5FV1L

Crystal structure of hvegf in complex with vk domain antibody
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel Interaction Mechanism of a Domain Antibody Based Inhibitor of Human Vascular Endothelial Growth Factor with Greater Potency Than Ranibizumab and Bevacizumab and Improved Capacity Over Aflibercept.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords VK DOMAIN ANTIBODY
total genus 23
structure length 108
sequence length 108
chains with identical sequence M
ec nomenclature
pdb deposition date 2016-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fv1L00
3REWB 4FFWD 5DJDA 5T5FL 1C8PA 1F11B 3VJ6B 1ZLVH 3D18B 2VOTA 3O3DB 2GW5A 4OZFG 4Y4HD 3WN5A 2YR3A 1VFBA 4LKXB 1JIBA 3QCVH 2A9NH 4LRNL 3FB5A 3L5HA 1BLNA 3VRIA 1UB6B 3HUJF 5K9OA 3T3PF 3TBYA 5FOJA 4P5TD 3V4UH 3VXUD 5GGTH 3ZE1F 5D2NC 5BCAA 4S1RH 2X70B 3O4LE 2JCCE 3SDYL 5LWYH 1RUKH 4UV4H 5MENE 1J5OL 4OCWL 5ECJE 3INUL 3VFVB 4J1UA 1IGTB 4LVNC 5DJ0A 1X5IA 1F90L 1BX2B 5F6IB 1MCBA 4AJ0A 2EEBA 4GAJH 4ZQKB 4F3FB 1J12A 1S9WB 3ARFA 4NBZB 1NDMB 3UBXA 2CIIA 3MV8A 5JO5A 2P5EE 4LF3A 5FK9A 4JPVH 3MRIA 3NFPB 3LKRB 3HZKB 3C5ZC 2WUCL 1JYNA 2K1MA 1JGDB 1EXUA 1T7WA 5EU4A 4TVPH 1I1RA 4ZXBC 5T1KB 3V8OA 1BQSA 2ED9A 5CCKL 1N0LA 5ICXA 3KPRE 1U8NB 3CC5A 4O9HL 1XIWA 4KKAC 1R24B 4BFBD 4YZFE 5IFAH 3EOAA 5DRXA 3FQRB 4GSDH 5ICYB 5IB2A 3W2DL 4XX1E 1ITCA 5ANME 3WNNA 3W9DA 4A6YA 2Y25A 1U36A 1AI1H 5IG7B 1UM4H 1ZVHA 1I9RH 4XCFL 2L0DA 5C0EB 2NX5A 3IS1X 1RFDL 3B6SB 5K59F 3BKCH 2KL6A 4LCWB 4PB0H 5J6HB 3C5SB 5J3HD 3CZJA 5DA0B 4NQDE 4UDTA 3RI5K 3DVIA 3FQNB 2V17H 3V52L 1MY7A 3K81A 2L7JA 5DJ2A 5KS9B 5BXFA 4L5FL 4FZ8L 4MNQD 4JVPA 1VEOA 1CXIA 1F3JB 1I9RL 3JV6A 5GGRY 5ISZE 5JMRA 2FR4A 4I3SH 5ALBL 3J8F7 4BZ1L 3SO3C 3I6LE 3V0WL 3GGWB 3AM8C 3L3DA 2LABA 4N90D 3H9SB 4XI5D 4NP4L 5BV7L 1GZQB 3FT3A 1MCWM 3VI4F 1PX4A 4HG4K 4YHNB 2XN9D 3B8SA 2NY7H 1HILB 2X5PA 5HHME 1AXSB 2NZ9D 4H88L 5SWQA 5I8KH 3QUXD 2HA1A 5JNYA 5KVDL 1IM3A 2APTA 5H35A 5D6DC 5AUMB 2XWBA 3TWCH 4Y5YC 3FN0L 2KDGA 5DEFA 3TN0D 1A6ZB 5SWSA 3DYMA 4LQFH 4LRIA 3CFJA 1SYSA 2XZQH 4P5MB 4KPHH 4GRWB 4X83A 2DQUH 1S7TA 3HZVA 4OZGF 4X7CC 4QHUA 3OPZH 5IMOA 2ZUQC 2VWEE 2EEAA 3OJVC 1G9ML 4DFHA 5DD5H 4P49A 4TRPL 5DFWH 1IILE 2OBGA 1MLBB 1NDMA 3EO1A 3NIDE 3MODH 4XI5C 3OZ9L 5D2LB 1AKJA 3S4SG 3MRJA 4NOBA 2BC4B 5DT1L 2EXWC 2JK5A 2ATPB 3HI5L 4GRWH 1I4FA 1DBML 3DO3A 4AK1A 3RWEB 1H3XA 3CXDL 1CTNA 1H15B 2XWTA 1N7MH 4JZNB 4G6KL 5K9OB 2HG5A 1KCUL 3O8XA 4IS6B 5SWZE 2OJZH 3P4OA 5ISZD 4XMPH 1EPFA 5F1KC 5C0JA 4P4KC 5ID1B 3PV6B 3QG7H 1GGCH 4GMTL 4KVNL 4JDTL 2AK4B 5EBGA 2F8XC 2CK2A 3EJYD 3RWGB 4D0DB 2QSCH 5FECB 1A7BA 3B5HA 1L7IL 1RUMH 2BSED 5B22A 1AE6L 4PGEA 1A6VL 4RGNB 4PRPA 1Q1JH 2Z8VC 3BHBA 3EOAB 3QO1B 4Z7QF 5DRXB 1DL7L 4RCAA 1K4DA 1LK3H 1VFAA 2QQLL 1KTLA 4Y4FB 4FQ2H 3KLDA 1TVBB 1B4RA 1MRCH 2EE2A 5E70A 3MRPA 4DN3H 2CD0A 4HKBB 2H2SD 5ETUB 1XCQB 1JUFA 3OKNB 4JFFB 4M62H 4OFPA 3ZDYE 5I73B 3I3DA 2R0LH 2ZUVA 5JO5B 2NMSA 1YY9C 2X4TB 3X13B 5EIIB 1BAFL 1Z3GL 3MX0A 1GAFL 4N5EC 1QR1B 4JDVB 3OKOB 4MWFB 1S9XA 1X6NA 2YD2A 1KJ3L 4PJBE 5FYJH 4OFDA 2GJZB 4OM0L 3I02A 3S97C 2VAJA 4XWOD 1MNUH 4DVRL 1FYHB 3BKJH 2RAMA 1R3JB 1FDLL 4YDKH 4CVZB 4Q0XH 5C08D 1RZ7L 1S7QA 3CDGA 3MRNB 1R3KA 4LDEB 1GRWA 1EIBA 4FTVD 3HUJB 3VGAC 3BGFB 3UTPD 3NPZB 5D7SH 5JOPE 1RJLB 4NZTL 1NC2A 4XPTH 4P2QA 1V7NH 1MREL 2HFGH 2JJTA 3T0VA 1Q0YL 1NKRA 1IKFL 1AR2A 1YPZA 1YEIL 1DUYA 3HAEG 2CH8A 4ONGL 5JDJA 4KUZH 4MNHA 2BVQA 3GNML 1KBGH 4FQXB 1ND0B 3O6ML 5KW9H 2X05A 1ZVSA 5IEKB 3IU4L 1H3PL 4PRID 4NBXB 5IM7A 2CRMA 4XXDB 3AROA 2IH3A 3W0WE 2E7CA 2EE9A 4W4NA 3VE0A 2BNRB 4JG1L 4J4PD 3TO4D 2W65A 2J4WL 1MPAL 5I15H 1T1ZB 4Y8DC 4HMEA 5E4EC 5MEQA 5GGSB 4W70A 3FL7A 1WZ1L 3LH2H 3FO9B 1VENA 1DBBH 5A16A 3EO0B 3FCTB 5C0CA 4YHZH 4QRRA 5DDHB 5KVGH 4MDJB 3U0WL 1DEDA 2APXA 2P8MB 3JWOC 1YECH 1OAYL 1WCBA 3SOBH 4Z7OF 3IAPA 3D85D 3SO5A 4XC3H 2FCBA 5EH1A 5IROA 5HYJB 1YQVL 3O3BA 4PRNB 3KGRA 2B4CC 3TP4A 2O5YH 1MFDH 1JTPA 1MI5A 3LKNA 2DI7A 4UU9A 3L95A 5DRZB 2OR7A 3M1BA 2XZAH 1R5WA 4XB8A 5GZOC 3NABL 5I8EA 3KXFE 5CFHA 4XVTL 3UJJH 1C7SA 2ITCB 3MXVH 3G6JB 4HK3N 3O9WB 2NW3A 1GH7A 2AABH 4WO4B 4XNMA 4KQ4L 1I7RB 4J2XA 4BKLB 1C5DA 3OL2A 4HJGA 4TSBH 3LD8B 4I2XA 5DUMH 5FDWA 1SVCP 3MRDB 2WUCH 3P40A 1RUAH 1TPXC 5ERWA 5I2IB 3GMPA 4DKAA 4D9LL 5D2NA 1AJ7L 4HT1L 5HHOD 3D69B 4V1DE 2BVPB 4JAMA 4PRBB 4OZIB 1IC7L 3K2UL 1IC1A 1XH3B 2QADC 1UXWA 4H0IA 1DQQA 2VSCA 4Y4KD 3FFDB 3NZ8A 3BPNC 2R4RL 3QIUD 1G7LA 2OTPA 1R5IA 2A77L 4M7KL 2EE3A 3TPUB 3N1QC 3ULVL 5FYKH 1NCBL 4G8GD 3PV7A 5IB4B 5IT2H 4Z7NF 4HC1H 4HUXB 4PGDB 1S5IH 1CGSH 4XGZA 4OT1L 3TBWB 2JKXA 5HHOB 4O2CA 1A1OA 5A3IC 1NAKL 2RGSA 2NR6C 4GXVH 1B6UA 3CFDA 4O4YH 3U4AA 1H3WM 2QQNL 4Y5XB 3B2VH 2B1HL 2JB5H 2BOBA 2LU7A 4HKBA 5H8DA 2EDEA 2ICEA 1RZGB 3Q5TA 2AJYH 5GRWA 4Z7OE 1MWAA 5I17A 2HKFH 3EYSH 1S9VB 5JPNB 1YMMA 3FQXA 2HFEB 1PSKH 4I9WE 4HBQA 4MCZB 4TTGA 1JZ8A 5E8DH 1ZHKB 1KT2A 2MHAA 3KYNB 4TTDC 5T5FH 2FECL 3SKOA 4XVUD 4EIZC 1GC1L 3U0TA 3FQTA 1KXQE 1I3RA 1L0YA 2IBBA 1EHAA 1X4ZA 3BP7A 1EK3A 5I8KL 4U3CA 4Z5RB 4Z7VA 5F9WC 3GUTB 1BVLB 2E7HA 1I8MA 3ULSA 1DBJH 1Z5LB 2HVKB 2OR9H 5F7EL 4CADB 1JHKL 4D2NA 3WDJA 1EO7A 1MCFA 4HKXB 5E8DL 1NC2B 1UXSA 4PG9B 4JFPA 3SDAB 5FM5O 4PRHA 3EJZC 2NX5D 5HHNB 4HH9A 1CFBA 4N0CD 4WWKD 2BC4A 4PYGA 1U58B 3BESR 4LPXA 4NQXB 1BFOB 1NGQH 4BJLA 4BH7A 1L7TL 4LVOC 4QY8A 5C86A 3NAAL 1YNLL 3U4EA 2FO1A 1HHJA 3L3OB 1ZHBA 4KV5E 1B2WH 2R2HB 4CBPA 3A6CH 5FHBL 2WAHA 2P8PB 3ABZA 1UZ8B 2EDOA 3QAZB 5E1AB 3IKCA 1I1FB 1PGRB 4ZODA 5DI8A 1E6OH 2D7TL 3C60D 1D9KD 1BD2D 4OM1H 4P46D 2DQTH 5D71H 5HHVH 1KCKA 4YPGB 3GBLA 1RZKH 4HS3B 5ENWA 2EO1A 3L7EB 4L8CA 5EBMB 1XF3B 2YD1A 5FDWB 4GAJL 1UEYA 4NO2A 3QHTC 4YR6A 1XGPB 5HYQA 4FQIH 3TCLA 1KPUB 3OKYA 2XA3A 3FFCE 2ITCA 5F88A 3WLBA 5KG9A 3AS0A 1P4BH 2PCPA 3V95A 4OQTL 1N6QH 1NCNA 4LLAA 3MJ9A 2HRLA 2A6KA 1ACZA 4IM8A 4OZGE 1U8JB 3VGDA 3GEWB 5CWSA 2OI9C 4MJ5A 3OR7A 1OY3B 5C3TA 2MTPA 3QI9C 5KVEL 1FRGH 4KHTH 5F70A 1SHMA 3RVUD 1SEBA 3MNVA 4KTDL 1A7QH 4BH8B 2BK8A 2ICES 4G8EA 1J0YA 1OF2A 2I5YH 4HGMA 5IBTL 2ZUYA 4RGNE 4Z95H 3VGFA 3H9SA 4TVPL 1AXIB 3DVNA 3GMOB 5EU6E 4K3JL 1SBSL 2PXYB 3GSWB 4I0PD 2PR4H 1KCSH 4Y19D 4FMFA 4UTAL 5C0EA 4B7IA 1LO0L 2DWEB 2N7BA 4RIRB 3ARBC 3NFNA 1LEKB 2XFXB 4QHLB 3MREA 1JPTH 3QNZA 5E8PB 4FQXA 1KXVC 3BGAA 1VHPA 5F9DC 3X3FL 2VR5A 4F9LC 4WI7A 1HH9B 3SE3A 1MCKA 3B8YA 5E2JA 3EGSB 1CN4A 4ELMB 1I8IA 1ZHLA 3D25A 2X4QA 3LKRA 1FZJB 3L5WA 4RAVB 1CGXA 4EEEA 5D5MF 5BVJB 3MUJA 4V1DD 2A9NL 5BVJA 2ZSVB 1P69B 5TQ0L 5EBLB 3VFUA 2ZPKL 5IVXE 1K5NB 4FQJH 2D31B 4TOYL 1XFPA 3RUGB 3WKMH 2VJXA 3IKCB 3V5HA 1NBQA 3VFVA 3LQZA 4JREB 4BQ9A 2R2HA 4AH2A 5ACZB 4TSCL 3RTQB 3KLHC 4X80H 3S5LB 1HDMB 4QCIB 3MA9L 3RWCB 5GRUH 5EB9A 5HGGS 2DLFL 4XZUA 2E9IA 1Q9KA 1LEGB 3U2SB 1MEXH 1KB5H 4HF5L 4FXGB 2CKBL 4Y4FC 1A1MB 3KYNA 3OZ9H 1HHIB 1OAUH 4NIKB 2QBWA 1K6QL 2FB4L 4ODSH 3BGMB 3QFJA 4NUGH 5FEBA 4G42A 4ZD3L 2WBKA 5I1EH 3L5JA 4AENA 1XCQA 5DR5L 1CGWA 5ICZA 1UACH 3QHFH 5DWUL 4G7YL 4JFYB 5DRWA 4LCWE 4ONFL 5L0QC 1N5AA 3UYOD 2VDRL 3U0WH 4XVSH 3SN6N 5EORL 2MQ0A 4U6XB 1YN6A 1F6AB 4PJ7F 4OD2B 5I6XC 3KDMB 4MJIE 1DQJB 3RVWD 4OLVL 4XXCA 5D5ME 4XWOC 1FNEA 3RGVC 1NGWB 1Q9WB 1G7LB 2BRQA 2XZAL 3MBEA 4MNQA 3B3IB 5CBEA 1J1OH 4XP6L 3OG4B 4TYUA 1LE5A 4JR9H 3RWFB 3VFSA 2E5EA 4G42B 1XGPA 5HYQB 1BEYL 3MXVL 4YH6A 1LO3H 3VFOA 3WUWB 1KPRB 2ZCKL 1SEBB 3MNVB 3BVNB 4G8IB 5DUML 4JM4L 4G6JH 5DLML 3EYUH 4M62L 4J3WA 4E42A 1T20B 1A2YA 2CDGA 4O2EA 3CLFL 2FBJL 2D03L 5F1NB 2I60L 4PG2A 4GXUM 4JZJB 2QSCL 3WLWD 3MLTA 1O7SA 1FL6B 4N0RA 5HVWA 3O41A 1RUQH 4G80A 4AEIL 5DQDL 5JUEL 1KV3A 4WCYH 3PQYE 3W11D 2EH7L 2AJSL 4XRCA 2ADIB 4NPYB 3VXSE 4JJ5B 3S98A 1JTTA 1BBJB 4H8WH 2VL4A 1CLYL 1QBLH 3LEXB 1CFNB 2FZ3B 4MXVF 2OL3B 4PJEF 2VXVH 4PRHB 2XA8H 1VFOA 1F13A 2QR0A 3S8WA 1MAMH 2I9TA 1FL5B 4X0KA 2FNBA 2XT1B 4D0CA 3UTZB 1YEKL 4M7ZC 4PJ7E 1JYWA 5ANMA 5GGSA 3IFOB 2YA2A 5F97E 1KUMA 3KJ4C 2V9RA 4L3CA 4XPTL 3C2AL 5MEPB 5J11C 4M8VA 3OGCB 3OGOE 1OTUC 1WUNT 4RAHA 1PY4A 3IDIA 5EC1A 4UBDD 5C0AD 3MR9A 1QBMH 3NFNB 4WWKB 2BY0A 1NFDE 4HFUL 4X6FA 5C0BE 1YEIH 2X4SA 4PP2A 2NY7L 1MY5A 1DN0B 2V6HA 1BVZA 3FQUB 1NCAH 4TSAH 4NZUH 4X4XB 4HIIB 4RAUB 3PNWA 5IKCA 3UDWC 5ID0B 2YPLD 2VN7A 3WDIA 2PW2B 1I8LC 3HAEB 3QRGL 3SJVD 2C3XA 3PUCA 1JZ3A 2GHWB 2DN7A 5E5MB 4JRYD 3QJHB 3GMQA 4LOUD 4JM2F 5I66B 1WBYA 1QTYT 2UWEA 4JFHD 3T09A 1CXLA 5IEKA 4G3YL 2H2PC 1S78C 2P24A 2XRAH 4ZAKD 3EDDA 4LKCB 5IGXH 2VLRB 3QUZD 4PJAA 1GZPB 3R8QA 3FRUA 1CD1A 5TH2A 4XCYB 2OTUA 4EKXA 3ZE0F 1DTUA 4MJID 3ZL4H 1KFAL 4ZPVB 4JRYE 3ARFC 2ARJB 5I1HL 1W72H 5IV2B 1CXHA 5CJ8A 1QSFB 5GGQH 3UYRL 4NNPH 1WGOA 4WGWB 1MFDL 3QDME 3HHRB 3ZE2E 4Y2DB 1KCRH 4ZNCD 3MSPA 4MWFA 4U7KA 2AKRB 5GS1B 2ITDA 4RSVA 4MD4B 1KYOK 3MA7B 3PG2A 4N1EA 5GS1A 4X8JB 2APBA 4CVWA 3ZL4L 4G6KH 1GHFH 3MOAH 3WV0A 3GO1H 5ESQB 1MNUL 5I76A 2ZJSH 5E6YA 4FOMA 1XR8B 3O6FD 3C5JB 4NNPL 4ELMF 4ZAKC 2ESVE 1FQ9C 1HXYB 1QNZL 2AJUL 5HVFB 3QDJA 4PRHE 5IF0B 1Y6KR 4OSUL 3V5DB 1S8DA 3G5YB 1L7IH 1RUML 1UYWL 4OKVB 4YO0B 1A47A 4MDJA 2C4FT 5KVEH 1GZPA 5JIHA 1H3UA 5C09B 1YN6B 3JUYA 4IRSD 4PJHF 4DGIH 4PTUB 1X5AA 2DYPD 2BNQD 1VB9A 4Z7UB 4DN3L 3ETBF 2PYEB 3MBEB 3WKNA 3RDTB 2HH0H 3PV6A 3SJVE 5CP3H 3BXNB 1Z5LA 3WXVL 4O4YL 5HHPB 2GIYA 5HDQH 3MJ8B 3BEWB 3HB3C 4RGOL 3EJYC 5I71B 3PWNB 5KOMC 3D85B 1NCDL 1MIML 1NCCL 3ARXA 4LPCA 1P84K 5LCVH 3V6BR 3ARPA 5TPWH 5D5MA 2QTEA 3QDGA 2LU4A 1LHZA 3TO4A 5D7IE 5DDHA 2VQ1B 5B4MD 5HDQL 3VRLE 2XQBH 1A22B 3ZE2F 3HNSL 3ZHKA 4BQBA 2AQ3A 4NUJA 3TC9A 2M26A 5C1MB 4YDLC 5I1GL 2G2RB 2PW2A 1AFVL 5E03A 2DAVA 3RDTA 1RZ7H 3VG9C 1IC5H 3KPRA 4JO3L 1P7QB 5DEZA 5LBSL 1ZS8B 3HE7A 4L4VD 3CMOH 3O6LL 3HB3D 4YHOH 3K2MC 1MQKH 3FRPA 5CEZL 4V1DA 2WP3T 1BOGA 2AXGA 3D48R 3HRPA 4NSKA 3PDOA 4KY1L 4OD1L 1ZSDA 2EIDA 4IRZH 4Y5VB 4LIQL 1PG7W 3OGCA 1MLBA 2I24N 1BZ7A 5E7FA 3WO4B 3BZFB 4R3SB 4L4JA 5KTEH 1FVCA 3L9RB 4NC2B 4ZUWB 5F7FA 5KANG 4XCEA 4EI5C 2WLZA 3MMEA 4PJHE 2AEIT 2ZOKA 4MA7L 15C8H 1YYLH 4L4VE 4NCC1 3BRGC 4FFYH 3MA7A 3CVHA 1ZVYA 3T4YB 5DVOA 2BXZA 4TSBL 4ZS6C 3AVEA 1PLGH 5HXMA 4WV1C 3X17A 3D2UD 4NZRH 1F5WA 3C6SA 5L2KE 2J3SA 2Z8SA 4KK6C 5GGUB 3VRJA 5MI0B 4NNYA 3SGEH 4XVJL 1LE5B 2EYSA 5C0RH 2Y9RT 2X4UB 5GXBB 3QFJD 1YEJH 4YXHL 1OTSD 4Q6IB 5EZJB 1RHFA 2L7UA 3CSYB 1D7FA 3IVKB 1PBYA 4HSQA 3D0LA 4MYWB 2OQJA 2A0LD 2WWMD 3BIKA 5ALCH 1NLDL 3S4SA 3U0PB 4X99B 4YHLL 3OB0K 1UA6H 3ULUD 4ZPTA 5E5UB 2VLLB 3RNKB 1HE7A 3B6SA 3MUZ1 2VLLA 3X13A 1P1ZB 1Q94A 3QR2A 1WZKA 5E8OA 1NAMH 1GGUA 3MOBL 2VXQL 4U6XA 1GVIA 5L8LB 4G8GE 1VPOL 3E6HA 3LKSB 3EZ8A 2C1OB 3S35X 4DEPB 1BEYH 3RQ3A 5KAQF 5IESL 1KENL 2H41A 4M7LH 4Q6IA 4FXKA 4YC2C 3PE9A 4OLUL 3GDBA 2HLFD 5CJOH 4H1LG 2DTSA 3D39E 3MRBA 3RZCC 3H9HA 1VGKB 4KKAD 1FNSL 1BZ9A 4ODBD 4X99A 4YDIL 3EHBD 4W4OA 1IAKB 1D5IH 3IDIB 3UJIH 3IDNA 4XPFL 4MQSB 2YD6A 3NA4A 3VW3H 3WIIH 5JXEC 3MGAA 2AQ2A 4QOKD 3I6GA 3QYCA 4IDLA 3QEHB 3TH3T 3V5HB 3GI8H 4PB9H 2HG5B 1JGDA 3O8XB 4Z7VF 1IAIM 2GK2A 4NQCD 4RBPK 1LGVA 3REVB 3RTQA 1PFCA 1QSED 4HV8B 3VH8B 3KPSD 1JNLL 4PJIE 5FA4B 4F37K 1U92A 2OMBA 2BVEA 1CFVH 3VXMA 2E7MA 5DD0L 3QDJE 3KYOA 3D2UB 3QUKA 4FXGA 4XNQA 5GZND 3RZCB 3SDDD 1FV1B 2PR4L 4XZUB 1RMFL 3RL1A 1NGQL 4EN3D 2PO6C 1JF6A 3LQAL 4PB9L 5DC4B 1FYTE 3T0EC 2BCKA 3MXWL 3S5LA 4NYLA 4XRCB 4BSVA 1J0JA 3GM8A 2OSLA 4JFEA 4K7PY 3EHBC 2XXMB 4K71C 2YKLH 1S5HA 4WUUB 3PDOB 3DI2B 5ACLA 3DMMA 5E56A 2VLKB 3PXHA 1JWMB 2WBJA 2V9QA 2DWEA 1GGIL 3Q6GH 4BYHA 5I1IH 5KZCB 2PXYC 5C0ND 1WWCA 4PGBA 1MRDL 2AXFA 1OTTC 4DTGL 1PKQA 3ROLA 4G6ML 5EZIL 4AIXA 1LEKA 1XZ0B 2YD5A 4J12A 1INDL 3GMNA 1SJHB 2IAMA 3EYVB 3ZKSD 2Y7QB 3KS0H 3VH8A 4HIJA 4ESKA 3S3JA 3EGSA 4KU1A 5D7IA 4JG0H 4LIQE 1LO4L 5TE4L 3CD4A 3T0DA 1EUTA 5HTSA 3RGVA 1I3RB 5FUOL 3RFZC 2ARJQ 1K4DB 3VDBA 4L29A 1EEUA 2R69L 4MQ7A 4FNLH 4H1LA 3D1MC 1IEAA 3QNYB 2YK1H 2FJGA 3P2TA 3NOIA 1N2RB 1JGLL 3O8XC 3RHWF 4QNPE 2CRZA 4ORZC 5DWUH 1VEPA 3FHAA 2CLVB 5KSBA 4KI1A 3GRWH 3C60A 2HWZH 5CZVH 2CKBH 4QOKE 3S37H 4XVSL 3GHEL 1NANI 1BD2A 5BVPL 4MS8D 4JPIA 4JDZB 2W07A 4AENB 1KEML 4OCRL 4R7DB 4PTUA 4LLDB 1JNHB 4FRWA 4XC1L 5IBUG 2A6KB 4JAMB 3O6KL 3NH7H 3GZKA 4WTZG 2EC8A 4DOHE 3T0AA 5C0AA 4MB3A 4TULL 5ERWB 5I8OL 1ZXQA 4G8FB 2B7DT 1GXEA 4NQEA 1VA9A 4XNUL 1Q9KB 3U2SA 2JJWA 3W39A 3N1GC 4XWGH 4Y16A 5E2UH 3O2DL 4OCSL 4JCMA 3V6ZB 4L8CB 3KPPA 1U8KB 5GHWL 3PWJB 1HI6A 5EZLB 4LLYA 5HY9B 1U91A 1KJVA 1ZA3B 2W38A 2Z8RA 5HI3C 1W8NA 3VXMB 5EZJA 3BW9A 3ULVD 4LSQH 3DBXA 5DS8A 3L3IA 5JR1H 3HE6A 4G43A 2VLJB 5KSAD 1CZ8H 3ZDZF 5TDOB 4JFZL 1MFAH 1BFVH 2NW3B 4WNQA 1UM5L 2DKMA 4YDLB 3BSZL 1FCCA 1BM3H 3UBXB 5SWSB 3FMGL 2XKUA 1CLYH 4BH7B 3HFMH 1NMCC 1LDSA 5DTFA 5C0DA 5CMAA 2BOCA 1N26A 1RPQA 4PJDE 5I8CB 3FOLB 3P11L 5AZ2L 3DSFL 2MQ3A 2VABA 2P8PA 3C5ZA 5IHLB 4NN5C 3HG1D 5ABDE 1MFAL 1AY1L 3U30B 2BHYA 1P5VA 4WHTB 1TQBC 1F4HA 4NSKB 4J3TA 4PJHA 1CDBA 2YUZA 1XGUA 3RWIB 4RFNC 3MV7D 1VGKA 4EI5B 3RWIA 4WWID 4M8QB 3TVMD 1CFQA 3VXUB 4F9PA 1ZA6A 5IFJB 1A7NH 4JFPB 2VXSH 4CL7A 3DVNB 1FNFA 3OBAA 1A5FH 5I1JL 1GSMA 4X6CF 1TZGH 2W65B 3BT2H 5I1DA 1H9VA 1RVFL 5GS0L 4ZNEA 4RQQB 3W5MA 2GTZA 1TVDA 2GFBA 2JJSC 2WNGA 4NJ9L 4NZTH 4UIMA 3VI3E 1XGYH 4K94H 4YE4L 4RRPG 4K7FB 5D5MB 4XHQA 1IQDB 3T1WA 1L0XA 4WW2F 4NN7C 1FDLH 3WFZA 1PZUB 5D7LD 4PRIB 4ONGH 5T3ZH 5DZNA 7FABL 3T1FB 3MFFA 3H7LA 3W9DB 1FG9C 3JTSA 2HFEA 3V4VH 2GKIA 3SGKA 2IPUG 1F6LL 1HHKA 2D0GA 4NHUA 2XI9A 5EUOF 5T1KD 4HS6A 2D4FA 4NO5B 4AL8H 3U9PL 4JFDA 1RZGA 2Q8BL 3P0YL 3NCYS 1H0DA 1QYGH 2IADA 4M6OL 3MNWA 4S10A 5I1CL 2EDWA 1X5JA 5D7IF 4A6YL 3UTSB 2X4OA 2IWGA 4I2XB 1FSKB 1G7HB 4WEBH 1WWAX 4K3DL 1BZ7B 2A6JB 5I2IA 5IR1A 3LHPH 4NPYA 1X7QA 4MQTB 1W72L 3QUZB 3QIBD 1YN7B 1TETL 3WNOA 4M03A 4YXHH 3T77B 4XVTH 5DGQA 4HQQH 1FJ1B 4FABH 1BMGA 1QFPA 4N0UE 1GGTA 4QHNB 5IROC 3CH1B 2ICWA 5CILH 4MA1B 4MGXA 4ZXBB 3MOAL 2YPVL 1XF4B 4P2OB 4WI4A 4UDUA 5BV7B 2BRRL 3HMXH 3CNKA 4MA3A 4XMKH 1IFHH 2YPLB 4OQ1A 2QQKL 2DM7A 3LAFA 1FNAA 3DTXB 3TN0C 4ETQB 4NKMB 3TO4C 3GSOB 2JCCB 3MNWB 4JANB 1J0HA 1F00I 2QQLH 5B39G 1FLRH 3PHQA 2V9TA 4GW1A 5IB1A 3P4OB 2IQ9L 3AS1A 4N0CC 4K55A 1Q0XH 4WWKC 2AGJH 1MI5B 2ATKA 4DZBB 2VRAA 4TUKH 4JO2H 2V2XA 4N9GB 1MCPL 1Y6MR 1F6AA 3ES6B 5CIPA 5F8QC 3WS3B 1KELH 2DDQL 5A2KH 1FO0L 1KIPA 3H9SE 4KKCD 4MXWL 4KH2A 1JWUB 4P9MH 4PJ5B 3WIIL 3HI6L 4H20H 4S1SL 1OP5H 1P2CA 2BFVH 3SGDH 4P5KB 2GFBB 2Q3ZA 1FORL 1D5ZB 4UILL 2BNUB 3RRQA 5LCVL 4QOKA 5CLTA 1DLHA 3H9ZA 4Z0BL 1I9EA 8FABA 1UT9A 2HN7B 3CFKB 5I0ZA 1V3LA 2X4OB 3GSNA 3FOLA 1RZ8A 1ZTXH 3RUGA 5BOPA 3ET9F 4S1SH 5B38A 2LTQB 1CXFA 3JWDC 4OLEA 2YWYA 4LSRL 4GKSB 4OD3H 5B3JE 5IHZB 4WHTA 3L3HA 4J8RB 5IF0A 1CFNA 5EOTA 4RNRB 2HMIC 3EZJB 4ODUA 3REVA 2VABB 4DW2L 1CGSL 3I02B 5INDB 4NKDA 2J1KA 35C8L 4N5ED 1NGXA 5D72L 5CLWA 3I6GB 1W0YT 4EZMA 2E7LA 1A3RH 1VGEL 5F9OL 3G08A 2IQAA 1NEZG 3O3EB 4YHYC 5DJ8B 1BOYA 4J6RL 1W8OA 1F4WH 2AKRA 1HHKB 4NHUB 4RAVA 32C2B 1GZQA 2HJKA 4L9LB 4M7ZB 4U33A 1DBKH 5E8NB 1G9NC 2HT3D 4IRSB 3QDMD 3PJSA 4XAWH 5BMFL 2NY2B 1H8OA 2X4TA 3MACL 3Q3GA 4MA8L 1WIOA 3DUSA 4LMQE 2WIMA 1HQ4A 3BD5A 2A74A 3HPLB 2AJXH 1A3QA 2EDXA 1PYWA 4HWUA 2YC1B 3WUZA 3MRFA 4LSDA 5FHBH 5TGBA 5DHYB 5KN5A 3RWGA 4P4KB 4QEGA 5EU6A 1OW0A 1Z0MA 3QP3A 3P73B 2BVTA 1HQRB 3PGFL 5FA3A 1FBIL 4WY7H 3KPQA 2JJSA 4CN1A 1P2CB 2Q8AL 5GISL 1IKNC 5HGBA 5EDXA 2IAMC 3DOSA 1F6FB 3WE6A 3F12B 3SE3C 5I1HH 3WSQH 4PB0L 4XP9H 1F4AA 5ETUA 4KI5E 4FFZH 2Y6SD 2IEPA 3MJ9H 3UCRA 2JK5B 1S78D 1JMXA 2Z0BA 3DUUA 2N56A 4JVWA 4KJYA 4LLUB 5E99H 4MHHG 1T89C 1CDYA 5F7LB 3PWPE 4LVOB 3G5VB 4OCMC 4UOJA 2FX9L 1FZMA 1JNNH 4YDJB 4HS3A 5CP7B 1IM9A 2YPKA 4XB7A 5ICZB 4X6CB 4OZHF 2BDNH 1J8HA 5DD0H 3QEGL 5E1AA 5T1DL 3WFBL 1AR1D 2W59A 3S88L 3C09C 1G6RB 4HEPG 4WENB 4TUJA 4UT9H 5FGBA 5C2UB 3DXAE 3X11A 4BK4A 1NUNB 4BUGA 4PRPD 4APQB 2CK0H 2BY3A 4XTRC 2LTQC 3V0WH 5KOVC 4GW4B 4Y5XC 2KPNA 3KWWA 1CR9L 3W39B 3TM6A 3K1DA 4R96B 2VSDA 4PBXA 5GRVK 1UXSB 4JQIH 1AGEA 1N8ZA 2FJHB 4XP5H 5DEFB 1F11A 1MUJB 1YA5A 4RFEB 4UNVA 5EC2A 4L5FH 3REWA 1JPTL 5L2KA 1XGQB 1FZOA 1NGYA 1NCWL 1O5DT 3DX7A 4LPVA 3FB7A 3HTLX 3QXDA 4L8BA 3X3FH 1KJ2L 2Z4QB 1TJGL 1KB9K 3OXRB 5SX4I 3QQNA 4M1DH 3D2UA 2OTWA 1LO2L 4JO1L 1XGTB 1BQHA 3K1KC 3VCLA 2A83B 1IAII 3Q5YA 4U1IA 1SYVB 4IIQA 5E5RB 3MV9E 4KWUA 4MS8C 2X4NB 2CPCA 3ULUL 4PPTA 1NC4D 3RVUC 3ZDZE 2BVOA 1AD0B 4HUKB 2Y1VA 4H1LB 5EIVA 1IL1A 1TJGH 5C09D 3EYQD 1HINH 1FGNL 5HYJD 3VWKA 4M4RA 3MBED 4QHLA 3WJJA 2LV4A 2MKLC 4C56E 1NC2D 4PR5A 2HTKC 1HQ4B 4B41A 5CBAB 1PG7H 2XN9E 4L9DA 1RK1B 4WI3A 4I48B 3VCLB 2J5LB 4O58L 2FR4B 5FYJD 1Q9LA 1TCMA 4M8QA 1AE6H 4KZEH 5GS2H 1WZLA 5T1KA 3BGFC 1U8JA 1UXWB 4PJFA 3T2NL 1KNOB 3C6LC 3F7VA 5BVPH 2IQAB 2AW2A 5GGRA 5CEYA 5I1KL 4U1LA 1A3LH 5T5NG 4GT7A 5B8CA 4X6CE 4ENED 3IFNH 4LSSH 4U6HA 1P9MA 2VQTA 3DETD 1RY7B 5IW6A 3FB6A 3VI3F 1T2QH 3H3PL 5D8JL 5C0DB 4HW6A 1S9KC 1JGLH 5IB2B 3LS4H 2FEDC 5HVHB 4AH2B 5JOEA 5JQHC 5GSVA 2X09A 1HHHA 3U79A 5TDOA 4OM0H 4PFEA 3TIDA 2CJUL 4XCNB 4TUJB 3MRGA 3I75B 3RWJB 4NWUL 3F58H 1NJ9A 5I1EL 3VFWB 4GS7C 1HHJB 5D7LA 5EBMA 3BI9X 4P23B 3F6IA 3N1FC 3O2WH 2H32B 1AO7A 3BWAB 5KVMC 4LHUG 2GCYA 1LO3L 1ODAA 1WT5C 4HH8A 3C8KB 3CX5J 4XT1C 4PJ5D 4P5KA 2JELL 1H8SA 2XKSA 1H5BC 3SEPA 1JNJA 4QXWA 4HAGA 4JFZH 1NFKA 3TH2T 4KAQL 1NAMB 3FMGH 3I84A 2W0PA 2FEDD 4ODHL 8FABB 1UZ6E 4TUKL 3I6KA 1HNFA 2G2RA 4DGVH 3U4EB 4K9EH 2FIKB 3KYMB 3BZ4B 1LQSR 3CDYA 4Z18A 4QRRE 2EDTA 4L4TE 1M71A 2ATKB 4DZBA 1R5VB 3QT2A 2JELH 4FFVD 4IRJA 5C07D 1IL1B 3TJHD 3R4DA 3E6FA 3C6LD 3WL9B 4EUPA 1LD9B 4G6JL 1XAUA 3TN0A 1U8QA 3NCYP 3UYPA 2YD3A 1KULA 4NQTA 2BNRA 2D03H 4J3OC 3NGBB 4ZUVB 4KJWD 5TF1L 5DJ8A 4UDTB 1IKFH 4LCIL 3RU8L 2ICEB 4IRSC 1AO7E 3RL2A 2VDKH 4AG4H 4P23C 1AY1H 4PJGA 3I85A 6CGTA 3OKDB 1AD0A 3UPAA 5EOCJ 3QH3A 2GJ6E 5I1CH 2FO4B 4YWGL 3I6LD 4FS0A 2IPKA 4MAYA 4P3DA 5CZVL 1QQDA 1D5MA 3LMJL 5DA4A 1BQHB 3QISA 1LE9B 1TNMA 2DTML 5H37G 4W4OC 1QFWH 3VXPA 4OAWB 5C08E 4ZXBA 2DBJA 2GK0A 3BQUB 5B38B 4KTEH 2BSTB 3BDBA 3DROB 4JM2C 4LCCB 5LAXA 4NKDB 4WV1A 3U9PH 3MUY1 5ESVA 4WUUA 4XX1G 5I8OH 4Q9QH 3QCUH 4XGZB 2P7TA 5DMJB 3AB0B 1KB5L 1VERA 4QLRA 1N59B 2D2OA 4QO1A 4QRTB 3RGVD 5IVZA 1K6QH 1C1EL 1FIEA 2VLRD 4TUOA 2G9HB 1HNGA 1I1AD 3CJJA 4OLXH 5D1XC 4NKIL 4OGXH 4HFUH 3HE7B 1N3NA 1IM9B 1SEQH 5GRZA 5EG6C 2KH2B 2GY5A 3VFMA 4RMUA 4FFVC 1ACYL 5MP6L 3QO1A 4C54A 5ADPL 2ZUTA 2Z9TA 4CMHB 3MJ8A 3OWEA 4OCXH 3GRWA 2IQ9H 4HIEA 2D7OA 1JWUA 4P46C 3LIZL 1IAOA 2OZ4H 2YPKB 3TVMB 1FFRA 4UTBH 4BZ2L 3IDNB 5IUSA 4MQXC 3U7YL 4QRRB 4R90H 3X3GH 4C83B 3DSFH 4NQSA 2DM3A 4XCYA 2R56L 1AGFB 1JGVH 1F8TH 4EOWH 3FONB 5EU6B 4GKNA 1BGXL 4H0HB 4K3HA 5TDNA 4F2MB 1MIEH 4UTBL 1QO3A 3ARGC 4WTXA 1DANU 4Y5XA 3SE4A 1CFQB 4JO2L 5J89A 3LY6A 5GHWH 5DMIL 1CE1L 5ESQA 3VA6A 4OT1H 3P4MB 4NQDA 2ICWI 5FA3B 3O4OB 4P5TB 1F8TL 4FFWC 3PWLA 3WFCL 5MEPA 1CIDA 1S3KH 4X7FC 1I8KB 1BIIA 1TJIH 2VH5H 5ID0A 3IRZA 3P4NB 3BP5B 4MMXC 5J6GB 3I75A 2OR9L 2D3VA 3BZEA 3V0VA 4C57C 1RURL 4PGDA 3HFML 1ZVSB 4U1MB 3HI1B 4QRTA 2XXCB 3CFEA 1E27A 4GUPB 3UO1H 1FZJA 1ETZA 3CVIL 4LGSB 3H42H 1LNUA 2B1HH 2QJDA 3A67L 4WO4A 4QHUB 2XZZA 4JFQB 4MD0B 1MHPH 4TNVF 4R6UA 4A6YH 3PP3H 4JKWA 3SE9H 4DKFL 1MFEH 1KIUA 5I1AB 2ORBL 2FZ3A 1K3IA 43C9A 2A73A 4OM1L 2DOCA 3UP1A 1XT5A 5E2VL 3VXRE 2CUHA 1QKZL 4ZUUB 2BNUA 4QRRD 1BQLH 1FNLA 1HEZA 4Y1AE 3E2HB 4YX2H 4OD1H 5CGTA 3A6CL 5CHNB 3RNQB 4LSPL 5FGRA 3GJFA 5D93B 3FT3B 4IMKC 1T1XA 3WJLA 1WC7A 1J5OH 2AK4E 4Y19E 2FH6A 4M6MH 2AJXL 3MUGB 3QI9B 4X6BA 4OUUB 2EYTB 4NBYB 1YQVH 4OLZL 2Q6WA 1ZA6B 3BHBB 4D0BB 1QLFA 1EO8H 2O5YL 4U3HA 5TFSL 4MJ5B 1RK0B 4MA7H 2VN4A 1DN0A 1FYTB 3CX5K 1TFHA 2HKHL 4FFYL 4GAGL 4W68A 5DHVH 2WBWB 2BJML 2W1NA 3FN3A 3BWAA 3CAFA 2XN9B 3QEQA 3FO0H 4OLYL 4GRMA 3E0GA 4DCQB 4GOSA 1C08B 4MNHB 1SY6H 5ICXB 1QFWI 2AGJL 4WHYG 2NX5E 3GIVA 3RGVB 1X44A 4XPBL 2Q7NA 3RUGF 4AT6B 2WBJC 2IFFH 3BEWA 3PHOB 2LVEA 4XTRD 4JCLA 4YHML 2BJMH 3H3PH 1E6JL 1N5AB 3BN3B 3N50A 1R24A 4NC0B 4BFEA 4ETQA 5LVEA 4IOFC 4F3FA 1NAMA 3MLTB 2APWA 5H94B 1TZIB 3E1F1 3T4AB 2EICA 2GITA 4NZRL 1PJ9A 1UWEH 1ES0B 5M94B 1UADC 4P2QB 4NM4L 4WTZA 1ZANL 7CGTA 1LP9E 1U92B 1VPOH 3EYFA 5SV4A 1J1XL 1FVDB 2ZSWA 1XGRA 1G9MC 4AEFA 2GTWB 4H8WC 4QRUA 1B3JA 3V6OA 2VERN 3V6OE 1D6VH 4R4FL 2JB5L 3FFCD 4YHIA 4PS4L 4R26H 5D93C 2WBJD 1T21B 3MJ6A 5JW4N 2R2BB 1T6VN 4U6VH 5HBBA 1P7QD 4HPYH 5L88H 3U83A 4NQVA 1HOCA 1E4XH 3GBML 2GY7B 1V05A 2PN5A 1MCCA 2R4SH 1UVQA 1QSEB 4HKZA 4PG2C 4PJGB 5I19L 3WFHA 3FOMB 3GMMA 4OAWA 5C6PB 3ULUC 1IT9H 1SYSB 5EO0B 3MV01 5IB3A 3MRKB 4Y1AB 4LAQH 1I9IL 1RK1A 2DBLH 4R0LC 3WD5L 1T4KA 4M1CC 3I50L 1IGFL 2XWBB 5DJDB 1SJHA 3EYVA 5BO1H 1FFOA 5DEGA 3MACH 4UT6H 3T0XA 1GGIH 3Q6GL 5I1IL 2ADFL 2V5MA 1QACA 3MUGA 1U3HA 4H88H 4PR5B 1HILA 3QXDB 4L8BB 3TYFB 3V6OC 3GJFB 5IBUB 2FX7L 3D0LB 4G8EB 1IGFH 2FIKA 3QFJB 1YMMD 2JE8A 2HJLB 2DWDA 3RWEA 4IHOA 2Z31A 4NYLB 4R96A 2AEQH 1I4FB 5FUOH 1HSBA 5EORH 3RNKA 3UX9B 2EYRB 5IFJA 4LGPB 4HIHB 3M45A 2V7NA 3SKUD 2AK4D 5IG7A 5DO2C 3RL1B 3MRJB 5DJ2B 3IETA 3DMMB 5D71L 5E00B 5HHVL 3VGEA 1NCTA 5ACZA 4FQLL 5EU7E 2AI0L 2AJ3A 4P9HC 3NCCB 3TVMC 2CSPA 2CLZB 3G6JE 25C8L 3CX2A 5TQ2L 1G6RA 4GW5A 3ARBB 4LSVH 2VDMH 3OR7B 5DUBA 4NN6C 1F58H 5JOPD 3FTGA 3QQ3A 4PY8I 1IZKA 4S0TD 4XCCH 1C5DB 2XOTA 2YEZA 4FXLA 4X6CA 4D0CB 4OF0A 3V5KB 3S5LG 3OKEB 1KJVB 1ZA3A 3CSBA 5DD3L 3TNMA 4JN1L 3OKEA 3HI5H 4HMDA 4HG4J 4LNVA 1JHTA 2NY6B 4LRIC 4EVNB 5GZNC 3VFWA 2XQYG 3NVQA 3EOBA 1TTFA 3B9KC 3DUHA 2KQMA 5FUCC 5EO9B 3QRFM 1FFNB 2OJZL 4JPVL 2ADIA 1JPGA 2B1AH 2B2XL 3BZFA 4OFIA 1K8DB 1XF2A 4WFHE 3BQUD 1NBYA 3HG1A 5GRXG 2MOVA 1T0NB 3AREC 4LAJH 2VUYA 5DT1H 4H0GA 3IETB 1NSNH 1DFBL 2PUQT 1WFTA 4PY8J 5A16B 3DWTA 3MLZL 2FGZA 2R1YA 5CKGA 5FUZH 1EERB 3N9GH 2NY6D 4W6WB 4LNRB 4Y88A 4F58H 3F7VB 2ERJB 4I2XE 4YHKL 2V5RA 3MCKA 3BO8B 1LVEA 5HHPA 4YDKL 3SDCD 3ESVF 5C0CD 1BD2B 4CJ1A 4K23L 3DX9B 4LSTL 2R0LL 2PCPB 4PJCE 5FUZL 2BDNL 2MHAB 3QIUC 4NKMA 4H25B 4ISVA 3LV3B 2BVOB 2XG5A 3EDEA 1CICC 2NZ9C 1Z3GH 1XMWA 1QP1A 1MHCA 4AIOA 4QKXB 3GMNB 4I3SL 2Y07L 2F58H 5I75B 2A9MH 5JMOC 5FYJL 2AJSH 5JZ7C 4OKVA 1MI5D 1FNHA 4NP4H 3BKJL 4I9WD 5D70L 3FZUD 4NGHH 3CH8A 4K8RC 2X44D 2YWZA 3OXRA 1NBVL 2OYPA 1JE6A 3VXTA 5L2JB 1GJIA 3D0VA 5C09E 5IQ7L 2R15A 4NNXB 4PGJA 4IMLA 2VDNL 2B5IB 2Z92B 3RIFF 4XP5L 1WAAF 4CRPA 5IB3B 1AXTL 4QF1A 3G08B 4KZEL 5IR1B 4DZ8A 2FLBT 2I07B 4FP8H 1CQKA 3U6RB 1RJCA 4YJZL 5K9KB 3IDJB 1XR9B 3LKQB 1MEXL 4M1DL 1OAKH 5EUOB 3NCBB 2XZQL 3CFKA 4PIRF 4YPJA 2F5AL 3TT1L 3V4VL 3QIUA 3DRTA 1Z9LA 5ADOH 1YYML 4R97B 1KEGH 5IHZA 1A6WL 1CFTB 1NBZA 4I18C 3IU4H 5I0DA 5D1QA 3PABA 4AEEA 4ODUB 3QCTL 1PZ5A 3SQBA 3OKKA 5EOTB 2R2CA 4Z7WE 3KPRB 1R0AH 3QRGH 4WHCA 1JVKA 1PX3A 1BREA 1REIA 1VFAB 4MAYC 1A7NL 4CADA 1E4KC 1NEZA 3BT2L 3D5OF 2AQ1A 5EFIB 4JY5L 1DBMH 3W0WD 2VDOL 3W9EA 3K7UA 3TO4B 3DRQB 2R23A 1CICA 3H9YA 1M7IB 2D7MA 1FGVH 1QRNB 4KRPD 4DK3A 1BGXH 1NL0H 4JHAH 2EDLA 1IC4L 4PJBA 1EMTL 1P1ZA 1Q94B 2MCPL 5JPNA 1P53A 3NZHH 3QWOB 2VDOH 2O61A 4LL9A 2AJUH 2BMKA 5TGBB 1C08A 5IJKC 4MZ2A 5F7HA 1JI2A 1JF1A 3GJFK 2UZIH 5I30L 2C1OA 3SKNA 4HUVB 4NFCA 1P7KA 3RIAF 3CFDB 1HZHH 5I8CA 1Y6NR 3RDTD 4O2CB 4KK9D 3JUZA 4WCYL 2YN5A 3ECBB 1KJMB 1GHFL 1MCPH 1IFHL 3HN3A 1HH6A 2O26U 5KN5B 3CXHK 4F7PB 1FO0H 5D1XB 3UC0L 5ANMB 2EDFA 3SCMC 1UQSB 3O81A 1ZLSH 2IBGA 4Y89A 4OCYH 5JLZA 3MLYH 4Y8AA 4JKLA 1QSFA 3WHXB 4NO0D 2CKBA 1DEEB 4X6DA 1YN7A 3UPCA 1Z2KA 4MB4A 1BM3L 3LS5L 4JKPL 4MAYB 5E08L 4JEGB 3KPPB 3B83A 5AUMA 3GMRA 2OK0H 4RWYL 4X9GA 3MLXL 1KN2H 1P4LB 4JLRA 3MV8D 1JV5B 1WCBB 4GKOA 2B0SH 5IVOA 2DQCL 4NOFA 4NQEB 2X7LA 2P5WD 4J3VA 4HLZH 4WFFE 2NY0C 4YQXL 4O5LL 1M6OB 4R0LB 3T3ME 4WDIA 3WNMA 5DGRA 4DAGL 4U7SA 5GZOD 2APFA 1CFSA 5J12B 3ARDB 2EIBA 4YX2L 2AK1H 2DM4A 1ZLVK 3D39A 2VLRA 2FEEL 2MPAL 4HC1L 5E6IC 4LSPH 3L3JA 4GUPA 3C60B 3T2OA 4RX4D 2P8MA 4NJAL 5C0GB 2YZ1A 4M02A 3HS0A 3EO0A 5C0CB 3HI6H 4H20L 5K93A 3GSNB 5CBEB 3FQWA 1U95B 4UILH 3B9AA 1U3HB 3VXOA 2HVKA 4KKBC 3PWLB 5J1AB 5T3XD 1FFOB 4Y5YA 4QHKJ 1UB5B 3SGJA 5EU5A 3RPIA 5GGTL 4ZXBD 3F7PC 3STZB 5HVGB 2AJZB 12E8H 3OXSB 4KROB 2AK4A 1XIWB 4GG8B 4Q2ZA 4JGJA 3DTXA 4Y4FA 2Y36L 2VMFA 4U1HB 3GSUB 3KPOA 3QIBB 4EI5A 5JIPA 1YPZB 2HT2D 2VLKA 5DD1H 3BJLA 5GSRA 3ZTJG 3NFPA 5D6CA 1CK0H 4TTDD 4EUPH 1P4IL 3L3GA 3KXFA 4W81A 4JANA 3O3AA 1RIVL 3IXTB 1OWWA 4GQ9L 3V6ZA 5HI5C 4XVJH 3LKOA 3D6GA 2ESVA 4P57B 1DBBL 2AV1A 3TBVA 5E9DA 2EZ0C 2QKIB 1T1YB 2P5WB 4U1JA 5DJ6A 1HYRC 5DD1L 3WEXA 1MAJA 1CF8H 4GAGH 3V4UL 5EIIA 3L3IB 1I8LA 4G8IA 3KHQA 4U1LB 1R3JA 5HYFA 4NT6A 3OB0H 1RIVH 3VFMB 4JQXA 5HY9A 4MJIA 3U1SH 4P2RB 4GRLD 4PJ8B 2RR3A 1QFWM 3FHQA 3LVEA 4LLQB 4MZ3A 4WRLA 2OTUB 2COQA 4R90L 3HZYB 1QHOA 5GGTA 4PBVC 4Z0XA 1XEDA 3IB4A 3MGTB 4FQCH 4QTIL 4RFNB 2HKFL 1ZHLB 3OAYK 4QRPB 3VWJD 4MQ7B 1MIEL 3MRRA 4Z95L 3VXQA 3NIFF 5I8EB 5CJOL 2ZUXA 1A8JH 2Z91B 4OV5B 4WTWA 4ERSH 2HFFB 3L95B 1HCFX 1KCSL 4AMKL 4U0QB 2F8OA 4PGEB 2ZCLH 3IDUA 2WM0A 4JDZA 1KJ2B 2EYRA 4D0BA 1LP9A 4R26L 3MZTA 5M95B 1A4KB 3GSNH 2W9DL 2HFTA 4ZS6D 4F7MB 1KOAA 2FHCA 3GFUA 4PP1D 3T2QA 2QHRL 2YKLL 3BH9A 1DDHA 1OSPH 4QCIA 3RWCA 2HJFA 3LQAC 3EOYG 1NKOA 2JLLA 3QQ4A 1MRFL 4HPOL 4YIQB 4XPGH 5EOCL 2AV7A 4JHZA 5AG8A 3U48A 2YK1L 1MRDH 3ZSSA 3KPMB 5F96L 2ATPA 3TJEL 3VFPA 3VGHA 5GGUA 3VRJB 1AXTH 5CWSB 5DRNB 5EPMA 2AAVA 3T8XA 1MHPL 3MRHA 3EDJA 4UMGA 3QDGD 3VFUB 1JHTB 1M1SA 3IXAA 2HTKD 3KPSE 4Y4KB 2E7BA 3RWHA 4JG0L 4PJCF 5DK0A 2IFFL 3J7HA 1MWAH 3PGDB 3Q5OA 3ARED 1OGTB 1U2CA 5MEOB 3HCVB 3KPRD 2D31A 4DTGH 1VFMA 1OGAA 4UNTA 5D4QA 5CMAB 1UM6H 2ZUWA 5FK9B 5HDLA 5FV1L 5F7EH 1A0QH 1MFCH 2Y06L 3UZEA 4XBEH 4YDJA 4XNZC 2GT9A 4D8PA 3TYGH 3BH9B 3PL6C 4ZAKB 5F21B 1N0XL 1WBZA 4ZFOA 4XP1L 1FV1A 2EDRA 5HHMB 1W2KT 3TBTB 5DD5L 1AP2A 5DS8B 1WAAE 4NT6B 5CZKA 3TA3C 1EDQA 2HJLA 4JY4B 1WIPA 2EE6A 3X12A 4CAGA 3K74B 3U4BL 3QEQD 4LLYB 4J23A 4BA8A 4MAUH 2VZVA 4L3ED 4Q58C 4UAOC 4RIRA 5AAWA 4UZGA 3ULUE 4WU7B 5EU7C 4JDVA 1IC4H 5J8OA 3SDXF 3VJ6A 3SDAD 1N2RA 3O2WL 3QXTA 1RUPL 5FCSH 2VL5A 4TULH 3JZ7A 4F58L 1I7TA 4EXPX 1JZ4A 5GGVH 1MJJB 3WHE1 2YBRB 1IARB 3RTQD 4LEXL 5ILTL 3N1PC 3SCMB 2IPUK 1JRHH 4PLKC 4PJXB 4RFOL 4L8DA 3PP4L 4HGKC 5T1DH 3WFBH 1J9CT 1AH1A 1T6WA 5I17B 5JORA 3P73A 3QQ9D 4JFYA 5DRWB 1AHWC 4ZPTB 4QT5B 4KDTA 1EH9A 4U1SA 3FOMA 3GMMB 1T1XB 4I3RH 2YSSB 3ARFD 5DJYB 3DX8B 4G9FA 3LN4B 5IWLA 2MQCA 4PRAA 4M6NH 1KLFA 3MRIB 2IAMB 3IDXL 1NBVH 4L8SC 4X7EC 4U0RC 1ORQB 4I77L 4LCIH 3RU8H 4R4BB 5D1QC 5BS0A 4JFOB 3TBYB 4D9RE 4YQXH 3HPJB 2VDPL 1JFQL 4OFVA 1OAZH 1DQQB 4X5XA 4JGUA 4P2OD 5DHVA 2BSTA 3DROA 5T3ZE 2Y07H 2VLMD 2VLJD 1NUFA 1TTGA 5EZOL 1T80A 4KROC 4QRQB 1K3ZA 5F9AC 4K3GA 2JIXD 4GRWF 4KHXL 3CVHL 5IEHB 1N6UA 1UB5A 2J7LA 3HCVA 4Q9BA 1T0PB 3SKJH 2NY3C 4GBXA 5DSCB 4GW4A 4OLWL 4ZUWA 3JXAA 2NYYC 4G3YH 4U31A 3HG1E 3AMKA 2C5DC 3ROOA 1U3HC 3V9FA 3O9WD 3T0BA 3QXAB 3D18A 3RAJL 1SM3L 1MF2L 5L7XL 2B39A 5CIPB 1RAMA 3O2VH 1RD6A 2HFGL 4G5ZL 3T8XB 4KJYB 4M9PA 1I8IB 5IWLC 2VWEC 3I9GL 4G7VL 2R29H 1AQKL 5F7NC 1B9ZA 4AT6A 4XNYH 3SGEI 3R1GL 2AV7B 2NY1B 1OT1A 4JRWA 3FQTB 3QUMH 3TN0B 1GC1C 3NIGF 3DV6A 5IFHH 3E6FB 4U0RB 4FTVE 3SDAC 3KJ6L 1KJMA 5IHUH 3SDDB 5HGBB 3OJMB 4P0DA 1IEBB 1MVUA 3NGBC 4BH8A 2NTFA 3QUXC 3IAQA 1XGUB 3BJ91 1AQKH 1HQRA 3N9GL 4MNGA 2HYMA 5TDNB 2FL5B 4HFWA 2HAZA 2VYRE 1U41A 3GMOA 4HCRH 4LSVL 1DQDL 2NCMA 2V2XB 4N9GA 4PJXE 1XR8A 4GKZA 1WQVT 4LCWD 4DGYH 1RUAL 3BYYA 1I1CA 5HVHC 5DMYA 2D7NA 3THMH 2BNQB 1OLLA 1N7ML 2PO6D 4BFGA 1FIGH 3BPOB 3UTSD 1NGZB 4KKLC 3BWUC 4LBEB 2A6IA 4B5EA 4AM0B 5EOQH 1R5IB 5FV2A 4KKCC 2FATL 4KQ3H 2CJUH 1UJ3A 2I9LA 1ADQH 3G6DH 1WJ3A 2NXYC 3B4NA 5I16B 4LP4A 2ZJSL 5ENWB 4LCYA 3HI1A 2IPTL 3QZWA 4P3CL 5FHAL 1A6VH 5E8EA 4OCYL 5JIIA 2DDQH 3MGOA 1ZLUK 5DO2D 3RKDD 1FFQA 3CH1A 5EN2B 5I76B 1LDPH 1FVCB 3R0MA 4ORGB 5B39A 1V3JA 2FL5A 1HWHB 2CUIA 3V4PH 3QWOA 2A6JA 3C08L 3ORJA 4P3CH 5FHAH 4K94C 3QPXH 2FBJH 4ZOCA 1FE8L 1KLUB 1ZS8A 5JHDA 4BFIB 1BAFH 1A3RL 3CDCA 4ZO9A 1SJEB 1LDPL 4KVCH 3ARDC 3OKOA 2ARJA 2PF6A 3NACL 1YNTA 3Q2CA 4NZUL 2GSIB 3A6BH 1OAQH 2VZTA 4S1QL 4P5TA 5C0AE 4Z5RA 3C08H 1BFOA 3JTSB 3HUJE 1ZE3C 4K94L 2D7PA 1U3ZA 3IDYB 4NGHL 1E4WH 2F53D 4NHCL 2AXHA 4OF3A 1QFOA 1KIPB 5JA8B 5MEQB 5I1GH 3OAUL 1QKZH 4YUEL 1MFBH 1TJHH 3ARGD 3D3VE 1I1YB 2P5ED 4BQ8A 3WFEH 3DV4B 2HRPL 3CMGA 4CW1A 2A6DA 4Y2OA 4OBSA 3NBNA 1D5XB 3F65A 1V7NL 1YNTB 1QYGL 2QSTA 4M6OH 3HC3H 3IKKA 4U1IB 2D9CA 4IRJC 4JHAL 4X5XB 3WDHA 4JRXD 5JXED 2H26B 1BP3B 1AKJB 2NXYD 2VC2L 3V8CA 4X9BA 1F02I 1CI5A 4UI2A 3JTTB 1I3UA 4FQXC 1YJDH 3AUVA 5EZLA 4DQOL 2W0KA 4HC1A 5L8JB 1XF5B 3O45A 4Y16B 5K9KA 5C09A 5A1AA 5DVKA 4ELKA 1HSAB 1P6FA 5BJTA 3NCEB 1S7UA 5EA0H 1IKNA 1CL7I 5FA4A 1KPRA 1H3GA 1UYWH 3E8UL 2XTJD 3L5IA 1MCRA 3BQUC 4LCCA 5LAXB 1FC2D 4LK4A 1FL6A 1BBJA 3SQOH 4XPHL 5LXGL 3ARYA 5IP4A 3SE4C 3PL6D 3IGAB 3U36A 3MV9D 4XPBH 4JM2D 4J3XA 4OZFB 2FDBP 4MDIA 1GIGH 3LKNB 1T03L 1B0GA 2I5YL 2XFXA 4PJAB 4EDWH 1OTSC 2NY1D 1DE4B 1BZ9B 1D5IL 2X6MA 3DVFA 3GSVA 1MHCB 3BAEL 1AHWA 4JFFA 5JW3H 3G04B 4ZSOA 5T33L 2HKHH 4OQTA 5B8CB 3N0PB 4QXGH 2DQGH 1U3HD 2WIIA 5E94B 4KMQA 1I3GH 4WFFD 3TZVB 4P59H 5L88L 1A4JA 4JJHA 1G7MA 4R7DA 5BV7H 4HKJA 5I1DB 5HYJA 3CSPA 3TFKD 4F7CB 2NZIA 3LSOA 4LCUA 1TZHB 4Y19B 1VESA 3PNWB 4U1NB 4ERSL 2ZOLB 3ULUH 1D6VL 4R4FH 4ZYKA 3T0EA 5ID1A 4GSDL 5EBWB 2ZUQB 3EOBB 3VG0H 3DHMA 3S3PA 3AGVA 1KTKE 3ARTA 4LSRH 2GTZB 3DMMD 4RGNC 5E5MA 4ZFOL 4UUJA 5FF6A 1AO7B 3RX8A 1AIFA 1OPGH 4UQ3A 1UWXK 5C0FA 2HTLC 4GBXB 5DSCA 3GMLB 1BBDL 2X1WL 5MEOA 1KN2L 1LEGA 3QIBC 4KPHL 1OOAA 2VUOA 1YPZE 1OWRM 3HZVB 4C4KT 3FAWA 2Y7QA 1YEEL 4A6YB 5DTFB 4YBLC 4F9LA 4K3EL 5T3XE 2VISB 5DK2B 3JV4B 4RRPA 3KAAA 1G7PB 1I1AB 5HGAB 3QIWC 2Y5EA 4V2BA 4BM7A 3UTSE 4QWWD 4F80A 3NCMA 2ORBH 2MPAH 3IJYB 5HPMB 4HZAA 5JDSB 5AYUL 2E8YA 4PTTA 4GO6B 5LGHH 5IMKB 3KPTA 5GQBA 2F53B 2DKUA 1ZT4A 4NCDA 2OL3L 1AXSA 2I9TB 4BSVB 4NUGL 1RMFH 5IK3A 1F90H 1U8LB 1UB6A 5F96H 3UMTA 4FQJL 1CF8L 4QRSB 1A0QL 1MFCL 1RZ8B 2NXZC 2ZSVA 3O4LB 3CZFB 4NDMA 2Z92A 4N0YL 2BSSB 1D9KA 3L3KB 1EBPA 3U1SL 1L7TH 4UB0H 1IGML 3FT2A 3WIFB 5FYKD 3ZDYF 2KUTA 3TZVA 3A6OA 4NNXA 4LLDA 3E6HB 4PLNC 4JREC 3BKML 1X5GA 4KRPC 4X4ZA 3WMSA 3B3IA 4XP9L 2NXYB 2LAAA 4OV5A 1FNEB 5GS2D 3RJDA 3CCHB 4N8VA 2O5ZL 4U1NA 1X5KA 3GRWL 5FCUH 1U2HA 2DRUA 5CJ5A 3QXUA 5IVXB 5TE6L 3GSVB 4XCFH 4OGYL 5IW3A 5HYSA 3QDMB 4JHBA 1YPZF 2IBZX 5GS1C 3MRBB 2NR6D 2V2TB 2VAAA 1HHGB 3NMEA 5A3ID 3EYUL 2Q86A 3MOBH 4GG6F 3GSOA 2BOBB 1I1AC 4PJFF 3O2DH 3RIFK 4K2UL 2X89A 1A7OL 2J8HA 3GHEH 1S7UB 4NDMB 1F97A 4YHLH 2W9DH 1CCZA 2BHZA 4OZFA 1MCWW 3B5TA 4P4KA 1JRHL 5C0JB 2CXGA 2UWEF 5JOFB 4LVNB 1BX2A 4KROD 1YEGL 3HE7C 2GT9B 5D6DA 4D8PB 5JR1L 1KIQA 4AQ1B 2NPLX 4LHUA 3CSYA 3QWRA 3HMWL 2OSLB 4JFEB 5KSUB 1EEYA 4NRZB 1PKQB 4M7LL 3ROLB 3JV0A 5EUKB 4DVBB 4LFHD 3VFGH 4L4TA 1TZIA 1B0WA 1JWMA 2WBJB 4P23D 3GSXA 3LMJH 2QL1A 3ZE1E 1M7DA 5J1SC 5DK2A 2ICWJ 4PP1C 4Z8FL 3UBXG 2A0LC 4AMKH 3N85H 43CAA 4RGMB 3SDDC 3OPZL 4DKEL 1QSZA 3DPBA 1UJTA 2A9ML 4NFBA 4PJ5E 5H35B 3FZUC 4EIGB 3FRUB 3KPMA 2D4DA 4GW5B 4YHPB 3VXRB 3GJEB 2H3NB 1HH9A 4JZOA 2P49B 4XHJD 3VG9B 2EH8L 1FZKB 1AIFB 4Q9CA 4N8VG 1G1CA 3WYRA 1CICD 2AJZA 2J4WH 5I1JH 3SGKC 3LKPB 1CTOA 1KLGB 5EU5B 1VKXA 1Q9OA 4P4RB 1L0QA 2FLRT 5JNYB 3RY6C 4LHJB 1KBGL 4XPAH 1G9NL 4X5WA 5EIQA 4TVPE 3VXSB 1DLHB 5TE4H 1KT2B 4OCXL 2UWEE 1Q0YH 3HPLA 5KJRL 1NCAL 4TSAL 5CIPH 5HHMD 5EC1B 3V5DA 3Q6FB 3U30C 1SEQL 3U7WL 3L3JB 3WS3A 1FGVL 3EO9H 5K9JL 1B0RB 1K2DA 2NW2A 4TRPH 1CFSB 3TA3D 5IMMA 4GQPH 5FO8B 1RJYB 3CFEB 4MDIB 4WI2A 5DVMA 1HIMH 3LEVH 4OF6A 1C1EH 3GSQB 1F3DH 1CDIA 2OZ4L 3NH7L 2J8UB 3G5XA 4MJIB 1PEWA 3SKMA 4N1CA 2MSPA 4HK3J 4J3UA 4Z77A 2CIIB 3MV8B 3QCTH 3ZHLA 3DURB 4L8SB 5L6YL 2R4RH 3ARDD 3BN9D 2B4CL 2IH1A 2P5EA 2R9HD 3NPSB 2R0WL 4I4WB 3E2HC 2G5BA 3T2PA 1EUUA 3HRZB 2HWZL 3MMEB 2FX8H 4LLMA 1XH3A 1I85A 3UJTL 5L9DL 4X6EA 3IXTA 4Q97A 1FVDA 2ZSWB 2G9HA 2EKJA 4U6YB 1UWGH 5MENA 4X8JA 3WXVH 5CGMA 1HXMB 1YEFH 4KVCL 2G60H 1IC7H 3WEXB 1CIUA 4OFYD 1AGCA 1R5WB 1KPVA 3BH8B 3RKDC 3GO1L 2Q1EA 3QULB 5C07A 2DQGL 1I7RA 1WFNA 4KQ4H 3C6LA 3B9KB 4HXBH 4PJDA 5D7JC 4DUXA 1JUFB 4NO0B 2X4RA 1ZT1A 3V4PL 3R06B 5JW5A 1LILA 1AQDB 1D5XA 4WFGE 3ULSB 3QPXL 1JK8A 3ARWA 2KKQA 5HI4D 1FE8H 2ZWLT 4ZS7H 4AEIH 3HNSH 3RY5A 2J6EL 5J1AA 5JHLL 3IYLW 4OI8A 3QBTB 4M1GL 3WFCH 5CD5C 4OD3L 4HXBL 2VKWA 5HHNA 3PHSA 3NFSL 1I9JH 2AK1L 2DL9A 4QRPD 4L29B 4G6FD 2SEBA 4K7FA 4DW2H 3GJEA 2G75B 1UENA 3L6FA 4OZIE 1UH2A 5I66A 3F5WB 3PL6A 3PWNA 4Z7VB 5D96B 4AY0A 2VDNH 4IRZL 4GG6A 5GRVL 4X7SH 3SO3B 4CU8A 4LDLB 3WNKA 1LEIB 1MH5A 4WUUE 3ZYJA 4M48L 4GH7B 3SDCC 3O6MH 5KW9L 4HBCH 2ARWA 1YJDL 4WO4C 4WDIB 2C4FU 5IQ9B 3IU3A 5SX5H 1M71B 5HDOA 2ZUSA 5F3HA 3SJVA 3BZ4A 4XBGB 5T3ZL 5F3HB 5AWNH 5B39B 3WXWH 2WV3A 2X9XA 4U1GB 1ZMYA 5FKPA 4Z7UA 1JGUL 3LN9A 4JB9H 4ZUTA 4LRNH 3WFEL 1FIGL 1EGJL 4YDVB 2GCYB 5F7UA 2IH1B 4KMLB 4Q6IC 4O2FA 4WY7L 5I16A 4P3DB 3BVNA 4G7VH 3MYZA 5ALCL 1NQBA 3FFCA 3WBDA 3R1GH 5DQJB 2UVEA 3VWJB 1A6UH 5DXWA 4YFDB 5IFHL 2AEPH 4NRYB 4LEOA 1TVBA 2ZUUA 3KJ6H 2WZPD 3C2SA 5DURB 5IHUL 1I7TB 2CKBB 4HQQL 4KUCD 3SE8L 4PY7B 3I2CH 4R97C 5I6XB 1T2JA 1U8KA 3MRQB 3OV6A 3MFFB 4RISH 5BMFH 3P4NA 5K33A 2E9BA 4F15B 4XC3L 5GISH 2GYSA 4JRYA 5KSAC 3IAGC 3CCHA 4N8VB 3FO1A 1CQYA 1KELL 2PXYA 4UV7H 3QUYB 4NQDD 1T83A 4BSJA 5JW3L 5I1LA 5D1ZB 4APQC 3S35L 3ILPB 5CGYC 4NQUA 3BOVA 4PJHB 3NACH 1AI1L 3EDFA 5E99L 3MRPB 1UA6L 3HNTL 5E24E 1A7QL 1T7YA 3H9SD 4LU5H 3KYKL 4M93B 2Y5TA 3MFGB 4ZFOB 3FCTA 2IGFH 2V17L 3V52H 5J06A 5I75C 1QLEL 4L8SA 1DBAH 5CUSH 3ZT5A 1NBYB 2QEJA 3SBWC 1BZQK 1QVOB 5IMKA 4HIEB 5HYIA 4LU5L 4K7PX 5AG9A 1U3JA 1FG2B 4LHUD 5C0BA 4HWEH 3H3KA 1ITBB 2IMMA 2FECI 4LAQL 1CD0A 5HDBF 1UWXH 3VMPA 2VDQH 3OF6D 4XNXL 4U49A 2OMNA 3I50H 4P5TC 4EVNA 4JPKH 1XZ0A 5JXEA 1OQOA 1VDGA 1E4XL 3RDTC 1P84J 3RWDB 5C08B 1F4XH 4WUKH 3LN5A 3WFDL 1A9EB 4L1HA 2YD9A 5JHDE 5I19H 4L4TB 3SDCA 1R3KB 4WFHD 3L1OH 5TPWL 1RZFL 4WI8A 4NWTH 3L3OA 2CK0L 3QEQE 1EFQA 2XKNA 3MYJB 3HE6D 2P42B 1DCLA 5E8PA 1EAPB 1R3IH 3QPQC 1LWRA 5D1ZC 4JPWH 5J13C 4OJFL 5HI3D 3HAEH 1NMBL 2R0ZL 1CU4H 3BQUA 4UNUA 4JN1H 1IGCL 2V5YA 4KK9C 5HJ3A 4G8FA 1RULH 1R3LA 4IBLT 3AREB 2JB6A 5FM5M 3LKPA 3HA0A 4YHNA 1WBXA 2ZPKH 4PJAE 1AC6A 3QWRD 4G9FB 5C07E 4TOYH 2B1AL 2B2XH 4ISVB 4TNWK 4Y1AA 4QRPE 5J0BA 4JRXA 2Q8AH 4N0YH 1F58L 3WIHL 1T1WA 3QA3A 2ZNWA 1K8IB 2Z93A 1J11A 1T1WB 3WFHB 4IRJD 2EDKA 4PLJC 4Z7NE 3VXRA 3TEUA 2FJFB 1WSST 4XHJC 1YEDB 1YNKL 4PUBL 1HKLL 1MI5E 3MJ9L 3UPRA 4LLWB 4CMMB 5HDBE 3EO9L 4Y4HA 4P2OC 3A0OA 5F1SA 1E6JH 4LVHC 4EBQL 5IJVA 2ZCKH 1JBJA 3HR5A 5HJ3B 1B4JL 1XGTA 1A6AB 1L9NA 3KVQA 3IGAA 4IRJB 3RPKA 5D1QD 4DJMA 3BO8A 5D7IB 2HVJA 4KFZC 1RIUL 1IQWH 4APQA 1BQUA 1CWVA 3EYFB 3BGMA 3JVGA 1S5HB 4PJEE 1HOCB 2H6PA 2M8XA 3WJJC 2QLVB 5J6HA 1MJ7H 4ODVH 5I74B 5ICYA 3ARBD 1FN4B 2DQJL 2VR9A 4U2YA 2OX5A 3BDYH 5GRYA 1EVUA 1UM4L 4F7EA 2Y72A 5BS0D 3W0WA 1CLZL 4POYA 5F9JB 4JDTH 1N0XH 3SDYH 5LWYL 4JFXA 1QSVA 5ESAA 1T0NA 3DARA 4OCWH 1H15A 1OB1B 5D2NB 2YA1A 3GI9H 4KI5C 5F89A 4KK6D 5C0IA 1ZT7B 1NJ9B 1E28A 4K3JH 4P2CG 2CRIA 2EYSB 2ITDB 1FFPA 4YGVB 2JIXA 3OJDB 3W2DH 2C3WA 3S7GA 1G7IA 4UINH 3TCLB 4PJAF 1LK3L 5E2UL 3T3PE 2PETA 1I1AA 5HGAA 3RZCA 1WTGT 5DJ0B 4AEHH 4LF3B 3RWDA 5ILTH 3C87A 2F58L 1PEZA 5KSBF 2JCCF 4L4VB 1QUNA 2K3TA 4KV5F 4Z78A 1NDGB 4MCYB 4ZQKA 2ADJA 2DIJA 5E95B 3M07A 3RA7L 5DRNA 4H5SB 4FN0A 5IVXA 1FSKC 1QBML 3GMLA 4UT6L 2BNQE 2Z31B 1MAML 2LE9A 4UT9L 3H7BA 1CG9A 3QDHA 1KG0B 4KKLD 4XPAL 4D3CH 1OT2A 1A9BA 3QSKB 2JJTC 4UOW0 2DLFH 4MCZA 2YZ8A 4J4PC 5TQ0H 1QEWB 5F7WC 4G9FE 3O11A 1HCVA 3TZVC 1M4KA 2QHRH 3QJHA 4LKXA 3BUYA 4ZYKB 4HIHA 5JW4Q 4PJ8C 4D9QE 1TXKA 5KJRH 5F7MC 4I48A 3VXOB 2CO6B 1T1ZA 4KK5D 3B9EA 4YZFF 5DHYA 1C16A 2AS5M 2VDKL 1SJEA 2HJKB 2VDLH 3OR6B 4WFEE 3JVGC 5BW7C 4FZ8H 3ESUF 1ED3B 1BVLA 2A38A 4OF7A 2J88H 3IRPX 4L9LC 3BMVA 3IJHA 5KVDH 4CN6A 1U8LA 3HC0A 1FAKT 4FQLH 2RB8A 5K59E 4OZHA 3T65B 5E8OB 4OFYA 4HUXA 1V7MH 2ZG3A 1MCLA 4UQ2B 2BVUA 4HF5H 5IIEA 1QSEA 4TQEL 3NTCH 1YDPA 1G7QA 4H5SA 4LHQB 5AWNL 1J86A 2VDLL 3D39B 2PW1B 5LGHL 3QI9D 5GGQL 2BZDA 5FGCB 3PWPB 4PY7A 3L3HB 1QPXA 1U8OA 3AS3A 5LQBL 1MWAB 2DQIL 3GKWH 5KZCD 5DJAB 3MLRL 3EYOA 3LPGA 5KSBE 1TETH 1RHHB 2B20A 1G9NH 4GAFB 3CFIC 4FZEL 1QPPA 1OARL 5HHQB 5IOPB 1JV5A 3FB7B 4ODTL 2DB8A 2VIRB 3G5ZA 3E3QE 1NL0L 3VI4E 3ZKQD 3S96B 3VFNA 2DTMH 3IFNL 1WT5A 3L7EA 4J8RA 3FQRA 4O00A 4WO4D 1MCEA 1AKJD 2BRRH 3WCYA 2I60H 4OGAC 2VXUH 5CEXA 3QG6B 2MWCA 1T1YA 1JMZA 2AXGB 4ENEC 5F9JA 2WQRA 1J05A 1X5LA 4RA3A 3BE1L 5F88B 3WLBB 5KG9B 1RIHH 4QRUB 1TCRA 3MRCB 4LMQI 4YR6B 4OB5H 5JHDD 1S9XB 4OIBA 5JXAH 2UYLA 3TBSA 3P30L 1QA9B 2CDEB 3O8XD 5TDPA 3O6KH 5L9DH 4M5ZL 4PRDA 4OGXL 5IVXF 2BP3A 4M1CD 1MVUB 4P57A 4JE4B 1T7XA 5E6ZA 2B0SL 1ULVA 3RWFA 5C6WH 1QRNA 1T04B 4OB5L 4JRYB 4NQCB 5BRZE 3KXFB 3MBEC 3V7AG 1V5JA 4B7LA 2XWJA 2X89D 3W9EB 4GG6B 2R0WH 3EKCA 3NIDF 3WS6C 3H0TA 3B2UD 1QFUH 1D5BA 1L6XA 2R2EB 5E9DE 1KN4H 1B0GB 1I1YA 1D5BB 2OXGA 2R2EA 3P0GB 4FQPA 4NN6B 3DO7B 4Q9RL 4C4KO 4ONHA 4U1HA 5EU6D 1SY6A 4Z0BH 5C0NC 2J8OA 1A21A 3PQYA 2VNCA 3UC0H 1TTUA 1SVZA 1GAFH 3RVTD 4NM8H 2J5LC 1TJIL 3B9KA 1G6RL 3VWKC 4PGZA 3CLEH 4DN4L 2H9GB 2EEDA 3O3UN 2NNAB 3MLUH 1AGBB 4ZUSB 5HI5D 4F9PC 1WCQA 2P7TB 3QUZC 1HHIA 1Y0LB 1KB9J 5ISZA 3QEUB 2QQNH 5HGDA 1RI8A 5CHNA 1EEZA 2H2PD 2B8OT 2YS4A 3BPCA 4PJGE 2DIBA 4Z7QE 5D2LA 4HWBA 3DUSB 4DOHB 2X4PA 4JFDE 3B9DA 1JHLL 3ARGB 3MV9B 3GMRB 4OIIL 4ZTOL 1JP5A 4LLVB 5EN2A 1ETZB 2VIRA 5JHDB 4M43L 4JO4L 5SV3A 4AIZA 5CINL 4YBHA 5CJXA 5IIEB 5J9PB 4HZLA 1GPOH 1I7UA 3TPKA 5DMGC 4QT5A 3DGGB 3NCJL 2VC2H 1FL5A 1BJMA 4FQ1H 1MCSA 3F8UB 4W6XB 2AJYL 2VLRE 3DX6A 1YY8B 4IOFD 4ODWA 5FAAA 4KI5D 1A6ZA 3QUMB 2C3GA 1TMCB 4Y2DA 3RBGA 2X4QB 3CMOL 4JFDD 3PWVA 1KIRB 3QFJE 3WL9A 4EUPB 4JFFD 1MREH 1P6AB 5D1ZD 2YBRA 1EHLL 3MV7A 4YK4C 1TVHA 3DI3B 4I18B 3M1BB 4FQQA 3OX8A 3FT4B 4H26A 4HJ0D 2X1PA 2WP3O 3QUXB 4X9HA 3IJHB 4XVUC 4Z76A 4ZTPL 5CD5D 4KMTL 1OL0A 4JZJA 12E8L 1WZMA 4F7PA 5FECA 5B8CC 4XNMB 2VITA 4X7TA 1G0XA 3I6KB 4NQCE 4RMSA 4GMSL 4NQCA 5J3HC 1P4BL 2R1YB 1YECL 4PJIA 3VXUA 4WW1A 2J6EA 3HNTH 4KDWA 5HSFA 3VXMD 3KHOA 3GHBL 5AZEL 4ZO6A 4PP2B 3IDGB 5K9QG 1IGIH 1NGPL 4PJGF 4PJIF 3SBWA 4BZYA 3TNNB 1NGWA 1Q9WA 4MNQB 1DSFH 3MJ7B 4R4ND 3S35H 4YC2B 3ES6A 3UJJL 2X42A 5DJZA 2J8UF 4E5XA 2VH5L 3M8OL 3HZMB 1WBZB 1NEZB 1MJUH 2NTFB 2QQQA 1C12A 5DQ9A 2FJGB 1INEH 5IT2L 1IEAB 1NDGA 2CDFB 2X9YA 3CK0L 2FBOJ 4EDWL 1CICB 5FFLA 1RZIA 3KPLA 3U9UB 3S36L 2Z35A 3LB6C 1OGAB 4RMQA 1QNZH 2AXJA 4XMLH 5MI0C 1VACA 4YFLI 3WN5C 5T3ZD 1KPUA 2DI8A 3BP4B 4LBEA 2XWTB 1FN4A 3VW3L 1QA9A 2CDEA 5AEAA 3SQOL 4XPHH 1XIWC 1MLCB 3SY0B 3OSKA 3LEYH 3CFBA 3O0RH 5EUOA 5IW1B 4N8CL 4C56A 3TIEB 1OGAD 3FB6B 4OFKA 3LPFA 3QEGH 3U6RA 5FM8A 4LFHG 1NBZB 4XP4L 5DMGD 1Z6JT 1F4XL 4WUKL 1BD2E 2R0ZH 1NMBH 1IE5A 1W0WB 3UJIL 2AEWA 1BWWA 1PW3A 4RGOH 4XBPA 1FNGB 2FRGP 5LGKA 2FO4A 2GUOB 4JFED 1S7XA 1IT9L 3ALXA 3VFOB 1IC5L 3WUWA 2OR8A 2MMXA 3L7FB 4NWTL 1F2QA 4OZGA 5JOFA 4EJ1C 2HLAB 4FG6D 4MVBD 1Q9LB 2CDGB 1AGBA 4NHCH 4ZUSA 1JNLH 5F3BB 3LRHA 1O0VA 4JPWL 4NO3B 5DEGB 3GKZA 3HNVL 2OL3H 4LIQH 5DJXA 3EBAA 3QUYD 3KDMA 4ELME 1T5WA 3D25B 4NQED 3LN4A 3QNYA 1IGCH 1YY9D 2SEBB 2GJZA 1U8MA 4RDQG 3VXTB 3TYFA 5L2JA 3PWUA 4K9EC 4YK4B 1G9MH 3L1OL 3P9MB 3STBA 2QADD 1QRNE 4JZOB 1A6TB 3SGDI 5F44A 2YXMA 3D39D 2AEQL 5JW4M 3RI5F 4ZUVA 3RZCD 1SY6L 1H5BB 3QDMA 1BBDH 1UKTA 4I0PC 1KEMH 4OCRH 4UIKH 1J7VR 4D0DA 1GGYA 1YMMB 3FQXB 4FA8A 1LD9A 3KR3H 4KGJA 2QSVA 2AXFB 4N8PA 1FGNH 3KWWB 3DGCR 1YC8A 5DD6A 3QXVA 2DQJH 4KUCF 4OZGB 1QLRB 3QWQB 4R4BA 3D9AH 1E28B 4UINL 2EKSB 1B4JH 2UYLB 1NLDH 5D7KE 5C0IB 2WLYA 1K8DA 3B43A 2XG4A 1RZJC 4YXLL 3MLPA 3JSSA 3VRLF 4P46A 3QQ9C 3ARUA 5C0RL 4P46B 3Q1SL 4G7YH 4WU5A 2YRZA 3QJFB 4Y4FD 3VFRB 2O5ZH 2BVPA 4Z78B 1TDQA 5JZ7D 5JPMB 1NFIB 1IAKA 3SY0A 2W92A 2X70A 1C12B 5DQ9B 1CLZH 2BSRB 1WFOA 1MRCL 1NFDF 1FC1A 2VLJA 2J8UA 2DQHL 1BPVA 4LEXH 3LD8C 3QEHA 3FB5B 4PRHD 4XC1H 4LSTH 3OQ3B 1ADQA 3BKYL 4FTVA 1J1OL 1CVRA 5DR5H 1J8HD 1II4E 2YUVA 1S9WA 4L3AA 4X4ME 5C9JB 3LQAH 2ZCLL 2F15A 3C9NA 3FTGB 2EO9A 3VD7A 1BWMA 4JQVC 4KJQC 2NXZD 3KJ4B 3P4LA 3BYTA 2F19L 2P44B 4EUPG 3MLVH 3MJ7A 3MRFB 5C0AB 5BRZB 4Y5VA 4MXQD 3F12A 4OJFH 1JGEA 1H5BA 2R1WA 3OKLA 3MLZH 5DZOA 3LKSA 3UBXI 3KNBA 2OJEB 3CXHJ 5DF0A 5HYSG 1RQ5A 1I7ZA 3KPQB 5FB8B 1C16B 1R3LB 2EDJA 1Q72L 4HH9B 3SDXA 4MJ4A 2NXZB 2EDNA 1FVEA 2NY1C 3B9KD 4ZUUA 1J87A 4ZFGL 5J57B 3PF2A 5D7SL 3VWJA 4S2SB 4MQXD 4YBQD 5KSVA 3UPRB 4HPYL 2XA8L 1SJXA 3FQNA 4JQIL 2C3VA 4NO3A 1N4XL 2NY4D 5AZ2H 1DVFD 4PJ8D 2EECA 4I18A 4DUWA 5ADOL 4TSCH 4C55A 1YEKH 5T1LD 1NLBL 3VXNA 4DWHA 2DQUL 2GI7A 4GBXC 5J11B 1OAZL 2D9QB 2EH7H 1NEUA 4E9LA 4QHMA 4WI9A 3AMLA 3PWVB 1QRND 25C8H 4PJ7B 3D85A 4RWHA 4ZTOH 1UG9A 1C5BH 2YMXH 5T1MA 4KHXH 4WFED 4JQXC 5KVFH 5F3BA 1NUDA 4TQEH 4K3DH 5GIRB 1RIUH 4JZJC 4OLWH 1XF5A 3O45B 2VB5A 5C0CE 3W82A 2AI0H 4XCEB 4KTYA 2P5WE 5J13B 1A1OB 3QXWA 5E2WH 1XF3A 5F89B 2VLME 3CGTA 3ZKXB 1FP5A 4Z0XB 1TQBB 4JGMA 2HLFC 2AVGA 1CS6A 3CC5B 2OCFD 4YNYB 4QGTA 1KCUH 4LLQA 2XTLA 4XXCC 3G6DL 2JTDA 1K9TA 4WEBL 3VA2C 1GOFA 3QG7L 5EU3B 1BF8A 1TQCB 1X9QA 2XRAL 1KCRL 1A7RL 3LSOB 5EULV 1UACL 4HKXA 4JR9L 4POUB 4ONHB 1FO0A 3FAXA 2ZCHH 3RX7A 1WF5A 2GITB 1R3HA 1CGUA 3QFDA 5EOQL 4U4BA 2MNUA 5I73C 2F9BT 3KPNB 4BKLA 1WICA 2Z35B 4RMVA 4X98B 4FQ2L 3PXJA 2FB4H 3STLB 5DMKB 4WVRA 1U6AH 2JCCA 4X9IA 3MRRB