5FV1L

Crystal structure of hvegf in complex with vk domain antibody
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
b'DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VK DOMAIN ANTIBODY
molecule tags Immune system
source organism Homo sapiens
publication title Novel Interaction Mechanism of a Domain Antibody Based Inhibitor of Human Vascular Endothelial Growth Factor with Greater Potency Than Ranibizumab and Bevacizumab and Improved Capacity Over Aflibercept.
pubmed doi rcsb
total genus 23
structure length 108
sequence length 108
chains with identical sequence M
ec nomenclature
pdb deposition date 2016-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fv1L00
5DK2B 5CJ5A 5TDOA 4PJHB 1EAPB 3IDMB 3H3PL 1MWAB 1ZMYA 1S9VA 5T3ZL 3RX8A 4D8PA 1ZAGA 4PJGA 1XR9B 2IPTL 2V9QA 2IFGA 4LIQE 5IBTH 2QQLH 2X9XA 5I8EA 4ZFGH 4XMKL 3E6HA 1OHQA 1W0VA 1V05A 3NCJH 1NLDL 1CI5A 3TPKA 4RISL 5E9DE 3FQWA 3P9LA 1I7UA 5CIPA 1G84A 3O11B 4MAUH 5EOCL 2I07B 3AY4A 4QRUB 3M8OH 3P4OA 3QDGA 4RAUA 2RB8A 3VH8B 1JPSH 2CUIA 5DQJB 5DLML 1Q0XH 1AQDB 4TUKH 2F54A 5MI0B 3DVGB 2HT2D 5FCSH 5BO1L 3EYSH 3CZFB 1CGWA 2QQKL 1J87A 5F9DC 4Y4HA 3Q5TA 2F5AL 5ITFB 5AG8A 1KJ2L 1RZFL 1ITBB 4EJ1C 4R6UA 5ACZA 4NQCE 1NANI 4O2CA 1CLOH 5EBLB 3JVGC 4KTDH 3VD5A 4PRHE 4C4KT 2FZ3A 1Q9KA 2EIBA 3LQAL 4XP9L 4G9FE 4KDTC 5CIPB 3QXTA 1P7QB 4YK4C 4N8CH 5IESL 5DJXA 3RGVA 2R56H 1J7VR 3MUHL 4M6OL 2Z31B 5E4IA 1FVDA 2FD6L 3CFJA 2FHCA 3WUWB 2WK2A 3OKNA 5C6PB 4A6YL 3K3QA 3T0EA 1I3GL 5EBWB 5C2UB 3FN9A 4DAGH 2YSSA 3HFMH 5I0DA 2Q76B 3D2UB 4OM1L 1D5IL 5I8CA 1RZKC 2IQAA 1NH6A 5D6DA 5TDPA 3NVQA 3LH2H 3D87B 5LCVL 3WFBH 4OZ4B 5KSVA 5DWUL 4OGYL 4PGZA 4S2SB 4P4KB 2ICCA 1Z5LB 5EZJA 1KOAA 4DWHA 4U1IA 3RTQA 1QKZL 4IIQB 3MPCA 4QY8A 5FV1L 3SKOA 4F57H 4PJXA 2YUZA 3PP3K 3KHOA 1QO3B 4LVOB 4HPOH 4PLKC 5IT2H 3GBML 1HQ4A 5T1KA 3IB4A 2NXYC 2BXYA 1NGWA 3KPMB 5L2KA 1KB5B 4X6EA 1UH4A 2ZNWA 4GKZA 2H8PA 3RUGA 4P46B 4JKWA 2KUTA 2JJTC 3FN0H 4POZC 1QBAA 4M93C 5ICXB 1ZLVH 2XN9E 2DQUH 3JUYA 4YAQB 4X6CB 4GXUM 4WEUD 4LLQB 3V5KB 4WWKC 5B4MD 4K7PL 3P9LB 5JXEA 3VXPB 5CP3H 1TZGH 4UOW0 2X42A 1RD6A 5DJDA 2ADJB 5E94A 4O5LH 2C3WA 4R97C 1VFMA 1L0XA 4HC1A 4OLUL 5GJTL 3MO1B 1N7ML 3QA3A 2FBJL 1JWSA 4HS3B 2DQDL 4LHUD 5C0DA 1FNEB 4NO5B 4X99B 5HYJE 2IG2H 2QSVA 3WSQL 2NY6D 4KTEH 5F7UA 1PSKL 5C92A 5IMOA 3BUYA 4LCYA 4BQ9A 4UNUA 1FSKC 4Y89A 3MLVL 3CX2A 1UYWH 4H20H 3RWDA 2H2PD 4IRJD 2FZ3B 5TE6L 4NQSB 4GG6E 2P24B 4QTHA 3ULUL 2EYSB 5CJQL 1CK0L 5FFLA 5DURB 5B21A 4YPJA 3C08H 2ADJA 4JPWL 5FM5O 3BT2H 1IGIL 5D70L 2EECA 3HN3A 4NWUL 3D3VD 5CIPH 1MCLA 3MO1A 4Q9BA 2CIKB 2J8HA 5ACLA 3VXUA 5DS8A 1A14L 4RA3A 2Q86B 2HFTA 1RZ8B 5K9QI 4PR5B 5F9OH 5T1DH 3RTQC 4UINH 3L3GB 3W11D 3JTSB 1XGRA 5JHDB 1J0KA 2VLRA 2F5BH 5DMGD 1UM4L 3JWOL 5H35B 5IHUH 4H0IA 1ERNA 4BK4A 4M9PA 4MNQA 1HHIB 2ICEB 1L0YA 1BFTA 4I3SL 1BM3H 3UYPA 4JQXC 3ARWA 1JUFB 1HHGB 3TIDA 3INUH 4WEMB 2NY5C 2BY2A 2BNRD 5EU7E 2X41A 1QR1B 3PWPB 2X10A 4V2BA 2ZJSH 2P7TA 3G9AB 1WC7A 4HMCA 4PS4L 4M43H 4YFLI 4KY1L 5M94B 2LFGA 1EBPA 5HHVL 1FGVH 2XICA 5EU3A 2FX8H 5DRWA 2WV3A 4KI5C 4WWKD 5B4MC 4QT5A 3CK0H 1UWEH 1A5FL 1F4HA 5JHDA 1MCFA 1K6QH 3B9KB 2HJLB 3HE6B 2QSCL 3ZT7A 5D1ZC 5DXWA 2EZ0D 1Q72H 1XZ0B 5T3XD 4IRSB 4PJGF 3WFEL 3ISWA 3RFZC 4UBDD 3HE7D 5IJVB 1KPUA 4QF1B 1F6AB 4KKBC 4MNGA 5EPMB 4PREA 1FG9C 4FFVD 5IR1A 1MI5E 3QDJA 2FHBA 2VQUA 3KLHC 1Y18A 2OMNA 2H2PC 4IRJC 1LP9B 4OIBA 4HZAA 4BUGA 4OZIF 4QRQB 3GZKA 2X9WA 4OF8A 4IOIB 2HFFA 1P9MC 5AUMA 5K9KB 3K8MA 3H2WA 1OM3L 1P84K 1SYVA 1HI6B 1Q9WA 1UB5B 1DBMH 1M7XA 3L6FB 4LCCC 3HE6A 2Y06H 2Y36H 2DD8H 2OI9B 2VLME 2NLJA 1L7IH 3O6FC 5F93C 1X6LA 5J6HB 1SEQH 2VDOL 1RUMH 4K2UH 1NGYA 1MQKH 3TT3H 2ITCB 5J9PB 3DUSB 4KVCL 1IC7L 2CDEB 3T0AA 5HYEA 1BF8A 2Q86A 3SHSA 1YEKH 4X5XB 3MJ9A 3TEUA 3MCLH 4S1DC 4G8FB 3O2DA 4TQEH 2BVPB 4FTVD 2VXVL 1U8IB 2YR3A 3QNXA 5F7EH 5H35A 2DL9A 5DK2A 3UTQA 4HDIA 4QRRE 4O4YL 2RJMA 3QDGD 43CAA 1JPFB 2FSEA 2W92A 2Q3ZA 4D8PB 4WUUD 1A7PH 4DOHE 1XT5A 4FQXD 4PJDF 2F54D 4JFQA 4PJAA 4I48A 3QCTL 1MNUL 3I84A 4PJIB 1INDL 2W9EH 5F96L 2DIBA 1T83A 4PRIB 1KFAH 4H88L 3PUCA 5IWLA 4M7KH 4R26H 3DNKA 1MF2L 1NC4A 5EOQH 1OAKH 1RPQA 2WBJC 5CHNB 3WYRA 4GRWF 2D7MA 1B0GB 1G7IA 2VOTA 4M6AA 5GHWL 2AK4D 2ZWLT 3DX6B 3GSVB 2X4TB 5IVXB 1NC2A 4OD2B 4D9RD 4JM2D 4U1GC 4DGYH 3VG0L 5EO1B 2DWEB 1WSST 3MXVL 4TOYL 3IDMA 3G04A 4I0CC 1EZVX 4IMKA 5D7JA 5HHME 3T4AA 1X5GA 3Q6GL 4ODHH 3QUKA 4ZMAT 4K23H 3HCVB 3REWB 4PJAB 4M1DL 5BCAA 3VXRE 4LSTH 4DQOH 2UWEB 1BGXL 1S7SA 2F8VA 5IBUB 1W0VB 3PHOA 5FO9B 4ERSH 1RZJL 4FQPA 1JGDB 1FFRA 2EXWC 1A3RL 2OTUB 3M1BA 1I7UB 5K9JH 3ILPB 3ZTNL 4LVHB 4TRPL 5K9KA 1RZGA 5C2BH 1NFKA 5INCB 5DJ2B 4HUVB 1ED3B 2X4TA 4S1RH 2FH8A 5H2BB 3SO3C 4EN3D 5E8NB 5SWSD 4XMPH 1S9VB 5CJXC 4U1JA 4HGWB 2W9DH 2YUXA 1AGFA 5DVLA 3P3YA 1IGTA 1ZTXL 3L5WB 3B43A 5I8EB 1EHAA 3K46A 1NGYB 2EC9U 3QUKB 3KJ6L 1YEDB 3AU1B 1KCUH 3FL7A 3OL2A 5EU7C 4NP4L 4L4VD 3NFNB 3TH4T 4HJ0C 1HINH 3CMGA 1I9IL 4N5EC 1Z6JT 4AZ8A 2R1WA 1R5WB 2VDPL 4JRXE 5DQJA 1KLUA 4UV4H 2F54B 4QTIL 2C4XA 5E24E 3QO1B 4Y1AD 2RFXB 1LNUA 1W72B 4C54A 2ZUSA 2R69H 4J3SA 1N6UA 3VMOA 2YPVH 1D5XA 2PCPB 4PJHF 1TPXB 3GJEA 4YHOL 5ID0A 1BX2B 3S88L 2XI9A 1XCQB 3ZE0F 5DMKA 4U6YA 4XMLL 2AK1H 2JB5L 2W9LA 1CGSH 2JJWA 4I3RH 2MFNA 2HTKD 3RU8L 1CGTA 4EUPG 5HHXH 1BIHA 4X7SH 1SY6A 4GAFB 4PGEB 3I9GL 1JTOA 3RTQB 5D1QC 4IDJL 4PRBB 2IMMA 4JPKH 5I76B 1NDGA 1P7QA 1TZHA 1CFBA 3UTSD 2V2TB 1QO3A 2OXHA 2UYLA 5CFHA 3K2UH 5EU6B 5ESQB 3NIFF 1DR9A 3MLRL 2QHRH 4X6EB 5EA0L 1RIUL 1VHPA 4H1LA 1SVZA 1P4BL 1D9KD 2QR0A 1FZJA 4JFZL 2BP3A 4OF0A 2R1YA 3U0TA 4X7EC 4Z7VA 1S9XB 4CDGC 3I6KB 3OGCA 2WLZA 2NY5H 4JFDD 3N1GC 5DEFA 1YQ2A 3H0TA 3O3EA 5JUEL 1RAMA 2FGWL 2IANB 2KQMA 5GRJH 1RU9L 1X5HA 1DTUA 2YD2A 3VXQA 2VLLB 4HK3J 2BRRH 5DJDB 5B38A 1CFQB 1MIEL 3LKPA 3K4DA 1KT2B 4GLRH 3LD8C 4MXQC 3MODL 1QHPA 2X70B 5D7KD 3HI1B 4GG6F 1MLCA 2EDQA 4NQXB 4HWBL 3RWFB 3LZFL 1U8NA 3ARFC 4MA1B 3W5MA 1BFOA 1OGAA 3NPSC 2QTEA 4HJGA 3NACH 32C2A 4FRWA 4G9FA 3VFVA 3E8UH 4CJ1A 4PD4K 2VJXA 4Z7VB 4I2XA 3BMWA 4P3DA 4QRSA 4QGYA 2R2HA 1S3KH 3O0RH 4P5MB 1F45A 2IBZY 4MNQB 5T5FL 2OK0H 3P0VH 2R0WH 3G5VA 4K7FA 2VDQL 2D7QA 1AFVH 3QJHA 3BPNC 1JWSB 4HS3A 3MLXL 4YXKL 2A9NL 4AL8H 1EERB 3NA4A 4CW1B 4MB5A 3O9WC 4ELMA 1MQ8A 2W91A 3WXWL 1EUTA 2APVA 4MMXC 5HGGS 1EFXB 4PV8A 1HHKA 1W72H 2DKMA 5JPNA 1EA9C 3V7AG 4GQ9L 3RVVD 1XGRB 3O8XB 1AI1H 4HUKB 4X4XB 2DYPB 1NCDH 1CDJA 1TIUA 1PDKA 2WBJB 1KXVC 1AC0A 3CLEH 1CBVH 3O2VH 1I75A 2Z8VC 3NCBB 3VU2A 2BZDA 4S1QL 3SE9H 2Q3AA 2A9ML 1JWMA 2QKIA 4PJAF 2VZOA 2BSSA 1EVUA 4AQ1B 3MNWB 4MYWB 5KOMC 5CD5D 1B6UA 3IJYB 2Y7QB 1FV1A 2GTZA 4YHIA 5KSUA 5JW5B 4HIEA 3VXUB 1CE1L 1N4XH 4LVNC 3L7FB 4B5EA 1QNZH 5HHNA 2CDGA 3FQXB 5CJOH 3TJHC 2MCPH 4L9DA 4ZUWA 3KPPB 1JZ3A 1MLBB 5DDHA 1T6VN 3B9KA 1JVKA 5T1LA 3V79C 4UU9B 1A3QA 1FBIH 2B5IC 4N1CA 4OT1L 5A2FA 5DVKA 3IDIA 1T0NB 3QUMB 4HMDA 5A2LH 2CO7B 3L5JA 5IJVA 2QKIB 3SOBL 3CC5B 3IFNH 4ODXB 4LIQL 5I1DB 4KHXH 4JJ5A 2A74A 4WFED 3U82B 2BY3A 4DJMA 3OR7A 5IR1B 4GRMB 4Y16B 1XF4A 1QFHA 3U6RB 1J5OL 3OXSB 2AJUL 1L6ZA 2LU3A 4LNVA 3K4AA 3TJHD 5DJCB 3DO7A 1CXHA 4MGXA 3ME0A 4QT5B 5D2LF 3LKRB 4KHTH 2VKWA 5EH1A 3C8DA 4PGJA 2YA1A 1A1MA 1CN4A 1T20B 4L3CB 1PQZA 1YNKL 3GBNH 4ZSOE 3W11C 1W8OA 3GIZH 4KMTL 2H6PB 1MJJA 4GRLB 1I4FA 3V4PH 4XWGL 2MNUA 3JV6A 4NZTH 4HLZH 4YHNB 2B1HH 1QTYT 3BIBX 5CUSH 4MD5B 4JM2C 4KRPC 2J88H 4PBVC 1KELH 2HFGH 1FNFA 1G6VK 3OHXB 4K71C 2D9CA 1XIWA 5AUMB 5DQ9B 5I66A 4LMQE 5IIEB 4P3CL 3SGKA 5M95B 1KCVH 1DL7H 3BX7C 2DQIL 1G7IB 4HWZA 4MAYA 1SYVB 1OWRM 5HI3C 3QHZL 1N8ZA 2QEJA 3HUJB 5D2LB 3X14A 2YC1B 4G9DB 1FO0H 1E4WH 3GMNB 4YLQT 4WU7A 1UC6A 5J11C 5ENWB 1EO7A 2ITDB 1XCTA 3MLWH 4NM8H 2XYCA 1X44A 3IRPX 4I48B 4OF7A 1TJIL 1HEZB 3LEYL 3RDTB 1VKXB 4FFYH 5DD5H 4PJBA 1WCBA 4KFZC 4OUUB 1RFDL 3ARFD 5BRZA 4LGRB 3RVXC 1N3NA 3IS1X 3T0WA 3P11L 2VAAB 2E6PA 2N7BA 4ZAKA 1U3YA 4LHUB 1V7NH 3VXME 1ZS8B 3FFDB 5J6GB 1IRAY 5KSAB 3IDNA 4QRRA 4GBXA 3JV0A 3BQUA 5TQ2H 4GJTB 1QLEH 5EOCH 3O4OC 5DI8B 5TPWH 3E3QE 1N0XH 1LO4H 2OR7A 1FIGH 4XCEA 3U2SB 4M3JA 3WCYA 1IL1B 1JRHI 5BVPH 5HXMA 1J1OL 4X6DB 1CG9B 2AJVH 2RCSL 1N5AB 3REVB 4UTAL 4HS8H 1GAFL 1ZKAA 5E1AA 4RDQG 5DHYA 1TMCB 5EO9A 5LJYH 1CDUA 1LP9F 1RJZB 1U8MA 1G7HA 1ZE3C 1U8KB 4NN7B 4ODSL 3V0WH 2H8PB 3GRWH 1KPVB 3RUGB 3VDAA 4B0MM 3C2AH 4HZLA 3GMLA 4NT6A 5I8KH 4MD0A 1MCWW 5F3HA 2LE9A 1S8DB 3T0BA 4P23C 3NMEA 4PP2B 3S35X 2FB4L 4G42B 1MCQA 2DQCH 2PYEB 5FECB 2BDNL 1ZANL 3HAEH 3O3DB 4MAYC 3VWJA 5A2JH 5FHAH 3NFNA 3MSPA 1C08A 2AXGA 2YMXH 3EOTH 4P5KA 3RWCA 4LF3A 4KJPC 3QDJD 4G8GB 5KTEH 4WFFD 2FJGA 3GM0A 3FQUB 4XGZA 2R1XB 1N8ZB 3HUJA 4FP8H 1FORL 1AQKH 2KPNA 1NFDA 4FFWD 4H1LB 4OFKA 4MX7B 1JBJA 3F5WB 2JK5A 1D5BA 2OXGA 4WEBH 3SE3C 4DZBB 2HVKA 5IG7A 5IK3A 3BD3A 3H9ZA 3BKCL 5E8DL 4N8PA 4KUZL 3LVEA 1T7VA 35C8L 4XAKE 4MA8H 4OUUA 1H0DA 2VQ1B 3IDJA 4PJCF 5GRUH 3I3BA 1EDQA 1X7QB 4JFHD 1JFQH 5JW4M 1A7RH 5EC1B 2QQLL 1SM3H 2GQHA 3U1SH 4AG4L 5AEAA 3B6SB 1GZQB 4O2EA 4U0QB 1U8JB 5HHOE 3MROA 2O61A 3UTZA 1WWBX 3RA7H 4P2RA 5FYKE 1W72A 1GGIL 2Q20A 4DN4L 4DEPB 5CINL 1MLCB 3M45A 1RVFL 4NQXA 4HKBA 4PRPD 5GGVY 3MUGB 1TETH 1MFEL 4RRPA 2XQYG 3G9VA 3BEVB 3ZT6A 5C86A 4U6YB 1OWWA 2HVKB 2IBBA 1DBJH 4XP4H 2DQHH 2P5ED 5C0FB 1XF2B 3KPLB 1U6AH 1ORQB 3QISA 4P3DB 4QRSB 2HG5A 2WQ8A 1ZA3B 1KJ2H 1RZFH 1X7QA 5ALBH 5I1HL 3QDAA 3OX8A 3EFDL 1HHGA 4V1DE 1NL0H 5HDOA 1U36A 5ESQA 4EVNA 3B6SA 1U8MB 3GJFH 5ANME 4CN6A 2HLFC 1OW0A 1RHHA 3ARSA 1T1WA 4NHCL 4LLDA 5CZKA 1KIPA 2GT9A 5C08E 1CK0H 4XNMA 5FGBA 3WO4B 2E7LC 3D69A 1MFDL 1INQA 1G7JB 1Q9LA 4ODBD 4YFEA 5IJKA 4OAWB 3MV8B 4JHBA 3IDYC 2FBOJ 2R8SL 4NSKB 1FYHB 4Y4HC 4LKCA 3V9FA 2EXYC 3FO1B 4X7TA 2EYRA 4PY8J 1XZ0A 3QEHB 2C5DC 3RWCB 5D2NC 1YY9C 4LGPB 4XVUD 2HA1A 4YO0A 3BO8A 5FYKH 4XGZB 4P48A 2VSCA 3GSWA 4K7FB 1NGZA 3VGFA 4HUXB 5T33L 2DQGH 2QADB 2VZSA 1IAMA 3CFKB 1HILB 4WI6A 1T0MB 4S10A 5I1LA 4G8GE 4EN3A 1YN6B 4I3SH 4QHKJ 1D5BB 2NNAA 3E6FA 3TBYB 5HHNB 4UV7L 5C71A 2HFFB 3QG7L 1R5IB 3QQ3A 4XNUL 5FUZH 4YXHH 1F00I 2ZCKL 2R2HB 3E2HB 5DRZB 2YHGA 3ZKQD 3MACL 4QNPF 4K9EH 5F97E 3VXPA 5BS0A 3MRFB 2FX8L 3H3PH 3T0EC 2H2SD 2BVYA 4KJWC 3QWOB 4ZFOA 4WJ5A 4XBPA 4BKLA 1S7VB 3DYMA 2XQYK 5IBTL 4JPIB 3PWLA 1GC1H 1ZLWK 1QPXA 1QBBA 1VFAA 1WFNA 2F19L 1NLDH 4MQXC 4F58L 4CU8A 3O4LE 4OM0L 4DEPC 2EH7L 2A6JB 4QRPE 1GIGL 1X5YA 4X4XA 4YQXH 5LGHL 3MV9B 2HKHH 4NFBA 4HSQA 1MRCL 4AK1A 3KPLA 4TUKL 2I9LA 4GKNA 4RWYL 1IM3B 4U31A 5BO1H 3ARPA 1B4JL 3GSNA 3QFJA 1YMMA 1YN7B 1G1CA 2QQKH 2XY2A 1NUGA 3OMZA 1I3RB 3VCLA 2R9HC 1UZ8A 1F4AA 1ADQA 3GI8L 4U2YA 5CEXA 4N0UE 3T65B 4C83B 2XA8H 5JW5A 5I1CL 1DQTA 3KPSE 1TVBA 3BKYL 3D0VB 5EG6C 2EDRA 3D48R 3QXVA 4TSBL 1QZ1A 3RPIB 4FQHB 3A6CL 3FONB 3S7GA 4PRID 3E1F1 2VDLH 5EUKB 1VFAB 4XCFL 4YPGB 5FUOL 4LVEA 2Z8RA 4TULH 3S36X 5EFIA 2NY0C 2E9IA 2CK2A 4FNLH 2VLRB 4YIQA 4XVJH 3SGKC 1OCWH 1T20A 3QUMA 4HLZG 5LWYL 1ZVSA 4ETQA 3MCLL 1GCFA 1BAFH 4KQ4L 4S11A 1AHWA 3ZKND 3CC5A 3LPGA 3TT1H 1D5IH 4F7EA 1CL7I 3BGMA 1BOGA 4NO2B 4QOKD 1UM4H 3ZE2F 5EUOA 1BQUA 1KC5L 5E9DA 3VI3F 1VKXA 4O9HL 3PL6D 4MD5A 2R23B 5ID1B 7FABL 3QQ9C 5EU3B 5GQBA 1BZ9A 1FNGA 3QEQB 2EH8L 4MJ5B 3SQBA 5KVEH 4G6JL 2VAAA 3CU1A 2CKBL 2ZPKH 4LSDA 3V6OC 4Z78A 4G6AC 5DMIH 5IM7A 3PWUB 4FMKA 1U92B 1KFAL 2EIDA 2IANE 5DC9B 1AJ7H 1J1XL 4LSRH 5J6GA 4J3UA 2GKIA 3TBTB 2E8ZA 3QHTC 3QT2A 3ZZ1A 1T66C 1X4YA 5F6IC 4IOFC 3WHXB 2GTWA 1WT5C 3SBWC 5KVFL 5JOPD 2NY4D 5JQHC 3L3KB 4YHKH 2BJMH 3LN9A 1IARB 2GSGA 3QDJB 1NAMB 3TVMB 5IMMA 1X9QA 1FJ1B 2AI0L 2IH3B 3I02B 4E42B 3HG1D 4G5ZH 3TN0A 3QNYA 4MAYB 5TFSH 1YPZF 3ESUF 4KKAC 4IOIA 3QCUL 4Q9RL 4JY5H 2XZAL 4L9LB 4M1DH 2R4RH 1FYTE 4XC3L 1N7MH 3EYSL 3QUXA 4N0FB 2DOCA 2J4WH 4CVXB 5IVXE 1J0IA 3MFGB 15C8H 5DI8A 3MRNA 4KTEL 4XVTL 3D6GA 1UXSB 5T3ZD 2FX9H 2OZ4A 1B2WL 1TVBB 3D0VA 1VENA 1KJMA 3C6SA 4PG9B 3MFFA 4XMPL 4JQVA 3ZE1F 4JRYB 3VG9C 4EI5A 1CE6B 3UYRH 4YUEL 3GDBA 2W9DL 4X6DA 4ZUUB 1NJ9B 4ZAKB 5IVXF 2XKNB 4GW4B 4LLUA 4QRTA 3HNVH 1RUAH 4APQA 4G80A 2UYLB 1ZS8A 3FQUA 4J4PA 3FFDA 2EDJA 5C0RH 4M6OH 5ACMA 1UCTA 3H7BB 2BOCB 3MBXL 5C0BA 3UTQB 1ZGLP 3RWHB 5C0ND 2GJJA 3QAZB 1G6RH 1A7BA 4LPYA 4GG8B 1CICC 3EFFA 3ROOB 4N0FA 1HDMB 4PUBL 4DAGL 3PNWB 2XTJC 5JTWA 4C55A 4GG6B 1KJ3H 1QPPA 4O2CB 3PL6C 2ZSWA 2IFFH 4M7LL 4PJIA 3OGCB 1ZHKA 4OQTL 3ZT5A 4KU1A 4X9IA 1S5HA 2V5SA 1E4XI 1ZWIB 1BFVL 5D9SA 5FKAB 2IANA 5DHXB 2A0LD 4I18B 4FZEH 1QEWA 2HH0L 4E9LA 5FV2A 1VACB 5C0EB 3BRFA 1HKLH 5DHYB 1LO5A 3PWNB 5E2WH 1KT2A 2XKNA 1U93A 2R1XA 4NDMA 3ZO0A 4QNPE 4ZQKA 4WDIA 1MRFL 4HIIB 2BOCA 3QB7C 1PBYA 5D2NE 2IGFL 5J1TC 4NN5B 3DRQB 3HLAA 3MRHB 3ZTJG 3WHXA 3HMXH 2VISA 2PYEA 2GY5A 4BQBA 4OUOA 2HT3D 2ORBL 2X4QB 4LNRB 1BP3B 2NPLX 2CMRH 3WO4C 1P9MA 2SEBA 4OB5H 1NCCH 4U1IB 5D9SB 5FKAA 4WY7L 1U3HC 3E2HC 4GQPH 5EC2A 3ILPA 5H8DA 5T3XL 2FJGB 4XP5H 3C6LB 4KC3B 1OPGH 1ZT4B 1U8JA 3ARDD 3QIWB 2MCG1 4DQOL 4PRPE 4JB9L 1G7PA 3QXDA 2H32B 1RZJH 1KACB 2IH1B 1U93B 5I0ZA 3ZKMC 4NQVB 3B9AA 5GZOD 4MJIA 1ZGLA 1WAAF 4CW1A 2DQDH 3DXAD 2FGWH 3GGWB 3FFCA 3DX8A 1Q0YH 2P1YA 1EXUB 3DURA 2GJ6A 5L0QC 4KKCC 2VDNH 5IG7B 1PSKH 4HMEA 4WW2B 3VFGL 3D69B 2XY1A 5JPNB 5LQBH 1HN1A 2FR4A 1D6VH 3OXRB 1EO8H 4S1RL 4OV5B 3EGSA 3RPKA 1X5KA 1AKJB 1W2KT 1VGKA 4YDVA 5F7WC 4NUGH 1OM3H 3V4UH 4EI5B 4FG6C 1T5WA 2A6KA 3UJIL 4G7YL 2EYRB 3HKFA 1QUNA 2DM3A 2Y06L 2XWJB 1MAKA 4LLUB 4QRTB 1AE6H 5ETUB 1ZT4A 1KTDA 4NP4H 1UB6A 3IKCA 3MJ6A 2VDKL 4HIEB 4NN6B 3IAPA 5EU6E 5C0DB 1Y6NR 3L5HA 4J23A 5DQDL 1ZSDB 3GK8H 1SJEB 1VGEH 2CDGB 3BEVA 3MC0A 1EEUA 3DURB 2B0SH 5F9OL 4QRRD 3HI5L 2IPKB 4P2QE 1QQDB 4Z7OE 4OCWH 2VDQH 3C8KA 2X4OB 3QRFM 4R90H 4X5WA 2F54E 1ZWIA 2P8PB 1MFCL 4D9QD 5E00B 1U2CA 2YPVL 5CSZA 5D5MF 4I18A 1QEWB 2UUDK 5D1XC 3S88H 1JMZA 1NDGB 1H3WM 1W72L 1MPAH 4HJJL 3T09A 4I0PD 2I24N 2VH5L 2X1WL 4Y4HD 4PY7A 1UXWA 1HNGA 1TCRA 1NMBL 3SKJH 4GRMA 5ADPH 5KN5A 2HRPH 3OXSA 2XOTA 3T3PF 5J12C 4WWID 4N9GB 5E08L 4S1QH 4HS6B 4M7KL 3T3ME 5IROC 4OJFL 3LKRA 2R1YB 4JFED 3EDEA 3VFPA 4P23B 5GRZA 1LQSR 4LFHD 1UWEL 5C3LD 2DMBA 3SDDB 2I9LB 3UBXB 4G8EB 4D9RE 2G60L 1NBVL 5KVGH 3MRLA 3WNPA 3BN9D 5CJXA 2PXYB 2MCPL 1OB1A 2DB8A 3ECBA 1QHOA 3D3VA 3PWPA 4LPXA 5MHSD 3VXUD 1T0MA 5I1LB 4ONFL 1RU9H 1BGXH 3KPRE 1ZEAL 1NUDA 3FFCB 4C56D 3K80A 4OZHA 1BQHA 4ETYA 1KTLA 5SWSE 4WHYG 2XT1B 1N59B 4PRPB 4HK3N 4AYFA 4EIZC 3KYMA 1NEZA 5B8CB 4CMMA 1JHLL 1IEAA 4LAQL 5EDXA 5FK9B 5DK0A 2UVFA 1T5WB 1GHFH 4G8IB 4ZO8A 3VXTA 2V5YA 1KN2L 3T1WA 3MRFA 3G6DH 2W0FB 1D6EB 2ESVB 2NCMA 5H37H 4BH8A 1OT1A 1L7IL 1KJ2A 3OKMA 4XBPB 1S7VA 4Q6IC 4QHKI 2NX5E 5GZND 2Q7YB 5JXAL 5GGQL 1JGVL 1QRNB 4XX1G 3IETB 1MQKL 3KJ6H 1BJ8A 2ZNXA 4Y5YB 1CXEA 1JYNA 3C60B 4ZUTB 4Y8AA 3TZVA 2GAZB 3NABL 1YEKL 2DWDB 5GGTA 5EUKA 1LO0L 3EYUH 3ARQA 1ZOXA 5D1QB 1DEEA 5IFJB 4QOKB 1BLNA 3NPZB 2BMKB 1CDCA 4NWTH 5TE7H 5DMYA 4XPHH 4RMRA 3L5XL 4FXKA 4OZIB 4LU5L 3HG1A 2KL6A 3QO0A 1YMMB 3STZB 4JFFB 1D6EA 2WIMA 1C1EH 4LRNL 5I75C 3MRRB 4OCYL 1IEHA 5FYJE 2E7MA 4F7EB 3SQOL 1JV5B 4P9HL 5ICZB 1UXWB 3AAZA 5KSBE 1RUQH 4H25A 4R4BB 3CAFA 2FWOB 3MOQA 1J86A 3VE0B 1I85C 1NAMA 3TVMA 4OFYA 4R26L 1EJ6A 3DBXB 5CSBA 1HXMA 3AM8A 3F12B 3PJSA 3TH2T 2APBA 2NY7L 2R39A 4Q58C 5F9WB 1GGBH 5ERWA 1DEEB 5IFJA 3PWUA 1NMCB 2NY2B 1IE5A 2FATL 4M6MH 3V0AC 1NMAL 5T1LB 3Q3GB 4TOYH 1L9NA 3TBTA 4YXLL 1YMHB 1T1YA 1JK8B 3HC3H 4G43A 2VL5A 1XF1A 3EHBD 4CVXA 1IC5H 1FAIL 3H9SE 2NXZC 2VSDA 5FA3B 1UXSA 4HUMB 3ARTA 3DSFL 5JHLH 3SKNB 3D1MC 3IJSB 1BD2D 1UEYA 1A9EB 1N5YH 4JRYA 2J8OA 4F2MB 3WD5H 5K9JL 3IDXH 1NC4B 2AQ2A 4NQDE 4KRNA 4FTVA 1NFIA 4E0RB 5JO5B 4TRPH 1IZJA 1YEFH 1WBXA 2KDGA 1IEAB 1LO4L 2MQ0A 3LKNA 3LHPL 3QUML 4N0UA 3L3OA 4PJFA 3AS0A 2ESVA 5HDBE 4LCUB 2NXYB 4WUUA 3VXRB 4NFDA 2AJVL 3FHAA 5HVHB 1HH9A 1S9YA 4PJ9D 2NY0D 2PYEE 4HK0A 5IK3B 3CVIH 5B22A 5DK3A 2R15A 2WUBL 1AXSB 2JIXD 2UWEA 1VCAA 1YNKH 4ODSH 4NZRH 5JPMB 2YEZB 4YBQD 1FZOA 1CXLA 1OF2A 5D71H 5EZLB 3UJTH 5JOFA 3BYTA 5JHDD 3EJYC 3MA7B 1BLNB 5E2VH 4XCCL 2DQCL 2ERJC 4Z8FL 4BFBD 2R0WL 1WIOA 2V2XB 5DFVC 3VXSE 5D7JD 4PRDA 3TBVA 4N1EA 3ARDA 1T3FA 4G6AD 4YX2H 3BN9C 3GHEL 4HAFA 4J8RB 2Y07H 1J1PL 2EEAA 5ICYA 2JLLA 4YBHA 1X5AA 2NY3C 5AZ2H 3MFFB 1FORH 4ZS7L 1JGEA 3FFCD 1MAJA 3FMGL 2Y5TA 4XRCB 3QIWC 4DVRH 4XZUB 4OBSA 1AD9A 2KH2B 1RIVL 4ZO6A 4JY6A 2FHFA 4APQB 3W9EA 4ZFOL 3ZE1E 1WFOA 5F7LB 4BELD 2A9MH 3EDKA 3MA7A 4Q0XH 3BW9A 4CN1A 1T1WB 3RWHA 3D85A 4KK6C 3Q3GA 5IEHA 3UZEA 1R3IH 5EWIL 2AABL 3GGWA 1YNLL 5GRVL 3RVWC 3TBVB 3QEGL 3MREA 1TQBC 1BFSA 2HLAA 3LEVL 2OI9C 3O6KL 5HJ3B 1U3JA 4NQED 4L4VA 2IC2A 2VZ1A 4L8BB 4X80L 1YPZE 5CINH 5D6CB 4TSAL 4PRNB 3R06A 5CEZD 4P9HC 4F2MA 5JUEH 2AGJL 2OZ4H 3KPTA 1KIRA 5E9DD 4LSVH 4X4YA 1DLHB 2J8UB 3HE6C 2CDFB 4NZUH 4CU7A 3C9NA 1N64L 1UKSA 1A1NA 3FB8B 3V6FA 3DVNB 3MODH 1AO7E 1X6NA 5BVPL 1OTTD 2I26N 1U3ZA 1OGTA 3R8QA 4KHXL 3LV3A 4J4PC 4ALAL 1F11A 1H3PL 3OV6A 4D9LL 5E99H 1AH1A 3HR5B 1LDSA 5GS1C 3DX8B 4XXCA 3HZKB 4H0HB 4R9HA 5ALBL 3I6GA 4MVBC 3TO4C 1JL8A 4LSPL 1IEBA 1UADC 2FR4B 1QQDA 3EZ8A 5JW4N 1QSFA 1U8OB 4RQQA 3PIQA 3KLDA 4ZSOB 4K3EH 2ARWA 1PVHA 3H0TB 3IU4H 3JTTA 5A2KH 5CSZB 2PXYD 2NTFB 4JFEA 1NMCC 2W60A 5C07E 1NC2D 2WM0A 3QIWA 3U4BL 5ESVB 5T5FH 2OK0L 4EDWL 4KROB 3VI3E 4HC1L 4BKLB 2J8UA 1KIQB 3C9NB 1D5MA 1L0QA 4LQ1A 4UTBH 2A0LC 1P7KB 1RZKH 2WWKT 1DZBA 1OGTB 5FM4A 3D18A 3KG5A 4G3YL 3EOYG 3LS5H 5C8JA 4J8RA 4QHLA 4ODTH 5DMJB 3WXVH 2PR4H 2FO4A 3GSXB 3S3PA 1S5IH 4RAVA 4NCC2 4JY4A 3LN4B 1P84J 1WCQA 5E8PB 4L9LC 4UOW1 4LP5A 3JTTB 1DN0B 4PJXE 2VDML 1KNOB 2W65B 2JELH 1I3RA 5IW6B 1Z9LA 3GMRB 3QG7H 3VWJC 3TPUB 1IGCH 1KCSL 2AJXH 3UTZB 4YDIL 2O61B 3B3IA 3PGDB 1CTNA 1MJUH 3PF2A 5IEHB 3W0WD 1E4KC 1X5LA 4FQHA 1JGLH 1MEXH 1JFQL 4PJ7E 1FVCB 1N26A 1NUNB 1S7RB 1V3MA 3NCYS 4JDTH 1F6LL 3ZE0E 3K0WA 1AO7B 2IPKA 2O5ZH 4G6FD 5E5MA 3X3FH 3WS6A 3C8KB 2O5YL 4PGBA 1FL5B 4Y5VB 4YIQB 1XMWA 1G9NL 2HT4D 2X44D 1TJHH 2VB5A 4KXZH 3R06B 4NM4H 4JY4B 3HHRB 2BOBA 2VLRD 1ORQA 1FBIL 1XAUA 2HN7A 1JNLL 3BKJL 3HNTH 3RY6A 3S4SG 3SDDD 2LTQB 4OM0H 2HJFA 4MSWA 1RIHL 4JO3L 1I8LC 2DICA 4JHWL 5I1EH 2XRAL 5FO8A 4Y4FD 1MVUB 5GGVL 5HYIA 1BBJA 4LEOA 4HBQA 4MCZB 3MBED 1S7WB 1IAII 4N1HB 2KZ1B 2NXZD 1TTFA 1OTUC 5E5UB 1KULA 3ESVF 1KB5H 4YHZH 4JFFE 3TCLB 3DSNA 3DOSA 1ZLSH 4KHTL 5I6XC 2XA8L 1EGJA 2H26B 3S3JA 1P5VA 2NTFA 1NCBH 3X12A 3WNLA 5DJ6B 2H45A 4Z7VE 2YPKB 5CKAA 4KUCD 4YEEA 1GOGA 3RWEA 5BZWA 5FGRA 5E0QA 1BREA 4FZ8L 3ZSSA 3V4PL 4J2XA 2H1PL 4W6WB 1CXFA 2IF7A 3FRPG 1MUJA 2VMFA 3CH1A 4HX1B 1Z3GL 3I75B 4Z7QF 1D9KA 2V7NA 1R5VB 2HTKC 4Y2DB 2EXWD 1BWWA 4I9WE 2VWEC 5CUSL 2P48B 3FOLA 4H25B 3TBSB 1BQHB 4MCZA 1S7WA 5FHAL 3X3GL 2DWDA 2B4CH 4K8RC 3FJTA 4MJID 4NBXB 2VR9A 1JZ6A 1CZ8H 5D1QA 4UDUA 4M6NL 2X4NA 2GFBA 3L7EB 4M00A 1ROWA 2NY3B 3UMTA 3AM8C 2AEPL 4UQ3A 3LEXA 4Y4KD 1V3KA 4L29B 2H6PA 4LSQH 4GKOA 1S78D 4P46D 4XAWH 3RWIB 3TA3B 3MRQB 1YEGL 3VDCA 1ND0B 2YWZA 4TSCL 1H3UA 3C6LC 4UDTA 2CLVB 3QG6B 4LPCA 1U3HB 2Y1VA 3TZVB 4PJ9A 4ZD3L 4R4BA 4Y2DA 2RR3A 3VE0A 5GGRA 4R7NB 3GMPB 2EC8A 1L6XA 4PGBB 4G80B 5L7XL 2CRIA 5FO7B 1XGQB 3X14B 3VGBA 1N0LA 5DD1L 4S1SL 3TM6A 4XMKH 5LGKA 2WWMC 3AUVA 4IOSD 3VFRA 3UX9B 5D7SL 5IB1B 2FJHB 5EO0B 4EI5C 1RVFH 4YDKL 2FJFB 3P0GB 3DMMA 4MDJA 4YQXL 5TFSL 2IJ0C 1MCHA 1BVLB 1MFEH 4I4WA 1C12A 3CSGA 4KK6D 1RV6X 1F3DH 4GW1A 2OJEA 5DZNA 3IFPA 5TGBA 5HDQL 4XNZB 2X5PA 4PJ8B 2BNUB 5IF0A 1N3NB 4NJ9H 4MHHG 2XKSA 1FRGH 3TIEA 1DCLA 5D2NB 2EDLA 5I1HH 1NL0L 4P9ML 4OCXH 2FO1A 4Q97A 4YUEH 1A2YA 4G43B 3UPCA 3S37H 4PRDB 2RBLA 3UPRB 1RJLB 1HZHL 4XPTL 5INDB 4RZCB 1IMHC 2ADFL 1OTSD 2F58L 4WI9A 1IVLA 4P2OD 1N6QH 4AQOA 1BVLA 4HX1A 4UUJB 1KF9B 5IMKA 4OIIH 1HSAB 3HPJA 2BDNH 3SGDI 5I1IH 1WFTA 5E9DB 4ZFFB 5DJYB 3KYNA 1G6RL 1JWUB 1D5ZB 2NW2B 2AP2A 4RMUA 2FL5B 5TH2B 2OJZH 6FABL 3VMNA 5JO5A 3GKWL 4MA1C 1JPTH 3BDYH 3B9KD 3L3JB 4POUB 1MCPH 1P69B 4NKMB 3QXDB 3CLFL 4OQTH 2D7TH 2L7JA 3NAAL 3OJDA 4IRSD 4O9HH 4JFPA 4QXGH 4YH6A 3DGGA 3PV6B 3RNKA 3FTGA 2QLVB 1K8DB 5C7XH 3GMOB 2HH0H 5D7IB 5CEYB 4PJAE 4LAJH 1HKLL 2ZPKL 4F7PA 2OM5A 3EJYD 2BSRB 1Q1JL 5JW3H 1B9ZA 3PDOB 1LP9E 1BMGA 1F3DJ 4FABL 4HKXA 1I1AB 4MA8L 4HWUA 5FUZL 5C0CA 4F9LC 1OF2B 3UBXI 5SWZB 2NYYD 3B2VH 1UQSA 4DKEH 2V9RA 1WJ3A 1GC1C 5DVOA 1QSFD 3GI9H 4K55A 2GUOA 3C60C 3ARVA 1ODAA 4MJ6B 5I73B 2BJML 4C56B 1A1NB 3V6FB 4YGAB 4NRYB 1CXKA 3VFRB 1CGVA 4JFPB 2FJHA 5EO0A 4EQ2A 5D8JH 2A6IB 5C9JB 3LQMA 5MENE 1RK1A 2F19H 3X13B 4RX4A 5HI5D 3RWJA 2MHAB 1KSRA 3MZGB 1UWGL 2H32H 5FYLL 2DQHL 5LGHH 4XWOC 3AGVA 3W2DH 1I1AA 2UZIL 5A40E 1OGAE 1HXYB 1DSFH 4ZDHA 1CT8A 4AENA 3DVIA 5IMLB 3DUHA 4HKJA 3OF6D 1YNTA 1B4JH 3WS3A 5JNYB 1G7MB 5DD3H 1PX3A 5ESVA 1BBDL 4OFYD 3BPCA 2ENSA 3UO1H 2XZCL 4PV9B 4NUJA 1R0AL 3UYRL 1L7TL 3ULVE 1C16B 3IFOA 5I1CH 1QVOA 4JFYA 4G7YH 3LKOA 3V7AE 3QUYB 4TSBH 5TE6H 2J6EA 3MOAH 4ZYKB 2EDFA 3G6JF 1WISA 3T1FA 4AEIL 5ISZD 3PGFL 3OG6B 4ZPTA 4TYUA 1AKJD 1QA9B 4BFEA 2DL2A 2J6EH 2VABB 5DJYA 1XF2A 3V5HB 1D5ZA 1G9EA 1IGYB 3S8WA 1VGEL 1U58B 3RKPA 5LBSL 2L7UA 1KJ3L 1XF3A 1OAQH 4NNYB 5T5NG 5KW9L 2X2YA 4KI5E 1LO5B 4JO2H 3ULSA 4EVNB 4R90L 3WEXA 1RJCA 5KSBB 1CD9B 5IBLC 1MCDA 4U1NA 1RULH 3MLUL 1KIPB 3G6JB 4FZEL 4JLRB 1KC5H 3SJVD 5GGSA 3QUYA 3QRGL 4BQ8A 2XV6B 1MPAL 4HJJH 2VISB 1PW3A 1OGAD 3KWWA 2XWBA 3BMVA 4Q9QL 1ZT7B 3QI9B 5KVEL 3N1QC 2FO4B 3GSXA 4G6JH 1QFUL 4HKXB 4X9BA 3ET9F 4WUKH 5C07A 3UPAA 5F1NA 1IT9H 2IGFH 4MJ4A 3MACH 2A77H 5CZXD 3V5HA 3K8KA 2HN7B 1FG2B 5C09D 5C08A 5JXEC 1DLFL 4UAOB 3LSOB 1OSZB 3QCVH 4ZUVA 4PJHE 4YHLL 1C7TA 1ZXQA 2LAGB 2CMRL 1UH3A 2D31A 2EE3A 4RAHA 1EEQA 2W0PA 4EKXA 3D18B 4MJIB 1ZGLB 2NX5B 4E41E 4P46C 4AY0A 1WF5A 4QRPB 1S7RA 3X13A 1X3DA 4NO0D 1Q72L 4P2OC 5HHMB 3WFEH 2EC9T 5TF0A 3CDYA 1WQVT 5I1KL 4PB0H 1X5JA 3UAJC 2B2XH 3QO0B 2VDNL 1I9JH 4LLYB 3VFGH 4R0LB 2ZZUT 1AD0B 1MCNA 2C3HA 3KLAB 5E7FA 3B3IB 4OIAA 2B1AL 15C8L 4ZUVB 2Z4QB 3BWAA 1CFVH 3UZVB 5LAXA 4KJQD 3PWJB 4LDOB 3GFUA 5EU4A 3Q1SL 4GFTB 4XAKD 1OD7A 5FGSA 1SJEA 2VDLL 3GSRB 3MBEB 4C59B 3SCMA 2DD8L 5IB3B 3MRGB 1ULVA 4P4KA 4LGSB 4JO4H 3DWTA 4JHAL 2ED8A 4W70A 2IADA 4LASL 4V1DB 3ZLQC 1SEQL 4Y2DD 4XXCC 5JDSB 3H9SD 1XF5B 3V6OA 1FC1A 1FFNA 3GK8L 3KPOB 2ADGA 4AEEA 1SYSA 4KJYB 5B3NA 3VMPA 4FQCH 4OFPA 3GSNB 1IC7H 3RL2B 1A6TA 2JE8A 4ONGL 1SBBA 4GSDH 4MSWB 2CD0A 1BAFL 3RWEB 25C8H 2KKQA 3WEXB 1T22A 4HGMA 1E0OB 2Y23A 3U0WH 5EOTB 5CEZL 1EH9A 3MV8D 3P30L 1ORSB 3O81A 1Q94B 3BP4A 2V7HA 3CFEA 2YD7A 2YKLL 4KRLB 5GGRB 2P44B 1JIBA 1G0DA 2P5EA 4F7MA 5EFIB 3ARUA 1J8KA 5F88B 3DTXA 3SQOH 1EEYA 1OD9A 5E2WL 2H26A 5JIKA 5DZOA 4P4RA 3QCTH 3MRJB 1QP1A 3QFJD 3QQNA 4L5FL 3UBXA 1EV2E 3N9GH 3B8YA 3KPNA 5C6TH 5D1ZA 2BNRB 1GGTA 3LKQB 5CWSA 5HHPA 4IS6B 3LSOA 1MI5B 2PXYA 1OB1B 3ECBB 1AIFB 4P57B 2C7UA 2R0ZH 1H9VA 4Q9CA 4YGVA 3SDCB 4OZFA 1LK3L 3QQ4A 3QIWD 3D9AL 4I0PC 2B20A 5K33A 2D7OA 2A1WL 2HTLC 4N9OB 1M4KA 2BNUA 4DGYL 4EXKA 3A67H 5D1XA 3VFWB 4BFIB 4HUUA 4MJ5A 5T3XH 3Q6GH 1NEZB 5B8CA 3QEUA 1MAMH 4F7MB 1OPGL 2HT2C 3GO1H 3KS0H 1EX0A 1V8HA 5SX5H 2OL3H 4JN1H 3CXDH 4LK4A 3T2QA 5J0BA 1GSMA 5DJAB 2N7AA 4FQLL 4JFOB 1YEJH 4IS6A 3LQZB 4I4WB 3SDXF 3ARBA 2C7UB 1UZ6F 3PL6A 2AK4E 3G6DL 3X11A 4OGZA 1NCNA 3BD4A 4ZFFA 2VNCA 3RIFF 3DVFA 4EOWL 3SCMB 2YK1L 1TENA 3W0WA 3FT2B 1DQJA 1F02I 5D2NA 3UP1A 2ATKA 3S35H 3V7MA 2Z31D 1V7ML 5C0CD 3NN8A 2BMKA 3OKLB 5A3IC 1LMKA 1PJ9A 3FKUS 1F5WA 3W9DA 3W81A 1WBZA 3F7VA 1KEMH 3L3IA 4RFNB 1RZJC 3FTGB 3QDMA 3MGAA 4GBXD 3TC9A 5F6HI 3B2UC 4M4PA 4F7PB 2ZUVA 4NPYA 3TFKC 3HI5H 2IFFL 5EOTA 1A4JB 1I7ZA 1U8QB 4KUCF 3O3AB 4LLMA 2A73B 3C60D 5K9QG 5DSCA 5D6CA 1OY3B 1Q94A 4DCQA 2NZIA 3UROR 5IGXL 2BHZA 2ZUXA 4OF5A 4RFNC 1RHFA 2A6DB 1MVFA 4D0BA 2P8LA 5KS9F 2PW2B 4PJDB 3PJSB 2WIIB 2GUOB 4I5BB 5AZ2L 5CZVH 3DJ9A 2VWEE 5F44A 2VH5H 2AK1L 2JB5H 2P5WA 5JA8B 1I1RA 1WZLA 3MX0A 1VFOA 4FFWC 2A6IA 4X7SL 5AG9A 3BZEA 5LXGL 5E6YA 5DEGB 1TVDA 1RMFH 2XN9D 1QSZA 1IC4H 2F15A 4PLNC 5ITBL 3PQYB 4JRXD 5ILTL 3UC0H 4L4VE 4J1UB 4M7JL 1LDPH 1IC5L 1YY9D 3C2SA 3DHMA 5SWZA 5D1XB 3VXUE 1HI6A 1Q9WB 3QH3B 2PO6C 2ZKHH 3DSFH 1UH2A 2IQ9H 4BSVA 1UGNA 4JFZH 5CLTA 3CCHB 5J57B 2A83B 3G5YA 3BPCB 2P47B 4MMZC 5C6WH 4F33B 3OBAA 4U4BA 2BNQA 2COQA 2OTPA 2Z9TA 3S36H 3LMJL 2BCKB 4LCUA 4WUUB 3VXRA 5L88H 3VRIB 1CDGA 4Z5RA 4NGHL 2FGZA 1HHHB 5BV7L 1YEFL 3UZQA 3KPRD 1IAKA 1MCOL 4H8WL 4LRIA 3KYAA 5KVDH 3VJ6A 3P77A 5K59F 2DQEL 3RVUC 1NCUA 4R3SA 4HFWB 3V6ZB 3ARGB 4BM7A 4JM2B 1HXYA 1KN2H 1PG7W 4YDLB 3NH7H 2FRGP 4LDEB 1MJ7H 4YDJB 4OZFH 1FFOA 1E27A 3O6MH 1DFBH 1I8KB 2NY1C 4O2FB 3MA9L 1XR8A 1MELA 5F71A 3CCHA 5DT1H 4PV9A 3GSQB 5ALCH 1AC6A 1MFAL 1WBZB 3F7VB 4XPAL 3BSZH 1A6PA 3HZYB 4PJDE 4ZNEE 2MJWA 5JOPE 5DQDH 4XNXH 3MLZL 4OZGB 3UEZA 3P73B 1T3FB 3PABB 1YA5A 1CF8L 1BJ1J 5E56A 2R4SL 1A4JA 1U8QA 4LLMB 4U3CA 3FCTA 5IROA 2HFEB 2GITA 3T2NH 5EUOE 4WFFE 4XHJC 4NBYB 1G9MH 4JFDE 4DCQB 1DBKL 3TN0D 1CT8B 2HRLA 3DX6A 3MJ9H 1H5BC 4ZOBA 4M7LT 3CPLA 4RGMC 4Z7UB 2HWZL 3SKMA 3NGBB 4ODTL 5KZCD 3SDXB 3ULSB 3T0EB 1I8KA 2C4FU 3QUXD 4BUHA 2G2RA 4ZOAA 2PO6A 2NY4C 3U83A 3WDIA 4FQJH 4N5ED 4DGVH 4LPTA 3U46A 2OBGA 5I71B 3REWA 3LDBB 4R4NC 4EUPB 3N1FC 3U48A 1QA9A 4M8VA 4K3JL 1KCSH 1O0VA 3WMSA 2NY7H 4NKDA 1ETZA 4JM4L 2AVGA 4IEFB 5EWIH 1F90L 4JDTL 4U0RC 5FYKD 2AS5M 5HPMA 1FC2D 4L8DA 3BH9A 2NR6D 2O5ZL 2J12B 4HH8A 4JFHE 4PLKD 4GUPA 4BSVB 4CVZB 3MBEC 2Z35A 5E2TH 2X4UB 3KLAA 4IRZH 3PQYE 1B4RA 4NQDD 3CDCA 5AD0A 3WJJA 4NM4L 1NAKL 2BNQB 1M6OA 3U30B 3L5WA 2BVQA 4E5XA 5I1JL 4NCC1 3WFDH 1F11B 2DMKA 1A6UH 5GGTL 5SWQA 4M62H 1GPOH 2CPCA 3RHWK 3TA3D 3F6IA 4I0PB 1N64H 1FFPA 3B2UD 4L8CB 1RUKH 4MQXD 2XWBB 3B9DA 4MZ2A 1XFPA 1LE5A 3VA2C 4P23A 3NTCL 5F1NB 3BISA 4HFWA 3V6ZA 3OAUL 3O9WB 2P5EE 4EUPH 4Y1AB 4XVSH 4FQXA 4G6ML 3Q6FB 1MI5D 3RUGF 1PD6A 4ZPVB 4YDJA 4R0LA 1YQVL 5I6XB 3BESR 2AJUH 3O3BA 3L9RA 4UT9H 4RMSA 3D3VB 2BHYA 1K4DA 1V5JA 3BN3B 1CLZL 3RVVC 1T22B 2W0KA 5HVFB 5HHOB 3GJEB 4L3AA 2WUBH 4PTTA 3DI3B 5MERB 5I9QC 2ADIB 4OKDA 1KIUA 4U1LB 1FH5L 4UAOC 1MWAH 1T03H 1LE9B 1EGJL 1HNFA 4J3XA 1BPVA 4KMTH 3HUJF 1RZKL 2LTQC 5BVJB 1ZK9A 4XCCH 3GKZA 4LL9A 2XFXB 3IVKB 1T1ZA 4KI5F 4TTDC 2FEDD 2MPAH 3B83A 4WV1A 3RZCB 2VC2H 4WENB 4Y5VC 1T04B 4XCNB 3KNBB 3P4MB 2HLFD 4A2LA 3DVGA 3G6AA 3QBTB 4XPGL 2DF3A 4ONHA 2PR4L 1CZ8L 1F13A 4K94C 1I1YB 2VO5A 2VZUA 4YFDB 2DQIH 4HW6A 4E41B 4KK5D 3FT4B 1RUQL 5IF0B 2R2BA 3BP4B 4EDXB 5I18L 4L8SA 1KGCD 4Y19D 5KS9A 1AO7A 1WZ1L 2Z92B 4U6XA 4FQ2L 4H1LH 4NC1C 5E5MB 3THML 5AZEL 4LEXH 1E6JH 1MJUL 2AXJA 5I17A 5F88A 1F8TH 1J0HA 5KANI 3T77B 2ZUTA 2GK2A 2BSTB 1A6TB 2MKLC 4R2GD 3RZCA 1B88A 1R3IL 2Z31A 5E6IA 3HI1A 5CEZE 3DYOA 3MRDB 1GZPA 4X98B 1S7XB 1AIFA 1LO3L 1WITA 3PV7A 1TJHL 4PGCB 43C9A 5JHLL 3O6KH 5GSVA 5SWZE 1OW0C 1BBJB 4OI9A 3UXFA 4M1GH 4JQVC 1NANH 2AGJH 3IDXL 4OZ4A 3GHBH 1FYTA 2EIEA 3UDWC 5BV7B 2AEQH 4LSVL 2FX7H 5B3JE 5HGHA 1OL0A 2V2WB 3F7QA 1YEHH 4D94A 5TPWL 5KAQF 3HAEA 4XHJD 1IJ9A 1INEL 3CSPA 3WIHL 3TYFA 1R24A 1A6VL 4U05A 3KPNB 5HVWA 2P5WE 1FIGL 2BSTA 4ZFZA 4YHYC 4WFHE 4OKVB 4JZNA 1ZHNA 1YDPB 3HZMA 4HXBH 4JQIH 1F4WL 1MCWM 2HT3C 3LQZA 5KSAC 4XVUC 4YHML 1M71A 1S7XA 3K81A 2CLZB 4WWKA 1ADQH 5IEKA 5MERA 4D0CA 5EOCJ 5DRNB 4HHAB 3FOLB 3S37L 3TBSA 2VERN 3VXMD 2H3NB 1C5BH 4XPTH 4OV6F 3EO1A 1DQLL 4QCIA 2Y25A 3EJZD 5I1GL 3SDCC 3QXWA 4LSUH 4ZTOH 4Z8FH 2FD6H 5DF0A 2FB4H 1WBYB 3ULUF 4RBPH 5TDNA 5HGAB 2ITCA 4GRWH 4N8VA 5LG1A 1TNMA 4AEHH 4GRLC 3G5XB 4JFDA 4NPYB 5L9DH 5LCVH 1BD2A 4X99A 2Q6WA 1I7ZB 4WO4A 3AREA 3WXVL 2C1OA 4LSSL 4YNYA 3BUYB 3N06B 1T5XB 5MHSE 5BMFH 3RZWA 4YE4L 4X0KA 4BQCA 1T2JA 4AENB 4PBXA 1P2CB 2V5RA 5I19L 4KZEH 2G5BA 3OKOA 3R0MA 43CAB 2VE6B 5GS1B 3ARXA 3OB0H 4NKOB 5IQ7L 4P4KD 3LS4H 4PRHA 3IU3A 3DV6A 3WDJA 1WBYA 5E6ZA 2EE2A 4X8JA 3B2VL 3FN0L 4M8QB 2AABH 2BCKA 4GRLD 2NXYD 4PTUB 2O5XH 4HV8A 1J8HA 4H5SB 1SM3L 1IM9B 1Q9OA 4HEPG 3NCJL 2EE6A 3QQ9D 1S78C 2P8MA 4AMKL 4HFUH 4Y5XB 5F8QC 4QHNB 5E8OA 4PR5A 1I7TB 3RWGA 1JNHA 1Z9MA 4R3SB 1CVSC 4MAUL 2UWEF 1HIML 1T5XA 4XZUA 1BQHG 3MGOB 2WINA 3JV4B 4X7DC 3O45B 4NQUA 2WIIA 3H9YA 3BE1H 1TETL 3G04B 3T4AB 2GEEA 4YWGL 3RQ3A 1BVZA 2EYTB 3V5DA 5BJTA 2FBJH 5JQ6H 4RGNC 4ALAH 2YD3A 4D9LH 1A3LL 1I4FB 4CGTA 5E99L 5J8OA 1BWMA 1EHLL 3G08B 1QFWI 3MLPA 3NIDE 2ZUQB 2J7LA 1CLOL 2HLAB 1T6WA 3IJHB 4KKCD 5SV3A 3IAQA 3KWWB 5D6DC 4BSWA 1JHKH 2CLZA 2XZCH 2BNRE 2B4CC 1C5CL 3FCTB 4P2OB 5DGQA 3VFUA 2F53E 3TA3C 1CDYA 2H3NA 5CJQH 1I7TA 4JM2A 3MGTB 2CJUL 2ZUYA 5K59E 2FL5A 5TH2A 3HE7B 2F58H 5IB4A 3GMQA 3RIFK 1RZIB 4KRPD 3EW3B 4Z7UA 5H37G 3MRCB 3GUTB 5LVEA 4Y19B 3ZDXE 1NAMH 1PKQA 2G5RA 4PJ5A 3VFNA 3D85D 5F1KC 4W6YB 2PNDA 4PJ5E 3FB6B 2H9GB 2HAZA 2R2EB 1YJDC 4ODWA 3HC0B 3DGGB 2OJZL 3PV6A 3VRIA 6FABH 3V6OE 1JPTL 1XGUA 4OM1H 3HS0A 5BZDB 1MY7A 3DXAA 1IAKB 1NGXB 4Y2DC 1QBML 4K7PX 5HGDA 3WJLC 1GGYA 3WFBL 1YPZB 2ZUUA 4JKKA 1LHZA 4U1SB 2EKSB 4M6NH 2WBJD 3EO0A 1P1ZB 3MLUH 3MLYL 1YYLL 3FQTB 1E4KA 2VDMH 4JFEB 4DTGH 4GOSA 1B0RB 2XG4A 1C8PA 4L8DB 1FGNH 1QBLL 2DQJL 4RFEB 3Q5YA 5ELIA 4PPTA 3I6LD 4LSQL 3VRLF 4FABH 4XC1H 2WBWB 3C5ZD 1M7IA 5LAXB 1DQML 3PWJA 2JJUA 1XCQA 1I8LA 1A47A 1XH3B 4MQTB 4PYGA 2H9GA 4OZIE 5J7CC 4Z0BL 4XNZC 5IVZA 4HT1H 4LCWE 2IAMA 4YHLH 4D0DA 2VL4A 2DTML 4Z77A 4Y5XA 5KS9E 3GJFK 4PRBA 1A5FH 1G9NH 4LRIC 1IKFL 1TZGL 4ORGA 1T7XA 3PQYD 3GSNL 4LCCB 3BZFB 4F7CA 4HIHA 4Y1AA 1G9NC 3BKJH 3BGAA 2FIKA 3VW3H 5I8OL 1J0YA 4PJHA 1P7HL 2FH6A 3TPUA 1HE7A 3L9RB 4OCRL 1J0JA 2EEDA 4JHWH 5HTSA 2VLJD 1JZ7A 1NLBL 1C16A 1IQWL 2IG2L 3ES6A 3WSQH 2B2XL 4P2YA 1XH3A 1MRCH 5HDQH 3I6KA 1EFQA 3TZVC 2GJZB 3QIUB 3QFJE 1LILA 5KSVB 5JA9A 1Z0NA 5IJKC 3BKML 3QUZD 1EEYB 1CFVL 1F3JA 5ISZB 1FVEB 1P7QD 3KXFA 4JRWA 3P4OB 1X4XA 2XN9A 3GSUA 3QDGB 4U1MA 4U33A 5GS2D 4WI3A 5DJZA 2WNGA 4LPVA 1NC2B 4OD2A 4KQ3H 5FOBB 3RP1A 4KKAD 3B5TA 4XI5D 5DA4A 5FUOH 3RWFA 4PJIF 5I75B 4NWUH 3QP3A 4HIXH 1ZHLA 3BP6A 4U1NB 4P2QD 3H7LA 3ZHKA 3DPBA 2JB6B 3NIGF 2EDEA 1YJDH 3BAEL 3DX7B 4ONOA 4XVJL 1OAQL 3BH8B 2B4CL 4NBZB 1FDLH 1S9KC 1LE9A 4L4TD 2VQ1A 5IUSA 3GKWH 4Y4FB 1YZZA 4KQ4H 4DW2L 3M1BB 3U0WL 1WLHA 1X5IA 1DUZB 3TT1L 1F97A 3MUZ1 1SY6L 4X5LA 4UT6H 1A4KB 4WV1B 5EN2A 4NRZA 4PJ9C 3X12B 1LD9B 1HQ4B 3G6JE 1DDHA 3KPSD 1U0QA 2BERA 2X7LB 1A7PL 4TTGA 1CIDA 3DETC 2QSQA 3OAYK 4WUKL 2E9BA 5FKPB 1AGFB 1LVEA 4H88H 3FB7B 4M02A 2NX5A 1XEDA 4LCYB 3WUWG 4JANB 4WI2A 4MS8C 4XP6H 3FT2A 5GHWH 2WLYA 4N8VG 2DKSA 1QFWH 1L4IA 3A6OA 4OGAD 1ZA3A 5HGHB 3WIFA 1IGJA 3QPXL 3JVGA 3SE4C 1IZKA 3MXVH 2Q87A 1XGPA 2PTTB 3I3EA 1V3LA 3ZDZF 2VZTA 5L2KB 1NSNH 2Y7QA 4YHIB 1LD9A 4LLDB 1HOCA 5EORL 1W0WA 3F6LA 1ZHNB 3PXHA 1OSPH 3GSOB 5A16B 3ARGD 2OCFD 3FOMA 3QCUH 5GRVK 4PJ9B 1TVHA 4XC3H 4WW1A 2PO6D 1YEIL 1VADA 3S37X 3V6BR 4C56E 1FL6A 4ISVA 3L3HA 3ZTNH 1GGUA 1MLBA 2EO1A 3S5LG 5D1QD 4X6BB 3J8F7 4R7DA 4LDLB 3V2AR 1MREH 4OCLC 1DANU 5C2BL 2V2WA 2DLFL 3Q1SH 3WDHA 4U1MB 5FYLD 3CVHA 3UO1L 1FFNB 2YXFA 2XACC 1DVFA 1JNNL 3LQAH 3IAGC 4HQQH 2OQJA 2XA3A 3BPLB 4PJBE 1NBZA 2VDOH 1GZPB 3ULVD 3MOAL 2APFA 1SMAA 1C12B 2NW3B 5GPRA 1HILA 2FEDC 1BVKB 4N8CL 1CXIA 2OR8A 5IMOB 1RUAL 2CLRA 1J8HD 2DM7A 3KR3L 4HPYL 5DEZA 2UZYB 3ARZA 3GRWA 4TVPH 3BDYL 5DEFB 3SJVE 4R7DB 1Z9OA 3OKOB 3MRIA 2NZ9C 3NFPB 4QYOA 2IPUK 5DWUH 4YBLC 3QWOA 5CD5C 3F7RA 4ZFZB 4MVBD 3TO4D 2YKLH 4DUWA 3EBAA 4RZCA 4MDIB 1P6FA 5F96H 4ZXBA 4PBWD 5JW3L 1EJOH 4F9PC 2NW3A 1RZ8A 4I77H 3ETBF 2BVOA 4RNRA 4M5YH 1QFUH 32C2B 2GCYB 2D03H 1JWUA 2NW2A 1U9KA 3RKDC 1HWGB 3LB6D 4AIZA 2YC1A 4G9DA 4DKEL 5IW1A 3QZWG 3ZKSD 3RI5K 3JV4A 3IS0X 4KMQA 4ORZC 3OKDA 1ZA6B 3K2UL 3QEUB 1QSEA 5ITBH 3ZE2E 1DQQB 5DD0L 4QYOB 3TNNA 3G5VB 4ODVL 1WC7B 1UFUA 3S4SA 1NCCL 4P99A 2DJUA 1WCBB 2IBZX 4HV8B 3GSOA 5A16A 2AJSL 1SJHA 4KV5F 4LSTL 5I71C 3BPNB 3CFDB 1DQDL 1EPFA 4J7RA 2Q8BH 1KPRB 4HBCL 3GIVA 5E8OB 1TVHB 4QRQA 2E9JA 5J1SC 4MQ7A 2MQCA 3I3DA 3LMJH 1WWWX 3L3HB 2BVPA 3O8XA 3DI2B 3STLA 3PHQA 4HJ0D 4L4JA 5EIQA 2WBJA 4WI4A 4X6CF 4IRSA 3O6FB 4JG0L 1U8PA 2ED7A 4Y19A 1PYWA 3SGEH 3NN8B 1HH6B 1JPGA 4APQC 2FSEB 4B7IA 1DVFB 3L3IB 3RL1A 5J3HC 2KZWA 4HKZA 4N90D 3VA6A 3WL9B 1F58H 5HBBA 1AHWC 5BRZD 4JPWH 2YD4A 5L2KD 3P4LA 1SJHB 4N5UA 5DT1L 4U1SA 1AE6L 4Q6YA 5DUPH 1ETZB 3HZVA 3SY0B 1SVCP 2M8XA 1I9IH 1QOKA 4DGIH 4XB7A 5HI3D 2VDPH 3QUZC 2V17L 3L6FA 2P4AB 1BIIB 3WLBA 4GSDL 2X4UA 3GM8A 1SBSL 2AJZB 4NQTA 3T8XA 3T2NL 3CFIC 4KK9D 5JXED 4JZJB 5JLZB 4UIMB 3MV7B 1FNSL 2HWZH 5CCKL 1VA9A 4WUUE 4GMTH 4JN2A 3OB0K 5HGDB 3CXHK 5IMMB 3KAAA 4CRPA 2I07A 2AK4B 3ABZA 4LF3B 2VABA 3CU7A 2JIXB 1IT9L 3MGTA 2EKJA 3LDBC 4ORGB 1DBAL 1FLTX 2MWCA 5K9OB 1AR2A 3Q6FA 2A77L 5HHVH 4LCIH 1RMFL 3HTLX 5E2UH 4ELKB 4GXVL 1NCTA 3CNKA 4NRXA 3KPMA 3O3BB 2MQ3A 3SEPA 1QSEB 1LGVA 5ILTH 1GGCL 1XGYL 1WIUA 1QSVA 1TTGA 3W5NA 2WSKA 4Y2OA 4JG1L 4ODUA 4FG6D 5FGCE 1N4XL 4HWNA 5BZDA 5E70A 5I2IB 2YXMA 1TNNA 4PLOB 3VGHA 3ZDYE 4PG9A 2E3VA 4OQ1A 1E28B 4R97B 1NKRA 2NY5L 5H94B 4Z77B 2CXKA 3GIVB 1MAML 2HKFH 3KPQB 1JYWA 3S36L 1T1ZB 1MHHA 1GZQA 4O2EB 2JCCA 4OT1H 5GGTH 2UV3A 1FVDB 4HUVA 1MIEH 3H3BC 4O02L 5CGMA 5E8EA 3O6FA 3WS6C 5FOBA 3PGCB 4O2FA 4U1JB 4Y19E 2D31B 2ITDA 4PJ7B 3L95B 3PNWA 3BP6B 4MD4B 1JHLH 4XBEH 3LOWA 4Y4FC 3NZHL 2UUDH 2E27H 3QUYD 4YFLF 1MJ7L 4C58B 3OZ9H 5J12B 1S7SB 1YEDA 1NGQL 3E6HB 3I2CH 5KSBF 2YK1H 4P5TC 4HWBA 4LVOC 3C5SB 5CJBA 5C07D 4CVWA 3S35L 2HYMA 4XNQB 2X4SB 3OX8B 3GSUB 5J06A 1KLUB 3GBNL 3BQUC 5IQ9A 3TYGH 4NC1E 1VEMA 3EO9L 1LNUB 4WI8A 1WZMA 3F58H 3FZUD 1AFVL 4HAGA 1CCZA 5I1AB 1KCRH 4Y88A 1SJVA 3SGDH 1DBKH 2GHWB 3ES6B 1TFHA 5F7EL 3L95A 2HJKB 1A7NH 1QD0A 3L3GA 4XPHL 5DTFB 1U8LA 3U46B 3VD9A 5IHZA 2EICA 4TNVF 4XPGH 1FO0B 4GQ9H 1DN2A 4NIKB 4D3CL 3V95A 5IB5B 5BV7C 4CVUA 2IADB 4V1DA 3HE7C 1T89C 3TO2A 4KMLB 4NKDB 4EEEA 2G75B 3DV4A 3JBG7 1T21A 3VRJB 5EN2B 4IOFD 5HYSG 3MLWL 4LLWA 3SE4A 5AZEH 1U8KA 1GOFA 3UTSE 5LXGH 4IBLT 4RIRB 4IMLA 4PJGB 1M71B 5I1AA 5ID0B 4NT6B 5DD5L 2IWGA 3D9AH 3D3VE 1A22B 4RMVA 1ACZA 1YEEH 3BH8A 1MRDH 1QNZL 5KJRL 3UC0L 3QQ3B 4U0RB 3SCMD 5I2IA 1IFHH 4M7JH 1MHEB 3MNZB 1AKJA 1NMAH 4NQSA 3P11H 1FFPB 3RIAF 4I2XB 2P5EB 4EBQH 2ZKHL 3GNMH 5HD8D 2AW2A 1JYVA 5GS0D 3BOVA 5TQ2L 2G75A 1R3LB 3DV4B 3LKQA 4Y5XC 1N5YL 2VN7A 1UACL 2CIKA 1MCEA 3IFNL 4HWEL 5T3ZE 1VEPA 5J4MA 4PJEB 2ICWA 4YGVB 3LKSA 3SDCA 1BVKA 5KVDL 2A6JA 4JE4B 2AQ3A 4GAYA 3V52L 1UJTA 5ICXA 2EZ0C 4X0KB 4FQ1H 3DIFA 5HPOA 5IP4A 2BY0A 2XTLA 4JQIL 3LY6A 1GAFH 3C5SA 4X6CA 5E00A 4TNVK 2X4PA 4H26B 4YHMH 1V7MH 2VLLA 2YD6A 3I50L 3IU3B 3WKML 3VFTB 4JHZA 4JKMA 1MSPA 1HKFA 2YUWA 1HINL 2D9QB 4NO3B 4M8QA 1UWXH 1G0YR 1T04A 1DQLH 4KTYA 1OARH 2JTDA 3QZWB 5HY9A 1I1YA 1OTUD 5JIIA 1OOAA 5JORA 2CLRB 2NTSP 4ZNEA 5E2VL 2IQAB 5F89B 4RNRB 1I3VA 5EZOH 3OAYH 2I5YL 1CFSA 3SN6N 4PGDB 4S2SA 3W82A 3VXOB 2I60L 4AEHL 2X6MA 4R0LC 4LLVA 3ILQD 4FP8L 1S7QB 3GHEH 4I3RL 3RU8H 1OQXA 5T1MA 1A02N 4PJFE 3MMEB 5T1KB 3G08A 4IDJH 4HIJA 4PRIA 2QQQA 4OLVL 2E9WA 4KUZH 4JPVL 4BH7B 3CFDA 3IFLH 4P2OA 5DS8B 1KTLB 4ZO9A 4MA7L 4WW2C 2QHRL 5DZLA 4BQ6A 2C1PA 3RGVD 1IBGL 3DO7B 1D7FA 3KYOB 2DIJA 2F9BT 4XPFH 3ARDC 4OFDA 1YNLH 2BSED 3GEWB 4FQXC 4HG4J 4OGXH 3B9VA 3BEWA 4L4TA 4W81A 2XNAB 4M1GL 5HI4D 2JKXA 3BDBA 5J9PA 4TSAH 2A74B 4F15B 5D93B 1WWCA 4L8SC 3MRBB 3OAZH 2PETA 4PJEA 3C60A 4X8XA 3BUTA 3HB3C 2YPLD 4NOFA 2GAZA 3VWKB 5ESAB 4Q74A 2NNAB 3E6FB 1WUNT 2WAHA 3SY0A 3U7WH 2AV7A 5DD6A 3FT3B 4N0YL 1A1MB 3WBDA 5IBUG 1TQCC 2CRYA 2H2SC 3E8UL 1VFBA 1RUPH 2OP4L 3IDUA 3U36A 1KTRL 4WU7B 5C0GA 3FB5B 1IAIM 4QXUH 2DI7A 2E5EA 5JLZA 3IF1B 3IU4L 3PWLB 1HHHA 2UZXB 3OR7B 3AU1A 4XP1H 2IAMB 3O4OB 3P0VL 5C0BE 2DI9A 2NY2D 1MY5A 5DJCA 4CKVX 4HC1H 1B0GA 4O58L 4WO4B 1XIWB 5D1XD 4D9QE 4GW4A 2I9TA 3HZVB 4MNQE 1HHJB 3CFBB 5L8JB 4JKPL 2DLIA 4FS0A 4PJEE 5DD6B 4LHUA 1UVQA 5DRXA 3T4YA 5FYKL 1QBMH 2F74B 3OR6B 1LEKA 5KSAA 3Q0HA 2BNQD 4GBXB 3QFJB 2CO6B 3K1KC 3MV9D 4PP1D 3FO9B 3OSKA 2HTLD 5E1HB 1QKZH 4MHHI 3VG9B 1QYGL 2GJZA 3QIUA 5CILH 4WHCA 5C0AA 3QULB 3UTOA 1B90A 3SDYH 2JELL 3BIKB 5IT2L 3F7YA 5EBMA 4EI6A 2V6HA 1E6JL 2BXZA 3O11A 4Q2ZB 4JR9L 2YZ8A 1NFIB 3EYFB 4HUNB 1RZGB 4JO1H 5E1AB 5D2LA 3VH8A 2YUVA 3P9WB 1M05B 3O45A 3RDTD 2VKXA 1G7HB 3UJJH 2X89D 5CSGA 4HFUL 4P5TB 4PP1C 1JTPA 1HH9B 1S9YB 3TZVD 4JZJA 1XR9A 4Z7UE 3HLAB 1Y6KR 1N2RB 1MHPL 3WFDL 3T2OA 3U30C 2X4QA 3FO9A 1DEDA 4M62L 3MLSL 3WIIH 1EMTH 4G6KL 1IL1A 3QHFL 4MNQD 4K3HA 2PYFB 5H94A 2LAAA 2HKHL 3BHBB 3FRPA 2NYYC 3NFSL 3HMWH 1NLBH 3VXQB 1A3LH 5I1EL 5GS0L 1P53A 4Q2ZA 1T4KA 2JCCB 3RVWD 3LPFA 8CGTA 1A0QL 1DDHB 2EXYD 4HCRH 1AQDA 3MRPB 3P9MA 2ZCHL 3GI8H 4ZOEA 2CR6A 2Z35B 3EOBA 1KPVA 2OS7A 2P5WD 3FAWA 4F37F 1CIUA 5C0GB 1U8NB 5F3HB 2AV1A 5KOVC 3TVMD 5DMKB 4Y16C 2EO9A 3FB7A 4P2CG 3HC0A 1G7LA 4NKIL 3W0WE 1F4YL 1EIBA 1WTLA 2CGRH 1U8LB 1RQ5A 3HS0B 1JGEB 2VR5A 5D5ME 4P49A 1T0PB 2Y5TB 4XRCA 5D70H 1JGDA 2M1KA 2ICWJ 4FZ8H 5ECJE 4NC2B 4ZODA 5JW4Q 3BAEH 4WNQB 4KROD 1SEBB 1UVQB 5EZIL 2FEEL 5DJ2A 2YD1A 3HG1E 4UINL 1KB5A 4D2NA 3OR6A 2Q8AH 3ALWA 3GMLB 1K4DB 4R96A 4RIRA 1S7TB 1M7IB 4Y16D 3QHZH 3VXRD 4X4ME 4ELMB 4JRYD 4MX7A 5IFAH 2QADC 1J05B 4QGTA 1E4WL 5EBLA 3KXFE 4WW1B 2VXSL 2D2OA 3K1DA 4U1HB 3FRUB 4PYHA 2WUCL 3WNKA 5BMFL 3O3DA 5F9JA 4OLZH 2XIDA 1NPUA 1FCCA 5I18H 5C0AB 4L8BA 3IDJB 3O6LL 5HYFA 5IB5A 2ED9A 3S97C 4WU5A 5A1AA 3O2WH 2APTA 4LSRL 3CIQA 2X9YA 4PJXB 12E8L 5E94B 1NCAL 5IQ7H 3ARGC 3E3QC 4NOBA 4S1DD 3QXAB 3O9WD 3WE6B 4PY7B 1SEBA 1JRHH 3QIBB 3OKNB 5C09E 5IVNA 2DTMH 3QA3B 4UQ2A 3LV3B 2YRLA 2LVCA 1GC1L 5GJSH 1BFOB 4F8TA 1KEGH 4GG8A 4OLYL 5F3BB 4HS6A 1HDMA 2WBKA 3IXAA 1K6QL 3NCMA 5I8CB 1D5XB 2PCPA 2HJKA 3ARBC 5DTFA 2VDRL 4ENED 2R2BB 4S1SH 3MV8A 2ZSWB 4E41D 2WANA 5D5MA 4YAQA 3PHOB 5FO9A 2PYFA 4A6YA 4Q9RH 2XZAH 3SDAB 5I17B 2DLHA 1ZGLM 3MV7E 3MQIA 4GRWB 3QIBC 1K85A 1CFTB 5JQ6L 3QJHB 4UB0L 3GSWB 3CXHJ 5F1SA 4ZOCA 3D39A 4JJ5B 3BKMH 4HIIA 2F5AH 1J12A 1CL7H 4X98A 1YUHB 2ICWB 2K3TA 1AXTH 5EIVA 3DRQA 3MRHA 3SPVA 1FNHA 1G6RA 5FYJL 4DOHB 3LIZH 1MHEA 2W38A 4BK5A 3RWDB 1PFCA 1C5BL 5I8KL 2D0HA 4PFEA 1OLLA 1CU4H 4X7TB 2AJ3A 4IHOB 1NDMA 3OKDB 4FNLL 3SDAA 1NBQA 3LAFA 4M1CD 1N6QL 1ZANH 4YO0B 2ENYA 3DHJA 4MXVF 2NY1B 3OJ2C 1PKQE 5AAWA 2RFXA 3EOTL 4HUXA 4Y4KB 4R2GB 2P7TB 1S9WB 1I3GH 5E5RB 4GS7B 5TF1H 3T0XA 4ELME 4CN4A 3HFML 4M7LH 1MH5A 3ZDXF 1M1SA 4G6FB 2VXVH 3ZDZE 2GJ6B 4TNWF 1AQKL 1FN4B 2ZUWA 4LSSH 3MV8E 3ROLB 1EZVY 3DIFB 1UM6L 3L1OL 5MEPB 1IGFL 3MLYH 4EIGB 4NQCB 3JXAA 4QO1A 2CKBH 2BY1A 4LLVB 1EJOL 5IHLB 5I76A 1PYWB 3ULVH 4I77L 4YC2B 4P5MA 2DBJA 4MJ2A 2XWJA 3BO8B 4M5YL 3NIDF 3N85H 5T1MB 3CFCH 3ARRA 5GRUL 4NO3A 3TESA 3HNSH 2NMSA 2PTTA 4XP6L 5TDNB 5HGAA 5FM5M 2VUYA 1HEZA 2A2QT 4LEOB 5F9AC 3QZWA 2FWOA 5F3BA 5AYUL 2RQ8A 3QPXH 1BD2B 2Q6WB 5I74C 4ZFGL 4AMKH 1G7QB 5BRZB 5DRWB 1MHCA 1R3KA 4YPGA 3VFSA 2OL3A 2ATPA 1K4CB 1UCBH 4PGDA 3V8CA 4YBQC 1H15A 5DC0A 2DYPA 3O4LD 3WLBB 1S7QA 5I8OH 3L3DA 1JPSL 1YMHA 1VFBB 2DIAA 3BQUB 3VCLB 3U36B 5D7JC 3VGEA 1U6AL 5CZXC 3BRDA 1EHLH 2CKBB 4JVUA 3MNWA 4PREB 1MREL 3IJSA 5F7NC 1DSFL 2DLFH 3FONA 1NFDE 3ARED 4M61B 4AT6B 4QXTB 3OHXA 4I1NB 1LEGB 2QHLA 1C5CH 3RNQA 5FEBA 4NUGL 1N5AA 4HWZB 3KYOA 3SGEI 1AO7D 3UJIH 3FQRA 1KCKA 1CDHA 5C0AD 2HJLA 4ZNCD 1F58L 4KQ3L 4OTXH 5C0RL 1NAML 4L4TB 1XCTB 5IESH 4UU9A 3MBXH 2XNAA 3DYPA 4L4TE 3QWRD 2R56L 1OP5H 1TZIB 5E6ID 3HI6H 1CDIA 2VXTL 2YBRB 1A9BB 4Q7DA 2Q1EA 3RDTA 4TVSa 2FNBA 5EUOB 2ID5A 4LLAA 3TO4B 4ZXBB 4FTVE 4AIOA 1CR9H 2YEZA 4BSWB 1JNJA 3FQWB 3BIKA 3BD5A 1EFXA 3LH2L 3UYOD 4R7NA 1MFCH 3Q5OA 2IH3A 3I02A 3QXUA 4PRPA 4OZGE 4E42A 1BF2A 2V9TA 4BZ1L 3EYFA 3MXWL 4IM8A 4PJ8C 1U8IA 2BVEA 3JWOH 4B7LA 5CCKH 1FQ9C 2XTJE 2ESVD 4F80A 3VI4E 4UI2A 4UT7L 1ZA6A 5I15H 4XC1L 1LEKB 3AVEA 1FPTH 5ITFA 2ZCKH 4DN3L 5ADPL 1DQQA 2IBGA 4PS4H 1QRND 1TZIA 4GXVH 2OLDA 3JV6B 3IETA 4HT1L 4EXPX 1NGXA 1F4XH 4LPUA 1KJMB 4WFHD 3CX5K 4HEME 3IDYB 4U7KA 4G7VH 5C0AE 5B3JF 4NHUB 3FQXA 4FHBD 2DQUL 4U6HB 3QCVL 5DD0H 4JG1H 3S6CA 3DRTA 4MA3A 4JFXB 1T80A 5IQ9B 3OAZK 1CDBA 1H15B 5JR1L 4XP5L 1I1AC 1P4BH 1AY1L 1DQDH 5H2BA 1DVFC 2AAVA 1PLGL 4CL7A 4S0SD 5DUMH 1JF5A 4OLUH 5JZ7C 3EFFB 3MRRA 4Z7UF 3ROOA 2Q76A 3D2UA 4P5TD 3C5ZB 1ZEAH 4JVWA 1IQWH 4IJ3C 4RWYH 5FA4B 3AB0C 3RL1B 3HCVA 1JGUL 5I1DA 2M2DA 4XT1C 5TE4L 3AAZB 1G1YA 3EDJA 2VYRE 4Y16A 4JFFD 3U6RA 3F7YB 4Z95H 1CTOA 1QFOA 5FIEA 1PZ5B 4G8GA 3WKNA 3FQRB 3GSVA 2E27L 5J11B 1KENH 3RJDA 3ULUH 4WTZA 1WZKA 1A6AA 5ADOH 1T2XA 3QO1A 1JHTA 3JWDH 4OCSH 3WIHA 3VDBA 2WW8A 3O2DH 1AGCA 1JK8A 3L5IA 1VPOL 4GRLA 4JHAH 3NBNA 5BS0D 4PIRF 4I9WD 1CS6A 4WHTB 3TT3L 3T2PA 5FA3A 2B0SL 4YHNA 3MNZA 5F70A 3PIQB 4ZSOA 5FHBL 4LLQA 2OTUA 3HA0A 3V5KA 3K8LA 3MJ7B 2YN5A 3FO1A 3VGGA 1RURL 2UWEE 3ORJA 4GAJL 2EDNA 25C8L 1XGTA 2A9NH 2Y72A 2QJDA 4PG2A 4U49A 1A7NL 5K9OA 7FABH 5FCUH 3LKNB 4OCYH 5EO9B 3P30H 3PWPE 3GMNA 4PJFB 1EAPA 2VLJA 3RHWF 3CSBA 2AV1B 4PB9H 1IC1A 3M07A 1J1XH 1Q38A 4CBPA 3VFOA 3D0LA 4WHTA 3QIBD 2AQ1A 3LN4A 3N9GL 2SEBB 5FECA 1GGCH 1XGYH 4JZOB 4I0KA 3H6JA 3TN0C 4IRJB 4M4RA 3O3EB 1FZOB 1R5WA 3LD8B 1KTKE 2AXGB 4WU5B 4YHKL 3F65A 4M6ML 4P5KB 2P46B 2R0LL 4NYLA 3C09C 5DFWH 2QSCH 1MCIA 3QDME 2B5IB 2H32A 4PJ5D 4BA8A 4ODVH 3NPSB 3SDAD 1QVOB 4KVNH 4R96B 3A67L 3PGCA 1OSPL 4U6TA 4CU6A 2GI7A 4KGLA 1B3JA 2YRPA 5GZNC 4HJGB 3DGCR 4O02H 4LNRA 3WD5L 3MV9A 4X83A 5D72H 4K8RD 4X5WB 1BQSA 4FQLH 4PJBF 4LARL 1GHFL 3V4VL 3LHPH 4XBEL 1KYOK 1AD9B 1YYML 5GXBB 5DMGC 4C4KO 3RVXD 3I6LE 4NZJA 3QXAA 1CFQA 4TVPE 3MMEA 1OTSC 4IMKC 1TXKA 4JDZB 1A6AB 3QYCA 3RGVB 3TNMB 5T1KD 1FSKB 4HIJB 3CUPB 1ZTXH 3AS1A 3HNVL 1U95A 4KROC 3DROB 4FXLA 2JJSC 2X89A 1S9XA 1G6RB 3BGFB 1KB9K 2X4OA 1ZT7A 5DJ0A 1OARL 1IKNA 3QUYC 4OFIA 4V2CB 3ZYZA 5KBNC 1A6ZB 3L5XH 3SDDA 3SE8H