1MCBA

Principles and pitfalls in designing site directed peptide ligands
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
216
structure length
216
Chain Sequence
PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
publication title Principles and pitfalls in designing site-directed peptide ligands.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 41
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcbA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcbA02
4IBLT 1KBGH 3OWEA 4Z95H 4TPRH 3EOTL 4GRLB 4ZAKB 3MJ7A 1LO3L 3OL2A 4UQ2B 3HZKB 3CDGA 3ULUH 2DQFA 3T1FA 2AV7B 4N0RA 4Q58C 4EN3C 1GVIA 1BVKB 1V3JA 2W9DL 1KCRL 5HYQA 4MHHG 3RNQA 1ZT1B 4PRIB 1EBPA 1D6VH 5IKCA 1WBZA 1K3IA 4HBCH 5IT2H 2PTUA 3OXSA 4TVPL 1V5JA 1J0KA 1LO0H 5F9JA 4RQQB 4WJ5B 4JB9H 4P0DA 5EU5B 2FX7L 1JGLL 2VDPL 3H3PH 1OP3K 3F65A 4TOYH 1ZHBB 2OI9C 2R4RH 4NN5B 3O0RH 4JY6A 4PV8B 3QIUD 4X9FA 4MAYA 4KQ4H 1QLEH 1RZIB 5DEGA 4X6CB 2J12B 4JDVB 4XGZA 2YK1L 2FSEB 1RUKL 4M1DH 5E94B 5L2KD 3GBNH 2BOCB 4QRTA 3FRPG 4P5KA 1NGWA 4QHUA 4PJHE 4PJIE 4ZXBA 1XCTA 3X3GH 3LD8B 4Z78A 5J13B 1HIMH 1CVSC 3WS3B 4KTDH 4CADB 3O3DA 1U8KA 3ZZ1A 4G42B 3T8XA 1DEDA 5CIPB 4XCCH 4QRSB 3HR5B 3S4SA 2Z93B 3DRTB 4P46B 4POUB 5EG6C 4RBPK 1DVFC 4Y4FC 1TITA 5EBWA 2FH6A 1BZ7A 2NY4D 4BJLA 3NACL 4WY7L 4YHMH 3W2DL 5TE6L 1TTGA 1BLNB 1BJ8A 4MD0A 4PTTB 2NY2D 3T0VA 5J9PA 2ICWI 3U9UA 4NHUA 4EI5A 2BDNH 3THML 1DEEB 3O6ML 3UO1H 1B4RA 1VKXA 5D2NC 4YR6A 3ZTJG 3ALPA 5E2UL 4NFBA 3DI3B 1RJYB 3L3OA 3LB6C 5F89A 1HHKA 2D7OA 2EE6A 3HS0A 5D6CB 2DM3A 2VDLL 2VXTH 2VC2L 3PDDA 3LS4L 3ILQC 1RZGB 3LZFH 3X3FH 3DRQB 3NGBB 3MA9H 4OUOA 3WLBA 5LQBL 4PRDB 4DZ8A 2MJWA 1A14L 2NW2A 4EN3D 1T2JA 3V0VA 1A1NB 2R56L 3KPRB 3WUWB 3RNKB 2Y07L 4KROB 3EYVA 2E5EA 1LO5B 1EHNA 4FQ1H 3STZB 4MD5B 4JFDD 2D7TH 5D70L 3VRJA 3G5XA 1S5HA 3GIVA 4KI1A 3ZT5A 1OW0C 3SGKC 1QFWH 1C5CL 3KAAA 1MCOL 1U92A 3GMMA 1UJ3B 1TVBB 1X5GA 2XTLA 3LRSA 4RAUA 3HE7A 5D7LD 4G6FD 3ZHLA 3TV3H 1U93B 1DDHA 5L8KB 1UWEH 4YX2L 1N5YH 5K9QI 5F88A 1YNLH 1KTDB 3PV7A 5IBLD 3BUTA 3RPIA 4KTYA 5JQ6L 1IC4H 1RUQH 1A6ZB 5FKPB 4DCQB 4P59H 5FUOL 1R0AH 3QHFH 2P5EE 1FGVL 4K23H 4L4TA 3C09B 4XNXL 1OLZA 4JFXA 1KOAA 3MRNA 3P4NB 5E2VL 1HI6A 3PL6C 1CR9L 2ZUUA 4KHTL 1YPZB 1KCLA 3SDAB 3QO1A 2ZCHH 4X4ZA 1O0VA 4WNQB 4NQDA 1UT9A 1D7FA 2E7LC 4Y5XA 2AJUL 3V8CA 4HS3B 1DVFD 1WGOA 5B3NA 4IMLA 2I9TA 3JSSA 4Y2DC 3VDAA 4Y5VC 2AJZB 1QO3B 4LRNH 4WU5A 5I6XC 4JPKH 4WTZA 3FHAA 1NCBL 3DUSB 3UC0H 5I1HL 3I3BA 3QWRD 3MRRB 1MJJA 4F58H 3AM8C 4S2SB 1XCQA 1E4JA 1JRHI 3RY6C 4XVTL 5EIVA 4OCXL 3LB6D 4I3RH 4YE4H 3PWNA 3GJFK 4IRZH 2R1XB 2Z35B 4WHCA 4OZIA 1FCGA 1XGYH 1N64L 3MJ9H 4J8RA 4UILH 1A02N 3ILQD 5SWZD 1IFHL 2EDBA 5ACMA 5TPWL 2IALB 3VRLE 3HI1A 1OF2B 3IJYA 1YNTA 3U83A 5AWNL 5JPNA 4OLYH 4NWUL 3C8HA 4PRHE 2UY7A 3U0TA 4X4YB 4TSAH 5DJ6A 4CNIB 3GBMH 4X5LA 4O02L 2VDRH 1II4E 4IRJA 1P6FA 4G8FB 4K7FA 1G7MA 1CGSL 3EAKA 4ISVA 5KSUB 1V3LA 5INCA 4FZ8H 5KOVC 4HK3J 2LE9A 4NQEE 4BH7A 2D0HA 5CEZL 1FNLA 5I76B 1C08A 2IAMC 1YEGH 1U8JB 1OSPL 5HYJD 3AB0B 2AV1A 3WEXB 1CD1A 3D85A 3NIGE 5DI8B 3QDMB 4U1KB 3MNVB 1J1XH 4J23A 1S7RA 5E8PB 2W38A 4G6JH 2C9AA 1UEYA 1BVZA 5D72L 2EDLA 1WQVT 2DLEA 3MJ7B 2VDNL 3QSKB 3I2CL 2DQFB 3T1FB 3PDGA 1KEML 3VD3A 4DAGH 2Q76A 2VR4A 1TJIL 2XY1A 4G80A 1PD6A 4JFOB 5LCVH 3GI9H 3UX9B 3RNQB 1K5NA 1ZT7A 5IKCB 1WBZB 3VU2A 1RUPL 3EGSA 4EBQL 3OXSB 5CKGA 2VDKL 3IFLL 3RAJH 2R0KL 5F9JB 1NLBH 3CU7A 5E03A 3ZYZA 3FFDA 4HMCA 1G6VK 3UTSA 3PL6D 5F9AC 3P2TA 3HFMH 4ONGH 4XNQA 2JCCF 3QQ3A 4U6VH 4E42B 3TBWA 4M8QA 1MFCL 3DGGA 5HDLA 3FQTA 2ZP0T 3IDXL 4JY6B 2ICCA 1CDJA 4N1CA 4MAYB 3AAZA 4Z9KB 5DEGB 5JXAH 4Y2DD 2ICEA 2OL3H 4XGZB 3WFEH 1B4JL 2DLGA 4Q6IB 4KFZC 5D8JH 1MOEA 3H7LA 4QRTB 2BVEA 1NGWB 3L5IA 1BF2A 4QHUB 4UV7H 1XCTB 3Q48A 2DL9A 1HQRA 2CQVA 4Z78B 4IIQC 4UQ3A 4LSPH 1Y6MR 4HZAA 5BRZD 5CP7A 1DBMH 3FRUA 3AC0A 3KR3H 4OKVB 1RFDH 3O3DB 2J4WL 3VFGL 2B1HL 1U8KB 1XR8A 4PJFF 2KKQA 3T8XB 5E6IA 1EFXD 4BA8A 3L3HA 5LBSL 5C0IA 1CGWA 3S4SB 1MUJA 1N7MH 4G6AC 3D39A 3GM8A 5DFTA 3CK0H 4X9HA 3D3VD 5EBWB 3HNTH 1HYSC 1BZ7B 2UVFA 4PJAA 1A6TA 4MD0B 1ZVYA 1XT5A 3TA3C 4F15B 2OX5A 5J9PB 2X9XA 3QJFA 2DB8A 5D7IE 3U9UB 1UZ6E 4NHUB 5BV7L 3DSFH 4NO0A 4EI5B 2IAMD 1VKXB 2OXGA 4QRRE 3CXHJ 5GXBB 4YR6B 1LO2L 1U91B 3H9YA 5HPOA 4LPWA 5F89B 1HHKB 5DUPL 1YQVH 4IEFB 3HS0B 4OGYL 1P7QD 5IQ7H 3W5NA 2EDEA 4MGXA 2WQ8A 3IFNH 1WCQA 3VXSD 1OOAA 4MS8C 4OSUH 1DBJH 1MAMH 3WLBB 4JEGB 2DYPA 4DZ8B 2NW2B 5JOFA 4JVUA 3V0VB 4HMDA 3KHOA 3QUYC 4L4VD 5IB2A 4O2FA 2PO6B 3N9GL 1JGDA 5I73B 4UT7H 3WNOA 2K7PA 4K3DH 3EYVB 3HCVA 4MDIA 4MCYA 3IFPB 4K7PH 5GJTH 3IDYC 2YA2A 1HE7A 3G5XB 1S5HB 3GIVB 4H1LH 4WI4A 1NFDF 3RTQA 1QZ1A 1DUYA 1I8KA 1V05A 5T3XD 1NC4A 4FQCH 1FNGA 1U92B 3GMMB 1CK0H 3LRSB 4RAUB 3HE7B 3MRHA 4DGIH 1DDHB 3F8UB 1TJGL 7CGTA 4PJXE 1LQSR 4IDLA 2F5AH 4RISL 5F88B 2OQJB 4KKAD 5F7EL 2XN9A 2AEQL 3RPIB 1G9ML 2P5WA 4R96A 3ZE2F 3E6FA 3C6SA 1WWWX 5T3ZL 1Q9WA 2FBOJ 4PGEA 4L4TB 5EA0L 2R29L 3MZGB 4HAFA 1UB6A 5MP6H 3NPSB 5J0BA 1OPGH 3MRNB 3CMGA 4KDTC 2R1YB 1HI6B 2W9EH 2P43B 4MA7H 3NA4A 1FC1A 1NUGA 4CU8A 3QO1B 4CMHC 4NQDB 1H5BA 1YNKH 4G6AD 4Y5XB 3MLUL 1BOYA 2CGRL 4JFZL 3SDXE 4IMLB 3UPRA 1HYSD 2I9TB 1ND0A 1IC7L 3TA3D 4J3VA 1A4JA 3ZYOA 3V5KA 4WU5B 1A7RL 1LVEA 5D1XC 1TZIA 5IHUH 2N7AA 5M7QA 1MJJB 3CC5A 1GIGL 1QVOA 3F58H 2AP2A 2OMNA 3U4EA 1R6VA 1D9KC 3PWNB 4LKXA 1CZ8L 2X4SA 4OZIB 3TBTA 4DQOL 4H88H 1E4KA 4J8RB 3QUXA 3HI6H 4F7TA 1RY7B 4IMKC 4MS8D 3WFCL 5I1EH 3HI1B 5SWQA 3IJYB 1YNTB 4EDWL 5JPNB 3T3MF 3QUYD 3U0TB 4U0RC 5DJ6B 5JIHA 2A1WH 2WV3A 4IRJB 4LIQE 2MTPA 1NQBA 5ALCL 5L2KA 1G7MB 4KAQL 4U7SA 4Q0XL 4XVUD 2VDQH 4ISVB 4M02A 5INCB 4GRWB 1IZJA 4OZHE 5FYJU 2OCFD 4BH7B 3MMEA 3ARVA 2C3XA 1C08B 3VFRA 4JFDE 4HUVA 2AV1B 4L8BB 1CD1B 3D85B 4OTXH 4YHZH 1S7RB 1EHLH 4W6WB 2BRRH 1MCSA 5FCSH 3S88L 4RWYL 1I7RB 2EH8H 5HTSA 1ZWIA 3TIEA 5JR1L 4X98A 4ZNCD 2YD3A 2EXYC 3WFBH 1MCJA 3OB0K 4TUJA 4B7IA 4G80B 4XCNA 5F1NA 2EO1A 1OAQH 3EOAA 2I5YH 1K5NB 1VFOA 1ZT7B 3K4AA 2OTUA 3EGSB 4DKEL 2AXGA 5ESVA 2EE9A 1J0YA 1R3KA 1EFQA 2OM5A 4M7JL 4JFPA 4OLZH 4XPFH 3DX7A 3FFDB 1W0WA 4K8RL 3UTSB 5BVPL 4XNQB 2VERN 3VG0H 4LFHD 3TBWB 3DGGB 4PGDA 2AGJL 2RBLA 1E0OB 3FQTB 2D03L 3TNMA 1I9RH 5EWIL 1Q72H 2IGFH 2EKSA 3AAZB 1YEDA 2V5RA 1YMME 2VZVA 2DLTA 2ICEB 4J2XA 1EX0A 5ALBH 4DZBA 1A1MA 1CFVL 1P4BL 5D1XD 3ZO0A 2ZOKA 2DQCH 1K85A 3OG6B 4NN7C 3DO7B 4HZLA 1UKSA 4A6YL 5C0GB 1X6NA 4PRBA 2WLZA 1HQRB 4WW2C 3MACH 2ENSA 2Y23A 1MJ7L 4UQ3B 4POYA 4BZ1H 3JWOL 1N6VA 4JFYA 2DTMH 2DQUL 3FRUB 1FFOA 5D7LA 3OJDA 5CJBA 4TUOA 1MIMH 1XR8B 3ET9F 5MENA 1QSVA 3MODH 4GW4B 5E6IB 1TNMA 4MSWA 3S37H 1L7IH 1KYOK 2AK4D 3WFDL 3L3HB 3V2AR 5F44A 8FABA 1MPAH 5HVFB 5C0IB 5EUOA 5SWZE 2EDDA 1MCPL 1MUJB 4IJ3B 3D39B 4Z7WE 4PJGA 1NLDL 4N0UE 3BX7C 4PJAB 1A6TB 2E7CA 4HXBL 3QJFB 4QRQB 4B0MM 5HDOA 4NO0B 3EYFA 5GGQL 3LDBB 3I3EA 1UA6H 2Q7YA 1YMHA 1KIRA 3ZDZF 1JF1A 1CD0A 4HIJA 1LK3H 1V7MH 3CFIC 2ZG2A 5TF0A 1FFNA 5HYJE 4U4BA 1ADQA 5KZCB 1QEWA 2F15A 1KV3A 5FM8A 1AKJB 4K94H 3VDBA 5GS2D 3BKJL 5K93A 2FB4L 4Y4FA 2DYPB 3VFVA 5KVMC 5JOFB 4X7FC 1F3DJ 2EXYD 5IB2B 1OARL 3IDNA 1QKZL 4O2FB 5HGDA 1JGDB 4HULB 4BQBA 3HCVB 3ZE1F 1ZVHA 4MDIB 4MCYB 5FYJL 3QWRA 1OAZL 2CSPA 4TRPL 4JM2F 5D2NA 3PGCA 3KXFD 2QR0A 5HPMA 5E4IA 3S98A 1JWUA 3RTQB 1OLLA 1DUYB 1I8KB 1MF2H 4XBPA 4XT1C 1NC4B 2JELL 1FNGB 1LK2A 2WBJC 2WBKA 1I1YA 3I9GH 4CU7A 1U2CA 3MRHB 4QTIH 1YN7A 4JGUA 4NZRL 1DN0A 5D4QA 4I2XB 4LEXH 3MUZ1 2XN9B 3WKML 3ZHDA 4HX1B 3PV6A 1A6UH 4YHYC 3AREC 4R96B 4Z7VE 1NH6A 3E6FB 1PYWA 2DLIA 2D0FA 2HJFA 3C6SB 4PRIE 4NFDA 1B0WA 1QNZL 1Q9WB 4PGEB 1OW0A 2C4FT 2PYFA 4R26H 3SGKA 3U9PH 1KB5A 2AXJA 4D8PA 1CF8L 4JDZA 4WV1C 2HKFH 4XMLH 1WCBA 4JRYD 4X4XA 5GGVH 3S34L 3F5WA 5A40E 3BIBX 3VXUA 5J1AA 1LNUA 3HLAA 1YECL 1QYGH 2VZ1A 1H5BB 3S8WA 5GZOC 3ZDXF 3D2UD 3K4ZA 3UPRB 4YIQA 4LPTA 2FGWL 1ND0B 4MXQC 4GQPH 4N1HB 5DA0B 5GHWH 1A4JB 3FMGH 3V5KB 1J0JA 4QHLB 4R90H 5H94A 4P2QE 3V4PL 1TZIB 4KRNA 5IB3B 2ARJA 4ODHL 2GY7B 3CC5B 1UH2A 1ZVSB 1GSMA 1QVOB 5GSRB 1EJ6A 3VXTB 2QSVA 4AJ0A 1BJMA 3U4EB 2VLLA 4YQXH 4LLWB 5DWUH 4I48A 4HWEH 4JKMA 4LKXB 4NZTL 5SV4A 2JIXD 3JBG7 3PL6A 4LCIH 4UTBH 3TBTB 3HRZA 1TETL 3LKSA 4PD4K 2Q1EA 4M4RA 2XT1B 3QUXB 1AGDB 3MXWL 4F7TB 3O3BA 2E7LA 1X5KA 5SWQB 2CK0H 1EIBA 2QSTA 5T1DL 1KCVH 4RDQG 3V79C 2E7BA 4Y5VA 1EO7A 1UYWL 3RU8L 5IUSA 2Y4SA 3AFLA 4L4VE 3AM8A 3NA9H 2G75A 5I0DA 3RY6A 3MMEB 1I1AA 3PWJA 3PWVA 4O4YL 3VFRB 5BRZA 4PJDA 4Z0BL 2WBJD 4D3CH 4HUVB 2VDOH 4LVNC 5EO9A 3LHPH 2D9CA 4DOHB 5CP3H 5DHVH 3QPXH 3SO3C 1DQDL 3WO4C 1S7TA 1PDKA 5L2JA 4WHYG 1K2DA 5KAQG 4JFED 4UIKH 2AI0L 2P8MA 3LQAH 1H8NA 2A6JA 4LSUL 1J1PL 1ZWIB 4NKIL 3TIEB 3ARED 3VRIA 3KPRE 3BGAA 4X98B 3D3VA 3G6DL 4LKCA 4XNMA 5EPMA 4HBQA 3B9DA 1T1YA 4TUJB 4XCNB 5F1NB 4CL7A 3V95A 3BEWA 3V6BR 3EOAB 3NPZB 1TTUA 1MJUH 2IAMA 2YEZA 2OTUB 2VXUH 1ORQB 2AXGB 4ZOCA 5ESVB 4C59B 2Y5TA 1R3KB 4LGRB 4DVRH 4JFPB 3DX7B 1W0WB 1FORL 4OD2B 3GO1L 4YHNB 5KS9F 2LTQC 1CLOH 3PWUA 4OFPA 3VXSA 4PGDB 3WUZA 3FQUA 3N1MC 3TNMB 1BD2A 2W9DH 5GZOD 4D9LL 2EKSB 3BDBA 1YEDB 2FECI 4MXQD 4JRXE 4TVPH 4DZBB 1NAMA 1NC2D 3O3EA 5AAMA 1A1MB 3GMNA 4HUWA 2HN7A 2ZOKB 5F96L 4YLQT 2AQ2A 3IFOA 4HZLB 2VDPH 2J8UE 4PRBB 5IB1A 3IU3A 4YDJA 3KJ6L 4JFYB 4D0BA 1FFOB 5D7LB 3OJDB 3OXRA 1JBJA 4TUOB 4TNWF 2GTZA 4WFHD 3UJJH 5MENB 4H8WC 1KF9B 2XZCH 4MSWB 5D7JA 1H3XA 1OP5K 4GJTB 4KY1H 4OCWL 8FABB 3EYSL 5EUOB 3EZJB 4GG6A 4UOW0 4L29A 4PG2A 2B4CH 4PJGB 1WFOA 3DTXA 3GSNL 1VB9A 1YQ2A 1AJ7H 4RFOL 3WIHL 5C0CE 1BFTA 3EYFB 4M7LL 4IIQA 4NPYA 1U3JA 1YY8A 2V9RA 1YMHB 1BVLA 3ZT6A 1KIRB 3T77A 1JF1B 2VL5B 4HIJB 1MWAA 5E8OA 1UKTA 1FFNB 3M17A 3BSZL 1QEWB 2QEJA 3DBXA 3NACH 1KJ2A 4WY7H 5TE6H 1JHTA 4H0GA 3W2DH 3W39A 1F4XL 3ZDYF 3FQNB 1CE1L 2EIZA 4Y4FB 3VFVB 2NY1B 5JA9A 2X7LA 2NXZC 3ZTJH 5FKAB 5L6YL 3TA3A 5F1SA 5E2UH 4TVSa 4UAOC 1Z0MA 4DJMA 3ALWA 4OCLC 2VDLH 3ARDC 5D2NB 5D1ZB 3PGCB 1BF8A 2VC2H 5HPMB 3JTSA 1JWUB 1ZT4A 2AJSL 5D6DC 5D71H 4XBPB 1A7NL 1LK2B 1P4IL 1I1YB 4BFIA 5LQBH 4U7KA 5DJXA 3H42L 1YN7B 3MRJA 1HEZA 2F8XC 2FIKA 5CJQL 1CCZA 1DN0B 4UINL 5IVXE 3VFTB 1T1WB 3AU1A 2MCG1 3QUYA 4LHJB 5D70H 1ZLSL 5KSBA 3CVHA 5GRWA 2KBGA 1WAAE 3W82A 5EZLA 1QP1A 1PYWB 3MRIA 2NQCA 1C5CH 2PYEA 3S36H 2BK8A 4YBLC 5FO8A 2PYFB 3GHEH 4MXVF 1KB5B 3I6GA 3VFPA 4D8PB 3CX5J 4JDZB 2CO6B 1AIFB 4P49A 1T5WA 4X4XB 5E5RB 3ABZA 3F5WB 3EKCA 4JAMA 4KUCD 5A1AA 1HZHH 3G9AB 4K9EL 5DQDH 3H0TA 5BMFH 2GSGA 3VXUB 1LNUB 3HLAB 4K3GA 1CIUA 2YA0A 1FGVH 4I3SL 4XNXH 5GPRA 5EU7C 4YIQB 4X6DE 4JHAH 1TTFA 1OAKL 5HYIA 5H94B 5B38G 3QISA 1EA9C 5HBBA 2FX8H 2ARJB 4X9IA 4EUPG 3R06A 3BQUC 5E2VH 1CR9H 1RIHL 5LGHH 4JQVA 2VLLB 5BCAA 3TFKC 3MLPA 4I48B 4X8XA 3W81A 2ENYA 5ID0A 1C5DA 2ZNXA 2R2EA 3PL6B 1A7QH 1JYVA 3HRZB 2Q86B 3VXOB 3LKSB 2MQ0A 3DHMA 5I8KL 1M7XA 3QQNA 1ZEAL 1W8OA 5I1HH 5J7CC 1EK3A 3OJ2C 1PVHA 2NXZD 1V7NL 3VWJC 2J8OA 2MPAL 4Y5VB 1I3RA 5IESL 2V5SA 5I1GL 1KYOJ 5C0BA 5D1XA 4KMQA 3PIQA 1Z5LA 4R7NA 1VEPA 1KXVC 3ARDD 2G75B 1ZLVH 1VDGA 2WP3O 2X1WL 3MO1A 1I1AB 3PWJB 2DLHA 1D9KA 1AR2A 3PWVB 3GSVA 4NNPL 3GJFA 1MCBA 5TPWH 4PJDB 1A5FL 1RU9H 3GB7A 3QCTL 5EO9B 3PWLA 5GIRA 5EOQL 4KTEL 1FL5A 2CKNA 4H20H 2IG2L 1EBAA 4NWUH 1OT2A 1FO0L 3FFCD 5GS0L 5CSZA 3V5DA 4O02H 2ZG3A 1S7TB 5FUCE 2AK4A 1XGRA 3D5OF 3KWWA 2F19L 3SE4C 5L2JB 1K2DB 1MCFA 5E5MA 5C07E 1CGSH 2P8MB 4PYGA 2A6JB 2EXWC 3MOQA 1WFNA 1IGYB 1WZMA 3VRIB 4XNMB 3D1MC 1CLYL 3D3VB 4LKCB 3OKYA 5EPMB 5IHLB 4YO0A 4JREC 5TF1H 3WXWL 4GKZA 3BEWB 3U30C 2MCPL 2NY7H 5C0JA 25C8H 1DQML 2IAMB 2YEZB 3FO2A 5IOPA 2Y5TB 1QD0A 3K1DA 5D72H 3JZ7A 3WJLC 2WWKT 3LMJL 4MNHA 3PP4H 1JTOA 4JRYE 3PWUB 3VXSB 3FQUB 5F9DC 1BD2B 3BESR 35C8H 4PJCF 4UIMA 1T2QL 5KANI 4UNVA 3TBVB 2JJVA 1PY9A 3SGJA 2EIDA 2VDKH 1NAMB 3O3EB 3J7HA 3G04A 2Z9TA 4HUWB 2G60L 3SDYH 2HN7B 4TSBL 4OIBA 4NRZA 3IFOB 4LL9A 2VAJA 2Y5EA 3BQUD 5ESAA 1S7SA 3KXFA 4NZUL 2ID5A 5JW3H 5IB1B 3IU3B 3TFKD 4XNZC 3OF6A 1MFCH 1S9WA 2D9QB 3P3YA 3IDXH 3DX6A 4D0BB 1YYLL 3OXRB 1JFQL 3ORJA 3OKLA 4GUPA 4JVWA 2GTZB 1RJZA 1N0XL 5D7JB 2WINA 1DLFL 2BJML 4H0HB 2DLFL 3VWJD 1CL7L 3DNKA 4GG6B 4L29B 1NMAL 4PJBE 2DIBA 5FA4A 4HWBL 1YJDC 5DC0A 3DTXB 3IGAB 2WIIA 1Y6KR 4NCDA 5IJKC 3AGVA 3RUGE 4P2RE 4ETYA 2J4WH 4IIQB 4UT9L 2B1HH 4HUNB 1YY8B 1ZSDA 1BVLB 2EEAA 5FF6A 1ZLWH 5D7SH 2ZKHL 3T77B 2F53E 1I1FA 5EZOL 5LBSH 1MWAB 5E8OB 1AFVH 4DGVL 1Z3GH 1XIWC 1ERNA 3AMLA 3M17B 1JI2A 3ES6A 3K2UL 2P24B 4NDMA 1R3HA 3DBXB 1JHTB 1U3HC 1G84A 2EXWD 3W39B 3V5HA 3NAAL 5BV7H 2EIZB 1KC5H 3VW3H 2X7LB 4PD4J 3FB8A 4JFEE 1JPSL 4XMPL 3TA3B 5CINH 3S7GA 2VLMD 2D31A 5KVFL 4P5TC 5I2IA 1LD9B 2I25N 5HI4C 4LIQL 3E3QE 3PWPD 4GW1A 4OF7A 3MLSL 1JGUL 1T21A 3JTSB 5CBAA 1ZT4B 1J12A 4XHQA 4N0CC 2JIXA 4OFDA 5MHSE 2F5BH 4BFIB 2DN7A 5DJXB 4KUZL 1MRFH 3MRJB 3N1PC 3N9GH 2FEDC 2FIKB 5CMAB 3VCLA 3AU1B 2ADIA 3QUYB 4ONOA 1HINL 5KSBB 3CVHB 3TT1H 2CDFA 3Q0HA 1S9VA 4FXKA 5EZLB 3DVNA 3MRIB 5SX4H 3O6FC 2AABH 3PQYD 2YSSB 3R8BB 2PYEB 3IDYB 4YAQA 2ADJA 2PR4L 5FO8B 1YUHA 4PJHF 5F71A 4ODVL 4PJIF 3I6GB 3VFPB 5C2BH 1TJGH 3LSOA 2WBJA 2C3WA 1TZHA 2BSRA 1T5WB 4WUKL 1HHJA 1DE4A 2OK0H 3K1KC 4JAMB 3RA7L 2AEQH 4XP9L 1G9MH 3CDFA 3H0TB 5HVHC 2VLRA 4LAQH 4RDQF 3UYRH 4W81A 5D2LA 4P2OA 4XCFL 3LKOA 3FJTA 4LK4A 4PJ8C 4PS4L 3KG5A 1OAXL 4OLXH 1FSKC 5EA0H 1G7LA 3MNWA 4XTRC 5ERWA 2FO4A 2R29H 4WHDA 3D87B 1E6OH 2VLJD 4CDGC 1O7SA 3QWQB 2SEBA 1G7PA 3R06B 1EJOH 2AEPL 4MQTB 4WV1A 2ZCKL 4FTVE 4HMEA 5JTWA 2R23A 2YUZA 1R3LA 2CRMA 4JCMA 1H8SA 1C5DB 4AG4H 1J9CT 3BWUC 1XIWD 5J89A 2R2EB 3MLUH 4JFZH 1FNAA 3INUL 3IS0X 3IETA 2HRPL 1U0QA 1WZLA 3TCXA 5EBGA 4CMHB 4DKDC 1IC7H 1U3HD 4RGNE 4LAJH 1CXEA 2GYSA 4OFKA 3RX8A 4NQCE 2RCSH 2ADFH 4YFLF 3C8KA 4YC2C 4DFIA 4GG8A 1HILA 1GIGH 1I3RB 4HV8A 3QR2A 1NC2A 5EC1A 1T66C 4P5TD 5C0BB 1QACA 1IGCL 3MUY1 3PIQB 1Z5LB 4R7NB 5HI4D 2E6QA 3H3BC 4GQ9H 4HS8L 4MA1C 1HSBA 4NYLA 4DQOH 3MO1B 3QEQE 5E6YA 4ZS6D 2ARWA 4DTGL 1D9KB 4N0CD 4BH8B 1FCCA 1PEWA 5IFHL 4ZO7A 3GSVB 3UDWC 3GJFB 4XWOC 1NMBL 3GB7B 3QDGD 3GSOA 4MQXC 5E6ZA 1KLFA 3PWLB 4EDWH 5GIRB 1EERB 3ZKNC 5CUSL 1A6AA 4LCWE 4E9LA 3MFFA 4FFYL 5CSZB 2FEDD 3V5DB 1HNFA 2AK4B 1QBML 1XGRB 1Z2KA 2ZUXA 2NNAA 2V5YA 3KWWB 2CLVA 3KPSD 2DD8L 3G6JE 4Q0XH 5E5MB 2B8OT 3O2WH 1EUTA 3G5VA 1IEBA 4TNVF 3L95A 4ACPA 1MIEL 5ADOH 1TZGL 4YO0B 3O6FD 3M8OH 3JV5A 3GMLA 4GKZB 1OTUC 15C8L 5C0JB 5ENWA 2X4PA 2P44B 2BHZA 2G2RA 4JQXC 4U1JA 3OZ9L 3FO2B 1JGEA 4NUGL 5IMKA 4E41D 5IOPB 1QFUL 3KPMB 3VXPB 1E4WL 3S88H 5F72S 2CRZA 4RWYH 3QAZC 3TYFA 4XP4H 3EYOA 5JR1H 1OWRM 1PG7X 1RZFL 4MNHB 5CGMA 5KN5A 3R0NA 3BUYA 1U8NA 3GBLA 4PJ8D 4I2XE 3U6RA 2YR3A 4UIMB 3MBXH 5JOEA 1P5UA 3FKUS 4FZEL 4X99A 4XTRD 5GGRA 5GRUH 3ZE0E 2PW2A 5DMIH 2HFGH 3ZKMC 4DKEH 2CUIA 5DVMA 5LGKA 3RWEA 3G04B 4F2MA 5GGUA 5J56B 2LAGB 1FLRL 3HAEG 4M7JH 2X4RA 1FZOA 4NRZB 1PLGL 4YXHL 3BMVA 1S7SB 4K8RH 5ESAB 1CYGA 3B8YA 4OQTH 2D3VA 2QTEA 5CILH 1KULA 1F4YL 4HUUA 1S9WB 5CBEA 2EDXA 2FJHA 2D03H 4HKBA 3DX6B 4KK9C 3HRPA 4ERSH 4ZYKA 1JNLH 2AS5M 4GUPB 3BXNA 1RJZB 1AGCA 3CFBA 2WINB 1CFVH 1G7JA 5DMKB 1P4BH 1C5BL 3EJYD 1IKFL 3SQOL 3NBNA 5FA4B 1FFPA 4HFWA 4CN4A 2VDMH 1F4WL 2WIIB 2QQQA 1JK8A 4NN7B 3JWOH 4DVBA 5I8CA 4LHUA 4YGVA 3FT4A 3P30L 5TQ2H 3K4DA 4JJHA 4G8GB 2BHUA 1NEZB 5FF6B 4MQXD 5E8NA 3WFDH 5IV2A 3ZKND 4XPAL 1ROWA 3NIGF 5KSAC 1XF1A 4TTGA 3P11L 3ES6B 3IAGC 2BY2A 2X1OA 1NLDH 1R3HB 3MOAH 3WCYA 1BFVL 4PB0L 4HXBH 5EZJA 3FFCE 3UTTD 3V5HB 3U4BH 5KVEH 1L0QA 4HWNA 3FB8B 4XCYA 3SDCA 2CIKA 1OTUD 2D31B 3MGAA 5I2IB 3GM0A 2A9ML 4JPIB 5ICZA 1BQHA 2UY6A 4GW1B 3KYAA 1T21B 3OKKB 2FCBA 5ILTL 4PLNC 4MJ6A 1PKQE 4MXWL 1L9NA 2JIXB 1JPGA 3WJJC 4M6OH 4U49A 4HUXA 1TXKA 4GLRH 4JGMA 1OARH 5TH2A 1QKZH 5IGXL 3L1OL 1SJEA 1TCRA 3HUJA 4UU9A 3CLFL 3VCLB 3VFOA 1IEAB 2ADIB 2QADC 1OAZH 3X14A 3WNKA 2X89A 5JW4R 3ZKMD 2E6PA 2DOCA 2CDFB 1S9VB 3DVNB 4HH9A 1YEKH 5AEAA 2JELH 3ARDA 4YAQB 4ZO6A 2ADJB 3MXVH 1RUAL 1YUHB 1W2KT 4IOIA 4TNWK 5D6DA 2EICA 2NY0B 3LSOB 2R2CA 2WBJB 3RZCD 4M48H 1TZHB 2XY2A 4KK9D 2BSRB 2L4OA 1SQ2N 4I18C 4FQXC 2DQHH 5IMMB 1HHJB 2YWZA 1NANI 1AXTL 1JHLH 5BW7A 1KN2L 3WKMH 3UBXA 5DD0L 1A6VL 2VLRB 3QEGL 5D2LB 4P2OB 1KJVA 3LKOB 1QNZH 5DD3L 1HKLH 1O5DT 4YHYB 4XP6H 5I16A 3RKDC 3V52L 1EPFA 3RVTC 4Z76A 1G7LB 3MNWB 5ERWB 4D0DA 2FO4B 2ZUTA 2FJGA 4I77L 4H1LA 2SEBB 2BMKA 2BY1A 3SO5A 1G7PB 3S34H 5D7IF 4HCRL 1UZ6F 2BFVH 2XI9A 5CKAA 1YECH 2R23B 2WLYA 3MZTA 4L1DA 4OT1H 3Q5OA 3K8KA 1GOHA 3VGDA 2HKHL 2HA1A 5KSAD 3IETB 2FGWH 5LKNA 3EO1A 4HC1L 5BJTA 1I75A 3WYRA 1FAIL 3IVKA 1QSFE 2NW3A 3C8KB 4JM2C 4GG8B 1HILB 1N3NA 4HV8B 4LF3A 3MRLA 1NC2B 4LEOA 5HHXH 3ARTA 3EFDL 5EC1B 1BMGA 4XNUL 4NZTH 3BQUA 1WVZA 1HSBB 4OFVA 4NYLB 2XQBL 3AROA 2VLME 1F8TL 4C83A 3A0OA 2F8VA 3TN0C 1SMAA 3V7AE 3W0WD 4ZFFA 1TLKA 4GKNB 4L8SC 3GSOB 5FO7A 4AENA 2RB8A 3BPNC 5B39A 5AYUL 3CFKA 3ALXA 4NN6B 3MFFB 1R5IA 5BXFA 1F97A 1PGRB 1UYWH 3ZL4L 4OI9A 2NNAB 5IBTL 4PJXF 3F6LA 3OG4B 2QADD 3H6JA 4PFEA 4HD9A 4Q9CA 2C26A 3G5VB 1IEBB 3EYUL 4QXUL 4O4YH 4FN0A 4Z0BH 3GMLB 1RZJH 3H8NA 1NCNA 5ENWB 2E27H 2X4PB 2Y7QA 2G2RB 1PSKH 4WFFD 2Z4QB 4ZNEE 5IMKB 1VSCA 4N8VG 4WHYH 3ULVE 2ED9A 4ORZC 5KTEL 4FQXD 4ZD3H 3SO3B 3TYFB 1MCDA 4NKIH 1TCMA 3EYOB 1GRWA 3WO4B 3G6DH 5KN5B 2HWZH 3SE4A 3CX2A 2P4AB 1RI8A 3BUYB 1U8NB 1I85C 1A4KA 5ITFA 3U6RB 2QQLL 4ELMF 1MI5B 1GAFH 3RKDD 3L5XH 2MQ3A 2WWKO 3RVTD 1IILE 1EEZA 4X99B 4TULH 5GGRB 2PW2B 2IBGA 3BPOB 4JO1H 2DI9A 3LKPA 4E0RA 3RWEB 4MQ7A 4WWKD 4F2MB 5GGUB 3O3AA 2HLFC 1JZ2A 2X4RB 1FZOB 1UM4L 5GISL 1BQLL 5HHOD 3PWPA 1FORH 3GO1H 4NKOA 2C1PA 4HUKB 5DTFB 1IAIM 1DQLL 1HHGA 1X4YA 4MA3A 5FUZH 5ISZD 1QHOA 3GSRA 3MLXL 4HUUB 5CBEB 2FJHB 3WJLA 4I8DA 4HKBB 4D9LH 3ECBA 3QUMA 4ZYKB 1SVZA 2BY0A 3BXNB 3CFBB 1AGCB 1G7JB 5GJSL 4KQ3L 2BXZA 3P9WB 4G8EA 3CFEA 4JM2D 1K6QL 4FFWC 4HG4K 5JHDD 5KVDH 2YA1A 2HFFA 4BQCA 1FFPB 4HFWB 1A64A 4JO3L 3DYOA 4AEHL 1JK8B 4OAWA 3PQYA 2N1KA 2NX5A 4DVBB 1ZXQA 2P8PA 5F7YC 5I8CB 1EMTL 4LHUB 1MNUL 4R4FL 2KDGA 4YGVB 3FT4B 4GRWH 3TN0D 1C1EL 1QBBA 2J5LC 4OZHF 3BT2L 4HS6A 5E8NB 4DK3A 5IV2B 3JWDH 4D9QD 1CDUA 2CH8A 3W11D 1DSFL 3QDGE 1AC0A 1NL0L 1UQSB 1K8DA 4RMSA 2CRYA 3EFFB 1WBYA 5EZJB 2YXMA 3WIHH 2VITA 3KPNA 4M7LH 4ODWA 4XCYB 2Q87A 3SDCB 3ARQA 2DQGL 5IJKA 2CIKB 4EIZC 2VLJA 1S9YA 2VNCA 1H3PH 2H2PC 5ICZB 1TPXC 2YN5A 1BQHB 3K8MA 1KGCD 3HG1D 1IC5L 4G3YH 3BSZH 4S1QH 1ZANL 3OJMB 1MHPL 3KYKL 5F6IC 1JPGB 3GRWL 4EQ2A 3GSQA 1CE1H 3B9KC 4HUXB 5CJXC 5ITBL 2OYPA 5L6YH 5TH2B 1U3HA 4H5SA 4ZSOE 4YFEA 1SJEB 1TCRB 3HUJB 3TVMA 4UU9B 3DSNA 1KIUA 3VFOB 5CEZD 2NXZB 3X14B 5DD1L 4Q9BA 2NY5H 4P5TA 1SYSA 4U2ZA 3FAWA 5DURD 4HH9B 1KLGA 2HLFD 4F9LC 4PB9L 5DVOA 3ARDB 4E41B 2JCCA 1BECA 4IOIB 4M7ZB 5F3HA 3H42H 1DBBL 3KS0J 5CJQH 4UINH 1R3IL 2BOBA 4CMMA 3GI8L 5EU6E 3RDTD 2FX9L 1ZLSH 3UBXB 2XXMB 3IDMA 5I8EA 1T7VA 4P3CH 3IAPA 1J11A 3KPSA 4P9HC 4FFWD 4PY8J 2FEEI 4QF1A 5I16B 3QRGL 4ZUSA 4NQVB 4MCZA 4Z76B 3O6FA 3VXME 4LQFL 4Z7WF 5DUMH 1MFBL 5BS0A 4C55A 4YBLB 2FJGB 1AO7E 4GAGL 3Q1SL 2WK2A 4H1LB 2BMKB 4NWTL 4PJFA 1H3TA 2XG4A 1KTLB 4E41A 1EHAA 1KNOA 2LU4A 5I8OH 4MVBD 2XTJD 3CD4A 3SOBL 4I3SH 3DXAE 4G6KL 1VCAA 2EDWA 1JWSB 5DHYA 2YXFA 3EO1B 3WO3B 1WUNT 1ZOXA 3TGXA 4BFBD 5BJTB 3BFOA 4EUPH 1MQ8A 1JWMA 1GL4B 1HDMA 2G9HA 4J3SA 5HJ3A 5I75C 4FQLL 1MCWW 3U0PA 2I9LA 3MV7D 4LF3B 3MRLB 3UTTE 1RIHH 4LEOB 1A0QL 2FJFA 4X7CC 2H2PD 2EEDA 6FABL 3BQUB 4A2MA 3CPLA 4C83B 2RQ8A 4P99A 3FN0L 2YD6A 5DC4B 1IAKA 1EO5A 4ZFFB 5I8KH 3BP7A 4JFQA 4NRYB 1ZEAH 5JO5A 1FC2D 4AENB 4G8IA 1MFDL 2BNUA 3B9KD 5I15H 4MQSB 1GZQA 2MPAH 1KCSH 3CFKB 3QDJA 4KK6C 1R5IB 5BXFB 5I1GH 4WI5A 3LPGA 4ONFL 3MV9A 3O11A 1YEJL 1T7ZA 5HVGB 2DBLL 1K3ZA 2Q7NA 3F7YA 1NDGA 1U41A 4NNPH 4Z7VF 1A5FH 3MRKA 4ZOBA 1OD7A 1IQWL 3QCTH 4HJJL 4HIXL 4LHQB 2IJ0C 4PRPE 2Y7QB 3FO0H 5I1AB 3WFZA 3UDWA 1FO0H 2QHRL 1S7WA 3BZEA 2FIRT 4DN4H 1FN4A 4DW2L 2B2XH 5D9SA 5C86A 1A3RL 5LAXA 1A9BA 4HIIA 2XZAH 1X5YA 2R2HA 3HA0A 3T3ME 1A4KB 1YDPA 2NXYC 4OGZA 3WXWH 5ITFB 4C4KT 5DZNA 1JNNL 1EEZB 1U58A 4JREB 4RMQA 3BKCL 3U30B 3LKPB 3U0WL 1CIDA 1EEYB 3DUHA 4WUUD 4E0RB 4MQ7B 2YWYA 2VRAA 2AJYL 3O3AB 4JQXA 1U2HA 1OTTC 2WZPD 4MJID 2EE2A 3PWPB 3GGWB 4XBGA 4F3FB 5HDQL 1Q1JL 4NKOB 3LMJH 2C1PB 1HHGB 4MA3B 3GSRB 3NFPA 2WM0A 5DHVA 1PJ9A 1T2QH 5B8CA 2DKUA 3ECBB 3QUMB 3K0WA 4FQIL 3VA2C 5T3ZD 4O9HL 1MCIA 3I6LD 5I1DA 5DGQA 5LG1A 3OHXA 1S7VA 1A3LL 2G60H 3SBWC 2ZZUT 4G8EB 3CFEB 4LRIC 4N8CL 4YK4C 1ORSA 2C4FU 3N06B 4OI7A 2HFFB 2H45A 2Q8BH 4OAWB 3PQYB 5EIIB 2NX5B 2P8PB 1YYLH 3HZYA 4M5YH 5BVJB 4PJ5B 1JFQH 4XNZB 4M93C 4LVEA 2P46B 2M8XA 5DXWA 3NMEA 4K07A 4QT5A 4HS6B 4EI6A 3WN5C 1CL7H 1K9TA 4JG1L 4TNVK 1GGTA 4KK6D 1IGML 5KVGL 4S0TD 2IPUK 1K8DB 4U3CA 1L6ZA 1WBYB 1T20A 2VITB 4S1SH 4APQC 2J6EL 3ARFC 3D0VA 4UT9H 5CCKL 4IOFC 4MA8H 4ODBD 4PBXA 4V1DD 3RWFA 4Q9RL 4PJ7E 2ZKHH 5CJ5A 2VLJB 1S9YB 4HIEA 5LWYH 4Y2OA 5EZOH 5C2UB 2VZ3A 3MUJA 5DJ2A 4ZFGL 3RVVD 4PJ9C 2CIIA 4DGVH 1MHCA 2XFXB 3IB4A 1UVQA 3K2UH 1I9IH 2DQJH 5EU4B 5TFSH 2BP3A 4HLJA 5KSAA 2KL6A 3GSQB 3FRPA 1B6UA 1G6RL 1LEGA 1IE5A 4FQ2L 1JPSH 1U3HB 4H5SB 5I30H 2NXYD 2H26B 1N6QH 4JY5L 2CR6A 2LVCA 5KVFH 3TVMB 4G5ZH 1F5WA 4JKPL 4LIQH 5HY9A 3MLSH 3V7MA 1T03H 4P5TB 1SYSB 4YPGA 1VFMA 1KLGB 1OTTD 1E4XL 4XPHH 3R1GL 1NCAL 3OKDA 2JCCB 1IM9D 2BVOA 5F3HB 3BD4A 3C08L 2J8UF 4Z7UE 1LEIB 3W0WA 2GT9A 3LH2L 4IDJH 5HHOE 1Z9MA 1S78C 3H3KA 1GGUA 1RMFL 1AD9A 5L88L 2BOBB 3C60A 4CMMB 4MMZC 1HINH 3KYMA 1LHZA 5C6TH 4NRXA 3IDMB 4OZ4A 4QGYA 1UGNA 3KPSB 1ODAA 5HYEA 2PR4H 3MV8E 4URTB 4JY4A 4QF1B 4ZUSB 4QY8A 1J8HD 1UWGL 4ODVH 4LVHC 3O6FB 2E9JA 3OAZH 3P0GB 5BS0B 2ERJC 3QCVL 3P4MA 3AXLA 4PJFB 4NCC2 5DQ9A 3RA7H 3HMWL 4WO4A 2PNDA 1QFWI 2YD1A 4XP9H 3GIZL 2R4SH 1JI1A 4Y19D 3TYGH 1YYML 4JM4L 3V6OE 4I18A 4FQXA 4OBSA 4X83A 4YDLC 2X9WA 5JW4Q 2HTLC 1X6LA 2VZUA 4PS4H 5HVHB 1G0DA 4JFHD 5HVWA 2FYYA 5DHYB 5FGCB 1ADQH 3AS0A 4APQD 5J11C 3BN9C 5BZWA 3ARFD 1HDMB 2G9HB 1FSKB 3MUHL 5HJ3B 4G9FD 4IOFD 5E00A 3U0PB 2I9LB 4OZGE 4MNGE 2ZCKH 4YBQC 3LVEA 4OZFG 2FJFB 5JHLL 4PJ9D 4X7SH 3F62A 1HH6A 1TMCB 3VDCA 4G8GE 4HG4J 2ZPKL 4HF5L 4QWWC 2HRPH 2VLKE 5ISZA 1IAKB 4JFQB 3T0EE 5JO5B 1G1YA 2QSQA 1G0YR 4G8IB 2BNUB 3DGCR 4XAWH 1SYVA 5DVLA 5TDPA 1YEFH 1GZQB 3MYZA 3QDJB 5GQBA 4M1CC 4OF0A 1IGCH 1LWRA 4YC2B 3MV9B 5IVXF 1OGAD 4HS8H 3O11B 2RJMA 4LARL 4JFFB 5JHDA 3KNBA 2A6IA 2AJ3A 5IFHH 1NDGB 1J87A 1WAAF 1SMOA 3MRKB 1EXUA 4YHPA 5FAAA 5T1KA 1T1ZA 3D48R 3LS5H 3OKOA 5E2JA 2AEWA 4FFYH 4L8SA 1S7WB 1S78D 4R2GC 3RBGA 3BZEB 4J3XA 1QBMH 1FN4B 2X4UB 4QRPE 5D9SB 5GGSA 4FABL 4YUEL 5LAXB 4WVRA 1A9BB 4GXVH 4HIIB 4XWGL 4BFGA 5IBUB 2BY3A 4G9DB 5HHVH 4MLSA 3S35H 1MIEH 3LRHA 2R2HB 4HLZG 5FYJD 4OJFH 1YDPB 5I74B 2D7MA 2IQAA 4RNRA 4HT1L 1U58B 3OZ9H 5DD5H 1ZHLA 4NUGH 1ULVA 1QFUH 4OM0L 3QQ4A 1E4WH 1YEHL 5CJOL 4O51A 4XBGB 2ITCA 3HG1A 4OIAA 2AW2A 4Q6YA 2X40A 2HTLD 3NFPB 3QAZB 5DHVB 3MLRL 5B8CB 4WFGD 4PUBL 3MPCA 2UUDH 2XTJE 1I85A 4Y16C 5I1DB 3OHXB 1B88A 3HAEH 2DQDH 3BN9D 4L4JA 3R4DA 4KJYA 3SKJL 1ORSB 2BNRD 4YBQD 2NY3D 3H9ZA 5B39G 2OP4L 3PJSA 4BSWA 3EJZC 1WT5C 2IQ9L 1QUNA 3LIZH 4QWWD 3HZYB 1REIA 1Q0XL 5C08A 4NQXA 1ZGLB 1IAIL 1ONQA 3X17A 4LASH 4EIGB 4QT5B 4EI6B 1SY6L 5E08H 1A3QA 4WIQA 4Z0XB 1IKFH 2XA8L 1KCUL 3TO2B 4AL8L 1FL3A 3VXQA 3CSYA 4M1CD 1F4WH 2V7HA 3E8UL 3OKNA 1GC1C 1W72L 3M07A 5CHNB 1T20B 1L0XA 1HXMA 3MLTA 5SX5H 3NIDE 4OLVL 3P30H 3D0VB 3AS2A 5IFAL 9CGTA 1JTPA 3RWFB 4HIEB 2E7HA 5DJ2B 4XPAH 3MYJA 4ALAL 5CD5C 2CIIB 5MI0C 1MHCB 3O4LE 4R2GD 1QFOA 4HXAH 1PZ5A 1UVQB 1EO8H 1CTNA 1LMKA 4HPYL 4AEEA 1F58L 4JKKA 2X05A 1BFVH 5KSAB 4WW2F 1A7PH 5DK0B 3IDJA 3SE3A 3MR9A 1RZKC 4WI7A 1LEGB 3V7AG 4NJAL 2DF3A 3O45A 4N0FA 1A7OH 1D5IL 2ARJQ 2D0GA 5IIEA 2J3SA 3EYQC 4AIZA 5IG7A 5HY9B 1T4KA 3CFCL 3MV7A 3H7BB 3BPLC 4YPGB 3PHQA 2ZOLA 2IFFH 1NAMH 5C09A 5KS9A 3CDCA 3OKDB 1X5IA 4L3EA 2BVOB 2VXVL 1JZ3A 3L3IA 1QOKA 5GGRY 3W0WB 2GT9B 3BZFA 4LLMA 3L1OH 2ESVE 2ZUVA 3C5ZC 3IDIA 4GS7B 3GKZA 4UB0L 1FE8L 4QRUA 5T3XH 1AD9B 4QOKD 3C60B 3ULVL 5DR5H 4KZEH 5H2BB 1OP3H 4Y16D 3KYMB 3GSUA 1F90H 4NRXB 2APFA 4NM4L 3UBXI 2NMSA 3QPQC 4OZ4B 1MI5E 3U1SL 4U1SA 2QADB 4NGHL 4JCLA 3I6LE 2CD0A 4WEBH 3O2DA 4JY4B 4QY8B 2W59A 3TJEL 1MCEA 4PJBF 3EJZD 1LDSA 1I1CA 2IPTL 4Z7OE 3P4MB 3REWA 5DQ9B 3RUGF 1AXTH 3QHZL 1KN2H 4WO4B 1YJDL 3FQRA 2W60A 5DD0H 1RAMA 1KUMA 4I18B 4RMRA 4FQXB 4YNYA 1CDBA 3UTZA 1GHFL 5DD3H 5KJRL 3G6AB 1Q94A 1B3JA 2FYYB 1Q9LA 4M5ZL 2CKBL 4NO5A 1I8MA 3HR6A 5JMRA 5CZVH 2VABA 4LSQH 2Y06L 4H26A 4NKDA 4YHOL 1XH3A 5M95B 1KJ2H 1RIVL 5BZWB 5D7KD 5J6HA 5E00B 3U82B 4CRPA 4RBPH 2DDQL 2R0LL 5F3BA 4WUUA 1F11A 2XWJA 3HI5L 5E9DA 5CD5D 1HH6B 2HKHH 2RR3A 4K9EC 5F9WB 5ISZB 1KT2A 1NCDL 4K7PX 1NFIA 5CLWA 4HC1H 3S9DB 2X44D 4L9DA 3MLYL 5HI3C 1SYVB 1IEHA 5TDPB 1MEXH 5T33H 4PGCA 4KZDL 3LN9A 5IHBA 3EFDH 3EYQD 2ZUQC 1KXTB 4LPCA 4XNUH 2F9BT 3KNBB 3QXDA 2A6IB 2AJ3B 3CVHH 3K81A 3VXNA 1TJHL 5HDBF 4ZG1A 4YHPB 1EXUB 5T1KB 2XOTA 3C9NA 1T1ZB 5E7BA 3L9RA 5F7NC 3OKOB 5AYUH 4J6RL 2L7JA 2BXYA 1X5XA 2DBJA 2OJZL 3C5ZD 1D5ZA 3WXVL 1VENA 5EOCJ 5IBTH 1RULL 3HC4L 3SDDC 4ZOAA 4RFNC 1FYTE 1MCQA 1MCHA 4HGKC 1BWWA 4FXLA 2YRZA 3O6LL 5JDSA 4PRHD 1KENL 3EYUH 3QPQD 5BOZG 2Y9RT 4Z18A 4KRMB 1T7XA 4JPWH 2IQAB 4RNRB 1VEMA 3MCKB 2H1PH 3BRFA 4X7TA 3VGHA 1KCKA 4XXDA 2Z91A 4UOJA 3PABA 4V1DA 3HNVL 2DWEA 4HK0A 1AI1H 3QQ4B 5KTEH 4TSCL 2ICES 3HMXL 2VB5A 4OD3H 4JJ5B 3S3PA 4O51B 2ITCB 3Q5TA 2ATPB 2W91A 5GS0C 3HG1B 1CQKA 3PUCA 3HPLA 4MJ2A 4ZTPH 2QQLH 1DANT 4F8TA 3I02A 1PG7W 5FHAH 3NCEB 5J4MA 3OB8A 4X4MA 2ZUSA 3IRZA 3MRPA 1XGTA 2AJXH 4JFHE 5C1MB 5GISH 5FHBL 2LU3A 3UTOA 3W5MA 4P23C 3STBA 2JK5A 5IJVA 1DLHA 3PJSB 3QHTC 4K3JL 1J0IA 4BSWB 4G9FE 4XNYH 3BYYA 3ZSSA 1IM9A 4RGMB 3NZHL 1Y0LA 3PGFL 5C08B 1KELH 4I0CC 4NQXB 2CK2A 1LDPL 1ONQB 2CUHA 4OCRL 4L8CA 3SJVD 3DWTA 5FYKU 3TNNB 4LU5L 3GJFH 5GJSH 5HI3D 4KQ3H 1S8DA 4CKVX 4MZ2A 1K6QH 1IAMA 1F3DH 1FL3B 3VXQB 3CSYB 1M6OA 4KJWD 2Z31A 3QIUC 1MJ8H 2V7HB 1D6EB 3OKNB 4JZNA 2XZZA 3VFNA 1HXMB 3L6FA 1NBVL 1J1OH 1J8HA 3MLTB 1S9KC 1P4LB 2VZTA 5J06A 1C1EH 3RIFF 3BT2H 1OGAE 2NLJA 1N5AA 4DUVA 1FZMA 5C9JA 1FG2A 1WISA 3MYJB 3Q6FA 4BSVA 1AC6A 3MBEB 4Y19A 3BP5A 3KJ4B 1FGNH 1PZ5B 5T5FL 3SDDD 1XMWA 1OAYL 3NABL 4LPYA 4KVCH 1URLA 3Q6GL 3IDJB 3MR9B 4KKBC 4ODXA 4W4OA 3W9EA 1FNSH 3O45B 2X1PA 4N0FB 2Q6WA 5C0FB 4A6YA 3BVNA 5IIEB 3FT3A 4D9RD 4DKAA 3F7VA 3ARFA 5TE4L 1NGQL 3TO4A 5IG7B 5GS2H 3IJSA 2A6KA 1OTSC 3MV7B 2VKXA 3L3DA 3BZ4B 4DWHA 5I71C 3BI9X 2VXQL 2DJSA 4QRRD 5E5UB 3PHQB 2ZOLB 1AY1L 1ZANH 1ZTXL 1DJSA 3KYKH 4F9PA 5C09B 2E8ZA 5KS9B 5GS0D 3GRWH 3HTLX 1R3JA 4L5FL 2DQTH 4L3EB 1AGFA 1QRNA 3L3IB 4RSVA 4Y1AD 5F6IB 3BZFB 4LLMB 4PJCA 3IDIB 3CNKA 2BVYA 4QRUB 4QXGH 5JW5B 1QTYT 5DD1H 4TN9A 1WEJH 3DETC 3GSUB 4FS0A 4UI2A 3PE9A 3TPUA 4WFGE 5BV7B 1BM3L 3GSWA 3NCJH 1OQOA 3GMOA 4PB9H 4U1SB 3V4VL 4PY7A 4P23D 1MQKL 1JNJA 1LEKA 2Y36H 3ESUF 3O6KL 1TQBB 4F7MA 3H9SA 4PLKC 1DBBH 2P8LB 1G9NL 2BNRE 1R3IH 4YDKL 5L7XL 1AH1A 3REWB 1E6JL 4CAGA 4PGZA 4XAKE 3G08A 4XH2A 3FQRB 4U0QB 1MAJA 4YNYB 2EDJA 4N1EA 4OCYL 3UTZB 5JORA 1GGBL 1T5XA 1Q94B 4LSRL 4GBXC 1Z9LA 1Q9LB 4Y4KC 3EO9H 4NO5B 1SEBB 4HQQL 1I8MB 2QJDA 3UROR 1WFUA 2GAZA 2VABB 3BWAA 4H26B 4NKDB 1XH3B 4GAGH 3Q1SH 5IBLC 1PY4A 4LSVL 4XVJH 5TE7L 3WS6C 5J6HB 1JZ5A 3K3QA 3ZHKA 4JDTL 1F02I 4WUUB 1MCRA 4R0LC 2NYYC 1F11B 5FCUL 3BD5A 5E9DB 3NCYP 4PJ5E 3SOBH 3RVUC 3GFUA 5GS1A 4H0IA 5IROA 4CVZA 1FIGL 3VMNA 3WNPA 4QHMA 1KT2B 1NFIB 4YPJA 4NC1C 1DCLA 1EGJA 3D18A 3DOSA 32C2A 4KKBD 1AR1C 4Z8FH 4M6NL 3P0VL 4PGCB 5I1CH 2VKWA 5JIKA 1AD0A 1I3GH 3NFSH 5I75B 1FJ1A 4KVNL 4EZMA 3BAEL 1OTSD 12E8L 4GH7B 3RFZC 4DUWA 3RY5A 4X80H 3QXDB 1LE9A 4JRWA 3RWCA 3VXNB 5M94B 1G7QA 3KLAB 2EYRA 3L9RB 4QXTA 1MFDH 3BDYH 3MGTA 4FQQA 4Y7MA 4XC3L 1KIQA 2GTWA 4YDIL 4P4KC 1D5ZB 4HFUL 2K1MA 1VA9A 4ONFH 2IANE 1YEJH 3DETD 3B5HA 5JDSB 2DBLH 3PP3K 2H9GA 2J2ZA 1FRGL 4QOKE 1JPFA 5C0AE 1U8PA 5JXEC 1IM3A 1NAKL 4HJJH 4HIXH 4X5WA 2W1NA 4PJHA 3QEHA 4LP5A 3QZWG 4PJIA 4X7TB 4ETQA 4XXDB 2Z91B 4LLVA 4PLKD 3BIAX 3PABB 4V1DB 2QHRH 4RZCA 2DWEB 4HK0B 4PJEB 2W0FA 4TTDC 3JV0A 4O5LL 3I85A 4OGAC 4QHKJ 4LDOB 1DBAH 5HHME 1NCCL 5CGYC 1DP0A 1UACL 1FPTH 4G7YH 4GBXD 3QFJB 1XR9A 3S96A 3ZKXB 4Y4KD 5I19L 3I02B 3BKCH 3VE0A 5GGTL 1JNHA 2VXSH 4Q9QH 3MRPB 2VUYA 1XGTB 3MOBH 4PREA 1JN6A 4FG6C 1T0PB 1X5AA 3CLEL 5EUOF 5DT1L 4QLRA 5HDQH 2A6DA 1RUML 1Q1JH 2V9QA 2JK5B 1OM3H 3GMPA 2NYYD 1DLHB 5HHQA 4R9HA 1DBKH 1DQQA 5ANME 5D7KE 1INDL 2DMKA 2DQEL 3RVUD 1IM9B 3U36A 1MRDL 1OAUH 3QBTB 4I3GA 4RRPG 1Y0LB 2PXYC 2EDHA 4O9HH 2GJ6B 3RBSA 4GMTH 2GK0A 1AR1D 2FWOA 4J3OC 1KJ3L 4GMSL 1S8DB 2BNQB 4O58L 1FFRA 4RMWA 4JO4L 4N8CH 4MHHI 1YMMD 4Z95L 2H2SC 4TPRL 4F7EA 3WHXA 1M6OB 2YZ1A 3AUVA 2Z31B 5GGVY 4YK4B 1VGKA 3VFNB 5E2WH 3LAFA 3PDOA 1J8HB 1CU4L 1JYWA 1JGVL 1RJLA 3ZLQC 5I1KH 1WT5A 2OR7A 1QQDA 2NLJB 2YKLH 1D6VL 1FZMB 3U48A 5C9JB 1FG2B 4RX4D 5LXGH 4Y0GA 4M93B 3Q6FB 5IT2L 4BSVB 2VWEE 3BP5B 4P4KD 4Y19B 5KVGH 1LO0L 2Y72A 1ZK9A 2FLBT 2QKIA 5F97E 3ULVF 4NN5C 5IMOA 5DEZA 3H3PL 3O3UN 2PCPA 4JHBA 4ODXB 2OXHA 4YEEA 3W9EB 3Q2CA 1A1OA 1WWCA 1SBBA 5ACLA 5JXED 2Q6WB 3U79A 1GCFA 4J3TA 1I9JH 4A6YB 3BVNB 2P5EA 3FT3B 4QTHA 1QLEL 3F7VB 3ARFB 3LEYH 4JFFE 5D5ME 3TO4B 4ZFGH 2A6KB 3L3DB 2YPLD 4TTDD 2XNAA 3OB0H 3LD8C 4OGAD 3P9MA 1BFOA 2Y6SD 1MHHA 1R3JB 4XP1H 3X3GL 1AGFB 1QRNB 5CGYD 4U6YA 1F2QA 4FQ2H 4AEFA 5TQ0L 4XI5D 1QSZA 3HC3L 4PJCB 4ODTH 4JY5H 1I7ZA 1AXSA 5EH1A 4UT6H 2V2TA 4S0SD 5DUBA 2CDGA 3GSNA 4JZJA 3WIHA 5DK3A 1CBVL 3TPUB 4XCCL 3K46A 2OBGA 4FG6D 3GMOB 1E4XH 3CDGB 4PY7B 3R1GH 2NTFA 1LEKB 1VFAA 2VMFA 2UZXB 3C08H 1XF3A 4YHML 2ZCLH 4F7MB 3H9SB 5HYQB 3LH2H 4C56A 1XGQA 1UH3A 1QSED 1RMFH 5L88H 2BDNL 2PXYD 4TQEH 3G08B 4XH2B 4WWID 4OGXL 1MFEL 1A9EA 4KH2A 4GRLD 4S1DC 3V0WL 1C16A 5JORB 2HFEA 1T5XB 3NGBC 3ARUA 4Z7QE 3SJVE 2H2SD 4PRHA 1ES0A 4H8WH 1CD9B 3VXRA 2GI7A 3LZFL 2GAZB 3MA9L 4KKAC 4PRID 1QRKA 5DJDA 1P9MA 4LVHB 1CGXA 4NQEA 3GIZH 3PG2A 2ERJB 4P5KB 1YYMH 3L5WA 4OLUH 4U3XA 3DURA 3FB6A 3NTCH 4ZXBB 5BOPA 2D7TL 3KPPA 5KG9A 1UJ3C 5GS1B 1LP9E 4CVZB 1KN4H 1X4ZA 4MB4A 2VL4A 4QHMB 2P45B 1HKFA 3D18B 32C2B 5DA4A 3SKUD 3TV3L 1A47A 4JHWL 2YUXA 4OZFH 4W70A 1N5YL 1B0GA 1AD0B 5J11B 5J12B 1YNLL 4HPOL 5FM5O 5JHLH 1FJ1B 1FV1A 5FDYA 2VH5L 4KRPB 4P2QD 2FATL 1RUQL 4XXCC 2O5ZH 3C09C 1QG3A 2ZPKH 3I3DA 4HF5H 1LE9B 4D9RE 3RWCB 1R0AL 3QHFL 1G7QB 4OB5H 5C0NC 3EBAA 2EYRB 1CGTA 2IPKA 4QXTB 3MGTB 4R3SA 3O2DL 2GTWB 3NOIA 3L3OB 1H3GA 4U3HA 1FAKT 3S36X 4MYWB 2OJEA 3SDAC 2X4NA 3JXAA 4LVOB 4YXLL 1Z0NA 1MCCA 4Y1AE 1HK6A 4NZJA 4M9OA 3MV11 5B38A 2H9GB 5EC2A 4K71C 1M7IA 4EUPA 1JPFB 5HD8C 1T89C 1MRCH 1U8PB 2X1QA 1IM3B 3VG9B 4X5WB 4BZ2L 1KFAH 4PJHB 3QEHB 4R8WH 4PJIB 4ETQB 3ZKQD 1CICA 4LLVB 5F93C 1PG7H 4RZCB 4BQ8A 4JPKL 3UC0L 4XVUC 4P9HL 4POZC 2V7NA 4FABH 3VRJB 4EJ1C 4F58L 4XWGH 3FCTA 1PX3A 3LN4A 3WDJA 8CGTA 4I3RL 2X10A 4S1DD 3SDDA 4IRZL 2O26U 4M1GH 2A74A 3AS3A 3VD5A 3MJ9L 3GJEA 1KIPA 1XR9B 3S96B 4CGTA 3MRQA 3KPRD 1I4FA 3VE0B 1JNHB 5DMGC 3B2UC 3D69A 5BO1H 4PREB 1JN6B 1YEHH 5D7IA 5CJOH 1UWXK 3GBML 2A6DB 2VDRL 3ARZA 5IB4A 2COQA 3GMPB 1ZA6A 1OB1A 5DQJA 5HHQB 1R5WA 4S1RL 2F54E 1NBZA 3CVIL 5F6HI 1FO0A 3AB0C 4FZ8L 1B0RA 4PR5A 5SWSE 5AZ2H 3U36B 4PUBH 5F7DA 1TENA 2O93L 1IBGL 4XBEH 2X4TA 3FO1A 3I6KA 1P6AB 3WL9A 1YEGL 3ARWA 3KPLA 4J12A 3O2VH 4JFXB 1P7KA 3FZUD 3HE6C 2FWOB 5E70A 1J1XL 1Y6NR 2VQ1A 4NKQB 4XC1H 3SKJH 4ELME 4JRXD 5FYLD 2Y25A 3WHXB 4ZFOA 5EORH 2IQ9H 1VGKB 2FDBP 4P23A 3PDOB 4N8PA 1U8HA 3F7RA 3QT2A 4OD1L 2MWCA 5LCVL 5C0ND 1QQDB 1W0VA 3TCLA 3FHQA 2EYSA 3T4AA 1XCQB 3JWNC 1F4HA 2XA8H 1FZKA 1RVFL 5GRVL 3GNML 1NLBL 3SDAD 4PJXA 1P69B 2QKIB 4PV9A 3T65A 3CZFA 1W72H 5IMOB 4LCUA 2LV4A 2PCPB 4EVNA 4OLVH 1TVHA 5HD8D 3QIUA 3B43A 1QBLL 3BEVA 5IFAH 5J8OA 3TZVC 3UTPD 4B50A 2P5EB 2ORBH 4Q6IC 2EYTA 2A0LC 4QTHB 2OR9H 2WP3T 5C0CD 2OL3L 2HH0H 3WFEL 2JB6A 1JPTH 4K7FB 1QR1A 1A22B 2XNAB 4FHBD 4OLEA 4POZD 1G0XA 1BFOB 1MHHB 5MI0B 4CN6A 4U6YB 4N9GA 4M7LT 4NJAH 4LSPL 1FG9C 4MAUH 1D5IH 1I7ZB 1AXSB 3KR3L 1RFDL 2V2TB 4HWBA 5DUBB 2CDGB 4KKCC 3GSNB 3SDXA 2DQIL 3CFCH 2F74A 4JZJB 1NKRA 3KYNA 3QUMH 5MEOA 3HZMA 4NC0B 5DMGD 3B2UD 5ID1A 1N0LA 2OSLA 1BEYH 3IXTA 4MDJA 2VSCA 3OAYK 3BYTA 1N7ML 2NTFB 3CK0L 1DN2A 3BPLB 2DWDA 2Q76B 3CX5K 4EI5C 3HNTL 3T0XA 4XVSH 4HH8A 4C56B 1XGQB 5ELIA 3WSQH 4UB0H 1JYNA 2VO5A 3DSFL 3VWKC 2FGZA 2ZSVA 5LGJA 1D3CA 1A9EB 2FH8A 4NM4H 4BKLA 3HE6D 2AXHA 2KQMA 1YQVL 1JZ6A 3QUKA 5FUCC 3QQ3B 2HFEB 4NC1E 1U9KA 4M8QB 4PRHB 1ES0B 4ZS7H 5DMJB 2YUWA 4JVPA 3IFNL 3RIFK 5DVNA 3VXRB 3GUTA 4OSUL 1OP5H 1MAML 2PO6C 2WQRA 4QKXB 4EN3A 4LLAA 2IPTH 1J5OL 5DJDB 1FVDA 4KDVA 4PRNA 1BBJA 3QHZH 4NQEB 4OZHA 5SX4I 1YJDH 2WUBH 4UT7L 1NCUA 3L5WB 3T0BA 5AZEH 3Q3GA 2GW5A 4JFDA 2CPCA 2W0PA 1JP5A 3DURB 4K7PL 4PJ7F 5GJTL 1BJ1J 3KPPB 5KG9B 5KJRH 1OL0A 5L8LB 4W4NA 5CP7B 4HKXA 2ZSWA 4M6AA 4GBXA 1RIVH 4MAYD 2CJUH 4MNQE 2LABA 1JZ8A 2DDQH 3TZVD 4WCYH 2F5AL 5FB8A 1B0GB 3I84A 2A0LD 1VPOL 1RSFA 3HI5H 1FV1B 3WS6A 3CU1A 1I3UA 4U1LA 4R0LA 2HFTA 3A67H 5I1IL 3OBAA 4H25A 4FQHA 2YPLE 2IPKB 2I60H 4Y8DC 4R3SB 5B21A 4NQUA 5J1TC 4Y89A 2IF7A 4ONHA 5B3JE 2OJEB 4Z7UF 5IP4A 2A2QT 4I13B 4KV5E 4KKCD 1NMCB 4Y5XC 4ZOEA 1YMMA 5B38B 1P84K 5EC2B 1M7IB 4EUPB 1ZS8A 1JF5A 2FO1A 2ZUQB 1A6PA 3L7EA 1YNKL 1TJHH 2DAVA 1DVFA 2KUTA 4WDIA 4N0YL 3T3PE 4EI5D 3FN3A 1CICB 3SCMC 1MELA 4J6RH 4WTXA 4ZFZA 3D25A 5C7XH 4GO6B 3VWKD 4RX4A 1DQJA 1RULH 3HC4H 5IHUL 1EVUA 1IAOA 4HDIA 5GRXG 3O6LH 4P4KA 3B6SA 2MQCA 3LN4B 1KENH 1QSEE 1DUZA 2IADA 3SDDB 5F8RC 3HNSL 5FEBA 1VEOA 2X41A 2M1KA 2J88L 1I7TA 2A74B 5C07D 5SWZA 3GJEB 1KIPB 3C2AL 3SN6N 2F8OA 3MRQB 4Z7WA 1I4FB 3OGOE 4XB8A 5EIQA 1CXFA 1NPUA 2PO6D 3HNVH 4BQ6A 4N0UA 4NHCH 4IRJC 2Y1VA 3D69B 5L0QB 1FNHA 3ULUF 4TSCH 1T83C 3HMXH 1EGJL 2P5WB 5D7IB 3R0MA 2XV6B 2A1WL 1P5VA 4JG0H 5DK2A 4NCC1 3LV3A 5IB4B 3E3QC 1ZA6B 1OB1B 4OZGF 5DQJB 1DFBL 1R5WB 1NBZB 2F58L 1FO0B 4L1HA 1B0RB 5MEPA 4PR5B 4UDTA 3VD9A 5F7DB 4HGMA 2X4TB 1KJMA 3FO1B 2BVUA 3I6KB 4RMTA 5HYJA 1UB6B 3WL9B 3KPLB 1P7KB 5JOPD 4X9BA 3B9EA 5D96B 4EOWH 3SKMA 4YHZL 5FIEA 1EHLL 2VQ1B 1RD6A 3WIFA 4AEIH 2QLVB 4K3JH 3D9AL 2EH8L 4X6CE 4ZO8A 4KHXH 4P23B 1JL8A 1U8HB 2IEPA 3PGFH 4NUJA 1FHGA 3WFBL 1LDPH 2DRUA 2GY5A 3UZVB 4OCRH 4C58B 2I5YL 1CE6A 3ZYIA 4LU5H 3RL2A 1W0VB 5IMLA 3TCLB 2EYSB 3T4AB 2PXYA 1QA9A 4HEPG 1FZKB 2V17H 3J8F7 1ZHKA 4PJXB 2X4SB 4OLZL 3TC9A 4PV9B 3BGFB 2IC2A 3CZFB 4LCUB 3HAEA 3GHBL 1NBVH 3VG0L 4EVNB 1TVHB 3QIUB 1BVKA 2YD7A 3WHE0 3BEVB 4Z7VA 4KJQC 4AZ8A 1VFBA 1Q72L 2IGFL 4PRIA 4ZUVA 4Y2DA 1A8JH 2EYTB 5DYOA 1OCWH 2Q8AH 4P2RD 3SCMD 2QL1A 1L7TL 2JB6B 5L2KB 3HZVA 1QR1B 2KZWA 5E8EA 3A6CH 5T5FH 1XGUA 4M03A 2WAHA 4C54A 2F53D 4MB5A 4OLWH 1TQCB 1RZ7L 4FNLH 5E99H 1NFKA 3MACL 4N9GB 1ZHBA 4DK6A 1PKOA 3FQWA 3MCG1 4HGWA 4PV8A 2BVPA 3GK8H 3UEZA 2DS4A 1N4XH 1K8IA 3MLWL 3EOYG 4RGNC 1HSAA 1ACYH 4M4PA 4UTAL 1NGQH 1MIML 4AQ1B 2HT3C 1J8KA 3MODL 3SDXB 1EFXA 4OFIA 2F74B 5E7FA 3KYNB 5MEOB 4PP2A 1L7IL 3HZMB 1WZKA 4IRJD 2VXQH 4Q2ZA 1MCKA 5ID1B 2OSLB 3IXTB 4MDJB 2BOCA 3DJ9A 1MPAL 1AY1H 3IU4H 2Z8RA 1ZTXH 4P5MA 2BX5A 1Q0YL 2C4XA 4P2QA 4KMTH 4L5FH 1SBSH 2NY4B 2DWDB 3V6FA 3BKYL 4I9WE 1ITBB 4R97C 2NY2B 5F7HA 4PJEE 3S5LA 1JPST 3UJTL 3D85D 1WICA 5MHSD 4LMQI 2Q3ZA 2ZSVB 1V3MA 5LGJB 3EOTH 2DKMA 5CIPA 1LO3H 4X5XA 3QH3A 4BKLB 4AY0A 1BM3H 1P7QA 3V4VH 3QFJE 4Y88A 4NO2A 4GLRI 4R4BA 1MQKH 4QGTA 2AJVL 3O6KH 3IS1X 4B5EA 1IT9L 1KCRH 2ATKA 3GUTB 5DJAA 3L5HA 1BLNA 4K94L 3RJQB 5C6PB 4EN3B 1I8IA 4L4VA 4KI5C 3VI3E 5FYLE 1R5VA 5AAWA 3DPBA 4PRNB 1E6JH 1BBJB 3BH9A 3HB3C 5J57B 2ZG1A 3NIDF 1RJYA 2FX7H 1JGLH 1GC1L 1JMZA 2IFGA 3Q3GB 4JFDB 2IPUG 3ROLA 4OCYH 1E28A 1GGBH 3UTSD 2GJ6E 2VQUA 1NGZA 4YWGL 4HKXB 3F7PC 3SGDH 2ZSWB 5EOCL 4QHNA 4G6FB 1TVDA 2BNQE 4GBXB 1YPZE 2OI9B 2PETA 2YK1H 4QTIL 3KPRA 5AD0A 1RUKH 3WUWA 1HHHA 4KJQD 3DV4A 5FB8B 5C0EA 3VH8G 4JLRA 5D1QC 4LEXL 3GEWB 4Y4HC 1RZKL 1J18A 3UTPE 4U1LB 3SKNA 4NO3A 4R0LB 1UH4A 1FIGH 4FTVD 1ETZA 4H25B 5I0ZA 4FQHB 3JV4A 5GRZA 1IGFL 1HN1A 2Q7YB 1U93A 3N1GC 3P0VH 4ONHB 3ISWA 2HKFL 5A16A 5K9OA 1VACA 3T2NL 4RGND 2MMXA 1KTDA 4RIRA 2HT3D 4NQCD 3UPAA 1H5BC 5KBNC 1ZLUK 1YMMB 2B0SL 1PAMA 4DCQA 4JRXA 3D6GA 1ZS8B 2CMRL 2IBBA 3L7EB 1S7UA 1DVFB 4HCRA 4XXCA 3THMH 5J3HD 3O6MH 1I9EA 3IDNB 2J8UA 3UZQA 5HGDB 4LLYA 1FH5L 5GHWL 4YDIH 3QEQD 1FDLL 3D25B 1XF4A 1DQJB 1IAOB 5B22A 2QR0B 4HDIB 3LS4H 4Z7OF 5A2IH 3EIFA 1ITCA 4B41A 4HC1A 3B6SB 4P4KB 4Q7DA 5FO9A 4YQXL 1DUZB 3SDAA 4LCWD 2IADB 2NR6C 3QDME 3QUXC 5KZCD 1XAUA 4HWEL 1AKJD 4LCIL 1I7TB 1CFTA 1A14H 3KPOA 4UTBL 2R0ZL 4HS3A 5SWZB 1CTOA 2DYPD 2R56H 4Z7WB 2Y07H 4FFZL 4S11A 5FOJA 4N0UB 2CK0L 4XPTL 2C3HA 4KI5D 4O5LH 1SVCP 2XZQL 1KCVL 5T5NG 5C0CA 3BOVA 3PV6B 1MVUA 3HB3D 4BELD 3HN3A 5DK2B 2HJFB 4OKDA 3LV3B 4LDEB 3RTQD 4P48A 1MCOH 3CH1A 2QQKL 1NC4D 3NA9L 3OAUL 3CXDL 2CXGA 5MEPB 4UDTB 3BW9A 5E1AA 5F70A 4YX2H 5F1KC 1KJMB 5HYJB 1INEL 1JE6A 1WCBB 2YC1A 2VDOL 5DRNA 3OR7A 3SKMB 5JQ6H 3A6OA 5DT1H 1EAPA 1IMHC 5J1AB 3EDJA 5FUOH 1RUMH 3WIFB 5D1QD 5K9JL 4G8FA 4BYHA 1M4KA 4Y4HD 1INDH 4LCYA 5K9QG 2DQEH 2YD2A 4N8VA 1UADC 3MV01 3FB5A 3JVGC 4NUJB 1KXQE 2X42A 1CE6B 1U8IA 1CS6A 4CVXA 3RL2B 5IMLB 1U8MA 4JGJA 2PXYB 1QA9B 3LEXA 1KJ3H 1T04A 4GMSH 3FTGA 4O58H 4KHTH 4JO4H 1RK1A 5E8PA 1T1XA 1ZHKB 1TIUA 3U7AA 4KDTA 3HE6A 4DVRL 1IGTA 1YA5A 2AJUH 3LY6A 5IVXA 4UNTA 5C92A 3HAEB 5ADPL 3O3BB 1CLOL 2HJLA 2APWA 1CU4H 1JGVH 1WAAA 4JFOA 4CJ1A 1NCBH 4Z7VB 3MA7A 1VFBB 4YHLL 4ZUVB 4Y2DB 3HUJF 5DYOB 3VD4A 3L3KA 4XVTH 5I6XB 4OCXH 1S3KL 3HZVB 2AERT 3VFSA 5E8EB 1XGUB 3KS0H 5DVKA 1MY5A 1N64H 4KK8C 3QEUA 2MSPA 1IFHH 3QXAA 1JRHL 4K2UL 1UZ8A 4E42A 2NR6D 3QUXD 5BRZB 5IF0A 3FQWB 4HGWB 5AWNH 2BVPB 1K8IB 4I0KA 1HSAB 4IMKA 1KPVA 3UPCA 1DTUA 2OTPA 2O61A 3UJJL 1EFXB 4KXZI 2XZCL 1QFHA 4PP2B 4X6DA 3TZVA 4PPTA 4Q2ZB 4Q6IA 4KY1L 3I50L 4M8VA 3RWGA 4P5MB 3EDDA 5C3TA 4P2QB 5CEZH 2B4CL 3CCHA 4NC2B 1T1YB 3V6FB 2JB5L 1P84J 1OSPH 3MRGA 3IKKA 5TQ0H 3S5LB 4ZFOL 3HC3H 1AJ7L 4OKVA 1MLCA 3C87A 2DMCA 5IB5A 3CSGA 2ZUWA 1CBVH 3AMKA 2VDNH 3QH3B 4X5XB 1P7QB 2YHGA 3I2CH 4NO2B 4KK5C 4X6BA 1KEMH 4R4BB 4ZUUA 5JOPE 4J7RA 2NY1C 1TJIH 1BWMA 2ATKB 5DJAB 3DYPA 1Z9SA 3VJ6A 3FQXA 3H9HA 4L3CA 1I8IB 1RUPH 4I5BA 4L4VB 1RHFA 1R5VB 1G7IA 4EBQH 3IFLH 5F7KC 3BH9B 3GMNB 2R0KH 5D1ZC 1UM5L 1MAKA 3GRWA 2VOTA 4L4TE 4OGXH 1MFEH 1U91A 4QCIA 3VWKA 3ROLB 3V0WH 1T80A 4U1MA 3ULVC 1OY3B 1E28B 1BGXL 3TBSA 4F80A 2FHFA 4YDJB 1DANU 2DM7A 1XF2A 2YD8A 3L3JA 3UMTA 1NGZB 5D71L 4QHNB 5C07A 3O8XC 1B4JH 2XA3A 5CZKA 5AD0B 4NQDE 1HHHB 1DZBA 3QWOA 2PO6A 2FBJL 1NSNL 3DV4B 5C0EB 4JLRB 3IFPA 1IZKA 3OKEA 2L0DA 4G43A 2V9TA 3SKNB 4NO3B 1ETZB 4CVWA 1L9MA 4KK8D 3S36L 4WW2A 3JV4B 2P1YA 3VFGH 3GHEL 1Q9KA 4NPYB 1XFPA 1WITA 1MCLA 1BZ9A 4JHWH 5MEND 3P0YL 4NT6A 4JRYA 5A16B 5K9OB 4OZIE 1VACB 2DI8A 4HPOH 4RIRB 4MJ5A 2OQJA 4KJPC 2VH5H 5JZ7C 4ZUWA 1QSFD 1HZHL 2FATH 5DQDL 5BMFL 1GXEA 1KJ2B 2V5MA 4JRXB 3LEVL 1U3YA 3ZYJA 2DJ4A 2ADGA 1S7UB 3D2UA 3RWHA 3B9VA 1JZ4A 3VA6A 2J8UB 4GRMA 4JHAL 1GPOL 4LLYB 3O2DH 1LO2H 3TEUA 4EEEA 1VGEL 5K33A 4GRWE 5DUPH 1XF4B 4OGYH 4YXLH 4GAJL 2FX8L 3L7FA 2R1YA 2D7NA 3BZDA 3HC0A 4ZS6C 5FO9B 5LGHL 3U7YL 1MCNA 1BHGA 1EHXA 2VE6A 3B8SA 1FVCA 1ZA3A 1KLUA 4KK5D 1C7TA 1CFTB 1A7QL 3KPOB 5ETUA 4Y4FD 4NNXA 4BZ2H 3VGBA 2NY1D 4K71B 1U36A 4GKOA 1HEZB 4PJBA 1Z6JT 4X7EC 4GOSA 3K7UA 4P9HH 1NUFA 1F00I 3RUGA 5C0CB 4P2RA 3SCMA 1MVUB 4A2LA 3CFJA 5D1ZD 5HDBE 2HJKA 4C56E 1I1AC 2I27N 2NCMA 3CH1B 2UV3A 4JN2A 3ULVD 4L3AA 2F53A 1MVFA 3BW9B 5E1AB 3F7QA 2YMXL 1IARB 4HJGA 1GGCL 2YC1B 4RISH 1RU9L 3UTSE 1Q9OA 5DRNB 1WWBX 4Z7NE 3OR7B 3O8XD 4H20L 5F7EH 5IEKA 1AGBA 1EAPB 2GSGB 4JANA 3VXRE 5T3ZH 4JFEA 2GSIA 2UZYB 5HHPA 1T83A 3P9LA 4YJZL 4S1RH 3AREA 4LCYB 3CVIH 4N8VB 1M05A 3EO0A 5DRWA 4CN1A 1WFTA 5EO1A 2HT2C 4WENB 2JJUA 1HNGA 2CDEA 3FB5B 1IBGH 4GKSA 2JJTC 5TF1L 1VADA 2NY7L 1U8IB 4L8BA 4CVXB 25C8L 4RAVA 2CO7B 1U8MB 5IWLC 3LEXB 1T04B 4U1HA 3FTGB 2BSSA 4K3EL 1RK1B 1X7QA 3VXUD 4LSSL 2VQTA 1T1XB 1DQTA 5ID0B 4PG9A 3HE6B 4KJPD 1IGTB 2CGRH 1I7RA 5IVXB 1M7DA 5JZ7D 1VFUA 4ODUA 3QXWA 3PP4L 4F37F 2HJLB 4WU7A 4OD1H 2H32H 3ARSA 3WV0A 1A7RH 35C8L 3D39E 3MA7B 4NFCA 3EJYC 1B2WL 4OF6A 2E7MA 3L3KB 4PJAE 4FQPA 5C9KA 5D1XB 1RVFH 4U33A 3VFSB 3GNMH 4PYHA 3CAFA 2N7BA 3SDYL 3SGEI 1CZ8H 1S7XA 2D2OA 2GJJA 3QEUB 1YY9C 5HYFA 1RK0A 2XQYG 5JW3L 4UMGA 3QXAB 4YZFF 1V8HA 1UZ8B 3WFCH 5IF0B 5LJYH 1QBLH 5D7JC 1FL5B 1CL7I 1KPVB 3VGGA 2O61B 5E8DL 2QSCL 4PG2C 5ALCH 4X6DB 3TZVB 4KAQH 3RI5F 3RWGB 2AQ1A 2IMNA 4U0RB 2W65A 4LP4A 3DO7A 4QHKI 5C0GA 3CCHB 2JE8A 1I1AD 4KI5E 3MRGB 4FTVA 3RHWF 1MLCB 3OSKA 3X13A 5IB5B 2MFNA 1SM3L 5JIIA 3B5GA 1QR4A 5A2JH 2DQIH 4GW4A 3P40A 4BK5A 5D7SL 2J6EA 3QDHA 3FOMA 3I75A 4NQCA 1AFVL 1T6VN 3DLQR 1Z3GL 4X6BB 1LO4L 5DFWH 1Q38A 4OV6F 1D5MA 4ZUUB 5HYSG 4HKZA 2UWEA 2YZ8A 3RX7A 2VZSA 2XN9E 1JV5A 4QRQA 3FQXB 3VJ6B 3H9HB 4L3CB 2P5WE 2HT4C 2HT2D 4I5BB 1KC5L 3VW3L 1G7IB 5FK9A 3QEQA 5CINL 1RIUL 1Z9OA 3MRDA 1G6RA 4QCIB 3VWKB 1N59A 3RGVC 5BVPH 4U1MB 3KXFB 3BPCA 3TBSB 5EU6D 3R8QA 3SEPA 1XF2B 4FRWA 2AGJH 3L3JB 4LCWA 1MY7A 3MSPA 3RZCC 5EWIH 1AKJA 4IS6A 1BD2D 4KGJA 2F5BL 1INQA 3G6JA 5C07B 4OBRA 3OKLB 5CSBA 1J5OH 1MRFL 1AQKL 2XKNA 3CH8A 3QWOB 1G9NC 2YD5A 3VXMD 5JUEL 3WIIL 4ZODA 2XPGA 2FL5A 4A6YH 1XGPA 4JHZA 1AO7D 3OKEB 4G43B 3TT1L 2AEIT</