IANE 3IAPA 3EOBB 2V2TA 2APXA 1R5VA 1ZLWK 3SCMB 2XWTB 3QR2A 4X6CE 3WSQL 2Y07L 1S7XA 1KV3A 1RHFA 1T80A 3PGCB 4W4NA 1INQB 4QOKD 4Z0XA 5I1LA 4H1LH 2G5BA 3QJHA 2VDPL 1G1YA 1U8NB 4NQVA 1DVFA 4WI2A 1WITA 3SGJA 1FIGH 1NCTA 3GJFA 1D5BA 5IROC 4HDIA 3TBSA 1F2XK 1I1YA 2Q76A 5T1DL 1JI2A 1JFQL 1T0PB 4WFED 5DD6B 1KIQA 5DJCB 1YMMA 4NKOA 5F44A 2BZDA 3BSZL 5IWLA 4PBVC 5D7JD 2GK0A 5CJQL 4JDVA 1HINL 1K8IB 4JFYA 1GZPB 4Q2ZB 1IKNA 3MGOA 4I18A 1WWWX 1NQBA 3MLWH 4JPWL 2XXCB 4KV5F 5JIHA 2PO6B 2XN9D 4GRLA 3ALPA 4GT7A 4K8RC 5C6WH 3KLAB 1LK3H 4BUHA 4MJIA 5TDPB 1P7QB 1E4XH 2BNUA 1F4HA 2AV7B 2CIKB 3HG1A 1RIVH 1Q9KA 2C3WA 4X9IA 4WHTB 2DL9A 4K23L 4P2CG 1AXSB 3LDBB 4N0FA 2F53D 1YNTB 5J9PA 4MLSA 2V7NA 4YHIA 4OTXH 1YECH 1UJ3C 5IM7A 3TVMC 3U4BH 1W0YT 3QHZL 3NAAH 4YDKL 5DJ0B 1KB5B 4MAYC 4MXWH 3BGFC 4LQ1A 4PUBH 1S7TA 2C1OA 4YR6B 2VH5L 4O2FA 1NGWB 1KB5H 4HT1L 2WAHA 2B8OT 2N7AA 1XCTA 2PTUA 5T3XH 5D7IA 3FOMA 4XCNB 3MBXL 1JF1B 1IGMH 1DN2A 1M71B 4QXTA 3T3MF 3V4PL 1OTSC 4MDIA 2X1OA 4EIGB 3CXDL 2WM0A 2IEPA 2V2XA 4PREB 3MMEB 2NXYB 4GRWB 43CAB 3TJEH 3QZWB 3TH2T 5GQBA 1FQ9C 1N2RA 3JVGA 4YBQD 4HWUA 5CJ8A 2YHGA 4GRWH 1NL0H 2R29H 1U2HA 4OLVH 1QPXA 1WV7T 3MV01 2BHYA 4HFWB 4KXZH 3MBED 3MLVH 1RHHA 2VWEE 2UV3A 4NT6B 1MFAH 4KHTH 4HPYH 1NDGB 5E5MB 2QTEA 4PJ7A 5F70A 3G5VA 3LKSA 3K4DA 1NFDB 4EI6A 4XNMA 1T7YA 4P23D 4ZMAT 1B3JA 2FH6A 3GIVB 5E1AA 1I8LC 1YYML 4C4KO 4XAWH 1GYAA 4CADA 4I77H 3N1FC 4BFIB 2P5EA 3WFEL 3OB8A 2FX8L 3HCVA 3RVVD 1MJ8L 3IDYC 4OF5A 5GS3A 2W9EL 1QLRA 3B83A 1IILE 3SO5A 4OIBA 1TIUA 3U6RB 5BS0B 4PG2A 2Q1EA 2CLRB 2YA0A 1NDMB 5EU4A 5T3ZL 5I8OH 3TBYB 1JK8B 2A0LD 1X5GA 3S5LB 1PSKL 4X7FC 5D93B 3LKQB 4AK1A 2QL1A 3HZKA 2V7HB 3RVWC 2FSEB 5C0BA 3F12B 2XKNB 3LZFL 2XWBB 5I1DB 5E8NA 1NSNH 4PRPD 4M48H 4ZFOA 1JGUL 3MRIA 4JVPA 4U49A 2Q6WA 3LS4L 4N8PA 1A14H 1A7QL 3FRUB 3VGHA 3BMWA 5A40E 1Q72H 2RGSA 2I25N 2O5YH 3WL9B 2DMKA 1BEYH 4MNQE 3GBMH 4FQPA 3ARFA 3SE3C 3DJ9A 3BWUC 3VD4A 3KPRD 1BFTA 4QYOA 2PXYB 3P0YL 4LNRB 4LVNB 4PP2B 4CRPA 4LSDA 3CVHA 4WW2B 3RWDA 2GFBB 3RZCA 1OLLA 3NACL 1EUUA 1XR8B 4A6YA 1IMHC 5B38B 1NGYB 2ICCA 5DEGB 4Z78A 4JGUA 2EZ0D 4OIAA 3L3HA 3V0AC 2RQ8A 2P43B 1KJ3H 3LN4A 4KJPD 5F7YC 7FABL 3PV6A 1CQKA 1H3WM 3T0BA 3UTTB 4QNPE 4S2SB 1RVFL 1BQHB 2ARJB 4D8PA 2R56L 4DTGL 2NY1B 4D0CB 5T3ZE 2X4NB 4WUUB 4Y5VB 4JHBA 1ND0B 3SCMA 1RJCA 1WTGT 1WFOA 3LD8C 4F7MB 3C5ZB 3S4SB 2AJUH 5J11C 3PWJA 3PXJA 4W6YB 1JWMA 4YE4H 2DQEH 3ZE0F 12E8H 3MUJA 1N7ML 5I1HH 2NNAB 1OCWH 4M7KL 4OZGA 4AJ0A 5JXED 1SVZA 3B9DA 3DETC 2FDBP 2A6JA 4UNTA 2HLFD 1NANI 3ARWA 2BNQE 3DI3B 5DHYB 3EGSA 1P4BL 2DQUH 4JO4H 5FUOL 5MP6L 1DR9A 3RDTB 4NQCD 4X80L 1J1XL 4H8WH 3ZDZF 1UXWB 2HA1A 3FONB 4P2QE 5IBUB 3WEXB 5DUML 4UOW1 3HAEG 3OXRB 3GHEH 4E42A 3LEVH 2BVPB 4LHJB 2BY2A 1UZ6E 1H5BC 1VGKB 1NCDL 5C0NC 1NAMB 4Z5RB 4HWZB 4XNUH 2AXJA 3AREB 4Y4KA 4NN7B 3QDMB 5TDPA 4IEFB 5CEYB 1JGLH 2AK1H 2NTFB 1NAMH 1HHGA 4U6HA 4ORGA 4LU5L 4YGVB 3IU3A 3WN5C 3KLHC 2JTDA 3D9AL 3AY4C 4JDZB 3QRFM 5GGVL 1AXSA 1YPZA 5ITBL 3NTCH 3ZKXC 5HGAA 4LLWB 1P9MA 4JKPL 3O11B 5I1AA 4TVPL 3CSPA 1AKJB 4TSBL 1YN7A 4KVNH 4GRWF 5IEKB 1OGAB 4IRSD 5HD8C 4XVTH 4J4PC 3MTRA 3ZYIA 1E6OH 5C2BL 3UO1H 3T04D 2QADC 2AJ3B 3NCBB 2Z8RA 5IHZA 3LQMA 3W9DB 5F6IC 5IVZA 4C56D 5IB3A 2UUDH 3FO2A 2GQHA 4WU5A 2WLYA 5ENWB 3BPOB 1JF1A 4LHUD 3VXRE 5HYSB 2X42A 4M62L 1RZGB 4G6JH 4GKSB 1NFDF 1UACH 4AEHH 3MV9E 5JNYA 4LGRB 4PREA 1YEEL 5FO8B 1PLGH 3U9UA 1QFUL 3HS0B 4QTHB 3X3GL 2X1PA 3AU1B 3B9KA 1HH9B 1AR1C 2E7MA 5CZVH 3PIQB 5E7BA 4PRHE 3VMPA 2CGRL 4HFWA 4W68A 3G5XB 4KTDH 2R1YB 1SEQL 4NNYA 1JBJA 4OQ1A 3QUXB 4RZCB 2VDQH 2FLRT 2FBOJ 4PRIA 1HI6A 1IEBB 1LO5B 1NFDA 3VFGH 1RZ8A 2YD4A 2XZCL 1FYHB 5ILTH 3TM6A 3GMOA 3IDXH 3MUY1 1PDKA 2HN7A 1K5NB 4LSVH 4TVPE 2IAMD 1II4E 4GXUM 1S7SA 1FL6B 4ZUTA 3MV8E 2P7TB 2EYSA 4RGOL 1RPQA 3FO1B 1N0XH 1FV1B 1A7OH 1UXSB 1Q1JH 4GAGH 5L88L 2CLRA 1CICB 1NDMA 4NRYB 3Q5YA 4NNXB 3V2AR 2ZOLB 2D7TH 4ZPVB 1QRNA 3S5LA 1RY7B 1X4XA 2IPKB 1IE5A 2ZOKB 3WIFA 5TE7L 4BQCA 1KG0A 2V7HA 4LHUG 4NQDA 4JN2A 5LAXA 2HVKB 2XZAL 5EOCH 5K9JH 4M8VA 1QQDB 1T4KB 4HX1B 4L3EA 4PJ8D 3O4OB 5HHOE 4WW2F 5D7LB 4JR9L 5I1DA 1EFQA 1L4IA 5F88B 2D2OA 2KBGA 3B2UD 1P1ZA 1VADA 1FJ1A 3FRUA 2NY6B 3L3DA 4NRXB 4F80A 5LJYH 3IFNH 1PEZA 3TNNA 2Z31B 2XA8H 4J8RB 1KB9K 3CVIH 4EUPB 2BDNH 3MLRL 5I18L 1RUQH 5BW7A 3INUH 4QRPA 1LD9A 2PXYA 5D2LE 1F3RB 2NLJB 2VLJD 5DVMA 3DUUB 5FO9B 3MNWB 4WW2A 5JQ6L 4KGLA 3DGGB 3IDNA 1FBIH 1KENH 1B0RA 4QRQB 3W2DL 3I6GB 3KNBB 3OB0K 4K2UL 2AKRB 4U6TA 5DEGA 1J10A 2VERN 4FZ8L 2R0LL 2FECI 4Q6YA 3OQ3B 3ZDYE 5IBTH 2FD6H 3HZYA 4AT6A 3BIKB 4L4TA 5FKPB 1IC7H 5AG9A 1DFBH 2W9DH 4ESKA 3I6KB 1EFXB 2D7PA 1K9TA 4XRCA 2E7LC 2ZPKL 4NZDA 4ZSOB 1S7QA 3QULB 4PJ5B 5INDB 4XI5C 5HYJB 1VACA 3QFDB 5EOQH 3VGBA 1HCFX 2AXGB 1ZWIB 3ULUH 3UBXA 1D6VH 5F8RC 3X14A 4IDLA 3MLYL 3Q1SH 1WC7A 1CU4L 3OTTA 1WSST 1YUHA 5GHWL 4Y4FA 4MMXC 5FK9B 5T5NF 3SDDC 8FABA 2PYED 5HJ3A 3I3DA 1EMTL 4EBQL 4EOWL 1LO2L 2ICEB 2XTJD 1MELA 3O0RH 3BT2H 3EJYD 5FGCE 4QT5B 1HHJB 3E6HA 4FFZL 4GG6A 4N5EC 4X4ZA 4HKZA 1B4JH 5FYKD 1G6RB 1UXWA 3UAJC 4HAGA 1HSBB 4N0CC 5HY9B 1U92B 2FO4B 4OZFA 3QCTL 1G6RH 2R0KH 4Z5RA 3ME0A 2VDLH 4KZEL 3IJSA 4QXWA 2A77L 2JF1A 4S0SD 4PJHB 4WI4A 4YGVA 2H9GA 3W0WA 3QRGH 1D9KC 1T1WA 3P0GB 5EORH 3U0PA 1WEJL 3JZ7A 4WV1C 5I1CH 1MFBL 4GMTL 5DZLA 2CSPA 4LLWA 2UVEA 1CZ8L 1QBML 2ERJB 4IDJL 2IANB 1NMBH 4MCYA 3O8XB 5J12C 3EYOB 2HJKA 3VXMB 4P5KB 4V1DA 5E99L 2X70B 2FR4A 1A2YA 3F5WB 4ODUB 4HF5L 4RCAA 2FGWH 3UJJH 1QFHA 4YPGB 1K85A 2XFXA 3RJQB 4DKAA 2AJYH 4XPGL 5AYUL 5C2UB 4ZDHA 4XXDA 2IMNA 1NJ9B 4KI1A 4P46D 4C57C 5IB5B 1XGTA 3N06B 2HG5A 3MRPA 3NABH 4J2XA 3K81A 2B4CL 3A6BL 3AU1A 4PP1C 3IJHA 1W0WA 1FL3B 3QIUB 3PIQA 3U9PL 3IT8D 3RU8H 1A1NB 3DTXA 5LWYL 4UI2A 3WLWC 3RA7L 4NQEB 4GO6B 1VFAB 5GS2D 1KTLA 25C8L 3REVB 3MLSH 1XIWA 3P30H 4U1NB 2HH0H 4U3XA 4B7IA 3BX7C 1VEMA 4ZYKB 2ILLA 2X41A 4XPHH 1UFUA 4Y4HA 1CWVA 1J0JA 1B88A 2X4QA 1EEYB 3MYJB 3GJFK 1OGTB 2VLKA 1UEMA 2OTWA 4XP6L 1FL6A 2CUMA 4OF8A 4AEIH 5H8DA 5SWQA 2VAAA 5E4EB 5C08B 4JG1L 4DUXA 5GS1A 1OP5H 3X17A 4NRYA 3DX7A 2DLHA 1LHZA 3BKJL 4Q9RH 3MRKA 3CMOL 4G9FB 3WSQH 3VFVB 1KLGA 4MB5A 1KN2H 4KMTL 3VXUD 4R6UA 5C0GB 4JFPB 1CGSH 2YSSA 2P8MA 5IV2B 2HVKA 5SWSB 5DD3H 1X5KA 1UH3A 5SX5H 3LHPH 4GAFB 3OHXA 4NCC2 4EI5D 4XAKE 3P0VH 4U6VH 3LMJL 5ICXB 4OM0L 3FO9B 5JDJA 1AQDB 4DN4H 2O93L 4NYLB 4TNWK 3WDIA 4LK4A 3RVXD 3AS1A 1FZKB 2D31B 3QPQD 3BVNB 1AHWB 1HOCB 2K9UA 2VC2L 5DMKA 4P4RA 4ZUUB 4U1LA 5I2IB 4N0UE 3ULUF 2DBLL 5GRVL 2Y36H 4ZAKC 5D5ME 1DBBL 3HR5B 4WO4B 4OD1L 2ZUYA 1U8HB 2F15A 1T5XA 4QRQA 4WHYH 5KJRH 1A9EB 1OSZB 3THML 3JBG7 3CZFA 4Y16B 3L7EA 2AKRA 3BIAX 4H0HB 1GZQA 3TN0D 2WUBL 3SDAB 1MQKH 4BFGA 1QKZL 5I74C 1EH9A 1KFAH 2NW2B 3BIKA 3DX8B 4M6ML 4N0RA 1MCDA 3RWGB 3WV0A 3LY6A 3MRGB 3M07A 4B53A 4XBEL 2NCMA 4DAGL 2C4FU 1JPTH 1U8QB 5FM5M 1KT2B 3BQUC 5EIIB 1PVHA 3RVUC 1MPAL 4ZSOA 1LEIB 4FXKB 4YDKH 2NY4B 4Q74A 4F3FB 1JNHB 4KKNA 5HDLA 2Z35A 5FYJH 1T7XA 3E0GA 2DIJA 5FYJU 4CMHC 3E2HC 3G5YB 5JORA 3OSKA 5DZOA 4LSPL 1K4CB 5FK9A 3IXAA 4HLZG 4CU7A 1U3ZA 1Z6JT 5KVEH 1IT9H 1QZ1A 4PJHF 3S9DB 4QT5A 3QUKB 4XBPA 5L0QB 1QVOA 1H0DB 3UDWC 1G6RA 5I1KH 5J13B 3PGDA 4LLYA 3R8QA 3MR9B 1F00I 4CGTA 3LSOA 1HSBA 3RL1B 3TNMA 5ANMA 1A1MA 5DK0B 3PF2A 1FPTH 1U3JA 2XIDA 3QQNA 3ULVD 3HE7C 1ZA6B 3FCTB 3PWLB 4L1DA 1ZVHA 1G9NC 2WSKA 4P3CL 2I9TB 1FFRA 1SEBB 3NFSL 1V7NL 2A73A 1U8PB 3QEQE 1J11A 4K9EC 5DXWA 1CDJA 2DICA 5DC4B 3MCKA 3VJ6B 3DMMC 1YEKL 3W9EB 2I24N 1CFQA 1BD2D 1XR9A 3NCEB 3STBA 5C0AD 3TO4C 1JGEA 2DLTA 2RFXB 4FNLL 4PFEA 2IANA 3EYFA 2V5YA 4X6CA 3LH2L 5HDBE 3UP1A 4U4BA 1QSED 4LSTL 5BRZD 4YAQA 3S88H 3O2DA 5F1NA 4K9EL 2CJUL 2COQA 4YX2H 1IM9D 1KPUB 1ZHKA 4MDJA 1FNGB 2PW1A 2BNQB 2DI7A 1BF8A 1HHIA 5EWIL 1HILA 1FYTE 5F7DB 3R0NA 4POYA 5TH2B 2EICA 1WZ1L 4GLRH 3O6FD 1GC1C 1QSFE 1I8MB 2ICES 3T2NL 4P2QB 4RFNC 1BM3H 4JY6A 1QFWI 1RUMH 3UTSE 3PUCA 1JYWA 4KTEL 1W72L 1A1NA 4OLUL 5E4IA 5D7JC 3EO9H 1JPGB 1MNUH 2OQJB 3C8DA 2EKSB 5JR1L 2CO7B 4JG0L 4XPBH 1GC1L 5D7KD 4BZ2L 1UCBL 1YC7A 2BSRB 3GRWL 1EJOL 5F96H 3A6CH 4M6OH 1N0LA 2XZQH 5JTWA 3PL6C 5E9DD 5E6IB 5BCAA 4Z77A 5HGGS 1UM4L 5JIIA 1YNKL 1MF2L 1UM6L 1ZLSH 3HI1A 7FABH 4IRZL 4OIIH 1BGXH 2WZPD 4KI5E 2B1HL 1CL7I 4HWEH 5DK3A 2R56H 2FL5A 2B5IC 3T0AA 3OAUH 1EVUA 1MCOH 3X13B 3O6KH 2YN5A 3VFVA 3QJFA 3VE0B 2Z92B 5C0GA 1JGDA 2Y5TA 4FQQA 4NBYB 2ADGB 3VFSB 3MOAL 5FHAL 4FQJL 4ODXA 4L8SA 4WI9A 1BX2A 1I1FA 3GBNL 5I1JL 2IH1B 2E27H 3MV9B 5MI0C 3KJ6H 4MQ7B 1EGJL 2J8UE 3RKPA 3N1MC 4KRMB 1GGUA 1CGWA 1RI8A 3GMNA 3NGBC 4XCYA 4C83A 5J8OA 5GGQL 2X7LB 3WNMA 1IQWL 2EYRB 3KXFB 4K3JH 1IAIL 2A9MH 5IROA 5I17B 4NYLA 4PRHB 1EK3A 5C07A 1FZKA 3VRJA 3FQXB 1AHWA 1HOCA 1XF3A 1T6VN 2R39A 4OJFL 4Z7UE 3GKZA 4MD5A 1CFNB 3O3DB 4WNQA 4U1SA 1V5JA 3I75B 4L8BB 3CMGA 4MX7B 4KAQL 1BVLB 3MBEC 3VG0L 2VZSA 2P8LB 2VN4A 4WFEE 4B5EA 1NGZA 2DQDL 3EDFA 4WGVB 3V6ZA 1CFSA 1KCLA 2NW2A 3DX8A 4LDEB 5BZDA 1OP9A 3GK8H 4XH2B 4BSVA 1JZ8A 4P23C 1QBAA 4U6XB 3EZJB 4G8GE 3UYRL 4TVPH 4MAUH 4X83A 4TSBH 3MACL 5D1XB 1L6XA 5HHMB 2XN9E 1VGEL 5EIIA 5D6CB 2HJLA 4L1HA 4P2OC 5C0CE 3RVVC 4HEPG 2R2CA 2EXWD 4X4ME 5GIRB 2ZSWA 1TQBC 4E9LA 3S35L 4YJZL 3V79C 1UJ3A 4QWWD 2W65B 1LO0L 1KJMB 3L5HA 3WKNA 3C09C 1M7DB 2A0LC 4FXLA 4GQ9L 5MHSD 5EDXA 3GSVB 3FFCB 1JN6A 1ZLUH 3ARGB 2F53E 1I9IL 3MA7A 1JRHL 5GGSA 3T0VA 3U46A 3WUWB 3BEVB 3VFTB 4XVSL 3MXWH 3LQZA 1QFUH 1CDHA 2YZ1A 4MNQA 2DN7A 4YDVA 3BDXA 3L5XL 4LLMA 4TSCH 1GOFA 2BERA 2HRPH 5CJ5A 3QUML 2CUHA 5DK0A 4NCDA 3BGMA 3VGGA 1C1EH 4LPTA 2CLVA 1DZBA 3ARBB 3UX9B 4ZFFB 5KSBE 5IKCB 4R3SB 3WJJA 2YRZA 1IZJA 5D1ZB 5L8LB 1MEXH 1S5HB 2K3TA 5EBLB 3U48A 4DKEL 2QSTA 2IPTH 3CFEA 5I8CA 4HZLB 4YC2B 3BKYL 4K3HA 1SJXA 4YEFA 4POZD 4ZO7A 3BP5A 4U2ZA 2YD1A 5EU7C 4AMKL 4D2NA 1V8HA 2R69L 2EZ0C 4HAFA 4RAVB 3GMMB 3RGVD 1T0NA 3UZVB 3CDYA 1CLZH 4X7EC 3TZVC 4KJPC 3GJEA 3UPCA 4XCEB 4P3DB 4CJ1A 3LVEA 4HS6A 4YXKH 1RIHL 1CI5A 1QG3A 5TE7H 2PF6A 4PG9B 4NPYB 1FNGA 2R1WB 4UIMA 2ZUWA 4KHXL 4JY4B 4JRYD 4DVRH 2BXZA 5EZOL 1GSMA 4S1RH 1RU9H 2ADFH 3AM8C 5HHPB 4LPYA 3W39B 3VD9A 5IOPB 3KYOB 1SQ2N 4P2QA 3FB6A 5F72S 2HLFC 2UZXB 2OJZL 1VKXB 2X4TA 3Q2CA 2BY0A 2EH7L 1CFTB 4A2MA 4HUUA 2GTWB 5ETUB 4HUKB 3WFBL 4N8VG 5I8KL 2VB5A 4G6ML 5EBMB 2Z93A 4NO2B 1JPGA 3EYSL 4JQIL 4OD3H 1PG7H 3ZDXF 2IFGA 4WFHE 2PR4L 3L6FA 4FS0A 3W2DH 3SE3A 1P2CB 2DJ4A 1BFVL 2GJZB 4NM8H 2FATH 4NZRL 2FWOA 2QR0A 5HTSA 3QIBB 2MPAH 1Q9OB 4G43A 4PYGA 1WCBB 3QUYB 4HS3A 1INEH 4JFHD 3CFDA 3NBNA 1KEGL 1MHCB 1KPVA 4PJBB 2H8PB 3L3KB 3NA4A 1YJDH 1EAPB 3KPRE 3TBWA 1JWSB 1MRDH 4R2GD 4DGIL 5HHVL 3HZVA 4CJ0A 3QG7L 5H35B 4WUKL 5EU3B 2I07A 2OTUA 2AXHA 3DOSA 1IAKA 1MCNA 1T20A 1SJEA 5DK2B 5GRUH 4R0LB 4KVCL 5E5UB 5SV3A 3PGFH 3RNKB 3OJDB 5SWZE 3VXRA 2BRQA 5IHLB 4I9WD 3L1OH 4MYWB 1QP1A 1FL5A 3O3EB 3MV9A 1FZJB 4FQCL 3RY5A 4WI7A 4HV8A 1EEZA 4NRZB 3REWB 3GI8L 2LE9A 4PJAE 5LQBH 3MXVH 2EYRA 1LP9E 3U1SL 5FCUL 2VMFA 4PRHA 5IVNA 1UM5H 4XNYL 1DQQB 5T1KB 3TJHD 3OGOE 4XCFL 3FQXA 1TVBA 1MREL 4M03A 3A67L 4K7FA 4PLJC 4LCWB 3HMXL 3GMLA 4ZO8A 4U1JB 4PJFE 2APFA 5DUPL 4PV8B 1RUPL 5DJYB 1MI5D 4B0MM 4GUPA 1XF5A 1ZVSB 2GSGA 5FUCC 3NPZB 5J6GB 2PYFB 5GZND 1D6EB 4NQCE 1WEJH 3MV8A 3V4VL 2JCCB 5FOBB 2GTZB 4U6XA 5CP7B 4F2MA 4X9GA 2LU7A 5HGBA 2YRLA 1CZ8H 3AC0A 5E00A 2A9NL 4ZTOH 1QEWA 3BAEL 5CGYD 1SY6H 3VW3H 3AY4A 2A6IB 3NIGE 3SKOA 3C2AL 2IAMC 5AAMA 2AQ3A 1AC0A 5CBEB 5KVDL 2UWEE 4HBCL 4BQ6A 2VXSL 4Z0BH 1YQVL 1T1ZB 4Y5XA 2W65A 1A4JB 1UWXH 4ZUVB 4Y1AE 5HHOA 3IAQA 1FH5H 4IMLB 4JZNB 5J6HB 4J4PA 1MLBB 2VLMD 5MENB 4P4KC 2VO5A 5IB2B 3ARGA 3SDCB 1LE5B 5L8KB 1WBZB 4XPGH 2DYPD 4WU7B 3VFTA 3T0EB 2XOTA 2VZOA 3FQTB 3MRBB 3OR6B 4PJ8C 3SGEI 2BNRE 3B2UC 4PV9A 4U0RB 3HPLB 5D2LA 5GJSL 5CEZH 4Z6AT 4XC3H 4N0UB 2OP4H 2CR6A 2JKXA 2YMXH 5D9SA 3HR6A 2HT4D 4C56E 2KH2B 1DN0B 5D1ZA 1MHEB 3L3IB 1T03L 1AD9B 1DSFH 4AENA 2ZCLH 1ACYL 3QNXA 3RL2B 4CN6A 4M1GH 2YBRB 4HZLA 5DRZA 5GS0D 2ZUQC 1Z9MA 4NN5C 1X6NA 3FB7B 4OLXH 4IIQA 4I3GA 1FP5A 3HE6D 5GISL 2OJEA 1TNMA 5FUCE 2E6QA 5GSVB 3BKJH 2EECA 4Y2OA 4W6XB 4KMTH 1CG9B 4X7SL 1RULL 4NPYA 4I0PB 2P24B 4QCIB 4X6DE 4NKMA 3OKLA 3HHRB 3MNZB 3UC0H 4QF1B 1RV6X 4AL8H 3AMKA 3FTGA 3KYOA 5C0BD 2L7JA 2ICWB 2YOCA 4YO0B 2FCBA 1PX4A 1A4KB 2FZ3A 2P42B 3DX6A 5CJOL 2XTJC 3UMTA 3V5HA 2GTWA 5D6DC 4PJBF 1TQCB 3STZB 5BXFA 2OM5A 3FMGL 3HMWL 3EJZD 2BJML 2VC2H 2B20A 4L8DB 5ADPH 4UQ2B 1ZHBA 4JFEB 3ARFD 3QEQB 3V5DB 1BZQK 1LDPL 1P2CA 3IFLH 2GJZA 2FO1A 2VITB 4JPKL 1E28B 1T1YB 2DQCH 3LS5L 3KJ4B 3TCXA 1BIIB 3QI9A 3TO2B 4YUEL 4AM0A 2H8PA 3MFFB 5FYKL 4YEEA 1CR9H 2B2XH 4B7LA 3RWIA 2OK0L 4HPOL 4D9QD 1B90A 3KDMB 4R4FH 4LKCB 5EU3A 1FG2A 5HBBA 1SYVA 2J88H 1XF1A 3LKNA 3IDIB 3T65A 2BOBB 2JIXD 1MJJA 1ZMYA 1CD1A 4GQPH 3SCMD 1JYVA 2GCYB 1JHKH 3HTLX 1RZFH 2DQHL 1QSFB 1UB5A 1GH7A 2LAAA 4TUKL 3O4LB 3REWA 7CGTA 1KGCD 2YUXA 3NCYP 3SDDA 3BD3A 3BESR 1OAUH 1QTYT 2JCCF 4HFUH 4P46C 4Y7MA 5IHUH 4GXVH 2EDQA 4EDXA 5ADOL 3WKMH 4BQ9A 5DMIH 2DDQH 3U7YH 4HLJA 4Z7VB 2PO6D 4KUZH 2W60B 3QNYB 4OKDA 4S1QH 4TTDC 3RUGB 2PYEE 3S3PA 5C70A 4XNQA 2G9HA 2Z4QB 3QO0B 4HGWA 2XTJE 5TQ0H 3M8OH 5J6GA 5DTFB 4HKXB 1P7QD 5SX4I 3IAGC 1HXMB 3C5JA 1MUJA 5GRYA 3NZHH 5FYKE 1ZA3A 5FOBA 1MCLA 3D18A 3O9WA 2PTTB 3BZ4B 1FORH 4NZUH 3TCLA 5T1MB 1I3GH 1CXKA 3TV3H 5DS8A 5IK3B 3MV7E 4BZ1H 3N50A 3MCG1 4RA0C 5LXGH 1WCQA 4WV1A 1PEWA 4LMQI 5CBEA 1RIUL 4H1LG 5ICZB 5M95B 3G5ZA 3SOBL 1SJHA 3SDYL 1BQSA 1ZT1B 2D0FA 4FG6D 4L9LB 1AGEB 1JUFA 1SM3H 3B6SB 4HXAH 4JZNA 1I85A 2AXFB 3IFOA 5T3XD 4XZUB 1U36A 2VDKH 3NA9H 4PJCB 3SDCA 2FX7H 1GOHA 3VA2C 4NWTL 43C9B 3FAXA 4YLQT 4X6EB 1RURH 3E8UL 3VWKB 4HIHA 3NCJL 1O7VA 5JW3L 3C08H 2NXYD 2V17H 3EYUH 3WNPA 2WLZA 1E4XI 3AMLA 5D5MA 1GIGH 2FHCA 4GJTB 2BCKA 4ZOBA 3OGCB 3QPQC 1AD9A 3CIQA 4KK8D 1R3JB 4PGCB 1PQZB 1FE8L 4J6RH 2OTPA 2A6KB 1I9RL 3CFJB 1UM4H 1YNKH 1UM6H 2NX5E 5DWUH 2W1NA 2BRRH 1LEKA 3TN0C 4TOYH 1M05B 2B1HH 1R3IL 1AE6H 5C0CB 1KC5H 3FJTA 2DI8A 2ARJQ 5M7QA 3ORJA 3HNSH 3LRHA 4UTBH 1HQRA 5CIPA 5KW9H 1S3KL 5L9DH 1R3KA 4UT7H 4NQXB 4NIKB 5KBNC 2ADJB 4WDIB 3JWDH 3OG4B 1XGRB 5DQDL 4ZXBB 1IGYA 1EGJH 2VAJA 4FFYH 2Q8AH 1INDH 5CWSA 5GJTH 4HS8H 1EBAA 3QZWG 3KYNA 5GGQH 4B41A 2RCSH 1C8PA 3O81A 3WFDH 3STZA 1YEDB 2OZ4L 3QSKB 3VXUE 5EFIA 4LSSL 2IADA 4KRPB 2WBJB 2VYRE 4OJFH 3O45B 3P9MB 3U83A 3BPLC 1A7RL 4RX4A 5DD0H 3QEQA 4HHAB 4ZD3H 2I26N 2UYLB 3H3PH 3PQYE 2IMMA 2PXYD 1FZOA 3VDBA 1MIEH 3GUTA 1FFQA 3ULVC 5KS9B 3EDJA 1W8OA 5E56A 3TO2A 5D70H 1BFOB 3O6LH 4ZAKA 1HK6A 1HZHL 4X99A 3ECBA 1ZGLP 4UQ3B 2F8VA 4BELD 3ZSTA 1IKFL 1T5WA 5JW5A 3GI9H 3DIFA 1J7VR 5I19H 3U30C 4DKFL 1OPGL 5JHDA 3WXVL 3TA3A 4F57L 3UTTD 4OI8A 4PJ9B 1ZT4A 5F93C 4LKCA 2GI7A 1Y18B 4RMQA 4LEXL 3PXHA 5DRXA 2IF7A 3IETA 5CLWA 3IDIA 3WJLA 4N5UA 1HNGA 1YMHB 2BOBA 4WY7L 3EBAA 2NY1D 4H25A 5IQ7L 4R90L 2IPUK 4WUUD 2IG2L 2BOCB 1FYTA 3BQUA 3QG6A 4OCLC 2GCYA 4F7CB 3MRQA 4GQ9H 4Z7VF 1WFUA 2R23B 3FO0H 2Z91B 3LQAH 1QSFA 3HI6H 3RUGF 4OB5L 1CXIA 5HI4D 1OAZH 4OGZA 3MNVA 3UTSA 3FN9A 4R9HA 4DUVA 2JK5B 4UU9B 4F15C 5BVPH 1X44A 4KI5F 2C4XA 4ZG1A 3O6FC 5I30H 3RDTD 4AIZB 4MA7L 4ELMB 5HPMA 1CBVH 4IHOB 4CAGA 4OGXH 1U9KA 3QA3B 1OARL 4NBXB 5E94B 5IJVA 1F45A 1YEHL 5BV7L 5GSRA 3WHE0 2G5RA 2Z4QA 1UCTA 4IRJB 3LKPB 3ARED 5C71A 5B38G 2VIRB 5DTFA 3QDMD 1K8DA 4HKXA 3RWFA 3LRSA 5JDSB 1HXMA 3AAZB 3HE7A 3PV7A 1F02I 5TDNA 4K55A 3BIBX 4XB8A 3HRPA 3VMOA 2FB4L 4PJCF 4OFKA 4DEPC 4XPFL 1MCHA 5IMKB 3SE8L 3ROOB 5F97E 1TJGL 3ZHKA 1CT8B 1BQHG 5IK3A 2CDEA 5F1IA 4JM4H 4LARL 4K7PH 3C5SA 3RJDA 5I73B 1BLNA 2EE3A 3S8WA 3QEGL 1AKJD 4KROB 4G8EB 3TO4A 2R2BA 2BSSB 4FQIH 4N8CL 5SWZB 1OGAD 1ZT1A 3S4SG 5B39B 1OTUD 4Q9CA 3MGTB 4G80B 4NHCH 3B6SA 2A38A 4NDMB 5EC1B 1G7MB 5GGUA 3CXHK 1IM3B 3VXTB 2FBJH 3TBVB 3WO4B 2J8UA 3F7VA 4KFZC 4MSWA 2WMPA 4MNHA 4QHLB 3UJIL 4PGDB 1BD2E 2J2ZA 4KQ4L 4LLVB 4KK5D 5IMLB 4EN3B 3HC3L 1XCQA 5KG9A 1W72A 3ARDB 5LBSH 3FQNA 2R0WH 5EIVA 1JV5B 3V4UH 4LBEB 3DUSA 4UDTB 1QSEE 5BRZE 3GSRB 1B6DA 5IBUG 4Z7UA 3CFKA 5DJ8A 3GRWA 2D9CA 3Q3GB 4ALAL 2PCPA 3QWOA 4JQIH 5HVFB 3F58H 1MCWW 2EDFA 1QLFA 2GT9A 3CDCA 1L0XA 5T5NG 3T4YB 2H32A 4IMKC 3QUXD 3X12B 3Q5TA 3C6SB 5D7JA 4KY1L 3GNMH 4RGMB 4EDWH 5HGDA 3EDDA 2X2YA 4O5LH 1A6TB 1CFVL 3UYPA 3MRNB 3NIFF 4G8GA 4TUJB 4P9HL 3G08A 1IGIH 1M05A 2XN9A 3O2VH 3AB0C 4QXGL 4CDHA 3BE1L 1A3QA 4PJGB 2SEBA 1AO7B 1K4DA 5C0CA 2VXTL 4OF6A 4X4MA 4CVUA 5KSUA 2HAZA 1DBKL 3BZFA 1ETZA 3S34H 3QFJE 4X5XA 4Q6IB 5CUSH 5D7KE 2VL5B 4HMDA 4Y1AB 3CDGB 3IRPX 4HQQL 2Y6SD 1HNFA 4KVCH 1EGJA 3O41B 1CGUA 3O6ML 1D5IH 2EXWC 2F53A 1CD9B 5BZWA 4X8JB 3IKCB 3ROLB 4PBXA 5HYSG 1X4ZA 5DD5L 3U0TB 4J23A 2I9LA 2ICWJ 4WI5A 4ZPTA 4YDLC 3ILQD 1FNFA 3D39B 3WNLA 5KS9F 5D7LD 4DZ8A 4X6BB 4F7EB 1I1AB 3LB6C 1I7TB 1A6WH 5IFJA 1D5MB 2IH3B 3D0VA 4MQTB 2YEZB 1YEDA 5DSCA 5KSBA 5C92A 2NY6D 3D69A 4M5ZH 2BC4B 3TLRA 1RZJH 4D0DA 2Z31D 4OF3A 5I9QC 1NCWL 3OKNA 5IG7A 3WDHA 4HHAA 4DCQB 1FDLH 3BD5A 5EOTA 4Y2DC 2H3NB 2ZWLT 2MJWA 4JM2B 2XPGA 1VPOL 2L7UA 1HXYB 3OR7A 1HSAB 3L3JB 5ID0B 2YPKB 3RWEA 4E41B 3QXDB 5F7EH 3B5HA 5CKGA 3EO1A 1BFOA 1PW3A 4NP4L 4UQ3A 2ZCKL 4NC2B 5IGXH 4K8RH 1QBBA 2OXHA 3MBEA 3PWUB 2JJUA 5F7KC 1MJ7H 2WWKT 4RNRB 2D0GA 3BAEH 1U91A 1ORQB 5LGJA 4XVJH 3VCLA 4POZC 5EU5A 2DWDA 1I8KA 1EFXD 1JIBA 4P23A 1YMHA 3GHBL 2Q3AA 3ULUD 3MROA 2AK4B 3TVMB 2Y9RT 4RFOL 4ELMF 4LVEA 4HUWB 4YK4B 2NMSA 4PJ5D 4PGBA 4YIQB 4M7JL 1U58A 2R23A 6FABH 5C9JB 2QQNH 2X09A 3BEWA 2A2QT 3BWAB 1UEYA 4ZFZB 2HVJB 5CGTA 2P44B 4XGZA 2XNAB 5DC0A 2EDJA 5LGHH 4RIRA 2B0SH 3QUMA 3V6FA 4UNVA 3DX9A 4U1MA 4UU9A 4HIEB 5FO7B 3IRZA 1NAKL 1UH2A 4EUPG 4WVRA 2C3XA 2R15A 3O2WL 5ID1A 1AP2A 4IHOA 3E1F1 1F4WH 4QY8B 4X98A 5GGTL 3EJJX 5J4MA 3WHXB 3GSNB 4G9DA 1N64H 4H0GA 1TJIH 3TPKA 5AD0B 1QNZH 4KPHL 4OF0A 4JGJA 4O02H 3GSNH 5JDSA 1IGJB 4J3XA 3QCUL 3G6DL 4ODWA 1FZMB 1NC2B 3KPRA 4WCYH 1OD7A 4YHYB 5TGBB 3HAEA 4JZJB 3ROOA 5IHBA 4RISH 1S7RB 3NCCB 5E2JA 1AGDA 4ONHA 1AFVL 4QHNB 3EOAA 5IFHH 3IDYB 2DTMH 1HQ4A 2IAND 1NGPH 4PRBB 1H3PH 2BVQA 4G3YH 3O8XD 1KNOA 5ESAA 4XP9H 4U6YA 4HIJB 5I1GL 4JFFB 3VXTA 3CFIC 4L3AA 4NO3A 3G6AA 5E08H 3VXMD 4OD2A 4QHLA 2IQ9L 4JB9L 3I6LD 4LSRL 3OZ9L 4PJAA 1F8TH 3RWJA 1KELL 1BREA 5IMLA 3K4ZA 1LP9A 2X89D 2E6JA 4J7RA 4XB7A 1GHFL 2AEQH 2I5YL 3DVNA 5AG8A 3OKEA 1L7TL 3GSRA 1ZKAA 3F62A 3AM8A 5JXEA 4PJFA 4OFPA 4PJGF 3Q3GA 1EHAA 2CKBL 2N7BA 3QIUD 3L5IA 3TJHC 3N1PC 3QPXL 5GPRA 2ATKB 2IQAB 1ODAA 2V2WB 4H26B 4IS6B 5IWLC 1MWAL 4NQED 3KPTA 1MFDH 4NQCA 3FOLB 4PRAB 4I18C 1ZTXL 4DW2H 4ZS7L 4LKXA 4TUJA 4XCCL 1JZ3A 4GRLC 1ZHNA 3MV7B 2EE2A 5IQ9B 2O5XL 5GZNC 4ZS6D 3OJVC 3TIEB 1QR1B 5AZEL 1QBLL 2Y7QA 3B4NA 1XEDA 2GIYA 2UWEA 5E7FA 1S7WA 4F9LC 2QHRL 2ZUTA 3MRJA 2ZG1A 5C08D 4ERSL 4PS4L 4Y1AA 4JPVL 5JHLL 1MAMH 5CGYC 4AQ1B 4KU1A 1HEZA 1AGFA 1LO4L 3O41A 4JFXA 4NC0B 4UIKL 4G9FD 4QTIH 2DQTL 4X8JA 1TCRB 1U8IA 3LD8B 4JFHE 5J11B 1KCSH 5B8CB 2DQHH 5IP4A 4X7TA 2J6EH 2VLRE 4FN0A 4G42A 4IRSA 4JM2F 4JVUA 1FO0B 1ORSA 4LCYB 2BNRA 5B22A 4OV5A 4X6BA 4F7EA 3DVFA 4F9PC 2Z0BA 3PP4H 4MS8D 3FKUS 5GGSY 1FO0H 3HMXA 2NY5C 3FFDA 3FT3B 2NW3B 4C56A 4JFDB 2GSIB 4NKIH 1CLOL 1GCFA 5E2UH 4LHUA 5DJXA 4I9WE 1UWXK 4PB0L 4DCQA 5IW6A 3EYVA 1FNSH 2DJUA 1CLYL 1VFBA 2BVTA 4UT6H 3T3PF 2X4SB 1L9MA 1C5BL 3JVGC 2QHLA 2HT4C 3QB7C 3ZE1E 1ZVYA 1F11A 1OHQA 2YPKA 4YHOL 4CN4A 5C0RL 4E5XA 2XWJA 4WO4D 1Y0LA 2P46B 5E8OB 2NX5B 4S0TD 1Q94B 4OUUB 4G8IA 4Y16D 3BYYA 1LE9A 1A9BB 2JJVA 1UT9A 2FJFA 3SDAD 3PWUA 3HUJB 2GUOA 2CPCA 4OZ4B 3IDGA 2ENYA 3WN5B 3UTQA 4CBPA 3PHQA 2X4OB 5C0JB 3IGAA 5T5FH 2VDRL 3ZT5A 2DQGH 2ZJSH 3ZL4L 4FQXB 4PJDB 1MI5E 3SOBH 5ACZA 3C8HA 5CD3A 5FYJD 3VXOB 4CKVX 4M43H 5DMJB 4X6DA 1F6AB 1YY8B 4FZEH 1E4WH 4NBZB 2NY4D 4KC3B 2IAMA 5MEPA 15C8H 3CFBA 5D71L 4I5BA 5IMOB 3BWAA 5GS0L 5L6YL 1CE1L 5DJZA 1P4LB 1AI1H 1F58L 3N1QC 4N9OB 3QXAB 1XGPB 2NR6D 5FECA 4Y89A 5DVKA 1UVQB 1TXKA 4KV5E 4NC1C 5I6XC 4OCWL 1N5AA 5AUMB 4YNYA 4XMLL 1CLCA 2HKHH 4IOIB 1H15A 2Q7YA 2FHFA 4PJ8A 4WHYG 3PQYB 3GSNA 4N9GA 1MFCH 1R3LA 4DFIA 4YHZL 4PD4K 3MRFB 5C8JB 1DTUA 5AD0A 3EJZC 3Q6FB 2WK2A 5H37H 1BBJA 3BO8B 4YHLH 1IGJA 2D9QB 4TRPH 3QEHA 1C16A 3ARFC 5TE4L 4TUOB 1RUAH 1MCQA 5EH1A 5FF6A 4ZOCA 3IJYB 1FZMA 4UT9H 2H26A 4GKNA 1KLUB 2V5MA 5TGBA 4WI6A 4ZFGL 5HHXH 2VLJA 2HKFL 1FLRL 1CXLA 3P73A 3UZQA 3BN3B 4JRXB 3QNZB 1IQDA 4NKDA 1KPRA 1SBSH 3BFOA 4HIJA 5D8JL 4HIIB 1AY1L 2AP2A 5DMGD 5F8QC 3B2VL 4P57A 5DEFA 3T4AB 3EKCA 1ZLVH 1MLCB 3MRMA 5I16B 5D96B 2XZZA 1J1OL 4ODBD 3SCMC 2QKIA 2HP4A 2BNQD 4HK3N 3RKDD 3QCVL 3MLXL 1YNLH 1UZ8B 1LNUA 4ZTPL 5D2NE 5DFVD 4O2EA 3LIZH 4AY0A 4P2QD 1FCGA 3BDBA 3JXAA 3L5WA 5DDHA 2PYEA 4I2XE 2WIIA 5CJXC 4W4OA 2IQAA 3FQRB 3NMEA 5DHXB 4H26A 4YHNB 5D6DA 4HUNB 3BP7B 4MLIA 1FIGL 1FVCB 3KPLB 3FOLA 1RZIA 1MVUA 4PRAA 3L3OA 1JE6A 2YKLH 2PO6C 4WFFD 2ED8A 5GGVY 4RQQA 5J89A 3D5OF 3L9RB 1W0VA 4Y4KC 5E6ID 4NSKA 3MLWL 5DQJA 3K1KC 1QFWH 4BH8B 5F7HA 3VFWA 1LK3L 2XG5A 3PHOB 2MNUA 1E4XL 3LDBC 2WWKO 4ZUWA 1RIVL 1NC4B 4ONGH 4GFTB 5TPWH 1UJTA 2H2PD 2VXUH 5FYLH 1QA9B 3KWWA 4FG6C 3OX8A 4OB5H 1JF5A 3WHE1 3RHWF 2A83A 3WMSA 3MV9D 2VXVH 4M93C 5ICYB 1YECL 4Z7NF 1G7JB 3BP4A 3U4BL 4M61B 1F6LL 4HWBH 3LKOB 5JPMA 2YC1A 2YPVH 3GBLA 5HPOA 3NAAL 2YUVA 4X0KB 3HUJF 1CL7H 4MA3B 1J88A 1DUYB 3B3IB 4MXWL 3KXFD 4PUBL 3QHFH 3BZEA 4LMQE 4PRHD 1JWUA 1KIRB 4PJIB 2NXYC 1V3JA 1KB5L 2XRAH 4PJDF 3EW3B 5T3XL 1IGML 3B9KC 4MHHI 3AS0A 5KANI 2NX5A 4MHHG 4U1GC 1ZXQA 1GGCH 3KS0H 3OXSA 4JKKA 1KGCE 1XT5A 4KK8C 3TJEL 2YK1H 1DBAH 1KTDB 4KJYA 2V9RA 4KKAC 4O4YH 1F42A 3DO7A 4YFDB 4TVPD 5CBAA 1NL0L 2R29L 4OLVL 3QFJB 3CLEH 2Q86B 3MV8D 3MLVL 4PTUB 3H7BB 5IIEA 3ZE0E 2X4UB 3CK0H 4J12A 5D1XD 5HHMD 1MFAL 4KHTL 4HPYL 4IJ3C 3VXOA 4MJ6B 3PWNA 1RZ7H 2YD3A 4JANA 3KPQA 3SKMB 3UJIH 2YPLB 4X4XA 3ES6A 4XAWL 4LRNH 1DLHB 2VZ1A 4I77L 4KWUA 5EZLB 5HHOD 1BAFH 3ZDZE 1XGPA 1TFHA 5ALBH 3GSQB 1ZV5A 3FFCD