1MCBA

Principles and pitfalls in designing site directed peptide ligands
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
216
structure length
216
Chain Sequence
PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
publication title Principles and pitfalls in designing site-directed peptide ligands.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 41
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcbA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcbA02
3NIGF 3QUMA 4OCSL 5GS1C 1ZEAH 4M7ZC 4NNYB 5DVMA 3IDJB 3VXQB 4NC2B 5L88H 2V7NA 5GS1A 4GKZA 2V5TA 2VISB 3HC3L 1IC4L 4X4MA 3ILQC 3ZE0F 4LBEB 4S1DD 2X9XA 4HWEH 2ICEA 5ITFA 2GK0B 4J7RA 2E3VA 4KKCD 4OB5H 4YH6A 1CFBA 2WBKA 3DV4A 3QH3A 4X8XA 3HI6L 4XPHL 2MFNA 5E8PB 1TZIB 1D6VH 4S11A 3T0VA 5E8NB 4AJ0A 1MCWM 4PJFA 2OJEA 4OGYL 3MJ9H 1LO4L 2NX5B 5CZKA 3N9GH 2NX5D 3C5SB 3IKCA 4UNTA 1FO0B 1BD2B 2EE3A 4YPJA 1J1XH 4JFPB 4JFHE 4ZFZB 4HJ0D 2H1PH 3WSQH 4W4OC 4ODTH 1MCEA 1YEFL 4WUKL 5F7MC 5IMOA 4XMLH 5CEZL 3OJVC 3IDYC 2P24A 4ZFFA 1A9EA 3U6RB 2Q86A 1D9KB 1FN4A 2AV1A 4JRXB 1FPTL 3D3VA 1S9KC 1D9KD 4JRXD 1CFQB 4Z7UF 3MLZL 2HTKD 2VQ1B 3TGXA 5I1KH 3RVUD 4V1DE 5DEGB 2QL1A 4OZFH 1INDL 4NJAL 5JA8B 1U8PA 1QYGH 4HIEB 3S98A 5DR5H 2PXYA 1NSNL 2FBJH 4FFZL 1JZ7A 5E9DB 2CKBA 4H5SB 4PTTB 5E9DD 3EO0B 3SCMB 1IGYB 1MELA 3SCMD 2UV3A 3MV8A 1K8IB 4N90D 4B41A 5DD6B 5KSUA 3H3PL 1QPPA 4KVNL 2FO4A 1YEEL 3MODL 5I1DA 1A3RL 5ID1B 2P5WE 2VDKL 1E27A 3OF6D 2IF7A 2JCCA 1J0KA 4JGUA 5F9AC 2R2HB 3UO1H 4K3JL 4R26H 3T0EB 2VXTL 3TN0C 5ALBH 3JWDL 3T0ED 4GAGL 4FRWA 3TN0A 2WLZA 1KCRL 4PREA 4JO1L 1T66C 3BPLB 1MCNA 3NZHH 2LTQB 1K4CA 1BAFL 3NA9L 4JR9H 1U92A 2NYYC 4ODWA 3U7YL 1A14L 3B9AA 5JW4Q 1IM3A 3CZFA 3DUSA 4YR6B 3CH8A 5IHUL 4BZ2H 1I9JL 2YPVL 5JDSB 4OF6A 1F4XL 5CD5C 3VGHA 2AP2A 5KVEH 3FQRB 4CN1A 1CQYA 2VWEC 2ZP0T 1CR9H 1A4KB 3C08L 3DYPA 4L8SB 4PP2A 4NO2A 3ZYIA 2HFFB 2VITA 4XPAL 1XF5B 3LKRA 1KB5A 4M62L 4LLWB 5T3ZL 15C8L 2WLYA 3MX0A 1OQXA 3K46A 3P0VH 4JG0L 4LCWE 2VH5H 3S34L 2H2SD 2RFXA 4L3EB 4DKFL 1S9WB 2VXUL 4L3ED 1IAIL 3QXTA 3FL7A 3MRQB 4LLYA 2X4OA 1P5VA 1UM4H 3B9DA 3FRUA 4LIQE 4M5YH 1KJ3L 3LQAL 1K2DA 1AD0B 3N1QC 2HMID 2R1XA 3B2UD 4M43H 4JM2D 2H32A 1DSFL 4JDTL 2DS4A 1NLDL 2YD2A 4R90H 4R4BB 1Z3GH 3KPLB 1RUAL 1TCRB 1MCSA 3N06B 5EUKB 1UQSA 2GSIA 5IQ7L 3DVNB 4NNPL 2K7PA 1E28B 3OGOE 1I4FB 5ITBH 1EHNA 3VFRA 1S7QA 4TUOA 4DUXA 4KI5C 2VLJB 3HZVB 4EOWL 5H35A 2Y7QB 2VLJD 4LSTH 4FABL 1YC8A 1T20B 2JB5H 5E95B 2DQGL 3CGTA 4XVTL 1A6TA 2ADIB 5DGQA 4ISVA 1WBXB 2BMKA 3FHQA 1EVTC 2VDNH 5DRNA 4LLDB 3L7EB 4HUUB 5F72S 4Y5XC 1AKJD 5L9DL 2RGSA 5T33L 3BOVA 1N7MH 4G9DA 3TNMA 5F96H 3L6FB 5I1HH 1O5DT 2FEDD 2VE6B 1MI5B 1IC5H 2YD6A 1DQMH 1SJHB 1MI5D 4K2UL 1XCTB 4KJYB 4UV7H 4KZEL 3LKPA 5FDWA 3KWWB 4NT6B 4JVUA 3OGCA 2WBJC 3BP6A 4OJFH 2XT1B 5C07A 1MUJB 4Q9RH 5I0ZA 1UACL 1JPST 1XGYH 3KGRA 5GJSH 4Z7VF 3OB8A 2Y23A 5DJXB 4K71C 3RZCC 1JGDB 3ILPB 4MHHG 2V9QA 2JK5B 2NTFB 4Z6AT 4ZFGL 1GGUA 2DLIA 3RZCA 4LARH 1RZFL 3GMNB 1BOGB 4AT6A 2FD6L 4BQBA 1LO0L 4LPTA 4NM8H 1NLBH 4YGVB 5JMOC 1A7PH 3RWDB 4PGBB 3LMJL 1PAMA 4MNGB 2D0FA 4KFZC 2FX9L 5IK3A 2AAVA 2ZCLL 2ICWA 3BW9B 3QUYB 4PJHA 5ENWA 1ZTXH 1DANT 4XI5C 3QUYD 2DQFA 2R1YB 3JTTB 1JRHI 4OGXL 3U79A 4M1GL 4HT1H 2PTVA 3VXPB 3LD8C 3AMLA 1DBAH 1YEJL 1VPOH 3BKJL 1MAKA 3SKJL 3BRFA 3FQTA 4F7TB 4JFOA 3QA3B 5GGVY 2GTWB 1XGPB 3TBWA 1KJ2B 5HYSB 4NQVA 4I0CC 1PD6A 4JFFB 4M9OA 1DN0B 2XNAA 4HK0B 2X4PB 4ZOBA 3RJQB 4JFFD 1V7NL 3X11B 2VKXA 4TNVF 4IRJB 1FJ1A 5I8EB 1G9NH 1EXUA 2ATKB 2D7PA 3G5ZA 4IRJD 3V6ZB 4IOFC 3VGFA 4X80L 5JQHC 2XKSA 2D31B 3TH3T 4EN3C 5DDHB 3O3AA 3B9KC 4JFQB 1PX3A 4EN3A 4G8GA 4WUUB 1AGBA 3B9KA 4Y5VB 1FNEB 4WUUD 1ZEAL 1HSBB 3F62A 3H3KA 3CPLB 2ADJB 4PRDB 5D1XC 3T8XB 1HHIA 1G6RA 4PD4K 4CVUA 4L8BB 5I15H 4MAYA 3OXSA 3WLWC 4OKDA 1GRWA 1GSMA 2OP4H 4Z0BL 4P46C 4R7DB 1G7LA 3QPQD 3UX9B 4HWEL 4P46A 2QHLA 2EDOA 1HYSD 1KJMB 4ETQA 1U8QA 4IRZH 4OB5L 3CFJB 4M7KL 1NEZG 2EDBA 5DYOA 4QHKJ 4C83B 1MLCB 2KZ1B 4XHJD 4CADA 2A6DA 2ICCA 2ERJC 3HCVB 4JM4H 1D6VL 3QUMB 5CLWA 4QRRA 2G75B 4PJDA 1EERB 2I27N 2V7NB 3OJ2C 3MJ9L 3S88L 5BV7C 3OXRA 2BNQE 3SKOA 1SBBA 3N9GL 3PDGA 4OUOA 3INUH 1OP3H 2P46B 1JGLL 4P4KA 4RFNB 1J1XL 3MRPA 3MRFB 2H1PL 4GAJH 3WSQL 4ODTL 3ILQD 4YHIB 1NCAH 3EO9H 3DV4B 2A6IA 3QH3B 2ZG3A 1IAIM 2ADGA 2BZDA 3IJHB 1YC7A 3L3DA 1NGZA 3SOBH 4ZYKA 4WVRA 1IAOB 3MXVH 4KRMB 5EZIH 3RU8H 3UZVB 4PJFB 5I1KL 1OSZB 3MRLB 3KPSA 5HY9A 2GTZA 2UUDK 3O6FC 3PXJA 4MAUH 1QYGL 5KG9A 4PP1C 2FBJL 3RX5A 4OZ4B 1JL8A 4LGSB 3UBXB 2VAJA 5IMOB 2JIXB 4X98A 2FBOJ 2P4AB 1JWSA 3D1MC 2JIXD 2Q86B 3VH8G 3MCKA 3WJJA 1FN4B 2AV1B 3D3VB 3HB3C 5HVGB 2XACC 5EZJB 3D3VD 3ARDA 3GMPA 1ACYH 3GRWH 2FJHB 1WFNA 2WQ8A 1MAJA 2DQEH 3T0BA 4BFBD 5GZOD 4GG8B 2MKLC 2HT4D 1T1YA 4R26L 1IRAY 3U4EA 2RR3A 3ARBC 5D7LA 1CF8H 5ALBL 1A7BA 2KDGA 2QLVB 2PXYB 3HMWH 2PXYD 2BRRH 5E5MA 4WHDA 3DVFA 3NZHL 4OI8A 3X14A 1BVZA 4JR9L 1D5ZB 1LDPH 3MTRA 3UTTE 3MV8B 2NY0C 5KSUB 4JO4H 3MV8D 3RX8A 3CX5J 2PO6B 4I0PA 4BZ2L 5I1DB 5SX4H 4C4KT 3M8OH 5KVEL 1E27B 5L2KA 2JCCB 2WWKT 4Q9CA 1J7VR 1CR9L 3LPWA 2GQHA 1ZE3C 2FL5A 3DHMA 5JIIA 2BHZA 1CXIA 5HHQB 3TN0B 2V5YA 3P0VL 1OM3L 3FO1B 4OQTH 3DURA 3OR7B 5MEPB 3TN0D 4I77H 1T83A 1MREL 2DLTA 2X10A 2NY1C 1EK3A 1A1NA 4OTXL 3ZYZA 3FQNA 6CGTA 2PW2A 1T66D 4JG1H 1HXYA 3CZFB 3DUSB 1LE9B 4M7JH 4C56A 2GJ6B 2WNGA 1UM4L 3BMVA 1CDJA 2NY5C 1C7SA 2BCKA 2C4FU 2GJ6D 2NYYD 4M5YL 4D9RD 3LOWA 1WFTA 4N1HB 4M43L 4XP4H 2VAAA 5IB5A 3T2PA 4O2FA 3P40A 5CD5D 4D9QD 4PP2B 5DA4A 4NO2B 5FYLH 1CE6A 1QKZH 2VITB 3H9SB 4R90L 1BFOB 1KB5B 3LKRB 4NWUH 4H1LH 5I9QB 2LU7A 3H9SD 1Z3GL 1WBYB 5HHMB 1X4XA 2X1WL 3HNTH 3S8WA 1QACA 2HA1A 2VO5A 5ITBL 1MHHA 1BVLA 5HYQB 2ZUUA 1LGVA 4L8DA 4LLYB 1A22B 1D5IH 2Y4SA 2CXGA 4LSTL 1F97A 5FYJD 5E7FA 4EI5C 3GMLB 1TPXC 1K2DB 2JB5L 1KPUA 4EI5A 2H32B 1ZHBA 1EZVX 1LO5A 2VDNL 4DGVH 2GW5A 2CO7B 3RKPA 4DAGL 4KTEH 4J3XA 1N7ML 2G5RA 2QHRL 5I0DA 5F96L 1NCNA 2GSIB 2OXHA 5I1HL 5TDPA 4RFEB 3GUTA 1IC5L 5FDYA 1DQML 5IESH 2WMPA 1S7QB 4ORGB 4TUOB 5BCAA 4UV7L 4X6FB 2XQYK 4ENED 4QKXB 5H35B 5JIHA 2EZ0D 2F53E 2RBLA 4OJFL 4XP9H 4CGTA 4Q9RL 4HIJA 1XGYL 2C9AA 4GW1B 4KI5D 1A6TB 2FHCA 5M95B 5GJSL 5HI5C 4ISVB 2BMKB 5JHDE 4RBPK 1IGIH 3RIAK 3I6KA 3VI3F 2J8UA 5FKAA 1M1SA 4O00A 4NCC1 3TNMB 3DNKA 4NM8L 43C9B 1NLBL 2V2TA 3NGBB 1BZ9A 5EBWA 1A7PL 5F7YC 3U9PH 4ZUTA 1ITBB 1KLUB 4TYUA 3I9GH 4EXPX 3LKPB 3MO1A 1KF9B 2DM7A 4XB8A 5C07B 4HHAB 5C07D 1GC1C 3BH8B 2PYFA 3B9EA 4RMWA 4HT1L 3Q1SH 2IWGA 1QHOA 5DJ0A 5GS0C 2HJFA 4Y2DC 4Y4KC 3FONA 2Z0BA 1DBAL 1VPOL 5JPMA 3RZCD 3DPBA 4AT6B 5JHLH 4Y2DA 1FIEA 4X6CE 1A5FH 1WWAX 1CVSC 2WUCH 4XPTL 4POUB 5HHNB 1ZSDB 2DQTH 4F8QA 5JZ7C 2CO6B 1PLGH 5A43C 3IFNH 5DZLA 1AJ7H 2HTLC 5LGJA 3MJ8A 5IK3B 3RWGA 4HGKC 2X9WA 1NUNB 3CMGA 5J12C 1WITA 2VLMD 1G9NL 4PJHB 1FZMA 5CP7B 4YNYB 4X6EB 4CUCA 2YRLA 4QWWC 2DQFB 1TQBC 3RUGA 4Z8FH 3MNZA 1A21A 4OI7A 3MJ6A 3PQYA 4XI5D 5FF6A 4K8RC 3W11D 1QLEH 1KN4H 4Z18A 5JW4R 1AGFA 4JFOB 2VLKA 4GBXA 4ELME 3QQ3A 5I15L 4QRUA 3D85A 4NQVB 1LDSA 4BFIA 5J11C 3G5YA 3CH1A 2XNAB 5FGCE 2OP4L 3QWQB 3CXHJ 1EXUB 1LEGA 4LFHG 3G5ZB 3QXDA 4U1SB 1QG3A 1IKNC 3U7WH 3O2DA 4IRZL 4XXCC 4OF5A 4Y7MA 3WIFA 1EBPA 5DMIL 2VN7A 5IB4A 4XXCA 1BQLL 5KBNC 3O8XB 4EN3B 5C0GB 1AGBB 3VXSB 4JM4L 3S35X 3O8XD 4EN3D 4G8GD 3VXSD 1MCJA 3I75A 3B9KD 3RWIA 1G6RB 4MAYB 3SN6N 3H2WA 2HFEA 3OXSB 2Z4QA 4MAYD 1XGRA 2A83B 5AG8A 5HJ3A 1RUML 3BYYA 3CFIC 1Q0YH 1HIMH 1G7LB 2NPLX 1I9EA 4P57A 5F3HB 2B7DT 4P46D 1IQDA 3LKSA 4ETQB 5LGKA 1TZGH 1NCAL 3EO9L 3VFTA 4G80A 3EDFA 3VWJA 5DYOB 4DCQA 5LAXA 4CADB 5D71H 4F2MA 1TETH 1TJGH 1S8DA 1SQ2N 3RBSA 3SOBL 3O6LH 3WHXA 4MD5B 4QRRB 2IANE 3MXVL 2CUMA 5EZIL 3RU8L 5I73B 1UA6H 4QRRD 5K9KB 4PJFF 3OKYA 2DL2A 2DIAA 2X4TA 3Q5YA 3OXRB 3VRJA 3SKOB 2FR4A 4G8IB 12E8H 3TVMC 2KL6A 5EBGA 1UGNA 5IVZA 3I02B 4P4KB 4ZD3H 3MRNA 3MRPB 4P4KD 1MCBA 3KXFA 1PDKA 4Y2OA 2ADGB 2VSDA 3L3DB 3NABH 1NGZB 2F15A 3HFMH 5FK9A 3E3QC 4WGWB 3U30C 1ACYL 3STZA 3GRWL 3FO9B 3EOBA 3QFJE 2E7HA 1VFOA 1KLFA 4Q74A 3ULSA 2D9QB 2DQEL 4JFDA 3W9DA 1DN2A 2FB4H 3KPSB 5HY9B 2DLFH 2D0GA 3KPSD 4XBPA 1CF8L 2RIKA 1DR9A 5KG9B 2WWMC 5DC4B 1EO8H 3HMWL 1MCIA 2ZCKL 4OT1H 1PQZB 4AEHH 3QZWA 5J3HC 1WK0A 2AGJH 2BRRL 4PP1D 1JWSB 1LDPL 1S7TB 3MCKB 1XEDA 5HGGS 1PKQE 1D3CA 3SE4C 1F42A 4JO4L 2IAMB 1I7RA 4JJHA 3QQ9C 3ALPA 3ARDB 3QWRA 5F7FA 2IAMD 5M94B 1MY7A 3SE4A 3ARDD 2EDFA 3M8OL 2PYEE 25C8H 2B5IC 3FRPA 1T2XA 4E42A 3OKMA 4L4TE 2NXZB 3RAJH 2EYTA 1T1YB 2NXZD 4ZAKC 1CLYH 1ZT4A 5D7LB 1F6LL 4WFFD 3PGDB 2Y1VA 4PJ5B 4QRSA 5D7LD 3UTSA 2YRZA 4PJ5D 3LQZB 1PJ9A 4OQTL 4OV6F 5FYKU 5E5MB 3X14B 1UKQA 1G1YA 3MJ9A 4NHCH 4Z7WE 4IBLT 3MR9A 3IDXH 4JG1L 1L0QA 3V4PH 1RU9L 1T7YA 4I0PB 3MC0A 4M7JL 4Y16C 2XQYG 4I0PD 5L0QC 3GEWB 1C5BL 2EKSA 5C92A 1N3NB 5L2KB 4Y16A 4OLZH 3UPCA 1MEXH 4XP4L 4FQXC 3O4LE 2VL5A 5L2KD 3TT1H 4WJ5B 2R15A 3S5LG 4LLVA 1A1OB 2FJGA 5FYLL 1UFUA 4FQXA 4R0LC 4WV1C 1S7VA 4NWUL 4NBZB 4O2CA 1Q9KA 2XA8H 2BJML 5H37H 4OUUA 4W6YB 1RUPH 3DURB 4LCUA 3H9ZA 5SWZA 1KCVH 1P2CA 3PHQA 4LCYA 3GMMA 2NZIA 2A73A 3FQNB 4LU5H 4OZFA 2PW2B 3L7FA 1JPGA 5K93A 1HXYB 1I9IH 2HFTA 4C54A 1D5IL 4QXWA 4KRNA 2BCKB 1X5YA 4C56D 4BFEA 2B39A 2PW1A 4KK8D 3WNKA 3I3EA 1FFNA 4PJGB 3SDXA 3V7AG 2WSKA 2Q8BL 5F6IB 1JN6A 4O2FB 4DGVL 2VDOH 1F3DH 3OKOB 5C0DA 2KPNA 3ZHDA 2P8MA 2DWEA 5EU6A 4HS3B 1ODAA 4KTEL 3AXLA 3VXOA 3GHBH 5KSBE 1ZVSA 5EO1A 1MHHB 2A74A 4L8DB 3OKDB 5INDA 1JHTB 1HSAA 2X40A 2DKUA 4ZPTA 3OBAA 2VDRH 4XP9L 1P53A 1A02N 4UT6H 5JOPE 1M7IB 4EI5B 1M7DA 1ZHBB 2ZOKA 1LNUA 1FRGH 1LO5B 1W0WA 4EI5D 2W0FA 4FQ1H 4P5KA 1CFSA 2OYPA 2XTJE 1IGIL 4P9HC 1WLHA 3PNWA 4NNXB 3ARPA 2ZUQB 4K7FA 4HKBA 2YN3A 5TDPB 3OPZH 1AXTH 4O58H 3U9PL 3O3EA 4M3JA 4AH2B 3B8SA 3I9GL 2FIKB 3L3HA 3UEZA 3BFOA 4HIJB 3EAKA 4DZ8A 5BS0E 1I8IA 4JANA 2ITCB 5I71B 2J5LC 2EO1A 2HVKA 5DJ8A 5H94B 2NY4B 3VGEA 1XCQA 2BSSA 2NY4D 5HI5D 2CUHA 3I6KB 4QEGA 4K3GA 1BQHA 2HKHH 5FKAB 5SV3A 3DLQR 4I3RH 5JHLL 4WU5A 1GAFH 1OHQA 1BFSA 2V2TB 1A5FL 4PGEA 2WUCL 1F8TH 3GBNH 2DQTL 1EX0A 1GGTA 3I84A 4ZUTB 1PLGL 4Z7OF 3ECBA 3IFNL 1AJ7L 2VYRE 4X6BA 5D9SA 3IRZA 2HP4A 5J6HA 1O7VA 3K4AA 3R8BB 3MO1B 1MH5A 1AHWC 5IJKC 3BISA 4HUWA 5T3ZD 4PJHF 3BP4A 4AIXA 1TQCC 1AHWA 2PYFB 1LP9A 3RY4A 1LK3H 1NKRA 3W5NA 5C0IA 5DJ0B 1Q1JH 2HJFB 5JW5A 3PJSA 3FONB 4TOYH 5F7WC 5JPMB 3EHBD 1MCRA 1QLEL 2PTTB 5MHSE 3MUJA 4G42B 2W1NA 4D0CA 4U1GC 1DTUA 5CGTA 4OZIF 3GJFB 5I1CH 5FUOH 1JF5A 2F19H 5LGJB 2GCYB 3MJ8B 2PR4H 5JZ7D 3NMEA 3ULUC 5ID0B 1FZMB 5E2VH 1Q8MA 1PX4A 3RUGB 3WO4C 2F9BT 4NKOB 2BFVH 2C3GA 3PQYB 1HDMB 4JZNA 2Z91A 2EXYC 1JJUA 3PQYD 3V6OC 1MF2H 1AGFB 4HFUH 1I75A 2VLKB 4GBXB 1XGUA 4KU1A 1NGYA 3QQ3B 1JWUB 2VLKD 4GBXD 4K8RD 2YK1H 3I3BA 3D85B 4U0RC 3K2MC 3CH1B 4PJEE 3D85D 3LRSB 4MSWA 1UH4A 2AEWA 1Q0YL 1LEGB 2RCSH 1WBZB 1YMHA 4Y5YC 5BMFH 3PGCA 1TZGL 5F70A 1CI5A 3BO8A 4LL9A 4EDWH 4ZSOE 4GFTB 4ELKA 4IHOA 2NY3B 5IB4B 1UWEH 5D71L 2W0LA 4I18C 2NY3D 5ICXA 1R5IA 1TETL 1TJGL 3ARFC 5SWQA 1REIA 4BSVA 4NN5C 1TJHH 1U3HA 3I75B 4E0RA 3RWIB 1YEHH 1UA6L 3ARFA 4P2RE 1GZQA 2HFEB 2Z4QB 3LVEA 1XGRB 3CVHH 1NGWA 1CXHA 5HGAB 4HJGA 12E8L 5HJ3B 1NFKA 4P57B 2WINA 1IQDB 3LKSB 4HWZA 4BH7A 4LNRA 3FT4B 2YWZA 3VFTB 4M3KB 4PIRF 4G80B 2EXWC 3VWJB 3Q6FB 2EE6A 4DCQB 4NQCB 4Q2ZB 2Z35A 4TVPD 3VWJD 4F2MB 3I2CH 4NQCD 3NABL 2Q3ZA 2WQRA 3A67L 3HFML 3S35H 3WHXB 2AQ2A 1JPFA 2P8LB 3LZFH 4U1JA 4OV5A 5DJ6A 3VA2C 1BOYA 2Q7YA 2FB4L 1P4LB 2FR4B 2RQ8A 2VQUA 2DLFL 4IJ3B 1MCQA 5IVZB 4YHOH 4HLZG 3MRNB 1EO8L 4AEHL 5I8OH 4L29A 3RWHB 2AGJL 4M03A 4NC1E 4FQPA 1YQ2A 3HZYA 3QIBA 5IVXA 3MUGA 2D03H 4U2ZA 3IJSA 2DM2A 3P73A 4LSRH 1FC1A 3K4DA 4FG6D 3EOBB 2W0KA 3TV3H 3ULSB 3U46A 1RY7B 4JFDB 3W9DB 3RAJL 4JFDD 1CDGA 1CLYL 2Z93B 3MRCA 4J23A 4XBPB 1NGPH 2J8HA 1JZ5A 1IARB 4PJBB 3QZWB 4XNQB 3BPCA 2R2CA 5C0BB 4X7DC 5DWUH 3WS3A 3S6CA 1XH3A 5IHLB 3IDXL 5I30H 4Z7NE 1KBGH 5J89A 1II4E 3V4PL 1I7RB 1JYVA 4Y4HA 1QRNE 3O11A 4HIIB 4TQEH 1ZWIA 4E42B 2ED8A 3OKMB 4OLZL 1MEXL 5EIIB 5HI3C 1V3LA 3UMTA 3TT1L 2EYTB 3ARGC 3CFEA 1ZT4B 5JPNA 1RUQH 3D9AH 4X4YA 2JB6B 5DSCA 2QSVA 1WAAF 3V5HA 3UTSB 1JF1A 2UY6A 1MIEH 2SEBA 3UTSD 3KYOA 4ONOA 3QEGH 1RUPL 4GG6B 1KCVL 1CXKA 1T1WA 4TNVK 4HLJA 3REWA 1I9IL 1XMWA 5GJTH 2C7UA 1A6WH 2DJUA 3VXRB 3HUJA 3O4OC 4X8JB 4BELD 3BD5A 4NO0A 3HLAA 4PJGF 3HRZA 2UVFA 4FFWD 2O5YH 3GMOB 4JY6A 4LLVB 2FJGB 4FQXB 1S7VB 3QBTB 4OD1H 3FTGB 2E9JA 4FQXD 1WWCA 2H26B 4OUUB 1S3KH 4LCUB 5SWZB 2UY7A 3GHBL 3PHQB 4LCYB 1KTDA 5SWZD 3GMMB 4U1HA 3UCRA 3HC0A 1Q94A 1LILA 4NQEE 4OZFB 3L7FB 5J6GB 3H8NA 4JQIH 4PBXA 1NC2A 3VD4A 1A9BA 2VDRL 5BXFA 4JY4A 1NFDB 1FFNB 2ICWJ 3GK8L 4UT6L 3S3SA 3ZL4H 3NIFE 1FRGL 1D5BA 3IGAA 2C3HA 2CH8A 4FQ1L 1K85A 4HD9A 5C0DB 5D5MA 4OLVH 1PSKH 3QDMA 5EU6D 3CD4A 3VXOB 2IALA 3EJZC 3H0TA 3HG1E 4NRXA 1X5IA 4XAKD 3OPZL 5IR1A 1AXTL 2X4UA 4O58L 5T3XH 1ZVSB 2A74B 4QTHA 4AMKH 3SY0A 3SDAC 4KMLB 5FO7B 2QEJA 3NVQA 4DEPB 3ALWA 4ZPTB 3BWUC 3BH9A 4LLUB 1UZ8B 2YPLA 4OIBA 4NQXA 3SDAA 1FE8H 1QSFE 1M7DB 3AC0A 3D18A 1LNUB 1W0WB 2W0FB 4P5KB 4PJIE 4PYHA 4UTBH 1CFSB 4APQC 3PNWB 3RFZC 2HKHL 1MCCA 4U1LA 4I3RL 4NRYB 4APQA 1GAFL 1MJ7H 1IEAB 4HKBB 3W0WA 3GBNL 5GGVH 2BC4B 3QHFH 2DDQH 3PV7A 3O3EB 5EUOA 3T2NH 1HOCA 1KN2H 2J6EH 4E41E 3P2TA 3L5IA 4PB9L 5DMKA 4H1LA 4YBLB 4RGMC 3CC5B 3PHSA 4GOSA 4DZ8B 1I8IB 3WHE1 5GSRA 4JANB 4MDIB 3TIEA 4NM4H 4QRPE 2HJLB 5DJ8B 4IMKC 1Q1JL 1XCQB 1GPOH 4WCYH 2BSSB 4IDLA 3EW3B 4IIQC 2FSEB 5ETUB 1TCMA 5ISZE 4IMKA 2DM4A 3RNKA 4BKLA 4WDIA 4PGEB 5DQJA 3VFMA 1J0YA 1FG9C 5D96B 5F1IA 4KPHH 2EDQA 5FUOL 2F19L 1OAKH 4A6YH 4YDLB 5D9SB 5C0AA 2PR4L 4U3CA 5CZVH 5J6HB 1MH5B 1BREA 4MJ2A 5E2VL 1DJSA 2Y6SC 3JSSA 1DQJA 1AHWB 3WKMH 1H5BA 4PJ7A 2AI0H 5KVDH 1TDQA 5IB3A 5JW5B 3PJSB 4OM0H 3IYLW 1T0NA 1MF2L 3WV0A 3TIDA 4HFUL 4Z7UE 1TVBA 4FNLH 1MJJB 4D0CB 4FQQA 5I8KH 1QVOB 5GXBB 1AO7A 3T3MF 3L3GA 2HG5A 4CW1A 3TWCH 3HE7A 2D7OA 3VWKC 1N5YH 1PZ5A 1K9TA 2MJWA 3ABZA 4LKCA 2RCSL 3JV4B 3QQNA 5BMFL 3OHXA 5E94A 1I8MB 2R9HD 3MLUH 3PGFH 3O9WA 2P7TA 1FORH 1S7XB 2MPAH 1RZJC 2Y5TA 1UWEL 2Z91B 4BZYA 3VXTA 3S96A 5I16A 1E0OB 3H7BB 1ADQH 1TJHL 1J1OH 3L1OL 4H20H 1NGYB 5BOZG 4I2XB 1QSEA 1AQKH 2GT9B 2VZOA 3G08A 5EBLA 3CVHL 3GSRA 1JHKL 4MSWB 4U0RB 3NFNB 2IMMA 3WFBH 1OGAB 1XR8A 1NDMA 1YMHB 5E6ZA 4S10A 1OGAD 4LPVA 3MLVH 2B20A 4JREB 1T21A 3DGCR 5GS2D 3QUKB 4IHOB 2EECA 3IFOA 3WEXB 3I2CL 3MRHA 2AEIT 3B4NA 1J18A 5SWQB 1G7MA 2VLLA 2Q8AL 3HPLB 3S36X 1U3HB 1DLHB 1U3HD 4U7SA 1GZQB 3ZTJG 2O5ZH 1NGWB 4YC2C 4HJGB 3G04A 5HHVL 5GRYA 1FL6A 3FKUS 4JGMA 3RVTD 4YHOL 2YD5A 2OI9C 4LLMA 4KMQA 5I8OL 3TZVB 4QY8B 2CRYA 2WINB 3LDBC 4HWZB 4BH7B 4LNRB 3TZVD 2Q1EA 1ZOXA 1MY5A 1FGVH 4KQ4H 1VEOA 2D03L 3EO1A 4NQSA 3QCTH 3CMOH 4LSRL 4GRLA 4HC1A 4WI5A 4TULH 1JPFB 1T80A 5BRZE 3T04D 3TV3L 3KLHD 4WTZG 4U1JB 4NIKB 5DJ6B 5D7KD 4PJCE 1LE5B 4UQ3A 2Q7YB 4N1CA 5ELIA 3BIKA 2IH1A 5CBAB 5IVNA 2Y36H 1RIVH 4K9EC 5GGQH 1O7SA 1TNMA 4WW2C 5C0RH 4PJBF 3SJVE 2AK4B 1BFVH 4L29B 4PRIA 3NA4A 1Z6JT 3K81A 3W39A 2XZCH 2AK4D 3DMMA 4WW2A 4YPGA 3HZYB 3QIBB 5DWUL 1NUFA 1ZLUK 5IVXB 2N56A 4YDKH 3QXAA 2I9TA 3UJTH 3QIBD 2GIYA 5I30L 3IJSB 5BJTB 1EH9A 1KBGL 1MCDA 1KIPB 3P73B 5F71A 3P30H 4OLXH 5DHXB 4O51A 3FOMB 5I6XB 5SWSE 4NP4H 4D2NA 4ZFOA 3LS4H 4TQEL 5B39A 1BVKB 3TJEH 4FN0A 4KKBC 3U46B 3Q5TA 2EYSA 1X5KA 4MX7B 3THMH 3O0RL 3MRCB 1RUQL 3D9AL 3MRDA 4N68A 4GSDH 3KLAB 1MIEL 4LEXL 5FUZH 3BEVA 1P4BH 3G6DH 3BPCB 3QEGL 4GG6F 1U8MA 5FV1L 1W8OA 3DBXA 1XH3B 3MOBL 3U4AA 2ZUVA 4ORZC 3X17A 4I13B 1A47A 5GJTL 1YPZE 3QO1B 1A6WL 5TFSH 4Y4HB 2X7LA 3O11B 3EUUA 3L95B 1JTPA 1TITA 2VXSH 1ZWIB 7FABH 4Y4HD 4OAWA 5I74B 1HH6B 3CFEB 1OAQH 2O5YL 4Z7VE 4BSWA 5JPNB 4LPWA 1VB9A 5I75C 5DSCB 4OD1L 5HI3D 3TYFA 1RURH 3I6GA 2SEBB 3BP5A 1S3KL 2VDLL 2AKRB 2X70A 1DBJH 5BVPL 4Q6YA 1KG0B 4MMZC 1T1WB 3RZWA 4XP5H 4ONGH 2LVEA 1QBLH 3V5KB 5CJ8A 1FZJA 2AW2A 5DRZA 2YUXA 1C08B 4JQIL 4QNPF 4AIOA 2C7UB 3VGAC 1YUHA 5DJYA 4CKVX 1P5UA 4PRHA 4NKDA 2ESVE 4LVHB 1NFDF 2IPKA 3HLAB 5AWNH 1C8PA 5IV2B 5E6IC 4YQXL 5EDXA 2EIBA 1K8DB 4JY6B 5LQBH 2I60H 2XWBA 1HHJA 3VFSA 4PLNC 3L3OB 4OLVL 1PSKL 4KJQC 2E6PA 1QFWH 3GSWA 4K23H 1MRCH 4PBWD 2X09A 3WNNA 1KTDB 4U1HB 3HC0B 1Q94B 1HQ4A 1FNSH 1NCCH 4AMKL 3IDGA 4ETYA 4HUVB 1KELH 1CGVA 1RZKC 3D48R 4G8EB 1A9BB 3C2SA 5BXFB 1ZLVK 1U3ZA 3AU1A 5C09E 3FRPG 3KPMA 1FE8L 3SO3C 1D5BB 3B83A 3JVGA 4YFLF 1EAPA 4UTBL 5D5MB 4P2OB 3QDMB 5INCA 3QDMD 3GI9H 1MHEA 2BOCB 5E4IA 1MJ7L 2ZSWA 2W07A 3KJ6H 1OTSD 4NRXB 5IR1B 2X4UB 5GGVL 4ZDHA 4FQCH 4QTHB 2DDQL 4XPFH 3E0GA 2A38A 3SY0B 3T2NL 1XF2A 1KN2L 2J6EL 5GRUH 5DZNA 3RL2B 3F7YA 3BRGC 2ZOLA 3BH9B 4S1QH 1OTUD 2YPLB 4V2CB 1FVCA 2YPLD 4S1SH 4RDQF 3D18B 4ZOCA 1QTYT 2ZUTA 3PP3K 2VNCA 4D3CH 5FM5M 5DD0H 2H6PA 4PJXA 1GPOL 4WCYL 2DTML 5DK3A 2AJ3A 4HQQH 3VRLE 8CGTA 1M71A 4U1LB 4G43A 3VFVA 3KS0J 4APQB 1YY9D 3G6JA 3EOAA 3AS0A 4APQD 2BXYA 3HE6B 3W0WD 3HE6D 1H3UA 4KPHL 1C5CH 3EKCA 2JJSA 5EUOB 1OAKL 2NX5E 5CZVL 4H1LB 5FYLD 2DTSA 4P0DA 4P48A 2FLRT 1CK0H 1JZ4A 3WKML 2VUYA 3TIEB 5BOPA 1PZUB 1ZHLA 5KVDL 2FWOA 1AI1H 5DD5H 4OM0L 1C5DB 1U95A 5GGSA 1YEGH 1UXWA 4JRXE 1M05A 1OGTA 5A16A 5D70H 3RVWD 1WISA 4BKLB 4FNLL 3TLRA 3B5HA 4WDIB 3VFMB 3MSPA 5F1IB 3U2SA 5ESVA 3TWCL 5C0AB 1N5YL 2X5PA 5C0AD 1J5OH 2VABA 2AV7A 1RJYA 4XZUA 1KLGA 4WI7A 3SGEH 3HI1A 3MLTA 2L7UA 3K74B 3DX6B 3BIBX 1H5BB 4PJ7B 2DQJH 3PGFL 3C2AL 4NQUA 4OM1H 5E9DE 1FORL 2VIRA 2MPAL 5IF0A 2ENSA 5DXWA 4N90E 5IB3B 4JHBA 2E8ZA 1MCPH 5JR1H 4Z5RB 3B5GA 3BD4A 4JFXA 1QNZH 1ADQL 1J1OL 4H20L 4ZTPH 1OARH 3TIDB 1TVBB 2F8VA 3NPSB 4HGMA 3MBEA 4CU6A 4FQQB 1FFQA 1AQKL 1IZJA 3OQ3B 1IKFH 4GXUN 4MZ3A 4CW1B 3L3GB 2HG5B 4YHPB 2H45A 2UUDH 3HE7B 3HE7D 3T0EE 5FB8A 4IOSD 4MB5A 1SEBA 5E94B 1OY3B 5EU4B 2A1WH 1RZ8B 3MLVL 1F45A 3QDJA 1I3RA 3VMOA 3MV11 4LQFH 3O9WB 4UT7H 1QPXA 3NH7H 1SJVA 2YZ1A 3O9WD 2IADB 1LHZA 1Q0XH 3V6FA 1BQHG 4E5XA 3ULVH 4NN7B 3VXTB 1RI8A 5KAQG 1HI6A 1HN1A 5HD8D 3S96B 5I16B 1G9EA 4KDTC 4X9BA 4HV8A 5FIEA 4N8VA 5B38G 4OZGA 4WWKC 1D6EB 4RMQA 4KDTA 3G08B 3WFEH 3MCLH 2O5ZL 1H3XA 1X6LA 3GSRB 2FJFA 1Z9SA 5BQ7A 1JPTH 3G9VA 5GS3A 4AK1A 4RAVB 1JF6A 4HPOH 2BVOA 5DQDH 5D7IB 4OF8A 4RIRA 4ZO6A 3HKFA 1JVKA 4K94H 4MDJA 5F88B 4OD2B 1FGVL 4KQ4L 4WEBH 5E99H 4PY8J 3IFOB 4L3EE 3U1SH 2OK0H 1JPSH 1M4KA 3UPAA 3QCTL 3CMOL 3TPUA 4XNZC 4JDZA 1G7MB 3UYPA 3QO0A 5GRVK 1KJ2H 2DBJA 2MQ0A 4LHUG 4LKXA 2LU3A 1TTUA 4I1NB 4MLIA 5JNYA 3P0YH 3VMNA 2Y36L 1RIVL 5IHBA 5GGQL 4MA7L 4W6WB 5JOFA 3BPOC 5C0RL 1BFVL 5IEKA 4M1DH 2OI9B 2XZCL 4ZS6C 4MD4A 4HEPG 1YYMH 3AY4A 1I7TA 1UM6H 3HZKB 6FABH 1CS6A 3EO1B 3UJTL 4MA1B 4U1IA 1A1MA 3D5OF 3P30L 4NZUH 2KZWA 4GRLB 4OLXL 2LVCA 2VLJE 4GRLD 4XNXL 4NP4L 3LS4L 2VZTA 2MCPH 3TJEL 4CN4A 3EGSB 1H3PH 1R3LA 2BSED 1B4JH 2VB5A 4UQ3B 3BIKB 3THML 1P84J 5JDJA 1YQVH 2VC2H 3IXTA 3X13A 4GSDL 4X7EC 4PRBA 2ITDB 4P99A 1EEUA 3G6DL 4BJLA 3E6FA 4PRIB 3W39B 3DMMB 5J7CC 4WW1B 4PRID 2M1KA 3DMMD 1M7XA 1UKTA 2I9TB 3QXAB 1MI5E 4KJPC 5IFHH 3EDEA 4LCCC 2DRUA 4ZMAT 4XMKL 4F7CB 5HVWA 5HTSA 1XGQB 4WHYH 2VXSL 5B39B 3UYOD 7FABL 2WM0A 4ESKA 4TSAH 3N1MC 2EYSB 2OL3A 3LB6D 4Q6IA 1OAQL 1INEL 5D2LB 2YD9A 1K3ZA 4PG2A 2ED9A 3MRDB 2NMSA 4CVXA 5IB2A 3N1PC 4ZUVA 1YY8A 1RURL 3BEVB 4JQXA 2EIZA 4L9DA 4F37F 4YHYC 4I5BA 1KCSL 3OKEA 1S7SA 1DBJL 3VGDA 3S3PA 1OVZA 1DUYA 4XP5L 4ONGL 1Z9MA 1QBLL 3DBXB 3EDJA 1N8ZB 1IGJB 1N4XH 2NR6C 5GGTH 5KS9B 4MNGE 1RULH 3QRFM 5GSVA 4I4WB 4NQDA 4QHKI 4OQ1A 4LVOC 1P7KA 2KKQA 1R3HA 1DFBH 2B2XH 1CFVH 5LQBL 2I60L 4BSWB 3H6JA 4AG4H 4RBPH 3FZUD 1QO3A 4JAMB 3RDTB 3TYFB 1NC4B 2YD3A 5B8CC 2VQTA 5I75B 4TRPL 1NC4D 1QFWL 2QSCH 2X70B 3EFDH 4XWOD 5DT1H 4DQOH 4KK9C 4OZHA 1RZ7H 5B8CA 3MLWH 1NCCL 1L9MA 2PETA 4XBGB 5DRZB 3TYGH 4JFFE 2NZ9D 1EMTH 4IMLA 1OAYH 4PRHB 4NKDB 3NTCH 1XGTB 2IPKB 4PRHD 4Y89A 3VFPA 4GXUM 5E4EC 2DJSA 3QNXA 4W4NA 4RGNB 2XWBB 4RWYH 4FQJH 1HHJB 4RGND 3VFSB 2HT2D 4ZO9A 2IMNA 5D5MF 1KIUA 5KANG 1SJEA 3SKMA 3DXAA 2CKBH 3GI9L 5EU7E 4WUUE 3V0AC 4DK6A 3KLSA 4ZUUB 1T2QH 4HS8H 1HQ4B 4QRQA 4XPFL 4XWGL 3FO2B 1S9XA 5GRUL 3ROOA 3UC0L 3CDFA 2E7LA 1OP5K 4S1QL 3AU1B 1CICC 3KPMB 1E4XH 5IIEB 5TJWK 4S1SL 4JVPA 1G0DA 4P49A 3RA7L 4Z77A 3IRPX 1CICA 4PJ8A 5KSAB 5ADPH 1EAPB 4Q9QL 5KSAD 2EC9U 4HQQL 4JKPH 5DVKA 2YC1B 4X6CF 3GSXA 3H42H 1OLLA 2ZSWB 2IBZY 4H0HB 4UDTA 5ESAA 4G6MH 4WTWA 5EIQA 1C5CL 3L5HA 2ARJA 2XI9A 5HI4D 4YBQD 3QUXC 1J05B 3F7YB 4X4ME 2ZOLB 1FVCB 3GM0A 1CK0L 5TF0A 1JTTA 2NY2C 4ZXBB 2J8OA 2LABA 4U0QB 4EZMA 4ZXBD 2H6PB 1VHPA 4W6XB 1AI1L 4PJXB 2HLAA 2AJ3B 1YEGL 1M71B 2J4WH 4HZLA 4JO3H 3FCTA 4G43B 5D70L 5CLTA 3VFVB 5TE6H 2XZZA 3G6JB 4ONFH 5C6PB 1GL4B 5JTWA 1MHPH 2QQQA 1FYTA 4PJFE 1CLZL 3BKMH 3KPPA 5FYJH 3RIFF 2VR5A 4J4PC 1J5OL 2WUBH 4Z78B 1X4YA 3VDCA 4J4PA 2EDLA 2DQIH 3AUVA 5IB1A 2DQJL 4OM1L 4W68A 1ZHLB 2FWOB 4KAQH 2FHBA 1WQVT 4I48A 3RTQB 5GGSB 3RTQD 5JR1L 1M05B 3D3VE 1QNZL 5DLML 4ZTPL 5FM4A 1OARL 3ARVA 3BPNC 3MXWH 5MEQA 4AEFA 3NCJH 3U2SB 4F15B 1IKFL 5ESVB 4DUWA 5IMMA 4XPGH 3WFCH 4P5MA 3EJYD 2VABB 2AV7B 1RJYB 3H3BC 4XZUB 3BZEB 2BNQA 5JXAH 3MLTB 2JF1A 5IJVA 2A1WL 4NBXB 5ACZA 1UXSB 4LQFL 1DVFC 1IM9B 2Z92A 4UT7L 2VIRB 1SEQH 5IF0B 1IM9D 3BGMB 4MS8C 2V2XA 1DVFA 1Q0XL 1FSKB 1MAMH 3MV8E 1ZT7A 4HIHA 3ULVL 1NCDH 4YLQT 4JFXB 2VRAA 3LS5H 3QHTC 4Y19A 3MBEB 4M93C 3AS3A 3MBED 2IPUK 3MCLL 1GGIH 2JCCE 1EO5A 4IM8A 3RHWF 2PF6A 2OR9H 3B2VH 1IGCL 4L4VA 3L5WA 1JPTL 1DQQB 1KEMH 5GZND 1SEBB 1X5JA 4HPOL 5BVJA 5C0JA 3SE8H 5HHPA 1ZA3B 5DQDL 3KPOA 3QDJB 3NFPB 4K94L 1I3RB 5D7IF 3K1DA 3QDJD 4QHNA 3ZKQD 4WEBL 3TBVA 5E99L 4CMHB 3U1SL 2OK0L 1F5WA 1JPSL 2AXGA 4A6YA 3WLBA 2I26N 3V6FB 2YUZA 3QNYA 2DI9A 5F7DA 2GJ6E 4D9RE 2MHAA 4N8VB 3QDGA 4OZGB 1KJ2L 4GMTH 3BAEH 3RY5A 3JV5A 2EDHA 2XKNA 4EJ1C 3WIHH 5LKNA 4IDJH 3P4NB 4D9QE 3P0YL 5DZOA 3ZDZE 2YUWA 1PBYA 4KMTH 1DBKH 3H9SE 5IBLC 1WSST 1QFWM 3AAZA 2F8XC 4M1DL 3U48A 4MDJB 2EC8A 1B3JA 1KNOA 1YYML 1WZKA 4AEIH 4EVNA 1UM6L 4AENA 3U83A 3RX7A 2ATPB 1IEHA 3O2WH 4WI4A 1ZANL 1VGKA 3QAZC 3TPUB 4NZUL 4F3FB 4RMRA 1B88A 5FYJE 2JLLA 5FEBA 1GIGH 2MCPL 3SDDC 2CDGA 5CWSA 5DEFA 5HPOA 2F58H 3I50H 4LKXB 3BMWA 4HWUA 1AGDA 5C0NC 3SDDA 1FZKA 5JNYB 1YQVL 2VC2L 4ODXB 4JJ5A 1DUZA 4HLZH 5JOFB 5F9WB 3O41A 1KSRA 5C0FA 5IEKB 4Z7WF 5E08H 3BPOB 3MGTA 4MD4B 4HFWB 1RK0B 1I7TB 2P8PA 3J8F7 5IFHL 4YDVB 4U1IB 5DVLA 1A1MB 1EO7A 3P4OB 5CUSH 3HHRB 4P23C 1R3LB 4TSAL 1NEZA 4P23A 3B3IA 4XGZA 2H8PA 1OAUL 2Y25A 2CDEB 4OIIH 5D2LF 1I7ZB 3C8KB 3B6SB 3X13B 5IKCA 4PRBB 3V6BR 3MA7A 3E6FB 1CD1A 3QIUC 1ZGLM 4NKIH 2BXZA 4MJ5A 1ES0A 1KEGH 4K3EH 3QIUA 1EDQA 5F9JA 1N4XL 1PFCA 5LXGL 4DVBA 5KS9F 2IJ0C 1RULL 2UZIH 3LY6A 1JYNA 3TA3C 4X99A 3WN5C 5JUEH 4JDVA 5C07E 3AM8A 2B2XL 4Q6IB 1CFVL 4OCWH 3IF1B 3VFOA 3WN5A 5BV7H 4AG4L 3BKYH 5ICYA 4JRWA 4G7YH 1YY8B 1MWAA 2EIZB 4I5BB 1L6ZA 1YECH 2QSCL 1LD9A 5KSBF 3EFDL 4DQOL 4ODVH 4X7CC 3CDCA 1RZ7L 2A6KB 2AEPH 3WDHA 5HYJA 4X9IA 5LCVL 4Z7OE 1N0LA 5EU5B 1KXQE 4PBVC 4QOKB 1OAYL 1YEKL 5GSVB 4NQDB 3NTCL 4POZD 4QOKD 2NR6D 1OB1A 3JXAA 4NQDD 4PJHE 1NMCC 1I1RA 1R3HB 2X1QA 4KKAC 1TMCB 4JHAH 3DO7A 4RWYL 4FQJL 3QR2A 1QO3B 4JPWL 3QEUA 5D1QB 1BBDH 5JHDA 5D1QD 2CKBL 4JGJA 5B4MC 4OZHB 1FVDA 5HGBB 5B8CB 5JMRA 3BD3A 4GXVL 1T2QL 1NUGA 3ZKXB 1AIFA 1CYGA 4K07A 5IW1B 4NN6B 4CVZA 4KK9D 1BJMA 1CQKA 3VW3H 1H15B 2VDQH 2ZKHL 4HKJA 5JO5B 3EDDA 4JHZA 4U4BA 4OFPA 4XXDA 5CD3B 5IM7A 1CGYA 1UCBH 2GJZA 4L3CA 1QD0A 3QNXB 1NEUA 5GRWA 2DKSA 5ADPL 4MQSB 1KIQB 4KV5F 2EE9A 4JKPL 1SJEB 3SKMB 3H42L 3DXAB 2V5MA 3VXSE 3DHJA 5DD3H 3DXAD 4G6ML 3RNQB 4ZNCD 5GGRA 4CJ0A 4LEOA 5IG7A 5EO0B 4PV9A 1EJOH 1EBAA 3DETC 3GGWA 3CNKA 4RMUA 1KXTB 1CN4A 3BEWA 3BGFB 5D93C 5T1LA 1VFBB 3EYVB 4Z77B 3MRKA 5KVMC 3LKOA 4MZ2A 4H8WL 1CICB 4PJ8B 1N6UA 3GSOB 1CICD 2EYRA 4PJ8D 1KB5L 3C5ZC 5K9OA 3CLFH 3MFGB 2J4WL 4JO3L 1MCHA 4KXZI 3C5ZA 4RISH 5TE6L 1RHHA 1JCKA 4UDTB 4ONFL 4QRRE 5ESAB 5CZXC 4GKOA 1MHPL 3BSZL 1GGCL 3BKML 4QF1B 2IPUG 3TO4B 5K9JH 1CBVH 2ARJB 4F7PA 4ELMA 5FYJL 5FV2A 5K59E 1I85C 1Y0LB 3K8MA 4D8PA 5CEXB 3RGVA 1MFBH 5IWLC 2WUBL 4QCIA 4PRPB 3TBSB 1R3IH 2NY5H 1OOAA 2DQIL 2HH0H 3CCHA 3T2OA 3BHBA 1BJ1J 2WWKO 4HUNB 5ILTH 4KAQL 1RJLA 2HLAB 4H0GA 4WI3A 2W92A 4HZLB 4EUPA 3MBXH 1JNLL 3FCTB 4PG9A 1E6JH 4DFHA 3MREA 4DW2H 2V9RA 3MXWL 4LVNB 3NCJL 3PIQA 1FYTB 1CGUA 1IAKB 1WJ3A 1FYTD 4YFEA 4TUJA 4XPGL 3KPPB 4R96B 3WFCL 3KPSE 1NAKH 1EJ6A 5JXAL 5LJYH 2UZXB 4QXUH 3G6AA 4J4PD 5IB1B 1I1AC 4AL8H 1SEQL 3R1GL 3NCMA 5T3XD 4N9GA 1ONQB 1RZGA 1MAML 2DMKA 4UDUB 1NCDL 1WEJH 3LAFA 1A8JH 4YGAB 3LS5L 1ACZA 2XN9A 2WAHA 4RFOH 5FA3A 4EKXA 2HFGH 4QXGH 2E8YA 1GGIL 1G0YR 5CSGA 3VXNA 3B2VL 4P5MB 2BVUA 3DGGA 4JLRA 4WFFE 4JO2H 4HZAA 1KEML 5D7LE 4EBQH 4PJ5E 3SE8L 2EDRA 3LKNA 5C6TH 5ACZB 1PW3A 3NCFB 1ZGLA 5DJZA 1FAKT 1SY6A 4X5WB 2Z92B 4HW6A 5FXCH 3IDMA 2GUOA 3BXNA 4DKAA 2V2XB 1L9NA 1S9YB 1ZT7B 4HIHB 4TNWF 5DUPH 3MROA 5J13B 5DUML 5F9DC 3LH2H 5EIVA 4OFIA 3WNOA 1A3LH 4WWID 3CAFA 4MS8D 5EULV 1MNUH 4Y19B 4GMTL 3TCXA 3BAEL 3QEQB 4Y19D 1AY1H 3WIHL 5L2KE 2HT3C 4IDJL 4GLRI 2YXMA 3FN9A 2Y06H 4F7EA 5EWIH 4L4VB 5MI0B 4X5XA 4FQHB 2X1XR 4KMTL 4L4VD 1DBKL 1WAAE 2MMXA 3KPOB 5DI8B 3BQUB 3BYTA 1GC1H 3BQUD 5CEYA 2AXGB 3L3IA 3O2WL 4A6YB 4XX1E 5E2TH 3WLBB 5HPMA 5HDBE 5GS0H 3PL6B 5C0CA 1YNTA 2X2YA 5F7DB 3PL6D 4BUHA 2MHAB 1GIGL 3OJDA 3QDGB 4P59H 3FB5A 1FAIH 2F58L 3QDGD 3CFKA 2XKNB 3I50L 4Y4FA 2IQAA 4PJGE 4R4NC 5CGYC 3RI5K 4KROC 2C3VB 3RVXD 5JOEA 2VXVH 3NZ8A 1U91A 3VXMA 3DJ9A 5E08L 4P4RA 1KNOB 32C2A 4FQLH 4P3WA 4LSPH 5CUSL 2CIKA 4ZUSA 4K8RH 1G6RL 2IGFH 4U6YA 2CDGB 5DEFB 5HGHA 1NDGA 3FB7A 5CS7A 2C3XA 2CLVB 1FZKB 2BSTA 4GO6B 5B3JF 4JJ5B 3M17A 3SDDD 1DUZB 1P6FA 1JZ2A 2OSLB 5C0ND 1LEKA 4WTXA 3CUPA 3O2DH 3FOLA 5JQ6H 4NKIL 4LK4A 2APFA 2P8PB 1KEGL 5GGSY 2ORBH 4K3EL 1F11B 5SX5K 3RY6C 2A9NH 4ONHB 4GW4B 5C70A 5A2LH 3KS0H 1VA9A 4XCNA 1QR4A 1A3QA 1AGEA 2UZIL 3SDCC 2H3NB 4J6RH 3UBXI 2AS5M 4Y1AB 1NEZB 4XGZB 3B3IB 4PLJD 1HCVA 4Y1AD 4OCWL 4P23D 1CDUA 1F02I 1E4WH 5E5UB 5IOPA 1FP5A 3PABA 3BKYL 4U1MB 4G7YL 1R5VA 3HPJA 1TZHA 2J2ZA 1YECL 1ETZA 1NGXA 4O5LL 1CD1B 3SGDH 4ODVL 5CJBA 4MJ5B 4TVPH 3KNBA 2AEPL 1ES0B 4MJ6A 5T1MB 5I1EH 2NY6C 1S7UB 2K9UA 5F9JB 1FNFA 3QJHA 4DVBB 3WE6A 3F58H 3IAQA 4AYFA 4S0TD 1BIIB 1CFNA 1EZVY 3C6LC 5T3ZE 4PJAA 1IL1A 3O6KH 3UXFA 2QSQA 2ZPKH 2IQ9H 4JHAL 3VFOB 1RVFL 5IHZA 3G9AB 1JE6A 1CTOA 5ICYB 2YD7A 4TPRH 1HNFA 2RAMA 3PE9A 3WDJA 2XTJC 4P3DB 1BBDL 1NANI 1LD9B 2NY7H 2Y9RT 5T5NF 5H2BA 4UUJA 1UJ3C 2XKUA 3CDGA 4OBRA 5E56A 4TN9A 3QCUH 5HYJB 4KK6D 1UJ3A 1C12B 3VW3L 2VDQL 5HYJD 3AS1A 3RWJA 1F3DJ 3UZQA 1OB1B 4QHLA 5D7JA 4PJIF 5C86A 4OGAD 3KPRA 3DO7B 3VH8B 3RUGE 3TPKA 4RNRB 2EH7H 4LSDA 2CLRA 1N59B 1VGEH 3QEUB 3PQYE 5EOCJ 1EEYB 3HR6A 3PG2A 3ZDXF 4PGCB 5HSFA 2NXYB 5C9JA 5JHDD 1ROWA 4S2SA 2NXYD 4YO0A 1R3JB 2VLKE 3MUZ1 4UAOC 5EOQL 1AIFB 5EG6C 1EJOL 1MFDH 3T3ME 4N0RA 3DI3B 1BX2B 2YHGA 4CBPA 1U8JA 4XXDB 1KTLB 4L3CB 3L5XH 1TVDA 4LPUA 2Z8SA 5IEHB 3TFKC 3RWFA 5F97E 3IT8D 4YFDB 5GGTA 2NTSP 3K8LA 3CLFL 4FFYH 4CDGC 4DJMA 5BZDA 1GZPA 1QBMH 4YK4B 3G5XA 1JK8A 4XVJH 1XAUA 3S5LA 4LEOB 5IG7B 5CIPA 1RIHH 4PV9B 5T1KA 3T0XA 4K7PX 3GGWB 3IVKA 1NBZB 1MFBL 5FAAA 3BEWB 3CVIH 1KFAH 5T1LB 4RZCA 1R3IL 2NY5L 5GGUA 3AGVA 1B0GA 1RK1A 5T1LD 3MRKB 4Z9KB 2HH0L 4KRPB 3CSYA 3OG6B 4W4OA 3KYKL 4KRPD 2HRPH 3WD5H 2EYRB 5ICZB 4L8CA 4TVPE 3C60C 2X4SA 4NQCE 1IZKA 3K1KC 3MBXL 1CD0A 1E6JL 5C6WH 3C60A 1RHHB 5IFJA 5F93C 2DD8L 3C5ZD 1A6AA 5DK0A 3D0VA 3A0OA 3DVGA 3PWUA 4JPIB 4F7PB 1V3JA 5F3BA 5CZXD 3VFNA 1DBBH 3WS6C 5J9PA 2FX8L 5E5RB 1NAKL 2HLFD 3RGVB 3V9FA 1N2RA 3JZ7A 4PJEA 3RGVD 4QXUL 1KXVC 3M45A 3CCHB 3BHBB 5DK2B 4AL8L 4N5ED 3LEVH 3QEHB 4Z95L 3PV6A 3C8DA 5C3LD 5AZ2H 3OZ9H 2B1AL 1FNGA 1WEJL 2QQNH 1U9KA 4PLKC 3MREB 4HMCA 1IGTA 4XP6H 4RFOL 4BQ8A 3PIQB 2HFGL 4QXGL 1T7XA 4F37K 4TUJB 4JFDE 3E2HC 2W60A 1UYWH 4MA8L 1TLKA 4N0CD 4LPCA 5EFIA 3BWAA 1IVLA 4JO2L 1H3TA 1ZA6A 4EBQL 4LAJH 4PJBE 5C6TL 3G6AB 2HVJB 4YAQA 3TEUA 1X3DA 4POYA 3SDYH 1U58A 5C0BE 4BSJA 4N9GB 5DUPL 2PNDA 4RA3A 3FB8B 3LH2L 4RDQG 1CG9A 4OCXH 1A3LL 4NKQB 1MNUL 3CXDH 2XN9B 4XVUC 1AGCB 3FHAA 2FCBA 1AY1L 2XN9D 2N7BA 4J3UA 1BECA 3OKNA 1LO2H 4MXQC 2Y06L 1TFHA 3MLXH 5FA4A 5EWIL 3T77A 3DGGB 3IDUA 4UILL 4UIKH 1CL7H 5JW3H 3IDNB 3UTSE 3LKNB 2BNRA 1GJIA 1MFEH 1ZGLB 3VGGA 3ZYJA 4NC1C 4GG6E 3GHEH 1ZLUH 3IDMB 2GUOB 1VDGA 5EPMB 2YRPA 2Y72A 5E2TL 3BDYL 3GSNA 2W0PA 3LEXA 3UROR 1T1XA 4P2YA 3AB0B 1FDLH 4JM2B 4PJCF 3VXRE 4NDMB 3SKNB 4P59L 5HHOA 1FAIL 5F89A 3KJ4C 1F6AA 2EDWA 4F7EB 3FJTA 4L5FH 1M6OA 1VFUA 1P4IL 2VXVL 4IOIA 1ZT1B 3RPKA 4CJ1A 5F44A 2XQBL 5SWZE 1J0IA 1JMXA 4FQLL 4GQPH 5E70A 3F7QA 2W59A 3L3IB 3T09A 3BJ91 5HPMB 3U0PA 1EEZA 1VSCA 5C0CB 3TT3H 1A0QH 3M1BA 4QNPE 4K8RL 1YNTB 4G7VH 5C0CD 2GY7B 3RPIA 1A4JA 2O61A 3FQXA 1NFDE 3CFKB 4Y4FB 2DL9A 2YBRB 4MQ7B 5E00B 4Y4FD 1QRNA 3S97C 1AKJB 4HCRA 1J8HB 4UNVA 2YSSB 4Y5XA 1J8HD 4HPYH 5IGXH 1MVFA 3NZ8B 3VXMB 3DI2B 3O2DL 4KROD 3VXMD 4P4RB 5JQ6L 3ULUH 1NH6A 5K33A 4XAKE 1XR9A 2ORBL 2A9NL 1YPZF 1QEWA 3GSQA 2CIKB 4ZUSB 4J6RL 4WFHE 3V52H 4U33A 5C9KA 4LFHD 4U6YB 1D7FA 2WBJA 5HGHB 1NDGB 5BO1L 3QHZH 1KTRL 3FB7B 1OQOA 3X12A 1E4WL 1LEIA 5C08A 1T03H 1AC6A 3BZ4A 3ULVD 5GS2H 3CUPB 3FOLB 5IBUG 4TVPL 4JFEA 2CSPA 4WHTA 3WIHA 3UYRH 1U3YA 4YZFF 3F58L 3UTZA 3SBWC 3SGJC 1ZAGA 1P7HL 1AGEB 3NIDF 3HN3A 4NQEA 3JUYA 3V0VA 1ZLVH 1ZLSH 3SBWA 3SGJA 3O6KL 2ZPKL 2IQ9L 1L7IH 3IU4H 3ES6A 3KYMA 4M6ML 1EEQA 5IOPB 4TPRL 3ZHKA 3BJLA 4WGVB 1R5VB 5I17A 1TZHB 5EZOH 2A77H 3VG9B 1NGXB 4R2GB 1NBQA 4NZRH 2NY7L 1QFHA 4R2GD 3KNBB 5FUCE 4MJ6B 1NCTA 5FHAH 1I1CA 4JPKH 1RQ5A 3QJHB 3QCUL 1J0HA 3QWOA 3UAJD 4FOMA 2BY1A 2Q3AA 3WE6B 1TTFA 4LP4A 5I1LA 1RAMA 4F9PC 1J86A 2NY6D 1CFNB 1G0XA 1R24A 4PJAB 2XXMB 1IL1B 4O4YL 4XC3H 4F9PA 3MJ7B 2I5YH 3PP3H 3OKKA 4U1KA 2EH7L 2FEEL 4G6AC 5EB9A 1S7WA 4WFED 1WV7T 3OKLB 1U8HA 3KPQB 5DFVC 4HBCH 3F65A 5L88L 5AYQA 4WRLA 5CHNB 1RMFH 4RMVA 4UUJB 1U93A 3C09B 5D1XA 2FLBT 4L4JA 3QDHA 4N5UA 2JKXA 3JUZA 3TJHD 1MFDL 5AG9A 4FQ2H 5DO2C 3IFPB 4X4XB 4PJ9C 4NCC2 4E41A 4QHLB 3QULA 4HXAH 3DX8A 3EOTH 4PJ9A 5D7JB 3WUZA 3VU2A 3L5XL 3KPRB 3B9VA 1HH9A 5DVNA 5A2FA 5D7JD 3JWOC 4MCZA 3KPRD 1CE1H 3J7HA 3VRLF 4OCNC 4TTDC 2CLRB 1LK2A 4G6KH 4FFYL 5K9QG 1VACA 2BHUA 4JQVC 4S2SB 3HAEG 5GS1B 4M7ZB 2IBBA 4XVJL 4GKZB 2X9YA 3OV6A 4I2XE 4P5TC 1RIHL 4TTGA 1XF4A 3QRGH 1IJ9A 4P5TA 5EZLA 1B0RA 2ICEB 4IRSC 3T4AA 3CVIL 1KFAL 5ITFB 1OGAE 3RGHA 3WMSA 1U8KA 4TVSa 4XMLL 5MP6H 1OTTC 3RWFB 3WD5L 2HRPL 5IMKA 1KYOK 5DQ9A 1I1YA 2K1MA 4DZBA 3TFKD 4M61A 5BZDB 1DEEA 5GISH 3G5XB 4ZODA 1SMAA 2OJEB 1R3KA 5A2JH 3S5LB 2Z9TA 3IKCB 2AXFA 4UU9A 4Z7UA 2NNAA 4GMSH 5F1OB 5DR5L 1DBBL 3O6FA 3IVKB 2HAZA 1VKXA 1T7ZA 5FCUH 3AROA 1DE4A 5GGUB 3K2UH 4N1EA 4ODSH 2P24B 4ZFFB 1A9EB 2R2BA 4TUKH 3LEVL 5DRWA 1U8OA 4L8CB 3IDYB 3VFWA 3UZEA 3BZDA 3OZ9L 5IFJB 4PS4H 4XP6L 2DWDA 3UO1L 5A1AA 1A6AB 4MJIA 5DK0B 3D0VB 5E2WH 4ACPA 1U8PB 3PWUB 3P11H 1UYWL 4YXLH 4FMFA 5I66A 3V79C 1FZOA 5J9PB 3BX7C 3C5JA 1VFAA 3ARBA 2CKBB 5HYEA 2AK4E 2XTLA 1S9VA 3SDYL 3PV6B 1U41A 3TBYA 2OX5A 4MCYA 5IVXE 3TH4T 4YE4H 2FO4B 4FTVA 1JZ6A 3PXHA 3WCYA 3EYSH 4OCXL 3KPNA 1IGTB 4OIAA 3CXDL 3T1WA 3EYQC 4FZEH 1IAII 1LO2L 3ZTNH 3MLXL 4NFCA 5EFIB 3P0GB 4UIKL 1ZA6B 4HSQA 1CL7L 4PREB 5JW3L 5F7LB 2VH5L 1K4CB 2WIIA 3O2VH 1MFEL 1YMMA 1U92B 4YAQB 5A3IC 4ODWB 3GHEL 3L3JA 4GRWH 1IM3B 2XZQH 4PRAA 1EGJH 3F5WA 4Z76A 4R6UA 2D7TH 4UOW0 3NPZB 2Q76A 5DHYA 4JM2F 3NOIA 4BZ1H 2FECL 4LMQE 5TF1H 2I9LA 3OKNB 5BRZA 5FA4B 3T77B 2FH6A 1KOAA 4N8CH 4L5FL 5FKPA 4N0UA 1HHHA 2V2WA 3X3FH 2BNRB 3W81A 2RFXB 4FXLA 5HVFB 5IT2H 2BNRD 3VRIA 3ZKNC 4KUZH 1BBJA 4NFDA 3ZSSA 5EN2A 5ERWA 5HBBA 3OAZK 1MCOH 2X4OB 3GSNB 3KHQA 3FRUB 3TT3L 1A0QL 4EUPG 4O2EA 2B8OT 4G7VL 2OTWA 3FB6A 2R1XB 5HHOB 4F9LC 2LAAA 5F89B 1T4KA 5HHOD 5SWSA 5DJAA 3FT2A 3DYOA 4F9LA 1H8OA 2FZ3A 1F3JA 5I76A 1EFQA 2AJSH 3FFCA 1QR1A 1UQSB 1QOKA 2XFXA 2BP3A 4YWGH 1SVCP 1WTGT 3VFRB 2W9LA 5IW6A 5I1AA 3U0PB 2G9HA 3F7PC 3M1BB 2I24N 3V52L 3RPIB 1A4JB 3QJFA 2O61B 4M48H 3SKUD 3KR3H 4HBQA 3QHZL 5DRNB 4UBDC 2DMBA 2K3TA 1NQBA 4K3DH 1T03L 2E7BA 2R1WA 4LARL 4Y5XB 5JXEC 4OLWH 3T1FA 3ULVF 4G9DB 5D5ME 4Z7VA 4FS0A 8FABA 3QDME 1OLZA 2YMXH 4YUEH 4NYLA 4YHML 5HVHC 3QP3A 3UYRL 4HEME 2PTUA 5FDWB 1RZJH 1QEWB 4HDIA 4WI8A 2G5BA 3GSQB 3BP6B 3OGCB 2R0KH 1ZTXL 4DGYH 3EZJB 1ZLSL 3L9RA 1N64H 2WBJB 5CMAA 2WANA 4HKZA 2YPLE 1L7IL 2WBJD 3IU4L 2BHYA 2ESVA 1LEIB 4K71B 3RZCB 4FHBD 1W72A 5C08D 2Z31C 5EZOL 2A77L 4Y4KA 2DYPA 1BJ1H 4NZRL 2QADC 2Z31A 2VERN 5TH2A 4JFEB 4QHMA 4WHTB 5FHAL 1JHLH 3C87A 4JFED 4JPKL 1SVZA 4GS7C 2VR9A 4FXGA 3NN8A 2AQ3A 5CJXC 5EUOE 1UKSA 2ICWB 5FYLE 5ENWB 4XBEH 2FHFA 1OP5H 4LPYA 4WIQA 4XC3L 1KACB 3OR6A 1T5XA 1GGYA 43CAA 3ES6B 3WJLC 3KYMB 2QTEA 5C09A 3NCYP 1Q9LA 4MGXA 4NSKA 2DQCH 2EH8H 3WJLA 3I3DA 5I17B 3FQTB 4NO5A 4QO1A 3LD8B 1SM3H 4KRLB 4HBCL 4WTZA 3TBWB 1RMFL 5DA0B 3IFLH 2AJUH 1U8NA 1J10A 1HHKA 3QWOB 4FQ2L 4HC1H 3DSFH 2D7QA 1FJ1B 4NNYA 5C0AE 4UZGA 3IDJA 2B4CC 3VXQA 4KUCD 1R24B 1JUFA 4HXAL 4K55A 4S1DC 1JRHH 3STLA 1JZ8A 2VISA 3MFFA 1IKNA 1P9MC 4IOFD 3O3AB 4KKCC 4PJ7E 1DL7H 5F7EH 5AEAA 2APWA 5FYKD 1QLFA 4G8GB 1S7WB 4G6KL 4K9EH 4Q58C 3B9KB 1VENA 2EKJA 5CP3A 1U8HB 2CXKA 2GK0A 4HWBH 1HHIB 3P9LA 5I18H 3GO1H 1W0YT 1U93B 4D0BA 5D1XB 3INUL 4NZJA 4KKLC 5D1XD 1CDBA 4OLUH 5KN5A 4MQTB 4I3GA 1UWGH 5GRZA 3ZE1F 3WLWD 3QRGL 5KVFH 2L7JA 3IAGC 4P46B 4U3HA 4GAJL 4IS6A 5FGSA 1U8QB 3QULB 2HRLA 1R6VA 5MP6L 1WT5C 3HC3H 4HJ0C 5D6DC 1FO0A 5LVEA 1X5LA 5C2UB 4JY5H 2JJTC 3PDOA 4MCZB 1BD2A 1K6QH 2A6DB 1JBJA 4C58B 1NPUA 2OR8A 3ZKMC 1JGVH 3JBG7 2JJTA 1LK2B 2ERJB 1WFUA 4KI1A 1D9KC 5GISL 4PJDB 1WIUA 4D0DA 3MGOA 3S4SG 2OMBA 3F6LA 3U6RA 3ZT6A 4EQ3A 4JRXA 1PEWA 3RVUC 1ZS8A 5BV7B 4MAUL 1CFQA 1KT2A 3WKNA 1XF4B 1JWMA 3TVMA 5EZLB 3RIAF 1B0RB 4P5TD 5DD1H 5FCUL 3T4AB 4KK5C 1SBSH 5DEGA 2BERA 1RJZA 5D7IE 1AP2A 2A6IB 4HIEA 1BMGA 4PD4J 4GW5A 1I1FA 4ZYKB 3SCMC 1I1YB 4DZBB 5IW3A 4M61B 1OTTD 4PS4L 2CD0A 3CSBA 4HAFA 1R3KB 4YFLI 4KY1H 1A2YA 3C9NA 5DD6A 5E2WL 2GTZB 2AXFB 3P11L 4YXLL 2NNAB 1Y6NR 2JE8A 3O6FB 2DN7A 1VKXB 5FOBA 2VZVA 3O6FD 2R2HA 4ZS7H 4X98B 1BM3H 1INDH 3MV9A 5DRWB 5L8KB 1YYLH 3BPLC 3WUWG 2LTQC 3VFWB 4NO3A 1ZHKA 5E03A 4H0IA 1NL0H 4DK3A 3GMPB 4J3TA 3EYSL 4YJZL 35C8H 3HB3D 2IFFH 5GRVL 1Y6MR 2DIBA 2JCCF 4FZEL 4MJIB 4LOUC 4GAFB 4MJID 3IXAA 3U4EB 3H3PH 3P9MA 3MODH 1A3RH 5FGRA 2VSCA 4LRNH 4G3YH 4ZAKA 4JN1H 3ARBB 3FQRA 4L8SC 2C5DC 5J06A 3ARBD 4I77L 1RZKH 3O2VL 3HNVH 1A4KA 4PRIE 3C6SA 1S9VB 2JELH 1DEDA 3P3YA 2H2SC 2FIRT 5TE4H 4C59B 3QG6A 5D7SH 3MZTA 1MCLA 2XZQL 4Y0GA 1WICA 1ZK9A 2WK2A 5CINH 3RWEA 4FTVB 2B0SH 5H37G 2D7TL 2BX5A 2NY0B 4FTVD 3ME0A 3LSOA 3KPNB 1ZVYA 2NY0D 1FIGH 3GBMH 3U4BH 4YHNA 4BZ1L 1T7WA 2X05A 3ZDZF 4WO4C 3UJJH 4D94A 1QKZL 2FL5B 5D2LE 4N8CL 4WO4A 4WFGD 4R0LA 4WV1A 4DWHA 4P3CH 3X3FL 3HNTL 1MJUH 1P1ZA 5IT2L 1YMMB 3MRJA 1A1NB 1YMMD 4KUZL 2EDEA 3L3JB 3BIAX 4R4BA 2NY1B 2D2OA 3RKDC 4CNIA 3KPLA 4C56B 2NY1D 5A3ID 4Z76B 1BZQK 2DF3A 5KS9E 3B43A 2GI7A 2Q76B 3DVNA 1I4FA 1MIMH 3QI9C 2N7AA 4KTDH 2VAAB 5IB5B 5J1TC 1MQKH 3QI9A 1V3MA 2I9LB 1CE6B 2I07A 3IB4A 3QXUA 4N0UB 2AJSL 1HHHB 2CK2A 2V2WB 2ADIA 1DSFH 4JDTH 5T1DH 4LQ1A 5E2JA 4YWGL 4HUUA 3VRIB 3LIZH 5IESL 1DLFH 1BVLB 2C1OA 2CQVA 5ERWB 2FEDC 5EOCH 5F7KC 4YHZH 4MVBC 3LHPH 4O2EB 1ULVA 1RIUH 2OTWB 4KI5F 1KPUB 1F4WH 3KR3L 3QDAA 1SJHA 4HF5H 4PRHE 1XCTA 5HYFA 4KJYA 1TPXB 3TESA 3ET9F 5DJAB 3FT2B 1N0XH 2FZ3B 3KWWA 4RGNE 4K3DL 3O3DA 4OLWL 3FFCB 2VJXA 2APBA 2XFXB 3FFCD 2YMXL 5DJXA 1L4IA 4YUEL 3GUTB 3TP4A 5I1IH 3SGKC 2JK5A 2LAGB 1UENA 2NTFA 5GHWH 5I1AB 5L9DH 3GMNA 4DTGH 2VLRA 3DIFA 1NAMA 3SGKA 3PWVA 1AXIB 4DGYL 3QJFB 4Z7QF 4RSVA 4K2UH 4GKSA 4WENB 4PGBA 3U0TA 3QUYC 1E4JA 3Q1SL 2MNUA 2XICA 4JCLA 1U2HA 3BW9A 3QUYA 4KV5E 2R1WB 1CLOH 3SQBA 2J8UB 4UBDD 1UB6A 2BVQA 4Y8DC 5B38A 1BZ9B 3R8QA 5EBWB 3MV7A 4NYLB 5CBEA 2V6HA 3VXPA 4HH8A 4Y88A 1JHLL 4PY7A 2H9GA 3O45A 2X6MA 3DX9A 3P9WB 5HVHB 3PWNA 5AAMA 2G5BB 3T0WA 1AXSA 2GTWA 4XBEL 1XGPA 3L9RB 2DJ4A 5IJKA 5CMAB 2APVA 1MPAH 2E7CA 4Z8FL 1MQ8A 4HKZB 3MJGX 3LMJH 5E1HB 1X5XA 4ZUWA 1FGNH 1DZBA 5EC1A 1MJ8H 5JLZA 1EIBA 5I8EA 4CL7A 2ESVD 3CFBA 1W72B 1KN4L 4PJXE 3FN0H 4Y2DB 4Y4KB 2XV6B 4G9FA 2DYPB 5GS0D 4Y2DD 4Y4KD 2DYPD 2D0HA 4LHUA 5EU7C 5TH2B 3G6JE 4QHMB 2Z31D 2AJUL 3IFLL 4Y5VC 4FXKA 3SKJH 3RWGB 1UG9A 2QADD 4HC1L 2J7LA 3DSFL 3MOAH 5KSVA 2ADJA 3CPLA 4GS7B 4HUMB 3LEYH 5B22A 2HTLD 5J12B 3OJMB 5HDOA 3U7WL 1TJIH 3QPQC 1JRHL 3MNZB 4D9LH 1DDHA 2UWEA 1V8HA 1HYSC 5F7EL 1DL7L 5FF6B 1TQBB 1UH2A 1Q9LB 4QWWD 3K4ZA 3UDWC 4NO5B 4X80H 1KJMA 4LMQI 5D6CA 5K9QI 3F8UB 3V6OA 3BI9X 5I18L 4QRUB 4F80A 3GO1L 1J87A 3T08A 4BFIB 3G5YB 1U8NB 3W82A 4ERSH 1QSVA 1BIHA 3ISWA 2DMCA 4OLUL 1HHKB 5J11B 1UWGL 1HIML 2X1PA 5KVFL 2WV3A 2G75A 4ZFOL 2F5BH 3QXDB 4XVSH 4G8FA 1ZKAA 3CK0H 1QRKA 1JUFB 2FO1A 2XZAH 3DOSA 4Y5YA 3STLB 3WIFB 2D4DA 4RFNC 5FO9A 4DGIH 3MFFB 2DQDH 4JY5L 4Z0BH 1S7RA 1K6QL 5F1KC 1QLFB 3LN5A 3O6LL 1JGVL 3MRFA 5KZCB 2X4NA 4I18A 5KZCD 4YHIA 4LGPB 3P9LB 4M7KH 3FQWA 3LN4A 1B0WA 4MNQA 4PJDF 1IGFH 2OMNA 4D0BB 4OKVA 2BVPA 1HQRA 4LCIH 3IJHA 3SE3C 5K59F 4UINH 1IAOA 5KN5B 4WY7H 4ZD3L 3SE3A 4DVRH 4OI9A 1V7MH 5DD1L 1OSZA 4KKLD 4IS6B 3MRLA 3S88H 1SBSL 1R0AH 1BHGA 3CX5K 2OL3H 4LIQH 3QDJE 4JN2A 1JGLH 3PDOB 5I1GH 5LAXB 1ED3A 4JKWA 4BQ9A 1YZZA 3ETBF 1BD2D 1S8DB 1N26A 3DVIA 1HINH 2D7MA 4OZ4A 3UBXA 3RVVC 5L2JA 3MRGA 2JIXA 4D0DB 3KYAA 3MGOB 3HR5A 3ZKMD 2X4TB 4KY1L 1J11A 1WVZA 3VRJB 4OZGE 1KTKE 1T6VN 4MLSA 5GZOC 1FCGA 1ZS8B 1KJVA 5EZJA 1KT2B 1JGUH 1VCAA 2HT4C 4EEEA 2BY3A 5SX4I 1JWMB 4B7IA 2FJHA 4OT1L 3TVMB 5T5NG 3KXFB 3TVMD 4GG8A 4PUBH 3KXFD 4ZS7L 1BM3L 2PXYC 1RJZB 1DQTA 4ZG1A 1AP2B 4JCMA 1GVIA 1YYLL 4KK5D 4GW5B 1F6FB 1I1FB 2R23A 1FFOA 5FK9B 3N85H 1NL0L 1LQSR 3STZB 25C8L 35C8L 2IFFL 1D5ZA 3MGAA 3U30B 2PO6C 3LRGA 3MACH 1A2YB 3C9NB 2C4XA 3ZHLA 1A6UH 2PO6A 1F4AA 4LRIC 1TENA 3WXWH 4LRNL 4G3YL 3MYZA 4JN1L 4LRIA 5FOBB 1PVHA 4NBYB 1YNLH 4ZQKA 3D6GA 4NFBA 2IH3A 1RZKL 3FQUA 3HNVL 3MV9B 4NHCL 2WWMD 5E24E 3FMGH 4E9LA 4MB4A 3MV9D 2JELL 5J3HD 1FLRH 5TE4L 4X7FC 3WXVH 5D7SL 5HHQA 5KW9H 4NO3B 1ZHKB 5CINL 2B0SL 3FO1A 5MEPA 3OR7A 3QWRD 2C1PA 5ABDE 1Z0NA 1RPQA 1FIGL 3GBML 3EYOA 3U4BL 3QQ9D 2B5IB 1INQA 1K4DA 3VJ6A 5GPRA 3IXAB 3UJJL 1LE9A 3P9MB 2GJ6A 4QRSB 3ARGA 5B3JE 4LOUD 4ZAKB 5F8QC 2XA8L 4H8WC 4LAQH 4LDEB 4BYHA 2VDMH 4ZAKD 4P3CL 1GOFA 3K80A 1MJUL 5A2KH 5I9QC 3C6SB 5C1MB 4LU5L 3W5MA 3H9SA 1BFOA 3MR9B 1JZ3A 4YDJA 3PUCA 3QG6B 5HDBF 1WBYA 4U3XA 3RWEB 1OM3H 5F7UA 1AE6H 3WL9A 2EKSB 4KTYA 2CMRH 1EV2E 1F00I 1MREH 3LSOB 5JW4N 4Y16B 1MIML 4KTDL 4OTXH 4W70A 5L0QB 1GH7A 2DLGA 1N6VA 2VL5B 4Y16D 3FT3A 4YHNB 5HYQA 4C57C 1MQKL 2VDOL 3QXVA 1PYWA 4AEEA 3F7RA 3GMLA 4WO4B 4O2CB 1Q9KB 3OMZA 4R0LB 4WV1B 5DVOA 2Q7NA 4WO4D 2F54A 1P2CB 1P1ZB 5T1DL 4HAGA 3MRJB 2A73B 4WEUD 3LIZL 1XZ0A 1DLFL 1JPGB 5SX5H 5EOCL 2EICA 4CNIB 4YHZL 4MWFA 3LV3A 3LHPL 2PW1B 2V7HA 1RIUL 4Q0XH 3BE1H 4ENEC 4DUVA 4RFEA 3RKDD 3SDXB 4QOKE 1F4WL 2EZ0C 4GT7A 4HF5L 4NQDE 1JN6B 2FH8A 4ORGA 2FGWH 1X5FA 4X6FA 3QI9B 4Y8AA 3CX2A 1N0XL 2I07B 4X7TA 3QI9D 2P8MB 1HKLH 4OFYA 2DWEB 3K8KA 5EU6B 5ADOH 3DRTA 4GW1A 3AXLB 2FRGP 5TE7H 1FH5H 3T3PF 5EO1B 4OZHE 1B6UA 5I1IL 2MQ3A 2C1OB 3HMXH 1RJCA 5GHWL 4DAGH 5F21B 1YJDC 2LFGA 3NGBC 2OZ4A 4DTGL 1HSAB 5INDB 1G9MC 2QHRH 43C9A 2QSTA 1H3WM 4PGDA 1YN7A 2ZOKB 2YD8A 3ZT5A 4MVBD 1KLUA 3VMPA 4OLEA 3QNZA 3ARWA 3O3DB 5C7XH 1I3UA 1CLOL 1EGJA 3SHSA 4HHAA 1WCBA 4M4RA 2J8UF 2X89A 3BH8A 4LHJB 4NHUA 4K7FB 1Y18A 1UADC 3ZDXE 2P5EA 1KULA 1F8TL 3DXAE 3CXHK 1X7QA 4BK4A 2OQJA 2YUVA 4LSSH 1PKOA 1WWWX 2VLRB 4HK3N 2EIDA 3DIFB 4BFGA 1NAMB 2FNBA 3PWVB 2VLRD 1OP9A 3L3HB 5HHNA 1ZSDA 1OL0A 1MPAL 4CN6A 4GKSB 1LK3L 3I6LD 4N9OB 3U0TB 2HVKB 1IMHC 1FGNL 1MJ8L 1B2WH 2J5LB 1U42A 4TOYL 1BQHB 2R2EA 5CP7A 1UB6B 3FN0L 2BVQB 4X6EA 4YNYA 4WU5B 3OB0K 4IIQA 4KDVA 5B38B 2YWYA 3W11C 1EPFA 3MV7B 5CBEB 1T2JA 3WDIA 4PFEA 5I1CL 3MV7D 4PY7B 2VL4A 3ECBB 2H9GB 4X6BB 1CVRA 3O45B 3DX9B 3PWNB 3MOAL 1FFPA 1AXSB 4HUWB 4ZNEE 3LEYL 3BP4B 4XPTH 4OZIA 1TJIL 1LP9B 3BDBA 4ZPVA 1UZ6E 4D9LL 3RUGF 4PRPE 1CDIA 2BFVL 1TQCB 4ZUWB 5C0IB 5EC1B 1YN6A 5JLZB 3CFBB 1LO3H 4FMKA 3K0WA 4U1SA 4P2CG 3VD3A 4G9FB 1CXEA 1CCZA 4G9FD 3O8XC 4LHUB 2YK1L 5DC9B 4LHUD 1X5ZA 5EORH 4ERSL 1T7VA 3O8XA 4U1GB 1FYTE 4FXKB 5C0GA 3VXSA 4MAYC 4W81A 1JNJA 5KSVB 3BUYA 3VWKA 2F5BL 4XVSL 3CK0L 2XZAL 2A83A 3CZJA 3VE0A 4DGIL 1DDHB 4EDWL 3ULUD 2UWEB 2YPKA 2DQDL 4FZ8H 5ANMA 4JZNB 5T3XE 3WO4B 3ARXA 5DTFA 5F3HA 1WZLA 2GITA 1CLCA 5D6CB 2UZYB 1YEIH 1XGUB 1YEHL 2EXYD 4PV8A 1IGFL 5DMIH 2BVYA 1UCTA 1QQDA 1BQLH 4LCIL 4P9MH 5I73C 3R06A 4UINL 4WY7L 4MD5A 4DVRL 5JW4M 3X3GH 5K9KA 1V7ML 3PGCB 4G8FB 5EO9A 4J8RA 1R0AL 3U0WH 2OL3L 4P4KC 4Y5YB 4G8IA 4O9HH 3BO8B 5FO9B 3KAAA 1RUMH 4LIQL 4WU7A 4ELKB 1S7RB 5I1GL 2O93L 3I02A 4QRTA 4NQTA 5ICXB 1R5IB 3LN5B 2GAZA 1HINL 3S35L 3GSUA 4BSVB 2X4NB 4I18B 4E0RB 4KZDH 3LZFL 1I8LC 2A0LC 3ARFB 3HAEH 3FQWB 3LN4B 4MNQB 5J8OA 2AABH 4NN5B 4K3HA 5C0EA 3ARFD 4MNQD 4OKVB 1I8LA 1HQRB 2BVPB 2F5AH 4Y19E 2QJDA 3QEQE 2CGRH 4QHUA 1JGUL 1KCLA 3D39A 3FO9A 4L4VE 1T3FA 1WIPA 4PUBL 4JN2B 1ZXQA 2Z35B 2AK1H 3TM6A 1ED3B 3SQOH 1A6ZA 4TSBH 4HJJH 1PQZA 1MWAH 3N85L 2EXWD 5L2JB 3MRGB 3WJJC 1FLTX 4OV5B 1EHLH 2IAMC 3HR5B 3QSKB 1S7TA 3MACL 3ARDC 3QDGE 3BGAA 2W9EH</