1MCBA

Principles and pitfalls in designing site directed peptide ligands
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
216
structure length
216
Chain Sequence
PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
publication title Principles and pitfalls in designing site-directed peptide ligands.
pubmed doi rcsb
total genus 41
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcbA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcbA02
3FRPG 1L7IH 1BOYA 3WJLA 1B4JL 1OAKL 3PP3H 4FS0A 4YH6A 4PJ8B 5A2KH 4FQXA 3KWWA 2VL5B 3BESR 1DLFH 1K3ZA 1LO2H 1J10A 4WO4D 3HNSH 3C2SA 2CO7B 1SBBA 2D0GA 3L3GA 1A1OB 4TQEH 4DGYL 3FZUD 5ADOH 4XP6H 4DK3A 3Q48A 3VGGA 4PJ7E 1P1ZB 2DDQL 3A6CL 4NC2B 3KPMA 2X89A 1OTTC 1T4KB 2Y7QA 1KN2L 4NO0D 3MLTA 3C87A 3RAJH 5ANMA 2J6EH 1I9IH 4MQ7A 3BUYA 4JKPH 4G8FB 3EDFA 3IDJA 3ARPA 2VWEE 2LAGB 3EYFB 3O6FD 1FNAA 1AQDA 2I60H 4N0RA 3VWKC 1KLUA 4NT6B 1DR9A 1EX0A 4WUUB 1LP9A 2NY3B 4NNYA 1PYWA 5CZXD 1MRDH 2QEJA 1QSFA 2JIXA 4HPOL 4JG0H 4OIBA 4Q9RL 2PW1A 3Q6FA 4O51B 5DZNA 2X40A 1OQOA 4YXKL 1UH3A 3QCTH 4X80H 5D2NA 1FH5L 2WWMC 2JCCA 4JRYD 2DQFB 3V0AC 4D9RE 4UIKL 2NR6C 4YPGA 5ACZB 4JFEE 3S5LG 3VFMB 4P99A 3EDKA 4L8DA 5IBLD 1ZLUH 4LPTA 4ODTH 2CGRL 4V2BA 4FABH 2MJWA 4ZSOE 2FL5A 1LEGA 3ES6A 2CR3A 3L3OA 1LO3H 1X3DA 4XRCA 5FM4A 3CX2A 5IM7B 5CJ8A 4OCXH 3O4OC 1A6AA 2X1OA 3VJ6A 2IFFL 2VLRB 2FBOJ 3P9MA 1S78C 3RVUD 1ORQA 4G6JH 3O2WL 2FECL 3RTQD 1JCKA 5DEGA 4E9LA 3OPZL 3KLHC 2DLEA 5DHYA 4KGLA 5KVFL 3HZVA 5ENWB 3WJJA 2A6KA 3H7BA 3W9DA 5EA0L 5AUMA 4JN1H 4X7TA 5DR5L 2WBJC 3G6AB 1DBKH 5EZIL 4QHMA 3SOBL 1ZANL 4POYA 1OARH 3MRGB 4U7KA 4CW1A 3AS0A 2BK8A 2IAMC 3K3QA 3PGCB 1PKQB 2IH3B 2IGFH 1GOFA 3GMOA 1TJGH 4TULL 4XWOC 4HGKC 5E7FA 2Q3AA 2NX5A 1EA9C 2DBLL 5KBNC 4JFFB 5J9PB 5JIIA 3LS4L 4KTYA 4PBWD 2J5LB 3NGBB 1YMME 4M93B 3S3JA 2XWTA 3SDXA 4WHYH 4OLWH 2P5EA 1L6ZA 4ONHA 3H6JA 5BOPA 1BQHA 5C0DA 1MH5A 1QR1A 2EDYA 1DE4B 1Z9SA 5E8EB 3QH3B 3WFBL 4X4XA 1T0MB 3U0WL 5E2VH 5K9KB 1OT1A 1QFUL 5CJQL 4TNVK 1SY6L 4M6NH 1KPRA 5BRZE 1NJ9A 1MLBA 3DX9B 5CINH 1U8PA 2MKWA 4LP4A 5CGYD 4HBCH 4RRPG 2GITA 5TDPB 4CUCA 4KKBC 4NC0B 2O26U 4HKXA 1ZAGA 4KK5C 4I18B 3SE8H 3O6LH 5E94B 4ZQKA 2J8HA 1IGML 3CFEB 3FL7A 4P4RA 3MV7B 3PXHA 2O5YL 4U31A 3QEGH 1RFDH 3SGDH 3QQ4A 1IEAA 4P3DA 3UMTA 4DOHB 2E3VA 3IFLH 3F58H 3DV4B 3L9RB 4MA1B 3VD9A 3X3GH 2QSTA 1QACA 3TBSB 1JTPA 5JXEA 4KUZH 1CIUA 3QUZB 5FFLA 3TPUB 5IWLC 1NBQA 1XGQB 1AO7A 1KELH 3V7AE 1TJIH 5FHBL 2XZAL 1TVHB 2VLJD 4QTIH 4Y4HA 4OM1H 4LSPL 2ZSVA 1OCWH 4KKCD 2PXYC 1MIEL 4HSQA 5K93A 3T4YB 4KVNH 4N0UE 1U2HA 3DIFB 3I84A 3THML 3BGFB 2XV6B 2VAAA 1K5NB 4R4BB 4XVTL 4NSKA 1A02N 3VXNA 4YWGL 5F7EL 1PGRB 4BH7B 4K3JL 5CEZH 5EH1A 3D18A 1I9EA 2FDBP 3U30C 3HKFA 3MRKB 5J13C 4GW1B 1V3JA 2Y9RT 5HYIA 3UYRH 4PJXB 1ZKAA 3U79A 2VUOA 5GS1C 4RMWA 2P45B 5JW4N 1N64L 3PL6D 1L7TL 4PBXA 3ULVD 5DQDL 1UJ3A 3EYVA 3TPKA 5EUOB 2DLHA 4DN4L 3VGFA 1NGPL 1FNGB 2X4QB 3ULVH 4P59L 2XZQL 4YXLH 1PQZB 1BECA 3PHOB 4PRPB 3BZFA 1F2QA 3PIQB 3EOTH 3MA7A 5BXFB 1X7QB 2A77H 4IJ3B 5GGSA 3RDTA 4U6HB 4WHTA 1EUTA 2HT4D 3D3VD 4GRMB 4UT6H 1JGDA 3WXWH 3RJQB 3FT4B 5I8EA 4LKCB 4QHLB 5HI5D 3S88L 4P4KC 4YBLC 1FZOA 2EIBA 4FZ8L 4OZFA 1NC2A 5I15H 1H8NA 3LKOA 3WNMA 3NFSL 5DHVH 5FA3A 3ARUA 4RGMC 3H9HA 5CJ5A 3T8XB 4EI5D 3MRFA 3N1FC 5DD6A 3HE7A 1SYVA 5SWZA 3SE9L 5C09A 2AGJL 3UCRA 2VDQL 3T65B 4D8PA 1KTKE 1RUPL 4G8GD 5IESH 1RIVL 1S9XB 1CLYH 4HEME 2VDLL 1DTUA 4Z5RA 2A9MH 2Q76A 4Z78B 1G1CA 1N26A 4F7EB 2AQ3A 1C1EL 1K85A 4RFNC 4S10A 5HHMD 3KPRB 4L29B 4FXLA 1KCRL 4D2NA 4O2CA 4ZPVA 4WU5A 3L7EA 3B4NA 3VDBA 1SEBB 1U3YA 1MCNA 2CK2A 4LLMB 1UM4L 4Y8DC 4KQ3H 5IVXE 3G6JA 4I2XA 4JB9H 5I8CB 5DMIH 4P5TD 3TC9A 5GRVK 2R2BB 4OD3H 5EIQA 4LASL 4MA8L 2OBGA 1NCCL 1JZ2A 4PRNA 5DXWA 1WBXB 3SKJH 3LKRB 1S7WA 5IB3B 4W6WB 3JWDH 5MENE 1YEHL 4GRWE 5DO2D 2B4CH 1R5IB 4WEUD 3TLRA 5BW7C 1AFVL 3IJSA 1FSKB 5KS9A 3LQAL 4JM2B 3EO1A 5IOPA 5DVLA 1DEEB 1U8KB 3QEQB 1IL1B 3QI9B 4RZCB 4U1HA 3NIFF 2X4TA 2XG5A 4YHIB 1FNSH 3ZKND 5HJ3A 5MI0B 4ZD3H 5TE7H 3HE6A 1IFHH 2CIIA 4UQ2A 2I9LB 4P49A 3QDGD 2NY0B 4MNQA 3KHOA 3TJHC 3VXUB 1NUDA 4XHJC 2J6EA 3GJEB 5C8JB 2GFBA 5KVEH 2FO4A 2VR5A 2A6IB 4WENB 4CU8A 3GJFB 5DS8A 1FVDB 2X4PB 3CFDA 4NO5B 2HT3C 2JB6A 3QUYD 2D3VA 4NKOB 5F72S 4BUGA 5J6HB 4YDVB 3W0WD 2J8UE 1WCBA 2MQ3A 3V95A 2VDPL 3ZSSA 2IADB 2PTTA 3OX8B 2HYMA 5DJDA 2IFGA 2Y4SA 3QWQB 4OQTH 1KSRA 4PLKD 2B1AH 3X12B 2HRPL 1NCUA 5TF1H 4S1RL 5FAAA 3FN0H 4BZ2L 5E6IB 5HYJA 5D2LF 3GMRA 3VXRA 2JJVA 1KJ2H 1C5DA 3QHZL 4ERSH 2X4NB 5E2TL 1U8OB 5FYLL 3RUGA 4Y4FD 5C08D 3CH1B 3FOMA 3VXQB 5B3NA 1WZKA 1G9MC 2XRAL 4LSTL 3STLA 3BH8A 3LEXB 1HDMA 3N0PB 5JIPA 3LB6C 1G6RL 1NGXB 1B0RB 1UA6H 1AP2B 4LSVL 2KZ1B 4YZFE 3OKNB 1WIOA 3KPLA 3U4BH 3GUTB 1UXWB 4W70A 4LIQE 2N1KA 2NTFA 2D7QA 1CLOL 2P5WE 4Y19D 2DWDB 1T6WA 4QWWD 3F65A 2AV1B 3DBXB 4QRRE 3OR7A 5DJCA 4DVBB 4OKVB 3RZCD 3DX6B 5DD5H 1W0WA 4JRWA 4BUHA 1H9VA 4ODHH 3QEHB 4JHWL 1Z5LA 5EC1B 2DL9A 1PEZA 3MUY1 4R97B 3MRMA 3MLYL 4DGVH 4NKDB 1ZMYA 3HZMB 4MQXC 4Y4KC 4N8VA 4YE4L 5IR1A 4Y16B 5JW5A 3VRIB 5KTEH 1ADQA 4IOIA 1JNLL 4G9FE 4OLVH 2UYLA 5F1IA 4HX1A 3W11C 1I8IA 4PP2A 5D4QA 3O9WA 2J7LA 2DOCA 4KTDL 4L8SA 4U1MA 4E42B 1KIUA 4KWUA 2MHAA 3P9LB 4LSSL 4X8XA 4I77H 1IQWH 1Q0XH 3AMKA 2ATPA 3C9NA 2IBZY 1OB1A 3NABH 1T83C 5J11C 2Q8BL 4NO3A 4ODWB 3MXWH 3HRZA 4JAMA 1CE1L 1LP9F 1KTDA 3VMPA 2VZVA 1GGYA 3LCYA 3ZYIA 2CMRH 4Q7DA 5F6IB 4JPIA 4XP1H 2X4SB 1NPUA 2W60A 4KDWA 4LHJB 3ZKMD 4PG2A 4ODUB 1RZGA 1K4DA 1MJ7H 3VXSE 4NQDA 1NAMH 1NEZA 5HI4D 1GCFA 4PGCA 3QT2A 3RVTD 1QYGH 5K9QI 4ZXBC 1UWGH 4GKZA 1FZMB 2H3NA 1TPXB 1F58L 4Q74A 3ARGC 4LLDA 4N0CD 1IM3B 4I0PD 4WWKD 5KSUA 5C0AE 1TQCC 4CU7A 3F7PC 5T1LD 5IP4A 4PJGA 1KFAH 4G42A 3GMPB 4X0KB 4WDIA 4LLUA 4KKNA 3WIHH 4TN9A 4BSVA 1S7UB 4MJ6A 2NNAB 4HS3B 3IFNL 4QRTB 4LEOA 5CIPB 3MV8D 3IDIB 4P3CL 3S3SA 1EO8H 3U2SA 1MF2L 3CLEL 3TCLB 1INEH 4YHNA 4LDOB 2Z8SA 3WHE1 2VOTA 1XFPA 3NVQA 4XMPH 4PREB 4FQLH 5H8DA 1MWAB 3DO7A 3HPLA 1JZ8A 4NGHH 1TXKA 1NMAH 5CBAA 1MCKA 3TH3T 5DD3L 3LQMA 3G5VB 4WNQB 2WWKT 5EO9A 2VRAA 2Q7NA 3GO1L 4JO3L 4M4RA 4KDTA 4MJ4A 3CZJA 3MLUL 1R3HB 1X5KA 5GGRB 1AXSB 1MREH 3QDAA 4XVSL 1U95B 2NLJA 3IFOA 2JK5B 3BQUC 2YC1A 4QOKE 2DTML 4GLRI 4Z95H 2PKDA 3IGAA 4BZYA 4ZUVB 1RMFH 3WS3B 4WJ5B 5D7IA 3SDXF 3LAFA 3ROLB 4LCYB 4YGVB 1XR9A 3HFML 4LCUB 4ZFOA 2H1PH 3TO4A 4PB0H 4UUJA 4J3XA 1B0GA 4XP4L 3MPCA 5F3BA 5BO1L 3D1MC 2Z8VC 3B9DA 1CLZL 3GB7B 3BKMH 3OKEA 3HG1A 4JZJB 3U83A 2VMFA 5FCUH 2HG5B 2DMCA 4EDXA 5BV7H 4OCLC 3F6LA 1JF5A 4S1DC 2E6QA 3C6LD 3BDYL 4UMGA 5DHVA 5KVMC 1ZHLB 3QA3B 5D1QD 1CFNB 5DK0B 4LCWB 5DJYA 4RQQA 1RUAL 2APXA 3B9VA 3HZKB 2J4WH 1MHEA 1V3MA 3K1KC 4PGBA 3RVVD 4JO4H 5FGBA 5I75B 5MEPA 5E99H 4PIRF 4NZTL 4RGNB 5ERWA 1OAUH 4G8GA 1IAMA 4FQ2L 4OT1L 4OAWB 3K2MC 1YEJL 2BMKA 5DJ2A 4MHHI 1MNUH 2W65B 4NZDA 1A4JA 2NYYD 4FFZL 4ZOEA 1J0JA 1LK3H 1JUFB 1RZ8B 2AJVL 1J1PH 3UZVB 3OSKA 1HOCA 5M95B 3U4EB 2VUYA 2CH8A 1G9NH 1ZHBA 1G7HA 5C2BL 3DRQA 1DQDL 3B9KA 5CP3H 4O5LH 3GHEH 4P5TA 1JIBA 4U1LB 4WCYH 1IILE 4HIHA 3J7HA 3U9PH 4H8WC 3IXAA 4QXTB 4WTXA 5MEOA 3L5WB 5DA0B 4P2OC 4ZYKB 4LVNB 4Z7VF 2UWEA 2YN5A 3GSNH 3AREB 3ULSA 1MUJA 3FQWA 1TIUA 3IU4L 4LKXA 4M7KL 4NKMB 1CE6A 2MFNA 3MLXH 1KTLB 4OIIL 2XXMB 1MHPH 3LQAC 4JVPA 3MODH 2NXYC 4OBRA 1KB9K 1CXIA 3EBAA 3LD8C 4QXUL 1GZPA 5HDLA 2ED7A 4H1LH 4GXVL 3QXAA 1BJ1J 5GS0D 1NC4B 2G2RB 4PJDA 3QIUA 2ADJB 1QNZH 3FMGH 1OGAB 3SDDD 1KIRA 2F15A 2EIZA 4JQIH 1FZKA 5GS0H 3BO8B 2AI0H 3EOAB 1MQKL 1PX3A 2NY4D 5CKAA 3C5ZC 1E4XL 3O41A 5B8CC 4QGTA 2NY6C 1FFNA 5E4EC 3GDBA 3AB0C 3VI3F 3WO3B 3VG0L 4GRLD 2HJFA 4IRSD 4KJPC 4OQTA 4A2MA 4EN3A 3KWWB 3P11L 3UJJL 1KEGL 3S35H 3RWCA 1TZGL 1H5BA 4I3RH 2EYSA 4OKDA 3L3GB 2H9GB 4ZUSA 5GSRA 4NQCA 1KC5L 1D9KC 1JPSH 4ONGL 1OT2A 1WCQA 1BIHA 1N5YL 3EYQC 1KJ2A 4PJFA 3KPMB 3UTSD 3TJEL 3MLTB 4M61A 2DQTH 3RP1A 4NKIH 3WFCL 5ANMB 5L9DL 5KANG 1WFUA 4MQ7B 3BUYB 4Y4FA 2HH0L 3IDJB 5HHOE 3VGAC 4X9HA 2FLRT 1AQDB 1KLUB 4H25A 4GSDL 1IC7L 5J06A 4G6AD 4MNHB 1OL0A 4HWBH 1LP9B 4IRZH 3Q1SH 1MAML 4YHOL 1PYWB 3TVMC 1QSFB 4XNXH 2JIXB 2FB4L 2CK0L 3RJDA 1RZ7L 1QHOA 4E41E 5HDOA 3S35X 4W6YB 4R4FH 4TPRH 2FX8H 2JCCB 3QEUA 3SN6N 2BJMH 1KB9J 1V7NH 3NACH 4HZLA 5GJTL 3RZCA 4OGAC 4PJHE 1BEYH 1WT5A 5D7JC 5BMFH 1B4RA 4O58H 4C56D 4AMKH 4WFHD 4ZO7A 2GSGB 3MCKA 4L8DB 5D70L 4LCIL 2JJTC 4IOSD 1A21A 5EO1A 5TFSH 4XMKH 2FL5B 2VABA 1LEGB 5EZOL 5M94B 2AJSH 3ES6B 4WIQA 2LQRA 3FB8A 3I02A 4XRCB 3KPSD 4NBZB 1A6AB 5I30L 4DKAA 1JHKL 4NHCL 3VGEA 2OM5A 5FM5M 1NEUA 3MZGB 1MCPL 4GG6E 3C2AH 3M07A 4G7VH 1ORQB 3F6IA 2YKLL 5D5MA 4W4OC 2XQBH 1FRGH 5DEGB 4WI9A 5L0QC 1VGKA 5DHYB 4DZBA 4X7DC 3HZVB 3QDJE 2A6KB 5L6YH 2X1QA 3H7BB 3W9DB 4XX1E 2F9BT 4HBQA 5AUMB 1ZSDA 4X7TB 3RPIA 3LRHA 4M8QA 2NZIA 3G9VA 4U6VL 4P2RD 3MRIA 5HGAA 1UFUA 4CW1B 3KGRA 1YPZE 4XNUL 3RVXD 1XH3A 4L3AA 4F15C 2CO6B 2VXUH 2X4RA 4XXDB 3GMOB 4XC3H 5JHLH 2ZCHL 1J1XH 4BFGA 1T22A 1NCWL 1VEOA 1GH7A 3K7UA 4JJHA 2NX5B 5DMGC 3EGSA 4KRLB 4KGJA 5C3LD 1NLDH 2XA8L 4XPFH 3JWOC 3K1DA 3SDXB 2FD6L 4PRHE 3UX9B 5CCKH 1IEBA 1JWSA 4J3VA 2APWA 1BM3L 2P5EB 4ONHB 1CWVA 1BZ7A 4HPYH 4I0PA 4WWKA 4LSUH 5I0ZA 3WIHA 5C0DB 1MH5B 5GJSH 1QR1B 5T1LA 3FQTB 3R06A 2M1KA 4X4XB 5I1GL 3GSUA 2ERJC 1ACYL 1Y18A 1P9MC 2QADC 4JPKH 3MV8A 3ZKQD 1KPRB 5SX5H 3WN5C 2Y06L 1MLBB 1T20A 4ZAKA 4GRWH 1RJLA 4YR6A 3K2UH 2CIKA 2FJGA 2WSKA 2F5AH 2X1WL 3SQBA 5HHQA 1FFQA 2GITB 2YUWA 3NCCB 5T1MA 5CD3A 4HKXB 1YEIL 4JFDA 4Z18A 4ZQKB 4P4RB 1MCCA 4HAFA 3VXME 1A5FH 4NQEE 3MNZA 1NBYA 5CJOH 2FATL 3QQ4B 1IEAB 1UKQA 1BWMA 3A67L 1U8MB 4FXGA 1TQBC 2WW8A 4GAGH 4W6XB 5EZJA 5FYKL 2AKRA 3VFNA 1P4BL 3O81A 4KK8C 3RPKA 5TE6L 3P4MA 3MGAA 5IMOA 1OP9A 1VFAA 1YY9D 2A0LD 3JUZA 4DWHA 2GK0A 1DUYB 5IEHA 4XVUD 1AO7B 3HNVL 4KRPC 5IHLB 4K8RD 4K3GA 3OXSA 1G7QA 3MGOA 4PP1D 5IHZA 3OKKA 1RPQA 4R2GB 4M5YH 4Y4HB 4MD5A 3GSOB 4K8RH 2NZ9C 2ZSVB 3LEVH 4KXZI 5KAQG 1WFOA 4Y5VC 1NBVH 5C0BE 4EBQL 2DM4A 3MX0A 3DI3B 4FTVD 1UT9A 2DQCH 2VAAB 2AEWA 5CGTA 3VXNB 5I73C 2J88H 2HKHH 1CK0L 4NOFA 2W38A 5CEYA 1AGCA 3D18B 5GGQH 5JW4R 2RBLA 4JCMA 2B39A 3REWA 3O4LB 5K59F 1KXTB 4F9LC 3VXPA 3MCG1 3ZHDA 2YMXL 2Z31B 4KPHH 4M3JA 3REVA 1CL7H 3S36H 1YECH 5CLWA 1ZT4A 2KKQA 4YBQD 5ESVA 5HHNA 4MAUH 5TPWL 4AEIL 4OSUH 4L5FH 1UJ3B 3EYVB 3JTSA 4WTWA 5E6ZA 4X8JA 3U82B 4LAQH 2ZZUT 3WS6A 4M1GH 5LXGH 1ITBB 2ZUQC 3O2VH 2OZ4H 5B38A 2OK0L 3MLZH 1K6QH 5C0CD 1YEDA 3MA7B 3QXTA 5GGSB 3CSYA 2XFXA 4WHTB 1GGIH 4PJGF 3LV3A 3B9AA 4LIQH 4MDIA 1WSST 1JGDB 2R56H 1OHQA 1SJEA 4OJFH 2DS4A 3RFZC 5DYOA 5HDBE 1FZOB 3MRRA 5EULV 5JR1H 2FJFB 3WBDA 3NBNA 3LKOB 2FLBT 1J12A 1FNHA 5FA3B 1P84K 1GPOL 2FZ3A 4PRAA 5DFWH 2OQJA 1ZA3B 3S36X 4BSJA 3H9HB 4FHBD 1DBML 1RJZA 4YHKL 3ESVF 5DD6B 2P43B 1SYVB 3VWKA 5C09B 1S3KH 3GSNA 4OLXL 1NMBL 4D8PB 3FT2B 4KI5F 3EW3B 1T1WA 3MCLL 4LBEA 4WUUE 5E8NA 3I50H 3M45A 4M93C 4HUMB 2Q76B 5A40E 3OV6A 3OAZK 5DD0L 1OP3K 4IIQC 3C08L 1FE8H 2I9TA 1H0DA 4OFDA 3QZWA 4H1LA 4O2CB 2FEEI 3EDJA 1QSED 4WU5B 4R8WH 3L7EB 1J5OL 4KDVA 1QFWL 3MRPA 4I2XB 1A6VH 4OLYH 1H3XA 4LCCA 4PUBH 2DJSA 4LHUD 5JUEH 5IMKA 1GL4B 1IZKA 2YD6A 3L6FA 4M5ZL 2KH2B 4HFUL 4CBPA 3PWLB 1C5BH 1IGYA 1YY8A 3T0XA 1S7WB 2F58H 4N0YH 3UPCA 5AYUL 3IJSB 2GJ6D 1VPOH 2DQIH 3PV6A 2EXYC 5KS9B 3GI8L 5DUML 4DVRH 5CHNB 5KW9H 3EO1B 5IOPB 1FVCA 1UEYA 4L9DA 5JOPD 2V2XA 3N06B 4UNUA 4ALAH 2YPLD 4U1HB 2HFGH 2X4TB 1S5HA 5HJ3B 1D5BA 2WBJA 4BSWA 1I1AC 1KBGH 5LBSL 4FG6C 2F19H 1RZFL 3HE6B 5EU7C 5F9OH 2VYRE 4IDJH 2CIIB 4FRWA 5INDA 4UQ2B 4S1QH 2FSEA 4MNQB 3I75A 5HHXH 4NP4H 4LPVA 5HGBA 5GRUL 2YXMA 2IAMA 2DQJH 1PD6A 4ZS7H 2GFBB 4D0DA 1P84J 5BVJA 4PGDA 5JDJA 5DS8B 2O5ZL 4GLRH 3UYPA 5DRXA 1I1FA 3CFDB 2WINA 1YC7A 2BY2A 1QBMH 4C4KO 1MWAL 2J1KA 2JB6B 3KPQA 5KSBE 4HWBA 2UUDK 2OCFD 3BPLC 1NGQL 2HAZA 1NGZA 1WCBB 4KVCL 1C5CH 1J11A 3DYPA 3ZTNH 2PTTB 4JKMA 4MGXA 3JSSA 1SBSL 5DJDB 3CCHA 3F7YA 2B0SL 1EK3A 1ZOXA 5B38G 5I8KH 2VIRA 1EO5A 4KU1A 5FDYA 3P40A 1TFHA 5F7DB 5HYJB 5IFHH 4WFEE 5FUZL 3GMRB 3VXRB 1F90L 1C5DB 4GMTL 1A7PL 4GFTB 2DQEL 5DUBB 2VO5A 3U7YL 1YEEL 4LPCA 2OTPA 2XNAA 3MV11 3IVKA 1HILA 3RUGB 2EDHA 4D9QD 3FOMB 1HHIB 1KENL 1HIMH 3BH8B 1E28A 1HDMB 4R90H 5HDQH 1HQ4A 3LKSB 1BGXH 1GZQA 5C0ND 1T7YA 4PJDF 2HLFD 4ZOBA 3KPLB 3S97C 2DIBA 2GQHA 2AQ2A 4GG8A 2NTFB 4JFHE 4WW2C 4DOHE 5I6XC 1JFQH 1BLNA 5F7WC 1KCVL 2ADFH 3OR7B 5DJCB 3TV3L 2DQHL 3PWVA 1P7HL 2RCSH 3MUHL 5IIEA 2ZUWA 5IWLA 2LVCA 4KAQL 4DAGL 2W9EH 1UB5A 5EU7E 4Z76A 2VQ1A 3UDWC 2XA3A 5DRZA 3FCTA 4KK9C 3MRMB 2D0HA 3RY4A 2PXYA 4LPXA 1YNLH 5IR1B 4JZNA 5BS0A 3DMMC 5JW5B 5EUKA 4IOIB 3VFRA 2UYLB 4JG1H 2BCKA 1DBAH 4HX1B 1I8IB 4PP2B 5F1OB 3O9WB 1JN6A 1RIHL 5KJRL 3HC3L 4L8SB 5FV1L 2OP4L 4U1MB 4G6FB 3QUMA 1BQLL 2MHAB 1P7QD 4PRDA 3BKYL 4UDTA 5IVXA 2CLZB 3L3KB 2R0WL 3EOBA 5T1DH 2NPLX 4R4ND 4GH7B 5GGVY 2AJXH 3C9NB 1FYTD 3CXDL 1OB1B 2IQ9H 4KQ4L 5CILL 1MFEH 4NO3B 5JXAL 1VADA 4GUPB 5EU5A 4CVXB 3HRZB 5CD5C 4JAMB 3MLRL 3CLFH 5EUOE 4LMQE 2C3HA 5DT1L 5FHAH 2F53B 4JPIB 5MENA 2XN9D 1ZK9A 2B5IB 3GIZH 1HHHA 1OAQH 4K7PH 2IG2L 4K7FA 4PRPE 5KAQF 3FFCB 5JZ7C 1ZHNB 1RZGB 1K4DB 2OXHA 1QRNE 3QQNA 3RWJA 4NQDB 5A2JH 3V7AG 2PR4H 1NEZB 4JM2C 4PGCB 1I3GH 4F33B 2YRLA 4LVHC 1S7XA 1X5AA 4OD2A 5L2JA 4GKZB 4J6RL 2OL3B 5E0QA 5I2IB 4JFOA 1N59A 4HIJB 4LMQI 4LLDB 3QCVL 4KZEH 3KXFE 1TZHA 4WI4A 5ISZB 5AZ2H 3FONB 4PJGB 2NY0C 4G42B 4WDIB 4LLUB 1YUHA 4MJ6B 4BSVB 1CFTA 4MAYD 3QXDA 3O2DH 4EOWH 2PYEE 4LEOB 4HCRL 1MIMH 2F5BH 1GGCH 3X14A 3DX7A 3IDNA 1MCQA 4OGYL 5D5MF 2J8UA 5JHDD 5GZOC 1UYWH 1MJUH 3O45A 2APVA 1QPXA 1FBIL 1FL3B 4PLJD 1RURL 3DO7B 2FJHA 2QTEA 4IDLA 1BZQK 2JELH 4AEHL 5CBAB 4PG9A 5B39G 3ARSA 3LMJL 1Z3GL 1S7VA 5T5FH 5EO9B 3M8OH 3GJFK 3AS3A 1VSCA 2OR7A 2X9XA 3T2OA 2FGWL 1CGWA 4JKKA 1FZJA 2BERA 3OJMB 3KLSA 3W39A 2VLKE 1DN2A 5CBEA 3V4UL 2NLJB 3IFOB 3BGAA 3TEUA 4ZFFB 4M6ML 3OGCB 2YC1B 1U8HB 5IVZA 5C0IA 4H8WH 3O3BA 2ZUXA 3IDYB 2OZ4A 1ES0B 2W92A 3KLDA 4LDEB 1V3KA 3QDMD 4MMXC 3UTQB 2G9HA 3OZ9L 4GMSH 2PW2A 4AY0A 1HYSD 1U58A 1I8LA 5BW7A 5C0CA 1XR9B 5E8DL 3T0AA 4KKAD 4ZFOB 3TO4B 4TSBH 3KPOA 4HS8L 1B0GB 4XB7A 1FPTL 2P5WA 3ZKXB 3RVWC 5F3BB 4G6KL 5HGHB 3C6SA 3MRHA 3PHQA 4QRRA 5FA4A 3NA4A 3ARRA 4J4PA 5LGKA 4Q9QH 4CRPA 2NXZB 3OKEB 5C7XL 3HG1B 1RD6A 4EDXB 5J12B 1DFBH 3W5MA 1I8KA 5FYKE 5DHVB 1AY1H 3O6ML 4NM8L 1NSNL 3NIGE 3MRNA 3WKMH 3SCMC 4Y1AD 1BBDH 1DBBL 4RQQB 3OF6A 1TNNA 3VXUE 3TN0D 4X6FB 4R97C 1IGJB 5TH2B 4PV8A 1MHEB 4G9FA 4H0HB 2QHRL 1SQ2N 4PGBB 4PJ7F 5MEPB 1Q0YL 1K8IA 1T7ZA 3W9EB 5E6YA 1Z9OA 4IS6A 5AYQA 5LGJA 3T2NL 3D2UA 1F4HA 5E7BA 1ZLWH 4Z77B 5FYKU 1QKZL 4G3YH 2BMKB 5FECA 2AEPH 4XCNA 3TBWB 2WMPA 4L8CA 1TTUA 3A0OA 2XTJD 3VFSA 1U92A 5GHWL 2JE8A 2ZCLL 1HOCB 4FN0A 3S37X 1QSEA 1IAIH 1IC4L 3QYCA 1ZHBB 2GJJA 4K2UL 1G7HB 1YQ2A 3DRQB 3B9KB 2QQKH 4K94C 3X11A 1CI5A 4FFVD 2CRYA 1YNTA 1RUKH 5F6IC 1N6VA 4AIOA 3ARQA 3ROOA 4HIHB 2AVGA 4KK6C 4JGMA 7FABL 4G8IB 4YNYB 3LIZL 3BWUC 3E8UL 3IXAB 5MEOB 3BP4A 4LHUA 4AK1A 1ZLVH 1WAAA 3LEYL 3ZL4H 1P4LA 3MLVL 1G84A 3ULSB 1MUJB 3NCJL 4TVPD 3FQWB 4LKXB 4JDTL 3K0WA 5F3HA 3BE1L 4TVPH 1G7JB 1TPXC 2A38A 4GW4A 4ETYA 3T1FA 2B2XL 5SX4I 1GZPB 2VDOL 4TUKH 2Y36L 2KZWA 4KHTH 1XMWA 2YPLA 4L4TE 5DHXB 3WDIA 3FT3A 5INCA 5CWSA 4PJDB 3QIUB 4NKQB 3EJZC 3RGVC 1GGBL 4PRIA 5F7YC 1KIRB 2EIZB 1FZKB 1XGYL 4Y4KA 1CN4A 3RU8L 5J6GA 3LKNA 3QWOA 4OZ4A 4UTBL 5C9JA 3O41B 1NCDL 5C0EA 1FFNB 1AI1H 3B5GA 2HJFB 3PWPD 1SJVA 1BWWA 1NCBL 4EN3B 1FGNH 3GMMA 2MMXA 3GI9L 1H5BB 2VDKH 3MV01 3A6BH 2EYSB 3G08A 4WUKL 1EJOL 1U3HC 4FOMA 5IB2A 4ZUSB 5GSRB 4NQCB 1JZ5A 4JANB 1BD2A 2FBJL 4JPWL 4YHZH 1CVSC 4PJFB 1KJ2B 1A9EA 4N5UA 4ZS6D 2FX9L 3DX8B 1G7LA 2O61A 3DSFH 1UH2A 4R3SA 4J23A 1I3VA 4M61B 2BVEA 3ME0A 1X5FA 8FABB 4Z8FH 3HC4H 1Q9OA 3ULUD 2D03L 3MC0A 1MCLA 5TDOA 2OR8A 2BNRD 3ULUH 5E2JA 4RIRB 3EFFA 4H25B 1B2WH 1HI6A 4UOJA 3CDCA 4HWEH 4F80A 4XNYH 5DZOA 1T80A 3NN8A 4D9LL 3HZYA 1B6UA 4APQA 5CFHA 3BD3A 5BOZG 3JWOH 3ARBC 5FDWB 2CDGA 5E8OA 5D1XC 3BD4A 4JY5L 1IGIH 3P0YL 1XIWB 4L4VD 4PJ5E 3RBGA 4HZLB 2D7TH 5GZNC 1T03H 1TJHH 3RZCB 2YR3A 3LN4A 1Z6JT 5FUOH 3OHXB 4X7FC 4U05A 2GI7A 1N2RB 4UB0L 3LN5B 1TNMA 1UQSA 5KG9A 5EO1B 5D6CA 5IMLA 5K9QG 4P23C 2VABB 4JPVL 5IGXL 1F4WL 4YDIH 5IBTL 2XWJA 2VZOA 1I1RA 3FB8B 3RL2A 1PLGH 2DLFH 4JGUA 3PG2A 2EDNA 4K3EH 3RY5A 5I1JL 1MFBL 4JFXA 2X6MA 4XMLH 4KROB 1HHGA 4TTDD 2E27H 4ZFZA 4AL8H 3SDAD 2O93L 4HJ0C 2DM7A 5D5MB 2AK4B 2R9HC 1NUNB 4U7SA 5DFVC 3RY6A 2ATKA 4BQ9A 4DZBB 4DW2L 1UACL 2DIAA 2N56A 1A6ZA 1VENA 1YEGH 4QHUA 4BYHA 4TNVF 1ZSDB 5C07E 3RPIB 4M8QB 1RZJL 2Q86A 1P5UA 1T7XA 1WEJH 3MRIB 5JW4Q 4OFKA 4LVNC 3Q5OA 5HGAB 1PX4A 2XN9A 4NWUH 4QRPE 2RQ8A 4RAUA 1XH3B 1MFDL 4M48L 4KJWD 3MJ9H 1LO0H 1CCZA 1D5IL 2OMBA 4B7LA 2EDRA 2A83A 4LRIA 2EDLA 1D6VL 3SDYL 2FX7H 1IAOA 1J86A 2LTQC 5H35A 4FZEL 3EFDL 3U0PA 5FGSA 1CXEA 4HWNA 4C55A 1IEBB 1JWSB 2P8MA 2X10A 5I8OH 1HZHL 1CDUA 1BZ7B 2HT2D 4F7MB 1QO3A 2QQLH 4GKSA 4G7YL 4OLUL 1VKXA 3H3KA 3SGEI 3R06B 3O2DA 3AGVA 3MMEA 3GSUB 4NOBA 1JPGB 1Y18B 3O6KL 4LQFL 3MV8B 3QIWA 2YBRA 1L7IL 1U2CA 4ZAKB 2AERT 4G5ZH 4I3SH 4K71B 1RJLB 4YR6B 5HGDA 2CIKB 3PXJA 2BOBA 2FJGB 3V79C 3Q6GH 4CVUA 5CP7A 1HK6A 5HHQB 5T1MB 4FQXC 1JK8A 2W0FA 3IS1X 1LO2L 4HUXA 5J7CC 1QLEH 4JFDB 4O2FA 3P4NB 4MQSB 4TQEL 2K7QA 1MI5D 5ADOL 1WZLA 5ADPL 1KIPB 3R4DA 5DUPH 3MNZB 1NBYB 1NCNA 4FXGB 1FQ9C 4RA0C 1ZA6B 3UAJC 3VFNB 2LVEA 4F7TB 4UV7H 1JGUH 4MD4A 2H2PD 4X4ZA 1FV1A 3P4MB 4HQQL 4L3CA 3T2PA 1VFAB 2J6EL 5E2UH 1YJDC 2GK0B 2Z8RA 5IEHB 1Q8MA 1CGVA 4PB9H 4R0LC 3MGOB 1G7QB 2NTSP 3OXSB 5IVXF 3U6RA 3OKKB 1PJ9A 3QXUA 4MHHG 1ETZB 4GAJH 4MD5B 4AEFA 4XGZA 3TT3L 4ONFL 1YN6A 1T1XA 4F8TA 1MRDL 5F96H 2H6PA 4G43B 3QHFL 2BHUA 5E95B 3X3FL 1D6EA 2IBZX 3QJFA 2DQGH 4X80L 4XPBH 4OCSL 3W82A 3MJGX 5D2NC 4GRWF 2VXSH 1UGNA 4OFVA 3LOWA 3REWB 1EBPA 3VXPB 3SPVA 5GRWA 4JFEB 2BX5A 2KPNA 2VLMD 2BY1A 3REVB 1UWEH 3IRZA 1ZT4B 5HHNB 1Y0LA 3DXAE 4Y1AA 4ZSOB 3EJYC 5IMMA 1OGAE 5L2KD 3JTSB 4X8JB 2R2EA 4NQTA 3P30H 2ZKHH 1LO3L 1T2QH 4U2ZA 5B38B 1YMMD 5I1HH 1MCRA 3OBAA 1YEDB 4GG6A 5D93C 4X6BA 4DTGH 3UTPD 3CSYB 4CDHA 2XFXB 3DWTA 3LV3B 4HKZA 5HTSA 2W9LA 4MDIB 3VCLB 3GIVB 4ODVH 1CVRA 1SJEB 1R3KB 1D9KA 1FG9C 4OV5A 2R15A 4QCIA 5DYOB 1Q94A 3HB3C 2J8UF 3S4SA 1NGWB 3WJJC 3MJ7A 2NY2C 4JN1L 4YJZL 1T89C 5IKCA 2FZ3B 4L8BB 4PRAB 4GBXA 4DKFH 2OQJB 1OARL 4E5XA 2C9AA 3ARVA 1HH6A 3WO4B 4POUB 2EH7H 1RJZB 2IGFL 1TJGL 4FQIL 4F57H 3VWKB 3AS1A 1U0QA 2DYPA 1ADQL 1XF1A 3OTTA 3QWRD 1T1WB 4LPWA 4XCFH 1AGDA 4EVNA 5TE4H 4LBEB 3V6BR 1ZLSH 2V2TA 5E8NB 3I6LD 1LP9E 4NNXB 4PRHA 5F88A 3KLHD 4DGIH 4HAGA 4OLWL 2BVOA 2OR9H 4OF7A 1LO4L 5DGRA 4H1LB 3BIKA 5D2NE 1AGEA 2KDGA 2VH5H 4YZFF 2JCCE 3LH2H 4Y2DD 3CU7A 3OMZA 2W59A 3MRPB 3OWEA 4WFGD 1Y6MR 3L5IA 2AJZA 4GT7A 5E2VL 5BRZB 4M6NL 2JJTA 4LCCB 3V7MA 5CINL 4XWOD 3B83A 5HD8D 5IMKB 4HBCL 1SM3H 3MRLB 3L6FB 3MYJA 1RU9L 3DETC 4ODBD 2NY4B 3O4OB 1IGYB 1YY8B 3SE8L 3O6LL 4U6TA 2BOCA 3DJ9A 4NQEA 4BFEA 4HLZG 4L3ED 1RFDL 1MHHA 2BVTA 2OL3L 4W4OA 3IFLL 5E9DE 3NFNA 1FVCB 2WP3T 1Q9LA 3QJHA 2A2QT 5I1IH 3X3GL 2V2XB 5DWUH 4DQOH 3FB5A 1S5HB 1D5BB 2WBJB 4JY4A 4BSWB 4NJ9L 2F54D 1WWAX 4WI2A 4PJBA 12E8H 3I75B 5KVGH 5HGBB 2IAMB 4Y4HC 1OCWL 3HAEA 1WBZB 4D0DB 3WDJA 4PRBA 4PGDB 3O8XD 4KVNL 5FKPB 2WINB 2BNRA 1EV2E 3KPQB 3DARA 2BXYA 4XP9H 2PCPA 4O02H 1RZIA 3MROA 3S6CA 1NGZB 5SWSD 5CEZL 3RWGA 2EDTA 2OX5A 4PJ9C 5A2IH 4X7CC 2AXGB 1HNFA 5F1NB 4M8VA 3QIBD 4TOYH 3F7YB 2P5EE 1F3JA 2R69L 1WAAF 2VIRB 5EBMA 4JCLA 1FVEB 1INDH 3UXFA 3MLWH 5DK3A 5I18H 5B39B 1P9MA 3B2UC 5FCSH 5FYJE 1KLGA 4YXLL 5AAMA 3PWJA 4MLSA 3WN5A 2XNAB 3IVKB 1HILB 2A77L 2X05A 1BQUA 4C58B 2UY6A 3RDTC 4ETQA 4ZFOL 3CIQA 1E28B 4XX1G 1U8NA 4UT6L 1W2KT 1AIFA 1HQ4B 1XGRA 5LWYL 4ZTPH 1GZQB 4NN6C 1IGTA 4UT9L 3BP6A 3BD5A 5IG7A 4GG8B 1BVZA 4PGEA 3ARYA 5ICYB 4L1DA 3QQ9C 2UZYB 5D7LD 3DVGA 2A9NH 1H3PH 1EHAA 1MJ8H 1BLNB 5EORH 1ED3A 4AENB 3ZKSD 4PTTA 3PWVB 4DZ8A 5HYQA 5IIEB 3C8KB 3UTTD 2VAJA 4YAQA 2A1WH 1F8TH 5BVPH 4YQXH 4HG4K 4MXQD 4Z76B 1AO7E 2VQ1B 5KSVA 3HE7C 5B4MC 3FCTB 1ZEAH 2H41A 5HBBA 3V52L 2H8PA 2PXYB 1CLYL 4JZNB 3S34H 5BS0B 3T0BA 3MJ9A 1HKFA 5EUKB 3VFRB 4X5WA 1RIUH 5KVDH 5TGBA 2ORBH 1Q9KA 2XZCH 1FAIH 1Z9MA 4NM4H 4AG4L 5KSAC 4ZPTB 4FMKA 3QUMB 3U30B 5J13B 4NCDA 4PRDB 4UDTB 5IVXB 4PLOB 3EOBB 2RHEA 3E3QC 4P46A 4JB9L 4P2QA 5GS1B 5DMIL 1EGJH 3WD5L 3PF2A 1VADB 4OD3L 2IMNA 4MZ2A 5T3ZL 5C3TA 2HVKA 5EU5B 2PNDA 3UPAA 1PW3A 3KDMA 4NWTH 1IT9H 1VEPA 1X5JA 2BRRH 3DUSA 2D31A 1DUZA 1PG7W 4GAYA 4GRWB 5MENB 2BDNH 4BQ6A 4K7FB 3JWDL 3C5SA 1JV5A 2B4CL 4LAJH 3BKJH 3AS2A 3RWJB 2DQUL 4PD4K 3ZDZE 4P4KB 1OPGL 4YBLB 1S7XB 4WO4C 4OD2B 3VD7A 3U46B 1FN4A 3UZQA 3L3IB 3TF7C 4P5KA 3FZUC 1XZ0A 3KJ6H 1FNSL 1N59B 1CGSH 4JFOB 4ZD3L 3PP3K 3HAEG 5TE7L 2NY5C 5DVKA 1TZHB 4Z0XA 3FFDA 3T0VA 4HH8A 1PDKA 3HA0A 4HJJH 5FEBA 1YUHB 2LU3A 3LDBC 1CFTB 4MSWA 4UZGA 5GGRY 3V4VH 5MHSD 5KVEL 3U7WH 4HGMA 1OAXH 4MCYA 1CGUA 5JQHC 1MCIA 3X14B 5F1KC 1HKLH 5FXCH 3DX7B 1ZVYA 4CNIB 5SWZE 3IDNB 1B4JH 5C09E 5IJKA 2J8UB 3DUHA 1LK2B 4HG4J 3WHXA 1EFXA 2DI9A 2VB5A 2FJHB 4OCYH 4OQTL 4RFNB 3ZTJH 5CZXC 4IIQA 1CD9B 3P77A 1ZS8B 4DGYH 1S7VB 5TF1L 1LMKA 4OCWL 4V1DD 1X6LA 3FN0L 3BT2L 3UJTH 3A6CH 1FZJB 2W0KA 3DSNA 3E3QE 4BH8A 1LWRA 1FFPA 4OUOA 1KJ2L 3G6JE 3W39B 5CBEB 4CMHC 4KH2A 3QSKB 1ND0A 1R0AL 3TYGL 4JRXE 4I0KA 3SKUD 5IVZB 5IBLC 5C0IB 2FWOA 1FORH 3O3BB 3INUL 1A3LL 5KN5B 1FGVH 2G9HB 2PW2B 4NHUA 4A6YH 1U58B 3RWDA 2P48B 1CIDA 4B0MM 4HLJA 3KPNA 3B9EA 1CF8L 3U4BL 2QQNH 3KPOB 2A6DA 3ZHKA 4FQQB 1KG0A 2P5WB 1TVBA 4GO6B 1ZLUK 3C6SB 3MRHB 3PHQB 2W07A 4QRRB 5FA4B 5KS9E 3RVUC 4YXKH 1FH5H 2Y07H 3RTQC 4M7ZC 4PD4J 1E27A 4LU5H 4FFYL 4UIKH 3BZDA 3MV9D 4WY7H 1O7SA 5DD5L 4WWID 1I8KB 4ODHL 4L4JA 3VI4E 3ARDD 3D85D 3MRNB 4EXKA 4L9LC 2CGRH 3VXSD 1YYMH 4DGVL 3R1GL 1ZT1B 3TZVA 4PV8B 4G9FB 1K8IB 4OLVL 3T77A 2UVFA 4IS6B 4POZD 5LGJB 1EEYA 3D2UB 4N8CL 2ICWI 3NZHL 5C0AD 3SO3C 4DUVA 1DVFD 1Q38A 4JY6A 2E9BA 3O2WH 1IQDA 5FECB 1E4WL 2EZ0D 4HUVA 4XCNB 1IQWL 4L8CB 3OPZH 3VFSB 4JO2H 2ZSWA 1U92B 3NABL 1CDGA 2P24B 3CSGA 1RY7B 1QSEB 1P6FA 1X5IA 3KNBA 9CGTA 4JRYE 5DR5H 5EZIH 1QLRA 4MQXD 2CMRL 4N5ED 1ZANH 2HTLD 3VXRE 3X11B 3FAXA 1YNTB 4F3FB 1RULH 2P7TB 2X09A 1QRNA 4YC2B 5H37G 1MJ7L 3RUGE 4PG2C 3BP4B 4LHUB 4RFOL 5CGYC 1P4LB 4XAKE 4OLEA 1UWGL 4MWFA 3FRUA 2AXJA 4UOW1 1EEZB 3FAWA 4PJIA 5F3HB 2MCPH 1U8JB 4MX7A 4WW2A 1F02I 3KXFA 5LQBL 3PP4L 3QNYA 4GW4B 3T1FB 4QOKD 3CVHH 3N85L 1NKRA 2Z8WC 4JVWA 5DA4A 3WIHL 4HDIA 3CVIL 2YK1H 2YPLB 2ZG3A 4GG6F 1QFUH 3FT3B 5CJQH 5INCB 4GXUM 5CWSB 3IAGC 1SY6H 1XF3A 1NCAH 4PRIB 4KUCD 2YZ8A 4Y4KB 3R8BB 5J6GB 3O3AA 3DMMA 4I13B 4XMPL 4X99A 3QWOB 4TNWF 4FQLL 4OZ4B 5I1EL 1E4KA 4LK4A 5C9JB 1A9BA 1W0VB 3MBED 3O8XA 1NMAL 4ZXBD 2GYSA 3FO2B 5C0EB 4UNVA 3IXTA 1PBYA 1IGMH 1ZGLM 2QR0B 1DCLA 3ARGD 1DANU 2YRZA 1YPZF 3D39A 2Y5TA 3GMMB 1X5GA 1ODAA 4KDTC 2VLKA 1HCVA 1LD9A 4O2EA 1WICA 4PTUA 4IRJD 1MREL 1NANH 6FABL 1IC5H 4UNTA 5IB2B 3BSZH 4PJEA 1BD2B 4OF6A 3AY4C 3MRCA 4Z95L 1S9WA 1A9EB 2XZAH 4GQ9L 3ULVC 3CGTA 1G7LB 5DJ6A 2O61B 4R3SB 4Q6IC 2MQCA 2NY1B 5C0FA 1N6QH 1U36A 1MIEH 4HMEA 2H1PL 5K59E 4PB0L 5HPMA 2HRLA 5TDOB 3H3BC 1QR4A 5ALCL 3THMH 2VERN 4X6CE 3EFFB 4ISVA 4MA7H 4XVTH 1HI6B 5GGUB 3BKML 2KBGA 4U1JA 4B5EA 4WEBL 4HZAA 5FCUL 3HZYB 4APQB 4WTZA 5HI5C 2X1PA 2VQUA 2V7NA 5DK2A 3NPSC 2CDGB 1TQCB 5E8OB 3NH7L 3BQUD 4LGSB 5D7LA 3GSWA 3MLSH 3BPNC 1N64H 4MMZC 5EIIA 5DQDH 2HKFL 5K33A 2GT9A 1X6NA 3PDGA 3LN4B 1NGPH 1BF2A 4P59H 4JO4L 2XZQH 5C6TH 2XYCA 2XOTA 1T1YA 4EI5C 1WBYA 1BFVL 1OAUL 3RQ3A 5D6CB 5IMLB 4NRXA 3PQYA 3VD3A 3H9YA 4FFWD 3QDHA 3RL2B 4YXHL 5C2UB 1WJ3A 1UM5L 1KJ3H 4JFXB 2R1XA 3S88H 3D6GA 4FZ8H 1QLFB 2QSCL 4ZFZB 2R8SL 2IPUG 2IBGA 1HCFX 1EGJA 4Z7WA 4KI1A 1PZ5A 2ATKB 4O5LL 4U0QB 4MVBD 4WCYL 1A6ZB 4P5TC 4QHUB 2APTA 2VZ1A 1SJHA 2EEAA 3SE9H 1KF9B 2AGJH 3EAKA 4MXWL 4OD1H 5DMKA 4BQ8A 3ULVE 2R2CA 1C16A 4HK3N 1T3FB 4Y8AA 1RUPH 1RIVH 4DKEL 1F4XH 5D7IE 1T0NB 2B4CC 4RAUB 2MTPA 3V0VB 1CICD 2NY7L 1MFCL 5FGCB 5DO2C 1WGOA 3MODL 1JHTA 4U7MA 3BJLA 4M00A 2A83B 4UIMB 2ZOLB 4WHCA 1IAOB 4KJQD 3HG1E 3SDCA 1OAZL 3MO1A 5H35B 4L4TA 3G5XA 5TQ2H 1A14H 3U0PB 1JYVA 3SCMA 3JBG7 3ZKNC 1QO3B 3FMGL 3QIUC 4GKSB 2OI9C 5J3HD 1VKXB 4LASH 4P2OD 5HDBF 4RNRA 1EZVX 1U93A 1EBAA 3DRTA 5DLML 3BPCA 2K1MA 3T4AA 3QIWB 2YBRB 3QISA 3MRJB 1AFVH 3QUYC 5HGDB 2NXYD 1HH9B 2H32B 4QHKJ 2BOBB 5AG9A 2PTUA 4G8GE 1MAJA 5CP7B 3T0ED 4K9EC 4KKLD 1JK8B 4HUXB 5F7NC 3E1F1 3TBVA 4O2FB 1A3RL 3D87B 1IC1A 1EJ6A 1J8HA 4PLKC 3NA9H 5IFAH 4XBEL 1JPSL 4R26L 4XWGH 4K23H 4XPAL 5F9AC 2IF7A 3OKOA 3PGDA 5ABDE 4U33A 4MD4B 3WFHA 3OJDA 1FV1B 1AD0A 5EOQL 4L3CB 5D1ZD 1MFAH 5DJZA 1U3JA 2QV2A 3C5ZD 4PJAE 4Y4FC 4A6YA 1M7XA 1MHCA 3L5XH 2CPCA 4KJPD 4XGZB 2UWEE 4HWBL 4NPYA 4IRZL 1T1XB 2PO6A 5L8KB 1EIBA 3BIBX 4XNXL 1WUNT 3TA3D 1IM9D 2AJ3A 5GGSY 2HRPH 3LD8B 3QJFB 4JM4L 1P2CA 3LVEA 3H9ZA 4TPRL 2FX8L 4S1RH 1DZBA 1OLZA 2E7LA 2BJML 4BZ2H 1CDJA 3SKOB 3NACL 3SPVB 2MPAL 3RZCC 4O58L 5FYJH 3RGVA 5FYLD 1WT5C 4AMKL 2OTWB 3DHJA 1KPUB 5E2TH 1Y0LB 5IMMB 2ITCB 3QDGE 5TFSL 3ARFA 1JZ6A 2R2EB 4LSTH 2AJSL 1DQQA 4ORZC 1SVCP 2NY6B 1G6RH 4OFYD 5E4EB 2H45A 5JA8B 3AB0B 3TVMD 4LSVH 3KLAA 4GG6B 5C71A 4L1HA 4RX4A 5LAXA 4HKZB 1CLOH 3O11A 3SKMB 1FRGL 1U3HA 1OF2A 3QDJB 5KSBF 4HMDA 1D9KB 3HRPA 5D7JD 4OV5B 4QCIB 2DJ4A 1Q94B 1MCJA 3S4SB 2DJUA 4JQXC 5C07A 1A0QL 4AIZB 3QFJA 3MJ7B 4JHWH 2PF6A 2IEPA 4ENED 4PJFE 3LSOB 1YPZB 4GBXB 4QRPA 4CGTA 3TESA 4YEEA 4K55A 4CL7A 3V0WL 2VXUL 1DJSA 4KC3B 3VGAB 4XC3L 1JNLH 4JHAH 5JIHA 2YD8A 1CFVL 3ZKMC 1J1XL 2C3VA 5C08E 1XCTA 2DYPB 4FXKA 4R7NB 5IW6B 4CJ1A 5J0BA 4G6ML 3FQUA 3ZT7A 1FNEA 3MXVL 1ACZA 2CRIA 1NLDL 4EVNB 1MRCL 5CSBA 2W9DL 4XPFL 1KGCE 5HI4C 3IFPA 2EE3A 4PRHB 5E4IA 3QUML 4BQCA 1G7MA 4I9WE 5F88B 3UJIH 3CVHA 5CCKL 2BVOB 3IYLW 5D1XA 4N9OB 2OMNA 3WIFA 4CADA 1Q9WA 4I0PC 4WWKC 4LOUD 1T1ZA 1D5MA 1AGEB 1XF4A 3MFGB 5J1AA 2D7OA 3A6OA 5DURD 4RBPK 2BNQD 2AJZB 5D7KD 3CPLA 1D5XA 3OB0H 1P7KA 4RMRA 1MCOH 2ZNWA 3QRFM 2GTZA 4P23A 3VG9C 3K2UL 1QG3A 1LE9A 1PAMA 3MYJB 3WNNA 1F3DH 1WZMA 2DKUA 3I9GL 1OD9A 3MBEA 1YEKH 3VXMB 1A1NA 1J87A 1XGTA 3D25A 2BOCB 4NQEB 1A5FL 2XWBB 5CJOL 3ARWA 4GAGL 3NFNB 5DQ9A 5L0QB 1HSBA 1Q9LB 3QJHB 3TNNA 3EOYG 4HJGA 4EUPH 3FB5B 1W8NA 4KHXL 4M7LT 3AU1A 2XI9A 3IFNH 2FCBA 2VR4A 4P3CH 4JKWA 4PJBB 4M5YL 4X7SH 4XTRC 3ALXA 4PJ8D 3LEVL 5C0BB 2CUMA 4DFIA 1G7PA 2X9WA 3HAEB 4PRBB 2V5RA 5CAYB 1GHFH 1JGLH 1BX2A 1R3IL 4OLZH 4U0RB 1IARB 2BNRB 3AXLB 5DD3H 5EUOF 3NCFB 4F7PB 4XXCC 4M1DH 2YUZA 1RZIB 3MROB 2HKHL 4WU7A 5EO0A 5BV7C 5FB8B 2A73A 5A1AA 3RWGB 3K8KA 3GO1H 1BVKA 3TNMA 5ETUA 5CEXA 3ELAT 1CG9B 5C1MB 4FQJH 4XVSH 5GS3A 1GYAA 1YECL 3C6LC 5DRNA 1F3JB 2ZUTA 3K4DA 4OSUL 5D1QC 5EBMB 2BHZA 3KVQA 5DGQA 1AKJB 1YN7B 3SQOL 4ZUUA 2ERJB 1T66D 5IK3A 3DGCR 2QADB 4JR9H 4NRYA 3RRQA 1KLGB 2NZ9D 4M1GL 5LXGL 3O2VL 1EPFA 3PWJB 5GISH 2OZ4L 4WUUD 4WW2F 3WN5B 3MLZL 1K6QL 3RVVC 2NY3D 1LEKB 3MV8E 2AP2A 5IUSA 5T3XH 1KT2B 5C70A 2VDNH 1GGIL 3ESUF 4LIQL 4ETQB 2AABL 5BO1H 1U8NB 2R56L 4ODXA 1AIFB 1DDHB 1XGRB 1VGEL 1IGTB 4OJFL 4RAVA 1UZ8A 4JFDE 1PY9A 1UM6L 2FO1A 3BISA 5E2WL 1S7QA 3IF1B 5IG7B 5HYSA 1TQBB 5HYEA 2VTFA 1G9NC 3DVGB 1DBJL 3PJSA 3I6KA 1YEFL 2NY5H 3RHWK 5I16A 3P0GB 1EEUA 2NW2A 3V5DB 1ED3B 2BSRA 1RUAH 4PTTB 5HYQB 2EC9U 1JI2A 3EUUA 4OCRL 4YAQB 4KRPB 2BNUA 3WO4C 4R0LA 3CC5A 3MNWA 5AD0A 4QO1A 3FO9A 4ZOAA 5KSVB 2VLRD 1U8LB 3IJYA 4Y5VB 5MERB 2H8PB 4FQ2H 1JMXA 4OT1H 4ELMA 1M7IA 1JRHH 1CICA 3I50L 1FLRL 4X5WB 4FFZH 5I73B 1XEDA 1XF2A 5TGBB 3WXVL 1FE8L 2XY1A 4FA8A 5CSZA 3D5OF 4J7RA 1OP5H 5KZCB 4XCCH 3BAEH 1NAKH 4P46B 4P5MB 2ZG2A 4OLYL 5I1DA 1JVKA 2VLLB 2XPGB 4P2QB 4J12A 3OQ3B 3LPWA 1E6OH 3DGGB 5GS0C 4JM2F 4ACPA 4YFDB 4LCCC 4LGPB 1KJMA 3GK8H 3OAZH 3SDDC 1N5AB 2FHBA 3FQRA 5JUEL 3WL9A 1G9ML 2ZUQB 3KAAA 1EXUA 5E08L 2EKSB 5C0GA 3DUSB 4XI5D 2D31B 4GAYB 4JFFD 3NIGF 3B2VL 2EXWC 2NY4C 3P9WB 2HFFB 3C5SB 4H5SA 4CU6A 4N0YL 1JV5B 3FN9A 3IU4H 4M7KH 2YA0A 4OIIH 2DQIL 5E9DA 4IRSC 4DVRL 5KW9L 3B5TA 4HUWA 3T0EA 3QRGH 3FO0H 3BHBA 1I9RL 3LN9A 4QXUH 4CDGC 1H15B 2BHYA 4HHAA 3F7RA 3U7AA 3B3IA 3V5HA 4MB3A 4ALAL 4P5KB 2HFGL 4GXVH 1XZ0B 4TUJA 3GMLA 4Y5YA 1KBGL 1T89A 2F19L 1K8DA 4MD0A 1MEXL 1A7RL 3EO0A 4Z0XB 3FFDB 4S1QL 4MS8C 5HSFA 5HHXL 4NP4L 1VHPA 4R96A 4UILH 4MSWB 2SEBA 1NDMA 1MQKH 4J8RA 5JDSA 4MCYB 1A6WH 1S8DA 1E4XH 5KSBB 1KEML 3SJVA 2CLRA 1A6TB 1KOAA 3N1PC 3C8DA 3MV7D 2VKXA 2EXYD 3WHXB 3G5ZA 4B41A 1CXKA 1EFXB 3P11H 1KEGH 1TZGH 3IT8D 4IIQB 5IQ7L 3EYUH 1N4XH 5KOMC 1UB6A 3QUZD 1MVUA 3BZ4A 3VFTA 1KC5H 4Z7QE 5I8KL 4ONGH 1RQ5A 2ZUVA 1N5YH 2UUDH 3T0WA 5F8QC 4BH8B 1K4CA 1FFPB 2G60H 1ND0B 1CLCA 4ORGA 4MA3A 3TCXA 3NIDE 3WFCH 5JLZA 5C0RH 2HFEA 3QNZA 3MQIA 3TFKC 3TO2A 4TYUA 4LLWA 2FWOB 3UBXI 3MA9L 3KS0H 1AC6A 3IDGA 5GIRA 4NHUB 3RWDB 5GS2D 1RV6X 3KPNB 1MAMH 1TETL 5DJXB 2A6DB 1GC1C 1KG0B 1TVBB 4YK4B 2CK0H 3E6FA 5D9SB 3D0LB 5KOVC 1F97A 3QNXA 3CDGB 2RCSL 5GJTH 1A7BA 1I1AB 4RWYL 1LHZA 3O3EA 1XGUA 1NL0H 5D70H 5JPNB 2GJZA 3UTSE 4X4MA 5I19H 4OI9A 3TZVB 1EHNA 5EZOH 2CLVA 5FUCC 2BSTA 5IHUL 3QAZC 3RVXC 2CSPA 4OCMC 1N7MH 3T77B 1YQVH 3BPLB 1EEYB 4XAWH 5I30H 3NCYS 1JHKH 1CDHA 2DRUA 4NHCH 3HCVA 4PJ9A 5BZWA 4JFPA 4BZ1L 4YDJA 3WSQH 5J57B 4JY6B 2YKLH 2V5MA 1I8MB 1IQDB 5T1KA 1IGFL 5SV4A 1M4KA 2ZSWB 3GSXA 1PG7X 1AXIB 4FQHA 3KR3L 2QKIA 1JYWA 3KNBB 4MZ3A 1QLRB 4U6VH 2BNQA 2XXCB 4XP5L 3GIZL 1E4JA 3F5WB 4AJ0A 4WFHE 1DQMH 1QRNB 1M05A 1JNNL 1F13A 3IJHA 3KPRD 4QRSA 2PR4L 1I3GL 2XA8H 4N68A 4LFHG 5DSCB 3FRUB 3KPSE 4Q2ZB 4M6OH 4MX7B 2FD6H 4WW2B 5DJ0A 3KXFB 5IBUG 3VFUA 5I6XB 4KZEL 3QNYB 1VERA 2AXFA 3WYRA 4UI2A 4EUPA 4TVSa 5LGHL 1AE6H 1QBLH 3JWNC 4NQSB 4ZODA 3BRFA 3MBXH 3CX5J 3I3EA 2PYEB 3V6ZA 1PSKH 3GBNH 5I1GH 2C7UA 5EG6C 3O2DL 1HINL 2A0LC 1XF3B 2F5BL 3HUJE 2YSSA 2D2OA 2WBWB 4ESKA 1VACA 3H9SA 5JZ7D 1GOHA 2Y06H 3KPPB 4K8RC 3IB4A 4FQ1L 1MJUL 4PP1C 4DUWA 3O3AB 3DMMB 4P2RE 4UBDC 1BQHG 1I7RB 4X99B 4JM2D 5FUCE 2Y25A 3BPOC 5BS0E 3RWHB 3WKNA 1A9BB 3MREA 3QEQD 2ESVA 3O3UN 1U9KA 1YNKL 4NIKB 1BPVA 3H7LA 5KSAA 3ZE2E 2RIKA 3IXTB 3QI9D 5FYKD 4QTHA 5T5FL 3PABA 4Y7MA 3D39B 3A67H 2Y5TB 1M1SA 2NY0D 1P4BH 3VXUD 3CK0H 1T4KA 2VLKB 1LD9B 2IALB 4PTUB 3L95B 4YHLH 4JRXA 3HR6A 3HMXH 3CXHK 2B1HL 1O7VA 4PJEB 4ZG1A 1OY3B 3MRCB 3QBTB 1WIUA 4YBQC 4RGOH 1PFCA 5EU6A 4KFZC 1S9WB 1WV7T 3HNVH 1MCDA 3QQ3A 4H8WL 4N0FA 3S3PA 5EBLB 5DJ6B 5GRJH 1DANT 4NT6A 4KY1L 4GMSL 3NZ8B 2I27N 2Y6SD 5C0FB 5F9WC 1I8LC 4TSBL 5HPMB 3KYKL 5GGVL 3TIDA 1D5ZA 1QTYT 4O51A 1WK0A 2PYFA 4ISVB 2CKNA 4U1SA 2EDXA 4Q9QL 4LVHB 4U1JB 4WO4A 1N0XL 4J4PC 5F71A 2X1XR 5EFIA 5E6ID 2ICWA 4NUGH 1K9TA 2P42B 2YMXH 4NN5C 2V7NB 5DK2B 5GGTL 1AGBA 3GSWB 1B90A 1JJUA 2UZIL 5LVEA 5TPWH 1BBDL 3CJJA 4NO0A 5EIIB 2F8XC 2J3SA 1WFNA 5JOFB 2GT9B 1JNJA 4I4WB 4Z0BH 1OD7A 1NFDA 3O6FA 3HTLX 4X9IA 1UH4A 1J18A 1CTNA 4OM0L 4IOFD 4NRXB 4G3YL 5E00A 3PQYB 2DF3A 1IGCL 1MCWM 4K9EH 2AXHA 1XAUA 1G7IA 1LDPL 4FTVE 2HP4A 5ITBH 4DKDC 3VFGL 2Y1VA 4HK3J 4JRYA 3CFJA 4YX2L 4NZRL 3DUUA 1AC0A 2C4FU 4Z7WB 2QQKL 1QOKA 1GPOH 4PS4H 4PYHA 1PZ5B 1RUKL 4Y16D 2I5YH 2IQAA 4ZO9A 2EIEA 4AH2A 3CXHJ 1SJHB 4YC2C 4QEGA 5DMKB 4LLYA 4OZFG 1C16B 4OLXH 2MSPA 3ZL4L 4DEPC 2VXVH 3VGBA 4NRZA 4YDKL 3MCLH 2QJDA 5C0CE 3BZEA 4M9OA 1AXTH 1CL7I 1MPAH 5DD0H 3VFVA 2OS7A 3RTQA 3BOVA 1S5IH 2Q1EA 4JDZA 4TUKL 3RKDC 3SDCB 3MO1B 4L4TB 2ENSA 1ORSB 4KHTL 1LDSA 5E8PA 3HI5L 3CD4A 4QXGL 1J0YA 1RVFH 3SCMB 4L9LA 4D94A 2AJYH 5FOBA 3QULA 3EKCA 3K74B 3VA6A 4RNRB 1U93B 1L0YA 4GAFB 4M5ZH 5TDPA 1U8IB 2UY7A 3DRTB 1INQA 1LO5A 3BPCB 3SGKA 4ZDHB 1PVHA 2X4OA 5EDXA 3T4AB 4I18A 1JYXA 2CKBH 1H3UA 2RR3A 4LP5A 1A4KA 2GW5A 4OZHE 5M7QA 1B3JA 5IT2L 1FGNL 3GI8H 5DUMH 5EWIH 4PY8I 4PY8J 3A6BL 1OM3L 2EDKA 1J8HB 4Y88A 2D4DA 5JMRA 3SE3A 3SBWC 4WI8A 3OKOB 1XGQA 5LBSH 4IHOA 1RZFH 1QSEE 4X5XA 1TVHA 4WGVB 3G04A 3DSFL 3WFHB 4HT1H 5E56A 4PJCE 4KMTH 3OJDB 4Z8FL 3HC4L 1AD0B 5DJZB 2NY1C 2O5ZH 2JCCF 2JKXA 4WRLA 1HWGB 4X6CA 5MP6L 4JHBA 4A6YB 1K5NA 1MHCB 1B2WL 3ZO0A 4BH7A 2V9TA 1NGQH 1WAAE 3GHBH 3I2CH 4HWEL 3VXOA 4NPYB 2PO6B 3JWOL 5C0NC 4APQC 1SBSH 1WISA 2HLFC 2AJ3B 1NUFA 2GJ6E 1P2CB 2EYTB 4PJ5B 1RUQL 1HHJB 1IGIL 2NMSA 3MUJA 2D7TL 5JOPE 3RGVB 5FUOL 4F58H 2YPLE 1EFQA 1A7PH 4HS6A 4WW1A 1YEEH 2PETA 2CUIA 4LRNL 2VLJA 2CRZA 4HWZB 4PRIE 3Q0HA 2B20A 2ZUSA 3EYOB 5IEKA 5SWQA 3ARFB 4XC1H 5CMAB 1DQQB 2JJSC 2VDMH 2DLFL 5HHVH 5ESAA 4K3EL 4YIQA 1UZ6E 5JW4M 1CR9L 1MJJA 2VXQH 3KLAB 2FNBA 4JFYB 4OF5A 5LAXB 2IMMA 2E27L 2E7HA 3BX7C 1F6AA 3CFKB 5ACMA 3O11B 4LCWD 1U3HB 1OF2B 1KCVH 4EXPX 3EZJB 1QSVA 4R4NC 3TV3H 2DQHH 3AY4A 3RY6C 2DQDH 3OXRB 1YEGL 1BD2E 2FEEL 5C07B 3RI5F 1HHKB 3PL6A 3IKCA 1FHGA 3QFJB 1IMHC 1T5WA 2HJKA 4Q6IA 5A43C 4RGND 1I75A 2YUXA 1WEJL 4QRPB 2Q8AL 3RWFA 4UDUA 3O0RL 3GMQA 1BQSA 4N90D 4Z78A 1KCUH 1AR1D 2C3VB 3KYMA 3MJ9L 4D9QE 3D3VA 4FXKB 3TH4T 1TZIB 4W68A 3HC3H 3FQUB 5KJRH 1FNEB 1GIGL 2OP4H 4HD9A 3DVFA 4LRIC 4IEFB 3ARBB 1I3UA 1QPPA 4HFWB 4HJ0D 1SEBA 1O5DT 2R9HD 1X44A 4M1CD 2YPVL 4N8VG 1CYGA 3CVHB 5D1XB 4UT7H 2FH6A 4JO1H 2R1WA 5I8OL 5JQ6H 3WIFB 4CADB 2QQLL 4KQ4H 1Q9WB 3FJTA 1T1ZB 1D5MB 5J1AB 3UP1A 2W0LA 3MNVB 4WHYG 3VMOA 3CPLB 5DT1H 4EI5A 4LLQA 5E03A 3ARED 1JP5A 2BVYA 2IG2H 4G8EA 3BYYA 1QQDA 3QIWC 4IM8A 2GTZB 4P23B 1QFOA 4RAHA 4Y2OA 1LE9B 2D4FA 1FC2D 1JTOA 4PLJC 3QO0B 1HEZA 3ILPB 4HIEB 1FO0H 3MBEB 1QLEL 1A7NL 5ILTH 1JMZA 3D25B 3QI9A 4HK0A 5DUPL 3QXVA 1NC4D 3DVIA 4R7DB 1EHLL 1OGAD 5DQ9B 3HMXA 1HSBB 4UV7L 3TNNB 1JGUL 1Q1JH 2APFA 3GJEA 3AC0A 3L3DA 4HC1H 4HJGB 1NEZG 3B43A 4UINH 5ALBL 1FYTE 4PJAA 1SEQL 3AU1B 1N8ZB 2Z4QB 5E2UL 5AEAA 2X70A 2I24N 2X4PA 4PB9L 1G6VK 4YUEL 1VFBA 3BH9A 2RAMA 4N9GA 1NMCC 3F7VA 1G7PB 3SEPA 5LJYH 3NAAL 2VISB 2XN9E 3VW3H 2LAAA 5F96L 2GUOA 3FTGA 1BX2B 3CZFA 4KKAC 4MQTB 4AEHH 2ZUYA 2DTSA 5FGCE 1QFHA 2DQGL 1FCCA 4WU7B 2LTQB 3OAYH 5EO0B 2A73B 3VRLE 2VXSL 1LNUB 2VN4A 2X89D 2P8LA 5ETUB 5CEXB 4EI6A 3QXWA 1S9YA 2WUBL 3DXAB 1UWEL 3WMSA 5DRNB 3ZDZF 3QDGA 4M6MH 1U8OA 2ICEA 4JFZH 5CZVH 4BKLB 4ZUUB 1KN4H 5J1TC 1FIGH 2FHCA 5IK3B 2ICCA 3P30L 2ZKHL 1G9EA 3QUYA 4NFBA 5E8DH 1QSFD 3UEZA 4DTGL 3MZTA 4X98A 2JIXD 3W0WA 1FPTH 5JHDE 4FQXB 1WQVT 4G6KH 4ODXB 3DBXA 4ODVL 1BBJA 3CUPA 4RAVB 4ZO6A 1UZ8B 1R5VA 1A8JH 1S7QB 4ODSL 3NCEB 2XTJC 3B8YA 3L1OH 3KJ4C 4NM8H 3U1SL 1NSNH 3PJSB 1N6UA 2Y7QB 4K3DL 43CAA 5I16B 2NW2B 1QBBA 1DBBH 2BSRB 4DKFL 2FRGP 3MJ6A 4GBXC 2ZCKL 4FFVC 2BNUB 2EH7L 4S2SA 4R0LB 3MNWB 5C08A 5AD0B 4F57L 4TNWK 4H0GA 4FNLL 3C60D 3IJYB 3T2NH 3G6JF 1P4IL 4HXBH 1F4AA 2IAND 4XCFL 1U8QA 1QKZH 1CFQA 4NNYB 1M7IB 3SO5A 1ZLSL 1EUUA 1ZTXL 4DGIL 2PW1B 3OR6A 3Q6FB 2OR9L 1PG7L 2EC9T 1I1YA 4Y19A 5D2NB 4OZGE 5CSZB 3Q5YA 1J1OH 3VA2C 1XCQA 2A6JA 1IC4H 2ITDA 4YPGB 4HF5L 4K2UH 2V5YA 1C08A 1KUMA 2I07A 5I1DB 4P9HC 4J3SA 4ZTOL 3G5YA 4PV9A 1IKFL 5IB4A 5KS9F 5F89A 3BRGC 4Z7NE 3LIZH 4Y1AE 4ZNEE 1V3LA 2J8OA 3WL9B 1EXUB 2NX5D 3L3OB 3FO1A 3LEYH 3VI4F 2CKBA 5D93B 2YD9A 4H5SB 3VJ6B 2AEQL 1E6JH 1C7SA 3P9MB 2EH8H 1GC1H 1JGEA 5E9DB 4K3HA 4WI6A 4HUWB 5I1KL 3BHBB 5I1IL 3QG6A 1PY4A 2VDOH 4LL9A 4HHAB 4NJAH 2ARJA 5DWUL 3V5HB 4JQXA 1DL7L 1OWRM 2XTJE 4TUJB 3GMLB 2H2SD 2NY2B 4Y5YB 1Z0MA 4HS3A 1A7OL 3F8UB 1K8DB 3IDIA 4MD0B 8CGTA 3EO0B 2J2ZA 4TRPH 4QHMB 4WV1C 4ZS6C 1XGYH 3RU8H 4M03A 4R96B 1CFBA 3FOLA 3P3YA 1JF6A 3QUKA 1NDMB 5IBUB 5IW3A 1NAMA 4J8RB 2BP3A 5JDSB 4OB5H 3ULUC 1S8DB 3SJVB 4U0RC 2R1YA 4XP9L 3JZ7A 1IKNA 2GHWB 3G5ZB 5DQJA 1IAII 2XWTB 3V6OA 4FQCH 3FRPA 4TVPE 3RUGF 4WUKH 4TOYL 1K3IA 5E70A 1U95A 5JXED 1UB6B 1BQHB 3BZ4B 3TWCL 2FBJH 4OGXH 2IH1A 1AO7D 5IQ9A 1INDL 3NTCH 5EIVA 5EN2A 3MLWL 5I18L 1OLLA 4R2GD 4Y4HD 2C3XA 4LCYA 5DJ8A 5AZEL 5ID1A 2EICA 4ORGB 4MA3B 1NJ9B 2YD1A 3BDBA 2D03H 5JLZB 4YHYB 1U8PB 4J2XA 3DURA 2P8PA 3TO2B 4LLWB 3BJ91 5TJWK 3BUTA 1S9KC 3N9GH 4OTXL 5GIRB 2NW3A 3H42H 4ZTPL 1CT8A 4D9LH 3O4LD 4PYGA 1VFMA 2Z31D 4TTDC 4ZUTA 4P3DB 5EU3A 3E6FB 4H20H 5D72H 1RHHA 1KB5H 1MJ8L 2JB5H 3PWUA 2HMIC 1CFNA 1MRFL 1HQRA 3QNXB 3VU2A 3SDAC 4U2YA 4HIXL 2ZOKA 1BFSA 5DJAA 3P0YH 1V5JA 3B2UD 4KRNA 2V17H 3UPRA 2A1WL 1F8TL 2IBBA 2R0ZL 1XGUB 2DD8L 4UB0H 4XVJL 4RDQG 2GJZB 4OBSA 4PJBE 3ZHLA 3K46A 4XH2A 3RIAF 1Z9LA 5IGXH 2CLVB 3MOAH 1X5LA 4QT5A 2BVPA 1T04A 3S5LA 1RHFA 1AHWC 3DYMA 3ULUE 2AK1H 1RIUL 4XXCA 1J7VR 1RZ8A 1UWXH 4NSKB 5T5NG 2BNRE 3RWEA 2ORBL 2XZCL 1FAIL 4NM4L 3HCVB 4PJ9B 5DDHA 5BZWB 4JFPB 1DLHA 3QPXL 1JNHA 2KUTA 3U4EA 1J0ZA 5T1KB 3C6LA 4P46C 5HHPA 4X6CF 2NQCA 1EGJL 3GSXB 2YD3A 5D1QA 4NN7C 4DW2H 5I71C 1UACH 4FQHB 3MOBL 2HT2C 2MOVA 3GRWL 5B4MD 5D7SH 5C09D 4PGJA 5B3JE 1JPST 4L4VE 4XZUA 4NWTL 3BWAA 3RBSA 2BDNL 25C8H 3BZFB 4HGWA 1OTSD 1IJ9A 5D2LA 1WWWX 4M48H 2YD4A 3OG6B 3RDTB 1M05B 2CRMA 3D9AH 2ARWA 3IJHB 1FO0A 5IV2A 4QRSB 5I8EB 4NN6B 3SDYH 2HWZL 4HUUA 2WUCH 2DICA 4R6UA 4BA8A 2HTKD 1J05A 3EFDH 4OZFB 3KJ6L 5DJ0B 1NC2B 4YHML 3VFUB 5CP3A 3K4ZA 4HC1A 4G7YH 4HJJL 4OLUH 1LEIA 3HN3A 4OZIE 2L7UA 3EOAA 3V4VL 1JF1A 4V2CB 3V6ZB 2H2PC 2O5XH 2FR4A 3V4PL 2C7UB 4NYLA 2CJUH 1OAXL 3MRFB 3RL1A 3HE7B 5SWZB 1CGYA 2YSSB 1HKLL 1C12A 2E8YA 4D0BA 4HIIA 1VACB 3E0GA 3H9SB 2GCYA 2P46B 4KV5E 4AQ1B 1F00I 1MELA 4LLAA 1NQBA 3WUZA 5IJKC 1T7WA 3EO9L 5EZLA 1RZKC 2IPTL 5EOCH 3UBXA 4Z5RB 4OCYL 3MREB 1DSFL 3RIFF 2DWEA 2ESVB 1OTUC 3ULVF 2DMBA 2EEBA 2H9GA 3EYSH 3VDAA 5KSAB 5ADPH 5TQ0H 4QTHB 5D7IF 4RRPA 4ZPVB 3PABB 1N0LA 3UYOD 3HE6D 3QO1A 4OF0A 3UJTL 5I17A 5IW1A 4IBLT 3G6JB 3IDXH 4MNQD 4UV4L 4JRXB 4K94L 3H3PH 2P49B 4P2QE 4HQQH 3CFIC 5DC9B 3K81A 4LPUA 3SDDA 1T2JA 3T3ME 5EU6B 4O9HH 5E5UB 1FORL 2P47B 3QQ3B 4N0FB 1S9VA 3QFDA 4PRNB 3IRPX 1FGVL 2WIIA 4NO2A 4A6YL 1LILA 1YC8A 5AAWA 4MNHA 3TT3H 4ONFH 1MY5A 3AM8A 3RA7L 3T08A 3G6DH 4GRLA 2QQNL 3GBML 2N7AA 3QHFH 4IRSA 3TIDB 1D5ZB 2WWKO 3X3FH 2PYFB 2DI7A 4U1SB 4YK4C 4WO4B 4RMQA 3H0TA 4OCSH 2Y07L 4YO0A 2XKNA 5EFIB 2OXGA 2ICWB 4LU5L 4M62L 4WY7L 5HYJD 5T33L 3VXRD 1MI5E 1IBGL 1AGBB 3WV0A 2RB8A 2C1OA 2GSGA 3UTSA 1AJ7H 3LDBB 4NO0B 1YYML 4BQBA 3EIFA 2FYYA 2FO4B 1D3CA 4XAKD 3TZVC 1Y6KR 4TSCH 1NFDB 3O6FB 4NBXB 4QF1A 4UU9A 3N1MC 3C60A 1JYNA 2IANA 5D8JL 5FGRA 4K7PY 4E0RA 5E00B 3JVGC 2B7DT 4KJYA 2C1PA 4PJAF 1QFWM 3KYNA 1G7IB 3M1BA 4JO2L 5HI3D 3GSVA 2UWEF 2OJZL 5C6PB 5L8JB 4JRYB 1CS6A 3CFJB 5JPMA 3DUUB 2EO9A 1P69B 3GSQA 4Y2DC 4CMHB 4C56A 3GKWH 2HVJA 2VLME 4N1CA 1RULL 2IQAB 2XACC 4AH2B 4D3CL 2HFTA 5DD1H 5DMYA 4XXDA 1F11A 4FQIH 1T0PB 3STLB 5AG8A 5L2KE 3O9WD 1ADQH 4LLYB 4M43L 1QVOA 5HD8C 3GNMH 5TDNA 4G6FD 4NRZB 1KLFA 3KPSA 4EEEA 1V05A 2QQQA 2C4FT 3BZEB 5F8RC 2MCPL 1L6XA 3UTPE 1I7ZA 1SYSA 1LO4H 3VFVB 3CVHL 3RTQB 4M7ZB 2IPUK 3S98A 2XKSA 3B6SA 1CZ8L 4JDZB 4Q9CA 4OCNC 3FQTA 2ZP0T 4N1EA 1W0WB 5E8PB 2YK1L 3HUJA 4BM7A 2F53D 3V8OA 3DOSA 3ZYZA 3UBXG 4EIGB 1NCAL 1Z5LB 4L9LB 4LSQH 4U1KA 3FFCD 4P2RA 5FOBB 3QULB 1OGTA 4N8VB 1CXHA 2BFVH 4NQDD 1RI8A 3QZWG 1J9CT 4H1LG 5JIKA 2EE2A 1RU9H 2RFXA 3FQNA 2JF1A 1INQB 1LO5B 3GM0A 1E4KC 3LRGA 5F1IB 2X4OB 2D7PA 3O8XC 4MJID 1J8KA 4PJFF 4F9PA 2EDJA 3BVNA 2WM0A 3SO3B 2Z93A 1A4KB 4NCC1 3TM6A 3N1QC 1MQ8A 1MCEA 1U8MA 15C8L 2OL3H 4DUXA 5ISZD 1NKOA 5DVOA 3I6LE 1WWBX 1NGYA 5H2BA 2ATPB 5I0DA 1IC5L 5I1LA 3BSZL 3QIBC 3LS5L 4NZUH 1GVIA 1DUYA 3UC0L 4NJ9H 4IHOB 4MYWB 1T7VA 4X5XB 2C4XA 1KTDB 3G04B 3OKDA 3QUXD 2CDEA 4WFGE 4RDQF 3GSOA 2W60B 3K4AA 1N6QL 4X6CB 35C8L 2HA1A 5CEZD 2DI8A 4MA7L 3L7FA 2JTDA 3R8QA 3EDEA 1FYHB 2XG4A 5T5NF 5L88L 3VXOB 5DEZA 3MUGA 3O4LA 4Z7VA 2VKWA 4KI5D 2H3NB 1KB5A 2Z31A 7CGTA 4PJIE 5KSUB 3HNTH 4WI7A 4L3EE 1FIEA 2R69H 3D48R 3MLSL 4RMSA 1JGVH 1X4YA 4F37F 3PGFL 3DV6A 3PNWA 5L7XL 1H3VA 3IAQA 1VB9A 5LCVL 1H8OA 2XKUA 5C6TL 4HS6B 4F2MA 4WW1B 3U2SB 2OYPA 4YHNB 4XBGA 2BVQA 2VLJB 3S8WA 1KNOA 3TO4D 4MXQC 1A6UL 2F54E 5IEKB 5SWQB 3MUZ1 3HPLB 2NXZD 3HG1D 1JPTH 4FTVA 5ESAB 5LWYH 4YIQB 1KJ3L 4H0IA 1EO7A 1MJJB 3LKPA 4UT9H 2KQMA 1JE6A 1OAYL 2FJFA 3DI2B 5SWSE 1F6AB 3D39E 2ZJSL 3D69A 5I1AA 2PUQT 1ZA3A 4RISL 2OSLA 4PJEE 2EDDA 3IGAB 3PL6B 1YJDL 2D7MA 3IKCB 1T5WB 5F9JA 2HJKB 4Q6IB 4OD1L 4X5LA 5D7IB 2CXGA 3FT2A 1EH9A 1F4XL 1RSFA 3V52H 5I9QC 3RWFB 4UDUB 3R0MA 3WNKA 4UUJB 1KJVA 3GMQB 2R4SL 3CMOH 3RKPA 5F7KC 1GGTA 3KYMB 3D3VB 1J0HA 1ONQA 3MRBA 3HLAA 4AG4H 3S37H 4M7LL 1E0OB 2E5EA 32C2A 1CQKA 1BHGA 1U6AH 4LARL 5B21A 3SDCC 3NPSB 5TQ2L 1A14L 1BIIA 2ZUUA 3B9KD 2E8ZA 3LZFL 1NUGA 2R1WB 5T3ZD 3BPNB 3WD5H 5F7MC 5DJYB 5D7LE 4NNPH 3BDXA 3MTRA 5T3ZH 1GAFH 1OQXA 4EDWL 4KTEL 2EIDA 1RAMA 3ILQD 3IDMA 4HV8A 4EI5B 4LLQB 3UTTE 2EO1A 3D0VA 3PWLA 4Q97A 4G8EB 3DECA 1QQDB 3VE0A 4UAOB 5ERWB 4OZHA 5JMOC 4G8GB 1TCMA 3IKKA 3LPFA 1R3LA 1WLHA 5DJ2B 2EDQA 2DQUH 1UKSA 5CHNA 3PQYE 1A4JB 1HEZB 3I3BA 4UOW0 1OPGH 5J56B 1T2XA 1YDPA 5HHMB 3NA9L 4OGZA 2BRQA 4XPHH 3WIIH 3JV6A 5IFAL 4HK0B 4M9PA 3BN9C 3P4OA 4XWGL 4K23L 3IU3A 3QIUD 4J3TA 1WZ1L 1R6VA 4PJCA 5DFTA 5C6WH 4Z7WE 4Q0XH 3C09C 3L3DB 4P5TB 1MFAL 1R5WA 2D9QB 1BAFH 2WQ8A 4PJAB 3L5HA 2ZWLT 3UO1H 2X70B 3CSPA 4AZ8A 1VFBB 3EJJX 3BH9B 2UWEB 4N9GB 3L5XL 2C26A 1YZZA 3F7VB 4EN3D 3W2DH 5D71H 1CE6B 2GUOB 3FTGB 3VDCA 2PO6C 3CZFB 1MCFA 2GJ6A 1CU4H 3V6FA 1NLBL 4WVRA 1OSPH 4NQCD 4OQ1A 3J8F7 3FQXA 3WFDH 4OCWH 3DNKA 1CDBA 5EB9A 3BT2H 2P8LB 3RHWF 5F7DA 1YYLH 2E7LC 3QXAB 4GS7C 4Q9BA 4EI6B 2VXTL 3STBA 5FYJL 3SGJC 4Y5XC 1S9YB 4P9HH 5DUBA 5ELIA 2Q20A 2OI9B 4ONOA 1R0AH 3TYGH 1U3ZA 3QDGB 5I1CL </