1XCQB

Complex hcv core-fab 19d9d6-protein l mutant (d55a,l57h,y64w) in space group p21
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
218
structure length
218
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTDFSMHWVNQAPGKGLNWMGWVNTETGEPTYADDFKGRFAFSLETSASTAYLQINSLKNEDTATYFCARFLLRQYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Capsid protein C
publication title Different crystal packing in Fab-protein L semi-disordered peptide complex.
pubmed doi rcsb
source organism Finegoldia magna
total genus 32
structure length 218
sequence length 218
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2004-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xcqB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xcqB02
1NCDH 4QOKD 2I25N 4HUUB 1D5MB 4LSPL 1U93A 3FQUA 5HPOA 3LV3A 1RIVL 4S2SB 5C0AB 3OAUH 1W72H 2DM3A 3MV9E 1S3KL 2DICA 1E4JA 4LPXA 5CJOH 5DA0B 1H8NA 3PQYA 1CFVH 4EOWL 2DDQL 1KENL 4NHCH 1S7UA 4NZTH 4Z7UB 4N0CD 1P5UA 1FIEA 2BXZA 5E5MA 1J0IA 3AFLA 3PL6B 4HS8L 1OAQL 1EJOH 1GZQA 3NFNA 2BHUA 3VJ6B 3LHPH 1LWRA 4LSSH 2OL3A 1SVCP 1FFRA 1CGSL 4I0KA 1T1WA 3QNXB 4TNWF 1ZVYA 3MRLA 5D7JC 3P11L 4NWTL 2UYLB 4NNXB 4NN7C 3QUZA 2Q7YB 1UM5H 3EYVB 3QNZA 4MQTB 4YDVA 5J89A 4N8CL 3BEVB 1JPSH 1MUJA 1MELA 1DBAH 1MNUH 3BRGC 2QLVB 3I85A 2FZ3B 1BQHA 4HX1A 1I9EA 5CLWA 1MLBB 3HAEA 1KXVC 4XAKE 3NFPA 3C5ZC 1HCVA 2HT4C 3AGVA 4M7LL 2OL3H 3FO1A 3HTLX 3SDYH 6CGTA 5F7NC 2H3NA 3QG6A 3LKNA 5GGUB 1RUQL 5J13C 3MLRL 2FEEL 5T5NF 4RFOL 3O4OB 4F7TA 5EOTA 1JFQH 1TNMA 3IFOA 2APFA 1H3PL 4JKPL 1HI6B 4FTVB 1ZGLM 4K3HA 3IFPA 5CZXD 4MAYC 3T2QA 1RUPH 1ORSA 3GMMB 4LQ1A 3GFUA 2NY5H 2E7BA 4XX1E 4G5ZH 1HH6A 3ARRA 3BW9B 3FT2B 3GHBH 3BWAB 3MRKA 4WU7B 3UTSB 3MRFB 1DDHB 3PWVA 4PS4H 2AK4A 1Z6JT 3V6OC 3SE8H 3B6SB 4CMMA 4HW6A 2VAAA 3NA9L 2VXVH 4KVNH 2F19L 2VLRD 4IJ3B 5D70H 3U0TB 3LN4B 5L8LB 2CUIA 4G8IB 1H3UA 4P4KB 5T1DH 5A16B 1NBYA 2BVEA 5JDJA 3HZMA 5EA0H 1IM9B 2Y36L 3SKOA 1KCSH 3HZKB 1S7QB 3ZZ1A 1FQ9C 4PLKC 2YZ8A 4CBPA 4EQ2A 3ZT6A 1PQZB 3QUML 1HEZB 3RTQA 3RDTD 2K9UA 2JK5B 1AGCA 3F7RA 4MA1C 3D69A 3V6FA 1KCRL 2C4FT 1RPQA 1EXUA 4JCMA 4Y8DC 5K9OA 2P8MB 3OR6A 4BQ6A 1MF2L 2BNRB 2EDDA 4LBEB 1NMAH 4JGUA 1NGQH 4JFFE 4NWUH 3VFOB 3B83A 5DWUL 1P9MA 4X99A 4K07A 3QA3A 4IMKA 1O0VA 4OTXL 5F6HJ 1ADQA 4XI5D 1R5IA 1CFNA 4K23L 3V9FA 3JUZA 3ILQD 5IG7A 2QJDA 5FYLD 2IAND 2QSTA 3QDME 3RVVD 4JFDD 4Y1AA 4HLZH 2H45A 1SYVA 4P3DA 5E2JA 3QEUB 3U0PB 4EN3C 5C0NC 4G9FD 4UOW0 2C3XA 5EU6B 1EUUA 2XQYK 1KTLB 1WF5A 4LMQI 2BSSA 2C1OA 4POZD 4N90E 4YO0A 5ESAB 4HPOH 3HE6A 1F00I 3WFEL 4DAGH 1K3IA 4UDUA 3M45A 2XIDA 1PKQE 1RZ8A 1NCCL 3E0GA 3WE6B 1OP3K 3GMLA 4GKNA 5IFJA 5E6ID 5CJQH 4YHNA 2X89A 3LS4H 4WTZA 1RZ7L 5DUPH 4OD3H 3EO1A 5EU5A 2OSLB 1MFBL 2ITCB 1T04A 1HOCB 3FO2A 3K4DA 3WBDA 4YR6A 43C9B 5EZLB 1K4DA 2VIRB 2EDLA 3QXVA 5JHLH 4FQXD 3OJDB 1ZTXL 2B7DT 1OHQA 3TBTA 1K8DA 3LMJH 4PRPD 4Z7NF 3MBEC 1Z3GH 2OMNA 3GK8H 4X6CE 4JKKA 2IFGA 4HPYH 5F3HB 3SBWA 2C3HA 2DL9A 3B9DA 3H9SB 4X4YB 3BT2H 3ETBF 4IMLB 1CGWA 3HLAA 5TFSH 4PTTB 3JV5A 3FQNA 4Q0XH 4NQCA 4WVRA 1Q9KB 3MRBA 4R0LB 2X4UB 5DD3H 3IFLH 4YHOH 2VXSH 2FHFA 4YAQB 3P4OA 3QDGA 3UJJH 4NUJB 4OLVH 4IRSC 2ATPB 4RNRA 3STZB 5K9QI 4JKLA 4Y5YB 3TT3L 2R4SL 1CLZH 2EXWC 5FV2A 1P84J 3QEHA 4JANA 2AXFA 3SN6N 5JTWA 5C0EB 2FX8L 2NX5E 1UXSB 4NZDA 1ZHLA 3MMEA 3O6KH 1KXTB 4LSRH 5T3XL 5EZOL 4HH9A 3UTTD 3TH2T 1NJ9B 5D4QA 2PN5A 5IQ7L 4GKSA 1QUNA 3WUWB 3R06A 2BY1A 1XGPB 1HQRA 2EECA 1QNZH 2R1XB 3TA3C 5D7LB 4EKXA 4JE4B 2A77L 4FZ8H 4R4NC 3KPOB 3X14B 3HR5A 3BUYB 4LAQH 2EKSA 2YD7A 4MXWL 5F96L 1MRCH 4TUOB 3EYOA 4WFGE 4HGMA 4JN2A 5EO0B 1NEZG 5SX5K 5GGSB 5F7KC 4PRBA 4UT6H 4AENB 1NCUA 1NL0H 3ZDXF 1TQBB 2DQCH 1BVKB 3HC4H 5SWZE 4L4TB 1UB5B 3BJLA 3L3JA 1FZMA 1U3HA 4KTYA 2Q3AA 4X98B 1LO3H 1IC7H 4R4FH 1VA9A 1UCBH 5DD1H 4PJDA 1ZLWH 3V52L 1HSBA 4GBXB 3FJTA 5IBTL 1A0QL 2FCBA 5J56B 3IDNB 1OAKH 3ULUC 3C2AL 1T1XA 3VXTA 4KMTL 1Y18B 3EAKA 2LAAA 3BN3B 1NFDF 4ZOAA 3QEQD 5HVWA 2P7TA 1MFCH 1OCWH 1JK8A 5LG1A 5T3ZE 4Z6AT 3LRHA 4UOJA 3ZKXC 1X5JA 5FM5M 4M1DL 1S7XA 5EOQL 1JPTL 4KAQL 3OGCA 4PGZA 1DBJH 2XXMB 2J2ZA 4MD0A 3DX7A 1XF3B 4R6UA 4M7ZB 3E3QE 2ERJB 4NN6C 3C8KA 4RQQA 1CDGA 2ZUYA 2YRZA 4LPVA 5CEXB 1Z0NA 3HG1E 5KW9H 4HIIB 2N7AA 1K6QH 1A6AB 1BLNA 4PR5B 3ULUL 3K8KA 2X40A 4IRZL 4YC2C 1S9YA 4FQQA 4PLJD 4M1GH 4PRIB 2XRAH 4LNRB 4V1DA 1AJ7L 3HZYA 4WW2A 5D6DC 4PJ5A 5CP7A 4PRNB 3FCTB 2HJLA 2VR5A 3ZL4L 4XNUH 1N3NB 3GJEB 2YXFA 3OJMB 1CGVA 4QRQB 3CCHA 4O5LH 2GAZB 4HUMB 2DWEA 4YDLB 2R4RH 4LLMA 5IP4A 2DBJA 3RHWF 4EDXB 3FB5B 3GSRA 2NY3B 3VFPB 3K2UL 4KHXH 3WD5H 4OCYH 3A67H 3PWUA 4GH7B 3BZEA 1B3JA 2PF6A 3D39B 1F6AA 2BMKB 2ZOKA 3OB0H 4NQUA 5EOCL 4MCYB 1NANI 3SE4C 3VFWB 3QYCA 3VFGL 3K7UA 4F80A 1IC5L 1NAKL 3VFNB 4F7EA 1JBJA 4Q6IB 4OIIH 4JFED 4UAOB 3MV8B 3S34H 3F12B 1WUNT 4HWZA 5GJSL 2VTFA 3CSYB 2HVJB 1QYGL 4HHAA 3SGKA 4M7KH 3W5NA 5INDA 4ETQB 5DC9B 4NT6A 4TTDC 2ITDA 1B90A 3VXUB 4F7PB 3VRLF 3WN5B 4Z8FL 4OCRL 4J4PA 1Q1JL 1Y6NR 4X7SH 4AEIH 4QYOA 3NH7L 4OD1H 1BZ9A 3ILQC 1BZ7A 3H9HB 5EUKB 1CICD 2PR4H 4QHMB 3U6RA 2BY0A 5GGTA 3N0PB 5DZNA 1JYWA 4PY8J 1I7RB 5HVFB 2VLJB 3RNKA 4K9EH 3PF2A 1KG0B 3S37H 2XTJE 2OQJB 3QQ9D 4MNQB 4U7MA 5AZ2L 3F7YB 3G6JA 5C9KA 3P4NB 3IKCA 2DS4A 3QUYD 4POZC 5E9DE 3OAZH 5EUOF 5HI5C 5D5MF 3T0EB 4YZFE 3MJ6A 1NSNL 4I5BA 2F53E 3OWEA 3G5ZA 4OB5L 5KSBE 2IAMD 3QNYB 4YNYA 2O5XH 2YBRA 3V5HA 3EW3B 3ULSB 4H26B 1QEWA 4APQC 3ALPA 5JR1H 5I30H 2IG2L 1T03H 4JRXE 4RGNC 1ZV5A 4NKOB 3O6LH 3RWJB 2RGSA 3UC0L 2YD6A 4WWKD 4MA3A 2K1MA 4BUHA 3O2DL 4HWEL 2GSGA 4M5ZH 4HAGA 1EGJA 1UCTA 4HUVA 3ZO0A 4RCAA 5K9JL 3CIQA 3MV7A 5CEYA 3RVXD 1QSVA 4FP8H 1LEIA 5LKNA 3QXWA 3LCYA 1P7QD 1FNLA 5GIRA 1KJVA 1GAFL 1P7KB 3O2VL 3PDOB 1CD0A 3RJQB 4ZPVA 5HHVL 3RIAF 3HCVA 3T77B 3UBXG 1LDPH 4F37K 3GM0A 2X7LB 2DQTL 4TSCL 4G6JH 4HUNB 4NQDA 1B6DA 1F11A 1GGYA 5IMKA 2OTUA 5I1JH 3FONB 4C83A 1YMME 1EGJH 5JW3H 1PJ9A 4X8XA 5F1OB 3BGFC 4RMWA 1U58A 4HWBL 3OZ9L 5T1KB 4P2RD 1CE6A 4Q58C 5IKCA 1MRFH 2VMFA 2WWMD 1RUAL 3S4SA 2J8UF 2F54B 2KQNA 4X5LA 2RBLA 3MGOB 3EYQD 4HS3B 2XN9A 3X12B 4GT7A 4H8WC 3G5XB 2NNAB 1QFWH 1G7IA 1DVFD 1WK0A 3CC5B 4PJXA 4QWWD 2QHLA 2DLTA 2QSQA 1ZVSA 5C09E 1XIWC 4Y16D 5JPNA 1VKXB 2NZ9D 1BD2D 5DR5H 4M6OH 1CD9B 5BQ7B 1MREL 3EFFA 3TH4T 1G84A 2FO4B 2YEZB 3FOLA 1SBSH 2F58H 4NP4H 3OKDA 3PQYD 3CK0H 4XH2B 2CIIA 4KKCD 4Y4FA 4PG9B 4ODVH 4JFOB 3W0WE 5KVMC 5D2NA 4X4XA 4GG6B 4K7PL 2R69H 3RWDB 1TFHA 1YEIL 4PJHB 4TVSa 3TPUB 3ULVE 3DIFB 3ZTJG 2XFXA 5F88A 3VGFA 3LRSA 1C12B 3RZCB 3OJ2C 3T04D 4JDTH 1FDLL 4OGXL 1YEHL 4H8WL 4OZHA 2JKXA 1MCEA 4ZFOB 5TH2A 5ACLA 4PRDB 3MNVA 2HKFL 5DQDH 2R8SH 5K9KA 3CJJA 4L1DA 3JTTB 4PJ7B 2MCG1 3K8LA 4XNZC 4LFHD 5JXAL 1SEBB 2P8PB 4N5ED 4TOYH 4WW1B 3DVGA 3VGAC 3P4MB 2PYEA 4U1HA 3L5XL 3DMMC 3VW3H 4D0CB 3ARFB 1CL7I 2IBZX 4QTHB 3EO0B 2ADJA 3QFJE 1P4BH 1QSED 3GUTA 4QRPB 2VDRL 1YYLL 3RUGF 4OZGE 1VACB 4HIJB 1EO8H 1EEYA 5AZEL 4NO2A 4AQOA 4JQXC 2Z8RA 1F2QA 1HSAA 2WMPA 1V3MA 5IMMA 1JNHA 2FATL 3O4LE 4OF5A 3IJYB 1F2XK 3RWIB 2W92A 4XTRC 1TCMA 4RBPK 1JWSB 3VFSA 4L8BB 1J88A 4QHUB 4OBSA 4O2CA 1JN6B 2V6HA 4GOSA 3SGJC 4HC1H 1KB5A 1R5WA 4HH8A 5HHXH 5I8EB 1CXFA 4S0SD 1IGTA 3FMGH 2W9DL 5DMGD 4D3CL 3S5LG 4S0TD 4L8DB 2WUCH 1MCPL 4HK0B 1UJ3A 4GXVH 1IMHC 1LEKB 1B2WH 1FSKC 1P53A 3QI9A 2AK4D 3N06B 1RZGA 2UZIL 5TQ2L 2F5BL 4E41A 1BIIA 3MCKB 1AO7E 1KJMA 3TO4D 4CVXB 3VXSB 1Q9WA 4BH7B 4LCCB 1WT5A 4OCWH 2KQMA 2WM0A 4HKZA 1KB5H 1JF6A 2ILLA 2HLAA 4AIXA 2WP3T 5F6IB 3DX8B 4WO4C 2A38A 1S9KC 1ES0B 3MRNA 3MRQB 1XR9B 1QOKA 1T66D 1T1ZA 2VE6A 1QHPA 5DJAB 4JRYB 5DJDB 1ZLUH 4WY7L 2VXQH 2AJYL 3CPLB 3D2UB 1A6TA 2YD8A 3CVHA 2GY5A 3KYOB 4NBXB 4I1NB 3VCLB 2P49B 1NAMB 3T3ME 2FR4B 1QSFB 4LCIL 4TULL 5E7BA 4XMLL 4ACPA 2XA8L 2L4OA 3ZE1E 4UV7H 4LASH 1QHOA 1WWCA 3P30H 1X5GA 5DK3A 4BH8B 4HIEB 5BZDA 4DZBB 1MI5B 4URTB 4MNGB 3RWCB 3CXHK 4W6YB 4Y89A 4ZAKB 1TITA 1A3LL 5C8JA 3MUY1 1U36A 3LN5B 4Y19D 4GW5A 4PJ9B 2C9AA 4JJ5A 1JHLL 5C0RH 4I0PC 4NYLA 1L4IA 3MLZH 2ICWA 4TSAH 1X5LA 3RY6C 4XXCA 4IIQA 2CR3A 4PJFF 4U3CA 1TDQA 1IGIH 4YX2L 3NVQA 4DTGH 3HPJB 1U8PB 1I3RB 1ZA3B 3ORJA 5FYKU 3BPOB 5KSAB 3V6BR 4Q2ZA 3NFSH 5F1NB 2EDTA 3RFZC 4FQHA 4KRLB 2FGWL 3VD7A 3P0VL 2OS7A 5F7DA 2XT1B 2QKIB 4GAYB 1G1YA 3QCVL 2XG5A 3OR7B 1BWWA 4U1GB 3I9GH 1DQTA 3QQ9C 1MCLA 3VXMB 3D9AL 3IGAA 5IB4A 3U7WL 1VERA 2B1AH 1K85A 4NJ9H 4LLWB 3QUYC 1U8HB 1AHWB 3K74B 1UQSA 3G5VA 3GSOB 1MPAH 1I9IL 3IETA 4RGMB 5B4MD 1WBYB 1A1NA 4I48A 4I18C 4LU5L 2J12B 4XVJH 2MCPL 4LPYA 1A7PH 3DRQA 3SGEI 2OR7A 2EEDA 3QULA 4YUEL 1UB6B 2OP4H 5BRZD 5IWLC 5E8OA 3WV0A 2DQFA 1G7MB 4WFFE 4X6BA 2FL5B 4PTUB 5DTFB 4XXDB 4WWKC 2BP3A 5C0BB 2GSIB 4MMZC 4P3CH 3PHSA 3QDGD 4LPTA 3PIQB 4ETYA 4K3EH 5GGSY 1TJIH 4FZEL 4M62L 5MI0B 5D1XB 1NGPL 4PB0L 4WI3A 1BMGA 3GIZL 4HLZG 3SPVB 3KLSA 4H5SA 2ED7A 3TVMB 1CT8A 4Z9KB 1QBMH 5CZVH 3X11B 1DQJB 3G6DH 1U8OA 4LPCA 4ZUSA 1T2JA 1EDQA 2YN5A 1LQSR 2GK0A 1TQCC 3N1MC 4QXUH 1PG7X 3CXHJ 3S35X 5GS1C 5IVXB 5IB3B 2NCMA 2WWMC 1KPVA 1NBQA 5FB8A 1U8QA 3CDCA 3GMOA 4GRLB 2YA2A 5JORB 1UACL 2G5BB 3T8XA 1KEMH 4LL9A 3BRDA 1IBGL 1DL7L 4XHJD 4FRWA 3HR6A 4QWWC 1HKFA 4Q6YA 5EORL 1FZKB 4Y16C 1FNSH 4JZOA 1IAII 4NM4L 2AQ3A 2XWTB 3RBGA 1JPST 2PYFB 4BYHA 4U6XA 4Z18A 1P1ZB 4NBYB 4QNPF 1A02N 1WFTA 2H8PB 2LFGA 5DEZA 2A0LC 2P24A 3SDCB 2R1WA 3IXTB 2DM2A 1HDMA 3MO1A 1A4KB 3PABB 4LP5A 4DOHB 2ICWI 3KPSE 4ELMA 2N56A 2YHGA 3FO9B 4BSVA 1TVBB 3QIBD 4F57H 1JV5A 4LEOB 5BMFL 4UINL 3HE7B 2VQUA 4Z7WB 3VFMA 4DKEL 3QUXA 5KVEH 3PL6C 1L0YA 1OTTC 1JGEA 1FN4A 2CIKB 4XBEL 3IDMA 4C56E 2P5EB 4HJJH 2AAVA 2VISB 1P7HL 5BS0E 4KI5D 2DQGL 2RAMA 2UWEA 1I7TB 1IGJA 3QXAA 3E1F1 1L7IL 3GBNL 3CFKB 2R9HC 3FB7A 2B0SL 3T0DA 2CKBL 3MREB 4P2OA 1F4YH 2Z8VC 3NTCL 4FQIL 1H3VA 3I02A 4BSWA 2EXYD 3L5JA 4JM2D 4XP5L 3KR3H 4UILH 4ZOBA 4X7CC 2DIBA 2O5ZL 1INEH 2WINB 2X4PB 2Y25A 3PP3H 2NYYC 3Q48A 3DO7A 4LK4A 3CMGA 2CGRL 3NZHL 1XGQA 2V9TA 3PG2A 3P9WB 5DMGC 5C3TA 1MVUB 3O4OC 1DBMH 4TYUA 1DQDH 4V1DD 4YK4B 43CAA 3TN0D 1FV1B 1W0VB 3HUJF 3UZEA 4UDTA 4G43A 2ARJQ 3NCFB 1IEAB 1S7RA 2G9HA 3TO4C 4KJWD 4GUPA 3WHXA 2CKNA 1G6RA 4M7JL 4OLUH 4I77L 4P5MA 1CN4A 5C0JA 1IT9H 5ENWA 3VRJA 4KHTL 2BVYA 1G9MC 4FFZL 1AC6A 2IMMA 2JCCB 1MJ7L 1FVEB 3U48A 1RZKH 4IJ3C 2BCKA 1CDBA 5AD0A 4ORGB 4HXAL 3O3AB 4O9HL 4P4KC 1ETZA 5AEAA 1H0DB 3W2DH 5CFHA 4YJZL 3KPMB 1N8ZA 3ARDA 2FO1A 1FYTE 1AXIB 2HTLC 4P57B 3THML 2V5SA 1F3RB 2W0FB 3QSKB 1G6RH 3O3DB 4GAFB 3AS0A 2I9TB 5MENA 1NH6A 1WIOA 4P46B 3BKMH 1KN2H 3IAGC 2D4FA 1IRAY 4J4PD 3KPRA 1A22B 4MXQD 3CFEA 1CK0L 4ZDHB 2SEBB 2AI0H 3BXNB 4S1SL 1IKNC 4R96B 4PJCB 2XZCL 1W72B 1OF2A 4QLRA 5CAYB 3S88H 1G9ML 2CPCA 2IJ0C 5C2BH 5EFIB 1LO2H 4OLZL 2QQKL 4GSDH 3IDJA 1DSFL 2XWJB 1UGNA 4LKCB 4HIXH 5KANG 4NQTA 3NABL 3L7EA 1UEYA 5IHUL 3UBXI 1T7XA 1UA6L 2D31A 1JTPA 5GS3A 4I4WA 2EZ0C 3SJVD 1AI1H 2ZZUT 1CYGA 3FQUB 3O45B 1FGNL 4KRPD 1IKFH 4LDEB 4MJ2A 1HHJB 3EKCA 5L9DH 4JY4A 1JHKL 3MYJA 4LCUA 5ITFB 4HEME 3P9LA 4J8RA 4WTXA 3OB8A 4PP1D 3SO3B 1S7UB 5DD5L 2D7TL 2FB4H 2X4OA 1T5WA 1J8KA 1FH5H 2B5IB 4HUXA 3MV7D 5DMJB 5GRVK 5FM8A 3NFNB 1MCRA 1Z9MA 2MHAB 4Z7NE 3BH8A 1JGDB 3BISA 1WCBA 4JFQA 2Q76A 4IEFB 1FE8L 4JHWL 5IB2B 1T1WB 4LRIC 5B4MC 3MRLB 4BFEA 2VQ1A 4Y4HA 1C1EL 3QUZB 1SEQL 2BSRA 3QNZB 3EDJA 5I9QB 4LCWA 3TYGL 5DS8A 5FFLA 1MUJB 4R3SA 3GNMH 1T89A 3TCXA 3PHQB 5KS9A 5FIEA 3N1PC 5DMIL 3NFPB 1UWEL 3HZVA 5FCUH 4X80L 5LJYH 3FO1B 1UEMA 5ELIA 2A9MH 2YD9A 1ONQA 3O3BB 5KJRH 5H94A 4D0DA 4R0LC 1PBYA 2XN9D 2IGFL 1IQWH 4ZFGL 2EDNA 2P8LA 4BUGA 1BWMA 4D2NA 4ONFH 4Y5YC 3CUPA 3IFPB 5HHNA 3HRPA 4MHHG 1ORSB 1KT2A 1T4KB 3REWB 1K3ZA 3O41B 4MLIA 1IJ9A 1AR1C 1SJXA 2P4AB 3DHJA 3UTQA 3LOWA 2GJ6A 3MRKB 3WO3B 1PKOA 3BP5B 2F5AH 4QXTB 3W9EA 1ZT4B 8FABB 4G9DB 4CMMB 2VAAB 4HBCL 2NXZB 1C5CL 1CXIA 5DRWA 3GMNA 4KI5F 4HKBB 3ZDXE 5GJTH 2XWBA 1TMCB 5F7UA 1NBYB 4YXLH 4ALAL 5E2UH 5E00A 3MV11 3MLXH 3SQBA 2EDRA 5JIHA 3SKOB 4C4KO 1CD8A 1G0DA 3T2NL 2FYYA 1T20A 3RTQB 3ESVF 1RUMH 1YQ2A 4JM2F 1S9VA 1AGCB 5AG9A 2M26A 1FFQA 3V6FB 3VDBA 2DQDH 3QCUH 2PYED 5K9OB 3VE0A 4JFFA 4MA8H 1F4HA 4WUUB 1QSZA 5I1EL 4R8WH 1NFDE 3QWRD 4YHPA 3EOTL 4Y2DA 1DBKL 3QG7H 5HYJB 5JW4Q 4KJYB 4RA3A 5JDSB 4X99B 4PJ8A 1IL1A 2VLRE 1M7DB 3QDMA 1R5IB 1CFNB 1CQYA 4AK1A 1I1FB 3FKUS 3KS0H 5IG7B 4HCRA 1ZHNA 4GBXC 4Y1AB 4MB5A 1SYVB 3FO0H 1CGTA 4AZ8A 4HKXA 2GEEA 1XGTA 3P73A 4YDKH 1S5IL 2BSSB 4YO0B 1PKQA 3HE6B 3TIDA 3O8XB 4GQ9H 4ZUUA 2YD2A 3BIBX 5EIVA 5C0CB 1T83A 5KTEL 3FRPG 4E41D 3BAEL 5CSBA 2EXYC 4GKNB 1SMAA 4HCRH 5IFJB 2J6EA 4XWGH 1C5DA 3S4SG 4XBPA 4M7ZC 4LGRB 3CX2A 4OLXL 1DN0A 3AMLA 5LWYH 3V4VL 1CFTA 4U3HA 5FA4B 1DE4A 3CLEH 5I17A 5JOEA 3Q6FA 3EO1B 5LBSH 4ELKA 5BV7H 1VESA 2OK0H 3L3OA 3MLWH 1P4IH 3B5HA 1T04B 3QCTL 3FO2B 5LCVH 5FYLE 2IANE 3JV4A 1K4DB 4MB3A 5JO5B 4JFDE 4OLYL 4UV4L 3HS0A 4K94C 3WIFA 3GSXB 2Q3ZA 1KULA 2P48B 1QLRB 4G9FE 1NMCB 1VGKB 3P3YA 3RL2B 2A73A 3MXWL 4TVPL 2DI7A 2J6EH 2J88H 2H32A 2DJUA 4K8RH 1EMTH 4KJWC 2ZG2A 3G6JF 4YXHH 5GRUL 4UOW1 4KMQA 5A40E 1SM3H 3FQNB 4NQCB 2VXUH 1QFUH 1D5XA 4TRPL 4WI7A 1KFAL 3P4OB 4RNRB 3FFDA 1JWUA 3GGWA 4IS6A 1OTUD 2O5YL 2P5WD 3GRWH 4YDLC 2DLHA 2NX5A 2C7UA 3QEHB 4JANB 1RU9L 2NY3C 4MXVF 5C07A 2PUQT 1JNJA 4Z95H 1P4LB 2H32H 3MBXL 3VRLE 5F9OH 5EBLA 1HHKA 5L2JB 1HQ4A 1TVDA 4M48H 3MMEB 2X4TA 3WNOA 4CADB 5T33L 4K94L 4AL8H 5E8DL 5BXFA 5IW1A 3NZ8A 1F4AA 3RPIA 4Q6IC 4XB7A 2APVA 5FGBA 2LVCA 5I1KH 2C3VB 4UAOC 4YGVA 4PRPE 4K3DH 4GG8B 3WNMA 3D3VA 2XTLA 1DQQB 3R06B 5E08H 3L3GA 1GZPA 3EFDH 1T0MB 4HIHA 5HGAA 4U4BA 4YDIH 5EUOE 5D5ME 3LN9A 1EERB 2EKSB 1R5VB 4G6AD 1EO5A 4PRAA 3MNWA 3AXLB 2NY0D 2UY7A 2JJSA 4GMSL 3P2TA 1CFBA 3EYOB 4EEEA 2Y7QB 1C5BH 1ZANH 4CW1A 3MRDA 1T21A 3P77A 3BO8B 4P9HC 4WI5A 5AWNL 2ATKA 4LLVB 4JEGB 4PRBB 3ROOB 2CRIA 2ZP0T 3LIZH 1UZ8B 4OGAC 3SKMA 1EEUA 1FBIL 3WMSA 4LRNH 2C3GA 4GRMB 5L2KB 2J3SA 3RPKA 4HKJB 4NC1C 4JFZL 4JR9H 3UTTE 1E6JL 1JTOA 1RSFA 1U3HB 2DM4A 4H1LG 5IESH 3T0EC 2CRMA 1BIHA 1BFSA 1A6WL 3MLYH 3WEXA 1CCZA 4JHAH 3S3JA 3TT1L 3A6BL 3H6JA 3RU8L 1UG9A 2ESVA 2GITA 3V5KA 3VFUA 1HINH 1I1AA 4PJAB 5FKAA 4AIZA 4A2MA 5E70A 3VXTB 4QHNA 1OB1A 1G1CA 2YD1A 5JPMB 2P7TB 4P59H 3D85A 1JK8B 4D94A 1A7RH 1U92B 4F2MA 1A6PA 5DSCA 3QZWA 4P9HL 3WDIA 3C08L 1IEHA 4KKNA 1M7IA 2HN7A 3WIIH 1MHHA 2BC4A 5BJTA 4JG1L 1BJ8A 2ZCHH 3KYNB 1AXSA 1NC4D 5L7XL 4MD0B 4RWHA 3DX7B 3LSOB 1UWXK 2J8UE 3X17A 3PUCA 4P5KB 5F7EL 3C8KB 3NCJL 3A6CL 4NSKB 4RQQB 4ZTOH 5FGSA 5T3ZH 5INCB 4OZIE 3MOBH 1N64L 1S7WB 1B0RA 1HHIB 1RMFL 5BO1H 1MJ8L 5GRVL 4WJ5A 1NLBH 1G7JB 4RAUA 4ERSL 3RY5A 3CZJA 1YEDA 1QA9A 2ICWJ 5IK3B 2AGJL 4RFNB 2YMXH 3MLTB 1RZJH 3GM8A 4KKBD 4XNYH 3QEQE 3RIFF 1QACA 1A1OA 4AH2A 3SCMB 3EYFA 1X3DA 4WDIB 4WW2B 4PJ5B 4KWUA 2HJKA 1H8SA 3B4NA 2HJLB 2QV2A 3GJFK 5CINH 5ICYB 4XVTH 3CCHB 4XC3H 5E7FA 1MJUL 3CU7A 1FORH 2E7CA 3GSVB 4M61A 4FG6D 2DWEB 4LLMB 3PWLB 1FL3A 1KCVL 3GSRB 1PSKH 1U8JA 4QT5A 3BZEB 2XKUA 1YECL 5HXMA 5I15L 2YKLH 3TYFA 5CD5D 1N5YL 3PNWB 4OF6A 1EHLL 1AP2A 32C2A 4F7EB 4OI9A 4RRPG 1T6WA 3TBWA 3EOYG 1ZGLP 1LILA 3RZCC 3RUGE 4IRJD 1OGTA 1JNLH 5LGJA 3STBA 5C08D 5ERWA 2DL2A 3SY0B 4E42B 1AIFA 4HHAB 4KZDL 1FFOA 3HNTH 5INDB 3BQUB 2ZOLA 2GT9A 4NT6B 4P2OD 2ITDB 4Z77B 1T2QH 4I3SH 4JB9L 5CEZD 3IU4H 5ICXA 3P9MA 2E8YA 2ADGA 4F9PA 2FJGA 5EG6C 3U7YL 3VG9B 2BSTB 2VZSA 3ARFC 12E8H 3HN3A 3TBYA 2CDFA 1BZ7B 4IDLA 5HD8D 2VDLH 3B2UC 3U6RB 3UPRA 2AV1A 2JELL 5DUMH 4QKXB 1OLLA 3O9WA 3LKQB 2VITA 5IEHA 5E9DA 2JJWA 5JNYA 1HXMA 5C7XH 4YE4L 1ORQA 3EHBD 3IYLW 5IVZB 5KSBA 1IGML 5MP6H 4L5FL 4JFEE 4HMCA 2IBBA 5HHMD 4LSUH 3VFVA 2FRGP 4JRXA 2YBRB 3ZTNH 3BMWA 2VNCA 4WTWA 1P2CA 4PBVC 5IHBA 4ZFOL 2XZAL 2CQVA 2WBJD 2XV6B 5L8JB 4OT1H 5EBMB 5SX4H 1OT1A 3F7VA 5FHAH 1LK3H 4HUVB 3DETC 1JZ2A 4R26H 2F8OA 5F9JA 4P48A 4LCCC 5C70A 5E56A 3EZJB 2J8HA 1F4XH 5GGRB 4GKOA 5JOPD 1KJVB 5KANI 4HEPG 3ARDD 3LEVL 5F6IC 2VLLB 3HKFA 4KY1L 4XCNA 2X9WA 3EYUL 5A1AA 1A9BB 1QFOA 5ID1B 1RULH 4X0KB 3LKSA 1R24B 2AP2A 4QXGH 5F89A 3HCVB 2FX9L 1YMMA 3MNZA 4NQDB 2Z91A 5FOBB 5MEND 1CBVH 2OTUB 5D2LB 3H7LA 4C83B 2EDHA 4J3SA 2AW2A 5HY9B 1QKZL 1X5YA 1OGAD 3VXQA 5GSVB 4WENB 1CG9A 1U58B 4AT6B 1VEOA 2X4QA 4EJ1C 1CE6B 1INDH 2IQ9H 3S4SB 4JLRA 4PJFE 4PGEA 1EK3A 4X9HA 1OAZH 1CDJA 2R2HA 4RDQF 2QSVA 5LGHH 3GSUA 1F58H 2BX5A 1Q0XH 3DUUA 3RY4A 4DZ8A 5IFHL 2R56H 5C09A 4OIBA 3KJ4B 1M1SA 5IROC 1L6ZA 4KGLA 2PW1B 4M9OA 4PJGF 2FX7L 4ZAKC 3WFBH 2X1PA 3UDWC 3RA7H 1TZIA 1YMHB 1I9JL 5JPNB 4P4RA 3RBSA 4JPVH 4PJ9C 3KJ6L 3QFDA 3EFFB 1PG7H 3S35H 4KZEL 2AKRA 4G8EA 4G8GB 4K7PX 2CIIB 3LKRA 4Y4FB 4MJ5B 5AAMA 3WSQL 1UXWA 3BPOC 5IHZA 5KSAC 1NAML 4X4XB 2RFXA 1IAIL 3MYZA 4PJIB 2ICEB 2N7BA 4P2RE 1A1MB 3QIWB 2XFXB 5F88B 1KC5L 4XMPH 4OI7A 1TCRB 1YEGL 4B7LA 3SDXA 2JB6A 3DRTA 4XNXL 2ENSA 5ADPL 4YEEA 4WEBH 5JA8B 2OXGA 4U1GC 4U0RB 4ODUA 1RFDL 4MHHI 1FP5A 4OZHB 3DBXB 4KK9C 4TN9A 4YH6A 3O6ML 4FQJL 4P49A 3T65A 2OZ4A 5K9KB 3U4EA 4Y4KB 3ZHDA 4JCLA 4LCWD 4XC1H 3UJTL 1IGCH 4I2XA 1RJLA 3W81A 2BFVL 4RGMC 3DVGB 3ULVH 4X6DB 4U1HB 1BD2E 5ADOL 1IC4H 4OZGA 1ZA6A 3RWHA 2ADJB 5CZKA 5FYJD 3VFTA 4CU6A 4F15C 4OF8A 3VXOA 1AKJD 1EEYB 3PQYE 4NO2B 4WFED 1HSAB 4LMQE 1H5BC 2FECL 4XPHL 5IMMB 1V5JA 1NPUA 4Z7VA 1LD9A 2OZ4H 1M6OA 3VFRA 5DVOA 4KKLC 5GS0D 2IADA 4O2CB 4RAHA 5D7IB 5FYKL 1R3LA 2QL1A 5IM7A 4G7VH 4YWGH 3KPNB 5IJKC 5MI0C 5FA3A 1GVIA 5TGBB 1A21A 15C8L 3WFDL 2GJ6D 4ZUWA 4KQ3L 1DQLH 5E2VH 3BVNB 4OKDA 3QI9B 4NFCA 5E5UB 1RZGB 3TVMC 3VXRB 3U1SH 4H1LB 1U6AL 1Q9WB 1QSEE 2EDOA 3K4AA 2UWEF 5C0IB 5FUCC 1J8HB 4NKMA 1YEFL 1WZ1H 3GI8L 4G3YH 5DXWA 3CXDL 4RWYH 1KB9J 2YPLB 2D4DA 1WBXB 2WW8A 2A83B 2E27H 1AD0A 5IGXH 3D0LA 3OKOA 3B9KB 2YSSB 3TIEB 4GRLC 5BW7A 4RISH 2AQ2A 1NGWB 5D1ZB 2Y06H 4XPTH 1X7QA 2A6KA 2XZQL 3BSZH 4DW2H 1RQ5A 2J7LA 4YHZL 2O61B 4XPBH 1YZZA 3K0WA 1D6EA 1PEZA 1U91B 3P40A 4FQPA 1A9EA 1Y6MR 2Y6SD 4XGZA 1XF4B 4U1LB 3RL1B 4L4JA 1MHPH 1X5ZA 3L9RA 1QR1A 5HI3D 5I16A 3PHOB 3MROA 3QDHA 5EO9B 1NFKA 4PJBF 3NIDF 3BZ4B 5BZDB 5D8JH 2Z31A 25C8H 3IDUA 4P2QA 4L4VB 3MGTB 5F93C 1HKLH 1DJSA 2PCPB 4IRJC 3VWJD 2EDBA 3QDAA 3DVFA 4JG0L 4JJ5B 3HE7C 5EC1A 1JP5A 2HRPH 5HHOD 4F3FA 4NRYA 3KLAA 2NZIA 4IIQB 2IPTH 2VXTL 5EU3A 4BELD 2OXHA 2FEDC 4O02L 3JV6B 4Q2ZB 5IMOB 5JIIA 4YFEA 4KQ4L 3T2OA 4K8RD 4YXKH 4HT1H 3OHXB 1FJ1A 2EH7H 1MQKL 2KZWA 3S37L 4NM8L 5IBUG 2X10A 3GO1L 4JO2L 5EULV 1A6ZA 2NTSP 1B0WA 2AJ3A 4UT7H 2BNRE 4XX1G 3IGAB 4U7SA 1A7QH 1N0XL 3HUJE 5MEQA 5IB4B 1OP5K 2W38A 3GSQB 3QHFL 2VB5A 1JZ7A 1T0PB 1UQSB 4X7TB 3DX6B 1YY9D 3IDIA 4NKQB 5E8NA 1S3KH 4ONHA 3FZUD 4H0GA 4RMUA 1A1NB 3B9VA 4Y19E 4N0FB 3IDXL 5KG9A 4NOBA 3KGRA 1FZOA 1YY8A 1GGCL 3SO5A 5FKPA 7CGTA 3DRQB 4HS8H 5EPMB 2H1PL 3BP4A 3QULB 3C8DA 5DZOA 4YK4C 3MSPA 5E8OB 5CEZL 2DQFB 1K9TA 1LO4L 3F7QA 4X6BB 5DJXB 1L9NA 4NQEA 2R0LL 3WFHA 3ZDZF 4NWTH 2HMID 3ARGB 3KWWA 3OGOE 4EBQL 2BVPA 1J0HA 4AEHL 5I18L 1LO0L 3MUGA 5C07D 3U46A 1JZ6A 4UB0L 4L8SC 1XR8A 1YDPB 4TQEL 3I6GA 2HT2D 5D7JA 1H3GA 5EH1A 4H5SB 3TESA 3SGDH 1CT8B 4JO1L 3B3IA 2ZNXA 5SWSA 3O2WH 4A6YA 1RUQH 3D3VD 4ZUSB 2DQJL 4KTDL 2Q8BH 2P43B 3OSKA 3BKJH 5BCAA 1FIGL 2GK0B 2ZUWA 3V8OA 4U1SA 4EIGB 5BRZE 5TDPB 3DXAD 5GISL 3C5ZA 4QF1B 4P46C 1BHGA 3FQXB 4NCDA 1KPVB 1VDGA 3IKKA 3S7GA 1NCAH 3QDGE 5EU7C 1DFBL 3HC3L 4KK8C 4UIKH 1CTNA 5B39A 2DYPA 4LLQA 3T8XB 5H37H 3QUMA 3BPNB 3K1DA 2FGZA 2HJFB 3I2CL 5KS9F 3MA7A 3BHBA 1NC2A 2CH8A 2KKQA 4MAYA 4X9FA 2FJFA 4A6YH 3NA9H 1KOAA 1AE6L 3QBTB 1ZT1A 3UTOA 1UM4L 1BQLL 1OL0A 1Z2KA 1CGYA 1A6VL 4S1RL 5DK2A 3RRQA 2ZCKL 4LVHB 4O2FB 4CJ1A 2Y36H 1II4E 3V6OA 2R1WB 2DKMA 3KPSA 3CFCL 3IAPA 1HDMB 3TZVD 5I66B 2ESVD 3MO1B 3QUMH 5E2WL 4OFDA 3AB0B 4H25A 3MR9A 5I1DA 3RWEA 1ZEAL 4BSVB 1NMBH 2NW3A 1JV5B 4RAVA 1NKRA 2PW2A 3SO3C 1NCDL 2WUBH 4C56A 4LGSB 1NCBL 3VFMB 4H0IA 3QUXB 4LLYA 2B5IC 1JGEB 1FN4B 1MF2H 4HZAA 3IDMB 4NNYB 5DHVA 2B2XH 1B6UA 5E4IA 3BYYA 5I75B 2FD6H 3ARBD 2HH0L 5JXEC 1S78C 1CFVL 1LNUB 4NHCL 5EZJB 3BE1L 2B4CC 1XCTA 2BRQA 5IOPB 5I71B 2UVFA 1EJOL 3QUZC 4EUPA 2CDEA 1KGCD 3LHPL 2VH5L 1Y0LB 4XPAL 4LSSL 5I9QC 3CX5K 4HSQA 3PV6B 4KK5C 4CN6A 3C6LD 3QDJB 1ROWA 5GS0C 3UPCA 1UM5L 5I2IA 4YHML 5GQBA 1UZ6F 4KI1A 3DO7B 1J87A 2MFNA 1XGQB 3T0XA 1NCCH 1OAUH 1MNUL 4YPGA 1NGZA 6FABL 1JF5A 4EUPH 1OM3H 4KI5E 4HG4K 4LAJH 43CAB 1A3RH 1IQDA 5C0DA 5JQ6L 3CDGA 4UNTA 5DURD 4UDTB 3SDYL 1S7RB 2B4CL 2DRUA 4GUPB 3WHXB 1G6RB 3OB0K 3V0WL 4X6EB 5FYJL 2HFTA 2F9BT 5C0JB 5ENWB 1JGLH 5ETUA 4WFHD 2NXZC 1INQA 4R4BA 2BCKB 5IEKA 5DFTA 3DSNA 4G5ZL 1X4XA 1J10A 3FRUA 1FYTA 3GHBL 5GS0L 3U0WL 4FQCH 5DEFA 1ETZB 1HN1A 4GO6B 2EEAA 4PS4L 2Q86A 3SE8L 4MAUH 5C6TH 5KVGH 3VXNB 3PDDA 2MMXA 5JZ7D 2VXVL 3RTQC 3ARED 1AY1H 3ZDYF 4ZSOA 3DOSA 4EI5B 3FQRA 5EA0L 1BM3H 4BZYA 1KCSL 3CFEB 3BZFB 1ZHBB 4PIRF 5DD6A 5CHNA 5D7KD 3KPTA 4IRSA 5EZOH 1OF2B 3OAZK 4LARL 4LNVA 5F9AC 1MJJB 3O9WD 1JRHH 1P9MC 2BVQA 3U4BH 5FV1L 4MS8D 5IQ7H 2Y5TA 4KUZH 4MVBD 1FNGB 1SY6H 3L7EB 3U4AA 4OF7A 1NMAL 3W82A 3IVKA 2PTTA 1NGQL 3O81A 2D31B 1F42A 1OARH 3MV9B 4WV1A 5KN5A 4LVEA 2JIXA 4XP9L 4MXWH 1NUFA 3HE6C 3O8XC 4WHCA 4LCUB 2QQNL 3P9LB 4J8RB 4X5XA 4P5TD 3TA3A 2Y72A 2EKJA 3MRGA 1U2CA 3HFML 1Q38A 4HUXB 1BAFL 1KIQA 4CNIA 4OQTA 1G7HA 4XBGA 4HG4J 2CD0A 1WCBB 4JFQB 5GHWL 4F33A 3G6JE 3FZUC 1W0WA 3BKYH 4HAFA 2IC2A 2VQ1B 5HYSG 4U1MA 5FCSH 3G5YA 3WLWD 1FC1A 1E27A 5MEPA 5IT2L 3KPLA 2LU3A 4TPRL 4OLWH 5DS8B 1I8MA 4MNQE 4JKWA 1RK1B 3SJVE 1T7WA 3DUSA 3C2AH 2XNAB 3E8UH 4KMTH 4K3GA 4MXVE 5E94A 2AXJA 1JWMA 4OQTH 2W0LA 2J5LB 3HZVB 5E8EB 4YDJB 2B1HL 3VWKD 5J12C 1M05A 5A2KH 1ONQB 4LHQB 1JPTH 3SOBH 3LMJL 3LKPB 1MY7A 5EZIL 1N7ML 3LAFA 1QRND 4FFVD 4N8VG 2HT2C 4HULB 4AG4L 4HPYL 2DBLL 5HHNB 4KROB 5TFSL 2X44D 4Q0XL 5ACZA 2DIJA 1JUFA 1G7PA 4OFYA 5DD3L 1KEGH 3IFLL 3ARPA 3RGHA 4OLVL 3W9EB 4LOUC 4HFWB 1ZS8B 1KCKA 4PJAF 4IRZH 5DRWB 3GMNB 4GS7B 2XWBB 5HYFA 1FFPA 1KLGB 2BNQD 3GMPA 1R3JA 1GIGH 4LSRL 1YPZF 2GW5A 2VR9A 4G8GD 3L3IB 2XN9E 2E7MA 1JHTB 2A6IA 2FYYB 1T20B 3KDMB 5JMOC 3HB3D 5D7SL 1KLUB 2YOCA 1O5DT 2OX5A 5F1IB 3GSWA 2W9EH 3LKOB 2IPKA 1YN6A 4PGJA 2VL5B 3I6KA 4FZ8L 1CU4L 3C5SA 5D6DA 4RGOL 1EV2E 4GW4A 5IV2B 5ABDE 3VE0B 4LAQL 4HGKC 4JFFB 1FVDA 3QEGL 5EOCH 1DQML 1MRCL 2X4RA 3VFGH 1I8KA 2VLRA 4Y2DB 2GCYA 3E6HB 4BFIA 3IDYB 4BK4A 4PRHD 1RZFH 1WTLA 5EC2B 1KN4H 2AEPL 4PJ8B 5GZNC 4UT6L 3QDMB 4P23D 2AEQL 1NL0L 1HILB 5D2NE 1G7LB 1BZQK 1ZGLB 5KSVA 5GJSH 3DHMA 4LKXB 2DQCL 2WBWB 1HYSD 1QYGH 4PJEA 3UTZA 2VWEC 4HKXB 1YJDC 1LO3L 5T1LB 1XGTB 1IC7L 5E5RB 3SE3A 4KV5F 1VFAA 4R4FL 5BV7B 3ZYOA 5DD1L 3ARBC 1UENA 3BEWA 1MQ8A 2EE2A 2E9IA 4GXUM 3MRJA 4UIMB 1PKQB 3W11C 3ZKQD 4KFZC 3TIDB 5HBBA 1J1XL 4ZUVA 2XY2A 4C58B 2WZPD 2X70A 3MRIB 4OZ4B 4JQVA 1QG3A 5AZ2H 1LP9A 1C5DB 1CR9L 4EI6B 3L6FA 3O2DA 3LQAH 4D9QE 1DN0B 5EBWA 3TO2B 1CFTB 2A74B 4HUWA 4MX7A 4MGXA 2IANA 5I17B 3VXRD 3Q6FB 1EFXA 1NSNH 4FXKA 4JFDA 4F8TA 4OB5H 3JV4B 1EAPB 5A3ID 1OTSD 3QWQB 3UJIL 5IF0A 5AUMA 3HS0B 3WIFB 5DEGA 1YJDL 4RFNC 4X6CB 3ARTA 3U7AA 1PG7W 1FNAA 3SKNB 3MRPA 3AM8A 2H32B 4HWEH 1G9NL 2R0ZL 3SCMC 3SHSA 5K9JH 1DLFH 2DTML 5D1ZD 5E6IA 1JIBA 1K6QL 3MCG1 4M43H 4MLSA 5FYLH 4APQA 1E28A 1UVQB 1I8IA 4WW2C 2GYSA 4E41E 1OWWA 1V3LA 4HWBA 4QRSA 4UUJA 5ESQB 3KYAA 4DUWA 1Q9LB 3QIUD 4N0YH 1M71A 1YNKL 3B9EA 1JWUB 3GGWB 3O2VH 5CGTA 5HDBF 4M1GL 4J3VA 2Z31D 3KYKH 2NX5B 5HHVH 2XRAL 4P2QD 2I9LA 3UO1L 3WKML 1KJ3H 3MUJA 5CGYC 3NAAH 1OP3H 3BRFA 2DQIL 5EBLB 1HHKB 4LLAA 2UV3A 1RK0A 2X4TB 2ZSWB 4B0MM 4Z78A 5BXFB 1IFHL 3NZ8B 1F02I 2R4RL 3RPIB 4L4VD 1KPUB 2MQCA 4F9LC 3IB4A 3GSNA 4YGVB 4KHXL 1CFSA 4OCYL 3A67L 1MCFA 4K9EC 4L9LA 1PZ5A 2HYMA 1S7TB 2EIDA 1GPOL 1XF5A 3SGKC 5EUOA 3BQUC 1GZPB 3JVGA 1CI5A 3VRIA 1HNFA 4OIIL 1JPFB 4LQFH 3HNSH 4GW1A 3MNWB 3VG9C 2P5WE 4D9LL 1EHAA 1MCJA 2ADFH 4M7KL 4NO5A 4OGYH 5J11B 4MVBC 3ES6B 1T21B 3MRDB 3P77B 1MREH 3ZKNC 3GSNH 2H41A 5SWZB 2NY2D 3SKMB 4X8JA 4LF3B 3UTTA 1WLHA 2X2YA 1RURL 4PD4K 4IOFD 4AEIL 3BYTA 3L5IA 5TJWK 4OD1L 1M7XA 1XIWA 1ZAGA 4MNGE 4XCEB 4DEPB 4WFFD 5I76A 1NEUA 1R3KA 2CLZA 4K7PH 1KTDB 1PAMA 2PR4L 3L1OL 5I8OL 3NCCB 5DJ6B 4K9EL 4KXZH 5J6HB 4FA8A 4NQED 3ALXA 1FDLH 4HV8B 4OGXH 1KYOJ 3V5KB 3VFUB 1YEHH 4H8WH 1I1AB 2NLJB 2VDMH 5DRXB 5FKAB 3TGXA 5DQJA 2E6QA 5TF0A 5E1HB 2OJZL 4CRPA 1LMKA 1RJYA 3SDAD 2ZUTA 3GHEH 2O5XL 5HGDB 3D85B 3W9DA 4F2MB 4N0UA 4MJID 5D7JD 3WLWC 5JR1L 5ISZB 2IMNA 2VDRH 2HN7B 2J8UA 1AXSB 5AZEH 3O6LL 5SWSD 4M5ZL 3SDXF 3W39A 3K1KC 2FATH 5DO2C 2ZSVA 2YUWA 4OZIA 3DMMA 4O4YL 4CVWA 4FP8L 3TPKA 1LE5A 3HG1B 4OSUH 2HT4D 3U36A 1NBZA 2E7HA 4GMTL 1R3HA 1FZJA 2CK0L 4JQXA 4KRNA 2VDKL 2W9DH 4PJGE 4WJ5B 4RAUB 1YEDB 1OQOA 3QEQA 4FFVC 4L3EA 1LDPL 2IH1B 1TTUA 3O11B 5I1CL 1NC2D 4XP4H 4LVOB 4MAYD 3T0BA 5I1JL 3SGJA 2UZIH 1A1OB 2F5BH 2VDPL 3PGDA 3WS6A 4AH2B 2ARWA 4JM4L 1DUYB 2AJZB 2LV4A 3EYFB 3SQOH 1DEEA 3DGGB 4Z7VF 3KJ4C 5HYSB 2CUHA 1GSMA 5HVHB 4M61B 3OXRA 5EU4B 2QQQA 1FL3B 2F8VA 4JVPA 1QFWL 2NXYB 2FBJL 1MCHA 3AVEA 5GSRA 3MOAL 3DURB 1CE1H 3LEXA 2NTFB 5D7IF 2AJYH 2COQA 4Y4FC 4C56D 4WO4A 1PW3A 2VRAA 4PPTA 1AP2B 4PLKD 5DR5L 4M6OL 2VLKD 3RUGA 4R7DA 2V2XA 1K4CA 1AGBB 3TBWB 5LQBL 3QIWC 4PV9B 1SMOA 1OGTB 1SBSL 4N8VB 1W2KT 2XKNB 1E6OH 4XMLH 5LGJB 1XF2A 1FL6A 4U0RC 4JVUA 1AXTH 2XA8H 1AIFB 4ODVL 4ZG1A 1FFOB 2A1WH 4PB9H 4WHTA 4NO0D 1YQVL 2R69L 5GRXG 5A2JH 1T1YA 4Y4KC 1JZ8A 2C3WA 35C8L 3P9MB 2ADGB 2O26U 1ZHKA 3OL2A 5D9SA 4JDTL 1A3LH 1BECA 2FJGB 4KDWA 4P23C 5F97E 3OG4B 3VD3A 1F3DH 3QP3A 1U95A 1EA9C 4Z0BH 1JHLH 2XTJB 3UPRB 1GCFA 5F1SA 1A7OL 2AV1B 4IHOA 3QUKA 2GHWB 1AGEA 5JW4R 1J1OL 4I9WD 3N1GC 2VITB 5IEHB 5E9DB 5JNYB 1HXMB 4YX2H 4JFEA 2F53B 5C0ND 4EN3D 3VW3L 4DOHE 1CXHA 5KSBB 4XRCB 1IGFH 1YUHB 1BF2A 5J1SC 1YNLL 2UWEE 4PGBA 3RY6A 4JDVB 3P0VH 5C08E 4JRXB 1AQDA 2G2RA 3QCVH 1ZWIA 3ARUA 2NY7H 3D9AH 1NCNA 2QQLH 2J4WH 5CEZE 2GTZA 4M9PA 5DHXB 5IJVA 3QI9C 4NQVB 3G08B 5B39G 4XCYB 2V7NB 4HC1L 2VUOA 5DA4A 4U1JA 3VMOA 3UZQA 1SJEB 3FMGL 3ZYJA 1SYSA 4LU5H 5F9JB 4G6KH 5A3IC 1FVCA 3K81A 2WUCL 3DVNA 1J11A 1ACZA 4GXVL 2MCPH 3B2VL 4OM1H 4R2GB 2XXCB 1H3WM 1Z5LA 3QUYA 5T3XD 3F5WA 4XCNB 1QP1A 5I0ZA 3DI3B 1I3UA 3WUWG 2WIIA 4I18A 3LKSB 4O58H 1B0GA 1W8OA 3MBED 3B9KC 1YMMB 3MNZB 4OCWL 4K55A 4PJBE 1RD6A 2Z91B 3NACH 5D1ZC 2NQCA 5F7LB 3MC0A 4U6HA 5HHME 3CMOL 4U6VH 4PFEA 5EWIL 3LB6C 4FZEH 5GZOC 1CQKA 3GBMH 4M62H 4D0BB 2YPVL 5IWLA 4TSBH 1Z0MA 1VGEL 2DD8L 3WNKA 4PB0H 3VXQB 4WWKA 3PWJB 4JY5H 4FMFA 3QH3A 2V2TB 1F3JA 4PJFA 1XCQA 4QHKJ 3UTPD 4KU1A 5I8CA 5SWQA 2JE8A 2EXWD 3DV6B 2AS5M 2ZG1A 1P7QA 2R2HB 5E1AB 1OD7A 3GSUB 5I73B 4DZ8B 2VC2L 3OKKA 3KPPB 4QRRD 4AQ1B 4ENEC 4JZNA 5T5NG 4MQ7B 5C09B 5JOPE 3SDDB 1QBLH 5DC0A 1TZIB 3EJYC 4V2BA 3BI9X 4W70A 2AJSH 3NBNA 3QFDB 3P30L 1VFBA 2PKDA 3ZSTA 3E2HB 4G42A 2EYRA 4G8EB 4IIQC 3W0WB 1IBGH 3TA3D 3LKRB 5DQ9A 4LSVL 4R4ND 2KPNA 5GS1A 1IAKA 1OGAE 1UXWB 5EORH 2M8XA 1UH2A 4JFHD 3DV4A 4YPJA 2EDKA 3VGGA 4MD5A 4D8PA 3MZTA 4TSAL 4YEFA 4QHLA 3I75A 3DRTB 1S9XA 1IGIL 4ODUB 1O7SA 5GRYA 3QJFA 2D7QA 2ZUVA 2C1PA 1A64A 3NFSL 5ILTL 4M7LT 1EUTA 4J1UA 5H35A 1JF1B 1S7SA 4Y16A 3SKUD 5KZCD 1OPGH 4J3OC 1BD2A 2HG5B 3ZDZE 5I1GL 3LVEA 2CKBA 3D0VB 3QFJB 5FHBL 1X9QA 4UNUA 4OZGB 1ZA6B 1U8NB 2EYSB 3VFTB 4DKEH 4HUUA 2W60A 1D5MA 3HMWL 3VXOB 1UYWL 1GGIH 4CKVX 2AEIT 3O4LB 1JVKA 3MRHA 4S2SA 5C0AA 4PGCA 3C60B 3ULUD 3SEPA 1MPAL 1PD6A 3SDAC 3MLUL 1LD9B 2C5DC 1M6OB 3VFRB 5CIPA 3GBNH 4Z7UA 4DWHA 3MV01 4JPKL 4MNHB 4DGIL 2GFBA 2B0SH 3UROR 3ARGC 1R3LB 3PL6A 5C2UB 5IM7B 3NTCH 4FQIH 3BN9D 2OP4L 3VJ6A 3KVQA 2CLRB 1G6VK 3LPGA 4OFYD 5FDWB 4Z0XA 5TQ0L 4HWNA 1ACYH 4ZUWB 2OCFD 2H2PC 3L3DA 5I8KH 5L6YH 1D5BA 1AO7B 4LSQH 4LCWE 1JGUH 2MPAL 2DN7A 1QSEA 1TJIL 3G9AB 4TUKH 3EYVA 4FNLH 5KS9E 3QRGH 2BOCB 3GBLA 1KCLA 3BEVA 5FYJE 5CIPH 3LRGA 2EH8L 4BFBD 4MB4A 4NKMB 4WFEE 2PO6B 3WS3B 2R1YA 7FABH 2ZUSA 5CZVL 4X7FC 5FUOH 1AD0B 3G6DL 3D0LB 4HJGB 3OKOB 3OBAA 5DRNB 1WISA 1FLTX 3HAEH 4M7JH 3BPNC 2MNUA 1KIUA 4KHTH 1DANT 1L0XA 2GJ6E 4N0RA 4NZRL 5TDNA 4I3RH 3WDHA 2NY1D 2Q7NA 4Y5VB 2XKSA 1I85A 3MFFB 3BPCB 4RBPH 4XGZB 3TO4A 3WLBA 3BW9A 4HXAH 2VDQH 4N9GA 4WU7A 2EDXA 1WICA 1QR1B 3MRFA 1J05A 1DDHA 4LVHC 1U8LB 4FQ2H 3THMH 3B6SA 4NKIL 4ZFFB 3U0TA 2UZYB 3AB0C 4G8IA 2VDNL 1KSRA 5A16A 1MHCA 3C2SA 1YNTA 1P6AB 1IM9A 4J3TA 4LP4A 5J1TC 3PWPB 1S7QA 3TH3T 1CK0H 4F3FB 2ZJSH 3QUXC 4S1SH 3DECA 4OAWB 3UX9B 1I7UA 5EU3B 4Z76A 2PXYD 4TTDD 5I75C 1G9MH 1UZ6E 2Z0BA 3MUHL 3S37X 2QQKH 3QRFM 1I9RH 4XCFL 1F5WA 3DYMA 1DSFH 2EC9T 5KVEL 2I5YH 2P8MA 5I71C 1FJ1B 4P2CG 3V6ZB 2QADB 1KBGH 5AAWA 3NABH 2BNRA 4HJJL 3DX9B 3HUJA 1EFXD 5TDOA 5D71H 1A6ZB 2AJ3B 5CS7A 1UA6H 5MEQB 2WAHA 2JB5H 5HYJE 4Y19A 3DI2B 1KCUL 2H26A 4IBLT 3GMRB 5HI5D 4MSWB 1KXQE 5ALBL 2NY4B 5M95B 1LK2B 4L9DA 4NC0B 4UILL 5HHOE 1ADQH 1YY8B 2D7TH 4YHYB 1RZKC 5FK9B 1AD9A 1KTLA 1A8JH 5EOCJ 3EDDA 1XH3B 3BP4B 3V0AC 4APQD 1QO3A 4RGND 1INEL 1FG2B 4IM8A 5L0QC 1FE8H 3O6FB 1IE5A 3LEYL 5DVNA 3WFHB 3DYOA 4ZO7A 4JPWL 2W59A 1ZXQA 1R0AL 4KK6C 3KWWB 1DBML 2BVPB 4BZ2H 1SEQH 1RV6X 3IU3A 3MUGB 4PYHA 3ZDYE 3TEUA 5HPMA 2OSLA 2RIKA 2R2CA 4GLRI 2ITCA 4OGZA 4OLUL 3WJLC 5C6WH 5EZLA 3EIFA 3IXAB 5DJCB 2EIZA 3FTGB 1ULVA 3H8NA 4NZJA 1IT9L 4UI2A 1X5KA 3OJDA 3B3IB 1XGUB 5BRZA 4A6YB 2IBZY 1RZKL 3FFCD 4KKAD 4ZFGH 1D9KB 1E4WH 3C5ZB 2YD3A 4EI5C 4X4YA 3MODL 2QEJA 1KELH 5DI8B 1MOEA 5HDQH 1I8LC 4R0LA 2FHBA 2X4UA 1G6RL 5J13B 5B39B 2DYPB 3CFJB 1LE9B 3RVWC 4YAQA 3QHTC 5C07E 4Y5YA 4MA7L 3DVIA 3BKML 1KN2L 4C57C 2FJFB 1MCKA 2YXMA 4HBCH 4DN3H 1ZT1B 1XIWD 2NR6C 5C0EA 3TBSB 3ULUF 1UXSA 1R6VA 2AI0L 2WLZA 4XVUC 1MHEB 4OJFH 5GGVH 3S96B 4U33A 3MJGX 2WV3A 3ROLA 2VYRE 5DJ0A 5DMKB 2GIYA 1DANU 5C2BL 1NJ9A 3KPSB 1LO2L 3D3VE 4GSDL 4OV5A 5CUSH 4F8QA 2XQBH 3FN3A 2OR9L 4L3CA 3DXAE 3HI5H 4H25B 1WIPA 5IIEB 1XGPA 3J7HA 4RAVB 5FECB 2R1XA 2PW2B 1CZ8L 2VSDA 3X14A 5BS0B 1AI1L 4LLYB 3BUYA 1NANH 3T1WA 1IKFL 5L9DL 5I1EH 3STLB 3EOTH 1EJ6A 4M3JA 4RMSA 5BVJA 4KJPC 5DJ2A 2C4FU 2V17H 4AENA 4Q9RH 3DMMD 3JTSB 1HHHB 4GAGL 2CDEB 4OM0L 4Y8AA 4L4TA 1UB5A 3H0TB 4Y5XB 5L2KE 5JW5A 3OJVC 5E8PA 5FUZL 3KHQA 2ESVE 3QIBA 1C16B 2DM7A 1S5IH 4ZD3H 2EC9U 3ABZA 1RY7B 1IAOB 3PXJA 4XTRD 2JJTC 4L3ED 5A2FA 1A47A 2Y4SA 5D1QD 4GBXA 4J3WA 1QD0A 3RGVD 3BN9C 3IDNA 3S36L 5KTEH 4G8FA 2YA0A 3GNML 3BAEH 4IOIB 2VWEE 4PJAE 4DGYL 1Y18A 2DAVA 2IH3A 4POUB 1BBDH 5TPWH 4NO3A 5FCUL 4KROC 3V4VH 1B4JL 1E4XI 2A9ML 2OR8A 3ECBB 2JJUA 4PJEF 1YPZE 1VB9A 4J3XA 4JM2A 4IOSD 3Q1SL 1IQWL 2FLRT 5I19H 4OLYH 1KGCE 4UV4H 5CILL 2UY6A 4DK3A 1HWHB 4ONFL 2IFFH 5ETUB 1YEKH 2Y23A 5HYIA 1INQB 4R4BB 4WO4D 5IEKB 4ZFZA 3FQTA 4GS7C 4XCCL 1FYTB 4HIIA 1LP9F 5ALCH 5CBEB 2UUDH 3TN0A 1B88A 1JPGB 2Z92B 5JW4M 4TRPH 2FH8A 1A4JA 2HWZH 2NY1C 3LZFH 3P4LA 2X4NA 2BERA 3FQRB 4YXLL 4LNRA 3IS0X 2E3VA 1RU9H 3QT2A 2CRYA 2R0KH 2IF7A 2VZTA 3V7AG 5DD6B 4UTAH 4PRNA 3FCTA 4KV5E 3VMPA 2IPUG 3GJEA 3CLFH 4QRQA 1RUML 4IRSB 4K94H 1A7BA 2GAZA 3ARVA 3MJ9L 4Y2DC 5E8DH 4RFEB 4WFHE 5JOFB 5J6GA 3L7FB 3IDYC 1VEPA 4KJQC 2BVQB 4LHUD 2NY6B 4PJ8C 3PDGA 3FB5A 4Q74A 3FB8A 2Y5TB 3HRZA 1AFVH 2D03H 1MCCA 1IZKA 3D39A 3VFWA 3UAJC 3U2SA 3ILPB 4DFHA 3T0AA 4I0PD 4QTIH 2PTTB 3IVKB 3QG7L 4ZO9A 1OD9A 1UT9A 3VFNA 2PXYC 3OX8A 3RKDC 1H3XA 3G04B 1VENA 3HMXA 3CNKA 5BV7C 1TZGL 4G6ML 4WV1B 4E5XB 2JIXB 4M93C 3JXAA 2X9YA 3F12A 2ZKHL 4GMSH 5D72L 1D5ZB 2YWYA 2HVJA 1QLFA 4WHYG 5AWNH 1MAJA 3M1BA 3L95B 3GDBA 4ZUTA 4YDKL 3T2PA 1B9ZA 1FBIH 3T08A 5GS2D 1VCAA 2VDOH 5D7KE 1FNEA 1G7HB 4XBGB 4JFZH 1F97A 5ICZA 3MTRA 5SV4A 4GQ9L 1E6JH 4HQQL 3TV3H 1N2RB 4MDIB 3BOVA 3H9HA 2YC1A 3I3DA 3HMXH 4ODXB 5EUKA 4QHMA 4F33B 1CLOH 3I84A 1A6WH 4ZQKB 3LH2L 4JPIA 2FWOB 2Q8AH 2VLJA 5JA9A 3TT1H 4QOKB 3A6BH 3BUTA 3G5YB 3ZKMC 2L7UA 1KG0A 3QQ3A 3RU8H 4MNQA 4XP1L 1OAYH 1MWAB 4WRLA 3SJVA 2Y9RT 3P4NA 3KPLB 1K5NA 1PX4A 5C6PB 4MQSB 5LWYL 4QRTA 3CH1B 5HDBE 1RZIA 5GGTH 1BJ1J 3DUSB 3PV7A 1JI1A 5LBSL 5BV7L 1WWAX 4AIOA 3MLWL 2W65B 5E94B 5FOJA 3V4PL 5LCVL 3KYMA 3OPZH 5SV3A 1F3DJ 1CL7H 2C26A 3ULSA 4MCZA 3NCYP 1WTGT 1WC7B 4P9HH 4U6TA 3RX7A 1WQVT 4ZS7H 5FGCB 4JG1H 4KPHL 3RWJA 4H88H 4NRXB 3VI3F 1F90H 4PV8B 2VABA 4YXHL 3E6FA 1BFVL 4NBZB 1VADB 5ACZB 2VXUL 1JUFB 1G7PB 1QFUL 1N64H 3X3FH 3N50A 3EDFA 1NCWH 1DLHB 3K8MA 3PWNB 3JWOH 4CVZB 4N68A 4KKAC 3GRWL 1YEEL 4ZS6D 4NN6B 2EIEA 5E99L 5GRJH 5FGBC 3T77A 3MCLL 2AGJH 5JQHC 3WIHL 4BFGA 4UT9H 4Z95L 5B38A 4G80B 4M48L 5ESVB 4CJ0A 1R3JB 5C0FA 4ONGH 2F8XC 2AJVH 1E4KC 4OZIF 1MIMH 1XGYL 3AY4C 5T1KA 2A6IB 4LGPB 4NQSA 1QBBA 4K3DL 4X6FB 1QRNE 1LVEA 3GSWB 5EIIA 2VERN 3MGOA 5DK0A 4HS3A 3X12A 5IBLC 4L8CB 5J11C 3CH8A 3MA9H 2FH6A 3I6KB 3KXFD 5HYQB 1U3JA 2OI9C 4PP2B 4YDIL 2Q87A 2OYPA 1NFDB 1YECH 1XAUA 1V8HA 1BVLB 1FVDB 4RMTA 3CC5A 2A0LD 2VN4A 3BX7C 4NPYA 1I8KB 3QPQC 1EHLH 4DEPC 4ESKA 2E8ZA 1VKXA 4JFPA 1C5BL 4BFIB 5BQ7A 1ZLSH 5JIKA 1IC1A 2D7OA 5C0AD 1RIHL 2FO4A 2YEZA 2H9GB 2Y1VA 4LRNL 5E2TH 4NN5B 4XH2A 2BNQE 4BM7A 4PG9A 4OD2B 4ZPTA 1F4WH 3BDYL 4JFOA 1I1AC 4JR9L 4XPFL 3R0NA 3SDXE 4G8GE 3RDTB 3PL6D 3S97C 4DKFH 1CFQB 1BQSA 2I60L 1CGXA 1OTTD 3ZE2F 3MXVH 1VFAB 4PJHA 3C60D 4JB9H 3T4YA 3TPUA 3DIFA 1MCWM 4EDWH 1C12A 3RZCA 3MRJB 4JHAL 5DC4B 4DVRH 4FQLH 2R9HD 4UBDC 4ZUVB 3U9PH 3RX5A 4BZ1L 4I2XE 3AS2A 4ZFOA 3WUZA 4MZ3A 4PRDA 2JELH 3QWRA 4MZ2A 3VGHA 1OOAA 4MD4A 1RZJC 3QO0A 1RJCA 2HVKA 1MCIA 2P8PA 2ZCLL 3L6FB 4WW1A 4YE4H 3P4MA 2GTWA 4ODBD 5EBWB 1A7RL 3ZT5A 4PRHE 3EO0A 4HUWB 2IANB 5FO9A 1V7ML 3VD4A 4JFDB 4NJAL 5D1QC 3NN8B 3WIIL 1VACA 3RGVC 2OBGA 1WEJL 4Z7VE 2ZCHL 2NYYD 3VG0H 5IF0B 1HH9A 4G9FB 4I0CC 1A6UL 2YD5A 1N59A 1T5XA 4Y2OA 5DEGB 3IJYA 4OIAA 3HI6H 4L8BA 2XZAH 4ZTOL 1UH4A 3A0OA 3C8HA 4FTVD 5T3ZL 1A7NH 3MOBL 5DGRA 4KVCL 4LVOC 2FJHB 5BO1L 2Z4QB 5D7IE 1NEZA 4HMEA 5DJYB 4JN1H 5E6IB 1GJIA 4WWID 4JZJB 3ARXA 4L8DA 1E28B 4U1IA 4HK0A 3VA2C 1Q9OA 3UTSD 3SGEH 1LEKA 4UUJB 1RZJL 2WQ8A 5F6HI 1R3IL 3EYUH 1M71B 3MCKA 4M8QA 1UKSA 3BKCL 4CVXA 1S8DB 1X6NA 3VXRE 4BH7A 2FX9H 3C5JA 4OV6F 5E6ZA 2NXYC 4P4KD 4FQXB 3CDYA 3KLHD 1IM9D 2HTLD 3DX8A 1RK0B 5J9PA 1FRGH 4XC3L 4KGJA 4PRPB 1MFAL 2D9CA 5HGBA 1I3GH 3MRQA 1XR9A 3GSNB 1PSKL 1CFSB 4L9LB 1HHGB 1PZ5B 5DJDA 3PWPD 3CPLA 5J3HC 5EUOB 5D5MB 1GGBH 3KYOA 4BKLB 3C9NA 3BESR 4XNQB 3BGFB 5IFHH 1NAMA 2BNRD 3ALWA 2P5WA 2E7LA 2W0KA 4BQCA 4F9PC 1JNLL 5BZWB 3CVHH 4E0RB 4OCSL 1I9JH 1TETL 4ZXBB 4NO5B 4P2QE 2BNUA 2XTJC 4KZEH 4BH8A 4W4OA 4HIEA 4LFHG 5CGMA 1QQDB 4X8JB 3UTTB 1BQHG 4MNGA 2ZWLT 2ORBH 3HAEG 4U1KA 3OKLA 2EZ0D 5EU6D 5H2BA 4LSTH 5I76B 12E8L 4L4VE 4PJ9A 1IAIH 3EOBB 2CLZB 4HXBL 1BFOB 2B20A 1D5IH 3GB7B 4GAJH 5EO1B 2HA1A 4F37F 5C7XL 1OAXH 1RFDH 4B5EA 1Q72H 1I3RA 1S7VA 2ED9A 5MP6L 5FO8A 5DQJB 2DMCA 3H3BC 5TE6L 1WITA 1RJYB 2BFVH 5I74B 3DSFH 3OR7A 3ZTNL 1CF8L 5ADOH 1NKOA 2LQRA 4ISVB 5KVDL 2P46B 1O7VA 4IDJH 4JO3H 4R2GC 1OSZA 2FHCA 1BX2A 1U8HA 2YS4A 5JIPA 1GL4B 4OT1L 1KJ2B 3GSOA 3VGAB 3W39B 1LK3L 2ZSVB 4OFIA 1LEGB 1FLRH 5DFVC 3MLPA 1F4XL 4PJGA 3U36B 4Z7OF 5F7MC 3H9SD 1FO0B 1NBZB 3MLSH 4NQEE 3WL9A 4RZCA 1UB6A 3UMTA 1R3HB 1T22B 1FZJB 2XY1A 5DD0H 2MKLC 1G7MA 1H5BA 4XXDA 3WFDH 2GSIA 3QEQB 3B5GA 4QXGL 5DGQA 3REVB 2P47B 3GKWH 3D87B 2GI7A 4UU9A 4W4NA 3PIQA 1CBVL 5DJZA 4EXPX 5IJKA 3PGDB 3QWOB 4MJIE 1AR1D 5I73C 1U6AH 3H3KA 4FS0A 1BPVA 1NC4A 4EXKA 3Q5OA 3HC0B 3T3PF 3WDJA 2DOCA 2V7HA 4ZS6C 3SDDC 4NRZA 1YEFH 5DFWH 1PZUB 4Z7UF 2H6PA 3FHQA 4YHIB 5I1HL 3BH9B 5SWSE 3TFKC 3TVMA 1U8IB 2EE3A 1C7SA 3MLVH 1MH5B 1DUZB 3OXRB 5LGHL 1UM6H 3X11A 3BMVA 1F58L 4WEUD 1Q0XL 3E2HC 5I1AB 2CJUH 5GSRB 2XZQH 1QPPA 3LEXB 5D7LD 2CDGA 4TNWK 3RA7L 3L3KB 3ULVC 3WO4B 5IB3A 1UWXH 4U1NB 5I1IL 4R7DB 1K4CB 3O3EB 1F8TH 5HHQA 1AGFB 4GRLA 2Z35B 2LTQB 1EZVX 4H20H 3IJHB 1XF2B 2NPLX 3TNNB 3GJFA 2E6JA 4EVNA 4WTZG 4XWOD 2DMKA 3AMKA 4WHTB 1BBJA 2AVGA 1FZKA 1J0YA 1U9KA 3LS5L 1LDSA 1T1YB 4L4TD 4M5YH 1T0NA 1MCBA 4XMPL 3V6OE 3M17A 2ZNWA 3QO1B 1P1ZA 2APWA 1ZHKB 5IVOA 2H8PA 1JGVH 5J57B 3UBXA 4JG0H 3BP7B 3IXTA 5F71A 3EZ8A 4IHOB 2DJ4A 4NHUB 3UYRL 4GBXD 4OF0A 1CXKA 3PABA 1MCOH 1FCGA 1T7ZA 4XC1L 3GJFH 1IGCL 4LLDB 3C60C 4JFEB 1TVBA 3ULVL 2VLKE 4IRJA 5FF6A 4TVPD 2FECI 5C08A 3HE7A 4KQ4H 4PREB 1JMXA 1MQKH 2P1YA 1AQDB 2G2RB 2P5EA 2R29L 4JQIL 4LEXL 4M6AA 4NM8H 3GO1H 1ZWIB 3MZGB 4JO2H 1I7TA 4YBLB 4XZUB 3C6SA 1N0XH 2OMBA 1WJ3A 4JY6A 3CFKA 2GTZB 4X5WB 4N8PA 1VPOL 2AJUH 1WBZB 3EO9L 1CICB 4YWGL 3Q3GB 3RNQA 1W0YT 5KOVC 3IDXH 2ADIA 4LPUA 5K33A 3U9UB 3DVNB 3FQWB 1GGCH 1EHNA 1DQLL 4AMKH 5E2VL 2D0GA 4I9WE 4XVSL 3QUYB 1EX0A 1UWGH 2H1PH 3T1FB 2PO6C 4PG2C 5CEZH 3HNVL 4NGHL 1LO4H 1NGYA 2X4PA 4PJBA 2IAMB 4MYWB 4I18B 1VFUA 2V5RA 1B0GB 2DMBA 2AXGA 4NUGL 4X7EC 1KNOB 4WIQA 4U6HB 1MIEH 4PRID 1WZ1L 4M4RA 4AEHH 4PGDB 5DDHA 2WBJA 3FAWA 2D2OA 2V5YA 5C92A 5B22A 1W0VA 3P0YL 3RP1A 3EDKA 4WWKB 1V3KA 4Y5VC 1IEAA 5J4MA 4HS6B 1F3JB 4PJFB 5JHDB 1XCQB 5I8CB 4GRWB 4RISL 3KPQA 5DUBA 1DZBA 4F7MA 4YBHA 2Y06L 4XPTL 1JYNA 3BSZL 4PY8I 4JO1H 4UTBH 1P7QB 2NY3D 1NDGA 3PJSB 3KLHC 3NPSB 3TWCH 4WEMB 3OKKB 3D39D 4L8SA 1FVEA 1F6LL 4ZYKA 4UQ3B 5T3XE 3GZKA 3AU1A 3D18B 4KUCD 4ORGA 3O3AA 1A5FL 1MHPL 1HIML 5GISH 2EDEA 1PLGL 3MV8D 3IFNH 5GRZA 3LD8B 4P57A 2IALA 1MFDH 3HC3H 4ZSOE 1F45A 4G42B 5D8JL 1OGAA 1YYML 3I2CH 4M1CD 1TQCB 1QLEL 5DQ9B 2EE9A 2I9TA 1IAKB 3S5LA 1HKLL 4P2RB 4BA8A 1TIUA 3VXUD 2MKWA 1I4FB 2J1KA 2HRPL 2HFGH 1E0OB 1GRWA 1MAKA 3UTPE 4DVBA 3INUL 2SEBA 1BQLH 4QHLB 3I75B 3JUYA 4R96A 2FSEA 2G60H 1A6VH 4PJCA 1DVFB 2X42A 4OGAD 2VLJD 1CXLA 4QRRE 2C1PB 5EFIA 3CFCH 4MNQD 4OUOA 4Y16B 4L29A 1BD2B 1U93B 4LKCA 1RIUH 4MQXD 3SE9H 5E2WH 3LV3B 4JDZA 3T0ED 2EO9A 1HZHH 2KL6A 2BK8A 1NFIA 2NY4C 3R0MA 1X5AA 3WHE0 3PQYB 4UT7L 4M6NL 2BVOA 1NCBH 4OKVA 1A7QL 5FO7A 2W60B 4YHYC 2GY7B 3AS1A 4LDLB 5E5MB 3AAZA 3O45A 2Q6WA 3MX0A 1GZQB 1HHJA 2WBKA 3MRHB 1WFOA 4PGCB 2YN3A 1JNNL 4HK3N 5ITFA 2OL3B 4JFHE 2HH0H 1Q0YL 3O6FC 4TUJA 2VKWA 5CIPB 2VN7A 3BE1H 5DZLA 4RMVA 2GFBB 1GC1C 2DLIA 3FT4A 4M4PA 3M8OL 2X1OA 2XI9A 4PUBH 2MHAA 2B8OT 5IHLB 2VH5H 4XPAH 1JGDA 2BDNH 4YDVB 4K2UH 4Z0XB 5JXEA 5IB2A 4DKDC 2KH2B 1BQHB 3L3DB 4ZO8A 4HX1B 1D5BB 2HT3D 3HAEB 2P44B 2FDBP 1JZ5A 1QSEB 4WUKL 4YHMH 2WQRA 3TJEL 1AKJA 1YC8A 3F58H 4X9BA 2H3NB 3QG6B 3LKNB 4P9MH 5T1MA 4LPWA 3PHQA 4OQ1A 6FABH 1X6LA 2EDWA 3UZVB 4F7TB 5EOTB 5F44A 1D9KC 4XT1C 5T5FL 3WKNA 2DB8A 1MVFA 5JQ6H 1KV3A 3IFOB 3ULUE 2R1YB 1E4XL 1D7FA 2R2BA 5T1KD 5EN2A 3FN0L 1MFEL 3O3BA 5J0BA 3Q0HA 2F54D 4Y7MA 2B4CH 3OXSA 2B39A 3O2WL 2X41A 1GC1L 3EJZC 2Q8BL 2Z93A 1HH6B 3QHZL 3V0WH 4RSVA 5FYJH 3BKJL 3G6AA 3NOIA 3VMNA 2BJMH 3WJJA 3PWVB 2AK4B 1T4KA 2MSPA 5TDNB 5C9JA 3REWA 1NCAL 3O41A 4UIKL 3WLBB 3TO4B 1LO5A 2AABH 5GS0H 3U0WH 4Q9CA 4N9GB 5E4EB 3BP5A 1CIUA 1WAAF 1J05B 4QXTA 4YHKL 1ZT4A 3L5WA 4JO4L 8FABA 3HZMB 5D93B 1CDHA 4G9DA 4A6YL 1PY9A 2HFFA 1GOHA 2WK2A 3CFIC 4UNVA 4HKBA 2APTA 3OAYH 1CVRA 1MHCB 1YNTB 4QO1A 3D69B 3RZCD 5ITBL 4XWOC 1EXUB 5CJ5A 4C54A 3OR6B 1TQBC 2YR3A 3N85H 1I7UB 4Z76B 3RI5K 1NMBL 4LARH 2D9QB 1P84K 4D9QD 4BJLA 2DQUH 2WUBL 3QA3B 2F15A 3H7BA 3SKJL 2QSCH 1QTYT 3OQ3B 1J86A 3ARFD 4S1QH 4U2YA 2B2XL 4WUUA 3HUJB 5TDOB 3B2UD 4QRPD 1IM3A 1DTUA 1LHZA 4Y5XC 4FFYH 5HYJA 1Q94A 4P3DB 4KJYA 2FD6L 5JDSA 4OCXH 1JJUA 5TE7H 4PJEE 3RVUC 1M7DA 3VWJA 3VI4F 4CAGA 4XP9H 1HNGA 4Y19B 4M02A 1I1FA 2C1OB 2H26B 5HHOA 1EVUA 4UDUB 3ARQA 2QQNH 3V5DA 2PTUA 5C0GA 2HKHL 1RZ8B 4UZGA 3HFMH 1AD9B 1BAFH 3GMLB 1RVFL 1HCFX 4YHNB 1T3FA 1QO3B 3RHWK 3HI1A 5B38G 4K7PY 2A9NL 3O8XA 1WFNA 2W91A 2ERJC 4DQOH 3N1FC 3EBAA 5C0CA 5GHWH 1LP9E 1ODAA 4KUCF 1OAUL 5EU5B 3DETD 4YR6B 3CVIL 3VXSD 3QB7C 1EVTC 5CJXC 1OM3L 5IT2H 3IU3B 1A3RL 4ZOCA 4TPRH 4KDTC 1MRDH 3TBTB 1K8DB 5FA4A 3WNPA 5HPMB 1NGXA 4OLEA 1ZOXA 3IRPX 1U8KA 2CXGA 2YK1L 4DGVH 5JO5A 2EIZB 2B1HH 1JGLL 3GSXA 2HTKC 4ZOEA 3FOMA 4L3AA 5E03A 1H15A 1QLRA 3HLAB 4JRYD 5BRZB 4S10A 1VGKA 3D2UD 3RL2A 3MRBB 1B4RA 1OP5H 5A2IH 5EZIH 1N7MH 4RGNE 4CDHA 1FC2D 3QDGB 4FQCL 1QSFD 4AG4H 2DBLH 1RHHA 2BVUA 1H9VA 4MAUL 5C6TL 2ARJA 5KVGL 2AXFB 1ITCA 4GJTB 4M6ML 4HUKB 1ZHLB 4G7YH 2HLFC 1AY1L 3DYPA 4NNPH 3G9VA 1MI5D 4HH9B 2NY6C 1BM3L 5CSZA 4HWUA 4ZAKD 2Y07H 2RCSL 2V9RA 1P4LA 2WIMA 4ZXBD 4GKSB 3TP4A 4PJ9D 5L2JA 3OKEA 4CADA 2DQEL 3ROLB 1HQRB 5DJ0B 4Q9QL 5JLZA 4M1CC 3EJJX 3V7MA 1JRHL 4FOMA 3U4BL 3DXAA 3FFCE 2C3VA 4OV5B 4WV1C 3HR5B 4Z5RA 3WN5C 2AV7A 1QPXA 4GG8A 4L3CB 4KUZL 5D7SH 5KSAD 3S6CA 1SY6L 1BJMA 1DQQA 1TTGA 4JN2B 2BRRH 2ICES 5FYKD 1T0MA 4OUUA 1CU4H 1KLFA 2ZPKL 1OARL 4RGOH 2YUXA 1R5VA 3IAQA 3QEGH 3RIAK 1SJHA 3VXMD 1DQMH 3AXLA 4KK9D 1DBBL 2V9QA 4MQXC 3L3JB 1FZMB 2Y7QA 1A2YA 5BVJB 2APXA 2AEPH 2IPUK 3BO8A 3QQNA 4LLVA 5DJ2B 3ROOA 3CDFA 3PP4L 3S9DB 2Q1EA 1MEXH 1UZ8A 3LDBB 5MERA 2AEQH 3TJHD 4PJDB 3K4ZA 4WCYL 4GRMA 5L2KA 3TZVA 4HKJA 3VI3E 1HSBB 3H42H 5JW5B 2Z8WC 3U30B 4K3JH 5E8PB 3QIBB 3K46A 1T1XB 3BKYL 3S36X 5C0BD 1FL5A 4N0CC 4XAWH 4KKLD 1J1XH 5HI4D 3FT3A 3H9YA 4OLWL 4PJAA 1Y6KR 2YUVA 3OKMA 3TLRA 4G8FB 3QJHA 3BWUC 5EDXA 1S7XB 3E8UL 4N0UE 3OGCB 3ARBA 1CR9H 5D1XD 4OQTL 2IH3B 5JPMA 3WYRA 3WFCH 1YPZA 4NO3B 2HT3C 1OLZA 2R2EA 4LLUA 4X4ME 1U92A 4JKMA 4RA0C 5EBGA 3TVMD 2WWKO 2QTEA 1PYWA 4GG6F 2FIRT 4JM2B 3LPWA 3KYNA 3SOBL 5ISZE 1UC6A 5IFAH 4PJHF 5BOPA 2XG4A 1MWAL 3UJIH 5BVPH 3LSOA 3C6LA 4P5KA 1BLNB 3D48R 1YJDH 1D3CA 4NSKA 1VFMA 3X3GL 3RI5F 5INCA 4ZFZB 3FQTB 1KEGL 1QR4A 1S7WA 2W07A 4YQXH 1HHIA 4M3KB 4L3EE 1S9YB 4PJ7F 1G9NH 2R0ZH 3BGAA 4FQQB 1G7JA 4W81A 2DTMH 3AS3A 4GRLD 3I50L 4KTEL 4V1DB 5HGGS 4POYA 3HZYB 2X5PA 5IK3A 5CZXC 5CP7B 3TN0B 3MLTA 1EBAA 1A4JB 1YNKH 2X4NB 5F8RC 3CFDA 3SCMA 1XF1A 1GIGL 3UO1H 5JMRA 1BOGA 4WDIA 4EZMA 3WKMH 1IVLA 3ZE2E 3OV6A 3PWUB 4LSDA 2DQIH 3Q5YA 4DCQA 5B21A 4LCYA 5ICYA 1F6AB 2ZOKB 4QRUA 3SDCD 4S11A 2W9EL 5J6GB 1IFHH 3GSVA 5GGQL 2H2SD 4B41A 1CWVA 3PWLA 2VZ3A 1RUKH