1MCBA

Principles and pitfalls in designing site directed peptide ligands
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
216
structure length
216
Chain Sequence
PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Principles and pitfalls in designing site-directed peptide ligands.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
total genus 41
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcbA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcbA02
4F2MB 1T1WA 2V7HB 1G9NC 3GJFK 1JN6A 4H88L 4Y5YB 2VLJB 5I1DA 4GRWH 2GTWB 3U46B 1I7RA 3BN9C 5C9JA 4DOHB 4Z0BL 1XGQA 4HWUA 4S1QL 1OGTA 3P3YA 4UUJA 1A02N 3NIFF 2XOTA 2FWOB 3LV3B 4NKMB 5HHME 4OLYH 2XWJA 2AK4D 3V7MA 1MFAH 2FBOJ 3LPWA 3LQAH 3VWJB 2VXQL 4ZAKC 1AFVL 2XN9D 3T8XA 4QYOB 1QR4A 1S7WB 3G6AA 4F15C 1MFBL 5IOPA 3TIEB 4C56B 4KMTH 2IQAA 2DWDB 5J6HA 1IEBB 4AL8H 4P4KB 1K8IB 4JPWL 3PWPD 4L4TE 4QHMB 3UC0L 4NN5B 3UTOA 3GIVB 4WHDA 3DSNA 1RUKL 5HHMB 4Z7WF 4UV4H 3EDFA 5CD3A 1WUNT 1JTTA 2OSLB 3BAEL 4KTEH 2X42A 3VFVB 3OKEB 4XCCL 2DKUA 4MNHA 1JF5A 5K93A 1JPGB 3PHQB 1E4XH 3T3PE 3ARUA 1ITBB 3VRIA 3P30H 4BH8B 2PUQT 4UINL 3PV7A 4KDVA 2YUVA 5DMIL 4YDVB 3C5SA 3MUZ1 1EV2E 1IGIH 4UT6L 3T65A 5HD8C 2GAZA 4L4VD 3CX2A 4RWYH 4WHYH 3RHWF 1I85C 4WWKB 1LK2A 3VFOB 4K55A 5AG9A 4GLRI 5KSVA 3UCRA 3NCMA 4GW4A 2RHEA 5GZND 2A6JA 3FB6A 3TWCL 2FJFB 1BQHG 1CFQB 1T5XA 5L0QC 3MOQA 5DHXB 1TLKA 2NTFB 5BVPL 5CUSH 4FFZH 1OSPH 5CJQL 4XNZC 4KJWD 4AK1A 4PBVC 1I9JH 4ZUSB 1S9VA 1AGCB 1HXYA 5BZWB 1CGUA 1WC7B 3V5HA 2R8SH 4N0UE 1NSNH 3TBYB 3PL6A 4BUHA 3OBAA 3ZDZF 3RJQB 4NP4H 1E4JA 2EYRB 3BHBB 3IF1B 1L9NA 1U95B 3THMH 1KB5A 4RNRB 4O58L 1TJIL 3TN0A 1G0YR 2J12B 4JPVH 4ERSH 3FO1A 1MHPH 1QYGL 4Z95L 1JV5B 3QQ9D 4YQXH 5EZIH 3H42H 3PABB 4F9PA 4RFEB 4NQVB 4IMKA 1JPGA 3M17A 3PHQA 5TF1L 2Q6WB 3LB6D 4AIZA 3LCYA 3VCLB 1DN2A 4TNWF 3SY0B 5GGUB 1JNNL 3G6DL 5E70A 3QEQE 2JJSC 4XBEL 1IMHC 4RAUB 4TQEH 3U7WH 4F7EB 4PBXA 2DKSA 4DVRH 4Y5VB 5EU7C 5EO1A 2PCPA 3UO1L 5FYKH 4F7CB 2A38A 1QFWM 4RMVA 1L9MA 4RFNB 5F7HA 3WXVL 3KWWA 3N1QC 1CFSB 4U49A 4ZUTA 5T1KB 1TXKA 3WCYA 5D93C 3WFEL 4YHNB 4POUB 1I1AA 3CFBB 4XPAH 5E99H 1ZS8A 3VFPA 3SDYH 4YXLH 1NAMH 1LEKB 1W0WA 4LFHD 4OV5B 2ILLA 3DUUB 2AJ3A 2IBZX 1MIML 1IM3A 5IBTH 4HHAB 1RPQA 5GSRB 3SBWA 3U46A 1KEMH 1Z3GH 3F62A 3S37L 3O6MH 3QWOB 4P9ML 5CHNB 4NN5C 3FQUA 4H5SA 5AAWA 4Q9QL 3RGVA 4DVBB 5FO8B 4NRZB 3DHJA 4P2QA 1N4XL 3B9KB 3V6OA 5KAQF 4M5ZH 5L7XL 5HYQA 2PF6A 4YHYB 3P4MA 2X6MA 3RUGF 4PV8A 1BAFH 4N0UB 5JPNA 4P23D 1DVFB 1OTTD 5E8PA 3EZ8A 4D9LL 5LJYH 1M7DB 5CGMA 4GW5A 4JFHE 2QTEA 3NFSL 5GRXG 1KIUA 1AO7A 1TJGH 5TE6L 3BGMB 4EI5C 1M05B 2VNCA 4MD5A 2CJUH 2P5WE 4YWGH 5AEAA 1X4YA 2RJMA 3B43A 3PWNB 4QHLB 2BP3A 2XZAL 4JLRA 1GZQB 4PJIF 1U8LA 3W11C 4ONHB 3RX8A 3CMOL 5EZJB 3PWUB 1CFTB 2H2SD 3IKKA 4OLXL 4LCIH 1GH7A 2AV1A 5LCVH 4XNZB 1T22A 2D7QA 2P8LA 5CEZL 3TN0C 1N64L 4RMRA 4PGBB 3A67L 3HR5B 3QA3A 3CMOH 5SX5H 3ET9F 3BGFB 1OGAB 5E5UB 1MLCA 3UP1A 3DPBA 1B0WA 1FCGA 4PRNA 2Y1VA 3AM8A 1B4RA 5KG9B 3S7GA 3P0GB 4RGNC 4J3TA 5JZ7C 5SV4A 4KQ4H 3AB0C 3PGCB 4RGNB 4XWGL 4ZDHB 3TIEA 4MNQA 43CAB 4DGVL 3CX5J 4KJPC 5DJYA 3QUYD 1LQSR 3SKUD 3FT3B 4PRPE 3IB4A 4D9LH 1NBVL 4YFDB 2F19L 5DK3A 4JO3L 3MOAH 3VMNA 5DO2D 4XMPL 3MFFB 3UX9B 4G8IB 4OGYH 1R24B 4FQXC 1QP1A 3T2OA 3KPQB 2NQCA 3RL1B 3TLRA 5C8JB 4Z7OE 1K8DB 4F37K 4PRPA 4UIKL 4XT1C 5J1TC 4HHAA 3PUCA 3FB8A 1B2WL 3MODL 2GT9A 1J1XH 3IDNA 4CN1A 4AMKL 4P2RD 5DEGA 3CDFA 3SPVB 2QKIB 2AK1L 4FZEL 4WHYG 1ZMYA 3RGVB 4DVBA 5FO8A 3B2VH 1VEOA 4ZNCD 2HTKC 5J57B 3RGVC 5IB3A 5EA0H 2VWEE 1CE6B 5E4EB 1U95A 5F1KC 5CS7A 1YYLH 5JW4N 2BX5A 2VZSA 1A6WL 3LS5L 5L8LB 2FJGA 4U6HB 3WEXB 5JORA 3SJVE 2ZNXA 2EYTA 3ILQD 4BFIA 2VR4A 1D5BA 2IPKB 5I1AA 3MPCA 4KK5C 5F7KC 2Y23A 5IB4A 1LE9A 8FABA 1AI1H 2WBJD 2BVQA 4DVRL 1WFOA 1RZ8B 5FUCE 5FYLD 4Y5XC 3PGCA 4QY8B 1TZGL 1RY7B 3QUMH 5I1LB 1NAMB 1GPOH 5L2KB 4UB0L 4PJGE 1B0RA 3D3VA 5DA4A 3P77B 2JB5H 4PJ5E 3MJGX 3QDMD 3LN5A 2AEQH 3KDMA 4LKXB 4Y1AA 3OKLB 2ZOKB 4APQA 2I24N 3Q5OA 3C6SA 2W9DH 5FKPA 5DTFA 4PGCB 3MV8B 3FFCB 1D5XB 4YHOL 5CSGA 1QSEB 2ESVD 3S96A 4U1HA 3LEVL 3DV4A 3PQYA 1QD0A 1KTLA 3TBSB 4P46A 2FBJL 2ZCHL 2HFGL 1UKQA 4I9WE 1QPXA 1YJDL 3DBXA 4N8VB 4F7TB 5C0NC 5IMLB 3IDUA 4L8CB 1PKQB 4H0GA 4NQDA 3I6LE 2P5ED 2AJZB 5AAMA 1S9VB 2XG4A 4G6ML 4WHCA 2BOCA 2EYSB 3DXAA 3VXRE 1M7DA 2AXJA 2BVUA 1FZKB 1GC1C 4OCSL 4NHUB 4YDJB 1H3PH 1OY3B 3QIUA 5FKAB 2R1WA 5DZLA 3O9WA 1PQZB 1ACZA 2JK5A 4LOUC 3AMKA 3IDNB 5HHOE 3WIIL 1CFVL 3P11L 4YNYB 4E42B 4RWYL 2NW2B 1Q94B 5CBEA 1CK0L 3T3ME 5HJ3B 2KPNA 3T77A 2R0ZL 5LQBL 1NAKH 4WV1C 5ESQA 1XF5A 2VC2H 1A4KB 3BIBX 1KGCD 3ETBF 3WKML 1YNTB 3DO7A 1R3LA 3HE7B 4MXWL 4XNYL 1BQLL 1UCBL 2CUMA 2HRPH 2WBJB 3WUWA 5I1CH 4KGLA 4KI5F 5MEOB 5GRVK 5E9DE 4MCZB 3TZVC 1IAIH 1N6QL 4HUVA 4UT7L 1MCLA 2YZ8A 4PGBA 4K94L 3DRQA 4PB0L 4GG6F 4MCYA 3SDXE 1YN6B 5DQ9B 3MUGA 4PJ7F 3VXPB 4AH2A 3NN8A 5CLWA 1GXEA 5EIIA 4GAGH 3UTTE 3HUJE 4R4FH 3BQUD 3WHXB 4ZXBD 4CMMA 1A7BA 4HIJA 1GOGA 4P2RA 4XPBH 4YXKL 4GMSL 4IS6B 2DJSA 2I9LB 1EIBA 2ADJB 5C71A 5CBAA 5IHUH 3OTTA 1AGDA 2D7NA 3N0PB 2QHRH 4RRPG 4BZ1H 1YEDA 4QXGH 4R3SA 1JGEA 3QCUL 2XFXA 1I7ZB 5GRUL 3HMXL 3B2UD 5ANMB 1YMMB 3RVUD 1FNSL 4GKZB 2HWZL 1JGLH 5TGBA 4EDWH 4I2XB 3OJMB 4H8WH 1F90H 3K80A 5H8DA 1VFBB 3IFNH 2W91A 3VW3L 1DQLH 3O11B 4WI9A 1KCUL 4XP5H 4R7NB 4JG1L 4J3SA 4KDTC 1OOAA 2EE9A 1Z0NA 1AHWA 5AG8A 5EOQL 1XAUA 1PVHA 2ZG3A 4G5ZL 4NPYA 2Z92A 1AQDB 3OAZH 2VLKD 2YA1A 4NWTL 4JFEB 5CIPA 1KYOJ 5F71A 5CEZD 5K59F 1MFCH 5E00A 3NFNA 5AYQA 2JE8A 5IBLC 1G9ML 5HYQB 5MENA 4S1RL 5HHPA 1JUFA 2C3WA 3Q6FA 4XVSH 3GSOB 4XHJD 5ESAB 2VAAA 4OKVB 4OZGB 1UJ3B 3WLBA 3NPZB 3HAEH 1NFDE 3OF6A 5KVDH 4FXKA 5JW5B 5AZEL 4OF3A 5GRVL 4H1LH 5F3BB 2A1WL 1HE7A 3E2HC 1N0LA 4Q0XL 4HCRH 5IVXE 3DO3A 1CN4A 3X17A 1HK6A 2XKNA 4WO4B 3V5KB 2P24B 5JOFB 4HUUB 1KTLB 4HJJL 5EZJA 1FNEA 2GY7B 3K2MC 4JVWA 1MEXL 3JV4A 4GKZA 5F9OL 5KVGH 1CLOL 4IRJC 4TUKL 2CK2A 3MLYH 3V52L 5FHBH 4BSWB 1MI5B 1E28B 2X89A 3LIZL 3KPOA 4DWHA 1X5XA 4HS3B 4LGRB 3BIAX 5DVMA 1I3RB 2VB5A 1JZ5A 1Q0YL 2OJEA 3O45A 3PV6B 4GBXC 3BWAA 2NY1D 4LCWA 5J12B 2O5ZH 3BMWA 2DWEB 3IDJB 2H2SC 2DKMA 1YNKH 4QO1A 3ZL4L 1UADC 1J1OL 4TNVK 5EPMA 1EUUA 3PE9A 3MV7A 3MUJA 3B9KC 4HPYL 4PJ7E 2DYPB 3FTGA 3FO0L 4OTXL 2OK0L 2DQGH 2FHBA 1CXIA 3REWA 2X4OA 5DQJA 1J0IA 1II4E 3MGOB 2YOCA 1BMGA 1PYWB 4GAFB 1IBGL 3QXTA 2FB4H 3IDGB 2GCYB 3LN4B 4O02L 3KS0J 4Y1AD 3O2VL 4P2OB 3MOBH 5EOTB 3RZCB 3U0PA 1BQHB 3EJZD 3CU1A 4N0RA 5C8JA 3B9AA 2BHZA 3QEGH 5HGBB 3BIKB 2VYRE 3FN3A 4W4OC 3GSWA 4NQCD 1IKFL 3T77B 2CLZA 2OX5A 3CIQA 3G5VA 4LSQL 2Z8RA 2AJXH 3FN0H 3QUKB 4GRLC 4I0PA 3GB7A 5C0EA 2X1OA 3HB3D 1CIDA 5DMGD 1RK1B 5IHZA 5HVGB 4H26B 1LEGA 4MX7A 5EBLB 5FB8B 1S7TA 1NMCB 2LU4A 3GHEL 3QBTB 3VU2A 2VABA 3O8XB 4MQ7A 5IJVA 1EGJH 4MCZA 2E3VA 3KLSA 5DMKB 3V9FA 2HRLA 3JWDH 4X6DE 2VQUA 1H15A 2HTKD 2G60L 3MLWH 3QUMB 2ORBL 2BVOB 3D3VD 1AE6L 3GSNA 4MQXD 4PTUB 5CBEB 4NBZB 4UQ3B 4M7JL 5F7EL 3WHXA 4J4PA 4OFDA 2XWBB 4TOYH 1MHCB 2FH6A 3W0WA 4OD2A 5CSZA 2MCG1 4CNIB 2ZCKL 1NCUA 1YY8A 4HD9A 4HUUA 4LHUG 1S8DA 3LD8C 4UNVA 3EJJX 1AXSA 4NRYB 5KG9A 4OT1H 5I0DA 3C60B 5AYUL 3M8OH 5C09E 1WFUA 4NQDE 4JM2D 3RDTD 5FA4A 1FYTD 2V9QA 3GMMA 3NVQA 1XGYH 1J05A 3UTTD 4G8GD 3BW9A 1T7XA 2LVEA 4GMSH 1ND0A 1LE5A 1CQYA 1FC2D 3OHXB 5KANG 3Q6FB 3DV4B 2F54B 4JGJA 3CZFB 3BJLA 4QXTB 3FRUB 2XG5A 4KVNL 4EDXB 4LSTL 3H7LA 1GRWA 5CFHA 5L9DL 2VZTA 3GRWL 4J12A 1F58H 1G7QB 1HDMA 2CDEB 1WV7T 3GHEH 1RZIB 3FO9B 4MA7L 1IGYB 1G7IB 5IFJA 5DRXB 3SE4C 1IEBA 2I9TB 4GG6A 2UYLA 5D5MF 1U8KB 1Y18A 4X7SH 2IALA 2X7LB 4RBPK 4ZFZB 1R5WA 5IJKA 2GITA 5TE7H 5DRZA 1UM4L 1IAOA 2NXZB 4XI5D 3KR3L 4LCWD 4D2NA 3SDXA 1CFVH 1ZGLA 5DRNA 4Q0XH 4Z7WB 3OKEA 4KJPD 1R0AH 3X12A 4PLKC 1GL4B 4KTDL 4WW1B 2OTUA 2JJTA 5AZEH 5ILTH 4PJBA 5EC2A 1E4KA 5FM5M 4K9EH 2WIMA 4KROB 4HPYH 3QR2A 4MD4B 2E9BA 1KEGH 4ZOEA 4C56A 1NGZB 3V0AC 4O9HL 2WANA 2HYMA 2QQKL 4XP6H 1YN7B 1BFSA 3QI9A 4LEOB 3UYOD 4UAOB 3T4AA 1Q0YH 4YHZH 3P0YL 2PXYB 4TSCH 1NCDH 3DRTB 1T6VN 3ZZ1A 5E2VL 1EEYB 3NIGE 1MFNA 4OCRH 2WINA 2AEWA 1FE8H 3D0LB 4LCYA 4PJDE 3LRHA 2X5PA 4QLRA 4UQ2A 3GMLA 3CC5B 5FGCE 3IDGA 4EDWL 2XY2A 3HI5L 2HKHL 3DX9A 1T6WA 2A83A 4HCRL 1JZ2A 4Z7VF 3B8SA 4XXDB 4LIQL 1PY4A 4FTVD 4RIRA 1A2YB 1KPVA 2VUOA 4HW6A 4QNPE 3DECA 5KVDL 1W2KT 1AI1L 2VIRB 4U1GC 4HWZA 4LVHC 2QL1A 4QRRD 3U6RA 3B6SA 5E9DD 4QTHB 4QT5A 3ARXA 5DUBA 3HAEA 1BVKA 5HHVL 3ARED 3WS3A 4GAGL 1JWMA 1X5FA 1MCWW 2LAAA 1VFMA 3EUUA 4MHHG 1I7UB 2B0SL 3D3VE 1YEIL 4ONGH 1QBBA 1OTUC 1YJDC 5JPNB 4DEPC 4PB0H 4UDTA 2AP2A 4JZJB 3O2DL 4TSBL 4UT7H 4WU5B 1QOKA 2OLDA 4PLOB 4G5ZH 3EW3B 5DEZA 3SQBA 3B2VL 4I0PD 3WDIA 3ZHDA 5DDHB 1JYXA 1UCBH 1CDCA 4I8DA 1J11A 2XRAH 1FZOB 5EORH 1FBIL 1JHKL 1KCUH 1K6QH 1J1XL 1FO0H 1F4YH 5IMOA 1F90L 1JNLL 3NCJH 5DWUH 1KELH 4QRUA 1U2HA 2BSRB 1NAMA 4LSDA 4L4VB 5KTEH 4LVNB 5FEBA 3VXMA 4PBWD 3LKRB 2OZ4L 3OB0H 4IRSD 4NQCE 3FQTB 5IVXF 4HX1B 5HPMB 1H3PL 3EZJB 3ZE0E 1OQXA 4ZS7H 5E8EB 1S7RA 1IGJB 3QIWD 2BNQB 2XICA 1IGFL 1YY9C 2NR6D 5H37G 4F7CA 2AXGB 4HT1L 4ODHH 4FN0A 3BPCB 5HHOB 4MWFB 3UTSD 5I19L 2EIDA 4DW2H 1NJ9B 5IG7A 1S7SA 1KFAL 3SOBH 5GGRA 3DTXA 2NNAA 4P2OA 3P9WB 2EDWA 3TFKD 2WBKA 5C6TL 1RHHB 4NQED 5BJTB 3B5HA 4MA3B 3OJDB 4ZOAA 2Z31B 1JGUL 2GITB 2YS4A 3STLB 3SGKA 4NKDB 2R4SH 1DBAL 3O4OC 5BRZE 2XWTA 3X3FL 4MXVF 4TUOB 1QSFB 2ZUQC 1J0KA 1DJSA 2R1WB 2O5XL 3LQMA 5C09D 4X6CF 1K4DB 3ZO0A 5T1DH 4OI7A 1FRGL 2C4XA 1MRFH 2B4CC 5ADPH 3V6OE 3C5JA 3REVB 3B9DA 3JV5A 3OG4B 4JY5H 5KS9B 1NCBL 1ZGLB 4HS8L 3HZKA 4GG8A 4G6MH 2ERJB 2RGSA 4I3SL 3MMEA 5I73C 4LRIC 5ESVA 3SDAC 3ZDYF 3FRPA 5HPMA 2D7PA 4L4VE 3VGAC 1UB5B 1KCKA 4HUVB 3P4NB 4CUCA 3AVEA 1E0OB 3NH7H 5DI8B 2P45B 4OZ4B 1UWEL 1R5IA 4UILL 5DYOA 2J4WH 4HMEA 3S8WA 1A6WH 3LZFL 4X6CE 5BV7C 1TETL 4LPVA 2ZSVA 1YN7A 2UZIL 4WEUD 4ZTOL 4KRLB 4FP8L 1R5VA 2VDRH 3RX7A 1NUGA 2XWBA 4DCQA 5IBLD 3ARBC 3ARDB 4DEPB 5L2KA 4KK5D 4TVPH 4PUBL 2UWEF 3U7YL 4UQ2B 1UZ6E 3L3IB 2W9LA 4X99B 3AS1A 4O00A 1QLFB 4PY8I 4UZGA 3C8HA 7FABH 2APFA 3OKLA 3QRGH 3QUML 3MGTB 2J8UF 5IHLB 1A3RL 2QSVA 1Z9SA 1W72A 3ZYIA 2VDOL 1NUNB 2EIBA 3BH8A 2ADIB 4JKKA 3H9SA 4ESKA 1JMXA 1JNHA 4DQOH 5J3HC 2VLLA 1A2YA 1KPVB 4WHTB 1EJ6A 4OZHB 4KKCD 2Z91B 1MF2L 3N1FC 1UH3A 2IPUK 5E2WH 4PRPB 3GHBL 5IB4B 1MHPL 3VFNB 1QO3B 3QIBD 2BY1A 2QKIA 1WCQA 2WP3O 1TVHA 4J3OC 4D9RE 3QIWC 1YYML 5DC0A 1UEYA 4NT6A 2PO6B 2OBGA 3G04B 1E4XI 5IQ7L 1RUPL 1U41A 4PRDA 2EH8L 4AMKH 5LWYL 5ID1A 4HX1A 2AXFA 4G42A 2VL5B 1J10A 4PRBB 3ULVF 5C07A 1KLGA 3TO2B 3KYNB 2A73A 5BZDB 5CGYC 5GS0H 3HZKB 4KJWC 5EU6E 3RA7L 1KCSH 1IJ9A 3BP7B 1WFNA 1LHZA 5I18H 2QBWA 5FYLL 5FUOL 3UPAA 4FABL 2ZUQB 1MAJA 4OFKA 1HYSD 2BDNH 3WEXA 1QSZA 5CSZB 1IGML 2WW8A 4QOKE 1DCLA 3GUTB 5F7YC 1QSVA 1KC5L 4YHPA 1U8OA 5D2NE 1A4JB 3JTTB 3EFFB 3SE3A 2FJFA 5FA3A 3TO4B 2GK0B 3VFGL 3RAJH 2F8XC 4QYOA 3GMOA 4N0YL 4MNGA 1QFWI 4MB4A 5DVLA 5GISL 4QRUB 5CZXC 1DANU 3EJYD 4JN2A 1QFUH 5ACLA 2CUIA 1HNFA 4S0TD 4ZXBC 4NZUL 1RUKH 4RRPA 1A1NB 4PUBH 4ODXB 4Z9KB 1FG2B 5TDPA 1X6LA 3ZE2F 3SDAA 2BOBB 3D39E 2Y5TA 2F54E 1NBZA 4NWUL 4G9FB 4J3WA 3AS2A 3T0VA 4FXLA 4GSDL 3ZTNL 4LSVH 4L3EE 1K5NA 1CE1H 3KYAA 1MFAL 4P5KA 1OSZA 2EYSA 2RFXB 2YWYA 4JAMA 1UJTA 4ODSL 1CXEA 2V2XA 3WV0A 3B3IA 4BH7A 5D2LA 4OD1L 4WFHD 5CJ8A 5L2KD 1A7OL 3H7BA 1S7WA 3O9WD 1IZKA 1ORSA 3VFWA 3EYFB 2IAMA 4HS8H 2PTVA 2NY4D 2IC2A 4KH2A 5A2LH 5I1KL 1IARB 1BFVH 5DJZB 2P8MA 1KV3A 3VWKC 1UM6L 2XTLA 3FQRA 5IEHB 3HPJB 5GGSA 4Y8DC 2AERT 1JWSA 3ARWA 1U0QA 1G9MC 1CT8A 4P2OD 1UT9A 1Y6NR 3OAYK 3QZWB 1F4WL 5GS1B 4Y5VC 1WT5C 4M61A 3QNXB 4Q9CA 2V5RA 2FO1A 4Q7DA 2YEZA 5E99L 3QDMB 1IM3B 3SN6N 1A3QA 1QLRB 2K1MA 3QO0B 3S35X 4QHUB 4YFLF 3FKUS 4YO0A 4A6YL 2MHAA 4NO0B 4P5MB 2R15A 1OARH 1F2XK 3MV9A 5D7KE 3W11D 1N8ZB 1P9MA 5C6TH 4F3FA 2WSKA 3GSRB 4HJGB 4A2LA 5C0RL 2XZCH 3AM8C 3MYJA 4EJ1C 3P0VH 3PV6A 1Z9OA 3U48A 2MTPA 2GSGB 2BK8A 2YMXH 2E6JA 3BO8A 3MRFB 3PWLA 2WUBH 5D4QA 3H42L 3FRUA 1UJ3A 1FFRA 1PX4A 4K8RC 2X4RA 3BKML 4D9QE 1JN6B 5IESL 4MJ6A 1WCBB 3E8UH 5F21B 5I6XB 2BMKB 4PB9L 4PB9H 1FZMB 5TFSH 1AC0A 1DUYA 3MRPA 2V2WB 4RFOL 1I1AB 3CFBA 3UPCA 4PRHD 4M8VA 4JR9L 4P4KD 1BM3H 5JW3L 4LSSL 5DS8A 2EYRA 3UC0H 2H9GA 3D87B 4X4YA 2EC9T 4RX4A 3UZVB 5IKCB 1EHLH 3H0TA 4P2QE 5KSAD 1CR9H 4OLUH 5F1OB 1RZGA 1B0GA 3QEUA 1A14H 4OD3L 4YHIB 5BMFL 1TCRA 3GSNL 3X12B 2G9HB 2BY3A 1RUQL 1WBZA 3OKNA 3EJYC 3BKCL 4DJMA 3ARZA 5F89B 2ICES 4ENED 2MJWA 3TJHD 1X5JA 1KSRA 1Z5LA 3GMOB 3KXFA 4NN7C 5F7FA 1W8OA 4JHBA 3SCMB 1L0YA 5EIQA 4LHUA 2XKNB 4WO4A 3KLHD 4UT6H 1IGIL 2HLAA 3ULVL 1DBMH 3CVIL 5I16A 4S1DD 5C0AD 1LMKA 4B0MM 4PGZA 3G6JE 1I1YB 3FMGL 4GS7B 1FAIH 3FT2B 3ARDD 4QOKA 3RWCA 1K85A 3GK8L 4OZHF 2GK0A 1XFPA 3DGGA 1NKRA 3MV8D 3KS0H 4HXBH 2A73B 4U1JA 2XIDA 3MRLA 1FIGH 3V2AR 4LP4A 4CNIA 2Y72A 4KK6D 5GRJH 3MCG1 3PNWA 4JM4L 4Z77A 4CN6A 5EU4A 5DJ8B 3DYMA 4JPWH 2C1PA 3L3KA 2DQFB 1OPGH 5T1MA 4XPTL 1YQVH 3N50A 4YHMH 1ZHLB 1LO0L 2EEDA 3K4AA 4JANA 5F1IA 5CHNA 2IFFL 1WZ1H 2UWEB 2X2YA 1XF2B 4U3XA 4ZO8A 2BSED 3CPLB 4NT6B 4OGAC 1PW3A 2JJTC 4KWUA 4Y4HB 2YPVH 4WHTA 5GHWH 5EULV 4I5BA 1C5CL 4EN3D 4WUUE 5TQ0H 1OP5K 1P7QA 2F8VA 2Y6SD 4YIQB 4ACPA 1FL5A 1MQKH 3TEUA 4WI5A 5GS1A 4LMQE 4Z7QF 4ELMF 5T3XH 1OP3K 2Q8AH 5ADOL 3A6CH 3MR9B 4ZFGH 2NZIA 5GRWA 1QLRA 1YMHA 2AEPH 2WV3A 2XA8H 2NYYD 1A6TA 4HJ0C 3LOWA 1MJJB 1WZMA 5IIEB 1KTDB 4X7SL 3O8XA 3HUJF 1M7XA 1UGNA 3OZ9H 4KPHH 4M62L 4KAQH 4L8SA 1JWSB 1IAMA 2Y7QB 4JFPB 3VXUD 5KVMC 1MJUL 4NZTL 3FHQA 2JJUA 5DFWH 2V2XB 4MLIA 5EFIA 4Q6IA 5E6IA 4PRNB 4PGEA 5L9DH 5HDQH 1YECL 4Y2DB 3ARGA 2DQDL 4LNRA 4LSTH 2JELL 1PLGH 4N8CL 2QQLL 4ONFL 3AC0A 1RIUH 1EEZA 2Z9TA 3EHBD 4K7PX 2OR9H 1MAML 4DKFL 4L8DB 1KCSL 1F4XH 4JKPH 3ULVC 4JG0L 1J5OL 1WZKA 3SGJC 1FNEB 4QHNB 2FJHB 1JHTA 4G8FA 5IMKA 1KBGH 1RULH 5HGAA 1D7FA 1XGYL 1KIRA 4NQXA 4NKOA 1GOHA 4NM4H 4X0KA 2FD6L 4PJCA 5DFVD 4GJTB 3OAUH 2DM2A 3NCYP 4YZFE 3S96B 4HKBA 3U4BL 3SKOB 2W0PA 4MJ5B 1B0RB 5D7LD 4MDJB 5ALCH 1OB1A 5GRYA 2ZWLT 4UT9H 5E5MA 2IAMD 4YX2L 4D94A 1A1NA 4X6DB 3MRCB 3TVMC 2WIIB 3SCMD 5BQ7B 3L7FB 2DBLL 4EI6B 4WGVB 3AXLA 3NZ8B 4MDIB 3INUH 4Y7MA 1ZLVK 4JGUA 3QQ3B 2HJFA 4PG2C 3C5JB 3QHFL 3RWFA 4IBLT 4X7EC 2DIBA 3O3UN 1A7NL 5BV7B 1RUMH 5L8JB 3R06A 3CFDB 3NA9L 1JP5A 3I85A 1N5AB 4RGMB 1ZANL 4F58H 1Z0MA 2A77L 2BERA 3BEVB 2VOTA 5HDOA 1NDGA 3KYNA 5DI8A 3HKFA 3P2TA 1GAFH 5KSAA 4EKXA 3DROB 5I1LA 4NM4L 2X1QA 1KPRB 2X10A 2E7CA 2WQRA 3LKRA 1S5HB 1SHMA 5L6YH 3F7VB 1HOCA 2XKSA 3WIHL 1T7WA 1D6EB 3QXAB 1YMMA 5J0BA 4ZFFA 4ELKB 5FGSA 4XC3L 2VXUL 1L6XA 4OQ1A 2K7QA 3MRLB 2OR9L 3GSQA 5SX4I 4O2CB 3ALWA 2NY4C 3N85H 3SO5A 4M1CD 3LZFH 4MNQD 3RNQA 3VXMB 2Y6SC 1XGRB 2BFVL 1CDJA 1VCAA 2OL3A 4LLMB 3FOMA 3L3KB 2IPTL 3DTXB 3HC3L 2XTJD 4RA3A 3IJSB 2PO6D 4JRXE 5IWLC 1KN2L 3U36A 4M3JA 5CEYB 4HIIB 5D7SH 2Y4SA 2V9RA 3ULSA 2NYYC 3UTQB 1HHHA 2FX9H 1FVCA 3GBML 5IW3A 4EEEA 2K7PA 1WK0A 1TQBB 4E41E 2KDGA 4J6RL 3X11B 3MRRB 1NGXA 5EBGA 4JQVC 2GW5A 4GAYA 4WW2A 2F53E 4OM0L 3WJJC 3K8KA 4NHUA 4NBYB 1HZHH 1NCCH 3T0XA 2XZZA 1DN0B 3BD5A 4YLQT 1RIHH 1XGTB 3MSPA 4RMQA 4Y5YC 5GJSH 4L4JA 2JLLA 1RZ7H 3AU1B 4KQ3L 2NY6C 2XNAA 1MQKL 1Q94A 4JFXA 4NN6C 5E1HB 4HIHB 5EC1A 1YQ2A 2GEEA 1C12A 3VI3E 4OCXH 1XIWC 3BSZL 3V5KA 2GUOB 3VE0B 5E9DA 1CLCA 5JQ6L 3IF1A 1U2CA 2X4NA 3CU7A 3HCVA 4JFHD 1OM3H 1T4KA 3SOBL 4S2SA 4BK5A 1P7KA 1JFQL 5A2IH 3ZKMC 5IF0B 1SEBB 1BIIA 3LRSA 4XBGB 3WNKA 3TVMB 3I2CH 4N9GB 1G9MH 2CKBB 4XAKD 2NW2A 3CFCH 2DTMH 5T1LA 3X14B 3FRPG 5IB5A 1MELA 4P46D 5C0DA 5EU5B 4XP4L 3HA0A 4YBLC 5ANME 2Q87A 4MA1B 4J1UA 2DLHA 4FQJL 3QO0A 3RDTB 1QFOA 1W0VB 3B83A 4UMGA 4I48B 2JJVA 3VW3H 1CICA 1PKOA 1NCWL 1DLFH 1U8IA 1EHAA 4NJ9L 1R3JA 4IRJA 3S6CA 4TVPE 1AXIB 4D0BB 1JHKH 5EORL 1REIA 1ZEAL 3FFDB 4E0RA 3LVEA 3V4UL 3LKPA 5B39A 3HMXH 3LKNA 4NSKA 4JY4B 2HJKA 1S9XB 1NEZA 5I8CB 2WUCL 4RAHA 4RMUA 1CYGA 5KS9A 3WFHA 3V6FA 1SJHA 5JHDB 5KSBF 5CP3H 2NY3B 3DJ9A 4Y1AE 1ZGLP 5F1IB 3HI1B 3PJSA 2DQUL 1KB9K 3FCTA 4A6YB 1NBYA 4JZOA 4WV1A 1OCWL 1P6FA 2GT9B 3RFZC 1T1ZB 1AQKL 3S5LG 2HTLC 4L9LA 2AJUL 3RI5K 2XWTB 2AI0L 12E8H 4NJ9H 1FGVH 1NMBL 2NPLX 4M7LT 5CWSB 5CJXC 1TVBB 3TYFB 4NZRL 4RNRA 5C0ND 4ZFFB 4PLJC 3BH9A 1QSED 5C0IA 3WKMH 1OGTB 3PABA 1DZBA 4KKCC 5D9SB 2YD2A 2W07A 1NH6A 1RZKH 4Y19E 4HFUH 1KT2B 1HH9B 4WJ5A 5IWLA 5BVJA 2WUBL 1JBJA 1P4BH 2AKRB 3K46A 1J12A 1I3GH 4N0CC 2CK0H 5T5FH 3WIIH 5DK2A 5BS0B 2JJSA 3LY6A 1I7TB 2EDFA 5B38B 4PGDA 3HR5A 4R2GB 3OB0K 4JFDD 2D03H 4JKMA 1B4JL 3C08L 4Y16D 3O4LA 2AK4A 1JK8A 4HEPG 4YHPB 4QGTA 2FO4A 1OARL 4Q2ZA 3GIVA 3MRJA 3LAFA 2NY2B 2EXWC 5ICYB 3TIDA 2P8PB 1DE4A 2HFEB 3ESVF 3RWJA 1GYAA 1NEUA 1RZ7L 1AHWC 5I1JL 5GJSL 1EUTA 3PJSB 3RWDA 1BBJB 4L1DA 1OB1B 2PETA 1TPXB 3JTTA 3X11A 3BQUA 4EBQH 3BZEA 4Y89A 3PHSA 3DX6A 4ZUVB 4LLYB 1MHEA 1G9EA 3C8KA 3LEXA 4G3YL 1ZHKB 1WBYB 5FYJD 1CFBA 1AXTL 5HGBA 3ZHKA 5HSFA 2HH0H 3KNBA 3QCVH 3KPRA 4P99A 2IQ9L 4NO5B 2B4CL 3CDGA 2HT3D 4OJFL 3PXJA 1U6AL 3L6FA 4MQSB 1JRHL 3SE9H 2A6IB 4ZPTB 5IVXB 5TH2A 4IJ3C 5C09A 3F5WA 1IQWH 1T04B 3E3QE 3SJVB 1PSKH 1S7QA 2R4RL 4NUJB 2ARJB 2A2QT 2YD8A 4ETQB 3VFNA 5IKCA 4C83A 4TTGA 4PV8B 1LP9F 1YEJL 5F9DC 4MD4A 3ZKXC 1P4IH 5I30L 2IAMC 5CP3A 4R4ND 1QEWA 4LCUA 1B6UA 1KB9J 5EU3B 3QQNA 3BN9D 4LLUA 1GOFA 3U0PB 1XGPB 5IB1A 4X7TA 4NKIL 3S34L 1ES0A 1I1CA 3B3IB 5BW7C 2DM7A 1WIPA 2XA3A 4BQ8A 1I8MB 5EBWB 4RFEA 4FRWA 4BKLB 1DQML 1IGTB 2KUTA 1FDLL 3QAZB 4RISL 4JPIA 1U8NB 4PRIA 4C59B 2R29L 1OTUD 3S4SB 2DBJA 5A40E 4WY7L 2EZ0D 3SY0A 1U8KA 3RNKB 4NO0A 4P5MA 5FIEA 4QKXB 1HEZB 2X4TB 2VE6B 3SKMB 3DX6B 4ZUVA 4AQ1B 5DRZB 4R96B 4FFYH 1HILA 4EOWH 5EO0A 1X3DA 1YMME 2X4OB 5DQJB 4DAGH 2FLBT 3GKWH 1U8PB 4MD0A 3VMOA 3PWJB 4L8BB 3L1OH 2A9MH 1NLDH 2GSGA 5HBBA 4G6FB 4HG4J 2FYYA 5E95B 4CAGA 3WN5C 5TH2B 1OAXL 2VAJA 1HIMH 3BP5A 4M43H 3VFTB 4NKOB 5BV7H 3T1FA 2D7MA 2ZUTA 2GY5A 3U30B 5GIRB 3REWB 2MKWA 3EO9H 5B8CA 3F7YA 1TQBC 3VXOB 1IAKA 1MCSA 3HC0A 3SGEI 1HYRC 1F97A 4JQXA 3I6LD 5LWYH 3TJEL 2COQA 3T2PA 5IFJB 1INEH 4H20L 3VXSB 2VLRE 4PRAA 2R2HA 3W9EB 5DJ0A 2ZUYA 4KHXH 4GW4B 4GKSB 1WF5A 4ONFH 4Y19B 4HBCL 3CX5K 4D0CA 1IBGH 4YEFA 3W0WD 3OAZK 4YBQC 2H3NA 2PW1A 1S7VA 2XZAH 3MV11 4P0DA 2OK0H 2P43B 2LTQB 1C08B 4I4WB 5TDNA 3RZCD 2AKRA 1AGEB 3RNKA 5DJ6A 2GUOA 3B5GA 3QH3A 1D6VH 4YWGL 1T5WA 4UTBL 1ORSB 1L6ZA 5I8OL 4YHLH 3H7BB 1U92B 3QRFM 3AMLA 3IU4L 5F88A 3NFSH 3BUYA 5F7DB 3UYPA 1KUMA 2B5IB 2EECA 3BPLC 3VD4A 1BBJA 3NN8B 4KY1H 1ES0B 4PJ8C 2ZZUT 4YDLC 3RWGB 4D9QD 4MWFA 4YDIH 3RIFK 3LIZH 2VDLL 1HXMB 4P23B 3BZDA 1SYSA 3LEYH 3EYOA 4TUKH 3KPRD 4ZG1A 2MPAL 4XTRD 2XTJB 2HKFL 5B8CC 5HY9A 1ERNA 5DEFB 1JTPA 3EYVA 1UM5L 5JDSB 3MRMB 3ZE2E 3LKPB 1JPSH 1EEUA 3QQ4B 1QSEE 1LEGB 5FB8A 1UWXH 2OTWB 4YUEH 5A2JH 4ODVH 1CD8A 3NOIA 1WCBA 5D72H 4NKDA 5J9PA 1JWUA 2V6HA 3VH8A 2GJJA 1RMFH 5DMKA 3QHTC 1PZUB 3TNMA 1NAML 5F1NA 4IOIA 2O26U 1MY5A 4JJHA 3W39B 5DURB 5KN5B 3MLZL 4HK3N 4XPHL 3ARDC 4Q9RL 4OZFB 4KI5D 3TT1H 1WZ1L 4KDTA 5EU6D 4BH8A 2DQFA 3MV9D 3OGOE 1AKJB 3EFFA 3DLQR 3QFJE 5TF0A 4OCWH 3TA3B 4XCFL 5D1XC 3V0WL 4PJFA 3SE8H 1P69B 2R2EA 5FYJH 4G9DA 1XIWB 2BNQA 2IF7A 3QUYA 3AXLB 1NCBH 1LNUA 2F74B 1BVLB 4PP2B 3CCHB 4YBHA 3G6DH 4PJXB 1XZ0B 4JY5L 3BIKA 2JF1A 3L7EA 1RJLB 5D1ZB 4WFGE 2DF3A 5EOQH 4PJXF 1IT9L 3JWOH 1X5LA 2QSTA 5E2TL 3AREC 4PJAF 5J6HB 2N56A 2UV3A 4N1CA 3T04D 4ERSL 2ITCA 3IFNL 5E8NA 3VE0A 2EXYD 4H8WL 3QIUB 2HN7A 3U2SA 3V4PL 2R4SL 5FF6B 1UA6H 3GNMH 1I9RL 2H3NB 3BPNC 3DRQB 1NSNL 1BZQK 2R8SL 5KVFH 2R2BA 2XXCB 4OQTA 3FT4A 5DJDB 3T3PF 2G9HA 2QHRL 1IAIM 1FL6B 4GRMB 5DD0L 4JHWH 3O0RL 1KCVH 4R0LB 4WFFE 3D39D 1K4DA 5C86A 3QI9D 3C2AH 1DE4B 2HFEA 4OFVA 3C5ZD 2FDBP 1T20A 4WFEE 4RZCB 3LKSB 2D7TL 2ZSWB 3MXWL 1CR9L 2QV2A 3QT2A 4AG4L 3Q6GL 1IGFH 4KZEL 2YA0A 4OIIH 5EUOA 2I5YL 2CMRH 4MJIE 5DUML 1RZKC 1T80A 2HG5A 1A0QL 1RZJH 4ONOA 5T5NF 1PEZA 2VN7A 1T5XB 1BF8A 5HGAB 1B3JA 1YPZF 4DCQB 3DXAE 4XXDA 4W4OA 2HVKB 2QEJA 4JRXB 2WBWB 2EKSA 4HMCA 5F3HA 2YD3A 2MCPH 4MXWH 3MV8A 3KPPA 1G1CA 5FAAA 3QUXD 1J18A 1ONQA 5I74C 4EXPX 5LQBH 3H3KA 2DMBA 5LGJA 4MJIB 4YDKL 1NCAH 1YPZE 2CKNA 1U3YA 2EXWD 2FX7H 3DMMC 1FFQA 1FNGA 2D0FA 3D25A 2XT1B 4XMLH 1QSFA 1UENA 4HV8A 3NCEB 4NO3B 4ZTPH 2YRPA 5E08L 4E41D 2ICCA 1H5BA 4KKNA 3I02B 3MNZB 2JIXB 5JIPA 1BBDH 2BNRB 3QJFA 2Z92B 1F3JB 2DQJH 5FGBC 4HEME 4Q9RH 2FZ3A 3C5ZB 4WU7A 3EDEA 3HB3C 1T5WB 5DEGB 3QJHB 4V1DA 4Z0BH 4FQCH 2B2XH 3AGVA 2WBJA 3IFOA 3BHBA 3ILQC 2ICEA 3KYKH 4CMHC 4EQ3A 2FATH 4I3RH 5IFAL 2C3XA 3U82B 3L3JB 4PJXE 3QUZD 3CLFH 3EO1A 2GTWA 1KYOK 1RZGB 1K4CA 2AEQL 1R3IH 3K2UH 4ZO7A 2PKDA 3GSUB 5DUBB 3CH1B 4OBSA 5D93B 1VSCA 4NC1C 3HAEG 1JF6A 1KCRH 2OL3B 2VDLH 2I60L 4ONHA 4YDIL 4RAVA 3ARFC 1KTRL 1EFXB 4FXGB 1LK3L 1C1EL 1RI8A 1QPPA 1DBJH 1X7QA 3GBLA 3UYRL 3F6IA 3OJDA 3BW9B 3WSQH 3B9KA 4ZPVB 1MLCB 5KSVB 3MZGB 4QRTA 1OW0A 4P2CG 1DLHB 4RMWA 1C5DB 1BBDL 2ADIA 2YSSA 2J6EL 4PGEB 2KH2B 4R0LC 1J8KA 5IMKB 4JO1L 1ZHBB 1AD9A 4HBCH 5DJ2B 5E6ZA 3WYRA 1J8HA 2BXZA 5E94B 2D0HA 4E5XA 5SWQA 2P5EB 3VXMD 4WI3A 3O6FD 3FQNB 2FX7L 3VWKA 1DUZB 1KENL 1INEL 3NCBB 4H5SB 4KI5E 5GSVB 4P46B 1S5IL 1ZLWH 1MAKA 3I50H 3ILPA 1QNZL 3QHZH 1M1SA 3UJIL 1B2WH 4OI8A 1AP2A 5ACZB 1KCLA 4D3CL 3DETC 1XT5A 3JTSB 2WK2A 3G5ZA 5BV7L 4XMPH 4XWOD 5E8PB 4K2UL 3GIZH 1G6RL 1HIML 1NBVH 1OAQH 5D9SA 3GRWH 1Q9KB 3L95A 1H15B 1RK1A 2YA2A 3BP7A 3EIFA 1RVFH 1XIWA 3RWIA 3O2DA 3J7HA 4OF6A 1YDPA 5FYLH 4XI5C 3MXWH 5EUKB 1DBBL 5B4MD 3FO2B 2CGRL 4EOWL 5CGYD 2CR3A 3JUYA 1N59A 5KZCB 4Z7NF 2G2RA 3OXRB 3NZHH 3T09A 2H8PA 4JM2B 1DR9A 3OWEA 2P5WA 5D2NA 5DD0H 1IC4L 1XR8B 5I1AB 4WFED 1MVUA 4O2EB 1MQ8A 1A6TB 1GCFA 4KHXL 3RZCC 1AO7B 1YEGH 1QACA 4MQTB 4FQXB 2VZOA 1T03H 4UU9B 3UEZA 1EVUA 1S9KC 5I66B 4U1IB 4H20H 4QY8A 3K74B 4HZLA 4J7RA 1HHGB 4UOJA 4YR6B 3CFKA 5HY9B 3PWPB 1ULVA 3MRMA 3S34H 4JGMA 5DJZA 3DVFA 2D9QB 2EDJA 1A7QH 1RJZA 4HDIA 3TO4C 3BZEB 4F7EA 3D39A 2X1WL 3SPVA 4Z6AT 1RJCA 1TNMA 1KTKE 1R3JB 3RIAF 5D7IA 3WNPA 1I85A 1PAMA 3KPOB 3N1PC 5F1NB 4WWKA 4GQPH 3QG7L 2F8OA 4QCIA 1TFHA 4I0KA 3ZDXF 2A9ML 3CDGB 3HCVB 3H8NA 3MNZA 5IB2A 4M48L 2Q7NA 1ZK9A 4DAGL 4HUMB 4WI4A 4ZSOE 4YE4L 3UZEA 1CFQA 1KIPA 4X6FB 1MJ7L 3HMWL 1IZJA 3BT2H 4ZAKA 4M5YH 4HSQA 5SWQB 5E0QA 5MHSE 1X5KA 2WLZA 3QXUA 1BD2E 1AXTH 4PJDB 5DA0B 1RZIA 3FO9A 5EUOE 4XH2A 5HGDB 2AS5M 1O5DT 3UROR 5GJTL 1QRND 5D1ZA 4NC1E 3EDKA 4M00A 3ARFA 1U3HB 3I75A 5D1QD 1MCKA 3MFFA 1D5ZA 2GI7A 3MRBB 4X98A 1I1YA 5D6CB 4NKIH 2VABB 4R8WH 5AWNH 3BRFA 3BH9B 2DQCL 1IEAA 5HYJD 2WZPD 4PG2A 4WDIB 4X7DC 4XPAL 3NH7L 4I0PC 4JM2F 3T0WA 3WFEH 3BXNB 3L3OA 5SWZE 1BLNB 3O4OB 1A7PL 4HIXH 4YFLI 4I0PB 1U8QB 2CRMA 2ARWA 1OHQA 3PNWB 4HIEB 5JOPE 2ADGB 2B20A 3WL9B 1VEMA 1FYTE 1NC2A 4JFOB 4B7IA 4K7FA 1N26A 3H9HA 2HVJA 4F80A 3UTSB 2CLRB 4JDVA 3Q1SL 4QHKI 3EGSA 3FQXB 4L4TA 1RQ5A 3BN3B 4E41A 4P2QD 1U8JA 4YQXL 2CUHA 2O5XH 1AXSB 1CL7H 3C87A 3PGFH 3FQUB 1C5BH 2DQIL 1OAYL 4WTZG 1UZ6F 3QUZA 3IDYC 1J9CT 1H3WM 1F4AA 3U9PL 2ADJA 5CBAB 3KPSB 2O93L 4NO2B 1I4FB 4LU5L 2QSCH 3M45A 1DEDA 4S0SD 1ZSDA 3MA7A 4JVUA 3B9KD 4FZ8L 1URLA 3RDTA 5T3ZD 1XR9A 3ARYA 5IBUB 4CW1B 2K9UA 1U3HA 1T2JA 3PP4H 1KFAH 4YDLB 4G9DB 2AJYL 3T4YB 1FSKB 2H9GB 1BECA 1ZVSA 32C2A 5CUSL 3C09C 4F15B 1JHLH 2VXVL 5B38G 4DK3A 5B39B 4I1NB 1NDMB 4F33A 3MRQA 1IFHH 5EN2A 4X6FA 1Q9KA 5D6DC 5C0FB 4QRQB 4ZS7L 1NLDL 5E7FA 4I3GA 1T04A 5CWSA 2Y9RT 4MCYB 3PIQB 1L4IA 4Q6YA 1S7QB 3DI2B 5C09B 2NZ9D 4U0RC 1KIQA 2FX8H 1F3JA 2OZ4H 1SY6H 5HGDA 3ZT7A 1KJ2H 5ID1B 1S9YA 3V4UH 2C4FT 5HJ3A 3ZKNC 1P4BL 1KB5L 4M9PA 4GT7A 1XF3B 3Q2CA 4NJAH 1JCKA 1UQSB 4M61B 4MVBC 4KRPD 5JMRA 5C0GA 3CXDL 1U8MA 1YEHH 4LHUB 3EYFA 1EAPA 1FVDB 4NQSB 4Y4FB 4KI5C 5JLZB 4IMKC 4UI2A 1AO7D 2VRAA 2ENSA 4RISH 3BEWA 3BQUB 4S1SH 4XP4H 2ZUVA 5FYJU 4TSBH 1VGKB 5D7IB 3OB8A 1MWAB 1LO4H 5KBNC 3DGGB 4YHIA 1U58B 3AY4C 3NAAL 1S9WB 4LL9A 3ULVE 4HKBB 3KPRE 3WL9A 4FA8A 4Z18A 5EWIL 3UBXG 1QG3A 1NFIB 3SKMA 3VWKD 4HF5H 3SE3C 5JR1H 1KIPB 3P9MA 5FA3B 3QUZC 4N1HB 2VXQH 3BISA 4HS3A 4L8CA 3TBTB 2R39A 2EDRA 4MMXC 4MJ2A 2Z31A 4PLNC 2MQ3A 1JZ4A 1PSKL 2Q7YA 5CLTA 1FL3A 3FONA 1CZ8L 4GBXA 1ETZA 3CC5A 1IAIL 1N6QH 1FO0A 3HNTL 1KXQE 5I1CL 1NFDA 1RURL 3TBVA 2XPGA 3CUPB 4XX1G 4OZFG 1FG2A 5TDPB 4ZYKB 4H88H 3MRFA 3PWLB 1MCHA 1VFBA 3BO8B 5C0CD 4DZBB 5JNYA 5C0JA 1JNJA 5MEQA 3C5ZC 4DFIA 1NGWA 1KJMB 1QA9B 3DVNB 3DYPA 1SJEB 1I7ZA 1OP9A 2AJVH 3IJYB 1KJ2L 1FZMA 1FVDA 4NQSA 4Y4FA 4LLDB 2RCSH 4MAUL 2ITCB 1KN4H 3BRGC 1OTSC 3SO3B 1FJ1A 4NO0D 4OLVH 2EIZB 1HINH 2A0LC 1T1ZA 2EDTA 3VGAB 4EIZC 4NO5A 3PHOB 2PYEE 3GDBA 5C7XL 1LD9B 2C7UA 2PTUA 4NPYB 4Z76B 1F3DH 2H2PD 5KSBB 1Q9WA 1U8JB 1LO2L 1OM3L 1B4JH 2FWOA 2BFVH 4E42A 1BD2A 4MQ7B 4FQHA 4PP1D 4XAKE 2VDMH 3MREB 3QQ3A 4Z78A 3FAXA 1LDPH 2ZPKL 1EAPB 3GRWA 3HRZB 2QSCL 4K7FB 2CLVA 3N1GC 4JFDE 3VMPA 3A6OA 3BESR 4NUGL 2VMFA 4O51B 7CGTA 2FL5B 1OT1A 4E41B 4F2MA 3HZVB 3DX7A 2AJSL 3STBA 5B4MC 4JANB 1TZIA 3RU8H 1HZHL 5E8EA 1SVZA 5HI3C 5IJKC 4NZRH 1VPOH 2EDLA 3RHWK 4NC2B 1TZGH 4LPCA 5JDSA 1DBKH 3ARDA 2AXGA 4HIEA 4QOKD 5T5NG 3NA9H 3LS4H 12E8L 3L5JA 2BOCB 1BFOB 5EIIB 1I8IB 1L0XA 4P46C 1A7NH 4QF1A 3I6GA 5DJCA 5C0BB 4JB9L 1TJHL 5DD6A 4HQQL 4LHUD 2GJ6A 4PJDA 5IFHH 4HUNB 5K9QG 4TN9A 1A6UL 1SEQH 4KUZH 3HI6H 4FNLL 4X4MA 3VGHA 2OR7A 1U92A 2L7JA 1T4KB 4KK6C 4LCWB 1JZ3A 2RFXA 2YPKB 3N85L 4TRPL 3O2WH 4PV9B 5ABDE 3U79A 5FKPB 4TUJA 1UZ8A 4B5EA 2E5EA 1IEAB 3S3SA 2XNAB 4WWID 4PJ9B 2ZCKH 3S88L 1ZKAA 4YNYA 3PQYB 2X70A 1F6AA 1A6ZA 5KS9E 4TNWK 5I74B 1SVCP 3G9VA 2C4FU 3ARFB 1AE6H 4UIMA 4O51A 3L7FA 4W6WB 3BT2L 2GQHA 5JHLH 3BD4A 4C58B 2APTA 4ELME 4Z7QE 1ZANH 1P84J 4F58L 4NNXB 3MLUH 4M6ML 3K3QA 2DTML 3EYQC 4U1MB 3SDXB 1PLGL 3KPMA 1OW0C 4APQD 3VD5A 4G6KL 1AIFA 3I2CL 1Q9WB 2BCKA 5HGGS 4YBLB 4YXHH 4XWGH 1CFNB 2PTTA 4ZUTB 5T1KA 4O2EA 3S9DB 3U0WH 4P2OC 3GSVB 1FN4A 2VKWA 4C55A 1JHTB 1CWVA 2BY0A 2J2ZA 4X6EB 4JFQB 1BJ1J 3SDCD 2L0DA 1OAZH 2X09A 4JY6B 5DQDL 4KAQL 2CR6A 1X5YA 1BQSA 4X4ME 4XP9H 3KYOB 2C9AA 3O3EA 4KV5E 3WFCL 1KPUB 4HKJA 3TP4A 3BZ4A 5CEZH 1N0XH 3QI9C 3F8UB 2BC4B 2NY5H 3MOBL 4ZMAT 4CU8A 1T03L 5LCVL 1LGVA 4WW2F 5FYLE 5MEND 3IAQA 1XCQA 4HKXA 3ARTA 5EZOL 3BVNB 5F96H 3JSSA 2H2PC 1W0WB 3GBNH 2QQNL 2NY3D 3DX8B 1I9IL 4PD4J 4LLVB 2DL2A 4JKPL 4HPOL 1Q8MA 3RP1A 2B1HH 4CDHA 4HZAA 4ODWB 4J6RH 1JWUB 2NNAB 2QQLH 4NC0B 4N8CH 2IBZY 1TJGL 3QDGB 3GM0A 1WWBX 1CF8L 3R06B 5CEXB 3BX7C 4N8VG 5FV2A 2XN9B 1V05A 2PR4H 4NCDA 4YGVA 4OZIA 3MXVH 3RTQD 4PJXA 4K2UH 3IVKA 1R3KA 1X5AA 3PXHA 3VG0L 5DXWA 2DQEH 4LBEB 4RZCA 2IANA 3SDDC 3R0MA 3DV6A 3PL6B 1CLOH 1S5HA 5I1EH 3FFCD 3V7AE 1D5BB 2VDNH 2X4PA 3HS0A 1FV1B 3RGHA 4UAOC 3PL6C 1T0MA 1QNZH 3QHZL 3QUMA 1BIIB 4BH7B 2R2HB 3CCHA 1KEML 4GXVL 5F6IC 5KJRH 4U2YA 1N59B 2HVKA 4JRXA 1ROWA 4D9RD 3A6BL 5I75C 4U6VL 5JLZA 2OZ4A 1FFNB 4LCWE 4XB7A 3QIBB 4Y16B 4YXLL 4P3WA 3MJ7A 4Y4KC 2FLRT 1GGCL 1ZLVH 4XCYB 2WWKO 4JHAL 4N90E 4L3CB 5MENB 3ULVH 5KW9H 5B38A 5T33L 4JDVB 2EE3A 1BJ1H 2ESVE 2YPVL 4Q58C 4X9HA 4TTDD 4R7DB 4RAVB 4K3JL 2BHYA 3VXSD 4FG6D 1YEKL 4QHKJ 1HH9A 4QHMA 3V7AG 3BKCH 5ICYA 2DLFH 1MI5D 1X6NA 5DR5L 4OZGE 1BFOA 4JN1L 4MNGB 2W59A 4HS6B 4QT5B 4QTHA 4X83A 4MNGE 1LEKA 4GQ9L 4F3FB 4CVXB 2XQBL 2EDQA 4KC3B 1S8DB 3PP3K 4OBRA 3G6JB 5D2LE 1TJIH 4JM4H 3MBEA 3KYMA 2ESVB 3PWVB 5IFAH 5ALCL 5GGVH 1E4WH 1HHIB 1QKZH 3IJHB 4L9LB 4NP4L 3ECBB 5TFSL 2W92A 4ZSOB 1CBVH 4KROC 4U0RB 2B2XL 4BQBA 5MENE 5TPWL 5GRUH 5IB1B 4NO3A 5J6GB 3RIAK 2IADA 2BVYA 3HMXA 3PHOA 1RULL 2Z35B 4YGAB 5I1IH 3DVNA 3HE6B 3LH2H 4J23A 5HDLA 5SWZA 5J13C 4DKDC 3ROOA 4PD4K 1WEJL 1T1XA 1I1FB 4GW5B 3WXWL 1LP9B 2AV7A 4YGVB 1EX0A 5I73B 5BVPH 4Y88A 4WU7B 1NBQA 4MX7B 1WZLA 5EBLA 5HI4C 5FM4A 5I71B 2JELH 3K1DA 2R0LH 2VLJA 5C0RH 5I1DB 3TWCH 3WKNA 4NN7B 4OKDA 1FIEA 3BEVA 3VI3F 5HDQL 4XVJH 4ZTPL 2BSSB 4NFBA 5EZLB 1JZ8A 3FB5B 5BMFH 4DN4L 1EERB 1Q9LB 3ZSSA 4CRPA 1EHLL 4KRPB 4I18C 5GGSB 1VGEL 4GW1A 4KPHL 4Y5XB 3D69B 5I1IL 3DRTA 2EDYA 4N0FB 5BRZD 4J4PC 5FK9A 1HHGA 1EFQA 5HVHB 1Q9OA 2ATPA 1N3NA 4UDTB 2F5AH 2A9NH 4RFOH 4HXAH 4OLZH 1K2DB 3IFLL 1G7PB 1U3HC 5CJ5A 2ZSVB 4M6OL 4V1DD 3FT2A 4YO0B 3TPUB 15C8L 3RTQA 5D7JB 4RGMC 3LPFA 1T20B 4PJ8D 4NQDB 4AL8L 3Q6GH 5CJOH 3G08A 4DK6A 2ICWA 4KZEH 5KZCD 2NY7L 4PR5A 4HWBL 5ICXB 4AEIL 4KMTL 3HR6A 4RIRB 4K3HA 1JK8B 1MFBH 1UKSA 3OSKA 3E6FA 5GHWL 5DURD 3S4SA 3FT3A 5T1MB 6CGTA 9CGTA 1T0PB 1QSEA 4M6AA 3O0RH 5E03A 4JJ5A 2ERJC 3GI8H 5IEKA 4N90D 2N7AA 4OLYL 2X1PA 1I3UA 3B5TA 4GUPA 5CIPB 4GSDH 4JRWA 5C0JB 1G7HA 4WWKC 4AM0A 1GGYA 1ONQB 4XB8A 5ISZE 4NGHL 2DYPD 5HHQB 2ZUWA 3LN5B 1YQVL 1RZFL 4R2GD 5ELIA 2XQYG 5GS0D 1QEWB 2X4UA 5D8JH 1J8HD 1CVSC 2O5YL 3O4LD 4ORGB 3NPSC 1KIQB 3ZKSD 2W9EH 2J8HA 4LDEB 5FUCC 4G8GA 4HUXA 5GRJL 1T2QH 5FM8A 2NY1B 3A6BH 4FXKB 3NIDE 5JW5A 1HH6A 5HTSA 1IT9H 1EA9C 3FFCE 1VDGA 2P7TA 4GXVH 4XPGL 3STLA 1PZ5A 4JFYA 1Q9OB 5IP4A 4K8RL 4OB5L 1KG0B 4W68A 5ALBH 3TBYA 3PQYE 5I1EL 4JRYB 2R69L 4XCFH 4PS4H 1PG7L 1NLBL 1YNTA 1DQQA 3RWEB 4MD5B 1YC7A 4F8TA 5CZVL 3I3BA 3MREA 2GFBA 2LABA 3PDOA 4OGXL 2VO5A 5D71L 5H35B 2PR4L 1MH5B 5GGTA 3S36H 1DEEA 3HPLA 2XXMB 3CDCA 1P4LB 1CE1L 3MUGB 1XF1A 4WCYL 1UYWH 3ZTNH 3O9WB 4J2XA 5I66A 2B1HL 1T0NA 4ETYA 1AJ7H 4LAQL 5TGBB 1M4KA 1GGBH 1MPAH 4GH7B 4UOW0 4ZSOA 4D0BA 4YUEL 3TT3H 4APQC 1BWWA 4CMMB 4BKLA 2QQNH 3RPKA 3RVVD 1G0DA 2H8PB 5I0ZA 3VG9B 2FH8A 2IADB 1CTNA 4UIKH 3TYGH 3CK0H 1JGDA 3IFLH 4TYUA 4M02A 3MRHB 5I8CA 2W60A 5GISH 3W9DA 4EIGB 4MXQC 1MI5E 4X9GA 2R0KH 4FQIH 4NO2A 1J86A 3UTSE 5JNYB 1ZVSB 32C2B 3CVHB 4MS8C 4HFWB 4XNQA 3VXPA 1KC5H 2DQHH 1BEYL 4Y5YA 4OUUA 5EU7E 3WFZA 3L3HB 4O4YH 2A6KB 2V5SA 4DN4H 1E4KC 2IAND 4UUJB 1Z2KA 3BDXA 2WQ8A 5D7JC 1BEYH 1FJ1B 1FZOA 4HWBA 3X13B 4KU1A 4N68A 4PJHF 4BFBD 5KSBE 1AGEA 5IMMA 1X4XA 5HI3D 2ZCLH 4M6MH 2BVEA 2NXYC 1MCRA 4FFWC 2HJFB 5IB2B 1XIWD 2PYEB 3WXWH 3DXAB 3BE1H 5DLML 3MCKB 3LB6C 4D8PB 1GGUA 4CBPA 5KSBA 5LXGH 1XCTA 3ARRA 5DF0A 3MA9H 4TVPL 4FTVA 1BOGB 1HWHB 4HUWB 3GSXA 1S78D 5F6IB 5TPWH 4X5WA 1KG0A 2ATPB 2HMIC 1GGBL 3ULUC 4MHHI 3MBEC 5I1HH 5IV2A 1HNGA 1U8QA 2KKQA 3LRGA 5HI5D 5I1KH 5ESVB 3T0EC 4UILH 1WVZA 3S36L 1BFTA 5E2WL 1MI5A 4RMTA 4KHTL 5CEYA 5K9OA 5D71H 3JV4B 1A6UH 4KUZL 4L29A 1WTLA 5E6ID 5A1AA 3ZLQC 3DGCR 4URTB 2P5WB 2Z8WC 3RL2A 4FFYL 3MNVA 5L7XH 1PG7H 1IC7H 2EDEA 3MRGA 1Y0LB 3QZWG 5EB9A 2JIXA 2BJMH 2VISB 4K8RH 2G75A 2BZDA 4LSVL 5I15L 3NABL 4HKXB 4Y0GA 5T33H 5IVZA 3DSFH 1FVCB 5DJYB 1IILE 5T1DL 1G0XA 3LD8B 2Z35A 4JHAH 1QLEH 4PYGA 3RU8L 2XY1A 4OLEA 1AO7E 5JUEH 5HVWA 1QHOA 1XR9B 2W9EL 1SM3L 4CW1A 1QBML 3T0AA 4ZAKD 1OTTC 4JQIH 2P44B 3GB7B 4U7KA 5C0EB 5F97E 5FO9A 4NZJA 3WDHA 3IFPB 4GG6B 3IJHA 1YC8A 3VFVA 3QFJB 5IROA 3TZVA 1A9BA 4PJBE 5D1QA 3RX5A 5C08B 5C0FA 3VFGH 1CT8B 1MCWM 3FB5A 1NDMA 1DQDL 3RWFB 1PX3A 3LSOA 3RVVC 3UBXB 5C07E 3TH4T 5I19H 4X80H 2R2CA 5LGKA 4NRXB 1D9KC 1C7TA 3IS0X 2NY7H 1FNLA 3QPXL 3VFWB 2YD1A 1XF3A 3GJFB 1L7IH 3GMNA 4XGZB 15C8H 2DQTL 3O81A 3QEQB 1OTSD 4ZPVA 4PRDB 3MRIA 5ISZA 3TESA 3ZDXE 1U42A 1QLFA 3ARGD 3C60A 5KTEL 4QXUL 5E6YA 1SYVB 2F5AL 1FFPB 3OJ2C 3GSQB 5IB5B 2CO7B 4ZUUA 5D7JD 3ES6A 3VGBA 3W0WB 1W72H 5J1AB 3TFKC 5IQ7H 4Z7UB 2CIKA 1CG9B 2VR5A 2OTPA 2NXYD 4FFWD 1EBPA 4GKOA 1VB9A 2LFGA 3QWOA 3CXHK 5GRZA 5FA4B 4LNRB 3RQ3A 5MP6L 1LNUB 2I07B 3G9AB 3EO0A 3GHBH 4RSVA 4Q97A 2Q86B 2IWGA 1HHHB 5ITBH 3ELAT 3FONB 1OGAA 4PJGB 3BOVA 1DVFC 5L2KE 2CK0L 1TPXC 1GJIA 4I13B 1PG7X 1CU4H 4PTTA 3E6HB 4GG6E 2DQHL 4DQOL 5DMIH 5C07D 5DZOA 5LKNA 5DJCB 5E8NB 5C0BA 4EI5B 4E5XB 5DMGC 2E6PA 4MJ6B 5K33A 1EXUA 4JDTL 3RVWD 3IU3A 1UXWA 3HI1A 1XGTA 1YEFH 1GHFH 2V17H 4JPKL 4PJAA 3DVIA 4XBPB 4DTGH 5CINH 1MCIA 4XGZA 43C9B 2GJ6E 5JHLL 2OL3L 3EFDL 1QKZL 1E4WL 3HI5H 4TTDC 3TYGL 1DL7H 4X6DA 4WW1A 3QFJA 1KLUB 4GAYB 3QG6A 5DS8B 4G43B 2HFFA 1EAJA 2J5LC 1ZT7B 1F4YL 3MRIB 4ZD3L 5SWSE 3DUUA 1SBSH 1MLBA 5CILL 5I76A 2XRAL 4PJFF 3TYFA 4UU9A 1RIVL 5FCSH 2IALB 3UJJL 4NM8H 4X7FC 2BSSA 5ITFB 2F5BH 4R4BB 8FABB 1BD2B 2J4WL 5MEPA 1YEKH 2VLMD 4Y2DC 1QVOB 3VA6A 1SEQL 1H3UA 5IFHL 2CDFA 1ZHLA 1H3XA 4HUKB 2M1KA 5I8KH 4RGOH 3KPPB 2VSCA 5FXCH 4Y8AA 4X6CA 2AABH 4Y4KA 1H0DB 4Z7VE 4EQ2A 1D5IL 3CDYA 2Y07H 1RUAL 2G75B 1DDHA 3VFUB 1VESA 3IETA 3FJTA 1ZS8B 1LE5B 1NC4D 3R8BB 1UM4H 1UCTA 1P5VA 2VLJE 2EKSB 2B5IC 2AJSH 1KPUA 3MROA 4HKJB 4QRRE 1FC1A 3CAFA 4BJLA 4G6JL 3KYOA 1C5BL 4J1UB 5GGRY 3C6LD 1DUZA 3QJFB 5FUZH 2YPLB 5FYKD 1E6JH 3E1F1 3DYOA 1JF1A 4MNQB 4EN3C 3DBXB 4N8VA 4U7MA 3I6GB 3MR9A 3WFHB 1D9KA 4JJ5B 2EEAA 2LU3A 4JE4B 3BDYL 4JO2H 3IDMA 3L5WA 4LHQB 2H1PL 3Q1SH 4LKCB 5DK0A 1TENA 2AXHA 3KVQA 1S7XA 4PG9A 3CFJB 1AIFB 1MCNA 3MV01 2NY2C 5IVXA 4XC1H 4NQEE 3VFRB 3WS3B 5T1KD 1JGVH 3W2DL 2ADGA 4XMKL 3ZTJG 4K9EL 4P57A 1KGCE 4OCNC 3OX8B 1A6AA 3BP4B 1V7MH 3OKMB 1HDMB 3NIDF 4JDZB 3MRPB 1KJVB 4Y2OA 4H25A 3S97C 3ZE0F 4CVUA 5C92A 1BD2D 2NY5L 5J11B 1N0XL 1QSFD 4M8QB 5TE7L 1NC4B 3GMRA 1WWCA 1OWRM 5GGQH 1Y6KR 3KPNA 2MFNA 5D1QB 5GJTH 5F9JB 4CGTA 1EHXA 1F11B 2Q1EA 4BFIB 1SYVA 1JL8A 5GZOC 3HN3A 3LMJL 4OCMC 2W0FB 5MERA 1OAZL 1QHPA 3IDIA 1F5WA 3NFPB 4NYLA 4LVNC 5BS0E 3JVGA 3BPLB 3ES6B 2SEBA 3U0WL 2P5EE 4Q2ZB 3BGMA 4EN3B 4XXCC 3D85D 1M7IA 3H3PL 3BKJL 4ODTL 2PXYA 4P5TC 1TZHA 1CZ8H 3G6AB 4WUKL 3GSNB 4PTUA 3VDAA 4NNPL 5IGXL 1G7JA 2X4TA 1JYVA 4P5TB 3VXQA 5AD0A 2ATKB 1UB6B 4OF5A 4N8PA 3F12A 1N7ML 1JGEB 2W1NA 5JR1L 2IPKA 1V5JA 5K9OB 1IC5H 1U9KA 3QNZA 1D3CA 3LH2L 5LBSH 4UOW1 1CCZA 1JMZA 5F7LB 3NPSB 1MCPH 3EBAA 3AS3A 4QGYA 3QZWA 5T3ZL 1IL1A 5D1XA 3UBXI 5JHDD 5E56A 2V7HA 4GUPB 5E6IC 1QTYT 5FV1L 1MCFA 2Z31C 5EU4B 5EBMB 2DRUA 5C6WH 1FYTA 3C09B 3QEGL 5CD5D 3UTTA 4G9FE 5I6XC 2P1YA 4NNYB 2QADB 1FVEB 5J11C 3I6KB 5KSUA 1RUML 1A7RL 3LDBC 5EOTA 4W4NA 4X6DF 4G43A 3AY4A 1EVTC 1PGRB 4OTXH 1G7QA 2CDEA 3IGAB 3VA2C 1FH5L 4Y19A 1LVEA 1ZAGA 3P0YH 5GPRA 2FX8L 3OXRA 4MJID 1BP3B 1MWAA 2DLFL 4XVTH 1BLNA 4WGWB 3RWHB 5HYJE 5DDHA 4R4BA 4HKZB 4O9HH 3F58H 3LS4L 2GJZB 5EO9A 3RVXD 3SDCB 1PY9A 3QEQD 4HAGA 4OSUL 1NFIA 5AZ2H 3FQWA 3WJLC 3U9UA 1K3ZA 4J3XA 1KEGL 3O6FA 5GGTL 3STZA 5IBUG 3VXSE 1A3LH 1OAKL 1TQCC 3OAUL 4P2RE 2VDPH 2G5BB 2A6DB 4AENB 5GXBB 4WI2A 1SY6A 1FNFA 5KVEH 5IV2B 4GBXB 3EDJA 2PO6C 2K3TA 2AQ1A 3CFDA 1EGJA 5EU6B 2WWMD 2YHGA 4NQUA 4PJ7B 4WO4D 1I3RA 3SGKC 1PDKA 1A47A 4LDLB 4YC2B 5DK0B 1OAYH 1JPTH 5TE4H 4QRRB 1D5XA 4BZ2L 2V9TA 1KOAA 4R6UA 2LAGB 4JVPA 1T21B 1PD6A 3RTQB 1FFOB 2FNBA 1LP9E 2NTFA 4OCYL 4ZAKB 4MA7H 1AGDB 5AZ2L 2UZXB 3MXVL 4KFZC 4LCCA 3SGDI 3P9LB 3ZL4H 4IS6A 3VFTA 5C2BL 1MFEH 3QUXB 4DGYL 2VR9A 3F58L 2EE2A 3G08B 2YD7A 5DFVC 2CXGA 3VFOA 1DBJL 2ZG1A 3PWVA 4XVTL 5HHPB 1IAKB 5C08D 1KIRB 4Q9BA 4HIXL 3M1BB 1E27A 4QRSA 1I9IH 4W81A 3HLAB 1MEXH 3ABZA 3T1FB 4JG1H 1S9YB 2WLYA 5D2LB 4KRMB 1RJZB 5T3XL 4R8WL 5AWNL 2XZQL 2O61A 1YEDB 1J7VR 5C9JB 2P42B 5JXAL 4JRYA 1FNSH 5MEPB 3VD9A 2CH8A 3ECBA 3SJVA 3X3GH 2X41A 3VWJA 4FQ2L 3VCLA 3HZMB 3WFBL 5EUKA 4M8QA 4QXWA 3E2HB 2P7TB 2GFBB 4M7JH 5F7EH 5F7WC 1P2CB 3RVUC 3U2SB 2MMXA 1JV5A 3KPSD 1H5BC 1MJ7H 3HMWH 1CD1A 1I7RB 3G5YB 4YE4H 4YDJA 4F7MA 2ICWI 3QDAA 3OXSB 1Q72L 4LSPL 4ZQKA 5IW1A 4EN3A 4S1RH 5ECJE 3BKYH 4XXCA 1U91A 3MLVH 4IRZH 3LDBB 1P6AB 2EIZA 1NEZG 2EDBA 3KPLB 1SYSB 2X4NB 4DUVA 5IMOB 2NY0B 3BKJH 2KQNA 5ESQB 4DN3H 5DJAB 2AK4B 5EH1A 3T2NL 3L3IA 3MA7B 1MHHA 1KJ3L 1HCFX 3EYQD 3VH8G 3IT8D 1KNOB 5FM5O 4BSWA 1A7QL 1NC2D 4GFTB 4XCYA 3DXAD 4LSQH 5IK3B 1VADB 1FNGB 3FN9A 1JI1A 2R0ZH 3S88H 5BZDA 3BXNA 3L3OB 3TBVB 2W0FA 3MBXL 1GSMA 2MCPL 4LGPB 2P5EA 1SY6L 3O2WL 3MROB 2DLIA 4BZ1L 4GRLB 1KLFA 4OF8A 3IDJA 4M93B 5J9PB 2FB4L 3SGEH 5DD6B 3UTSA 1A0QH 2FGWH 1G7LB 2E7LA 1AGFB 4FNLH 5IHZB 1QQDA 3DUHA 4P59H 2VXVH 2DQGL 4ZFOL 3VRJA 2CGRH 1FORH 4X4YB 3P4OB 4HC1H 1O7VA 3L3GA 4Z0XB 3NZ8A 2AJYH 3ARBA 3NTCL 3OKKB 3I9GL 1WBXA 4JLRB 4EUPG 3G04A 1DFBL 1FQ9C 1TCRB 3RZCA 3E0GA 3SO3C 5E2JA 5DUPH 3GIZL 2NY0D 4JO2L 3ZE1E 2FGZA 4LU5H 1MREH 3VGEA 1QR1B 3E8UL 4CVWA 2R23A 3MLYL 3MV7E 4XVUC 3ROLA 2NY6B 2R2BB 3CH1A 3SDDA 3FOLA 3KJ4C 2CLVB 4V1DB 1NAKL 1W8NA 2A6DA 5IB3B 5E5RB 1S5IH 4NUGH 1VEPA 1A1MB 3MRDB 4NQDD 4QHUA 5E2TH 1CK0H 1MFDL 2E6QA 1KNOA 1ZGLM 3IJSA 4U1MA 1U8IB 1LDPL 2ZPKH 3MRHA 2E7MA 1V3MA 3WNMA 2DLGA 2VDML 1Q1JL 1PEWA 2XZCL 4HZLB 1D5IH 1P1ZB 1U8NA 4PRIB 3DX8A 4O2CA 2EIEA 1K8IA 3WJJA 2OTUB 2IEPA 1RZ8A 4FQ1H 1UWXK 5T3XD 3SGJA 4P9HC 4ODWA 2A74A 1A7PH 3MV8E 3Q5YA 4QTIH 3TT1L 2MQCA 4U1KA 4DKAA 3JWOC 3VXQB 4OI9A 4K94C 1D5MB 2HT3C 4OLVL 1JZ7A 3ZDYE 2F5BL 2V5YA 2OI9B 4XNXL 1HN1A 3WHE1 5L2JA 5FYJE 2BNQD 2DDQL 3D25B 1RIVH 4R9HA 1UM6H 3C9NB 2VLKE 3TCLB 1RSFA 2QADD 4KGJA 3QA3B 1BFVL 4WI7A 3MJ8A 4G6AD 2VUYA 4X8JB 3B9EA 2MPAH 2JB5L 5F9WB 4YPJA 2UUDK 4OUOA 3QAZC 3Q0HA 1HQRA 4OD1H 3F7QA 4OGYL 2F54A 2EO9A 4TUOA 4HLZH 3QCUH 4XBGA 1GC1L 2ADFH 4JDTH 4XCNA 4O5LL 2E9IA 4FQLL 5D1QC 3QSKB 5I8OH 3QFDA 3O3DA 2DQJL 4G6FD 4HWZB 1CICD 2Y36L 4IMLB 5K9JL 1XCTB 3KPQA 2X1XR 4ZS6D 2D0GA 1F3RB 4CADA 1FCCA 4PJCF 5DJ6B 4NKQB 3LS5H 4P4RB 4ZFOA 3BEWB 4M1CC 3ALPA 3WIHA 4NZUH 5IK3A 3BZFA 3FQWB 4LP5A 1SJVA 4LK4A 3IVKB 4ZUUB 2V2TB 4ISVA 3VXRA 5FCUL 1BQLH 2OI9C 3QIBA 4LCIL 3RWDB 4GS7C 1WLHA 4ZUWB 5DJAA 1CLZL 3TJEH 4YDKH 4FFVC 1EFXA 4HH9B 3HS0B 3SJVD 4GRLA 1YEHL 3CXDH 4YPGA 3KDMB 3P77A 3H0TB 2KZWA 3T0BA 3QCTH 2I07A 5HDBF 2FIKB 1YN6A 5DQ9A 1K4CB 1CQKA 3QI9B 2R56L 5I1GL 1ORQB 2CIKB 2GSIA 3GUTA 4OCSH 1IM9A 1CL7I 4BUGA 1AH1A 4U1HB 3MLRL 4DGVH 2FHFA 3ORJA 3CSYA 5ACMA 1BAFL 2IMMA 4PJAE 2X4RB 3ALXA 4JO4H 2XN9A 4PLKD 2D4DA 4X80L 2CRYA 4HGWA 1LEIB 3QCTL 5F6HI 3MNVB 5JPMA 2HFGH 3EOAA 2ZCHH 3MYJB 4YZFF 4PGJA 4FZ8H 3I50L 4A2MA 3S5LA 4WY7H 4XAWH 1KJ2B 1T66D 1NQBA 3WFDL 2YC1A 3SDAD 2NW3B 3U9PH 2W9DL 3VRLF 2P46B 3HE6A 2GK2A 3D69A 4YJZL 3WNOA 3B9VA 3JVGC 4OFYA 1XGQB 5DO2C 5JUEL 1I8LA 4JREC 3VXNA 2IJ0C 1R3LB 3HE7A 3DSFL 1A4KA 4OV6F 1J0HA 2HLFC 3RRQA 3D0VA 1T1WB 1U93B 3MRKB 5EOCH 3KPNB 3QDME 4HGKC 5FHAL 4WU5A 3MZTA 1Y6MR 4LCUB 1FNHA 2YXMA 2Z4QA 5EOCL 3LN9A 5FKAA 3HZYB 3K4ZA 3D18A 3CSGA 1M7IB 3WS6C 1JRHH 4JHZA 3QDJA 4KJYB 2B4CH 4X6EA 1F6AB 4OGZA 5E6IB 4Z95H 5EZIL 1MCJA 2DI7A 4LRNH 4ZOCA 4P9MH 3VGDA 5HYSG 1V3JA 4O58H 1NUFA 1G7HB 4AM0B 2UZIH 4ZTOH 1ZT1A 5JO5A 1WISA 2VITB 2BSTA 2FATL 4I3RL 2DDQH 5J3HD 2YKLL 1CD9B 3QXDA 4QHNA 3KYMB 2WBJC 4PJBF 3TV3H 3QWRD 2QLVB 3QFJD 3IXAB 3NIGF 4OGAD 3RPIA 5T3XE 4L29B 4MNHB 2HKFH 2NY4B 2BRRL 3MJ8B 3CSPA 1F4HA 4L3EB 2F15A 4LF3A 4M5YL 1EPFA 1TQCB 5CMAB 3AFLA 1V8HA 4Q6IB 4FFZL 4F9LA 4PJ8B 4U6XA 2EKJA 1FZJB 3VFRA 5ITFA 3TIDB 4KXZH 3B4NA 3B6SB 2BY2A 3QG7H 2HT4C 4M1GH 4FFVD 4F7TA 1D5MA 5IMLA 4PJ5A 4XCNB 3DHMA 4K23L 2DJ4A 3LHPH 1D6VL 3P4MB 3T8XB 3HE6C 1JUFB 5C0GB 2X70B 4OZIF 3EOTL 4R26H 5HHNA 2CDGA 5GGRB 3DX9B 4PTTB 4XWOC 4Z76A 4UINH 1X5ZA 4I5BB 5I71C 2HN7B 5HI4D 4ZO6A 2KZ1B 1BVLA 4PP2A 2BVPB 4TVSa 3NBNA 3WFDH 1UQSA 4XCCH 3Q3GA 1JGUH 4NQEB 3VFSB 2NY2D 1IM9D 4KTEL 3CK0L 1YEGL 3FT4B 5DJDA 3MLXH 4EVNB 5EBWA 5MI0B 3CXHJ 2PW2A 2CO6B 4PP1C 5L0QB 3DROA 1AC6A 1C08A 4I4WA 5CJBA 1ZOXA 3NTCH 4JFDB 5I76B 1MPAL 5D96B 2YUXA 4JO4L 1OCWH 1JZ6A 3PG2A 4JRXD 4YPGB 4JCMA 2DQUH 4M43L 3C2AL 4NFDA 1CDYA 1K9TA 3RKDC 2VDQH 3LQAL 1G6RA 1PJ9A 1S7UA 4P23A 3RNQB 4JHWL 4WTZA 2OJEB 2WUCH 4P4KC 1NFDB 5INCB 5TJWK 4FQPA 5GZOD 5DEFA 3CZFA 4Y4KD 5IEKB 3TNNA 5HI5C 1ZA6B 2ATKA 4KTYA 5MEQB 1RZJC 1BOYA 4NCC2 3ARVA 2IQAB 5DWUL 1AGBA 3EGSB 2GTZA 3FTGB 2P24A 3GM8A 4M03A 4X4XA 4M3KB 4F9PC 1UXSA 5E5MB 2DI9A 5DJ8A 5JW4Q 5C0BD 1INQB 4MDJA 1MRCH 4ENEC 4QRPB 4FQJH 3WLWD 4F7PA 4C56E 1TVDA 3V5HB 4PY7A 1XF4B 4G7VH 4NQXB 3D48R 4K3EH 3C6LA 3WO4B 3W9EA 5E8OA 4R2GC 3SKOA 1S7XB 3WO4C 3GSOA 5ESAA 1BJMA 1WTGT 2Y36H 4MMZC 4QTIL 3H2WA 1J0YA 1HKLL 4NRZA 5F7NC 3M17B 5HHVH 1P4IL 5I30H 4P4RA 2BVOA 4ZFOB 3WDJA 5JOPD 3DMMB 4AY0A 4R0LA 4LRIA 3UO1H 2FCBA 2VN4A 2V7NA 5ID0A 1NDGB 1RHFA 4QHLA 4X7CC 1P7KB 3VJ6B 2UY6A 4R97B 2D31B 4IIQB 4S2SB 4MAYD 3X3GL 3BUYB 5F7DA 2I60H 4X8XA 3OXSA 4IIQC 3SE9L 4HWBH 4ODVL 3L3JA 3MRGB 2P8LB 2XN9E 3HC4L 4YHNA 2C3HA 3I84A 2HH0L 1UM5H 4JPVL 3U9UB 2NX5E 2XTJC 2ICWB 4N0FA 1ZA6A 3EOBB 1WWAX 2H45A 3LQZB 3LEYL 3QDMA 2PYEA 5F8QC 1OD9A 5E2VH 5DHYA 1NCTA 2VITA 5EC2B 4OM0H 6FABL 3SKNA 3JZ7A 2E7LC 3MJ9A 3P9MB 4FQXA 2IBGA 1C8PA 2A74B 3ZYJA 4PJFB 5ERWA 3ZDZE 1EEQA 5F44A 1AR1D 3I9GH 4IDLA 4CN4A 2YXFA 4J8RA 5FDWB 4U7SA 4XVUD 1QFWL 1H5BB 3JBG7 4NN6B 5ETUB 1U3ZA 4P3DB 4N0UA 1UH4A 2FJHA 3O6KL 4KDWA 3T3MF 1I8IA 3VWJC 2HT2C 2OXGA 3DETD 1L7TL 2VZVA 4CJ0A 5T5FL 2BVPA 4ETQA 1C16A 3AROA 1WEJH 5KSAC 3RY5A 1MFDH 1G9NL 3GMPB 3MBXH 5GSRA 2J88H 5KVEL 4PJHA 2GCYA 4HBQA 1M71A 3DWTA 1XR8A 4OV5A 1E4XL 3FZUC 1EZVY 4X5XA 3WIFB 3TH2T 4X7TB 3R1GL 3HLAA 3NFNB 3TJHC 3NIFE 4TPRL 5GGVL 5EU6A 3KPSE 4YHYC 4IHOB 1BGXH 2P48B 5I9QB 3KLDA 5GGSY 4MAYB 4OAWA 4LDOB 1Q0XH 2BNUA 1IGTA 5FDYA 1OP5H 4XP1L 2BSRA 1FLTX 3WNNA 2CMRL 2I5YH 4M93C 1T66C 5BVJB 4GQ9H 4UIMB 4NQCB 4PJBB 5ID0B 5CIPH 3TVMA 3CGTA 4U6YA 4WUUB 5AUMB 1FORL 3O6FB 1ZVHA 1UWGL 2AVGA 4G9FD 3FB7A 1HHKA 2NX5B 1MHHB 1A7RH 4DFHA 1WJ3A 1IC1A 4B53A 1ITCA 3NA4A 4FQ2H 3O8XC 5C0CA 3NCCB 1FFPA 1RV6X 1VADA 4U1JB 3GNML 1DQMH 3IDYB 4PJ7A 4PY7B 3BDBA 4M4RA 5JXEC 4D0DA 3VD7A 1NGPL 4ODUA 1S9WA 3H9SE 4PFEA 3S35L 5CMAA 3D3VB 5E8OB 5DT1L 5DD5H 2VIRA 2GTZB 1X7QB 2BXYA 1SJHB 5JHDA 5JQHC 1CGTA 2KQMA 4DN3L 4YAQA 1DSFL 5H35A 4PJHB 1FSKC 3ZHLA 3C8KB 4X9BA 3MRBA 2VLME 1CS6A 2DM3A 3JWDL 5F70A 3UXFA 3ZKQD 1NBZB 3SE8L 5IMMB 2DQDH 2ED9A