5FV1L

Crystal structure of hvegf in complex with vk domain antibody
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VK DOMAIN ANTIBODY
publication title Novel Interaction Mechanism of a Domain Antibody Based Inhibitor of Human Vascular Endothelial Growth Factor with Greater Potency Than Ranibizumab and Bevacizumab and Improved Capacity Over Aflibercept.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 23
structure length 108
sequence length 108
chains with identical sequence M
ec nomenclature
pdb deposition date 2016-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fv1L00
2V9RA 4WFHD 5E7FA 4PYGA 4FQCL 4JFPA 2XZAL 1KPVA 3BZEB 5FIEA 3EFDL 4KDWA 3EKCA 5FECB 3PE9A 1WZKA 3QCTH 4WCYL 1AD0A 5E8OB 5IF0B 4CUCA 5FYJE 3QZWB 3U82B 1LK3H 1B6DA 4H0GA 5GS2D 3IDNB 4I3RH 4P23D 4BKLA 3UAJD 1TVHB 4GO6B 2X9WA 7FABH 1MLBA 5FGBA 4O02L 1BOYA 4YK4B 4JM2F 1X9QA 2GITA 4QF1A 4KDTA 4CNIB 3K7UA 4LSVH 4YJZL 3OKNA 1OAZH 2ZOKA 2Q7YB 3WXWH 3MUJA 3ULUL 4HWUA 4YC2B 2WQRA 3JWDL 4J12A 3QH3A 3D6GA 3SQOL 4GBXD 4UIKL 1RIHH 5TQ2L 4OF3A 5SX4I 5IMLA 4FFYH 4MA8L 3MNWB 3RDTA 3LN4B 2P5EE 5DQ9A 2WIIB 2FCBA 5DDHB 5IBLD 2E27H 4JDZA 3VRJB 1D3CA 1MFBH 5EIIB 1FNFA 1JWMA 2FIKA 4NN5B 2NTSP 1Y18A 2ADJA 3ME0A 1J0KA 3RWIA 5DHVH 4RBPK 3VH8A 1N6QH 3IU4H 1IL1A 1UM4H 3ALWA 1T7ZA 1C5CH 4MQXC 5TDOA 2NY2D 3CVHA 2RBLA 1C7SA 5I0DA 1A2YB 3F65A 3VD3A 4L4VE 4PGJA 2F54B 3BXNA 1V7NL 3WUWB 3MLZL 4KJQC 4UUJB 3SO5A 1WC7B 2EDRA 3CMOL 4X99B 2X1OA 5C6TL 2M26A 1JUFB 1NCWL 1NEZA 1L9NA 5F6HI 1S9YA 3ILQD 3S3PA 5JW4Q 2CUIA 3ZTJH 4Z7VB 1HQRA 2EDTA 4XVJL 4G80A 2PYEB 2DDQH 3U30B 3UC0L 1VFMA 4KRPC 4LEOB 3AFLA 4DUXA 4M4RA 5DVKA 4G8GD 5J1AA 5EN2B 3QO1A 4RGNE 5FF6B 1HH9A 1R0AL 4D94A 2VDOH 1DQTA 4DGYH 1KLUA 4PRHE 2Y1VA 3GSNB 1TNNA 4P2CG 5DRXB 5TDNB 5B3JF 2VH5L 4D9LL 1IC1A 3WKMH 4IOIA 3QB7C 3G5ZB 4EBQL 5IB5B 2H32H 3QRGL 2AJ3B 1A7OL 3OZ9H 5TQ0H 3DHMA 4H88H 3ABZA 1MRDL 3IVKB 2HKHL 1MCFA 4PPTA 4UTBH 4YIQB 3HMXL 4XCNA 5CGYC 2WWKT 2YD9A 2NW3B 3TBSA 3BN9C 3RUGE 3P9WB 3ARSA 5DWUL 4Q9RH 4OTXH 4U7MA 3KDMA 3HNVH 1AIFA 1MWAH 4FXGB 4LU5H 4QCIB 5HJ3A 1F6FB 5GGQL 4KK8D 2CIIA 4A6YA 4DVBA 3G5YA 3BP7B 4JFYB 2O5YH 3M17B 3RTQD 1ZTXH 1CXKA 4AEHH 4Y5YB 3RY6C 3WXVL 3BWAA 4KUZH 5J11C 1DSFH 5DJZA 3OG6B 1KJ2A 1ES0A 1BECA 3STLB 2YRPA 3IJYB 1RURL 2EH7H 5IM7B 3QFDA 1AKJA 4R7NB 4ZO6A 1A9BB 2Y6SD 5C3TA 1T4KA 1EAJA 4H25A 4JG1L 4M9PA 4R97B 1RV6X 3TJEL 1SYVB 4MD4B 4PRDB 4P2RB 4WEBH 3T3MF 3DO7A 3TBYA 3WE6B 1NPUA 4HUXA 4OI7A 1QFUH 4H8WC 3EDKA 2XOTA 3ARYA 1EUTA 3CLEL 3O6FC 4MJIB 1T1XB 4PJBB 4Y4FD 2JJTC 1AGFA 4R0LB 4XCYA 3BP5A 2OQJA 4G6KH 4F7CA 5T3ZD 2HWZH 3CSYA 3T09A 1BVZA 1LQSR 4MX7A 1YDPB 2W9EH 2VXSH 2H6PB 1KELH 1T20B 1J0YA 4CU8A 1MI5A 1UCTA 3FFDB 1ZS8B 4MXWH 4D9RE 4LLDA 2CLZB 4UV7H 2QKIB 3BJLA 2PW2A 3IF1B 5DD1H 1FCGA 1XR8A 4XMPH 1FGNL 2R0LL 3GNML 1REIA 5FYJD 3VU2A 2HT2D 3QYCA 4X4MA 3NTCH 1K4DB 3KYKL 2AJXH 5HVHC 1GIGL 2PTVA 1NFIB 1TITA 4N1CA 1S7TA 5L88H 1N64L 3OR7A 1JPST 5HHXL 3FN9A 4AEEA 4XGZB 1FIEA 5SWZE 5FUCE 4DKAA 4KVNH 3MLSL 4QXUH 3T0AA 3DRTB 4MD0A 3H7BA 4HWEH 3RWEA 5F71A 1OAYH 15C8L 3LV3B 1ZSDA 1LNUB 3MV7A 3ULVE 3SDAC 1G0DA 3NFNB 4L8SC 3MJ6A 1ND0A 3VD4A 4OCYL 2EXWC 4OFDA 1JIBA 4AH2A 1CL7H 2Y07L 1NGZB 3ECBA 4OD2A 2O5XH 1NCAL 2IAMD 3IFNL 2D7TL 4RNRA 3V9FA 4P5TC 4YPJA 4YWGH 4PJGF 4H8WH 2IFFL 3G5XA 2C3XA 2G9HB 3CPLB 3EGSA 3ZTNH 4QRUB 4K9EC 3FHQA 1ZGLP 4QWWC 2Q76A 1GZQB 3C5ZC 2ARWA 3ETBF 3LPFA 2EIBA 1JGVL 4NWTL 1AQDB 5TFSH 1UH4A 5DGQA 1KLGA 1T1ZA 1TJGL 4L4VD 1GHFH 1FO0H 3O6FA 3PDOA 1XIWB 1U6AH 1A9EA 1RIVL 2JJTA 4PJ9D 2VE6A 4Q97A 4U1KA 2R1XB 4HFUL 2ITDA 5AWNH 1NC4A 4WW1B 5C0CE 2VLJB 2Z4QA 1OM3L 4LRNH 2AK4A 3MLRL 1GPOL 1MLCB 3H2WA 5GGRA 2DQTL 4L3EB 3VXRE 4W68A 5CJBA 5JPMB 2GAZB 4HWZA 4RGND 3VG9B 2DS4A 2NY7H 3VWJD 2R69L 4WGVB 1IGYB 1EFXB 2QSVA 5FOBB 1NLBL 4MXQC 5EULV 2BMKA 1MJUL 3CFEB 3TH2T 5T1LA 4ZS7L 5D2NE 5L0QC 3OAUL 5K9KB 4G6JH 1A6VL 2VIRB 3IGAA 2CR3A 3HG1A 1DBJL 4X8JB 5E2VH 4Z7WE 1H3PH 4QXTA 4HUUA 2P48B 4QEGA 1A7NL 3TT1H 3K8LA 3ZE2F 2FECL 3MMEB 4YO0A 1JNNH 3F62A 4P59L 4R2GC 1XFPA 1SMOA 5FCUH 2YPVL 5DMKB 5JMRA 1NFDF 4ENED 3JZ7A 3W81A 1FV1A 5CP7B 2YOCA 2VZ1A 4NNPL 4NC2B 3FB8A 1S7WB 4PJ8B 1YQ2A 3O8XC 2HJFA 1CZ8L 2V2XB 4NO3A 4P5TA 1NMBL 3P4NA 5CWSB 1NGWB 3GJEB 1IM3B 2YWYA 4PGBA 2EE3A 4J2XA 4MAUL 4J23A 4RZCA 1MJJA 3WUZA 3GMPA 2A38A 3ZKXB 3MUGA 4K8RL 1LEGA 4G9FB 3GMMA 1BBJB 2WBJA 1NCDH 2WZPD 4NZUL 5GZNC 3WIIH 3CFIC 4UV4L 3I84A 1ED3B 4RAUB 2R2HB 1DEEB 5IJVB 2Z31D 5DHYA 2HTKD 5CSZB 5ALBL 2X42A 3GO1H 2A1WH 4P2OB 4QYOA 4BZ1H 3IXAB 4NP4H 4OF5A 4PJIB 5C0BE 1XF3A 4OZ4A 5I8OL 3SJVA 1Y0LA 1IEHA 5EZLA 3SY0B 5INCB 2YPLA 1T7VA 4PB9L 2ZJSL 4M48H 2YK1H 2EO9A 1B4JL 2Q3AA 2J4WH 3JWDC 4YHYC 4OZHE 4FQHB 2A73B 2VXVL 4YQXH 3ES6B 2C3WA 1S7QA 3SDDA 5HYEA 4B0MM 5JW3L 3T1WA 4XXDA 3MRIB 4G6MH 4M9OA 1IQWH 3CLFL 3TZVA 2W0LA 3DX7B 3P9MB 1MCNA 4LNVA 3AS0A 5JW5A 5FO9A 5LGJA 4D9RD 4RBPH 4NKDA 5LAXA 1JWUA 4OFKA 4DZ8A 2BDNH 4WV1B 2DD8L 4JRXE 2EEBA 4NNYB 1XGYL 4XAKD 3IDXL 3QDJA 2FLRT 3ARFD 1C12A 3BEWA 5C0DA 3D9AL 2AQ3A 4WWKD 2GY5A 2B7DT 5J3HD 3X3GH 5I74B 4ZTPL 3L9RB 4M61A 2X09A 4AMKH 3FQUA 4S11A 5DQJB 3VXQB 3MYJB 1I1FB 5SWZD 3P2TA 5JLZA 5KSBB 4AEFA 4WCYH 3QULB 1MH5B 2PNDA 4N0UA 4X6BB 3RAJH 2CSPA 3H42L 1UQSB 1RHHB 4P9MH 3O8XA 4K3DL 3J7HA 4L1HA 4XCEA 2PKDA 3ULVD 4WVRA 4I5BA 3HE7B 3OR6A 1KXTB 4HK3J 1J0HA 2GSIA 4WFEE 1KTDA 4JPIA 5DR5L 5DYOB 2WP3O 1WCBB 2P42B 3V52H 2HH0L 3LVEA 1CS6A 3NIGE 4XPBH 2ESVA 1T0NA 3OAYK 5JDSB 3KYOB 4HBCL 3CGTA 5KVFL 3RNQB 1UH3A 2FHBA 1EFQA 4NO2A 4WRLA 1LE9A 3JWDH 3JV0A 1PW3A 1ADQH 3NCJL 4RIRA 4UIKH 4JFDE 5TQ2H 3T0EE 2H26B 3MRPA 2Z8SA 4LLYB 3KPMB 1DQLL 2A83B 1GZPB 1QA9A 2X7LB 1YNTB 3KPSE 1RPQA 3V7AG 5IQ7L 4P2YA 3FRPG 4JFFD 43CAB 4H20L 5C0FB 4DFIA 5ILTL 3HFMH 4X7SL 5I17A 5HD8C 2R2EA 1TQCB 2WIMA 4J3SA 4F8QA 2VZVA 4OZGE 2BNQE 4CKVX 3MACL 4GAGH 4YPGA 3QUXB 2AJYL 3MREB 5C0CD 2QADD 1YY9D 3QI9B 3RZCD 1FG2B 3FQXA 4Z7UA 3O11A 2NNAB 5E2TH 1CFNB 2GK2A 5DD0H 3VXRD 1V7NH 2I9TB 3QWOB 4Y4HB 3BAEH 4LSSL 3PXHA 1IKFH 5ALCH 5DI8A 1U8OB 1ZA3A 3IDGB 3T77A 1E4WH 3HC0A 5D1ZA 3P11L 3K8MA 3P9LB 4MNQD 1EHLL 1F4WH 1R24A 2VL5B 4X4XB 3F6LA 4OKVB 2K9UA 3ZSSA 4XCCL 3U4EB 1Q72H 4RFNB 5FM4A 1FFPA 5FHBH 2FO1A 1K85A 3LSOB 3RJQB 5I76B 4R7DB 3WL9A 2CLRB 1ETZB 4B7LA 2AI0H 3D48R 2NYYD 3GHBH 4NO0A 3KWWA 3TFKD 3GGWA 3QUYC 1JZ8A 2CKBB 3VXPB 4LVOC 4CDGC 4EBQH 4IJ3C 1D9KC 4NM4H 3QIWC 4X6DE 1A7OH 5CP3H 1MRDH 1SM3H 2HKHH 4YE4L 4GXVL 4K2UL 1X5ZA 3QWRD 4JB9L 2FATH 3B6SB 5D1QC 3ULSB 1HYSD 5DD5L 1HIML 5D93C 3VXMB 3WJLA 1GGBH 4HIIA 1RUQH 5ANME 5C1MB 1IAOA 1RJYA 4U6VL 3HE6C 1RUKL 4HKZB 4Z78B 4X80L 3SE3C 3IS1X 2BVOB 3HMXA 4HJGB 2UZIH 3VGAC 5E24E 3QEUA 2FX8L 4XWGL 4RCAA 1U3HD 4KH2A 2A9NH 3RGVC 1DN2A 5JNYA 3NCYP 2OLDA 1CGXA 5C0BD 3RIAF 1OF2A 5LQBH 3WLBA 3THML 1IEBA 3VFMB 4D0CA 1PEWA 4G6FD 4EOWH 3R06A 2X41A 4P2QB 1G6RB 3TVMD 1N5YL 5H37H 2V2WA 1X7QB 5HGBB 3I02A 3UXFA 1CGTA 1PZ5A 3DIFB 3MCLL 1CG9A 2VXQL 2MFNA 1NMCC 4PTTB 5FUOL 4PRPE 3S4SB 1FNSL 1MREL 4FG6C 1IAII 2N1KA 3TC9A 2EICA 3AXLB 4G8EB 2V2TA 4RAVB 3NFSL 4WU5A 1AO7E 4BSVA 3RBSA 4YZFF 4Z8FH 4IOFC 4Y1AE 1MFAH 4PY8J 2J12B 1KIPB 2R56H 4JRXD 3MRJB 5J6HB 2BSRA 4V2BA 3TT3L 1ZANL 4N9GA 2VSCA 4KGLA 3ZSTA 1A21A 1WBXB 4GAYB 2BSSB 4E41E 1BZQK 5LG1A 1IJ9A 3EYFB 1VFAB 4PJFA 5EUKB 2Z92B 4C54A 1B88A 4WUKH 5IR1A 1AR2A 4MS8D 3MR9B 5GGUB 1ZGLA 2F53E 2DJSA 2I60L 1D9KA 1ZEAH 3QIWA 3S4SG 2NY1D 4WO4D 1FIGH 3W2DL 3CJJA 1BZ9B 1WFTA 4D0BA 1KYOJ 2G5RA 4MJ6B 1GYAA 3ZYZA 1D6EB 4ALAL 3FZUC 4AY0A 2XNAB 4LEXH 4WFED 4L29A 3NIDE 5DJYB 2NY5H 3N85L 4NKMB 4CMMB 2ORBL 3WYRA 3MLSH 4YDVB 5DMIH 2CD0A 2VWEC 3CDYA 4XVSL 1FNEB 4K3GA 4PRAB 1NAMB 2IQ9H 5ISZB 1ZV5A 1KBGL 3DOSA 5DK2A 3GDBA 5ACZA 3BZ4B 1QYGL 4M5ZL 3BHBA 2Y07H 3C60B 1Q9KB 4JFDD 4FZEH 3O45B 2B4CL 3T0ED 1NCAH 5J13C 1M4KA 3KPSD 1D5XB 2D7TH 3HZKB 2Z9TA 3TO4C 3H3BC 2F9BT 2GTZA 4L8DA 5IVXA 5GS0D 1ZLUK 4ORGB 5M7QA 1YEIH 3HPJB 5ICXA 4N8VA 4ZAKA 3GHEL 2BNQD 4JCLA 2DLFL 3GSOA 1XGUA 3U4AA 1BLNB 3FB5B 3GSVB 4GBXB 3U0PA 1CGYA 3BJ91 3L3DB 1UACL 4KROC 4MSWB 2FJHB 4L4TD 5C2BL 4WU7A 3NOIA 1U58A 4GRWH 4ODWA 1U8PA 1XCTB 4OGYH 4G6AD 2ZWLT 4X6FB 2YHGA 3DYMA 4PJ7E 2KQMA 5T5NG 1H9VA 5IW1A 1SJVA 1J88A 4K8RC 4BSJA 4HIHB 3BH8A 1NCCL 2HT3D 4HFUH 5DFVD 2VZTA 3B3IB 1HXMA 2J3SA 3BOVA 5IEHB 1OM3H 1MFDL 4WI9A 1G7MA 3MNZA 3LRSB 1MELA 4N5ED 1G6VK 3GK8H 3MLRH 4PB0L 4TTDD 3I3BA 4OCXL 5D7JD 3EDEA 5MENB 2FR4B 2BP3A 1TTGA 4XNZB 4EI6B 3P77A 4XNUH 4BZ2L 3ARGD 3U0WH 2R69H 3I3DA 1KPVB 1MCLA 4CL7A 1NLBH 3CFKB 4KV5F 3S3SA 4JM2C 2G75B 3OAUH 4UAOB 3TBWA 5ITFA 3FQWA 1DBJH 4HV8A 4G8GB 5ESVA 1MNUH 2H45A 3GIVA 5EO0B 3BPLB 5TE6L 4L3AA 5EBLA 4PG2C 2Q7NA 1FE8H 2X4UA 2HG5B 4NQXB 5ESAB 1E6OH 3TP4A 1QBAA 1TNMA 3NH7H 1OAUL 1TPXB 2JLLA 4QF1B 4ELMB 1PKOA 3I6KA 4EN3C 1LO2L 2P49B 4GS7C 2JB6A 4GG6B 2YRLA 3TO4A 3QQ9D 4PJDB 3RPIA 3ROOA 1D6VH 2ZUTA 2YKLH 4X8XA 4TNWF 3V5HB 3TNMB 5J57B 3TBTA 4PJXE 3UYPA 2FYYA 5DQ9B 5E5MA 4MZ2A 4R8WH 4NWUL 5BRZE 1JWMB 3FQNA 1HINL 3O3AB 5EZIH 1A8JH 4ZUSB 4D3CL 3VDAA 4R9HA 5ID1A 4DZBB 2M2DA 2ZCHH 3VFSA 5CEZL 1JNJA 1EMTL 2QSCL 4BUGA 5TDOB 5IG7A 2J5LB 4PRPD 4MB3A 1DCLA 1FAIH 3OAYH 4UINL 4QRTA 4YHKH 2IH1A 1S8DB 1AGCA 1D5IL 3LB6C 4PB9H 5BZDB 1J8HA 1WAAA 1AO7D 3BUTA 1QSEA 3ALPA 1LP9A 2AEQL 1JI2A 1DLHB 3V4VL 3VXUA 3MRLA 2OS7A 1A4KB 4PRNA 5DJAB 4ZTOH 4QOKA 1S9YB 2PCPA 2H2PC 3VRLF 1Y6MR 2VUYA 2JB5H 4OCNC 3RRQA 1V3KA 4E41D 3CIQA 3HAEB 4BH7A 3BKYH 3KPRE 3L3IB 5SV4A 2DBLL 4MZ3A 4Y4FB 2FNBA 4FQLH 4IIQC 1J0ZA 5F93C 4MA1B 3QO1B 1YPZA 1HH9B 4F7TB 4WTZG 5L2KA 4KAQH 3LPGA 1KLUB 5JXAH 4RAHA 3MBXL 3D9AH 1INEH 1N4XL 5T3XD 3UEZA 5SWSE 1N0XH 5D5ME 2VMFA 4PG2A 2YUXA 1K4CB 3QUMH 4U1JA 1IC4H 2DYPD 5KSVB 3QPXH 3S34L 4IMLB 1KF9B 2WSKA 1SJHB 4LHQB 5EBMA 2G5BB 3IRPX 5HVGB 3HAEG 3TYGL 4Y2OA 4K3DH 3PWVA 4RISL 5I1GH 4G3YH 1KJ3L 4JDTH 5E99H 2F8XC 2CIIB 1JHTA 2E7CA 4L1DA 3G5YB 5K59E 1IKNC 5DR5H 4O9HH 2VZUA 4AYFA 1MCQA 2R2CA 1FSKC 3D2UA 4GJTB 4M7LL 5E8DL 4PBVC 2FBJL 2EC9U 3TN0C 4FMFA 2HKFH 1S78C 1U93A 3MXWL 3KS0H 2UUDH 5KVFH 4TUOA 2B1AH 1CFTB 4DVRH 3OHXA 4HXBL 5KVEH 1B9ZA 3B43A 1JGLL 1TXKA 3BWAB 5CIPH 1FL5A 3AS2A 3FCTA 5DJZB 1E0OB 2DQJL 1G0XA 4MDJA 1PQZA 4Y4KD 3C5JB 2GJZA 3EYSH 1DQLH 2P5EB 3QFDB 1AKJB 3QCUL 4NQDE 5IQ7H 4H20H 1T4KB 2P24A 3EYUL 4H25B 3DO7B 4U1MB 4MLSA 4OFIA 4HUXB 2DM7A 5CINL 3MACH 1EEZA 1VENA 5GGVY 1V3JA 5GGSY 3ZDZF 3GBMH 4EUPA 1CLOH 1YN7A 3BSZL 1YMME 4LPUA 4UU9B 2ATPA 1IMHC 1KC5H 2ICWB 2DLEA 3BP5B 5I30H 5LGKA 3DVFA 3PWUA 1J9CT 1W0WB 1R5IB 4PJHF 1EO5A 2F5BH 4FQPA 3A67H 5C09A 1QNZH 1F11A 3B9DA 4M1CC 1RK0A 5ETUA 4NQEA 2B5IC 2Z8RA 1IGMH 3ARBA 3IFOA 1C08A 4LARL 5DXWA 5KVDH 1UJTA 1EHLH 2X40A 4ZO9A 2PW2B 4P57B 1R3HA 2VC2H 4XNYH 2B1HH 3UTTA 3P73A 3WHXA 1OGTB 4O5LH 1YEHL 1OTSD 2GI7A 4Q6IC 4RGNB 4HFWB 3VWJB 2NZ9C 4JKPH 4Z7VF 1GCFA 3GMNB 3H9SE 4PRHB 3VXNA 3EW3B 1ZHLA 3U1SL 4UILH 2CDGA 3MV9A 3OKKA 5KANG 1FBIH 1S7TB 2C9AA 3G08A 5SWSA 1AQKL 1F4YL 4KI5E 1UEYA 5E8EB 2ZPKL 1CU4L 3B2VH 1TZIA 2BVQB 3H7BB 4R26L 3QHFL 3RWEB 1BAFH 2A9ML 1IKNA 1ERNA 4YE4H 5FHAL 3O81A 3MLVL 4NRYB 3S8WA 1ZSDB 1Z9LA 3RUGB 5E7BA 1ND0B 4JVUA 2OL3H 4UOW1 1XGRA 4HBQA 4JFXA 3TN0A 3ECBB 1KENL 4UT6L 5EUOE 1BF8A 2MHAB 3L6FA 4X80H 5CZVL 1UKQA 3LS5L 5BRZD 2EEDA 3FMGL 4M1DL 1JF1A 2CK0L 4FP8L 3OGOE 4F9PC 1F4AA 1NUFA 5C0EB 3BUYA 5GRUH 1OY3B 2UYLB 1I9IL 1ZT4A 3G6JE 3LY6A 1UKSA 4HPOL 2LTQB 2PXYC 2JCCF 1T1ZB 2OJZL 4JFEE 1AXTH 1I7ZA 4Q2ZA 4AJ0A 1CICC 2CUMA 3K74B 2UWEE 4LCWA 4FABH 3C2AL 2VE6B 2NW2A 1VDGA 1NGYA 2B4CC 3DRQB 3KPNB 4P3CL 1NC4B 1FCCA 1UXSA 1ZLUH 1NBVL 3RIAK 3DTXA 3MLPA 5FUOH 2IMMA 1YNLL 1OP5K 4JHZA 1T6WA 3HC4H 4LCCC 4OV5B 3VXSA 3K4ZA 1KG0B 2A74A 5MEOB 1QFWL 1PX4A 4DEPC 3BZFB 1LO3L 1ZKAA 2ZNXA 1WGOA 4RMWA 3PUCA 3L95A 2OZ4H 4GKOA 1JZ2A 2OXHA 2EO1A 2IBBA 1ZANH 4Q6IA 3W11D 4PJBF 3UYRL 4OLUL 5T1LB 3QG7H 4MJ4A 1DVFA 5CUSH 4QRPA 4HXAL 1JTPA 5F9DC 3IGAB 4PJCE 4OJFL 3V6OE 1UVQA 5IMKA 3L1OH 5C0IA 3AVEA 4HUUB 4PRBA 3OGCA 3QFJE 4DAGH 3ARFB 3MBED 4YO0B 4UQ2A 1X4YA 1KCSH 2YD4A 1CFVL 3LKPB 3B83A 3DV4B 2W91A 1IAKA 2Y06L 4LNRB 3DSFH 5KAQG 4OT1L 5SWZB 3N85H 5AUMA 1UEMA 2ORBH 4LCIL 4LMQE 5DURB 1BBDL 1F8TH 3SCMC 4XVSH 4ZSOA 3P4NB 3RFZC 1FNAA 5DHXB 3ARTA 4XNMA 2R4RH 3PABB 3BIKA 4ONHB 2NMSA 1S7UB 3OKLB 2DIAA 4RZCB 1QR4A 1BEYL 3FN3A 3RL1A 5J56B 2PO6B 3C6LC 1QYGH 3MUGB 1I1YB 3GMMB 3DXAA 2WBJB 2YRZA 2B4CH 4OLYL 1FGVL 1IVLA 4JR9H 4NQDD 4O58L 2EYSB 4JCMA 4JFHE 3WN5C 1HSAB 5DJ8B 3LDBB 1P7HL 5E94B 3KPOA 5D96C 1TZHB 3HC3L 1CICA 2VDKL 4QYOB 4J8RA 2DLFH 3F8UB 1HHGA 5LWYH 3CFCL 4YEFA 1S5HB 4OZ4B 3FT3A 4PLKC 2D7OA 4S1SL 1Y0LB 4E5XB 5FGSA 5IKCA 3PP4H 3G04A 1INQB 3QXDB 4OUOA 1YMMD 2CRMA 2H9GB 4QHKI 1AXSA 1CE6A 1YEKH 4JN1L 2UZYB 2BVUA 4PJ5A 1R3LA 3SDDB 4I0PC 4MGXA 3L3GB 4GMTL 1QEWA 4TSCH 5C0CB 3TZVB 4GLRI 2WMPA 3VFUB 4OM1L 4HWNA 5CBEB 4K7FB 5FO9B 3DYOA 4OF0A 2QR0A 1MHHA 3Q6FA 3IAQA 1UCBH 1W8NA 3NCCB 1I1CA 1DQJA 5ECJE 4X7TA 5L8LB 3AREA 3SKNA 5I9QC 1FDLL 3BEWB 1PG7X 4YR6A 1I3RA 4BZ2H 3VMNA 4LLUB 4P5MA 3MGOA 5HPOA 5HHVL 4X4YB 1FL3A 1T83A 2K1MA 5D2NB 1S9VA 4KI5D 4BFIB 1ZXQA 4WFGE 5JLZB 2P47B 3IDMB 4R4FH 4Z7WB 4X9GA 3DGCR 4OD1H 4N0UB 3WO4B 5KN5B 3CK0H 4QTIL 2VLRD 3D3VA 1H8OA 1HILB 1DBAL 3P40A 3SCMA 1MY5A 4I5BB 4LKCB 3UBXI 2N4IA 2LE9A 1K2DB 5AG9A 3V7MA 4IHOA 1KTDB 2BVEA 1C16B 2XQYK 4M02A 5KSAC 2DLHA 4I4WA 2ICCA 1FN4B 3GI8H 2ESVB 3WNKA 1LO2H 2P4AB 3E6HB 5J12B 4FQ1L 4I48B 5H8DA 4CVWA 1KSRA 4MQXD 4RGMC 5CBAA 5JR1H 7CGTA 1EEYA 3DECA 3WN5A 5TF0A 2UY6A 3AMLA 1IM9D 1RJZB 4BK5A 4RIRB 1G7HB 3UJJL 3PGFL 2V7HA 4KJQD 3MRPB 4IMKC 4H1LB 5D9SA 3WSQH 1HHHA 3ZO0A 1CDYA 1GL4B 1ONQB 4JFED 2CGRL 3FTGB 4IS6A 1JYWA 3IJSA 3S5LB 1MCSA 1ZA6B 1TENA 5GJTL 4YPGB 1U3HB 3MOAL 3RA7H 5CEZH 4TNWK 2R0KH 5J89A 1UJ3C 1I7RB 4I0PA 1NKRA 2DQUL 4NJAL 1H8NA 1O5DT 1ODAA 2APXA 1MHEA 3DUHA 3L3JA 5I8CA 2J8UE 4KRPD 3SGJC 2H2SC 2F74B 4UINH 4Q9QL 4XP1L 3W82A 2KUTA 4PG9A 1FZOB 3TVMB 4I18C 3HNSL 1WFUA 2A6JB 2MSPA 4HIJA 4OZHB 1MI5D 4PJIF 5E1AB 5DI8B 4OSUH 1Q9WA 4OCRL 1A7PH 4H1LG 1CE1H 4HG4J 1NC2D 5D1ZB 3BKCH 5I73C 3IDYB 4WNQA 3PGCA 1WWBX 1X4XA 1R24B 1I8LA 3GMOA 1NSNH 3QIUA 4G8FA 3S5LG 1N6VA 4JO2L 5CGYD 3N50A 1Q1JH 5K9OA 1C1EH 2DBLH 2Q86B 3MRDB 2ADFH 5M94B 3ILPA 4YDKL 5ACMA 1ORSA 1RUPL 3FOLB 1T2JA 1U8QB 3P0VL 3K4DA 2ILLA 2HLAB 3KWWB 5IB3B 3KJ6L 1CIUA 1KTRL 4PJAE 1N4XH 4WHYG 1KPRB 3FO1A 1R3JB 4JG0H 1P9MA 2DOCA 5AZEH 5AYQA 4ZUVA 5BOPA 4KTDH 1NDMA 1Z6JT 3CNKA 5D7IA 5KSAA 1RIUL 1RZKL 1HNGA 3RWFB 3T1FA 3D39E 2EH8L 4IOSD 1A3LL 3O2VL 4OZIA 5I1KH 1RU9L 1VACA 3ARWA 3UTPE 2B39A 1HQ4A 2A6KA 5CJ5A 1NCUA 4YFLF 3SDYH 4AL8L 5MHSE 4GW1B 1F90L 2A2QT 1CFQB 1S7RA 2Q87A 4ZODA 4IMKA 3U6RA 3EO9H 1S7SA 2RQ8A 5BO1L 1MFEL 4JFHD 1ORQA 4P99A 4XI5C 2E5EA 2E7LA 3O6FD 1RFDH 1KCUH 3VFOB 2C1OA 4JRWA 4P49A 3TV3L 1CGSH 3TYFB 4D2NA 3WLBB 4D0CB 1IEBB 1JGUL 1PYWA 1Y6NR 3T0EB 3FO0L 1ACYL 1UJ3A 3D69A 3JV6B 1MRCL 2X4OB 2DIJA 2BC4A 2V2WB 1J5OH 3MA7A 3SGJA 4WIQA 1N8ZB 2BK8A 3CFBA 2QHRL 4I18A 4K7PH 1NAKH 1MVUB 4OZGB 2BNQB 2FX7H 1KYOK 4U6YA 1HZHH 4XVTL 5CINH 4CW1A 2JK5A 1T5XA 5ADPH 3D0VB 5F1OB 4FMKA 3SDXA 3CVIH 5C3LD 3O6KL 4LPCA 4BSVB 2AXFB 3FRUA 4OGXH 1JGEB 1U8LA 5HGDA 1AFVH 2APTA 3WO3B 1CIDA 1IILE 2VZOA 2IADA 3HG1D 4N9GB 3IT8D 4IRJA 3C08L 4GFTB 1Q9OA 3N1FC 4RWYL 3TH3T 2VQ1A 1HOCB 3FB7A 1QSFA 1IC5H 3H3KA 4ELKB 4PJFB 5ICZA 1WFOA 4HWBL 5KJRH 4RFEA 2YEZB 3SDAD 3UZQA 5JW4M 2KZ1B 1QLFB 2EXWD 4DQOH 5JW4N 3C8KA 2CMRH 4N8CL 2P8LB 5F7NC 3WFCL 4LLWA 3ARGB 2GUOA 1EBAA 4X5LA 3U1SH 4C56A 4N0YL 2FWOB 5F1NA 3KG5A 1FYTE 4N90E 4P5TD 1OW0C 3KYAA 3BYYA 5CGTA 3ZDXE 1IBGH 4BK4A 2EIZB 4U7KA 4Y89A 4BA8A 1ZMYA 5HHQA 1T1YA 2AABH 1CGWA 4QWWD 1VGKA 5GJSL 2C1PA 3C5ZD 4MA7L 2DQEH 3JV4B 4RA0C 1U2HA 4IRSA 5ACZB 2KZWA 3BO8A 5F72S 4KMTL 3BHBB 5T1KA 2VYRE 4UT6H 5FKAB 2YBRA 3LZFL 3R8BB 3OKOA 1WBYB 4ZPVA 2ATKA 2R9HC 2GTZB 3QNXA 2B0SL 1P1ZB 3LS5H 3SJVD 3FMGH 1EV2E 1O7VA 4M1DH 4ZMAT 1NGPH 1A7QL 1BQHG 1CD0A 1I1AC 2HJLB 5ICXB 1ZLSL 1PDKA 4NKIL 4ZAKB 2YPLD 1FQ9C 1TJIL 2DI8A 3BMVA 2X4PA 3DJ9A 1XGUB 3U7YL 4HC1L 5HDQL 2CIKB 1EJOH 4JY6A 1YMHB 2EKSA 2GHWB 1U58B 5JOFB 1U8PB 4YXHH 1DANT 3HLAA 1WT5C 1UH2A 4UT7L 2J8HA 1BWMA 4V2CB 3P4MA 5A16A 2YUVA 2G2RB 2CRIA 4POYA 4JQVC 5TH2B 2IQAA 2HLFD 4QO1A 1S3KL 2EXYC 4PRPB 1G7MB 3MNZB 4X6CE 1S7XB 2HJKA 4RRPA 1LEKA 5H35A 3GB7A 3VXTB 3K46A 1AO7B 1GGTA 1QFWH 1N0LA 4L5FL 2NY4D 3RNKA 1GXEA 4Y1AB 2HYMA 1BJ8A 1SY6L 3MRRA 5GIRB 3CC5A 4XPTH 4E0RB 4OZFH 1RJLA 1F4XH 4N1EA 1UB5A 5T33L 4WW2B 4GT7A 3O8XD 1OTTC 4QY8A 4FRWA 5ITFB 5FYKL 5D2LE 1OW0A 4HV8B 3MLXL 3T3PE 5D71H 2F53B 3O2WL 4HKJA 5J9PB 2DKMA 3NCMA 3QHTC 3GIVB 5HPMB 2FEDC 3BPNC 3Q3GA 2XWJA 5EBLB 5MI0B 1UT9A 1A6TA 1YQVL 1G1CA 5CEXB 1CFVH 5C0GA 3UTPD 5EZOL 3BT2L 3LN5A 1YUHA 4QRRA 3G5VA 5LCVL 1FL6A 2OK0L 4U2YA 5CJQH 1UWEL 4OT1H 4HMDA 4UNUA 2NXYC 3BDYL 5D72H 2JB6B 3TWCH 5D8JH 3WNLA 5JHLH 4XC3H 5TJWK 3WNOA 4ODHH 1AC6A 4LHUA 2Z35A 3H9YA 3ROOB 3ZT6A 1FFQA 1J1XL 4NZTH 5I1JL 3TBTB 4U1IA 3TNNB 2FYYB 5E5MB 4K3EL 3EBAA 1K9TA 4XP5H 5ICYB 3W0WE 4OLYH 2E7MA 4P9HC 4JY5H 1BM3H 1Y6KR 3O3DA 3FQNB 4O58H 4G7YL 4XHJC 2D03L 2HN7B 4P46A 1JP5A 3HZVB 3QG6B 5DF0A 3OB0H 1WT5A 1FZKA 4OUUA 4Y19E 3QXUA 4XB7A 3KAAA 4ZOCA 5EPMA 1SBSL 3H8NA 5F88B 3SGDI 2ICWJ 3KPQA 1IT9L 3L5XL 4EI5C 4Y4KB 2YD3A 4N1HB 1AGCB 3VFVB 2MWCA 3R1GL 1OCWL 3IDIB 4WDIA 1J8HB 5C0AE 3I3EA 4GRWE 2XG5A 4OCWH 4JPKL 1G84A 2EDXA 3PWPE 4PJ7B 1KXQE 3BZDA 2Q6WB 3TA3C 3MRLB 3PWLA 5IIEB 4PRNB 4QOKB 5JXEA 5E2WL 4GMTH 3PIQB 4OM1H 1AGEA 4BH7B 4EJ1C 1I85C 1BWWA 1VADA 3NZ8A 4F7MB 2AQ2A 1UWGL 4C83B 2AJZA 2DIBA 2BVYA 1KEGH 1IC7H 3HZMA 4POUB 4YHOH 1IEAA 1A1NA 1II4E 5FA3A 4F7PB 5J1TC 3P0YL 4K71B 1CCZA 1FYTD 4N90D 4FXKB 5E6ZA 2EE2A 4OD3L 4POZC 3S35L 1BJ1J 1FLRL 4JM4L 5IJKA 2HFFA 2VN7A 1NL0H 2DJ4A 5EBMB 1YYMH 2AK1L 3FN0L 5E70A 4D8PB 2A6IB 2XZCL 4EIZC 5FM8A 1JZ7A 1FVCA 4W4OA 3PWVB 4YK4C 2FD6L 5EOQL 1S9XA 1IE5A 4P9HH 5EH1A 5CLWA 5EBGA 3WLWC 2C4FT 3UO1L 3FO2B 5HD8D 4XTRC 1N3NB 3SO3B 1N59A 1OGAA 4YC2C 4KJYA 4MDIA 3L3OA 4M6NL 3ARDA 4MVBC 4LSRL 1MPAH 1A3RH 4DN3L 1B0RB 2IF7A 1H3XA 3LRHA 1FL5B 3D0LA 5ITBL 1S5IH 3FCTB 3LRGA 5BZWB 3GJFB 1AE6L 4MDJB 4JHAL 4NN5C 3PGFH 2IPKA 4PJXB 5KTEH 5E08L 3V6FB 4CU7A 2ZOLA 5C6PB 4GG6F 3NABH 2R23B 4QTHA 2CH8A 1KPUB 4LSUH 4F9LC 5BRZB 1X5LA 4L9LB 3RL2A 1HI6A 3V4PH 1MHCB 1ZHBB 8CGTA 1XZ0A 5HHOA 5KVGH 1NEUA 3STBA 3LKRA 1EEZB 4DCQA 3SE9L 3A6CH 4XAWL 3T8XA 3GSQA 4ETQA 4TPRH 3EYQC 2DQUH 5J06A 3L7EB 1YN7B 3QNYA 3ROLA 4Q9QH 1E4JA 4XP1H 4HDIA 4PRIE 2V5YA 2R0ZL 1DLFH 2DLGA 4ODXA 3PWUB 3TIEB 1I85A 3TO2A 3D85D 1NQBA 5EORL 5GRZA 2DBJA 1OSPL 1QP1A 2EZ0C 5BMFH 3EO0B 3QUYD 4XPAH 5I1IL 2F5AH 5ETUB 1KXVC 3ARBB 3U30C 3BZEA 1X6NA 2W60B 3QIWD 4GMSL 4L8CB 2X4SB 1GRWA 3KPRB 1R3HB 5D1XB 5E8OA 5IF0A 5D1QD 4GW4B 4JANB 1EGJH 3IDNA 3PWJB 3U9UB 4YDKH 4TRPL 1FZJB 3KYMA 4NIKB 4AK1A 4QXWA 2YPKB 3HE6D 2CDGB 3OKKB 3KJ6H 1YJDL 4WFFE 3G08B 3RX5A 3FONB 3GRWH 5SWSB 3ZKQD 5DS8B 5D5MB 3HB3D 4AT6B 1WZ1H 3S6CA 4LPXA 4XWOC 2EDFA 3O2DL 3IKCB 5E0QA 1JNLL 1XR9B 1NDGB 1J8KA 1RIUH 3RGVD 2ZSWB 5E5UB 5I1DB 1P53A 1FRGL 1SVCP 1EERB 4LL9A 2EH8H 5D7SL 1A5FL 2Q8BL 3PWNB 3MNWA 3PHQB 5DDHA 3BGFB 5FUZH 4JRYE 3VRJA 5F7KC 1WUNT 4YNYB 1OOAA 3NA9L 3QDGE 3W0WD 4Y5YC 5AZ2H 1GGCH 4OCMC 2H1PL 5JHDE 2XWBB 1P2CA 1JRHL 2J1KA 5CD3B 2X1QA 4FG6D 4YEEA 3DBXA 1ZT4B 4Y19D 1EZVX 4DN4L 2QLVB 1EBPA 1CFBA 1NMAH 3BKJH 5DRNB 1H3UA 5JPNA 3UTZA 1A2YA 4UT9L 4R97C 2F54A 1JGUH 2KBGA 4UUJA 1N2RB 1RZFL 5JA9A 4NQDB 4X99A 2IWGA 1U8MB 5C0AD 5B3JE 1ROWA 2X1XR 2BVTA 1JUFA 2KL6A 3V95A 3PWPD 1A02N 4PUBL 2VQUA 5F3BB 1E4XL 3TPUB 1CDJA 3DHJA 1UXSB 5DHVB 2OTUA 3GSNH 4JO3H 4JO1L 4NJ9L 4R0LC 2YZ1A 1INDH 2PYEA 3IJHB 2CKBL 1U95B 4GAJL 5TPWL 5HDBF 2VDMH 3O6KH 2GCYB 3DI2B 3CU7A 3VE0A 3L7FA 1P6AB 1WEJL 5BS0A 2V5TA 1Z3GH 4NCC2 5FF6A 4TUJB 1YEJL 4HHAA 5C0RL 5GS1A 1RY7B 3L95B 3LMJH 5CKAA 1KCVH 1I8IB 3JUZA 5DRXA 3FZUD 3H9ZA 5DJ6A 5A2IH 4KTYA 4XRCB 4OBRA 1OAKL 1X5YA 2XQBL 4YHML 3G5ZA 5DSCB 1DVFB 3BP6B 5IW3A 1P5VA 3V8CA 3AAZB 1FJ1B 1UVQB 3IVKA 2VAAB 5C0IB 4UBDC 5IMKB 4AG4L 2HFGH 2VDNH 4OFYD 4YIQA 2V5RA 2YD6A 3S9DB 2RFXA 3UTSE 4I2XE 3T08A 3MJ8B 3QEQA 2XI9A 3V6ZA 4S1RL 1MCRA 1F6LL 3F7YB 3H9SB 4QHLA 4FXGA 4KJWC 4GKSB 2HFEB 2FDBP 3TO4D 4KY1L 2IGFL 3BP7A 4HWBA 1M1SA 4JFYA 3SE4C 1FNGB 3O9WD 4XH2B 3M17A 1G6RL 4KVCL 2AJUL 1MCEA 3IXTB 2H32B 3F5WA 3QR2A 4Y0GA 5I6XB 5GJSH 4Z95H 4YHPB 2OMNA 1Q38A 3QUKA 4KROD 3ZTJG 2XKNA 3RL1B 4CN6A 2HRPH 4HS3B 5IWLC 3STLA 3IJYA 5EUOB 1MWAB 5IM7A 2JIXD 1A9BA 2PW1A 2DQIL 1NCBL 4JRYA 4DGVH 5C08E 5T5FL 4QNPE 4HQQL 4TSBL 3WE6A 1UWXH 1OP3H 5JHDA 1D5ZB 4HIEB 1QBLH 4LOUC 4NKIH 5BJTB 1TJIH 4J8RB 4YXLL 1DBBL 1AJ7H 3U7YH 1CK0L 4HC1H 1B6UA 3FT3B 3G6JB 4YHLL 4C4KO 4MJIA 1XIWC 3DROB 3PQYE 3VXUD 5EZJB 1QLEH 1QRKA 5GISH 3RBGA 3ZYOA 4Z6AT 3ZE0F 1T6VN 3VMOA 4JFEB 4PRID 1AXSB 1CE6B 3B2UC 3HNTL 1MRFH 1U8NB 4UNVA 4WI6A 2UWEB 3VW3H 1YDPA 1CXIA 4HZLB 1FLTX 4HC1A 5KSUB 1FAKT 4ZQKA 3T2NL 4JM2D 1T20A 3VFNA 3FFDA 1ZS8A 5JIPA 4NDMA 2CLZA 5TE4L 4I0KA 2QKIA 3DX6B 3C09B 3VFTA 2HRLA 4OGZA 2AXGB 3SKJL 1JJUA 4FQXD 4TQEL 1K4DA 1DBML 3AREB 1RZJH 5EG6C 1NAML 3SKNB 5F7DB 4FFWD 1NFIA 1UA6L 2F58L 1Q0YH 2DJUA 4P5MB 3MGOB 4PJGE 4K23H 3VD7A 4WFFD 2QBWA 4LSQL 1FL3B 5T33H 4EN3D 5J8OA 5IBTL 4XGZA 2CUHA 4KI1A 4CMHB 3QJHA 1YZZA 3O41A 2DM2A 1SY6A 1YN6A 1LNUA 4Q58C 2FJGB 1BHGA 2W65B 3E1F1 1GAFH 3NFNA 5BW7C 1NUDA 2RCSL 3UTSA 3QFJB 4UZGA 1BPVA 4N0FB 1NGZA 5E8NB 1FZMA 1FVDA 4LSDA 3MO1B 4PJ8C 4CN1A 5FV2A 5EZOH 2NY3B 3BT2H 4LQFH 2MTPA 4WGWB 1I3GL 4IM8A 3IETB 1K8DB 2DQDH 5I8KL 2OK0H 5IWLA 1MAML 3CPLA 3BDYH 1M71B 2ZUWA 4PP2B 3CFJA 5IB2B 3PJSA 3SBWC 1AP2A 1BGXH 2FLBT 4XMKH 1GZQA 3LHPH 3ZKXC 5DVOA 5I18L 2VOTA 3QQNA 3HN3A 4OQTA 3FB6A 5DD6A 5GRVL 1AQDA 5I1JH 5IW6B 4M6ML 3BE1H 1TZGL 1OP9A 1Z9OA 3LB6D 3MLUH 1J12A 2QQKL 3GSRB 4Q9CA 3AC0A 3QXAB 5C70A 1P4BH 3C6SB 2F15A 4IS6B 4LPVA 4P2OC 2D03H 1RHFA 2DLIA 2H2PD 2XIDA 4OLXL 4RDQF 2R1XA 1QSZA 2VLJA 5GRXG 4WUUA 3JTTB 2R8SH 4FXLA 1MLCA 5I8CB 3KLHD 4L3EA 3MODL 3VCLB 4PG9B 3QIBD 2LU7A 1U92A 3R1GH 5JPMA 4U1LA 4ZS6C 2GAZA 4GQ9L 4HIJB 1A6UL 1DFBH 4XXCC 2AKRA 1FO0B 1NFDE 1EFXA 5FOBA 1KACB 1KB9J 3CFEA 3PGCB 3TBVB 2W92A 2QQNL 5K9KA 1EO8H 3QIUB 3LQZB 2VZ3A 4WV1C 6CGTA 3MRKA 4XMLL 1MF2L 4X8JA 4HULB 2FO4A 4K3HA 3ILPB 1ORSB 5I74C 3PL6A 3MMEA 4OIAA 4OLWL 4U6TA 3LS4L 4U1NB 3VFPB 1P4LA 4O51A 1CF8H 4X4ZA 3HR5A 1A6AA 2QTEA 4KK6D 4OB5H 3NMEA 3VI3E 5ADOL 5HYJE 5FA4A 5CP7A 2UVEA 4PGCA 2IANE 4Y2DD 1S7WA 4YH6A 4HMCA 4OD3H 4P5KB 4PJ8A 3BQUA 1UXWA 1FLRH 4JM4H 5GRVK 5E4IA 2V2XA 3SDAB 5D7IB 3NAAH 2CO7B 3HE7C 2EE9A 5CWSA 1XGTB 1NGWA 3GJEA 1MCOH 3GI9L 3PNWB 1IM3A 4CGTA 4OZIB 4JPWH 1VACB 1MVFA 2G60H 3SBWA 4G9FA 1G7PB 1MCWM 2B20A 5T1MB 4ODVL 1S7RB 1I75A 4ODBD 5IHLB 1A14H 4PGEB 2L7JA 4ONFH 1ED3A 3IFLL 4RAUA 5DEFA 2R2HA 5C08D 3C5ZB 1YJDC 5TF1L 5IJVA 1X3DA 4M6NH 5CSZA 4S0TD 3QCVL 8FABB 4P2OA 4XNQB 3IXAA 3NCFB 1BD2A 1CLCA 1IFHH 3WFZA 1HCVA 3HMWH 1QACA 4PTUB 5ITBH 3SY0A 4ZD3L 4MYWB 5INCA 1PYWB 1E28B 2AEIT 4UMGA 3UJIH 3UX9B 3PQYD 4NQCE 4ONGL 1TQCC 5MEQA 1DBKH 3D69B 4XPFL 5LXGL 1OB1B 2AJVH 4YX2H 2A73A 2BC4B 4O4YL 5J0BA 3QUXC 3C2SA 1MIMH 3TJHC 4M1CD 3CFBB 2QSQA 4OCSH 1F5WA 3CUPA 5GRJL 3QI9C 3LKSB 3MRIA 3VXSD 3WFBL 1B4RA 4JE4B 2GEEA 3ZZ1A 4CW1B 1DUYB 3SE9H 3DX7A 1T5XB 2L4OA 5A1AA 3P9MA 5CEZE 2XN9E 1L4IA 3ULUF 3M1BB 4KFZC 5IP4A 3HCVB 5KS9E 2P8PA 3AM8A 2P5WE 2NPLX 3S37L 4WV1A 1QOKA 2NZ9D 2R0ZH 3E8UL 5BOZG 1O0VA 4HLZH 3F7QA 5EORH 5FYJL 2VL4A 4LAQL 2IADB 4IRJB 4Z7UF 1T1WA 1Q9OB 2D0GA 3SGEH 2R0WL 3L9RA 5I1IH 2GFBA 3EOTH 1RUAH 2VQ1B 4MLIA 4RFNC 2IFGA 4NHCH 3FB7B 3RHWF 1KN4L 1HSBB 1FH5H 5DQJA 3VXQA 3MYJA 4NN6B 1I1FA 2BCKB 3MROB 5KSBA 2AAVA 5F21B 4CADB 4UDUB 3QULA 2BHYA 2HVJA 2NY4B 1MH5A 4X6BA 3FRPA 3C8KB 1UQSA 1RHHA 4Y5VB 1ZT7B 4UQ3B 4Y5XB 5IUSA 2MKLC 3I85A 3VG0H 4HGMA 3QO0B 3HE7A 5IROC 4ACPA 1YEFL 2Y7QB 2BFVL 1YJDH 1MJ7H 5DYOA 5DK3A 3S96B 5LBSL 1QFWI 4PFEA 3MGTA 1T1YB 3O2DH 1U3YA 4LQ1A 2NXZB 2C1PB 5JDSA 3KYOA 5EB9A 1NUGA 1TLKA 5EWIL 4WHTA 2J8OA 3D39B 2PXYD 4W6XB 4ZFGL 1A5FH 5EO9B 4XX1G 1YY8B 2YN3A 5T1KB 4LLYA 4FQIH 3KPMA 1KEML 2A83A 1GZPA 2X7LA 4NUGL 1YNTA 3OKOB 4K7PX 5C0FA 2OCFD 4ZPVB 3HS0B 3QNXB 5LGHH 2GJJA 2MCG1 3QHZH 3Q1SL 2VNCA 4HUMB 2ID5A 3MTRA 3QUXA 3L5JA 2X4PB 1KT2B 2X1WL 5FGRA 3QI9A 1FG2A 3CD4A 2EKSB 3QPQD 3B9KD 2NNAA 4L4JA 1CFNA 4H5SB 4MCYB 4O2EB 5DRZA 3W9EB 2I9TA 3KXFE 3QWOA 1P7KB 4N0CD 4Y4HA 4BZYA 1U8OA 3MJGX 1NGQH 1MUJB 5A16B 3IDGA 4PUBH 4RFOL 5BVPH 3P9LA 4YDJA 5CCKH 2X10A 3QDME 5B8CB 4X4XA 3WFHB 4OKVA 5I1CH 3I9GL 1CR9L 4NJ9H 5KOMC 3WNNA 1Q0XH 2HJKB 5JIHA 3GKWL 2CKBH 2R39A 3U4EA 4GAJH 5H35B 1A3QA 1S9WB 5EA0L 2BNRE 4OZGF 1IQDA 5KS9A 3LSOA 2J2ZA 3RNKB 1WEJH 2Y9RT 4R7DA 4WFHE 5T3XH 1ETZA 4M3JA 3KHOA 1RJLB 2C3VA 5L9DL 1UB5B 2CKBA 4ODTL 1QRNE 3VXPA 1KTKE 2XQBH 4KKAC 3D3VD 2QV2A 5M95B 1JZ6A 2YR3A 2Q1EA 2XTJE 3OJDB 4G7VH 3ULSA 4PV8B 3C6LD 1OD7A 1B2WH 2PR4L 1PG7W 32C2B 3VXMA 3X13B 1JPSL 1M6OB 1BFOB 4PJFF 1NLDL 3MNVB 4HKZA 3LN5B 4Z78A 1FYTB 4QRRB 4FTVE 2DMBA 2FGWL 2DWEA 4F15B 1SJEA 2BVOA 4HJGA 1UADC 1JHLL 2LV4A 4ZXBA 3SE8L 2Z35B 3C60C 3EYOA 4PLKD 1K5NA 2X9YA 4LLQB 4V1DA 4F58L 4YZFE 4U1IB 1T89C 4LPTA 3VFMA 3UBXG 1VGEH 2MPAL 5GGVL 3AS3A 4P2QA 1G6RA 4FFVD 5I1EH 4BFGA 2I25N 4XP4H 5IB1B 4NQCD 2UV3A 2WINB 1DUZA 3VD9A 1XF2B 1YECH 1NCBH 5FYLH 3V0VA 1X7QA 4I0PD 5HGBA 4XP6L 5BV7H 2DAVA 4P46B 5T5FH 2DQCH 4GBXC 2DI9A 3DIFA 4TSBH 5DVLA 3OXRB 1FZKB 5EPMB 4KTEH 5B38B 2VXTL 3S4SA 1T0MA 3JTSB 3KPQB 2JE8A 3EZ8A 5ID0B 4PJEE 5CEZD 3AXLA 2XN9D 4XPHL 2J6EH 5K9JH 3BPCB 1CQKA 5GGTL 2FB4L 4MMZC 2P5WD 1KIPA 4I3SL 4Y16B 4KZEL 4GXUM 4KKCC 3MRJA 3NACL 3IB4A 4JPVL 4LP4A 5FYKU 3GIZL 3G6AA 2IG2L 3T2NH 4GAYA 3T0BA 2BSSA 5TE7L 4R3SB 3EYFA 1AGEB 4NZRH 5EUKA 4X6CB 4XNZC 4KKBD 3MR9A 1KIUA 5GGUA 3NZ8B 4S1QH 1RZ7H 1T2QL 3ILQC 4HUWA 5K9QG 1A6ZB 3D85B 4PIRF 5MP6L 4JDVB 4PY8I 1TTFA 5DJDB 1NAMH 1ZHKA 3EFFA 5C0JA 1YNKH 3BP4B 4WI8A 3VJ6B 5J7CC 4UAOC 3LKQB 4J3XA 5DLMH 3ULVL 2I5YL 1A1NB 2BRRL 2NY0B 2F58H 2XNAA 1BOGB 3LIZL 1JVKA 2GIYA 3QBTB 2IEPA 4LSQH 5DJYA 2VXUL 1RVFL 3NA4A 5H37G 3BPLC 5D2LB 1FNEA 4PRAA 1CD8A 3RX8A 5ISZA 4P23A 3ZHLA 3LH2L 4LHJB 5FGBC 2W0FB 4LASH 1TPXC 3BZ4A 4OF7A 4ESKA 3C60A 5DO2C 4Z5RB 5IB4B 4PYHA 2BX5A 4TVPH 1I3GH 1IAIH 3HZKA 1N59B 1T89A 4EXPX 4NN7B 4ORGA 1MAMH 3HPJA 3OAZK 3ARDB 2E9IA 5JZ7C 1G9NH 4KK8C 5L6YH 1B0WA 1BLNA 3FB5A 1ZLWK 4GBXA 3D0LB 2H2SD 4YHZL 3L3DA 4W6WB 3PP3K 4MSWA 2FJHA 4YLQT 5F7WC 2A6DB 3KXFD 2YUWA 4EXKA 2BNUA 4APQD 4HIHA 2YA0A 2J5LC 2VDRL 1WWAX 2FX9L 2APVA 2WUBL 4KV5E 2ZUVA 3RKDD 5GQBA 3QUZD 4EDXB 3B3IA 4Y19B 5IEHA 3RP1A 4Z0BL 4HPYH 4HH8A 5H94A 2Y6SC 3LRSA 3V0WH 3GBNL 3QNYB 4NFCA 3E3QC 2D3VA 4M62L 2XA8L 5SX5H 2BNRD 1IGFH 3PHSA 3JSSA 2FR4A 5C0AB 1OL0A 5F7YC 4EI6A 2BJML 3ESVF 1RI8A 2R4SL 1RAMA 1WCQA 3RWHA 3WKNA 3O6LH 4Y4FC 3CFKA 1QRND 1WAAF 2G75A 2RGSA 1RJCA 3LEYL 4MA1C 5F9OL 1R5VB 1LP9F 4Q74A 4LFHD 3KJ4B 2AVGA 2CK2A 5DD3L 1U3ZA 4G8GA 4AENB 2XTJD 3KYMB 5F7HA 3LQAC 5EO0A 4WTWA 1MEXL 4DUWA 1CXHA 1NKOA 4X7FC 2HG5A 4NQXA 4S10A 5ESAA 1LDPL 5F97E 4ELMA 2AEPL 4M6OH 1YPZF 4FTVD 3O6MH 4FFZL 5FM5O 4MNGE 2DQHH 4HJJL 4GG6A 4PJDA 1F58H 3U0TB 2VDLH 3TCXA 4FN0A 2BSTB 3V5HA 3TNMA 3KR3H 1CXLA 5J13B 4M43L 2AXJA 3CVHH 3M8OL 2A77H 3UJTL 2CJUL 2WP3T 3O9WB 3RJDA 4ODVH 3O3AA 4ZUSA 1TETH 2GT9B 1V8HA 3BKMH 3RTQA 1QVOA 1P2CB 5TF1H 4OAWA 2QHLA 4DZBA 3QCVH 3DBXB 1VPOL 1RULH 3DVGB 2X4RB 1LO4L 3EOYG 5JPNB 4JZNB 3UTZB 1S8DA 3CX5K 3WIHL 2JIXB 1W0VA 4M00A 2AV7B 5BZDA 1QUNA 5DRWA 5LXGH 1K6QH 1L7IH 1DQML 3P3YA 3RX7A 3V4UL 1DLHA 1UB6A 5FK9A 5E2UL 4XNXL 1A4KA 12E8H 5DJAA 1W2KT 3WFBH 4PJXF 5I19L 2OTUB 4LDOB 1SBBA 1R5WB 3HAEA 1TCMA 3FT2A 2VKXA 3LQAH 5DUPH 3L3IA 4HUVB 5CMAB 4M7ZB 1YYLH 4Y4FA 3VE0B 1EZVY 3L7FB 1KGCE 1WSST 4PRIB 5BS0B 3RVUD 3S37H 2VDQL 3QT2A 2V6HA 4F7TA 4HHAB 5GS1B 2GYSA 1A6WL 1HDMB 5DJ6B 1OVZA 1LD9B 4U6HB 1E6JL 2CRYA 4FZ8L 2EECA 4K3JL 2DB8A 1A22B 1K4CA 1T7YA 5EFIB 4RGNC 5EU4A 4A6YH 3VWJC 2E6JA 2R1YB 4X98B 4IMLA 5KSVA 1SJHA 4CJ1A 4K07A 2G5BA 4FQXB 5F1SA 2RFXB 3GSWB 1QR1B 3S98A 1F02I 3S97C 3QEQB 2I27N 2ADGB 4M8QB 3PG2A 3V6ZB 3B4NA 4LSTH 1HKLH 2WQ8A 3VWKB 2PUQT 4QHLB 1PZUB 5H2BA 4I77H 3RHWK 1FPTH 4JHWH 3BRGC 1KJ2H 4QGYA 1KB5L 4HZAA 5B4MD 4RMRA 1I1AD 2P7TB 1DQDH 2IPUG 5E6ID 3HUJE 3F5WB 3QUMB 3WDJA 1QHPA 5GS0L 2ICEA 5ESQA 1CFTA 4RWHA 5E9DE 4ENEC 3QUKB 4HS8L 2XKNB 3L3HA 4QRSB 1KFAL 4OLVH 5LKNA 1UZ6F 3C5JA 4EDWH 2P5EA 2YMXL 4OIIL 4PJHE 4NUGH 1ACZA 4G43B 3N9GL 2PW1B 4JRYB 3UPAA 2VDPL 4XBEL 1PEZA 4PR5A 1IGCH 1MFCL 3QDGB 3MRFB 5T1DH 5JUEH 2XV6B 1KCLA 1AH1A 4U1MA 2VERN 1CLYL 5JHDB 1NCTA 2LTQC 1U8JB 2EXYD 4JFZH 4BFBD 5A40E 5JA8B 5CILL 1HWGB 3UROR 5C0NC 5HHMD 1QTYT 5K59F 4UU9A 5CIPB 2ICWA 4L4VA 2NLJB 3G9VA 1J18A 5IFAL 2HTKC 2VLKE 4Z7VE 4ZFFA 4I9WD 4F8TA 5GHWL 4NRXB 1W0WA 1R5IA 3LEVL 4XCFL 3RU8H 2EDHA 1VFOA 35C8L 4ZQKB 4HK0A 3B9AA 3VFNB 4X6EB 4YDLB 4DKEL 2WAHA 3JWOL 1GGYA 4NDMB 4UDTA 1CR9H 4TSAL 4P57A 3VFTB 5EOCL 3QIBB 1EHXA 3CXDL 4XAKE 2FEDD 4M7KL 1EIBA 1OGTA 1J1PL 5IFHH 5I71B 4HFWA 1AHWA 2ZUQB 2X9XA 3VWJA 3GMNA 1QFOA 4PRHA 3SGKC 3EUUA 3OPZL 4Z77A 3QEHB 5E8EA 3TLRA 1CVSC 3MOBL 2NXYD 1K8IA 3W9DB 1QD0A 3QJHB 2BVQA 3O41B 3STZB 1U2CA 2DTML 4UTAL 3ARFC 5J3HC 1YN6B 4NRYA 5F9WB 4PD4J 4KQ3H 3RUGA 4XZUB 1U36A 1MHPH 2JCCE 2C7UB 4I2XB 3UTSB 5BXFB 1MQKH 1XF1A 3LPWA 1JPSH 1BFVL 1FZMB 3PDGA 1FVDB 2MHAA 5FUCC 3INUH 5DUMH 1V3LA 2I24N 2HFTA 4Y2DB 2XWTB 5FCSH 5AYUH 1JHLH 2X1PA 4DTGL 4J1UB 5I8EA 3CFJB 3PJSB 3EYVB 3VFRA 1AP2B 2PO6C 5IVOA 5C0EA 5DMGC 2UYLA 2WBJC 3FB6B 3DUUA 5DD6B 2D7PA 4EI5D 1PLGH 4NSKB 4QRQB 5FO8B 4CVXB 2OL3B 4JFFE 3HTLX 5AAMA 5HHOD 3SEPA 2MPAH 1HK6A 2X89D 3LDBC 1EAPB 4IRZL 6FABH 3TA3D 3WFDL 4PJBE 5C08B 4XP6H 4JJ5B 2Z31A 3RWJB 2X5PA 1S7VB 3DRQA 3KPNA 2Y5TB 5EUOF 3I50H 2I07A 5IMOB 3RVTC 3A6BH 3OAZH 4WUUB 5GGSA 1I9JL 4H26B 5EC2A 4OV5A 4XPHH 3SDDC 5I66A 1KG0A 1JPFB 1U92B 1XCQA 5MEOA 4U1LB 3BZFA 1KGCD 1F2QA 3RGHA 3EJYC 3PP3H 2AKRB 5CJOL 4KZEH 3MA9L 3TZVC 4KPHL 3ZKMC 3EOAB 3G6JF 4JPVH 1TJHL 1YY9C 1RUML 3GIZH 1A0QH 4ODSH 5I1AA 4M7JH 4MNQE 4YDIH 4P3WA 1TDQA 5TE7H 2YD7A 3SGKA 5GGTA 3MRKB 3WS3B 1I3VA 2FO4B 3WMSA 1FFOB 3NCBB 1DL7H 1PD6A 3PL6B 4NGHL 4AEIL 3ARFA 2OR9L 3RKPA 4WWKA 3WLWD 4PS4H 3MCKB 5TDPB 5D2NC 1H15A 1P4LB 3LKPA 3DV4A 4O51B 3HR5B 1A6AB 4LNRA 2MCPL 4XTRD 1FC1A 4K9EH 1MIEL 3L5WB 3JVGC 3DYPA 4PJGB 1PG7H 5FA4B 4HGWA 1JHKL 2YUZA 5DC0A 4PGCB 3HI5H 4NZDA 4YFLI 3WO4C 4F57H 5SWZA 1RVFH 3BQUB 3MRGA 4W4NA 3GMLB 1UXWB 4MVBD 4EZMA 4OM0L 2NYYC 3BI9X 1MCPL 1CBVH 3I2CL 3SGEI 1ZAGA 1JFQL 3MZGB 3PABA 4ONHA 5B39B 1S7UA 3OKLA 1KLFA 5E9DD 4MJ2A 2EEAA 4WY7L 2PO6A 3BGMB 1MJ8H 1AD9B 1I1YA 2I9LA 5F44A 3WS6C 1XF5B 5GXBB 5J12C 2O26U 5CKGA 2EYSA 1Z9MA 3SOBH 3Q5TA 5DEFB 3NIFF 1HSAA 5DJ8A 2WLZA 4QHKJ 5E94A 4ERSL 1OAXL 3TCLB 1TZHA 1WWWX 5F1IA 1V05A 1BD2B 3EYQD 2XZZA 1S5HA 4L3CB 4E5XA 2MKWA 3FFCE 1J05B 2QQQA 3I6GB 4WJ5B 4CJ0A 4KQ4H 5HVWA 3ULUC 1INQA 3FHAA 1JMZA 1A7RL 1ZHNA 3QXDA 5MEQB 5L7XH 4A2LA 1T0PB 3TEUA 2H9GA 5B39G 3U9PL 3MJ9L 2VLKD 3C5SA 1U3HC 3ZL4H 1F6AB 2F19L 2M8XA 1V7ML 3CUPB 3L3GA 2ZG2A 1UC6A 3MRNB 5C0CA 3VFUA 3TVMC 3L5HA 2GJ6E 5CBEA 1CTNA 4K7FA 4Z0BH 1PGRB 2OR8A 3B9KB 2EDKA 4Z7QE 3BD3A 1P7QB 3VXRA 2P8PB 3Q6GL 1G7IB 2PTTB 1JRHI 5JQ6L 5D1ZC 3IDYC 2AGJH 4KHTL 4NRZB 1E4KA 3P30L 1T21A 2R4SH 3U7WL 4FQCH 1T1WB 4LLUA 2XZAH 3DWTA 2GFBB 4U4BA 4X4YA 3S35X 4M5YL 1R3KB 5BVJB 3MV8E 4XWOD 3EFDH 3RY5A 5D2NA 2IPTL 4BFIA 4OFVA 1CT8A 2VLME 3OJMB 3Q5YA 3PXJA 5F9OH 3JVGA 3IDMA 4G42B 5DD3H 2HVJB 4Z7WA 4D0DA 1T80A 5F8QC 4DGIL 5KN5A 1XGQB 1H5BB 1HILA 5C9JB 2YC1B 1VA9A 1IRAY 2B2XL 4LKCA 1EEUA 5EU5B 1MEXH 2RAMA 5JO5B 1MCKA 1K2DA 2FH8A 4MS8C 4O02H 3DX9B 1C16A 5IV2B 5HYJB 2AEPH 1FN4A 2IANB 3QP3A 3MGTB 3WS6A 1Z0MA 3CU1A 4RGOL 3WJLC 3E6HA 4HJJH 5IHUL 3QWRA 4I48A 1A7BA 3ULUH 4WHTB 4ODUA 1BQLL 3DURB 1RJZA 4JFQA 3SQOH 1G7HA 2VISB 2V17L 2XZQL 4MA8H 4P2RD 1LE5B 4H1LA 3NCEB 4GLRH 4JN2A 5D7IF 4PJIE 2ZUYA 4GRLB 4BH8B 1ONQA 3BPOB 4FQJL 1F3DJ 3FTGA 4OZIF 5D96B 3S5LA 5CD5C 1ZA6A 5HDOA 1A1OB 4NQUA 4P3DB 1U3HA 4RQQA 1I3UA 3T0EC 3H6JA 1VPOH 4BM7A 1I7RA 2X70B 5C0BA 1LO4H 1JWSB 4L4TE 1ZVHA 5FYJU 4WTXA 2F74A 2W9LA 1FZOA 5DRZB 3TVMA 3MLZH 4HCRL 4NQCB 2A6JA 2MJWA 2OBGA 3CMOH 4OZHA 3REVB 2QQLL 5C6TH 3UTOA 5E1AA 4KRMB 1DQMH 1UM6L 4ORZC 3IDJB 3F7VB 4K7PY 1OAQL 1L7TL 1BIIB 5C7XL 1NCWH 4YDJB 2NR6D 3WIHA 4XVJH 3DPBA 3UC0H 3BWUC 2FHCA 2Q86A 3MRDA 1IQDB 5KS9B 2P5WB 5DFVC 4JRXA 1R0AH 3E6FB 3FOLA 3O3EA 3GZKA 1U8QA 3GJFK 3SDCD 4YHIB 4F2MB 1VCAA 3QCTL 3A6OA 2HLAA 5IB3A 5IBUG 3SDXF 3N1QC 4ZYKB 4DFHA 2C3VB 2VH5H 5C07E 1G1YA 2ZCKL 1BX2A 4D9LH 1KPRA 1LK2B 1R3JA 2YN5A 3CXHJ 3MJ7A 4FZ8H 43C9B 4NT6A 1Z5LB 3QRGH 2FZ3A 3BH9B 7FABL 1OD9A 5FGCB 1P5UA 2NX5E 4DOHB 3ARGC 3HMXH 3RWFA 3TIDA 3MRBB 2WNGA 3JWOC 4CAGA 4LSVL 2EDYA 5DWUH 3GFUA 1OAZL 4E9LA 4GW5A 4ZFOL 2V5MA 4JGJA 2BHUA 4GW1A 5GGQH 1CFQA 1W0YT 2DWEB 4U0RB 3DMMD 1SJEB 1TVDA 3D25A 4OF6A 4FFYL 3L5IA 2CPCA 4LOUD 4ZXBB 1T22B 4FS0A 4FNLL 4PGDB 4NQVB 2HMIC 2E27L 4U05A 1MFBL 1XT5A 4Z18A 3NN8A 3EYOB 3NPZB 4NFDA 1K5NB 4V1DB 3WXVH 1MCDA 3VFOA 4J4PD 1XIWD 1A47A 1VEPA 3OKDB 3TYFA 1KFAH 4PV9B 4Q9BA 4JFDA 3FFCD 1KB5A 3T0EA 3IU4L 3NPSB 4CVZA 1UM4L 1RURH 3KPSA 4LLVB 3JV6A 1C5CL 2X4OA 4LF3A 4ZAKC 1U8KB 1JZ3A 1DUZB 4AIXA 5HYSG 5GPRA 3V0VB 4WHDA 4XBEH 4XPGL 4JG1H 3TJEH 1N8ZA 1I9EA 3D18A 1MVUA 4OZGA 2BNQA 3K1KC 4KK5C 1H0DB 2W0PA 5EU6E 1T0MB 5KG9A 3T4YB 1EA9C 3D0VA 2GJ6D 2Z8WC 4WHCA 3CLEH 1H3WM 2VR4A 1EFXD 2AXFA 5SWQB 3KXFB 1JGEA 3UZVB 5GHWH 4APQB 3QWQB 1NBYA 3RVXD 3BIAX 1W72B 5HGGS 2P46B 4I1NB 3G6AB 5HGHB 5DJXA 1H8SA 2XA3A 3PHOB 5C8JA 3QUZB 2PN5A 4H0HB 4NHUA 5DA0B 1HOCA 3OJVC 4DGYL 3QDMB 2HT4C 3O4LE 4ELKA 3MV8D 1FC2D 1CTOA 4J3UA 2VLMD 4TSAH 2YEZA 1JGDB 5EOCH 1FGNH 3WKML 2R0LH 4D9QE 3LOWA 2BNRB 3GNMH 1QLFA 4HUWB 4FQ2L 3V6BR 1ZK9A 1J1PH 3ARQA 2ARJQ 2P8LA 1X5HA 2OTPA 3OZ9L 2ED7A 5TQ0L 4H88L 1ZHKB 3EFFB 3ARGA 3KYKH 5C0JB 5T3XE 4YAQB 1GIGH 3BN3B 2VZSA 1BQHA 1H3VA 2FWOA 1BZ7B 1N64H 1QRNB 4Q9RL 2IH3A 4NC1C 1QZ1A 4OTXL 5HHXH 2NY6D 3HNVL 2EIZA 1TMCB 1MWAL 2J88L 2W38A 1URLA 1NUNB 4X6DA 5MI0C 3JV4A 3KLAA 4HF5L 1HH6A 4P23B 15C8H 2XTJB 3VGGA 5D70L 4ZG1A 5F7UA 3KPLA 4OCYH 3L3KB 4OGAC 1BFVH 5ANMA 5FKAA 4AEHL 1WBYA 3IFNH 4JJHA 4KUZL 4X7CC 1VERA 1DSFL 1P1ZA 1TIUA 2IFFH 2HJLA 4DTGH 1T5WB 4TOYL 3T0XA 1EEQA 2CIKA 1JGVH 2RR3A 2WBWB 3MFFB 4NWTH 4LFHG 3K2UL 4WEBL 5FB8B 1YMHA 2Y5EA 3MPCA 1CFSA 1QFUL 1TJGH 5JOFA 3RWDB 3WD5L 4ZO7A 3CX2A 5IEKA 3KVQA 5D7LE 2BNUB 4ZUTB 1GJIA 5A3IC 5FYLE 3FQRA 1RIVH 2AXHA 1HN1A 2G2RA 1HEZB 5TH2A 4G6KL 4Y4KC 4MQ7B 2HWZL 2NY2B 5B3NA 4PRPA 5H94B 2LVCA 4PY7B 2W9EL 1S7XA 1GPOH 2DQTH 4PJEB 2VXSL 3VXTA 1KELL 1AO7A 3NBNA 5INDA 2HA1A 1QLRA 4Y1AA 4UIMA 5CJOH 5DD1L 5GIRA 3O4OB 3RWHB 4E0RA 4X5WA 4E42A 4WI5A 4WW2A 5E00B 1MJUH 3NTCL 5C07D 2O93L 4E41A 4ZS7H 3OF6D 4JY4B 2AJXL 1A6VH 2EE6A 2FJFB 4U7SA 2F53A 2NX5D 2GK0A 5J9PA 1A7NH 5HPMA 4XVUD 4DK3A 4K71C 4QXUL 5FO7B 4P59H 4JZOA 1UKTA 5CEXA 2YPVH 1OAYL 3MV01 4EEEA 4M1GL 2MCPH 4R4NC 1KIRB 1CL7L 1OTSC 4NNPH 2DYPA 1CZ8H 1U0QA 4J7RA 1NMBH 2ZSVA 4KC3B 1JK8B 4H8WL 4LCUB 2XRAL 4MAUH 3ZTNL 3SO3C 1QO3A 5E03A 4K8RH 3TNNA 4C57C 3S36L 2BVPA 1KV3A 5ICYA 1QFWM 2BOBB 4NZUH 3QJFB 1WZMA 5TFSL 4TVPE 4UV4H 3MLTB 2HN7A 5E6IB 1XAUA 3GUTA 3RTQB 3HZVA 1AR1C 3QG6A 1GHFL 4TN9A 1QVOB 3T2PA 1FO0L 3AB0C 4OAWB 3KS0J 4OZFG 5ALBH 4ERSH 5CAYB 2ZKHL 4HAFA 1U6AL 5F88A 3N0PB 5I8OH 5EU6D 4AZ8A 4R96A 5F7FA 4Y4KA 4X9BA 5AWNL 3VFVA 3IDIA 2ZJSH 1W0VB 1B4JH 5DRWB 4LRNL 3HI1B 2VXVH 3U9PH 1SEQL 4PJ7A 1UB6B 5FK9B 2Q6WA 1KCRL 4QLRA 5IIEA 5JW3H 4N68A 1PKQE 5MENE 3CLFH 3RVWD 1JI1A 4ZNEE 2NY7L 3FT2B 3PIQA 4LDEB 4B5EA 4Z7OF 4RMSA 2ICWI 3O4LD 5KANI 3MJ9A 4NQSB 2HVKB 3PV6B 4F7MA 1WF5A 4NKQB 4C83A 2DD8H 3GBLA 4D9QD 4OI9A 1XGYH 3ARBC 4G6JL 1HCFX 2EDBA 3IDXH 5JQHC 3CH1B 4KHTH 5E2VL 2DICA 2EDDA 2EDWA 3U7WH 4ZTPH 4F7PA 5D1XC 4FXKA 5DJCA 1YEEL 1JNNL 3VXMD 1KIQA 5FCUL 5C2UB 5EU4B 3VGFA 3DETC 3MC0A 1WISA 4D8PA 2A6IA 3W11C 3GMRB 3H42H 4P4KD 3VFWB 5H2BB 1PX3A 3V2AR 3SGDH 4EQ3A 3FO2A 3MRMA 3KPPB 2NXYB 5ELIA 1N3NA 4AM0B 4BSWB 2HH0H 4MAYD 2GQHA 4MNGB 1WIOA 4RGOH 4YFDB 3X14A 5FEBA 5LVEA 2ICEB 5ESQB 3WIIL 4HBCH 4P2QD 4HD9A 1B0RA 1ZVYA 2Y4SA 3BGFC 2WM0A 4K94L 3L3HB 4KK9C 3NCJH 5BZWA 3GJFA 2EDJA 4MNHB 3GO1L 3V5KB 4PJXA 2IAMB 4HH9B 2VQTA 3V6FA 4BZ1L 2R23A 2ZP0T 4EUPH 4NP4L 2CDFB 1KPUA 1NJ9A 5BRZA 4L9LA 1FFNB 4PR5B 5ILTH 4X7SH 1MHCA 1ZHBA 5D7LD 5BQ7B 2WANA 3CCHA 1L6ZA 3ZKNC 2DKUA 1PSKL 5CEYA 4M48L 5FYLD 2YK1L 1DZBA 4KWUA 2J4WL 2AJYH 5DUBA 4YQXL 3E3QE 1X4ZA 3GMQA 4PGZA 5I0ZA 3L7EA 3S37X 4M93B 2X4QB 4L4VB 4G6ML 3IFPA 1IQWL 3K1DA 2JF1A 4ZFFB 2WLYA 3LEXB 3TIEA 3MCG1 2YSSB 4LSSH 4PD4K 4PJ9B 3NGBB 5JIIA 3EO0A 3EHBD 2DF3A 4KJPC 2BDNL 4KKAD 4HK0B 4QHNA 3P11H 2W60A 5I75B 4LPWA 5DA4A 3TF7C 2PTUA 4L8CA 2X4SA 4UDTB 4ZNEA 4HCRA 4XCCH 3X3GL 3KPRA 4XHQA 5D1XA 5DJ0B 1G7JB 3RY4A 4GW4A 4JANA 4RX4D 2WWMC 2QJDA 3PWJA 3U9UA 3OMZA 4Z7NF 1FZJA 2XT1B 5EC1B 4AMKL 1AHWB 3LCYA 2YPKA 1DVFC 2GSGA 4LRIA 1I4FA 4LVHB 3N06B 3FONA 4Z77B 3RAJL 2ZCKH 5ISZD 4P9ML 5DS8A 5D5MA 3VA6A 4AT6A 1K8IB 3T0DA 3IKCA 4KKLD 5HI5C 1XR9A 1NDGA 2J7LA 5DEGB 3C60D 1HHKB 3MRCB 4GXVH 2VLRE 3R0NA 2ZSWA 4K2UH 5I1DA 3EDFA 1KN2L 4JB9H 3OG4B 5J4MA 3MBEA 3V52L 5DD5H 1HIMH 3UDWC 1YEGL 4XPBL 4KI5C 3PWNA 4QHUB 3PHQA 1X5FA 4U6VH 1RUKH 3MZTA 5FOJA 5I6XC 3T65B 4YNYA 1ADQL 1QHOA 4NFBA 3SN6N 4TVPD 1OTUC 2XWBA 5I8EB 3QZWG 4OKDA 3HUJB 1XF4B 1EUUA 3K0WA 3VFRB 4FNLH 5CD3A 2FX8H 4OLEA 4XWGH 1WVZA 3HFML 3DUUB 5HDBE 5DRNA 4DUVA 4ZFOA 5IT2L 5E9DB 3UCRA 2N7BA 2FBOJ 3AY4C 4JAMA 4GAGL 3BW9A 3THMH 1N2RA 4KKCD 5CHNB 4PJHB 2Y25A 3EJJX 1N5YH 4NQDA 1EVUA 1U8MA 5FDYA 4XPGH 2Z31B 5E2TL 3LKNA 5TGBB 5DD0L 5GSRA 3MCLH 2VXQH 5F3BA 3TPUA 3BAEL 2I07B 5DHVA 1IKFL 5MEND 5ALCL 1FNSH 1MREH 3IJHA 1U95A 5GGSB 1E4WL 1EHNA 1B0GB 4HEME 5D7KD 1YMMA 2GCYA 2RHEA 5EC2B 5I66B 3NFSH 1XCQB 5HY9B 1MI5E 1F4WL 2VLKB 4TUJA 5HSFA 1FG9C 1U41A 1I8IA 3KGRA 5EBWA 1Q72L 5I1AB 3TT3H 2A0LC 4XRCA 5FHBL 4X4ME 3C09C 5DSCA 3BP6A 4LKXB 3EAKA 2AI0L 4LK4A 3AAZA 5GRWA 1FJ1A 3GHBL 4AIZB 1U3JA 2VAAA 3AREC 5CSGA 3WUWG 4FOMA 1VFUA 1XGPB 1VFBA 3WFEL 1WBZB 3CDGB 3OKMA 2I60H 3BEVB 4FQ2H 4NM4L 3MJ8A 1P4IL 3W2DH 4WWKB 1T83C 3F7YA 1SM3L 3H9SA 1H15B 5DO2D 5I16B 4CMHC 1X44A 4GKSA 2HFEA 3MV7E 4DWHA 2FATL 1F3JB 3V6OC 4LP5A 3UDWA 4GG8B 4ALAH 4RSVA 2DWDB 3QA3B 2DQFA 4HGWB 1FNGA 1GGBL 1RUQL 4XH2A 1H3GA 2LAGB 4HKXB 3MRGB 5HBBA 2J88H 4JFOB 3IXTA 2H32A 5JZ7D 3RDTD 5K93A 4LBEB 4HF5H 5ENWA 1KBGH 2VLRA 5L2JB 4YHPA 5D70H 2UZIL 2NY3C 2JCCB 5GZOC 4HX1B 5DEZA 4M5ZH 3ZE0E 2I9LB 4HS3A 3VI4F 4GUPB 3LD8B 1LO5B 4Y7MA 5EUOA 1MWAA 3UPRB 2A9NL 3WDIA 3AY4A 3TGXA 4N9OB 4TYUA 5LQBL 3DVNB 2IBGA 3B8YA 4EOWL 1D5ZA 4HIEA 1J1OL 1QBBA 5BJTA 5F1IB 4JZJB 1AY1L 3GHEH 4TOYH 3T04D 1IM9A 3SKUD 3G6JA 2ERJB 3CFDA 3K2UH 1UACH 3DROA 5EZJA 5C2BH 3ARZA 1ZHNB 5MEPA 3SKMA 4JFFB 3WD5H 2AK4E 4JFEA 2BXYA 3C5SB 1XMWA 5AG8A 1U8NA 1BVLB 4P0DA 2UWEA 3WBDA 1CVRA 1B3JA 2IBZX 3OKYA 4HZLA 2AERT 5EO1B 4Z8FL 5KSUA 1MFAL 1NCCH 2R56L 2QADB 3RZCB 1MFDH 3HPLB 4PB0H 2X4NB 3MRQB 3DX6A 5FKPB 2Q3ZA 4QNPF 3VXRB 2B8OT 2AXGA 1AC0A 4OCXH 1NANI 3HG1E 4WUKL 5F7DA 1I8LC 4CU6A 2ARJA 1T21B 3BESR 3NCYS 1NC2A 3QIUC 2OI9B 2OSLB 2CLVB 4HJ0C 4O2CA 3FOMB 4YBLB 4GKNB 1ZEAL 4MNQB 1FIGL 3QQ3A 1CT8B 3MLYL 4HIXL 3LKOB 4PJCA 2HAZA 3V6OA 4L8BB 5I15L 4YBHA 3HRZB 4N0RA 4PREB 4D0DB 4LEXL 2FJGA 1OHQA 2W65A 1NFKA 5FDWB 1DE4A 1VB9A 2NY5L 3RWGB 3SDCB 3QFJA 5TE6H 1P9MC 1KTLA 5DMIL 4N0FA 4NZJA 5E8NA 2IQ9L 1DDHB 3MO1A 4KUCF 3F12A 4HMEA 2EYRA 3JUYA 4M1GH 1OAUH 3IETA 1K8DA 4O2FB 5AAWA 1JPGB 1WK0A 3MXVL 4FZEL 1M71A 4PP2A 5IB2A 4JKLA 3RY6A 1HHIB 2Z91B 2P5ED 4YUEL 1AKJD 3FKUS 2R2BA 4ODUB 5IW6A 4JFQB 5E1HB 2XRAH 1YEIL 4WEMB 2VUOA 4U1GB 1IGJA 2OMBA 3GSRA 2QL1A 3S36H 2PETA 4MXVF 4JN2B 2VAJA 3DMMB 3QXAA 4NWUH 3SJVE 3C6SA 3RWCA 1HINH 2E7LC 1JNHB 5CJ8A 2YPLE 4D3CH 5F96L 1YEDB 4OGYL 1GGUA 4RQQB 4S1DC 3W5MA 1EMTH 2ZKHH 2QSCH 4AIOA 5C0BB 3EOBA 3JTTA 4HS6B 1Q94A 5JIKA 3CXHK 3FFCB 3VCLA 4G6FB 1D5IH 4U1HB 5L8JB 4K94C 2CDEB 1FO0A 1WQVT 3GK8L 1SEQH 4ZOAA 2AEQH 1U8HB 3V4VH 1KCRH 4LVNB 1WICA 3TBVA 3QDJE 3P0GB 4MWFB 1KOAA 3LQZA 2GJ6B 4XNUL 3U0WL 3VGHA 4XX1E 1UZ8A 2FSEB 4PRHD 3BN9D 1LMKA 2OJEA 4ZNCD 5C9KA 4IRJC 5HHNA 5EDXA 4JRXB 3JBG7 2HLFC 3QXWA 3O3EB 3VMPA 4U1NA 4BQ9A 3VFPA 3MBXH 1MNUL 4NN6C 1BX2B 4N0UE 3T0WA 3MV7D 3MJ7B 2ED8A 2N56A 3MV8B 1YEEH 4NT6B 3ARUA 2NY4C 5DC4B 3V5DA 3LAFA 1FE8L 2FZ3B 1JF5A 4P5KA 4Y5VC 4QT5B 4Y5XC 1E6OL 3SDAA 3NH7L 1JN6B 4L8SA 3S34H 3TIDB 3ZT7A 2YXFA 2NY1B 1XGTA 1VEMA 4WO4B 3PNWA 4H0IA 1WWCA 3TYGH 1DEDA 2ESVE 4RISH 4GW5B 4RMUA 3ZDYF 1KJ3H 3AU1B 5KSBF 4U2ZA 1D6VL 1G7PA 1I7UB 2NXZC 5T1MA 2YKLL 3EJZC 2NY6B 3OL2A 3D25B 4OCLC 4QGTA 3WEXA 4IRSC 4PGEA 3ELAT 4NM8L 3C5ZA 4GRMB 4M7LH 5E8DH 1RK1B 2FBJH 4R8WL 5C0ND 5GSVA 8FABA 4XNQA 3KNBA 3MXWH 3NN8B 1ZOXA 3ULUE 1C5DB 4HXBH 5EZIL 3WDHA 4F3FB 1JGLH 3VI3F 2W07A 4K94H 4PTUA 2FEEL 2DQJH 4JFDB 1J11A 1E28A 1KB5B 1T04B 2ZCHL 4CVZB 3KPSB 1NC4D 1OB1A 3QCUH 3QEGL 4LF3B 3CZFA 1XH3A 2R15A 1FAIL 2AK4D 4Z7UE 3EYUH 4ISVB 5EU3A 1AGDB 4YHKL 3QRFM 3D18B 2OYPA 1PSKH 1UGNA 1ZT1B 3LKSA 3W39B 2HTLC 3VDBA 1DUYA 1FFRA 1E27B 5KG9B 5K33A 2Q8AL 1L9MA 2APBA 3M07A 4L4TB 5D6CA 3M1BA 4FQQB 4LCYB 2J8UA 3BDXA 3BSZH <