5FV1L

Crystal structure of hvegf in complex with vk domain antibody
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VK DOMAIN ANTIBODY
publication title Novel Interaction Mechanism of a Domain Antibody Based Inhibitor of Human Vascular Endothelial Growth Factor with Greater Potency Than Ranibizumab and Bevacizumab and Improved Capacity Over Aflibercept.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 23
structure length 108
sequence length 108
chains with identical sequence M
ec nomenclature
pdb deposition date 2016-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fv1L00
4RRPG 3QUKA 4JFED 3HNVL 2BVPA 43CAB 3UROR 2L7UA 5IT2L 4U7MA 1S7TB 4QHNA 2FJGA 3Q0HA 3KG5A 1T7VA 1AD9A 4JZOB 3HCVB 5C0CA 2ITDA 5T3XE 3DGGB 1K4CB 1Q72L 5IB2B 3LKOB 4XNYL 3RRQA 4JFFD 1YMHA 4TUJA 3U9PL 5ITFB 4GKZA 3CK0H 4DGVH 5FFLA 2X4RB 3EYOB 3LVEA 5E9DE 2ADFL 4QWWD 4RGMB 5GGQL 1C5BL 4JVUA 1BZQK 4JY6B 1NKOA 1CLYH 1RK1B 2B5IC 1E4XL 2AJXL 5KAQF 1YUHB 4EI5D 1SYVA 1RUAL 1VGKA 3BXNA 3GK8L 2BX5A 4S1RH 1MWAB 4KHXL 3E3QC 1FNAA 1UKTA 3OPZL 2CIKA 1E4KA 2VLKB 3F7RA 3ZDZF 3Q3GA 5J3HD 4YXLH 5DJZB 5ALCL 4LBEA 5ECJE 4X8JB 4OGYH 1JF1A 3MBXH 3QZWB 4QRTB 1YEGH 3PGDB 3SBWA 1H15B 3S3JA 4NOBA 5LWYH 2BJMH 3U36A 4R0LC 3TT1H 3V6OA 2VISA 2FIRT 4P0DA 1F3DH 3O3AA 4K94C 3OGCB 2RQ8A 3KS0J 3QEHB 5GJTH 5IB5B 4AK1A 4FFVC 5EU3A 3WIFB 1RZIB 5CINL 1ZGLM 1MWAH 1C12A 1GYAA 5TH2B 3IDIB 3G6JF 5BVPL 1RU9L 2XWTB 5KSAC 2J6EA 1WISA 3A6CL 4XMKL 2W07A 3O6FA 3U6RA 4D9RE 2JLLA 4D0DB 1CYGA 5CBEB 5GZND 2HVJA 4U1GB 5EC2B 3QUMB 2YMXL 1X6NA 5C09B 3RU8H 4LSUH 4F57H 5AYUH 2D0FA 5HYQA 4GW4B 3U0WL 3KDMA 4ZUUB 3OR7B 3O8XC 1SBSH 1IM3A 1ZT1B 3MRLA 5B4MD 2YC1B 5J6HA 3UBXA 1F58L 3DXAD 3EOAB 4YE4H 3IFPB 3KPQB 4P4KC 5BVJA 1CF8H 3JTSA 3RGHA 2E9BA 4PRIE 2DBJA 4BUGA 4PJXB 4WEBL 4JVWA 3S97C 5CGTA 1CIDA 3BH8A 2V5RA 1KC5H 4FQQA 4OZ4A 1T22A 4I13B 3V6ZA 3RVUC 2NY4B 4OI8A 3VW3L 2DJUA 3QUMH 4N1CA 4F2MA 2DYPA 2Q76A 3GNML 4YBHA 3FONA 4HEME 5DJYB 4NQCB 3ULVL 5BMFL 1N8ZB 1ORQA 1J7VR 3HG1D 2J8UA 4EUPB 1NFDA 4OV5B 2ERJC 3UTPE 2Y72A 3NIGE 3DURB 1AI1L 4QOKA 3SOBL 4P9HL 4C54A 3CFCL 5IGXH 2EZ0C 4HFWA 2CLZB 3CX5J 4PRHE 4Y5VB 4G6FB 1HDMB 1FVDB 2Z31A 3QI9C 3TJEH 4XC1H 2XTJC 1W0WB 1MRFH 1T89C 2CLRA 3T0AA 2X4NB 3VU2A 4FS0A 3MUZ1 5SWQB 5CD5C 2C5DC 2YPLA 2XN9B 3VJ6A 3GEWB 3DVGB 1MAML 1G0XA 4EUPH 4X9BA 4H8WH 1IE5A 5CP7B 2UYLA 5C2UB 5HDBE 4JFEE 3PDOA 3FZUC 1A6ZA 5KS9A 4LLDA 4M6NH 2VZTA 1T3FB 2BNQA 3C08H 1CQKA 3V52L 1KSRA 3RVVC 4YO0A 5IV2B 1ZEAH 4ZXBC 4M1DH 2DQTL 4C58B 1CWVA 3MJ8A 2JJVA 3GB7B 3SKMA 5H94B 5C0RH 2JIXD 1OGAD 4MQSB 4HH8A 4P23D 4DK6A 4F7CA 3QO1B 4WNQB 3GSNA 3HHRB 3O6KL 3HC3L 5AAWA 5J56B 5K93A 4J6RH 5FHBH 3O4OC 1IEBB 1G6RA 5L2KB 2W60A 4M61B 3MLSL 1FZKA 5J12B 2A74B 4POZD 1QRNB 1MJJB 4YHZH 4ZS7H 4MXVF 4JEGB 5SV4A 3S36L 3THMH 1HH9A 1CGYA 4XVUC 3UAJC 1KJMB 4RFNB 1CXHA 1U2CA 2FECI 1S9XA 5A1AA 2PCPA 3WO4B 4P49A 1ZT4B 3BAEH 4Y5YC 1P6FA 3KWWA 2Y5TB 4NUGH 3IDMB 5E94A 3LB6D 2A6IA 4G42A 1S7RB 3BH9B 4PJIB 5D7KD 5IHUH 1G9MH 1DQLL 43C9A 4WW2C 4HZLB 1S7QA 3MJ9L 1T03H 1IC7H 1U36A 3K8KA 4XBPB 5E56A 3NFPB 4ODVL 3RA7L 2NY6D 5C0AA 1QQDB 3GI9H 5JXED 3RWEA 1CGUA 4DKEL 5F3HA 2XI9A 1OP9A 3T2QA 1FC2D 4HUXA 5F7EH 4XVSH 3SE4C 1ZOXA 4NC2B 4LOUC 3SHSA 4LLWB 3T0VA 4TNWF 1F8TL 4OLXL 4U1LB 2NW2A 3X3FH 1CLCA 1QLFB 3GMOA 4JRWA 4E5XA 2P5EE 3MV9B 3M17B 5KZCB 2W0LA 3DXAE 4CJ0A 4HUMB 5H2BA 4AIZA 1IGMH 5HHVL 3MBEB 4XHQA 3IAGC 3QWQB 3BWUC 3W2DH 3O45A 5IFHL 3KYMA 3NA9H 1IM9B 4PJCA 5EN2B 1ZHBA 1NC4B 4GAGL 4GMTH 3PP4H 5HPMA 1P2CB 5CD3B 4FXKA 5GRVK 4QHMA 3Q5TA 4WI6A 1EDQA 2HJFB 4WU7A 5SX4H 4PYGA 1QR1B 2EXWC 4PGZA 3M45A 4PTUB 4U33A 3TCLB 1A3RH 2JJSA 2XY1A 2XWBB 1KN4H 1UEYA 4NJ9H 4O00A 1X3DA 3N1QC 5MEPB 4Z77B 1PKQE 3HG1E 5TQ2H 4KZEH 4KHTL 4DFIA 3NOIA 4APQA 4RIRA 1HE7A 2ZPKL 4OUOA 3FT4B 4OM1H 5I1GL 2P24A 3QP3A 2M2DA 1X5FA 5DQDL 4PLJD 1XF5A 1IQWL 1L7TH 4MNGE 1G7PA 1QSVA 2D7PA 4PJHB 4XGZA 5DQ9A 5EBGA 1YEFL 2ED7A 1X6LA 3FQRB 1IC4L 5JHDA 1W0YT 3VWJD 5HGAB 2J8UF 4Y4KA 4LEOA 5EFIB 1A7NH 1IGYA 3NZHL 1U8QA 5F9JB 1KEMH 2W59A 4H20L 4K9EH 1QBMH 2DL9A 4Q9CA 5D2LF 4NQSA 4HX1B 5D7IB 5GS0C 3MREA 1FL3A 1T83A 1EEZB 4Q2ZA 1FYTB 2AK4B 2XNAB 3QIBA 2OL3L 4I3SL 3LQAL 1UXSA 1KGCE 4RMTA 1HYSD 3QUYA 3V4VL 3B8YA 3RDTC 1DZBA 3T2NL 1H9VA 2F58L 2WMPA 3SDCC 3MA7A 3W9DB 2A6DB 4WW2F 2YD9A 5GPRA 1I7RA 1NGXA 1O5DT 4M9OA 2PETA 1P4BH 5FEBA 2YD8A 4CN1A 3QISA 2HG5B 4NOFA 1MH5B 4QCIB 4DN3H 1A14L 4XTRD 4WUUD 1XH3A 1VENA 3TJHD 2WUCH 3BKYH 2Y06L 5GRUL 3W11D 2F19L 1MQKH 2IBZX 4LHUA 4AEIH 1YJDL 3JVGC 5B8CB 1T21A 1REIA 3SO3C 5DRXA 1OAUH 5F1KC 2FO1A 4L4TA 5ADPH 3HPLA 2DQEH 5K9OB 3EO9L 1JRHI 3HLAB 4N8CL 4X7CC 3FRUB 2OR8A 5DFTA 3TO4B 1CT8A 2IF7A 3FHAA 3QIWC 1XIWD 1TQBC 3ILQD 1Z5LA 35C8H 1D9KB 4JFFA 3QRGL 4PY7B 4F33B 2FYYA 5D7KE 4I3RH 1KELH 5IW6A 3IFNH 3ARYA 1SEQL 4K3DL 4H5SB 2R1YA 2IALA 3PWPB 4FQXB 1DUZA 4MJIE 5IQ7H 1UYWL 1HI6B 4UOW1 2ICEB 3O6ML 5CKGA 2KL6A 1JNNH 5CJXC 4YHYB 3ZTNL 4NZJA 3OKLB 4PR5A 3DX8A 2GT9B 2I9TA 5BZWA 3L3IB 4OCYH 4UU9A 1W72A 4W6YB 1M6OB 2C1PB 3CGTA 3GJEB 4ELMA 4HC1A 2VDKH 2WUBH 5FYJD 4GRLC 2LQRA 3UPRA 1C16A 4WO4D 5DJ2B 1AHWB 2EDFA 1FVCA 2BMKA 4TVPD 4XP5L 5F6HJ 3HNVH 1IQDB 2WWMD 5IT2H 4G8EA 1BM3L 3CXHJ 2H2SC 3MRNA 4Y89A 4WFEE 2J8HA 2X1PA 1GZQB 1A7RL 1UM4L 2ATKB 4LCCB 1Q72H 4HIIB 3T0XA 4F3FB 3TA3B 4KXZH 4XNYH 4XHJD 5INDA 1KTKE 4Z7UF 2R0KL 4BFBD 1FJ1B 2YSSB 2DWDB 1RK0A 3U9PH 5DDHA 3DYOA 3ARFC 3QH3B 5GGRA 5EU5A 1HN1A 1T2JA 2CK0L 2ADFH 15C8L 3L3GA 3O3EA 1EEUA 1C5BH 5GGQH 3C5ZD 3TH2T 3T0DA 4NNPL 5HGHA 4UUJA 4J3OC 1VHPA 4PJCF 1E4XH 4NO5A 2AJXH 5HSFA 1MCQA 1L4IA 3G5XB 1II4E 1RUAH 2YBRA 4U2ZA 5LKNA 3GK8H 3MV7E 4KHXH 3OPZH 1JL8A 1QVOA 3HUJB 2X41A 2XKNA 3BKJL 4OFYD 5TGBA 5IFAL 2CXKA 5ALCH 4Z7VA 3V5HA 4PJ9B 2YA0A 1CS6A 5EU6E 5HD8D 3BUTA 3T0ED 3G5ZB 3QXUA 4MAYD 4NKOA 3WN5B 3JWOL 1TQCB 5C8JB 2WW8A 4DQOL 5SWZA 2VNCA 2HJLB 3HNSL 4BSVA 5IBUB 1ZWIA 3RPIB 1OW0C 3SE9H 1I3RA 2ZUQC 4UT6L 2O61B 4KRPB 3ZE1E 5EOTB 4W70A 1OB1B 5CINH 3HI6L 4ORGA 2HJKA 5BVPH 1RU9H 3WDIA 5K9JL 5J1AA 4S0TD 2ZUUA 3A6CH 1U95A 4XMKH 5I1IL 4UAOC 5B39G 1JPST 4QYOB 3MUGA 3QG7L 3AB0C 2HFFA 5HGBA 2YMXH 2H6PB 1EZVY 2DLEA 1KPUB 1CFSA 4EVNB 2BOCA 3DUHA 3U0WH 4CVZA 3O3DA 1CXIA 3T4AB 5ICXA 4O02L 4DUVA 4PJ5B 1H3GA 4MCYA 1F58H 1A6TA 3RWJA 4H0IA 5HYJB 4NN7B 4PJFE 1U8HA 2VOTA 3X13B 1CN4A 3OAUL 1DBKL 2AGJL 2P8PB 4B53A 4W4NA 1T1YA 4WEBH 3VXPA 4YFDB 4JR9L 5DJCB 3K2UL 3VW3H 5TDNB 4ZPTA 3R4DA 4DVBA 5HYSB 2DJSA 2IQAB 3ARED 4NZRL 5EO1A 3PP3K 4RQQB 4RAVB 3GNMH 2VJXA 1T4KA 5D4QA 3ULVH 5BMFH 4OLWL 3RIFK 4YH6A 1SJHA 3CH1B 3VE0B 3ZYIA 2R56L 4ELKB 2EE2A 1VFAA 1RD6A 1TPXB 2G2RB 2JIXA 4IIQC 4M5YL 5FA4A 1IAIM 2E5EA 1AI1H 1OGAA 2CDFA 3SOBH 4P9HH 3CFCH 2W9EL 4Y0GA 4FFVD 1IRAY 3OJMB 2DQJL 5BV7L 1D3CA 1IGJB 5ANMA 1R0AL 1V05A 1EHLL 4WWKB 4XP4L 1BFTA 1YN7B 2C3VA 1P4IL 4JJHA 5KSAD 4JY4B 5KAQG 3LDBB 4ONHA 1AD0A 5KW9L 3DPBA 5M94B 1DANU 7CGTA 3QCUL 4Q7DA 3KR3L 4OF5A 4Y8AA 2IEPA 5FYJE 3VFPB 3KPNA 1MAMH 3O8XD 4O2EA 1CDBA 4ZUSA 2APVA 2EDTA 4TVPE 1U8OA 3ZDZE 2FECL 1BBJB 4XBGA 4P4KD 2XYCA 5EPMA 2VQ1B 3V52H 1MPAL 3D6GA 1BX2B 2CKBL 4JLRB 3FO9A 3DMMB 2X1OA 4ELMF 2DQTH 5IJKA 2R1XB 1D5XA 1S5HA 3ET9F 5ESVA 3RVUD 3IETA 5JXEA 2BNRD 2R2BB 3ZKSD 3VXOA 1W8NA 4MD0B 4XPBL 1TDQA 4NWUL 1OLZA 1ZHLB 4HJGA 3BSZL 4I48B 2UZYB 5T1MB 3ZE2F 5I16B 3RGVB 2FR4A 4NBYB 3O6KH 1T20A 3HC3H 2PTVA 4IS6A 3LS4L 3GSXB 5E2VL 1MCIA 1DANT 4U1NA 3MLSH 2BC4B 2G9HB 2EZ0D 2H32A 2X4QA 2IH1B 1LVEA 3S36H 3E2HB 1U8PA 1D7FA 1B0WA 4R97B 3HR5A 1CFQA 3QI9D 2XTJD 1A5FL 1H5BA 4LNVA 4F7TB 1FO0B 4L3EA 2V5SA 4HDIA 2FWOA 3ARBC 5IVZB 4U3CA 3ZT7A 2BOBA 1WBZB 4HLZH 1E28B 3L95B 1W0VB 3CX2A 4MJ2A 5CD5D 1ZE3C 5DD5L 5I1AB 3F62A 4RGNC 3SKJL 1KG0A 5BQ7A 1QFPA 3WJJC 2C7UA 1DQLH 1N3NA 2UUDH 2V2XB 4Z7VF 3SDDB 4RMRA 1J8HB 1AE6L 3MJ9H 3DTXB 4YDJB 5JW4Q 3FZUD 3P4MB 4KMLB 4ODVH 4RCAA 3RA7H 1NUFA 4M4RA 3OKMA 4JZOA 4DKEH 2P8LB 3RVVD 3O4LD 2KDGA 3DGGA 1K4CA 4ZXBD 4GOSA 5ETUB 3D3VB 3LKOA 5IB2A 5D71L 3QXDB 4LRNL 1F8TH 4OLXH 4PGCB 2NZ9C 4YXKL 4U6TA 3V79C 5ITFA 1AQDB 5C7XL 4HKBB 5DHVH 3L3HA 2A2QT 4HG4K 1E4JA 4I8DA 4P5KA 3U9UB 1K3IA 4JY6A 4JZNB 1GC1C 5DYOA 5HHVH 1OAYL 1ZK9A 3N0PB 4RA0C 4EN3B 3NCFB 3NFNA 5IFHH 3KPRB 3DRQB 1MEXL 3ES6B 4HBQA 2V2TB 4S0SD 1UT9A 4GAGH 4ODWB 3SGEH 2W38A 3TFKC 2BK8A 1IAII 5DJZA 1YC8A 4XNUL 2HRPL 1A0QL 1G7JB 2VXQH 1TFHA 5C0GB 4XVUD 3UAJD 1ZSDB 3RX8A 4X8JA 3LRSB 2M26A 3B9DA 4QRTA 1I8MB 3DV6B 4PGJA 4JDZB 4P99A 3LOWA 4KHTH 1FIEA 4BFIB 4XNZC 1VERA 3OGCA 4WUUA 3QEHA 2ZPKH 5I1GH 4RMWA 5DJ6A 4GXVL 5IB5A 3WIFA 2OL3B 5DQDH 3OBAA 1IQWH 1KTLA 1RZIA 2BVOB 1FYHB 4ODUA 5JHLL 4WWID 5TH2A 1YEFH 1DEEA 1HOCB 4LU5L 1IC4H 4EBQL 4B5EA 3F7YA 3RVTC 4D0DA 4X6EB 4ENED 1LNUA 3MYJB 4NCC2 2DI9A 3HAEG 3NZHH 1HSAB 3LEVL 3IJHB 3VGDA 1GL4B 5DMJB 4H20H 4LOUD 3UJIL 2VTFA 4ZUUA 3BQUC 5HHQB 3GJFA 5I76B 1JRHL 4LCUA 5KVMC 5L8JB 3EOAA 3DHJA 5IVXA 1QSEE 3W0WD 5JZ7C 3IFPA 2ILLA 4P2RB 1OPGL 2OL3H 3OB8A 4I3SH 1U42A 4NSKB 3LQAH 3V4VH 3S5LB 3T2NH 1DTUA 2F58H 2Y36L 2WANA 1YZZA 4NGHL 3UC0L 2DM7A 4CN4A 4R3SB 1JVKA 3DVNB 5I0ZA 2BNRE 3FCTB 1R5WA 4JQVA 5T5FL 5C0JA 4YJZL 1A14H 2EXWD 2R15A 3GHBL 5DJYA 4NQCA 2Y06H 5GRUH 2AKRB 3ELAT 2F19H 1FFOB 2V7NA 2XQBL 5FF6A 1YJDH 1BOYA 1CVSC 1PEZA 4HPYL 4JKLA 4XPHL 2VZ3A 3VXQB 4ZOAA 5HHOD 2CLZA 4L4VD 4Y5VA 4CMMA 3EO9H 1HDMA 2W9LA 4N8CH 5K59F 1FVDA 1MHHB 5D1QB 1I1AC 1FVEA 4F15C 1MCWM 3GBLA 2XTJE 3MLTB 3WDHA 1U8JB 2X4NA 3LN9A 4JO4L 1D5IL 3CSBA 2VXSL 4OIIL 3JWDL 3QRGH 4QHUB 5TE4L 5D1XB 1G9NL 2XN9A 1QKZL 3V95A 3CU1A 2ZOKB 3DRTB 1SEQH 4K3DH 5GS0D 5CP7A 2WAHA 5CEYB 2VXUL 3BUYB 4L8DA 1CICC 4JN2B 5EUOA 1XR9B 4POUB 5T5NF 3RVXC 1UYWH 1XGYL 3O6MH 1T3FA 4MGXA 3MRKB 2OTWA 3N06B 5IV2A 4P3DA 2LAGB 3RDTD 4ESKA 3O4LE 5AWNL 1RJLB 2ZUVA 2XPGB 2OCFD 4TTDC 1CXFA 1KTRL 3QIUC 3TBTA 4YIQB 3ZTJG 5F71A 4JRXD 2D0GA 2Z93A 2NY4C 3T0EA 1KB5A 1J0JA 3RZCC 5BO1L 5DEGA 4XP5H 3C6LC 1LK3L 3H9SD 2BSED 1ZAGA 4HKXB 4WNQA 5HHPB 5GRXG 4BKLB 1BM3H 2PF6A 4KVCL 3JV0A 2ZKHL 5T1LD 1A7RH 1UM4H 1ZTXL 4NRXB 3RI5F 4M61A 3QHFL 4YDKL 2OK0L 3RL2A 1MJJA 3MRGA 2R0KH 3PUCA 1KIUA 1NCCL 2PTTA 1Q9LA 5D2LE 4YWGL 2YEZB 3ECBB 4ISVB 4ZFGL 3O9WB 4JFDD 2CK0H 3MOAL 15C8H 3QIWD 4Z7QF 4NNPH 1FCGA 5JDJA 4KKAC 1WAAF 3G9VA 3KPLB 3IDMA 2VUYA 4U0RB 4PJ7B 4HCRL 1S7RA 1BECA 3S6CA 4F7PA 4YHNB 3JUYA 4PJIA 2X10A 3WEXB 3DUSA 1PGRB 4GG6B 5JTWA 3LN5A 3L7FA 3DGCR 5GRVL 3BKJH 4IMLB 1FQ9C 2V5YA 3NFPA 2D0HA 3CSYA 4LLYB 5IFAH 3ZL4L 5HVFB 4PJ8B 5C3LD 5HVWA 5JLZB 3JWOH 1ORSB 1F6FB 1BQLL 2QQKL 4DQOH 4LLWA 3HNSH 2GHWB 4X8XA 1BOGA 2NX5D 5DURB 4UT6H 4GRLD 2ITCB 2EKJA 4FXGA 4XCNA 3W0WE 3HI6H 5ID0B 1OSZB 4W68A 4GMSL 4RMVA 1A22B 4H1LA 5K9JH 1QBLL 3TIEB 5AUMB 1I1RA 1G9MC 1FG9C 2H2SD 5I1IH 3QDGE 1NC4A 4J1UB 3QG7H 2OBGA 4WJ5B 2Q8BL 4F80A 1P2CA 4X6DB 2XWJB 3V7AG 3MC0A 1C1EL 4PJBA 3MRFA 3U1SL 2M1KA 1U8IB 5KSAA 4PTUA 4O02H 3ARFD 4Z76A 1X4XA 2EDYA 1YYLL 4LGRB 2K1MA 1LEKB 3PHSA 4WW1B 4P5TA 4PJXF 5D9SB 3OF6A 3OAUH 1NCWL 4M8QB 1DBKH 2AGJH 3STZB 4LNRB 3OWEA 4OCRL 1YEIL 5BV7B 2HTKC 4JR9H 3NZ8A 3K2UH 3QDJE 4PJHA 5HJ3B 2D4FA 4L4VE 3FQUB 1AC0A 1S7SB 4LGPB 3FQRA 1LO0L 3QUXB 2IMMA 5GGTA 1JYNA 4NZRH 3BVNA 4L9LB 1A3LL 3ESVF 4FQ1L 5EFIA 2EEBA 5FV1L 4OLWH 3DARA 2AJ3B 4MB4A 2BNRA 2GSGA 3FN9A 2R56H 5FIEA 3AS1A 1MCKA 1SJEB 3UO1L 5CSZB 4M5YH 3KPPA 4HX1A 5DD6A 2PXYB 3P9MA 4KC3B 4WHDA 4QF1A 1PAMA 2W9EH 4P4RA 1RMFL 4HUWB 5HYFA 2AK4A 2DQJH 3GSUB 5BV7H 2DDQL 4CMHB 1R0AH 4Z7UE 3C5SB 2CKBB 1EHLH 3QEQD 5ESAB 1P4IH 1X4ZA 3MV11 3OZ9L 4XPGL 5KW9H 5J1SC 1QA9B 3QCUH 2ZNXA 3ALPA 3L3DA 2E27L 2EDLA 4GS7C 4JRXE 4X0KB 2HG5A 3BPCA 2AVGA 3QI9A 4QCIA 5E8EA 4X6FB 3DO7A 2GCYA 4PJEB 3X14B 1T89A 4OZHB 2DM4A 5HHMB 1FCCA 4J3VA 2FDBP 3P40A 3HE6D 1QPPA 4K9EC 4Z7WB 1WQVT 1BQHG 4NYLA 1MPAH 5B8CA 1I1YB 2CKBH 5L2JB 4OD2A 2BSSB 4M93C 1K4DB 1H0DA 1Q94B 5F97E 4LIQL 5HDQL 1JI2A 3HLAA 5C0FA 4JJ5A 3TO4A 3HKFA 3WXVL 4JFDE 4XPBH 3LKPA 4NWUH 5DHYA 5F6IB 4LCWB 4FQPA 3BSZH 1JF6A 4F33A 4NKDB 4MNHA 3UBXI 1M05A 1K85A 1ZANL 5DTFB 2HWZL 4S10A 1CD1B 5D7LB 3LS4H 2NCMA 4ZUWB 4U1MA 5E2VH 3PWPA 5H8DA 4FQXA 3QWOB 3FT2B 3PIQA 4U49A 5E8OA 1HI6A 3O2DL 2ICEA 1I9IL 4Y4FB 4F7MA 3LKRB 1A5FH 3K0WA 2GT9A 3C09C 4PJIF 5DVOA 4LFHD 5FKPB 1FFPB 4IRJB 2C1PA 3UCRA 3H3BC 3I6GB 3BFOA 4LVEA 1GGCL 5DD5H 3GRWA 2FX7L 2NX5E 3SKJH 4BSWA 5FYLE 2J8OA 3CFJB 1A21A 5GS3A 3WFBL 1AE6H 1OY3B 1S9WB 2NXZB 1IQDA 3B5TA 4Y5YA 1RZFL 5C9KA 3AGVA 4NQDD 3SJVB 5IF0B 2BDNL 4ZSOB 2EDOA 2ZSVA 3REWB 3BMVA 2JB6B 4LGSB 1HK6A 4LCCA 1SMOA 4HIIA 1WCBB 5D71H 1AGBA 1I3GL 1LDSA 3DX7A 3V0AC 4OGZA 4LRNH 3WS3A 4LAJH 1FJ1A 2YSSA 3QNYB 4EI6B 4YXKH 3ESUF 3QH3A 4GBXC 1UZ6F 5C7XH 2Q6WA 2C4FU 4KRNA 3TN0B 3BW9B 4K3JL 4AMKL 5LCVL 1OAYH 5IB1B 2VLJD 1G7HA 4NDMB 1ZHNA 1D9KC 1YNKL 2MQ3A 2P49B 1T7XA 4WU5B 4CU7A 2VLMD 4FQIL 1OP3H 5I2IA 1MEXH 2GUOA 2P8MA 3GUTA 3U30C 1N59B 1JGVL 1H3PL 5E6YA 1MCEA 2WLYA 2NYYC 1LP9B 2F53D 1HHKA 3GKWL 2BHUA 4XNUH 2HRPH 1A0QH 3MLWL 5CUSL 4ERSL 1N0XL 1NMCB 1S7WB 4K8RL 3GSWA 3G5ZA 4E0RB 3T09A 5C8JA 4IRSC 3TPUA 2QHLA 2X44D 5IMOB 2EO1A 3ZYZA 4AEFA 3ARBD 3MCKA 3QXAA 4DCQB 3EJZD 4I2XE 4PJHF 3BO8B 4HIXL 4KK9C 4GXVH 1T1WB 1P4LB 3H42L 4KQ3L 4RGND 5DEFB 2RCSL 2GTWA 4ZO7A 3ME0A 2D4DA 5EZIL 1AHWC 2Z4QB 5JHLH 3V8OA 3WDJA 4QO1A 4LU5H 3VGHA 2P48B 1UH2A 4EBQH 3IDGB 3GMLB 1LK2B 3GI8L 1CZ8L 1P7KB 1DQQB 3OB0K 5HHOA 5D5MA 4L4VA 1C7SA 5D7IF 3B5GA 1KPUA 3LEVH 5C07D 3UJIH 1HCVA 3CXHK 1UVQB 2NZ9D 1JRHH 1T0NA 1TETL 1X5LA 1ZS8A 3D85B 3ARZA 5D6CA 2E6JA 5C0IB 3UX9B 3D39D 3MR9A 1OPGH 4ZTPL 5GGUA 3WNPA 1NEZB 5MI0C 3I9GL 1LEGB 2P8PA 4JGUA 4U3HA 3UYOD 4OZGE 1UQSB 1UACL 2Y36H 4NGHH 3QXTA 3C8DA 4HV8B 3UC0H 1P6AB 3BYTA 3TFKD 5T5FH 3GGWB 5DD0L 4ZS6C 1JGDB 3SDCA 4RQQA 3GHBH 4RAVA 1UG9A 5BRZD 3BE1L 3GSRB 4BJLA 5C1MB 4OTXL 4JRXA 3VE0A 2XQBH 2G2RA 1QHPA 4JY5L 3FFCB 4HPYH 1R3JA 4MNQE 4DUXA 2IAMB 5CIPB 4XPHH 5F3BB 1FZOB 3H9SA 4ZQKB 1IGJA 3CU7A 1L9NA 3JVGA 4M02A 3RNQB 2FIKB 2QR0A 4I9WD 4K07A 3RVTD 2EC8A 2IPKB 3VXMB 5GGRY 4ZDHA 4JO4H 2GTZB 2VXSH 4OIIH 3JWDH 4ZO9A 3HE7C 5TE4H 1G9NH 4C57C 4QHKJ 1QKZH 4JFDA 3B6SB 3BQUD 3EBAA 3LEYL 3QIWA 2VXUH 4QXTB 4LQ1A 4HH9B 5D96C 2FSEB 5CIPH 1BBJA 4N9OB 5JZ7D 3MRQA 1XGYH 1CFNA 4X7DC 4R90L 3OXSA 5D1ZB 3HMWL 4JAMA 1DN2A 4XCEA 4ZOBA 5CAYB 5AWNH 2QADB 4QGTA 3EDDA 1HHHA 1J05B 2VZ1A 1DLFL 5I30L 3LCYA 3V6FB 3L5WB 3VG9C 1M71B 5JIHA 3VD5A 2R2BA 5DJXA 3T04D 5CJXA 2OSLB 2VLKD 5I1DB 3CD4A 4MD0A 4R4NC 3RVWC 2VAJA 2HFGL 4JG1L 5BO1H 1ZHLA 1CDCA 1T2XA 2A6JB 1LK3H 4MXQC 2NXYB 5T1MA 3S8WA 5GXBB 2CO6B 2VLJE 5IMMB 3L5XL 4Z7OF 4KVCH 2VLME 3GSXA 3JV4B 3PWLB 2ZKHH 1ZTXH 2OTPA 3QHFH 4YDKH 2OK0H 2BC4A 2G9HA 4AH2A 2OMNA 1PD6A 2IH1A 5EOCJ 3ARDB 5FECB 1NCCH 2W9DL 3TBSB 5E5MB 3T0BA 1V3JA 1J0ZA 2NW3B 3VWKC 1I1AD 4ZFGH 4UQ2B 2GW5A 4WWKC 2I9LA 3MOAH 2VL5B 4F7TA 1FO0A 5T1KD 1QLEL 5C0BE 4UOW0 5DJAB 5IVZA 1WBZA 1E28A 3HFML 3L95A 4KTYA 4OI7A 1MLCB 4MA3A 3CVIL 3HUJF 4HCRH 3ARFA 4RFEA 5DS8B 4YPGB 5I1AA 2D7QA 3K4AA 4FA8A 1PVHA 2E7BA 3SDXE 3SDDA 1IGCH 4LSVL 3DTXA 4OCLC 4PGBB 4YDJA 5F1OB 1Z2KA 3G5VB 1CICD 4NO0D 4U6HB 3RVXD 3ZL4H 2JJWA 3NACL 2R2CA 4B7LA 3C5JB 1TCRA 5GS1B 4YHML 1N2RB 1BQLH 2VAAA 3OKOA 5ETUA 2QQKH 1MUJA 4WGVB 1G7MB 3QXDA 4TTDD 4ORZC 5C07E 2QTEA 4HGWA 4PJGB 4XB8A 4PGCA 2C9AA 4ODTL 1AQDA 3ZSSA 2NY4D 4PRPA 3MRBB 1PKOA 2MCPH 3RZCD 3MXVL 4CDGC 3F7VA 4GMSH 3FQXB 4WHYH 5F7WC 5EO9B 1QPXA 4EN3A 3PGFL 5D2NC 3VXUB 1QBLH 4YR6A 4N8VA 2QKIB 3TNMA 3EO1B 8FABB 2VSCA 3O2WL 4XVJL 4YEFA 2Q8BH 1RY7B 3ARGB 4JQXA 4TNVF 3ULVF 3HC0B 3QEQA 4YAQB 4ETQB 1C1EH 3U1SH 1G7JA 3BZFB 3VD7A 4DZ8A 4PREB 3RY6A 1I8MA 5T5NG 4R97C 1UH3A 5KN5A 1HSBB 1YYLH 1YQVL 1F5WA 1DQJB 2GKIA 5EBMB 1NCWH 4U0QB 5DJ0B 1V5JA 4OCRH 1YEIH 5DGQA 3P0VL 3SKOB 1MCFA 4HWZA 1OD9A 2X89D 1BVKB 3OKEB 2ZOLB 5F89B 4P2OA 1LO0H 3EDKA 3CZFB 2VWEE 4OZGA 3VI4E 1U93B 3ULUC 1G7IA 1QO3B 2GK0A 1FNSL 1WCQA 4I9WE 1CFTA 4X6EA 5LAXB 1A3LH 1E4WL 3BP5B 3BYYA 4FQ1H 2BNUB 3MRDA 3CZJA 4I0CC 1HSAA 3L3OA 3AS3A 4TUOB 1AXTL 2FCBA 2J6EL 4Y2DC 3B43A 3BDBA 5HHQA 5I76A 3UO1H 4N1EA 5GRZA 2AJVL 1I1CA 3QNZA 4J8RA 1KCVL 4ZPVB 1RMFH 3TH3T 3PHQB 3HI1B 2CUIA 4P2RA 2DDQH 4E41A 1S7XA 1KPRB 4NSKA 1A2YA 3CFIC 4YK4C 3S5LA 1URLA 4IIQA 3KGRA 3LS5L 1R3IL 3RAJL 5F9WB 3TZVB 4X4XB 3OZ9H 4XPGH 3SGJC 1TVBB 3D18A 2ICWJ 3MLZL 1WAAE 3EOBB 3DVNA 3W39A 2C3GA 3FCTA 1E6JL 2E27H 3MRRB 2VLKE 4CVWA 3QZWG 4X7TB 1PZ5B 3GMMB 4LLMB 5FYKL 2DICA 1X5GA 4MCZB 1I7UB 3ROOA 1HXYA 4OFDA 3JUZA 1EJOL 3E1F1 4CADB 2OM5A 5BJTA 1P69B 2ICWA 5DLML 1U58B 3X3GL 2HTKD 3R8BB 2BSRB 3EHBC 3ARVA 4LIQH 5HDQH 4OM0L 3BISA 2BRRL 4NQDA 1MHHA 4X83A 5D1QA 2Y7QB 3WXVH 2Y07L 3MLTA 4JGJA 2GY5A 1I85A 2Z8WC 4TRPL 4Y2OA 5L6YL 1MHPL 3I84A 3VFWA 5FK9B 5D1XA 1ZANH 3HNTL 1QLRB 3W82A 2HWZH 3DRTA 5C09E 3KJ4C 5C6TL 1P7QD 2VXTL 1U8KB 3KYOB 5IB3A 2AJZA 1HKLL 3VFUA 2E9IA 4XX1E 2C26A 4JN2A 2X6MA 1KPVA 3REVB 5D6DC 4WY7L 3O2DH 4YHPB 1I9IH 2DS4A 5KZCD 5DRZB 4P2QB 2ZUXA 3SE3C 3SKNA 5AD0B 5D93C 2K7QA 2MQ0A 1TTUA 1RJLA 5ABDE 2XPGA 3CJJA 2F53A 4BZ2L 4PRNA 4PJXE 4MSWB 2X2YA 1AGFB 1N5AB 3UTSB 4PRDA 5KOVC 1GGCH 1CL7I 2FX7H 2W0FB 4Q6YA 2NTFA 4MA1C 3WFBH 2HLFC 1VFMA 1RZFH 4IDLA 4QRRB 3JBG7 4KJPC 4EUPG 2MQCA 1GZPB 1K5NB 2JTDA 3LPFA 1MFCL 1XF4B 2NY2C 2BDNH 1BVLB 5D7JC 3WJJA 4EDXB 1CXEA 3TIDB 1XGUB 5J57B 1C08A 4Z18A 4OZFB 1I3GH 5JR1L 1MHEB 2O5YL 3CFKB 3GSNL 4LAQL 4M6OL 4U1JB 2YEZA 4ISVA 4OCXL 1EGJA 5F7FA 1G6RL 4XWOC 2QV2A 4GRMA 4LKXB 4K3JH 5EUKB 4AMKH 1BZ7A 3AFLA 4OUUB 1QYGL 1AXSA 5LCVH 3UTQA 3KPLA 4JN1L 5FA3B 5F88A 5KSBB 1YNKH 3B9KC 2OMBA 4FQIH 1SEBB 2I5YH 1R3KA 3D39A 4LK4A 5IEHB 2QHRL 1JGVH 1H3PH 4PB0L 1R24B 2HVKA 4LLYA 4MJ5B 3GKWH 1RJZB 1A6UH 4NRZB 1J1PL 4PJ8A 4HHAB 5CUSH 4ERSH 4ODSL 3S98A 1N0XH 3DSNA 4K8RH 1N5YL 2A1WL 5GGSA 4BFEA 1DBAL 5IKCB 4R7NB 4HJ0C 5EA0L 4HIXH 1HILB 3H42H 3L7EB 1CU4L 4KQ3H 4QRPB 3GSOA 5BRZA 3BRDA 4GG8A 2RCSH 3UYRL 2I07A 4MVBC 5EZIH 4S1SL 1GOFA 3PP3H 2GAZA 4PRAB 3TIEA 3TBVB 5AUMA 1IZKA 3GI8H 1H8SA 1CZ8H 1S9YB 3PQYD 3WUWA 4WJ5A 1KLGA 4Y1AD 4X6DA 4BUHA 3B2UC 3KLSA 4X4YB 4HIHA 3I6LD 2LV4A 3B3IB 5HYIA 2LE9A 3H6JA 3TBYB 1TETH 2CDGB 3U7WL 1QRNE 4GBXD 4I0PB 3H7BB 4ODBD 2X40A 5ENWB 4ZTPH 5D9SA 3OXRB 1N4XL 2PO6C 4PJDA 3I9GH 1BIIB 3STZA 4LNRA 1D9KD 3MRHB 6CGTA 1UACH 2EH8L 4X9HA 2B4CL 1YPZB 1FSKB 1S7SA 3RNKB 2NYYD 4U6VL 5AYQA 5DD0H 1ETZA 1G1YA 3H3PL 3BE1H 2MKLC 2AJ3A 3CPLB 3DUUB 4RSVA 4OTXH 2A83A 3K7UA 2YUVA 3I50L 4MJ6B 4BA8A 4JY5H 6FABL 5CSZA 2PXYA 1YYMH 3DX9A 32C2B 3NCMA 5CILL 3FFDA 4FNLL 4KK9D 3ZSTA 1QEWB 4XXCC 3QJFB 4U6YB 2CLVA 1F02I 1OL0A 3S34L 1JWUB 3U4AA 3BRGC 3MV9E 4X7FC 4Y5XB 3FB6B 4LSDA 3QJHA 1CVRA 2J7LA 3KYAA 2YRLA 1PYWB 1F3JA 1FL6B 1JZ8A 5I6XB 4HXAL 2W1NA 1B4RA 3NIFF 3ZKXB 3BPLB 4D94A 2VZOA 5ISZD 1I1AA 4X6FA 1R5IA 3LEYH 3ZE0F 4PJEA 2I26N 3X14A 5CEXB 1SJXA 3MUY1 1NCDL 3SGDI 2WBJC 1V3MA 5E6ZA 4R90H 4YPJA 1UENA 3HMWH 1CGVA 2QLVB 3FHQA 3AC0A 3QEGL 5L2JA 4JRYB 3WIIL 1K4DA 1J5OL 1CICA 1DLFH 5I30H 5BV7C 2YA2A 3MROA 3AMKA 1J8KA 3MA9L 3MRMA 4RDQF 2GI7A 5C0DB 2FLBT 1ZVSA 1UADC 4ZS6D 2HFGH 1CTOA 4JG1H 4NO3B 4XAWL 2DMKA 2CMRL 3QIUA 5IJVA 4L9LC 1OWRM 1D6EA 4NKDA 3L5XH 1M1SA 5DTFA 1FL5A 5FOJA 2R39A 5FAAA 1CD1A 1JNLL 2VL4A 3P4LA 1BD2B 3RZCA 4KH2A 4ZAKC 2W65B 4HKZA 5E6IB 4NQEB 3L6FA 1AO7D 3C6LA 1SBBA 3QWOA 3OAYK 3FT2A 4GFTB 4BFGA 5D7IE 4XPAL 3IT8D 2VDNL 3ROLB 3RL1A 4TNWK 3PGCB 1VKXB 4Y4FA 2UV3A 5D8JL 1FYTE 1RZJH 2AXHA 2BVPB 3C60C 4MS8C 5F1IB 4PJ7F 2BVYA 1QLEH 4Y16C 4QHNB 5IWLC 2FJGB 4GG6F 4YBQC 3HFMH 1AD9B 1FFPA 5C08D 1YMMB 1KT2B 4XI5C 1ZVHA 3CVIH 3I6GA 2O93L 3HE7D 4X5WB 5E70A 1MREL 4G8GB 4Y4HC 3QEUA 1YMHB 4DFHA 4LSVH 1S9WA 1L7IL 1NLDL 4JM2C 4GKZB 2X7LA 1W72L 4PJ5D 5T3ZL 2GK2A 3NACH 3SJVA 4V1DD 5IF0A 4ZSOA 1S9VB 2JB6A 4OCWL 3IS0X 2O5XL 3PQYE 2BZDA 4G7YL 2A9NL 4Y1AE 3I6KA 3Q6GL 2AEQL 1VGKB 3BXNB 4R4FL 2PYED 4KGJA 4EI6A 3IJYB 4EXKA 4F37F 4ODTH 2CIKB 5C0EA 1PQZA 3D69B 3Q3GB 5HHXL 3SPVB 1YA5A 3IDYB 5E7FA 3BW9A 4R4ND 3RVWD 3QDMB 3MXVH 4LBEB 5E2WL 5IB1A 4MXQD 3PGFH 1IKFL 1J0YA 4GXUN 1MFDL 4AG4L 2VH5L 4X6DF 1L0XA 2X42A 3CH8A 3O2WH 1E0OB 3O3AB 4XVJH 2D9CA 1LP9A 2R1WA 3F6IA 5I9QB 3N1MC 5K33A 1F6AA 5EU3B 2RHEA 3O11A 2BRQA 1C12B 2JCCA 3VWKD 2B8OT 4WWKD 4PJAE 1IILE 1YQVH 3O6FB 3U6RB 3KXFD 2P5WD 3T8XB 4DCQA 4LKCA 3V5KA 3DVIA 1KIRA 3BO8A 3L5HA 3P0VH 5DEFA 3OJDA 1N6VA 3KDMB 4M7KL 2Z4QA 1IM3B 3MRLB 4H0GA 4WHCA 1MCWW 3WHXA 3UBXB 1EBPA 1HWGB 1LK2A 1FNSH 5A2KH 1E4WH 4FZ8L 3JTSB 3BRFA 1NL0L 1WZLA 1CXLA 1M7XA 4KDWA 1AXTH 3BH8B 4FQQB 3LH2L 4OZ4B 2AJVH 2X09A 4IM8A 1KCVH 1F11A 3TCXA 4X6CE 4F2MB 1JN6B 4BZ1L 3KS0H 1U8NA 4TSBL 2DYPB 1KLFA 2Q76B 2D2OA 4OQTA 5A43C 4GW5B 4KI1A 3FONB 3TVMC 3UDWC 4UTAL 1UQSA 4QTIL 2G60L 3LS5H 1R3IH 3RAJH 3VXRD 5BW7C 1NFDB 3MLZH 3UYPA 4PJEF 4R4BA 1VSCA 1A9BA 4OZHF 1SVZA 1E6JH 1LO5A 4QOKB 3HUJE 3GGWA 4HFWB 1JGDA 5SX4I 4Z7WF 5FYKH 1J88A 2AERT 3GSRA 2Z31B 3KPSA 5E4EC 5IBUG 5IHLB 1EJOH 3EJJX 3GZKA 3FFCA 4YGAB 4HIJA 1CL7L 5B22A 1JMXA 1FZOA 4M8VA 5DLMH 3X3GH 1INQB 2YPLB 2R9HC 5DSCA 3VH8A 3NABL 3VJ6B 5FO8A 1JZ5A 3MFGB 2C1OA 4OM0H 2DLFL 4P46C 2BRRH 5INCB 2BSTB 1CLOL 1RZ7L 2UYLB 2ZJSL 4KMTL 4KJYB 2FIKA 3PDOB 2Y07H 1A6ZB 3ULUD 4HF5L 5DF0A 1AQKL 3VXMA 4LLDB 3Q1SL 2Q3ZA 2GTZA 4TRPH 1HZHL 1MHPH 4YO0B 5L6YH 5C08E 2OJZL 1BLNB 5C0ND 3HNTH 4NC0B 1JYWA 5C6TH 2VXTH 5ERWB 2V9TA 4OLZL 4NCC1 5EIVA 3QWRD 4YFLF 1HKLH 1NC2B 5E00A 2X9XA 4HH9A 3UTTD 3ULVE 5DVNA 3CSPA 4PJ5E 2IBBA 4QWWC 4WY7H 4NCDA 5JOEA 5BOZG 2JKXA 4I18C 5HYJE 4V1DE 1F4AA 1ITBB 1N7ML 4ZG1A 3IU4L 1ZGLB 3UZEA 4ZFFB 2FD6L 4F7CB 2L4OA 3MRJA 4M7LT 1P5VA 3V6FA 4BZ2H 3ARRA 2YXFA 2PYEE 5HYSG 1G6RB 1HNFA 2OSLA 2W60B 5I1DA 4LSRL 4NT6B 3K80A 2B0SL 3Q2CA 3DV4A 4KTEL 3P9LB 2A6JA 4NPYA 1K2DA 4FHBD 2VYRE 3V6BR 3JWDC 2NY3B 2DB8A 2NY0B 1ZV5A 1G9NC 1S9XB 4LVNC 4NBZB 1MFCH 3MRPA 4DEPB 2PCPB 3JV4A 5TDPA 3KWWB 5E94B 1M7IA 1WZKA 3EHBD 4F8QA 5JR1H 1DSFL 2O5YH 3V0WL 4R26L 3GSNH 4L1DA 3ARDA 43C9B 5FECA 2EC9T 4LAQH 4M6OH 4GJTB 3TBSA 1I9EA 3VFNA 1S7QB 4OCXH 3PQYA 1G6RH 2ATPB 2DD8L 1WITA 1WF5A 3BWAA 1MQ8A 4HW6A 4QRUA 4FQLL 3H0TA 1QYGH 1FORL 1AR2A 3RWEB 1B0RA 4JN1H 1E27B 2P5WE 2FBJL 5DS8A 4HUXB 4GBXA 4JHAL 5DMKA 3MNZB 1C5DA 3VFGL 1LP9F 3QCVH 3WSQL 1RURL 2E7LA 2QHRH 2NW2B 4PB0H 4U7SA 3K74B 1MIEL 3G5VA 3GMOB 4E5XB 4FQJL 4U6HA 3OGOE 1J1PH 25C8L 2YWZA 4ODSH 5SX5H 3WLWC 3M1BA 5H2BB 5JPMB 3C5JA 1N5YH 5GS1A 4J4PC 4LEXH 2A1WH 3BP4B 4D3CL 1VGEL 1DBAH 4DVRL 4NNYB 1G7MA 2N1KA 3SN6N 2UWEE 3G04B 3KYMB 1ZHKA 4JHWL 2YK1H 4Z0XA 2VKXA 3ISWA 3U4BL 3D0LA 5EA0H 3MRBA 5HPMB 4BM7A 1OWWA 1T1ZB 1CU4H 3DBXA 4HLZG 4FXKB 4IRSA 1JPSL 3UYRH 4K71B 5E08L 2O5ZL 4WU7B 3NIDE 3FQXA 4S1SH 2OR9L 4WTWA 2HLFD 2NR6C 5F8RC 1YDPB 4KJPD 2GJ6D 1EA9C 1A02N 1EEQA 1GH7A 5GHWL 5D2NE 4UNVA 4I4WB 1KCSL 4ZOEA 8FABA 2NY2D 5D7JD 4I1NB 3ARGA 2XZZA 4B50A 1G7PB 4XGZB 3U7WH 5DQ9B 2PR4L 1MI5A 1HSBA 4PRIB 2XT1B 3EOYG 3B9VA 4X4ME 4XWOD 1CGWA 3IRPX 3PJSB 4NKQB 1N4XH 5ISZA 1DQJA 1R6VA 2BXYA 3MGTA 5C6WH 5EBMA 5KVGL 2DI7A 3RWDA 5DMGC 4LEOB 5HGGS 3FQWB 4J23A 4HBCL 1IGYB 2FJHA 2AI0L 3B9KD 4Q9QL 2EH8H 1KTDB 1JPTL 2XFXB 4YDLC 2B4CH 1TZHB 1U41A 1BVKA 5CGYC 1JF5A 3TYFB 1FL3B 1U93A 1J8HE 1QO3A 1U91A 4U6VH 3WFCL 3EYSL 1PEWA 2IAND 3QIBB 4AYFA 4YDIL 4Q6IC 1UXSB 5I8KL 3H3PH 4HS8L 2BNUA 4P57A 3QUYB 3VGAB 1JZ3A 2CUMA 3CCHA 1KXVC 1FC1A 1X5AA 2PYFB 3MA7B 1TMCB 4FG6C 4TUOA 4TULL 2OI9B 1GJIA 2YD4A 5F44A 4X98A 6FABH 1EBAA 4XP9L 3D3VE 4N5EC 1I7RB 1NGXB 5CILH 5GS2D 2EYSB 4FNLH 3OQ3B 3PHQA 4RAHA 3C9NA 3S34H 3UTTE 1FNEB 4V2BA 3G6AB 1AGEB 5E5RB 1A6WL 3DWTA 4X9IA 1AO7A 4HUNB 4LHUB 2J12B 3TZVA 3FRPA 1EFXD 1TVBA 4OGAC 1KCRL 4HXAH 1WBXB 4ONFL 4JFEB 3B2UD 5ITBL 3MRRA 4P5MB 2MJWA 3GMMA 2GSIB 3BP7A 3K3QA 4C56D 1NCDH 1CT8B 4F9LA 1Z6JT 3T77B 4N68A 3HE7A 3UZVB 2PO6D 1Z5LB 4JFFB 4CAGA 1U58A 1AFVL 3WIIH 2FYYB 3GSQA 4YLQT 3NBNA 1J5OH 3BZEB 4CBPA 3MJ6A 5FYJL 4FP8H 2ZUYA 4V1DA 3MA9H 3QXWA 2IALB 5DD1L 4TVPL 4HEPG 4ZFZB 3HPJB 3BHBA 4EI5B 1I8LA 3E6HB 4KUCF 4XAWH 4S2SA 2LU7A 2CMRH 2PYEA 1QBAA 5CZKA 2Y5EA 5FK9A 2CR6A 3UPAA 3QFJD 2J2ZA 1EVTC 1JNLH 5BZWB 4GAJL 4NKMA 4UU9B 2BY3A 1OM3L 1NAMA 3REVA 4XPAH 5E24E 4BH8A 2VDNH 4YHPA 2R4SL 5DRZA 2BMKB 3S5LG 3BD5A 4MXWL 5D8JH 4MB3A 2ED8A 1U3HC 2FB4L 5DI8A 4O2CB 2FHFA 3EYFB 5HXMA 4KVNL 1J1XL 4G8EB 3CC5A 4EIZC 1XF3A 4MSWA 1CDUA 1N5AA 2WQ8A 3QFDA 1MREH 1E6OL 1ND0A 4IOIA 5JIKA 2W0FA 1XAUA 2R0LL 5INDB 1NAKL 3WKML 1L7IH 2E6QA 1A6PA 1NLDH 3K4ZA 3KXFA 4JCLA 5DDHB 1L9MA 4EEEA 4RZCA 5GGRB 1W72H 5T3ZH 3S96A 2WBJD 1GZPA 4LL9A 4YX2L 3VGGA 1KB5L 3L3GB 3L9RB 1XF4A 4N0UE 1BVLA 2LAAA 4UUJB 1XGUA 4OCWH 4NO5B 4PJGF 3ZZ1A 2O5XH 4G7YH 2J5LC 4M7JL 3Q6GH 2AEQH 4MJ4A 4OZFA 1IARB 3BN3B 3DXAB 4R4FH 5EH1A 5F1NA 1QVOB 3OJ2C 2XKNB 4NFCA 4D8PA 1OGTA 3UTZB 5HHXH 5TGBB 4NQUA 4HPOL 5EUKA 2UWEA 4HLJA 2F5AL 3V5HB 5E2WH 3IXTA 1G84A 5FA3A 5F96L 4NKOB 4MD4A 4KWUA 1IKFH 2ARWA 4AG4H 1MFDH 4KUZL 2VH5H 3OB0H 1WWBX 3OG4B 1SEBA 1WWAX 4NQXA 1RIHL 2X05A 1NDMB 4LPXA 4ZAKD 1X5IA 1ZWIB 2KZ1B 3I3EA 1C8PA 1I3RB 5DO2D 3VXTB 3NIFE 3CLFL 3DI2B 4NRZA 4RNRB 3PWUB 2A38A 3EO0B 3VXRA 2IANE 1YN6A 3HG1B 4HXBL 3C60D 4ORGB 4QHKI 4MS8D 4KGLA 4U1IB 2HJKB 4DKFL 4Y16D 3QPXL 4NN5C 1JNJA 4MNGB 4YBQD 4K7PX 5T3XD 3F5WB 3PXHA 4R7NA 4XI5D 3MUGB 4YHOL 4DAGL 2VDPL 3S4SA 5I66A 1GGUA 4TYUA 3AROA 5HGBB 1HILA 1QFWL 4QRPA 4P9MH 1CFSB 2BOCB 4RDQG 4LVOC 3QQ3B 1QSFD 4Y4HD 4M7KH 4G6JL 4CVZB 3O3DB 2A6KA 3MMEA 2J88L 1ULVA 3VXSD 1PW3A 3CSGA 3LAFA 5E9DD 3JV6B 1A6TB 1YNTB 3EW3B 1S9YA 3TH4T 1F13A 4KU1A 2N4IA 4FZ8H 1FZJA 1JFQL 3VD9A 1NL0H 3DIFB 4K94L 1NGWA 4X4YA 5EZLB 4FFWC 4JQIL 4OFPA 2VLRD 4K8RC 3LH2H 4I0PA 2BVTA 5FOBB 3BPOB 4D0BB 2EDQA 3L3JA 4ZPTB 1N6QH 4DVBB 4OKVB 3B2VL 5ENWA 3EJYC 3PWJA 4BZ1H 4ZTOL 4TSBH 5EO1B 3JSSA 2DQGL 5E99L 4F7EB 4Y2DA 1BIIA 4UTAH 3OG6B 4QTIH 2G60H 3MRHA 2YOCA 1SJHB 2BVEA 4PJ7E 1ACYL 3UTTA 3RUGA 1VFAB 4TTGA 4GG6E 2JIXB 4IMKC 1J12A 2GITB 1OGAB 2CDFB 1ED3A 4P23B 3STLB 4RWYL 5ANMB 3WS6C 4JZJB 1RUQL 3LD8C 2VZUA 3L5JA 2C3VB 1KIPB 3CPLA 4D9RD 5A2LH 5H35B 4ONHB 3DX6A 1AD0B 5GGTL 3QFJE 3ZHKA 3MOQA 4BK4A 1CL7H 1QEWA 3Q48A 3Q5YA 3IB4A 4U6YA 2ZCKL 2ADGA 3NABH 3T1FB 5J13C 5J9PA 4P48A 4L8CB 4O2EB 2DLFH 1FIGL 1CLOH 2YHGA 1RZ7H 2ZJSH 4KMTH 4ZUSB 4JGMA 1U8OB 5DC0A 4HF5H 1AQKH 4XBGB 4LLVA 3Q1SH 1PYWA 4ZNEE 5TDOA 1HZHH 1IGIH 2AW2A 3FO9B 1PG7X 2OJZH 1RUPL 4HG4J 4HUKB 1D5XB 1S5HB 1N6UA 3PL6C 4OLZH 2NY6B 4OZIA 2VDLL 3RI5K 3BDXA 3NCBB 3CFEA 1HH6B 4HJGB 4JHBA 4W4OC 3TVMD 1N7MH 1JTOA 3FQTA 2F54D 5B3JF 4GLRI 3IU4H 5C86A 1IC5L 2FD6H 3DECA 4M62L 1T20B 2WP3O 3RWGA 1K9TA 5D6DA 1XEDA 5GGSY 1WT5C 3U7YL 3PV6A 3BGMA 1CGTA 3SE3A 4LSRH 5C0DA 2B0SH 3NGBC 2OZ4A 2H32B 4PRHD 5BS0D 4KTEH 4NO3A 1WTGT 2VSDA 4G6AC 3W5NA 1G7LA 1U8PB 2EE3A 4O9HL 2Y6SC 3BPNC 1CFQB 1BFSA 1H5BB 1K8DA 3AXLA 1IKNC 3KYNB 4Z7NE 2FWOB 2FH6A 3V4PL 1BD2A 1OD7A 3B83A 5E6IA 3UMTA 4NQEA 1EPFA 3IAQA 3SE8L 5I73C 2R9HD 2YKLL 5KSUA 1DSFH 1KG0B 2GJ6A 3V0WH 4R26H 3ROLA 5TJWK 2LU4A 1JGEA 1N3NB 3PGCA 1VKXA 4P46D 1KLUA 1BFOB 5IHBA 5D7JA 5M95B 5F1IA 2DD8H 4G43A 4HULB 5KSBF 4FQLH 1DQDL 2H32H 2PUQT 1FORH 3HZKA 3OKMB 3ZDYF 1YMMA 1KT2A 2FBJH 4L8SC 2DAVA 5CBAB 3ARTA 4JHAH 4X5WA 3VFGH 4G8GA 3WSQH 1RURH 1I3UA 1QSFE 3VWJB 1AKJD 1MIEH 4JKMA 4LP4A 3VXSE 3D85D 4FQJH 4JO2L 3L3HB 3NAAL 3QUZC 25C8H 2ICWI 3GRWL 4P5KB 4OF7A 5HVGB 5DYOB 1S9VA 3DROA 5IP4A 2BXZA 4Z7WE 3VDCA 1CIUA 3NFNB 4D3CH 1VGEH 1UZ8B 4DVRH 4WHTA 4WV1C 4JHWH 3IJYA 4NFBA 5FGBC 3U4BH 1RULL 1FDLL 2VLRE 3D69A 2OLDA 3SPVA 1JPSH 1BPVA 1FFQA 1QR4A 5E08H 2J3SA 2O5ZH 3QDMA 3AREC 4JFHD 2OR9H 3T2PA 1NMAL 1FNLA 1RJCA 2ADIB 3VFVA 4LCWE 4YGVA 3IFOA 4LMQI 5GHWH 1KCSH 2MFNA 2ESVD 1KN2L 3NMEA 3MZTA 4YNYA 5AG8A 4WUUB 3SE9L 4AY0A 3PNWA 5D7LE 1FZMA 1PX3A 3HMXA 5DJ6B 2A0LC 4UNTA 1KTLB 1RV6X 3SCMC 2PR4H 3OR6A 4MMZC 4ODUB 1EFXA 1DEEB 1D5MA 3EDEA 3F7YB 1EXUB 3EOTL 2PKDA 1IAKA 3LSOA 3LKQA 3T8XA 5KVGH 1YPZF 3KHOA 4X7EC 3WIHA 4FABL 3D2UD 3F7QA 1LNUB 4HBCH 4XMLL 2AI0H 4Q9QH 4C56A 1JPTH 4Y88A 4XNMB 4J3SA 4JPIA 1S7VA 3GJFB 4LCUB 3RHWK 1XIWB 2PO6A 2P5ED 3SGDH 3WFCH 5IVXB 3EYSH 3WLWD 2IWGA 2LTQB 4YDIH 4J4PD 5I8KH 4HS8H 2QSTA 1A7BA 5L7XL 4R96A 1FGVL 4L3AA 1HNGA 2IPUK 4TULH 5F70A 1DQTA 4XP9H 2IH3B 4HAFA 3T3MF 2EDHA 4HFUL 1TVHA 3TT3L 4PS4L 1XF2B 1R5WB 5EB9A 1JN6A 1NBQA 5C0JB 5CFHA 3I02B 3GMRA 3IDYC 2NR6D 1J10A 4GW5A 3GJFH 1A6WH 4XBEL 3F58L 1TZGL 1WEJL 2F54E 3P11L 4XXCA 2V7NB 4KUCD 1H3VA 4JO3L 5FF6B 4J3XA 1KCRH 4WO4B 1JZ4A 4U31A 2I60L 4AM0A 4UMGA 4ONFH 1F00I 5ITBH 3RKPA 4EKXA 3HTLX 5GS0L 1U0QA 5LBSL 5BS0E 2NY5L 4CMMB 4FQCL 2VR5A 1EO7A 2ADJA 1FVEB 1QSZA 3BKML 3O2VL 3GIZL 3WYRA 5I8EA 3FB8B 5DMGD 2B1HL 3H8NA 2WIIA 3QPQC 3O6LL 1AFVH 1INQA 1MFEL 2R69L 4X6BA 2YD3A 2WBJA 5FYJH 5INCA 2BSTA 4M3JA 2QSCL 5CGYD 2V9QA 4KJYA 4HK0A 3MLUL 4L8DB 3MXWL 5DD1H 3NPSB 4TVPH 2EYTB 2WV3A 3LY6A 5EUOB 4WUKL 1Y6KR 1KGCD 4MZ3A 1EO5A 2XICA 2OTWB 3JV5A 1MJUL 4P3DB 3SGKA 3WFZA 1BLNA 2VO5A 3P4OA 4CW1A 4FG6D 3M07A 3U83A 5ERWA 4LSTL 2D7OA 3K81A 4GAJH 4N5ED 3BGFB 3TBTB 1BREA 1NC2A 2EKSA 1OM3H 4G6KL 2Z93B 3KJ6L 3T0EB 3FO2B 1KB5B 4MAYB 1NEZG 4XB7A 3K46A 1WBYB 4OI9A 5ILTL 2R4SH 1OF2A 5DEGB 4MXWH 1N0LA 3I75A 1ZLSL 1FE8L 2FB4H 1ZGLA 4ZFFA 1UB5A 5FKAA 2IMNA 4KVNH 3VXUD 1J1XH 4QGYA 3TP4A 2ENYA 4OGAD 3QB7C 5MEND 4PLNC 3HC4L 1JPFA 1B2WH 1E6OH 4NT6A 3RL2B 2QEJA 2R0LH 3MRGB 4EXPX 1HINL 4RRPA 4CKVX 4Y16A 1NAKH 1UB6A 2LVCA 3P9LA 3WKMH 1GXEA 5C2BL 3J8F7 2PTTB 1Q9LB 4KKCC 4JFHE 1V3KA 5A16B 4M03A 1DUYA 5L9DL 4YX2H 1KB5H 2VKWA 1DJSA 4G3YL 1OAQL 2ESVE 4Y4HA 4LSSL 5IMKB 3A6OA 4F7PB 4JM2A 2FO4A 4M7JH 3DUSB 5E9DA 2XXCB 3EFDL 3LN5B 1RUKL 3L7FB 1X7QB 1F4HA 3MV8D 1GVIA 4MJID 2B5IB 2ATPA 3U0PB 5DUBA 4FXLA 4HPOH 3CSYB 1BWWA 1VFBB 3A0OA 2HYMA 3CXDL 2ARJB 2F5AH 1E27A 5F96H 2HN7A 3E8UL 4ENEC 1B9ZA 1KCLA 2Z35B 4KUZH 3MNZA 5TE7L 3QHTC 3MCG1 3WHE1 1RIHH 1FO0L 5EBWA 1GRWA 3H2WA 1BOGB 3PABA 1CDYA 1V3LA 3CLFH 3CNKA 4FXGB 4XCNB 1JNHA 5JPMA 1BQSA 5LJYH 4R0LB 4LF3A 4HXBH 1UKSA 5EWIL 4M3KB 1U3HD 3BP4A 5CEZL 5E5UB 5EOCL 4H1LB 4DKFH 4R7DA 4NNYA 2EDNA 2KQMA 4WI9A 1XZ0A 3G04A 2FJFA 3QPXH 4KV5F 5GSRA 1Z9OA 1XR8A 4WFED 1WLHA 4YHOH 4DAGH 2VDPH 1T1ZA 1QFWH 4PJBB 3O3BA 3MRFB 2UY6A 4G6JH 2VXQL 5KSAB 1MCOL 4NRYA 4Z76B 2J88H 1Q9OA 1YDPA 1QUNA 5C6PB 3T4YB 4KI5F 1WUNT 3VFTA 2DM2A 4I4WA 4JFPA 3WMSA 2NY0C 2Q20A 4P5TB 1QFHA 4YFLI 1JFQH 3P73B 1JJUA 4K94H 1S7UA 3MV7D 1LE5A 4H1LH 3NZ8B 4JQIH 2A77L 1T7WA 4P4KB 1O7VA 1MIML 3LKSB 1I7TA 4PRIA 4R9HA 4OD3L 2APBA 2XY2A 1DVFC 3B2VH 4XPFL 1F4YL 3PJSA 5EU6D 4ZTOH 1I7ZB 3VDAA 3BVNB 3FJTA 2DQGH 5E99H 1U92B 4NQTA 1NFDF 3IF1B 3FQWA 1B0GA 4WHYG 2BNRB 1KTDA 2GSGB 3WLBA 1ACYH 2XFXA 1TZHA 5CHNA 1OTSC 2WLZA 3KPPB 5DD6B 3P9MB 3TYFA 4QF1B 1MFAL 3UDWA 1B90A 4P4RB 4CU8A 4RWYH 5BW7A 3DVFA 1RUQH 2ERJB 3MRCB 5SWSD 2RGSA 2PYFA 1NCAL 5GGTH 4PRHA 3ZT5A 5F7UA 2EYSA 3L3DB 4PJGE 3FN3A 4HMEA 2F15A 3UTSD 2ZCKH 3BPCB 3QI9B 5E8EB 1TITA 4EZMA 1AXIB 1FNEA 2XTJB 3DO7B 2GCYB 3PV7A 3G6AA 1FIGH 5KS9F 4K7PL 1AGEA 1NBYA 5BZDB 1IZJA 3OJVC 4XMPL 4K7FA 2B4CC 4RX4A 3VXUE 1GCFA 5IK3A 2X4UB 4NYLB 3K1KC 3X12A 1Y18A 4P46A 1WBXA 2XZCL 4JFEA 2OJEB 5MENE 3OX8B 4OD2B 1RUPH 4P5MA 4APQC 4FFWD 1H0DB 3OAYH 4K8RD 1YECL 2GSIA 3MX0A 2VDLH 5C0FB 4JJ5B 3O4LB 3T77A 1C7TA 3EJYD 2F74A 1I8IA 4ZXBB 3LKPB 5DHYB 2IFFL 3BDYH 3TBWB 1DCLA 1IC5H 4Y4KC 3NCYP 4M62H 4MNHB 1M05B 3T0WA 1T04B 3BZEA 5H37H 4HK3N 5D70L 4U1MB 3U7YH 4I18A 1EH9A 3MV8E 5F7YC 3PHOA 4ZFZA 3V5DA 5I71C 3PIQB 3HPJA 5E8OB 4EI5A 5IFJB 2PW1A 3E6HA 3K4DA 4O9HH 3D1MC 4F7MB 4JFYB 3O4OB 1FLRL 1WVZA 3NFSL 3V4PH 3U7AA 5HHNA 1I8KA 2Z8SA 5D2LB 1A7PL 2CJUL 5DJ8A 3G08A 3SE8H 2YKLH 1DBJL 4BSWB 4LSPL 1QNZL 3GO1L 1OCWH 5FO9A 4Y5YB 3ZO0A 4O2CA 3EYFA 3FRPG 1A7OL 1FP5A 1DQDH 4XNXL 1NKRA 2ZSVB 4O2FA 4LIQE 5CJBA 2XIDA 2Y23A 2YS4A 3MLRL 3ZKMC 1ADQA 4L3CB 2YPKB 1AGBB 2APWA 4N0YL 3DX7B 3RX5A 3WS3B 1ERNA 1NDGA 3PL6D 4HS6B 2V6HA 4X9FA 2X9YA 3FMGL 5CWSA 4A6YB 2EDBA 4Z95L 2Q6WB 4IHOB 4MDIA 4JO2H 3F65A 1PG7L 3NAAH 1Q9KA 3GRWH 3L9RA 5DT1L 4PUBL 5EZJA 1G7HB 2CK2A 4E9LA 4OLUL 1X5ZA 1ZHNB 2UZIL 1K8IB 5HDOA 2P5EA 2NMSA 4KJWC 3IRZA 3DXAA 1A9EA 5I2IB 2QSQA 3ZDXE 4WI7A 2GUOB 3N9GL 2P8MB 1RULH 1G1CA 1FDLH 3GUTB 2OX5A 4J4PA 3UTZA 3C6SA 5JO5A 1HHKB 5JDSA 3OAZK 4G6AD 1XGRA 4WFGD 1MSPA 1NMAH 2Y6SD 1T5WB 3GSWB 1F90L 2LABA 1DBML 1QHOA 3AMLA 3TPUB 1EGJL 1NDMA 3MCKB 3OKKB 1KN2H 3QXAB 1KF9B 2X4OB 1ZGLP 3VXTA 4MWFB 4RNRA 3PWUA 3EO0A 2GTWB 1PKQA 3HG1A 4U1IA 1UFUA 4L4JA 4LARL 2JE8A 4P2QE 5SWSE 4CN6A 3EOTH 2AJSL 4MNGA 1RZKC 3F5WA 1IAMA 5HHOB 5D5MB 1XGPB 4L4VB 4FABH 4XMLH 3QR2A 1RJYB 2DMCA 3QQ3A 3UTSE 4B7IA 1UJ3C 2MSPA 1T0NB 1EHAA 3FO1B 1ZS8B 3JV6A 2VZSA 5D6CB 4NJAL 3NIGF 1YNTA 5BXFB 2CO7B 3QUZD 3HE6C 3MR9B 4NN6C 4QRRE 5GGUB 5IUSA 1U3ZA 4KY1L 4N8PA 2HKFL 1LE9A 1QP1A 3QULA 4OZFG 4XCCL 3DIFA 5L7XH 5EZLA 1FGVH 1BBDL 3DYPA 3VA2C 1KV3A 4NKIL 3VDBA 1A1NB 5FOBA 4Q6IA 1ITCA 1T1XA 4HFUH 4D0BA 3TT3H 4PS4H 4HS3B 4OKVA 1VEOA 1EZVX 1MLBA 3RDTB 4R2GC 2Q3AA 5JUEL 3SDCB 4F7EA 1EAPA 2A9ML 4TSCH 3QQ9C 3F58H 4XBEH 3RTQC 1TZGH 1WEJH 4JRXB 3P11H 1UCBL 4JO3H 5KSBE 2BY1A 4O4YL 3FOLA 3GM8A 5FGSA 1HQ4A 2GITA 5DJDA 1EUUA 1R3JB 2I60H 4EOWL 2EIEA 1KJ2A 2YXMA 2JF1A 2V5TA 5F7HA 2A0LD 2CPCA 4P23A 5GS0H 3P2TA 3H9SB 1TCMA 1XF1A 3STLA 5LBSH 2NY5H 3SCMD 4JZJA 4FQCH 5FYJU 4XC3L 5ELIA 1KIPA 2QR0B 3SO3B 5IHZB 5H35A 2AXGB 5T1LB 4M43L 4NC1C 3BKMH 3O2VH 3GIZH 2Q7YA 2B1HH 4ZDHB 5C0CD 3O6LH 4TOYL 2R69H 1MFEH 2APTA 2XQYK 4R6UA 3ZKQD 3T1FA 2G75A 4JFDB 4L8CA 4WFHD 2OXGA 3QIWB 4C4KT 2QSCH 4N9GA 1TQBB 3SDAC 1QSED 3MLUH 4YBLC 3MXWH 4MA8L 4WUKH 3MRQB 1CFNB 1JWMB 2EXYD 1WIOA 3OXSB 1PDKA 4LCYB 1UWEL 1YY8A 1I1FA 1MJUH 1A1OB 4JAMB 4DOHB 4XCEB 1WGOA 3MV8A 3NN8A 4MJIA 1HHHB 1DE4B 2AJUL 4LSTH 5FHAL 4LLUA 2XZQL 5DJXB 3VFOA 4G6KH 5EIQA 4QRSA 3KJ6H 1H3WM 2F5BL 3C2AL 4NM4L 4WI5A 1HH6A 3LIZL 4JDVA 4CGTA 5ILTH 3NPZB 3GBML 4U1HA 1NCBL 1IT9L 2E7HA 3K2MC 2LVEA 1ZLSH 1FE8H 2AAVA 3G6JE 2DL2A 2NX5B 4GRLB 1DLHB 2DRUA 1YPZE 3HC4H 1WZMA 4AH2B 2AXFA 1HINH 2QQQA 5C2BH 4JKWA 4WFGE 5L0QC 5L9DH 2I9LB 5L88L 3KYNA 4UIKL 5JW3L 2G5RA 5FM5M 1AJ7L 4G3YH 3O6FD 1OAQH 4RISL 4U1SA 4Y19D 3QPQD 3EJZC 3IDUA 4LSSH 2F8XC 4MA3B 3ARFB 4RFEB 3GM0A 3FAXA 2YPVL 3EFDH 4OLYL 1RUKH 2DIAA 1A6AA 1BFOA 4KJQC 2X9WA 3FO0L 4M7ZC 3CXDH 3OTTA 3MV7A 5BCAA 1TCRB 3E8UH 5CBAA 2IC2A 5GSVA 4LQFL 1VACA 2VAAB 4KI5D 3LV3B 3OKOB 5TE7H 1MUJB 4NWTL 1FO0H 4HGWB 5LGHL 5EU6A 3VWJA 4HWEL 4BQBA 5FYKD 1BAFL 5I8CA 4UDTA 4PRPB 5HVHC 1P9MA 3MUJA 5D72L 4UOJA 1WFNA 1FAKT 5LGKA 3FB7A 2H26B 3F7VB 2V2WA 3BEVA 5EWIH 2DYPD 2DN7A 1TZIA 1F97A 2EIBA 5CEZH 3LEXA 5EOCH 1UZ8A 3RBGA 2ZUQB 4YR6B 4PPTA 4N8VB 1V7ML 3QNXA 3TNMB 4JRYE 2NY1C 1UM5L 3SO5A 3ALWA 4F8TA 3LKNA 5I74C 4FTVD 5JA8B 3BN9C 1U3YA 3QEQB 3UJJL 3EYUL 4JREC 2ID5A 1MCOH 4DZ8B 1RZ8A 1TLKA 2ADIA 1RZGA 4KKCD 4UAOB 4LVHC 4G9FD 5KN5B 3AB0B 1UWGL 5FGCB 1AGDB 4FQHA 2ZUTA 5J6GA 5B39A 1U8LB 1CG9A 2WZPD 5AZEL 3ZMRA 4XT1C 1LEIB 3HZYA 4PJFA 3F8UB 4QXGL 2A77H 4HWZB 5GJSL 3GBNL 1KYOJ 1TJIL 2VWEC 2MCG1 4P2OB 1MIMH 4ZUTA 1NBVL 4RBPK 4BQ6A 4OD3H 3QQ4A 1R5VA 2NTSP 4OZGB 2QQNL 2HAZA 1EXUA 4XPFH 5DFWH 1F4YH 1G7IB 2GK0B 1HHGA 1J18A 3AM8C 2OTUA 1CFTB 3KNBB 4WTZA 1F4XH 1BJ1J 2BNQD 5JQ6L 2ZZUT 5JMOC 3MRDB 3OL2A 5C0CE 3L3OB 5DMIL 4XNMA 4OFIA 2P43B 2N56A 5HGDA 12E8L 1JUFB 4WFHE 1XIWA 4J8RB 3QNZB 1HCFX 1MFAH 3HN3A 4WVRA 3HR6A 5IB4A 4E41B 1S7XB 4MXVE 1A2YB 4RGMC 5EC1A 3QSKB 4GLRH 4IIQB 1BWMA 5CGMA 2XG5A 1CFVL 4PBVC 1KNOB 1NCAH 3QDGD 1J11A 2YD2A 3LPGA 2IH3A 3D18B 3W39B 2HLAA 1P84K 3MOBL 4PYHA 1XF2A 1EERB 3VG0L 4S1DC 3I02A 5HI5C 5CMAA 4K7PH 2DTML 4EQ3A 5J8OA 4KPHL 1NGQL 4G9DA 4LHJB 5FDWB 2NY0D 3ROOB 1HXYB 3EGSB 4PV9A 4XMPH 4K3EL 5K9QI 2K3TA 2DWEB 4WO4A 5ICYA 2B7DT 3I85A 3Q6FA 5E8NA 5BJTB 3V6OE 4OQTL 2XZCH 4TPRL 1OAZL 2ICWB 4LRIC 3QDJD 1HQRA 1OQXA 4LLQA 1BMGA 1YECH 2DBLL 3ZLQC 4NQDB 4G6ML 1IEAA 5A2IH 1DVFD 3FAWA 5I1JL 2IFFH 5C0AD 1JGLL 3FB8A 3PL6A 4Y19E 4U1GC 3VFWB 2APFA 1BFVL 1NGZB 5MEOB 5D70H 1OTSD 3UBXG 3C5ZA 5IB3B 2AJZB 3VFUB 4MMXC 4W4OA 2GEEA 5HY9A 2EYTA 4OFKA 1KPVB 4PTTA 4JO1L 4FQ2L 2ZSWB 4WENB 4Z78B 3SKNB 4NO2A 4JG0L 2F8OA 4H25A 1FLRH 4KI5E 4OFYA 2NZIA 3NFSH 2F53B 1DBBL 4HKJA 4PRNB 5KTEL 1A7PH 2CJUH 2Z8VC 4PRDB 5FYKE 3FO2A 3SKUD 4MAYA 4UBDC 1DBJH 4OAWA 2FZ3B 2FLRT 1QD0A 4LSPH 1WBYA 1QNZH 3GO1H 3VFRA 1IKNA 4NQVA 2NTFB 4JKKA 2E6PA 2VQTA 3ARBB 5J11B 2WSKA 4D9QD 1BGXL 1KIQA 1A7OH 4UZGA 3GMNA 4F9PC 5DRWB 1JZ7A 1IL1A 1JYXA 1FGNL 4RGNB 4XNXH 3SDXB 5KSVB 5A3IC 4H8WC 2J8UE 3MLRH 1C08B 2R0ZL 2X1XR 5ALBL 1NFDE 4FTVE 4APQD 4N0YH 5I1KL 2KBGA 4QHLB 3FMGH 3NCJL 4Z95H 4Y5VC 1NUNB 5IQ9B 5A16A 4L8SA 1PG7H 1TJGH 4G9FE 5JHDD 3BJ91 4GRMB 5C07B 5DT1H 3RWFA 3ZE1F 1BZ7B 4K3HA 4PUBH 1AXSB 3FTGA 3UTQB 4OFVA 1OP5H 1CXKA 4NM8L 5IMKA 5F88B 4OLUH 3O41B 4Y4KD 2UZIH 1ROWA 2B20A 4S11A 3RY4A 3QUZA 1R3KB 3D39B 1X7QA 3N9GH 1IGCL 3LMJL 3W9EB 1ZXQA 2AV1B 3U0PA 2HVKB 1VADB 5FM4A 5I1CL 1VFBA 3SEPA 1T6VN 2ARJA 2XACC 3KPOB 1QOKA 1GAFL 3R1GL 1X5YA 4WV1A 1RPQA 3TC9A 4ZOCA 5KS9E 1F90H 5FGBA 5GGSB 1DBMH 2Z35A 2BNQE 1EGJH 1MY5A 1J0KA 5KVFL 3D48R 5JPNB 4QTHA 3AREA 3QHZH 5FYLD 5BOPA 3GSOB 1EX0A 5BRZB 3VRLF 4GG8B 2MCPL 4KQ4L 2I07B 4WI3A 4R0LA 3BGAA 2EDRA 3UP1A 1FNGB 4LARH 4XNZB 2GAZB 1CE6A 1R3HA 1RVFL 4P3WA 4ZO8A 5J7CC 2AJSH 1EK3A 3KPTA 2V17L 3WUWB 4GUPA 2BVQA 5EU4A 1CK0L 5FUCE 3KPMA 4M1GL 1KLGB 3ZKMD 3CIQA 5E0QA 4IEFB 2WIMA 2YD6A 3DSFL 4HIHB 5IVXF 5J12C 4F58L 4L4TD 1PG7W 5I1HL 3V7AE 4NJAH 3T4YA 4RFNC 1OOAA 4MDJB 2HH0L 4UILL 1KXQE 3VXNA 4KY1H 3WO4C 3O8XA 2HKFH 4PJDB 3BQUB 2GJZB 3HAEA 4IOFC 4XCCH 1YQ2A 1PFCA 3GKZA 3P73A 5CLWA 1QSEA 4KJWD 2JJTC 1BBDH 5ICZA 2HT2C 3EDJA 4NKIH 4P4KA 1MAJA 3GHEL 2EDXA 3LKSA 2VXVL 4YHLL 3ZKNC 3I2CL 4OGXL 5A2FA 2EDDA 1M7DB 1MCCA 4OV6F 1I7ZA 5JUEH 4UDUA 1U92A 2A9MH 3PWNB 1ETZB 4NNXA 3IF1A 5EIIB 5C0AE 3BX7C 1YEEL 3OKYA 3MODL 3PDDA 5I15L 2A83B 4UT7L 1UCBH 4I3GA 4HGKC 4O4YH 4HK3J 5DK0A 1R3LB 2OP4L 2RFXA 4EOWH 3DX9B 5CP3A 1BF2A 2BY0A 3DHMA 3FFDB 5T3ZD 2CLVB 5F7MC 4LPVA 3Q5OA 4KROB 4PRBB 4HIEA 1X5XA 4XC3H 3MRCA 1NMBL 4JANB 3QJHB 3MBEC 4M43H 1G6VK 1JHTA 5FB8B 2Q1EA 1F3JB 1CGSL 1KXTB 2MWCA 4PJCE 4PY8J 4WDIA 4TOYH 2FEDC 4OLVL 1I1AB 1IC1A 1PY4A 4F15B 1R5IB 5EUOF 3NCYS 2IPTL 5T1KB 4Q97A 5DQJA 4QLRA 4AT6A 5BZDA 1TENA 1AIFA 4Y19A 4MA8H 2D7TL 4D9QE 1KCUL 1XFPA 1OP3K 4Z9KB 2X4UA 1UWEH 4P5TC 4JDTL 3MNVB 4LP5A 1A1MB 1DN0A 2OJEA 3OX8A 2A73B 1P1ZA 2AJUH 4NO0B 1CICB 1MFNA 5FHAH 2NLJA 4GKSA 4DK3A 5JOFA 2XZQH 3MROB 4CRPA 1YEDA 1BJ8A 3C8KB 5J06A 3MRMB 4U05A 1WK0A 2F5BH 3O4LA 2FGWL 3C2AH 4M7LL 1ZVSB 4NM4H 2FX9L 4R2GD 5E8DL 3LIZH 4ZXBA 1DP0A 3GBMH 5B38B 1NCBH 1IT9H 5JHDE 1CR9L 1X9QA 3TBWA 3QIUB 5DK2A 5IJVB 2I24N 3QQ9D 3EUUA 3RTQD 1MVUB 2ED9A 4L8BB 4AEHL 1D6EB 4XRCA 1T04A 5LGJA 1FL5B 4MNQD 3LQMA 3RZCB 5SWZD 4BQ9A 5C71A 5C70A 4HKZB 3L6FB 3C6LB 3OHXA 2VDML 5IFJA 3EFFB 4NZTL 3RL1B 4M5ZL 4XCYA 4JFYA 1GGYA 3RY5A 2YZ1A 4FTVA 3ZYOA 5L8LB 2H3NA 5L88H 4UIKH 1KENL 2PW2A 5JW3H 1AJ7H 3MLXL 1FPTL 4RISH 3G5YB 5D2LA 2W92A 4PB9L 4MQTB 4XXDA 1HHIA 3MJ7B 2H2PC 2WBKA 1LGVA 4G9FA 2YPVH 4OLYH 3BP6B 1TVDA 3QEUB 5IOPA 3F12A 3IVKA 3SDAD 3FO0H 2X7LB 4LHUG 2BCKA 5HI3C 4X80L 4X5XB 5E8PA 1NAML 4QXWA 5HPOA 4QT5A 1EJ6A 4WW2A 4J3WA 5IMLB 4Z8FL 4LQFH 5B8CC 1J0IA 4D2NA 4L3CA 2YPKA 4NWTH 3I6KB 3N1PC 4HS6A 5LGHH 4A6YA 1MY7A 2C4XA 4HWEH 5F7DB 5C0EB 1BAFH 1PQZB 3MACL 4L4TE 4IHOA 2BFVL 5D72H 3TO4C 1CD9B 2E9WA 4LPWA 3SE4A 1JI1A 4CNIA 4C59B 3SDYL 5KOMC 1OARL 1K8IA 1Z9SA 4WGWB 1V7MH 3JXAA 4JFFE 2I5YL 3W0WA 1UM5H 4PJBF 2DTSA 4ZYKB 4H0HB 4OSUL 3FQNA 2R1WB 4I5BA 3TF7C 1BHGA 1IFHL 1NJ9A 3UJJH 4OCMC 3EYUH 4FFYL 1A6UL 4FQXC 1F6AB 3V9FA 2I27N 3O11B 1FV1A 1T5WA 3QDGA 4PD4J 2JCCB 3CFBA 3LZFL 3TV3L 1UWGH 5C0BD 4YHYC 4E42A 4Q9BA 1AP2B 3U48A 3IFLL 2WINA 3OKKA 5AZEH 2PN5A 2X4OA 4LKCB 3V5KB 1MCSA 1KIRB 2DKUA 4YDVA 5DZOA 3WFDL 5JIPA 4MWFA 2G5BA 5T3ZE 4MA7L 3D9AL 4JKPL 2UVEA 3OJDB 3WHE0 4QXGH 4ELME 5GJSH 1QFUL 3GBNH 1TJIH 3TWCL 4KJQD 3AY4C 4RMQA 2YN3A 1NBVH 3WHXB 2QQNH 4XH2A 1NSNL 3QDJA 3AUVA 4RFOL 4IRZL 1XGPA 2YUZA 5JQ6H 3WJLC 3ZE2E 1ZKAA 1RJYA 3UXFA 4HWBA 4LCCC 5DMIH 3HRPA 2DQIL 1DVFA 3TA3C 12E8H 1JK8A 4OD1L 3VCLA 3FO1A 4P3CL 1ONQB 3RZWA 3TEUA 5BXFA 1F11B 3AU1A 3LRGA 5LVEA 1MJ8L 1U8NB 1SYSB 1P7QB 1B88A 1GPOL 1ZA6B 3FN0L 1CFVH 4YZFF 2NY1D 4Z7UA 1A1NA 4R4BB 3SY0A 3BN9D 1A9BB 4HS3A 1LO5B 3MOBH 4W6WB 1F2QA 4DZBB 3VG0H 3RDTA 3MLVL 1HIML 1LD9A 3IDXL 1GIGL 3ULUL 2DTMH 4PJ9C 3DNKA 4GRWB 4Z7VE 2H8PB 3ARUA 2X4PA 3KPSB 4KPHH 3WN5C 1NGQH 1TQCC 4GS7B 4JPKL 4K3EH 4L3ED 5DZLA 2X4SB 3N50A 4G8FA 1YYML 1FG2A 4HIJB 4OQTH 5SWZE 3KLAB 4TPRH 1OAZH 2CD0A 3GIVA 5DSCB 1ES0A 3VH8B 5FO7B 4KRPC 2Z0BA 5J1TC 5FO8B 2FH8A 2C1OB 3LQZA 2DBLH 2W91A 2XOTA 4G6MH 3ETBF 5IHZA 2AXGA 4U7KA 5T1LA 3RKDC 5C9JA 3MFFA 1A4KA 3INUL 4NC1E 1BQHA 4M93B 1K6QL 5I1JH 1Z3GL 2KZWA 4C83A 5JW4N 1JGLH 5TF0A 3E6FA 4GRWH 4J7RA 4YFEA 5I17A 3GMPB 4JVPA 2GFBA 1BFVH 1J9CT 4LHQB 1JHKL 4HGMA 5E00B 3ULVC 1T0MA 1ZLVK 1JWMA 4NN7C 4JO1H 4FQ2H 4LCYA 3T65A 1A1OA 3OKNA 4JG0H 4P9HC 3MRJB 1DE4A 1CD8A 1XCTA 1DBBH 2IBZY 5KTEH 3B9EA 2NY5C 5FV2A 2VITA 4QEGA 4MYWB 4S1DD 5EORL 5JMRA 3DV4B 5HI5D 3C09B 1IAOA 4NPYB 1K2DB 3MJGX 1BGXH 4HUUA 4IJ3B 5IM7A 2NX5A 2HRLA 5EU7E 2HMIC 4GRLA 1DLHA 1FGNH 3MRPB 1JWSB 4G8IA 2ZWLT 3HRZB 5TDPB 1TPXC 2R0ZH 5ALBH 4MLSA 1M7IB 1KJVA 2VN4A 2R29L 4DN4L 5I1KH 1OGAE 4DGYH 3NCJH 3HI5L 4HZAA 4KAQL 1RZJL 4PGEB 3VFNB 1BQUA 3PQYB 5ANME 5JNYA 4Y1AB <