1XCQB

Complex hcv core-fab 19d9d6-protein l mutant (d55a,l57h,y64w) in space group p21
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
218
structure length
218
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTDFSMHWVNQAPGKGLNWMGWVNTETGEPTYADDFKGRFAFSLETSASTAYLQINSLKNEDTATYFCARFLLRQYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein C
publication title Different crystal packing in Fab-protein L semi-disordered peptide complex.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 32
structure length 218
sequence length 218
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2004-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xcqB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xcqB02
1CD0A 5HDBE 5KVMC 5IM7B 2DLTA 3GUTB 2EXYC 3ARWA 4PJ7A 1RU9L 1U3HD 4OFVA 1D5BB 1MAJA 3B2UD 4RQQB 4YXLL 4XPBH 5HYSB 1PFCA 4D9LL 1PD6A 2CDFA 1Q0YL 5F7EH 5ACZB 1B6DA 3RUGF 4NO5B 3MGTA 6CGTA 1IAMA 3DV6B 1SY6H 4CVXA 4AH2A 5I2IA 1NDGB 3QEQA 2DQTL 5HGGS 5JTWA 1NCTA 2BX5A 4ESKA 3L3GA 3DVGB 5D71L 1D7FA 3QDHA 1LDSA 4DZ8B 2A9NH 4XPFL 4K9EL 5JQHC 1MJ7H 1UFUA 3ZKND 4JFOA 2XOTA 3V95A 4GG6A 1E4WL 5DEFA 3MMEA 2PW2B 4DVRH 1ED3B 4KRPD 1OGTB 4KKBD 3KXFB 1FFOA 1YEHH 2B1HH 4U6XA 3NIDF 1EJ6A 4I5BB 3A0OA 4GRLB 5I16A 2XIDA 1FZOA 4IOIB 1YN6B 5IFHH 4A2MA 4GKNB 3GSRB 3LRSA 1EGJL 5HYJE 4XRCA 5E00B 1I1AB 3S3PA 3IS1X 3D2UB 2AI0H 3ZL4L 2VDRH 4R26H 5FO7B 5FM5O 5D2NC 3QRFM 3TBYB 3ZDZF 1A7OL 5HHQB 4DKDC 3DX6B 1G7MB 4KFZC 5ALBL 5BZDB 1K2DB 3PWPE 1HKLL 5CUSH 1YYML 1U0QA 4OBRA 4PB9L 5FB8A 5K93A 3IJSA 4H8WL 1GGIH 1R5VA 4P59H 1VGKA 3MLVL 2YMXL 4PJ8C 4Y88A 5J6HA 4O58H 1TJIH 1S7SA 4UBDC 4WHYH 4OLYH 3UTZB 3SDAB 5E4IA 4YR6A 1NANI 1ZVHA 4YX2L 5CEYA 3WXWL 3HE7C 2G5BB 1RD6A 1CE6B 4G7YH 1WSST 2ADGB 3GO1H 1MRDL 2W9EH 2LE9A 4R4FH 2Q8AH 5J3HC 4GMTL 3HNSH 4KK8D 2C4FT 4LQFH 5L8JB 5FYJL 1MCPH 5C3TA 3VWKA 1U3ZA 4MNHB 3EOBA 5E4EB 4OV5A 3O3BA 1D9KC 4P2OC 3X14B 43C9B 1FNAA 1TZHB 4H25B 4Y4HA 1RIHH 4JQIH 5T5FL 1ACYH 1SEQL 2YXMA 1HYSD 2RHEA 2AK4B 2BVPA 1QYGL 4GOSA 4LLMB 3C6SB 2VUOA 3PWLB 1F45A 1NGZA 3WFHA 1JYWA 1MHPH 3P2TA 2HVJB 2GSIB 3N50A 3TO4D 2FL5A 3MRCB 4DTGH 3DBXA 1LEKB 5E94B 2R4SL 2BNUA 5DJAA 4LPXA 4H5SB 1MFAL 2V17H 1WGOA 3KXFD 4OKDA 1ETZB 3ROOB 1JPTL 4CU6A 1VA9A 4EIZC 1T04B 1RZFH 2YSSB 4F9PA 5F6HJ 1FYTE 4Z7QE 1JPFB 3W0WA 1S7VB 1XF4B 4GRLD 4N0FB 3T4YB 1PKQE 5C7XL 2F15A 2UWEE 5BJTA 1MCWM 2VLMD 3P4LA 1JPSL 4EUPG 1DBKL 1KPVA 4HIIB 1SVZA 3PJSB 1NGPL 2ITCB 4RRPG 1I1AD 5BOZG 4NZRL 5CP3A 3TWCH 5J0BA 3MZGB 5IW1B 4B7IA 4OJFL 3SQBA 3QCVH 2GITB 4O51B 4Q9QL 1EO7A 4HWUA 3ARTA 4W68A 3RZCB 3QG7L 4JDVB 2YD2A 2WUCH 4IJ3B 5HI3C 1KELH 3ISWA 4BKLB 3VA2C 1PVHA 1KPUB 3GZKA 3TBWB 5CJOH 1RV6X 5FF6A 4QHKJ 3FMGL 3WJLA 1RZIB 3EYFB 1LEGA 2Q76A 3AMKA 3EKCA 3NGBC 4NWTH 5AYUL 5DYOA 1G0XA 12E8H 5KG9B 4MHHI 3SDAD 2WUBH 2DBJA 4MX7B 4TTDD 3ZZ1A 5HVHB 4ZAKA 3WFBL 5E2UL 2NTSP 5BS0B 2EEAA 1T22B 4LLWB 2W59A 4JCMA 4QGTA 2J8OA 4WDIB 4E0RB 3DI3B 1LP9E 3VFGH 2ORBH 4RFOL 3TV3H 1FE8L 1G7PB 2WP3T 3PABA 1A7QH 4MCZA 3SGKA 1H3PL 3VXRA 4FQIL 1IGYA 1O7SA 5FFLA 2VL5B 2AK1H 1CVSC 2VLKA 3HZKA 4N90D 5LAXA 4LSQL 1YN7A 4HF5H 3KPLB 4WHCA 3GSQB 3TPUA 5HY9B 3FN0L 3BGFC 1CLOL 1ZWIB 1RK1A 5KVDH 1ZLVK 4EXPX 4TTGA 2BSTB 1JGEB 3JV6A 5KSBA 5KW9H 2D9CA 4WJ5B 1IM9A 1N7MH 2DI7A 1CXIA 5AEAA 5HDLA 3QNYA 4DCQB 5C0EA 1MCJA 3OB0H 2BSSB 4NT6A 4E42B 4JRYE 4LIQH 4OF5A 5KN5A 1MOEA 2R1WA 5EO0B 4R7NA 4EI6A 4OUUA 1WTLA 1UCTA 4ODTH 2QQKH 1KULA 2HWZL 3IF1A 5LVEA 4DKEH 4WU7B 1IC5H 5AAMA 3K7UA 3VJ6B 5IB5A 1MRCL 1B0GB 3VWJD 2BNQB 4HWZB 1IAIH 2GK2A 4OD2A 4S11A 1I1CA 3HNVH 5FHBL 1YC7A 4PYGA 1S7TB 2IANE 4O4YH 3ARFB 3G08A 3TNMB 3S4SG 4QHMB 3V2AR 5JPMA 3FQWB 1N8ZA 3FO0L 5A2KH 1OPGH 3RL2B 3BIAX 5ESAB 2LU4A 4JVWA 3GSVB 1YY9D 4EUPB 4PJDB 3OKLB 4JG1L 4AEIH 5EU6E 4HMCA 2HFFA 4QHUA 4XXCA 3L7FB 2PCPB 2DOCA 2BVOA 5BS0D 3U0TB 4CADB 3NH7H 2APWA 1NAKL 3KPNB 4ZS7L 3S98A 5IW6A 3U46B 2NX5A 3O6ML 2EO1A 4M6MH 2ZP0T 1ZHKA 4RX4D 3VGAC 3UAJD 5JUEH 1UJ3A 4B50A 1A14H 2YZ1A 5KVGL 1VKXB 2ATKA 1NC4A 5C0BE 3CU7A 1AR1D 2P47B 2V9TA 4I4WB 4IRSA 3S3SA 2FX7L 1BFVL 3LRHA 3MACL 4WUUB 1FIEA 5GRWA 5K59F 1R3IL 5DT1H 3IFPA 2FIRT 2VH5L 3S36L 2D7NA 4GS7B 2GT9A 3C2AL 4OCWL 1IBGL 1ZHBA 1XGRB 1PX4A 5CEZE 3JWDL 4JB9H 4JPIA 4JFDB 4NNXA 5C0JB 4PGBA 4V1DB 1QHPA 1ZLWH 4KKLD 1XEDA 1VESA 1IC7L 4ODXA 1S9VB 3CFKB 3BZEB 4AEEA 5I1DA 3FFDB 4PP2B 2IAMC 2ZCLH 2UYLA 4CJ0A 4WW1B 5EH1A 2EECA 4HK0A 2O5ZL 4YXLH 3QFJA 5E2WH 4F57L 3RUGA 4YGVA 4NNPL 2EDXA 4I18A 2MHAB 3SKJL 2FR4B 4DW2L 3NZ8A 1UWGH 4XWGH 5DHYA 1K8DB 3RBGA 4EUPH 1FQ9C 5JNYA 1ES0A 4JHBA 3L5WA 4R4NC 4AENB 2DQTH 25C8H 3ARFD 3KNBB 3ZE0E 5I75B 5HDOA 5D71H 3MUJA 2OR7A 5J1AB 2XNAA 5IHBA 2EKSB 5MERA 5FAAA 1AGEB 1VADA 1U91A 3MJ9L 2X1QA 3U4EA 5E4EC 4P5MB 1H5BC 2NXYC 5EOCJ 4ZNEA 3QXDB 4XMLH 5ICZB 4P57A 1HDMB 2WSKA 2IG2H 4JY4B 1OB1B 2WBKA 1IQWL 2XKNA 2I25N 5ISZE 3C6LB 4N1CA 4NZJA 2XTJD 1J0HA 5C07B 1ZT1B 4AL8L 3RY5A 3BRFA 2BY2A 3GRWL 3VRJB 4HW6A 3S4SB 4KJYA 3ZO0A 4XC3L 2DS4A 3STZB 2J12B 1LO2L 1KNOA 1I1RA 3V5HA 4FOMA 3ZL4H 3HNTH 4D3CL 3LV3B 3KJ4C 4D9QD 3W9DA 4JZJA 3QJFB 4WUUD 5C6TL 1WBYB 2A83A 4GJTB 2Y06H 2HVKA 1NAML 4MQ7A 3ULVH 2DL9A 4HUVA 4G42B 5LG1A 1XGPB 3C2SA 3C60B 5DK0B 5MENA 5IF0B 3MLUL 3OAUL 1MFDL 4XCNA 2BP3A 5JLZA 1OAYH 3HZYB 3DGCR 4JFDD 4WNQB 4X7TA 5F7YC 3SJVA 2ZUQB 1YUHA 3O4LB 3IFOA 5KANG 5CBAB 1LNUB 4ZYKB 4CN6A 4YHOL 5HGBB 3RI5K 3TH4T 3FHQA 1XFPA 1S9XA 5BVPL 3RZCC 5F1IB 2DTMH 3T0ED 4LCCA 4GAYA 4YLQT 1NMCB 3O8XD 3C5SA 1WC7B 4X7EC 2D7TL 4YDLC 3ARGB 3QSKB 4QCIB 4ZS6C 2BCKA 1EJOH 3VGFA 5ID0A 4IOFC 5I1CL 4ZFOL 2ZOKB 4OM1L 2PTTB 4MJ6B 3NCJL 4WY7L 1J8HA 1A1MB 4MCYB 1MHHB 2MCPL 3ARED 5T5FH 1MI5E 1SEQH 5A1AA 1A9BB 1OWRM 5DXWA 2A73B 4XVTH 1RJLB 1ORQA 1TVBB 2MJWA 3UPAA 1QYGH 3HB3C 5FYJD 5JZ7D 3SOBH 2GJJA 5F89A 4NO0D 1U8MB 3HRZA 4UZGA 4D9RD 5AZ2L 2XA3A 1DUZB 3TN0D 1B0WA 4JGUA 2WP3O 3ULUH 4ZPVB 3KLSA 4LKXA 1JRHI 4OCLC 1K4CB 2R39A 1A4JA 3C6LD 4M5ZH 1QSVA 3RKDC 5HYQA 5IFAL 4ZSOB 3QCUH 5AYQA 4ZUWA 5SWZA 1Y0LB 4XMPH 1JPSH 1RUML 3F6IA 1DBKH 3GB7B 3HN3A 3QI9C 2PUQT 4HS8L 3RGVC 1PZ5B 1AFVL 4NZRH 4PV9A 3GJEB 3V6OA 3MRMB 2FEDD 1MPAH 2V2XA 1FZKB 3TCLB 3RAJL 3K74B 4OJFH 2AAVA 4PJAE 2ZPKH 4F58H 2XZAH 2UVEA 2M8XA 1E4KA 5DD6B 2VL4A 3NABL 4Y5VC 4Y8DC 3QG7H 3TBTB 5EOTA 3FO9B 4QKXB 1DFBH 1FC2D 3RX7A 1DE4A 2XWBB 3S34L 5DMJB 1NBVL 4IOSD 3QQ4A 5DA4A 4QRRE 4Y19A 4JKPL 1X7QA 3RWGB 1BZ9B 2VABB 5K9KB 4ZTPL 3I6LD 4MD0A 5IMOA 4BZ1H 2Y36H 1TPXB 4PRPA 5EZJB 5FYKL 3MRJB 2KKQA 1D5MB 5IROC 4HKXA 2BOCA 3DJ9A 3KLHD 1I8MA 5ILTL 3CZFB 4C4KT 4NRXB 1QFWL 4LLUA 4NRZB 4RFOH 4M1DL 1RI8A 4BZ2L 3WO3B 1FE8H 3ARGD 4BM7A 3DUUB 5DGRA 1DBML 4XB8A 1AP2B 5E7FA 5JXAH 1MFNA 5F96L 5CKGA 1A6AA 2YKLL 4HKBB 2XWTA 3L3IB 1TIUA 5DQ9A 3IKCA 4O5LH 5FO9B 3LD8B 3S37H 5F7UA 1UADC 2X40A 3GMQA 3MLRL 1OF2A 2WQ8A 3KWWA 3WYRA 2E7BA 3MJ7B 2P8LB 3FN0H 4FQCL 3ZSTA 4I8DA 5JIHA 4MA7H 4R3SB 1CLOH 1NGWA 2FIKB 4A6YH 4H88L 4KMQA 3WEXB 2G5RA 4G8GA 1L9MA 1VACB 3QDME 2AJVL 2X42A 3H9HA 4I3SL 1QOKA 2VDOL 1MFEL 4U6TA 1KN2L 5FDWA 4XNQA 3IVKB 1CDYA 3V4PL 2UUDH 4CKVX 2IALA 5ANMA 3WMSA 1QSZA 4ZDHA 1D5IH 2NY3C 3QEGL 2O5YL 1RK0A 1ZAGA 5E6IC 4PRNA 4QTIH 3RJQB 3SDXF 1YY8A 1C16A 4K3DL 5FKAB 5IT2L 3UO1L 4HIXL 3S36X 3WIHH 2HWZH 3IU3A 5B3JE 3KLAB 5H8DA 3QRGH 1RJZA 2PYEB 4YXHL 4G6MH 2R56L 3P73A 2H6PB 3VFRA 2KH2B 1NFKA 1JJUA 5FHBH 1AQKL 3DX8B 4OTXL 3ULVC 2IGFL 5C9KA 2HJLB 4Y4FA 1NSNL 5FM8A 4X9IA 1A02N 4XI5D 4KJPC 4JRXA 2W07A 1AGDB 3FO0H 1T0MB 1BBDH 2P44B 5EB9A 5IJVB 1N59B 1M6OB 3BQUC 4G9FE 2CKBH 5HPMA 4XHJD 3NPSB 3A6BH 1G7JA 1OSZB 2JB5H 4HUMB 3ARRA 3JVGC 4UMGA 4WHDA 2Z8RA 1KJ3L 1CQKA 1NAKH 3W39B 3WNMA 1I85C 2YEZA 3O6MH 3H3KA 3CSBA 3SGEI 5INDB 4Y16C 3PWJB 4NUJA 1NFIA 2VSCA 1JHLH 3FONB 1FNGB 3EO9L 1RMFL 2FX7H 1BFVH 1P7KA 3MACH 3F12B 2E7MA 1R3IH 1JN6B 3RX8A 2XFXA 1KB5A 3HUJF 4LCWA 4N0UB 3QIBA 1RUQH 1T6WA 4RMRA 1M05A 4G7VL 2Y7QA 4MGXA 3JWDH 5IBTL 4HIHB 4PJXE 5ICYB 4QRTA 1RVFL 3ULUC 1JWSA 1QBAA 2X70B 2IPTL 2NXZB 1ZGLM 1NAMB 3QZWG 3PG2A 1RZGB 4FFVC 2OMBA 4KMTH 4AM0B 3S35H 5HPOA 1IGIH 3C60C 5GGQH 4F57H 4L4VB 5CSZA 4NNPH 5FYLL 3SKJH 4L8BA 5T1MA 2VN7A 3BGAA 1T0PB 3UMTA 1NDMA 2PYED 4O02H 2ZUQC 3TVMD 1TZGL 2VKXA 3G6JE 2OXHA 2AEPL 3VXNB 1HCVA 3L3JA 2VWEE 2AV7B 4J3WA 3MLYL 1FC1A 4PP1C 3RA7L 4JR9L 1M71B 3VI4F 2GKIA 3NFNB 1Q0XL 1CD9B 2WV3A 4JKWA 1N26A 3RY6C 1J0KA 4ZFOB 5CJXC 5EU6B 3WFCL 1MCWW 4NZDA 4FQPA 4LBEA 4F33B 5A40E 3DRQA 5DHVA 3SDCB 2EEDA 1IQWH 1HXMA 4TUOA 1GGBL 3TBVA 2CRYA 3LKNA 4RFEA 3OKDA 3ESVF 3AAZB 4AL8H 3WDJA 3K81A 1WCBA 1YECL 2BDNL 2AW2A 2HT2C 3GRWH 3O6FD 3RL1A 3VMOA 1QA9B 4QWWD 1T0NB 1FDLL 1LO2H 2R2HB 1F6FB 2F8XC 4OGZA 3BWAA 4M7JL 4D3CH 4JFZL 3HC4L 5IEHA 4OBSA 1R3KA 3H6JA 1EFQA 5DJ2B 1MWAA 3LPWA 1MJ8H 3BAEH 3X12B 5HVFB 3OX8A 4BUGA 2DDQL 1XGUB 5GSVA 1INDL 1HINH 5E7BA 4MYWB 1A9EA 3MLUH 4NC0B 4G6AC 3V5KB 4N0YL 3CJJA 4CMMA 2ZJSL 4JFEE 4YHOH 1F97A 5JW3L 4M9OA 3HAEH 2NXZD 4FFWC 3L5XH 2ICWI 1CQYA 4IDLA 4FA8A 1IGFL 1FV1B 2A9ML 3K4ZA 2AXFA 1J12A 4QT5B 3OXSB 4PS4L 1XGTA 2H9GB 4M4RA 3TM6A 5E2JA 5F7KC 4KY1H 1U8OA 1AGCB 1XGYL 5CJ5A 2HFGL 5I1CH 2XTJE 3RVUD 1NC2A 4OM1H 3ILQD 4X80L 4RMTA 1Q9LB 2VITB 3U0PA 2R1YA 5D1ZA 4Z0XA 1WIPA 3ESUF 5IWLC 2VZTA 2X1WL 2DF3A 5GRVK 3CFBB 4C56D 2ED8A 1HH9A 3I6KB 2OQJA 3F7PC 1ZEAL 2MOVA 5J7CC 1BQLL 1OARL 2FBJL 3QZWB 2PNDA 4P4RB 1CD1B 1OTSD 2LFGA 4JPVL 4C4KO 2YK1L 5AD0B 4JJ5A 1W0VB 2UWEF 4NN5B 3FB7A 1T1XA 3L3OB 3TC9A 1W72H 3VW3L 3IS0X 2B2XL 2BNRA 2VDQL 4LGPB 4XGZB 5IFAH 4DGYL 3LIZL 5KS9E 3G5YB 2R0ZH 2DQEL 2OTWA 5IBLC 3GMPB 1CG9B 2ADJA 1RUMH 3MODH 3H9YA 1IKFH 1KB9J 3QDAA 1BOGA 2VQTA 2RCSH 5GGUA 5IMMB 4MDIB 5CEZH 4HS8H 3FCTB 3BUYA 3RTQC 4PJFF 3WDIA 2X4QA 1AFVH 3CXHJ 5L2JB 3T0EE 1DZBA 4DUVA 3RAJH 1PG7H 3RWIA 4ZO9A 3D85A 2Z91B 5T1DL 1U8JB 3ZYJA 1T1ZA 3VXOA 4PJGA 5MEOB 5JHDB 1ZGLA 3R06A 1CXHA 2BMKA 3D0LB 1KIRA 1JNJA 4FQQA 4JO2L 2OLDA 3QUZD 5D7LE 1UACL 3S34H 2YOCA 3REWA 5KVEL 1NBVH 2E9JA 1BEYH 4BQCA 4JZNA 1FLRL 3JWDC 4XP1H 4POZD 3TCXA 4JKPH 3FQRA 4TSBL 3PWVA 4KJQC 5EU7E 5IG7B 4PJ9A 1IM3B 4OAWA 3HI1B 3K8LA 1E4XL 3DIFA 1M4KA 1ZS8A 3KHOA 3D18B 4J3TA 5TDOB 4M7KL 3EYSL 5HI5C 1KJMA 1C1EL 4D9RE 4RA3A 43CAA 2NY1C 4Y0GA 5ERWB 4ZTOL 1LWRA 4RNRA 1NMBL 1JMZA 1QFWH 5D7IF 2ZG1A 3TIDA 2A0LC 1V3MA 4YHNA 4BZ2H 3K2MC 3IKKA 4RWYH 1INEL 3SN6N 2LU7A 4D0CB 1YC8A 4OZFG 1ITCA 3QHZH 4GXUM 5EUOB 4OQTH 3OKYA 1KXQE 3B8YA 3NPSC 5GGRA 4WUKL 4F7EB 5FYKD 4DZBA 3CFDB 3LMJL 3ARUA 4L3EB 4K94L 4QO1A 3AVEA 4N1EA 5DS8A 5GRJH 1Z9SA 4QRQA 3BIKB 2NZ9C 3HLAB 4Q6IC 4UTAH 3BP5A 1AIFB 5IB2B 1E27A 3MBXH 5EOCL 3HFMH 4Y5XA 2EH8H 4H88H 1IGMH 5F93C 1P4LB 4GRWF 3H0TB 5ENWA 3MRHA 4M8QB 5EO1B 1J0JA 5CZKA 3LRGA 4HIEA 4NQEB 5D70L 3D39A 2VDOH 3TO2A 1KCKA 3X13B 1KYOK 2C4XA 3IDIB 3SDXA 5H2BB 2EE3A 1NEUA 1J11A 2EIEA 5KJRL 2Q7NA 3SCMD 3CFIC 2O5YH 1CICA 3QEGH 4FQXD 1TQBB 4K3DH 4MD4B 3O2WL 1I9RL 4PJBB 1W8OA 2C1OA 4JHWL 3RWFA 4GBXB 3ZT7A 5ID1A 5A43C 2V7NB 4YXHH 4U05A 4KV5E 3ROLB 5AG9A 1Z6JT 2R56H 3LEYH 3T0WA 1JNNH 3D0VA 4ODSH 4J3UA 1A6TB 5JHDD 4MNGE 1S7XB 4OTXH 4Y4KB 1LE5A 2P5WB 2EIZA 1A2YA 3BH8A 1NFDB 1NSNH 1A5FH 3P30H 5J6HB 3F5WB 2DIJA 3BRGC 1Y18B 5F9WB 5I1IL 5BRZB 3TF7C 3HE6A 2V5SA 2R8SL 2XQBH 2ARJQ 2JJTC 1AD9B 2QADC 2HG5B 5T3XD 4DVBA 4R4BB 2XKSA 4J4PA 1ZOXA 3Q6FA 4YHLL 4UQ3A 4WWKB 1KJ3H 1F90L 4LDLB 3U83A 1UWEH 3KPRA 1OGAA 3O41A 3FRUB 1TXKA 2YD1A 2DLIA 1CFVL 3DSFL 4FP8H 1LQSR 1MLBA 5FUOL 2AJYH 4OFIA 4JM2B 4K07A 4F8QA 1VSCA 3GJFK 5E24E 4OFDA 2F74A 3EZ8A 1YJDL 1MH5B 3HUJA 3SKOB 2ICWJ 3SDCC 5EA0L 4UT6L 1RMFH 4LLQB 5CGYC 1JMXA 3S96B 5JXEC 3DMMA 5TFSH 5L88L 5HBBA 1QSFA 3FAWA 4JFFB 5IK3A 1A7PL 2E7HA 2X9XA 4G7VH 3WHXA 1UM6L 4L8CB 1R6VA 2BNUB 3ECBA 4XWOC 4XH2B 5EC2B 3DTXB 3SDYH 4NQED 4OZGA 1RVFH 1DL7L 4HK3N 3MNWA 1EHNA 2A6KA 2Z8VC 4HH8A 1MCCA 3WNLA 3KPOB 5GHWL 1A7NL 4OZFB 3QWOB 3BFOA 1KLFA 1H8SA 1AI1H 3JBG7 4J8RA 4M8VA 5IVZA 2X4NA 4XX1E 4HCRL 5J9PA 3Q48A 4U1SA 1N5AB 1JP5A 2DLGA 5FYLH 1L4IA 3RPKA 3VG0L 4GBXD 4X7SH 5I1AA 1FG9C 5KAQG 2KQNA 4UDUB 4TOYL 5KZCB 4Z7UF 2EYTA 5EU4A 1LO3L 1RSFA 4ELMB 1AD0B 2AEPH 4NYLA 1NGQL 3EFFB 2GFBB 4OB5L 2LAAA 5KSAC 5DWUL 4Y4KD 5FUCE 1P69B 3DVNB 2P5WD 3RA7H 2JTDA 3CIQA 5IKCA 1LEGB 2FJGB 1P7QA 1Q0XH 2FB4L 5D1XC 1WEJH 1LEIB 2K7PA 2HFTA 1KG0B 2DM3A 1CF8L 1S8DA 2F5AH 2AJXH 1UWXH 5I73C 4CDGC 2ZCHH 5ESQB 5DRNA 4ZAKB 3TZVB 1AKJB 1TJHH 3RVWC 3SGDH 3MV9A 4ZXBA 4NGHL 1KIQB 4BFIA 4MHHG 3PHSA 2HMID 1FO0A 2X44D 4QYOB 3T2QA 4WWKD 4HS3A 4PREA 5T1KB 3D3VE 3DO7B 5T3ZL 2W0KA 1YQVH 4UQ2B 4LLVB 4QNPF 3HC0B 1A1OA 3H9ZA 4AEFA 4U1KA 4S0SD 4XNZB 4LPUA 2R2EA 4PRHB 2B20A 3HPLA 4L5FL 3SE3C 3P4MA 4M7JH 1UC6A 4NN5C 1BM3L 4GKZB 4JFZH 3HC4H 4MXQD 1MHCA 4GT7A 4KQ3H 3CX2A 3U1SL 1NMAL 3MLXL 2R4RL 1EXUA 2MQCA 5CAYB 5CIPH 1CXKA 3BRDA 5H35A 3PGFL 1MLCB 2H32H 3S97C 3ABZA 2H45A 3MRLB 4GO6B 1RUKH 1UM5H 2ZNWA 1JWMA 4NHCL 4N0YH 1TFHA 2FD6L 5DDHB 1X3DA 4QY8B 2CXGA 5ECJE 2ADIB 3BT2L 3KYMA 3W11D 1BVZA 1BWMA 2B1AL 2HTLD 4W70A 5JW3H 3I6GA 1G9ML 3CPLB 3FFCA 5C0EB 1UXSA 5FM5M 4XNMA 2A6DA 3UTOA 2YD6A 2V2TB 4TSCL 1IGFH 1TMCB 3IDMA 3QIUA 3I2CH 3KPPA 2OJEB 4OI9A 3KPSA 4FQ2L 3M45A 3KPQA 3IXAA 3IB4A 3IF1B 5HHOE 4MXVF 2ZUTA 3ULSB 3PDDA 1G7IB 3V6ZA 4YBLC 3Q3GB 4OZHF 4LCYB 2R0LH 1QFPA 4YHKL 5FA4B 2IFFH 4XAWH 1TITA 4HWBA 2UZXB 5B4MD 5JW4N 5KZCD 2WBWB 2OJZL 2VTFA 2VLLA 4WO4A 4X80H 4PLOB 5IHLB 4GUPB 1INQA 1S7WA 1JYNA 4MA1B 4LNVA 3VFMB 3T3MF 5C0FB 2X1OA 3MOBH 3PQYA 2COQA 4HT1H 1ZEAH 1RUPH 1BQLH 1OARH 2A74B 5T5NG 3P0GB 1MCIA 4O2CB 1DTUA 2FDBP 3DROA 5E95B 2C7UA 3OHXA 4U1HB 5DJDA 1G0YR 1AGFB 4L9DA 2EH7H 3MQIA 2FRGP 4I3RL 4RMVA 2BC4A 5JPNA 2WQRA 3F7YB 2DIBA 4ZAKD 3BO8A 3FTGA 2AQ1A 5I9QB 5CP7A 4KVCL 3ZE1E 2DQJL 1DQQA 1FLTX 3VGHA 2B2XH 3QUKA 1JHTB 4PJFA 1Q9OA 4PJAF 1OVZA 3IJYB 1FCGA 2MKWA 1IFHH 2ATPA 3BN9C 3HCVA 4C83A 4H0IA 3VXRD 1LMKA 1NANH 4XXDB 5I8KL 4PRHD 3UTSA 1MCRA 4WENB 2HP4A 4YNYA 3WHE1 1EEYA 2JK5B 5T1DH 1OLZA 5B38G 1CL7L 4S1SL 2C3HA 2A38A 2F53A 3EAKA 4PJEB 1B90A 1QQDB 4JDZB 1N6UA 4LSSH 5TDNA 5GS2D 1SVCP 4JO2H 3IDGB 1TQBC 3CD4A 3DURB 4JQXA 1MAML 3O2DH 4ELKB 1FLRH 1K3IA 1SMAA 3M8OL 1CGWA 1KTKE 4TSBH 4C56E 2PF6A 4X7CC 1Y6NR 1YNKL 3UX9B 4G8EB 3VE0A 5DSCB 4O00A 4RAHA 3MBEA 5D7IA 4Z7WE 4WV1B 2O61B 4Q9RL 5JO5B 2XRAH 3UBXA 5GGSY 2IJ0C 1UQSB 2FH8A 4UB0L 5E9DA 4Z8FL 3DX7A 3TNNB 1NMBH 3MNVB 1JUFA 5FK9B 3NZHL 4OLWL 1G6RA 1G1CA 5E8NA 5DJ8A 1NL0H 1BBJA 3GJFA 1F02I 1UH3A 3NFPA 3N1FC 1ES0B 2V6HA 4G6KL 4KDTA 5D5MB 2X1PA 2F54E 2QQQA 2DB8A 3TO4C 3NIGE 4IBLT 4F15B 2NY4B 9CGTA 3FOMA 4RISL 4R90H 1IRAY 2VQ1B 1BQUA 5EOCH 1YEIL 1TJGL 4L9LC 4NNYB 1EAJA 4JM2C 2FJFB 4BSVB 4Y5YC 3VCLA 5K9OA 1EO8H 4N8CH 4X5XA 5F72S 4Q9BA 3OKEB 5JW5A 2XPGB 5IMLB 3WNKA 4FTVA 4PGEA 5KJRH 2R9HD 1GCFA 2VR4A 5MI0C 5EU5B 4YEFA 2NX5D 5C3LD 3VD7A 1I9RH 2CLZB 1MCHA 3O3EB 1CGSH 4JHWH 1WISA 1ZHNA 4L4TB 1B0RA 4WI8A 2I9TA 3W5NA 3SHSA 1IL1A 5E0QA 4JQVA 2ZOLA 3QULA 3VFOB 1U42A 3VXSA 1A4KB 2RQ8A 3FO2A 5HHME 3D25B 1QBML 1C5DB 4LKCB 2RB8A 3LAFA 1JK8B 3OJDA 3QNZA 1FVDB 1KGCE 1I7UA 5J12C 5I15H 4WI3A 1T1YA 3GIZL 3MRGB 3AS0A 4NZTL 3FQTB 3ZSSA 5LKNA 2Q20A 1QG3A 1N6VA 3WN5A 5I1IH 3T77A 1CDBA 5D2NA 4M5YH 3SJVB 3DXAA 5I1EL 4M02A 2FSEB 4PGCB 5LGJB 4P2QE 4BYHA 4ZUTA 4KK5C 3MLZL 3VRLE 1LE9A 2Q6WA 4N5UA 4UINL 4DOHB 1QRNB 3SEPA 4GKOA 1UB6A 4PJ8A 1F90H 5B38B 4H1LG 5AUMA 2OK0L 3ZHDA 4X8JA 1DVFB 3HG1A 3R1GL 4JG0H 2GY5A 1CFVH 4RAVB 1FFPB 2XG5A 5D96B 4DGVL 4JFYB 3WS3A 1TVHA 3NTCL 4Z77B 1J1OH 3MRQA 1HHGA 5ICXB 1X5ZA 1K5NB 1FHGA 1YJDH 3I84A 3TZVC 4MJIB 4PUBL 4ETQA 4HC1L 3K3QA 2NY4D 1IAOB 3SPVB 4IS6A 4LSRL 5HHNB 3EOYG 4YHPB 5L88H 4YZFF 2XTLA 3NCCB 1F11A 4NN7B 4PG9B 4AEHH 1A7PH 2ENYA 2VISB 3I02B 1GRWA 4YPGA 5B8CC 2PW1B 3D87B 5H94B 3MRIA 2OTUB 2P8PA 3O2VL 4Y1AB 3QT2A 4HHAB 4XCEB 5DC9B 1KENH 1KJ2L 1QRKA 3THML 2LVEA 2HT4C 2OXGA 1T7VA 4HLJA 1X5LA 4M93B 4LPCA 4MQTB 4L8SC 5D2LE 3PIQB 1JNLH 2EDYA 1J0IA 4RFNB 4QXGH 4ISVA 4M62L 2BOBA 5IMKA 5DI8A 5E8EA 5TH2B 3GSOA 3E6HB 3PDOA 2P5EB 1AO7E 4PJ7E 5T3XE 3BZDA 4L4TD 4L29B 3VXMB 4MS8D 5LXGL 1EH9A 5GRYA 2I9LA 3DECA 1Q72H 1HQ4A 1MVUA 1MUJA 4UUJA 1FVEA 1NGQH 4QHLB 4JY6B 4XNUH 1I7TB 1EBAA 2HLFD 4ZUVB 3B2VL 3ZHKA 2A6IA 5MEND 1DN0A 2YA0A 4ENEC 5J1TC 3QEQE 1ZXQA 2FO4B 5CMAA 1HQRB 3O4OC 2EDFA 3FB5A 2Z4QA 3T0VA 2YN3A 3SJVD 5C70A 3KPTA 1FORL 2EEBA 3V4UL 4XP5L 1XCQB 3VFSA 2OR9L 4I2XB 3S5LG 4KROB 5H37H 2VWEC 4GG6E 3CC5A 3BOVA 2QBWA 3F7VB 5D7SL 3EOAA 5FOBA 5D6CB 1M7DB 2XI9A 3VGGA 2DQGH 2XYCA 2G9HA 3CVHA 2W0PA 1JV5B 3PHOB 1T83C 4X6BB 1DVFD 4FG6C 4BA8A 4ORGB 2DLFH 4LLAA 1GIGL 2G2RB 4XVUC 4X9HA 2GAZA 4PY7B 4L5FH 5DFWH 4DN4L 1JZ7A 5GZND 3DETD 1BM3H 3DUHA 3U1SH 1DLFL 3TJEL 4X6DB 2WBJB 3UPRB 4ZFGH 5T3ZD 1KOAA 3KLDA 3SKMA 5GGTH 3TJHD 3FRPA 2FEEL 1LO5A 3WD5L 4H1LB 3EYQC 4WWID 2VE6A 5MEPA 1NUGA 4NQDA 5J6GA 3BT2H 2IPKB 2H1PL 4MA3A 4OD3L 4PJDF 2B1AH 2VR9A 2YPLB 4ZUSA 1GGTA 1W0YT 1G9MH 4HJGA 2K7QA 4ODWB 1QACA 5C0CB 1X5KA 2RAMA 4RBPK 3DPBA 1C16B 3ETBF 3JWOL 1Z9MA 5SWZD 5GS1C 5A16B 3QB7C 4FQ2H 5CZVH 4OZHA 1D6VH 5F1NA 3AM8C 4EDXB 1LILA 5EG6C 2PKDA 4PLKD 1LK2B 3SE8L 3VFRB 4P3DB 1QLRA 4YHKH 4NSKB 1QFUL 3EFDH 3UTTB 1WFUA 3WKML 5EC1A 2LVCA 4HKJB 4XPTL 1MFBL 4OKVA 2FHCA 2JCCA 4QRPB 3QAZB 2IPUK 1KN4L 3Q5OA 4YWGL 4JANB 2GJZB 4RA0C 5DO2D 1DSFH 4IRJC 1GGCL 3CDGB 4JZOA 5CBEA 3IXTA 1BQHA 1A6WL 2XTJC 4YHYB 2V9QA 5EWIL 4I3RH 1FNHA 3RVTD 4XBGB 2R29L 5KS9F 3ARDC 5IM7A 2I27N 5BOPA 3GUTA 4MB5A 3BZ4B 1D5BA 4RQQA 4EOWH 1N64L 1ZK9A 2BVUA 3QFDB 4F15C 5HYSA 2DQJH 2I24N 5CLTA 2YPVH 5L6YH 1EVUA 4U7KA 1L0QA 1QNZH 3ORJA 15C8H 3QDGB 4PD4J 2EXWD 5ACZA 1KXVC 4XP4H 3F6LA 4NO5A 2DQDL 2YN5A 4WEBL 3DV6A 5EIVA 3W0WE 1MCDA 3BP4B 4G43B 1NDGA 3DVIA 4LK4A 3DVGA 4U31A 4CN4A 2HLAA 3UJTL 2ICEB 1P7KB 4OFYA 1CL7H 1AJ7L 3WDHA 4S1SH 3S7GA 4DZ8A 1A21A 1VEPA 1NLBL 5DUBB 1F6AB 2WBJD 5DC4B 3S5LB 3IAQA 4HEME 4Z9KB 2PW2A 1ED3A 1A6VL 1OGTA 5T33L 1V8HA 2VXTH 3KXFA 5A2JH 4G8GD 2VZSA 5JHLL 3IDYC 4I5BA 5L8LB 2OL3H 1Q94A 4BK4A 2CK0L 2YPLD 1WT5A 4IOIA 1YN6A 3ARYA 5C0CD 2CLRB 2XWJB 3EJJX 1CGVA 3DWTA 2DI9A 4GKNA 1AXTH 3N85L 4W6YB 5IVNA 1MQKL 5E00A 2J7LA 4Z8FH 1Z9OA 1I1AA 3D2UA 5CSZB 4D8PB 1RFDH 3E2HB 3NZHH 4OLWH 3MO1B 5FO7A 5EU7C 2WLYA 2DWDA 3TBYA 3HR5B 5HHQA 2B0SH 4AZ8A 4POYA 1JRHH 5JZ7C 1AHWB 1JWUB 3DX6A 1G7MA 4MVBD 5BZDA 4Y2DB 1K2DA 2A1WL 3BPLB 3UTTD 3DGGB 2QTEA 1FP5A 3VXRE 1VPOL 3GMMB 2YUWA 3KR3L 5F1OB 4KI5E 4QRPD 1SM3L 3TN0C 5JA8B 4QOKB 2Z31B 4Y4FD 5HHPB 5A2IH 5C2UB 4YDKL 3L3HB 2VLKE 1WBXB 3UTZA 1GOFA 4YO0B 3SDAA 3WFDL 1GHFL 5EO9B 2XXMB 3QUYB 3AS1A 3Q5TA 3HI5L 1PSKL 2G5BA 2R0WH 1LO4L 4OF6A 1CE6A 4M43L 5D7JC 2ADGA 4LNRB 4BELD 3BKMH 5KSBE 3EHBC 2V7HB 3QWRA 3K1DA 5GS0D 1D6EB 4MNHA 2Z35B 1A7RH 3BEVB 3QDGD 5GPRA 3U9UB 4NN6B 4LAQL 3X14A 3IAPA 43C9A 2EDNA 4FQJH 4H25A 1OP5H 2F19H 3V7AE 4FABL 1KJ2B 2AK4A 4LLMA 3C6SA 5E99L 5F9JB 5DQDL 5AWNH 3MXVL 2DQCH 2HVJA 1QBMH 2GSIA 3PGDB 2YXFA 3MRCA 3CDCA 2VNCA 2X5PA 5E94A 1LEKA 3QIBD 3VMPA 3CMOL 4H5SA 3GIZH 4LCIL 4CGTA 1KV3A 1ETZA 3ROOA 4MAYC 2LV4A 1T04A 2YSSA 1B4RA 1JPFA 1S7VA 2V5MA 2VXVH 5FGBC 4N0FA 3T4YA 1MCFA 5JOEA 1ZMYA 3ARSA 5D93C 3KPMB 3PJSA 2BVYA 3LS5L 2WIIB 1T66C 2ITCA 1ZGLP 3UJJH 2OK0H 2C4FU 1MREH 3VFVB 1R5IB 1MY7A 2C5DC 4X9BA 5IW1A 1S9WB 1JPGB 1KLUB 1U8OB 4KKCD 4U1MB 4O51A 4FFYH 4JE4B 4Z7VA 4IIQB 5I71C 3RZCA 4JDVA 2F54B 2NX5E 2R1YB 4Y2DD 3KYNB 3P9LB 3O11A 4BKLA 4KROC 1YEFL 1KPUA 3KDMA 3TBWA 4HC1H 1J86A 1RZIA 3EYFA 3TYFB 2NY2B 4OCRL 5MHSD 4LSRH 2Z31D 3PXHA 4QOKD 4M03A 3JTTB 1KCUH 1I3RB 2HTKD 1NCWH 5KG9A 4M61A 4KGLA 4NQSB 3QUYD 4MX7A 2D7MA 1OTUD 5AAWA 4HXBL 5I18L 3O2VH 1I1FA 5DR5H 2MPAH 1T22A 4LLWA 4WDIA 3C8KB 4E0RA 4PRDB 2H2PC 5J4MA 2BNRB 2J6EL 3SKNB 2XQYG 1G7PA 4RX4A 2OTWB 1UA6H 2XA8L 1CDUA 2VL5A 4M62H 4NQUA 1XIWC 1BECA 2FHFA 3BUYB 6FABH 1TDQA 1CN4A 5TQ0L 3F8UB 2KL6A 3QFJE 5LXGH 3KPLA 3RUGE 3GSQA 1RURL 3WLBB 32C2B 4JN1L 2FWOB 5HY9A 4EBQL 1ZGLB 1P6FA 4FQHB 1EEUA 2BMKB 4U1GC 4G3YL 4UNTA 1EPFA 1ZWIA 3JUZA 2BSTA 1JGEA 3SGEH 1RIUL 1ITBB 1U2HA 4H20L 4WJ5A 1S7RB 4HFWB 4GXUN 3J7HA 5CZXC 3DOSA 1JTTA 2OSLB 1U58B 3AB0C 1P4BH 4Y5VA 4DCQA 1FORH 2NYYC 4EKXA 3DIFB 2BSSA 2NW3B 4XP5H 3LPGA 5CJ8A 2OR9H 3FT3B 4E42A 4P23C 4PRAB 3LKPB 3NIDE 5EO0A 3X3GH 5FUCC 2W65B 4ACPA 2EYRA 2DQIH 4IMLB 4PV8B 4NPYB 3U6RB 4WU7A 4YHNB 3VJ6A 2EICA 3QUML 1B0GA 2BNQA 2VDLL 4HWZA 3V52L 2LAGB 2LQRA 3TIEB 1S7TA 1NC2D 4YHMH 4DN4H 3ARFA 4WCYL 5DC0A 2Y6SD 4P2RE 3TNMA 1FH5L 1MNUL 3C08H 5K9JH 3W2DH 4LHUG 4QHMA 1FNEB 3TJEH 4XZUB 3ZDZE 3VFUB 3ARBB 4YBHA 3FQWA 4NQCA 2NY2D 4OZIB 5K33A 3CMGA 5B22A 3RL2A 1S78D 1FL6B 5DMIH 3GSVA 1N0XL 4EUPA 2F58L 4PJDA 3VGBA 3OKLA 3EGSB 4RRPA 4XPHL 4K8RL 3WD5H 4LRNL 1BREA 2GJ6B 3L7FA 3TO2B 3SDDB 2PCPA 4LLYB 4OD3H 3U7YH 3U0TA 4CADA 5MENE 3KPNA 4M48L 4HWEL 4LEOB 1FZJB 2BNRD 4JO1L 5FKPB 3U46A 1PQZB 4EI5B 4EJ1C 3TVMC 4J3SA 1ORSB 3QIWB 4HQQL 4BH8B 3SBWC 3JUYA 4YGAB 1VKXA 2JIXB 3EJZC 1GPOL 4I4WA 1MJJB 3SE8H 4HSQA 3SGJA 4WUUA 4P2CG 4Q0XH 3NCFB 2WWMD 1G1YA 2G60L 3V0WL 5I1GH 4XPTH 3QUXB 3O3AB 1EGJA 2HJKB 5C0GB 3FQNB 1XGRA 4S0TD 1J8HE 3GI9L 3H7LA 3ZT6A 4JFDA 4R8WH 5C0JA 4LVNC 4EDWL 2HN7B 4V1DA 3MLTA 4UDTB 3IRPX 1WV7T 3WFZA 2W38A 2X4SB 2QQLH 3M1BB 1WLHA 1JGDB 1BZ7B 1A6WH 1S9VA 3CFKA 1HHHA 4H26B 4ONGL 3BZEA 1FIGH 3FFDA 4PP2A 2Z9TA 5IBUB 1AHWC 4ZODA 1IGCL 2PXYC 4OCNC 3CU1A 2MHAA 2FR4A 2PO6B 5I1LB 4GQ9L 3K4DA 1PEZA 3IFNL 4HLZG 1OWWA 1K8DA 4WEBH 3PXJA 4AENA 3C5ZC 5SWZE 3RDTC 5CCKL 3KNBA 5IQ9B 2A77L 1OP5K 5FUZH 4FNLL 5C0RL 5J1AA 2WZPD 1I85A 4UI2A 2EKSA 3GNMH 3I9GH 4JAMB 3RNQB 1AGEA 3MFFB 2AP2A 3WLWD 2NNAB 3ARBD 3KJ6L 3OAYH 3V6OE 4P5MA 5L9DH 4ZFFB 3ZTJG 5DK2B 3QXDA 5ICZA 5ADPH 1XGQB 1R5WB 1HDMA 2DYPB 5JHLH 4P46C 5F70A 1Q1JH 4JY4A 1DJSA 1OB1A 3JTSB 3SDDD 4ZFZB 2QQNH 3C6LA 4YQXL 2CK0H 4JFQB 5K9QI 5C07A 4CVUA 1ZT1A 4Y19E 2EDJA 4BQBA 4U2YA 3TFKD 4EI5D 3P4NB 3VRJA 4F80A 4YK4B 4YDJA 3S4SA 2DJUA 3MCLL 5JMRA 5FGCE 3OR7B 2X4OB 4KTDH 4DKFL 4PRPE 2C1PB 3STZA 1AXSB 4WW2B 2CUMA 4NRYB 4NBYB 4TQEL 3LV3A 4LSDA 3L1OH 2JIXD 4GKSB 1XT5A 3MFGB 1CT8B 4BSWB 3QJFA 1WBYA 4JVUA 4Z95L 2A1WH 5HYIA 3UYPA 2DTSA 4ZQKB 4G42A 1XGPA 3F62A 3C60A 5HYEA 1FFRA 5DK0A 3QHFL 5IF0A 3V7AG 4DN3L 1NCDL 4KH2A 2ZNXA 4AMKL 3HZYA 3GK8H 4WNQA 3O4LA 5CBAA 3WFDH 1GHFH 1LNUA 4ZYKA 3U79A 5HGBA 2ID5A 4R2GB 4QLRA 3HI5H 2CIIB 4IIQC 2DJ4A 1LO4H 5TE6H 5F1IA 2YR3A 2YD3A 2KPNA 1BIIB 4XBEH 2EE9A 4EXKA 4G8GE 4J4PD 1WC7A 5HI4C 4L3CB 2VXUH 5DD5H 2HRLA 3ARGA 4QCIA 1OGAD 3BVNB 2G75B 2J88H 3RY6A 1JL8A 2PO6D 4LAQH 5CJXA 5ANME 2ZOKA 2PTTA 4MJ6A 4OM0L 3L3DB 5ACLA 3UYRL 1A1MA 4MCYA 2FNBA 3NAAL 3ES6B 4DKAA 1A9BA 2A73A 4FABH 1S5HB 1P7HL 1RJLA 2WINB 3H9SB 1TVBA 1F2QA 5JW4Q 2DM2A 1OCWL 1VFOA 1BHGA 3U4BL 3KYOB 1ZLSH 1K8IB 4U6VL 3WSQL 4HGWB 3BUTA 1NGXA 4S1DD 1HZHH 3S8WA 1U8MA 1QSFD 1HKFA 3QPQD 3CMOH 1IKNA 1DUZA 3QQ3B 5J11C 5SX4I 3QXTA 3GI8L 5L7XL 1ZVYA 3OQ3B 2MKLC 1FNLA 1K4CA 3FFCB 4U6HB 4XPAL 4JO4L 4JRXE 4MXWH 5DGQA 3EUUA 3MV8E 1P1ZB 3OG4B 5HGHB 1Y0LA 4A6YA 5E8DL 3GB7A 2V5RA 3LS5H 1YPZB 2DD8L 2OP4L 1PZ5A 3EDDA 3IAGC 3MTRA 3GJEA 1IC4L 3MRMA 4YFLF 1FZKA 3GSUB 3TCLA 3OGOE 4I0PB 3MRBB 5FO8B 3EJYD 3U82B 3QEHB 5DD6A 2LTQC 4FXKB 2VLLB 3TBTA 3FO9A 1S7QB 4YE4H 3TA3B 1D5XB 3UBXI 3HTLX 1YEFH 5HYFA 1JGUL 4FZ8L 2XWBA 5HVWA 1LDPH 3PWNB 1P6AB 5K59E 3PL6B 3RWGA 5ALCL 1BZ9A 2APBA 2VABA 5K9KA 4X6EB 3QUMB 2C7UB 3O0RL 3U7WL 5DJDB 2Q86A 5FECB 4UV4H 4FQXC 4HXBH 5EZJA 5I18H 3MRJA 3QG6B 1YA5A 1D5MA 1NH6A 4N9GB 3QH3B 4LCWE 5IHUH 2VLJB 3MV9D 1J0ZA 2A6JA 3WJJA 4XPBL 4NRXA 1HHIB 1NCBH 4KZDL 4NRZA 1LVEA 5F7EL 4P3CL 5DEGB 5LBSL 4TYUA 1FPTH 3DUUA 4CMHC 2IBBA 1AP2A 2LABA 3GDBA 4K7FA 3RWEB 1SY6L 4ZMAT 4HKBA 4RGNE 5LCVL 3U7AA 3L3IA 1YEKL 5ETUB 5FO9A 4AY0A 3BP6B 1RULL 1MFCL 2H41A 5EUOF 5JA9A 4HLZH 4GG8B 3H9SD 3MJ7A 3AU1A 2P8LA 4MA8H 4JN1H 3TLRA 3BXNB 1MJ7L 4G3YH 4R3SA 1CLZL 2PR4L 2FIKA 4RGMB 3QIWC 4PJHB 5D1QB 3WEXA 1CS6A 1UCBH 1VACA 1YEHL 4H20H 4JGJA 4JREB 2B1HL 3B9KB 1FFNA 3IVKA 4JFHD 1P5UA 3FFCD 4U1NB 2NR6D 5FKAA 4MD5B 3RWCB 3QUXC 1BP3B 3KPSD 2VZUA 3KLAA 2AI0L 1PY9A 2VDRL 3REVB 2V5YA 4R26L 5E8NB 4PJBF 2H6PA 5D7KE 1WIOA 2VDLH 3V52H 2BZDA 4CU8A 2JKXA 2CR3A 1N3NB 3DX8A 3L95B 3O9WB 4WO4D 4HUUB 5CUSL 1MNUH 3TA3D 2OYPA 3DVFA 2W91A 4KKAD 3CSGA 1X4XA 3MX0A 5GIRB 4ZG1A 1AGDA 1T0MA 4TPRH 3PL6D 2D7QA 5IJVA 1N59A 3EDFA 1M6OA 1NFDF 4N68A 1CU4L 2F58H 4LGSB 4Z18A 4XP9H 4I1NB 1OSZA 4LRNH 4F7PB 3GO1L 4UAOC 4R4FL 4ZUUB 2Q8AL 4B41A 5CFHA 2ZUYA 2VLJD 4LQFL 1P84K 4PLJD 3CAFA 3W39A 3L9RB 1MCPL 5JUEL 4OCSH 3MJ9A 4TVSa 2N56A 4X99B 5INDA 1HEZB 1I4FB 2KBGA 1SJEB 3PWJA 3QCTH 3QQ9D 4HQQH 3N1GC 4K8RD 1CDHA 1U93B 3UTSD 3S88L 1ACYL 3FONA 1FNGA 3V0AC 3F12A 3WUWG 1G0DA 3QO0B 1JN6A 2R23B 5DJ0A 4PJCB 2G60H 3FKUS 3V0WH 4GMSL 2F53D 3NIFF 3GRWA 4N0UA 3LKOB 2F8VA 3P9MB 5EBLA 4WU5B 1HCFX 3HRPA 4LPVA 2VXSH 5D1QD 4HIHA 1BD2B 4WW2C 1KYOJ 2V17L 5ICYA 1BOYA 3DARA 2Y72A 3RHWK 3CX5K 3T77B 2X70A 5E08H 4TUKL 1QVOB 5I0ZA 4ZUTB 5C0AB 3VWKC 1RZGA 1SBSH 3K2UH 4L3AA 4C54A 4TNWK 3OTTA 4L4VA 5E9DD 2P7TB 4Y4HC 1BJ1J 1IQDB 4PBXA 4GQ9H 4PJ5B 3IFNH 5IHZB 4N0CD 2NY5H 1L6XA 2JJTA 3VXNA 3HE7B 2HYMA 2QSVA 1FL3B 3IDJA 2EXYD 4PTTB 2AV7A 4S10A 5C08E 2A77H 5C0RH 5CJOL 4F2MB 4ELMF 4F3FB 1M71A 1E6OH 3CFCL 3H8NA 2M1KA 3NFNA 3KJ6H 4F7TB 4NWTL 3HZMB 1D9KB 12E8L 4P2OB 1IEBB 1EVTC 2P24B 4ZFOA 3FZUC 1ULVA 4PJGE 2WUBL 4YBQC 2APTA 3E3QE 5EU6A 4NKIH 4F33A 3MRIB 3QJHB 2CRIA 3SDCA 2VMFA 1S9YB 4NQTA 4CVZB 4YQXH 5IQ7H 5GGVH 3EO0B 1P2CB 2ORBL 5F7DA 3AAZA 3BZFB 4FTVD 3FT4B 3TV3L 3EDKA 4Y2OA 1A7QL 1MVFA 3MCLH 1QA9A 1T0NA 1N5YL 1AQDB 2AK1L 2R2HA 4WFGD 4TQEH 4OT1H 1CGTA 3T2NH 3VXTB 1IAKB 3K4AA 5GQBA 2M26A 4NWUL 4NZUH 5GJSH 4QF1B 4TNVF 4E5XB 5DJ2A 3WJLC 4Z95H 3X12A 2VXQL 1FVEB 2E7LA 1XGUA 2EDRA 3OKKB 3T2OA 4GSDL 3BSZL 4RMQA 3V5KA 4LF3B 3CVIH 1FNSH 3JV5A 1N7ML 3RRQA 5A3IC 2L7UA 5LGHH 1QSEB 4I0PC 3DXAD 3RNKB 3RWJB 2YBRB 3RVXC 1A6ZB 5GGVY 1V3LA 3E6FB 3MUHL 2AXJA 3SGKC 3AUVA 5C0AD 4HX1B 4LIQL 1FV1A 1OT1A 4WTWA 4OI7A 4OZ4B 4KI5C 2QQKL 4ODTL 4QT5A 4PJ8D 4PRIB 3WUWB 3OXSA 3NGBB 1NGYA 3QDJB 3D39E 2CR6A 2H9GA 4OIBA 1IC5L 4DKEL 4UBDD 3WXVL 3HG1D 4NC2B 4PB0H 3VA6A 3SDXE 4EVNB 2CGRH 1AGCA 3BEWB 1T1WB 1MY5A 1B88A 1U36A 4OM0H 3HNVL 4MSWB 1A6UH 1Q9LA 2VITA 3UYRH 4DK6A 3HE7D 3NAAH 4O4YL 4WTZG 5DJ6B 2MTPA 3EYUL 4XC1L 4KI1A 3CFBA 1FL5B 5J3HD 3I6KA 4PBWD 4Y8AA 1OCWH 3MPCA 3U4BH 3QZWA 5DZOA 4P4RA 1CD1A 3DV4B 2DIAA 3MGOB 1D9KD 4YDIH 4P2OD 4U1IB 4OQTA 2IH1B 4AEIL 1LO5B 1YMMB 4CRPA 1W0VA 3HZVB 3SE3A 2PN5A 3BN3B 5CWSB 1KC5H 3L3OA 4UT9L 1PYWB 4HPYH 1EX0A 4Q74A 3U36B 3GI8H 4NO3B 4BQ8A 1GC1H 3LQAH 4XGZA 4XVJL 3QP3A 2QLVB 1T5XB 3BGFB 4E41E 3G5YA 5KAQF 3GMPA 1CG9A 5D8JH 3VFWB 3VH8G 3VU2A 4JHZA 5DD1L 5IMMA 4MDIA 3IJHB 2BK8A 2AGJH 5L2JA 2VO5A 1A14L 4TNVK 1S5IL 4HAFA 3GSNL 3B9KC 3WFEL 2Z91A 1GAFH 1U8JA 3BW9B 5MP6H 3KPRE 5MEOA 1OGAE 5JHDA 2YHGA 5ESVB 1ZLVH 4WGVB 4HIJB 5F9DC 4TVPE 3D0LA 1EHAA 1BJ8A 5JR1L 3WIIL 5HSFA 2EE2A 4PJEF 5FYKU 2X9WA 4FHBD 3L5JA 1DEDA 1EV2E 2VDPL 1ZA3B 3ALWA 5ALCH 3HUJE 1J10A 5IG7A 1IM3A 3O0RH 3HI1A 4Z7NF 2AABH 2ZCLL 5L2KB 1Q9KB 3D18A 5DJXA 5TDOA 1QSFE 3O9WC 5HI3D 3NCMA 5ERWA 1GL4B 4TULH 5E2WL 5I8EA 4KZDH 1RIVL 2ZG2A 3RVVC 3VG9C 1A6PA 2P45B 3QDJD 4OZGE 4P3CH 5EOQH 5LBSH 1UWGL 4XWGL 4D0CA 2Z93B 4IRSC 4OF7A 5EUOA 2NY5C 4F7EA 5LCVH 4K3JH 3NN8B 1YEKH 1DN2A 3CFDA 4APQB 4L3EA 25C8L 4WEMB 1RULH 1MFCH 3UJIH 3EO1B 2HLAB 3BIKA 3B3IB 4WVRA 4MNQB 2VAJA 3HLAA 5D5MF 2QSCH 4R0LB 3EDEA 1A3LH 1AIFA 3MCKB 1RZ7H 5IB2A 1CLZH 2PR4H 3VGAB 2AJZB 1P4LA 4XMLL 3H0TA 5FEBA 3GMNB 4M8QA 5EO1A 2VLRB 5IV2B 1YMHB 4NQEA 3VI4E 4J7RA 3WIFB 2IG2L 3X13A 3IDIA 4DQOH 4NQDD 5H2BA 1Q94B 3GBLA 4I18C 2ZSWB 3ZYIA 2E6PA 3GHBH 1CYGA 4MD4A 4PJBA 2VAAB 2WWKT 2AJ3B 1J0YA 4X4XB 1S3KH 4UU9B 4GBXA 3MNZB 2ZKHL 1HH6B 3HNTL 2V7NA 3MV9E 2ENSA 3ROLA 4GW5B 2CUHA 2DWDB 2GTWB 1XR9B 4MJ4A 5I17B 3MA7B 2IAMB 4HJJL 2ZSVB 2Y06L 1A6TA 1S7XA 5T5NF 3ULVL 4Y4KA 1HILB 2P5WA 1NFDA 4K23H 1QTYT 5E56A 5C0IB 3BYTA 4JPWH 3MR9B 4WFFD 1OAYL 3F5WA 1Y18A 4O2FB 2RR3A 2J8HA 3CLEH 5BRZA 3VH8B 1CU4H 3EYOB 4P4KB 1AD9A 1X4ZA 5L2KD 2HG5A 2DTML 2B8OT 4R4BA 4WWKA 4DGIH 4KRMB 4FQ1L 3U48A 5JDSB 3FRUA 3FT2B 5GS3A 3D5OF 4YIQB 3AGVA 1IAII 1H5BB 2NXYB 1EJOL 4JM2A 3ILPB 4JZJC 2J4WL 1IZKA 5I1KH 2XICA 3S88H 3CFEB 1MH5A 4GFTB 3SKOA 4XVTL 4LLQA 3KPSE 3OJMB 3S96A 3TT1H 1Z0NA 4OFYD 1CFQB 1JGLL 4Q58C 3SOBL 1G84A 4GMSH 4NBXB 2X10A 4JFFA 2XY1A 4U1LB 4LASL 2DQHH 2EDDA 2BJML 4L8CA 5FCUH 2YUXA 2ZWLT 4XH2A 2VLRD 4Z5RB 4AG4H 5EC2A 3DTXA 3ULUL 4X98B 1ZA6B 2GCYB 3KJ4B 3HKFA 4O2EB 1F6LL 4J2XA 3KPOA 4LCCC 1SEBB 3QWOA 1GC1C 4OZFA 3LQAC 3PQYE 5IVXB 3FB6B 4TUKH 5IP4A 4KUCF 4M5ZL 1R3LB 3QCUL 5MEQB 3DRTB 1REIA 4XMPL 5KTEH 3MV01 2CLVB 1N5AA 1VHPA 3W82A 4KRNA 1ZSDB 3D2UD 4NCDA 1MPAL 2C3GA 1JZ2A 4UDUA 4X6CB 2ZPKL 4F58L 2XZAL 1DQMH 4ELMA 1AD0A 1QPPA 4Z7VB 3ZKMC 1KB5H 4PJFE 2IAMD 2IBZY 3EFFA 4NCC1 2GFBA 4CJ1A 4DUWA 3BI9X 4JGMA 1DFBL 3O11B 1W8NA 3DVNA 5HGDB 3KDMB 4NCC2 5JW4R 5TE7H 3GHEH 2W0FB 2N7BA 4YDLB 4F37F 3CFCH 3UTSE 4K7PY 2FJGA 1F58H 1U2CA 5JOFB 1LEIA 1KG0A 4M61B 1EK3A 2Y36L 4KJWC 1OAQH 4BZ1L 4UV7L 2F53E 1I8LC 3W9EB 1UGNA 4R4ND 5ESQA 3GBMH 3TZVA 4AIXA 1U8IB 1AKJA 1I1FB 2ESVB 1KIQA 4OIAA 1VENA 5IESH 1WK0A 1T21B 4QYOA 2I07B 4XP6H 3QWRD 5T1KA 3DO7A 3V6OC 2CH8A 1EBPA 4UQ2A 3OB8A 4LLVA 4UIMB 3HC0A 1QLEL 4UILL 1MCQA 4NC1E 1ZTXL 2SEBB 1KCLA 5JIKA 4Z7OE 5JXAL 5C09B 4PRHA 1N5YH 4RZCB 2D4DA 5D7IE 2HA1A 5C86A 4O5LL 3S37L 4GKZA 2KDGA 4NWUH 1FFQA 4HBQA 5E9DE 2P42B 4Q97A 4GXVH 2AK4D 1T2QH 2QV2A 2VXQH 3OV6A 2X9YA 3MRPB 4MA7L 4ONHB 1M7IB 3MJ8B 4KK6C 4U7MA 5FOJA 4A6YL 3QNXB 3QI9B 1PEWA 1MLCA 4GSDH 4C59B 5KSUB 3BSZH 4GAGH 3MRLA 4NO2B 4KXZI 3RGVB 5JOPE 3N1QC 4P9HL 1K4DB 2JJWA 5DDHA 2GW5A 1OD9A 4ZOBA 4QY8A 5TE4H 3P77B 5DHVH 2ADIA 3GSNB 5CINL 3G04B 4HH9B 5DFVC 3CPLA 4Y5VB 5I0DA 4GRWE 1D5IL 1GJIA 3CGTA 4QTIL 1ZLUK 2V2TA 2OJEA 2EYRB 3WIHL 1P5VA 2RFXB 5BW7A 4HV8B 4HDIB 3QRGL 1M1SA 3ULSA 3WXVH 1G7IA 4G6ML 4PD4K 3Q3GA 4LCYA 1VGEH 5FA4A 1MWAH 1I8IB 1QHOA 4FTVE 1BFOB 4GUPA 3RZCD 1HNFA 3G9VA 2XN9B 1CXEA 3EYUH 4XC1H 3OKNB 3VFMA 5C0FA 3RX5A 5C9JB 4OIIH 4U0RB 5F6IC 4NQCB 3KGRA 2A74A 1BBDL 4O2CA 4KUZL 2W92A 2NCMA 3G5XB 4ZS6D 4ZO8A 1OD7A 4U1HA 1ERNA 1AGFA 2CKBL 4IOFD 4LRIC 3AC0A 3PV7A 1YDPB 3VXSE 2BXYA 3A6BL 2ZCKH 2X1XR 5E5MB 2JB5L 3F7YA 4P5KB 1KLGB 4XPGL 4UT9H 4APQC 3V79C 4YFDB 2H3NB 2ESVD 4X6FB 3DUSB 4F7MB 1JHTA 5SX5K 1PG7W 3HB3D 4XVJH 1BF2A 1N2RB 4R0LC 3MV7B 5D2NE 3DXAE 3IJYA 5DJZB 5DD1H 4HEPG 4XXDA 1JVKA 3AS2A 1JHLL 1XZ0B 1S5IH 3GSNH 4BUHA 3PP3K 3WFEH 4X4ZA 3QXUA 1V3JA 2JK5A 3RQ3A 5KOMC 2IADB 2NY3B 4P99A 5E6IB 2IQAB 4PJEA 3HG1E 3RKDD 1QQDA 4JDZA 5JR1H 3IDGA 5CGMA 1YEEL 3WIIH 1RUQL 5J13C 3DURA 5EBWB 2DI8A 8FABB 3QI9D 4PJIB 3AM8A 5SWSB 2YD7A 4ELKA 2VDPH 4F9LA 3MLTB 4M9PA 5HGAB 3ARVA 3MYJA 2WWKO 4LOUC 5GS0C 1HHHB 4G8EA 5F7LB 5DSCA 1F2XK 4WV1A 1H3XA 2O61A 4NFDA 5JO5A 3VDBA 1RZ8B 4KMTL 3S35L 3I75B 5J1SC 2IC2A 1IGIL 5GGQL 1UQSA 2WM0A 4NHUB 3TNNA 1CWVA 3MNVA 1RIVH 5FK9A 1Z5LB 3OXRB 2OS7A 1KXTB 4EIGB 3BQUB 2EKJA 4O02L 4YUEL 2AEIT 4GAJL 1HI6A 2BNQD 4PTUB 2EDQA 5D5MA 4P4KC 1SYSB 1MIEL 3QIBC 3VXUB 5BMFL 1CE1L 1HOCB 2FECL 5I30L 4Z7UE 1XF2A 1F4WL 4MLIA 1MF2H 2VQ1A 4NQCD 4Y16B 4KDWA 4NNYA 1BVLA 1UH2A 1FN4B 2FJFA 4BSVA 3O6KL 4OGAC 4RGNC 4C58B 4PY8I 1CLYL 3OKEA 3KG5A 1KEML 2XPGA 3CSYB 3MROB 3MOAH 2E9WA 5IMLA 4FXGB 4XAKE 4ETYA 4OUOA 1ZANH 5EU5A 1EERB 4YDJB 5BXFB 4P5TC 2CLZA 2L4OA 3O3EA 3GBNH 3C09C 4L4TA 3UPCA 2ZKHH 3FOLB 1U6AL 2R2CA 4I3GA 1JZ5A 4JHAL 3FB8B 4HFUL 3MGAA 4QNPE 3VFOA 1A7BA 4ZOAA 5FXCH 4HJJH 1A4KA 1MJ8L 2KUTA 2NY3D 3BAEL 4WIQA 5E6ID 3D25A 1C5DA 4LKCA 4Z78B 1JK8A 2ITDA 1ND0B 5C0DB 2B7DT 1NUNB 1FVDA 2AEQL 1HINL 1MEXL 4HCRA 2J8UB 4NOFA 2E27L 4ODBD 3MRGA 5JORB 3FQTA 2X7LB 5SWSD 7FABH 4V1DD 2FSEA 4PGCA 5LGJA 1VCAA 1G7QB 4NUGL 3L5XL 1F3JB 1KJVB 1NQBA 1Z3GH 3H2WA 4P0DA 3RIAF 2H8PB 3ULVD 5J57B 1QRNA 3L6FB 5DMKB 5DRWB 2VZOA 1DDHB 5B38A 3QO1B 4FQ1H 4CVWA 1CIDA 2PTVA 1DVFA 5GGRY 4KJPD 4RAVA 4NQDE 2NW2B 1FFPA 4KY1L 5BZWB 4JFYA 3BQUD 5EZIL 5BVJB 4ERSH 3BGMB 2WANA 3BH9B 4Z77A 2J4WH 5E2VH 1BAFL 5ICXA 3WNOA 3RWHB 3T4AB 1K5NA 4MXVE 4MJIA 5D6DC 5KBNC 3VXUD 4OZHE 1IAOA 1URLA 3SPVA 1JGLH 3STBA 5HHNA 4YHPA 1F3DJ 3SE9H 1KCVL 1NGXB 1OP9A 4LASH 4PG9A 5DUMH 4Y16D 2VISA 2MCG1 3MLPA 3I02A 3UROR 3T3ME 2BJMH 5J06A 4NIKB 2PW1A 5H94A 4IMKA 2OTUA 4Y1AA 4HHAA 5KANI 4XCEA 5FCSH 1X5XA 1W72L 5E70A 4WFFE 3S37X 5JDJA 1H9VA 1A47A 4UTBL 4TVPH 5C07D 2UY7A 4GLRI 2R0ZL 3PIQA 5HYJB 2XXCB 4A6YB 3MODL 1IKFL 1DUYB 2RCSL 4TSAL 5CEZL 4GRMB 1T5WB 5TH2A 3E6HA 2P5EA 4NFBA 4MB4A 1R24B 2ED9A 5D1ZC 1FVCB 4L29A 2C3WA 3VDAA 1UZ8B 1PG7L 3VXMA 3ULUD 1IEAB 2K3TA 1R3JB 3LB6C 2UV3A 5DQJB 2ICES 4OLVL 5ITBL 5BQ7B 3VRIB 4QHLA 3IU4H 4JY6A 3PWPB 4FFVD 1I7TA 1KPRB 2YD4A 4ZUVA 4PJGF 3C60D 3GMRB 3QXAB 1BEYL 2FO4A 4XP1L 2GTZB 3SKUD 1HQRA 3UDWC 1X5IA 1JFQL 2HT3C 4KAQL 1FJ1B 3O4LD 2Q86B 4UV7H 2R2BB 3GIVB 4AT6B 1XCQA 4I2XA 3WE6B 4AJ0A 5F7NC 3F7VA 4PP1D 4NQXB 2A6JB 5D6CA 5IB4B 1M7DA 3KXFE 1EEQA 3ZDXF 1FRGH 1JV5A 2R0KL 3H42L 3PHOA 4X6BA 4U0RC 4RWYL 5IR1B 5DFTA 3VDCA 4ORGA 1QLEH 4UILH 1A0QL 1U8KB 1ZTXH 2G2RA 2CKBB 3QHZL 3EYVB 4K7FB 2YRZA 4OQTL 4I48B 3E3QC 1OAUH 4PY7A 2VLME 4N1HB 1PX3A 2X6MA 5GRJL 2QKIB 2FYYB 1GYAA 4X6DA 4XTRC 3AU1B 2WBJA 2NY6B 3UPRA 2BSRB 4UTAL 4WI6A 1QPXA 4X0KB 1TZIB 3MBXL 2HT2D 3HFML 1Y6KR 2EH8L 4PJ9C 1IGML 1U41A 3HAEG 3RTQB 3FL7A 1WAAF 3VXPB 4K55A 2PYFB 3GEWB 4OZIF 4H1LA 4P9HH 5CS7A 4K71C 2QJDA 1I7ZB 2IPKA 4WEUD 5CINH 1FFNB 2Y1VA 1RZKH 3SO3B 2YPLA 1FYTB 5IOPA 4ODWA 5C0CA 3BDBA 1PKQB 3BIBX 3IGAB 1XR8B 2H2SC 2UWEB 1BLNB 5F9OH 5HYJD 5A16A 1A1NB 3IDXL 1U8HB 3GMLB 3F58H 4G6AD 2CO7B 4EDXA 1BGXL 3GMOB 1LK2A 4ZO6A 3LEYL 4P3DA 1JNNL 4NSKA 5HHXH 4X5WB 1UVQB 3BPNB 3WLWC 2VDKL 4FFWD 3RKPA 3OJVC 4HUKB 3UTTA 4ODSL 4U6YB 5AG8A 4P23A 1BVKB 1OTTC 4HKJA 3PWPD 2R1XB 2NY1B 2FO1A 1MJUL 1YNLH 4QRPA 4BH7B 1I8KB 4URTB 2YA1A 1J5OH 1IGTB 4JANA 4JM4H 1A5FL 2GJZA 1AXIB 3P30L 3S35X 4N90E 3MRFB 5KVFL 1RHHB 4KUZH 3CDGA 3MRDB 2AK4E 4X9GA 1RJCA 5D72L 1X5GA 1HXYB 2XQBL 4XBGA 1CICC 1I1YB 4XPGH 3BZ4A 4W81A 3QFDA 1UB5B 1B6UA 1LP9B 4Q6IB 1TTFA 1UWEL 5F3HB 3ZYZA 3QDGA 4AK1A 4FP8L 3FHAA 2AJYL 1C08B 4HWBH 4DAGH 5DVLA 3BP4A 4G43A 1KTDB 4G8FB 1IT9L 2XY2A 4JRWA 3MLWH 4WI9A 2NY0C 3T65B 2ICEA 3MOQA 5CD3B 3G5VB 5TFSL 1OSPH 5DUBA 4K2UL 1F6AA 5DJ0B 2BVEA 4U3HA 3VXQB 2X4TB 3S5LA 3RIFF 1YEEH 4Q6YA 2FX8H 3HE6C 3N9GH 5EBLB 1R3HA 3RTQD 4C55A 1DQDH 4OLZH 1YEGL 1WITA 4J3OC 1DBBH 3SDYL 1YNTB 4YZFE 4G8IB 1HHJB 1QO3B 4J4PC 4S2SB 1FYTD 3HMXL 4NQVB 2CLRA 2XWJA 1AI1L 1UYWH 4OZGF 4JRYB 4M6AA 1MAKA 1R0AL 1B9ZA 5IEKB 5IB1B 1BJ1H 3Q5YA 4D8PA 3MO1A 4X7SL 2OZ4H 5BS0E 4MDJB 4KJQD 3HHRB 4YUEH 5SX4H 3I3EA 3HR5A 1EZVY 3HAEB 1T7WA 4GAJH 3DMMC 1AHWA 1JWUA 2D03L 4Y2DA 5GXBB 2IANB 2QADB 3IDJB 3H3BC 4OSUH 3DGGA 3X11B 1MIEH 3LDBC 3GMMA 3PV6B 5HI5D 5BMFH 3VD4A 3QPQC 1CE1H 2VIRB 1QR4A 5BV7H 2NY1D 4LLDB 1V5JA 4QOKA 2Z31A 5HHPA 5I30H 1F4WH 2A0LD 3L3HA 1WEJL 1WBXA 1CD8A 4YO0A 5EO9A 3QUYA 4AYFA 4OF0A 1Q9WB 2F5AL 4RDQG 2AJXL 3O6KH 4RMWA 3C5ZA 2ZCHL 1WTGT 2VJXA 1TJHL 4LNRA 4Z76B 5EIIB 1CLYH 2X4PB 1KF9B 4L4JA 4HC1A 1QFWI 3K8KA 1KEMH 3ALPA 1P9MA 2V7HA 2NZ9D 3CXDL 2Z92B 2JJSC 2YWYA 1D6EA 5F7DB 2Z35A 3HC3H 3BEVA 1YQVL 4HKZB 3U9UA 3GJFH 2XZCH 4DWHA 3NCEB 4JJHA 4P46A 5F7MC 4HJ0C 2VYRE 1U6AH 1RQ5A 5C0BB 4AIOA 1DQJB 1QEWB 1KJ2A 4NM8H 1T7YA 4JHAH 4KQ3L 4HFUH 1W72B 4KK9C 4LDOB 4WFHD 5F9JA 2EDLA 3RIFK 4YFLI 3B8SA 4HULB 3PGDA 2AKRB 3OF6D 4GW4B 2VERN 2BNQE 5IJKA 1ADQL 2AEQH 5E1AB 1MEXH 2E27H 1RUKL 1UM5L 4P9HC 4OD1H 5FM4A 4ZXBC 3RBSA 4NKOB 1RZKC 5BCAA 2AERT 1J05B 1PG7X 3ZE2E 4NUGH 5KSAB 2BSED 3AY4A 3B5GA 3OGCB 4JRYD 3ZLQC 3I2CL 5GJTH 3KPMA 4PJDE 3AMLA 2WIIA 4B7LA 1OAZL 4ZD3L 4P9ML 5CILH 3O3UN 5KSVB 5D1XB 1NGYB 3VFVA 4L4VD 1R5IA 1S9WA 1JPGA 2UVFA 2IMNA 1HHKB 2CO6B 1KLUA 1YPZF 4U1MA 5E1HB 5EZIH 3V5DB 5I76B 4OLXL 5I6XC 2R0LL 2X09A 4KTEL 2JJUA 2IFFL 4XAWL 5I73B 3GM8A 4IIQA 3LQZB 1DLHB 3STLB 2F54A 1BAFH 4I13B 1L7TH 3KYNA 3P9LA 3HA0A 2QADD 4EN3B 2DLEA 5D9SB 1OP3K 3MOBL 4XCYB 3TYFA 2NTFB 1RUAH 4HT1L 1RUPL 3LKSB 2OR8A 4D9QE 3JTTA 3WNNA 1I3RA 1KCVH 1A64A 4WUUE 1HIMH 4NQSA 1U8NB 2EH7L 1X6NA 4HXAH 5I74C 2D0GA 5EU6D 4S1RH 4LARH 3A6CH 3QIUC 3SDCD 3TEUA 3BKJH 3C8KA 5ISZB 3UCRA 4PRDA 3R0NA 5JXED 4X7FC 4JFDE 3LSOA 2MQ0A 4UTBH 4V1DE 3SKNA 1XH3B 2NY6C 4UIKL 3UZQA 3T1FB 5A2LH 1IFHL 4NKMB 2VUYA 3K46A 4TSAH 2GIYA 4QXUH 1U3HB 4WO4C 5C2BL 4XWOD 1FYHB 2CD0A 4M6NH 2AQ2A 4N8VG 4BQ6A 3P0VL 1WBZB 3DYPA 3UXFA 5C0BD 1C5BH 1JYXA 3SO3C 4KKNA 4OLVH 3WLBA 5ITBH 32C2A 2FWOA 1A3RH 2ARWA 4FQHA 3DHMA 1K6QH 4LSSL 4PR5A 1PKOA 2RGSA 4JDTH 4YXKH 1QUNA 1BFTA 1WJ3A 4LCUB 3BISA 3O2DL 5CEZD 4G9DB 1S7RA 4HFWA 2EC9U 2GK0B 1JFQH 4KAQH 4YBLB 4PJHF 2OSLA 1U58A 1DBAL 5FYJE 2VB5A 3BPNC 2NW3A 3FT3A 1G7HB 1SBBA 4PRAA 5DJXB 5SV3A 3L5HA 3LKPA 4Z7OF 2FX9L 2W65A 1TTUA 3QQ9C 2XRAL 5FV1L 1N0LA 4IMLA 4PV8A 3D48R 5I8EB 3C9NB 4NPYA 3U6RA 3KYKL 3MREB 2R0KH 3H42H 4W6XB 1IJ9A 1NL0L 4LVEA 1A0QH 1O5DT 5C0NC 5C07E 2BRQA 3TIEA 1CFNB 2YC1B 1MI5B 2HKFH 3RVWD 4PBVC 5FIEA 4S1QH 1FNEA 5BV7C 5IB3B 4XZUA 2W9DH 3VFUA 3ARBA 1OAKL 4RGOL 5IVOA 4R90L 1WAAA 4OZIA 1LO0H 1FL6A 4O9HH 1OM3H 1DANT 3MYZA 2FHBA 3SGDI 3EGSA 3MBEC 3LZFH 1EO8L 4N8CL 2GJ6A 1OAXL 3SDDA 4QTHB 4LLYA 1AE6H 5EN2B 1HE7A 2DRUA 4HMEA 1KFAL 5ISZD 1UZ6F 5I1HL 3CVHH 4HPOL 4LEOA 1FZJA 5FKPA 1HSAB 1V7ML 1PQZA 3G5ZB 4EI5A 3AXLB 2CDGB 5GZOD 1G9NH 3I6LE 3O4LE 1ORSA 3QIWA 3IT8D 5TQ2H 3IDXH 1YZZA 2V5TA 4BH8A 1CGSL 1AO7A 4KDTC 1N6QL 2H26A 1BGXH 1YEDA 2JIXA 4PJAB 2UZIH 1MJJA 1ODAA 2P8MB 2Y5TB 2VDKH 3GKWH 4LSVL 1O0VA 4UT7H 4M1GL 1U8LB 3QUXA 3O3AA 1NCNA 2HJKA 5C0GA 1P53A 2DKSA 3FQNA 3GKZA 1MJUH 2AEWA 1XF3B 4PJCF 5I15L 4QRRB 2GI7A 4RMUA 3QBTB 2ICCA 5KVFH 2HN7A 3SQOH 3I85A 4UDTA 2X4SA 3M1BA 4M5YL 1UJTA 1JGDA 1BZ7A 4H26A 2K1MA 5LQBL 1HYRC 5D72H 3JV4B 4JFPB 3QR2A 4JCLA 3TO4B 4J6RL 35C8L 4N8VB 1G7LB 3CK0L 3H7BB 3LCYA 3QEUB 4QRUB 4XBPA 5DA0B 4R96B 4WTXA 4M1CD 1HK6A 4ONFL 1OT2A 4JG0L 1JF1B 2PO6A 4NKDB 5I1LA 5HDQH 4L9LB 1J87A 3KYAA 4JQVC 5DJCB 4Y5YB 1RZJL 3HPJB 1J1OL 4ZSOE 2IQ9L 1IT9H 4IRZL 2ZUUA 2AJUH 5IQ9A 1MI5D 1DBJH 4L3ED 2E9IA 4JAMA 2BFVH 3RNQA 3MFFA 4K2UH 5HD8C 2NNAA 2BY0A 5MI0B 1WFOA 3WN5C 4QHNB 4ZFFA 4AEHL 5I66B 1DQLH 1KCRH 5DK2A 3BN9D 3QISA 3B6SB 5M95B 3QDMB 1XGQA 1R5WA 1YEGH 5IGXH 2DYPA 2J5LB 2KZ1B 5AZEH 1B4JH 3FQUB 5CD5C 3V8OA 3JTSA 1P84J 1KENL 4ZFZA 2DKUA 1CGUA 4JFQA 3HMXH 5DMGC 5CIPB 1IVLA 3P4NA 1JNLL 4D0BB 2HJFB 4QXGL 3OR7A 2X4OA 1GOHA 1R0AH 5J12B 2C1PA 2H32B 4LHUA 4M7ZC 4G6JH 1AXSA 3BJ91 4WW2A 4NRYA 3SE4C 2IPUG 3GGWB 4CDHA 4GKSA 2XZQL 1CT8A 2MNUA 4BSWA 5E8OB 5I1JH 2BVTA 1Q72L 2D03H 1O7VA 4XNUL 4ZQKA 5ACMA 4EZMA 2B5IC 5DVNA 3IFLH 5FGSA 4FMFA 5EU3B 2HAZA 3P11L 3T3PE 3UTPD 3ARQA 3CX5J 4QRRD 5FYLD 4CNIB 1E4XI 4G9FB 2Z0BA 1OLLA 4FQLL 4QXTB 5BRZD 2CIIA 1ZHLB 4PRBB 1BIIA 4MQXC 4EN3C 4X4YB 3CXDH 4GW1B 2DQGL 4L3CA 2Q3AA 3BVNA 2G75A 2NZIA 2DLFL 4F7CB 4JM2D 3ZKXB 1OL0A 5B8CB 3L3DA 3ES6A 5I19H 1NCAL 1S5HA 1F8TH 2WINA 3H9SA 3BE1H 3BHBB 2J6EA 3VMNA 3ELAT 1BJMA 3KYOA 2PYEE 4L8SB 1K8IA 4ZFGL 3OAZK 3VWJB 4HGWA 5GGSB 4D0DB 1ADQH 5GGTL 4JFFD 4EQ3A 5HTSA 4PJXB 1ZE3C 3QQ3A 3QDMD 1U3HC 1WZ1H 2WW8A 3B2UC 2W0LA 2MSPA 3PNWB 1ZT7B 1NBQA 1P4IH 5INCB 2V9RA 4U6HA 3BKCH 1B3JA 1P1ZA 5HGHA 3BMVA 5B3NA 3T0DA 4JFXB 1G9NC 4DJMA 1Z9LA 1YPZA 1N4XH 1OAZH 2ILLA 3VD5A 4ZD3H 4P9MH 5CZVL 1D6VL 4D2NA 3O4OB 3GSUA 3F7RA 2VC2H 5DUPH 4I0PA 3MRBA 5FO8A 1WWCA 1FCCA 3G6JB 4OLXH 1TQCC 3GSWB 3QEHA 4KTEH 2GUOB 3EFDL 3IDNB 4U33A 4FXKA 3DLQR 4KK5D 3ZKNC 1S7QA 3TA3A 1D5XA 5EPMB 2AXHA 4KRPC 1KTLB 4KKBC 3UZVB 3PWNA 4J1UB 4ONOA 3PL6A 3LKRB 2NLJB 1DSFL 2DM7A 2JCCF 4X6EA 3QUMA 3U2SB 4WFHE 1DR9A 3CH1B 2EIBA 2EDOA 4G9FD 5FECA 3DX9B 1EIBA 3QG6A 4N9GA 3QH3A 2IFGA 4N0UE 3TZVD 1AKJD 2VLJA 2CIKB 4EOWL 1CBVH 3HS0B 4RAUB 4R6UA 1HHIA 2YPVL 5L6YL 3BP7B 2FJHB 2FLBT 1QNZL 15C8L 5DEGA 4UIKH 5T1KD 4BJLA 4XNXH 4XP4L 4NJAH 1X4YA 3Q1SL 3SY0B 2O5XH 4YAQB 3RWEA 5EZLA 1CFBA 1BX2B 2M2DA 5C2BH 3PGCB 5ETUA 3P0VH 3FQXB 1II4E 3BP6A 2D31B 4Q2ZB 1E4JA 4GG8A 3RZWA 1OW0A 2HT4D 3OPZL 4L4VE 1QLFB 4XCCH 4G80B 3BXNA 3OMZA 4K3EH 1HWGB 2EDEA 5GS1B 4L1DA 2QSQA 4PJHA 5D1QA 1CDIA 2VXTL 3L7EB 4ODUB 5H37G 3B9KA 3RWDB 4JFEB 3MYJB 4KK8C 2OL3L 1DBAH 1IC1A 4RBPH 3MRKA 3QYCA 4U1NA 3ME0A 1XF5B 5CHNA 1AXTL 1CR9H 4U1JB 4MD5A 3WS6A 3RWCA 2FX9H 4HUWB 1CVRA 4WHTB 1BPVA 4ENED 1DEEB 4OGYL 3KYKH 1RFDL 5JW4M 4IRJB 3REVA 1FZMB 3RPIB 1HYSC 4YFEA 2XTJB 4HUNB 4HS6B 5GRXG 5DD0L 2W9LA 2B0SL 1HI6B 1JRHL 3K8MA 3ARDB 1N3NA 4YDVA 2FATH 3L95A 3NACL 1QKZH 3O9WA 3MLSL 4HUUA 4IM8A 1DP0A 2OCFD 3A6OA 1IGJB 4L8DB 3MJGX 5GIRA 1SYVB 2VZVA 1XF2B 1OAKH 4RGOH 4YJZL 1KSRA 4LQ1A 4QXWA 5TF1H 1MHEB 2J2ZA 4FG6D 1BVLB 3NPZB 4GRLC 4XVUD 5F7FA 1WT5C 5M94B 5F7WC 2R0WL 4Q9CA 4F7PA 1OAXH 1FSKB 4NKQB 3BKML 4KHTH 4ZUUA 1MCEA 3T8XB 3L9RA 1I1AC 1KFAH 4G6FB 5I1HH 1WFNA 4HPOH 1V7MH 5KS9B 2FLRT 3JZ7A 1A7RL 4X99A 1EAPA 1HEZA 1I4FA 2ARJB 3Q6GH 3L5IA 1SJEA 1IEHA 1K85A 4FQJL 2F19L 3RI5F 3T0EB 1RU9H 3IDYB 1N6QH 1U93A 3EYQD 2E8YA 2J5LC 3O8XB 3LY6A 3LN5B 2Y5EA 5B39G 4D9LH 3OR6B 3QO0A 4ZOEA 1Q0YH 2R23A 4LSVH 4PJCA 3OKMB 5AWNL 2DQCL 1CK0L 4M1GH 4JVPA 2ITDB 3LKOA 2DICA 3SDAC 3P9MA 5D7LB 2DMCA 3MUZ1 4TTDC 4WU5A 3AREB 1T6VN 3G6DL 5FYKE 1BD2A 3WUZA 2AXGB 3V0VB 3TBSB 1QR1B 1I9EA 3BD3A 1EMTL 3WKNA 4PGDB 4RIRB 4JFED 1VFBB 2DQFB 5TDPB 5LQBH 2R15A 2VXVL 1VDGA 1QVOA 2RIKA 4XPFH 4K9EH 4J6RH 4NO0B 5C0AA