4S2SB

Crystal structure of fab fragment of monoclonal antibody roab13
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
217
structure length
217
Chain Sequence
DIVMSQSPSSLAVSVGEKVTMSCKSSQSLLYRGNQMNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTEFTLTISSVKAEDLTVYYCQQYYTYPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords RoAb13 Fab Heavy chain
publication title A Linear Epitope in the N-Terminal Domain of CCR5 and Its Interaction with Antibody.
pubmed doi rcsb
total genus 54
structure length 217
sequence length 217
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s2sB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s2sB01
2N7BA 3HKFA 3U9PL 3GRWL 3W11C 5HHQB 2YPVH 3RGHA 4Y1AE 3D0VA 3PWPD 5GJSL 3RUGE 4FFYH 4PRNB 3SY0B 1KB9K 4O51A 4M62H 2WWMD 1ZT7B 1BZ7A 1CIDA 4XMKL 3T1FB 1HNFA 3UAJD 1PZ5A 5A2JH 3GGWA 3M1BB 3DUSA 3MUGA 2OSLB 1CXHA 3KWWB 1YYLL 4RFOH 5BRZB 5F72S 3BIKB 5SV3A 4YQXL 3T0EE 3EYVA 1H3VA 3DXAD 3NPSC 5IVZB 2NX5E 3ZE1F 2FX7L 2XT1B 2CKNA 3ALXA 1WC7A 3GB7A 5EN2A 4I4WB 3GHBL 4ZXBC 1NFDF 2FIKB 4HKZA 3TESA 4U6TA 4BM7A 2EIZA 4LEOB 1CFVH 5ALBH 1A6WL 3EYFA 2BRRL 3QZWG 3CVHB 5F9DC 1PG7X 3MRIA 4Z77B 3LKSB 5DURD 1RIUL 1LP9B 4JFEE 1YPZB 1E27A 3ULVF 3PL6C 1OGAA 1E4JA 1INEH 5HDOA 5I1HL 4QY8B 3EKCA 5GZNC 1JPST 5FV1L 1FO0L 5GHWL 5AAWA 2OX5A 3WXVH 1T2QL 3WKML 5H37G 5HHNA 2I9TA 1NUDA 4YZFE 3UO1L 3ETBF 4F57H 4X9HA 5BQ7B 4I2XE 5LBSL 3DX7A 4NKIH 1RJZB 4F9LC 3U36A 2FL5B 4FS0A 2AJUH 5A2IH 4TSCH 4GO6B 3QRGL 1VFAB 4ZAKD 1WIUA 1NFKA 4ZO8A 2LVEA 4HQQH 2XRAL 1XF5A 5I2IB 2FBJL 4QTIH 1ZA3B 3NCCB 2KPNA 4AK1A 5EUOF 2NNAB 3RVTC 1FNGA 3EFFB 1BJ8A 2H2PC 1JV5B 3HE6B 3BI9X 2PYED 3TH3T 4D9QD 5TDNA 2CMRH 2WIIB 4HZLA 1BBJA 2AQ3A 5KSBE 2BJMH 4P2QB 1T1YB 2DQFA 3N9GH 1MCIA 3WN5A 1I7TA 5E2VL 3MYJA 3PP3H 1JVKA 3JTSA 4A2LA 4PJGF 4NHCL 3TVMD 1MJJB 4QYOA 4OCNC 4RAUB 3UPAA 4XC3L 5ETUA 4PGBB 1YEHH 3LKPA 4QCIA 3CCHB 1EK3A 4G3YL 3FCTB 1RFDL 5KS9A 1I8KB 3GMQB 4GSDL 1UKQA 4M5ZH 4DN3L 4XB8A 1QRNE 2JJWA 4KROD 5DFTA 5B38B 2EIBA 2XQYG 3MRNA 3VFMB 3U4EB 3VD7A 1IC4H 4MVBC 3O2DA 1EFXA 3ECBA 4NO3A 1YN7A 5J13C 2WW8A 4Z7UF 4UT9L 4Y8DC 5DFVC 4QOKA 3RX5A 3DIFB 3DPBA 3MNZA 5GSVA 5GSRB 1CXIA 1U8LB 4G6AD 4NYLA 3T8XB 2R9HC 3MRFA 4YHZL 4M6NL 1GOFA 4MJ6A 1RUMH 1T2XA 5FOBA 1LEIA 3V9FA 5EDXA 3LN9A 2IADB 4NT6A 1YECL 3D18A 1U3HC 5E9DB 5FB8A 3AXLA 1NJ9A 5B3JE 1MCSA 3QI9A 3NCEB 4HGWB 3BEWB 1AJ7L 1U92B 3QBTB 2G9HA 4TQEL 5I1DB 2X4NB 1DQDL 5F7EH 5E08H 4HEME 2GHWB 2ORBL 3WUZA 2E8YA 4JRXD 1SMAA 1IL1A 4H25B 3K2UH 4Y4KA 3NIDE 5HGBB 1UJ3B 3LS5L 3STLB 4OKVA 4R8WL 4PJHF 4PRPE 1TQCB 4ISVA 4POYA 2FJGA 3QUYC 5D2NE 4IMLB 4U6YA 5DHVB 5IEKB 3IT8D 1OGTA 1J5OH 5CJ5A 1NGYA 5J1AA 3UTTD 3H7LA 3QXVA 4Y5VC 1T83C 4LDLB 4WCYH 3KPMB 4L4VE 3HZVA 4M02A 4ZUVB 4KRNA 3GKWH 2VDPL 4KZDL 1EHXA 5HSFA 3VFTA 5KSVB 4OLUH 2FATH 4X8XA 3QG6A 4F33B 5JLZA 1NC2A 2NY1C 5KAQG 2FSEA 3HNVH 4UIMA 3KPRA 4KK6D 5ANME 3VG0L 4I18B 4QHUA 5HYFA 3QDJD 3DV4A 1TIUA 3HUJB 3WJJA 4FHBD 5IF0A 1XMWA 2C4XA 3GMPA 5HYEA 4ZYKB 5IQ9A 3S4SB 3TGXA 3R8QA 3OF6A 3UPCA 4QRQA 4RIRA 4UU9A 4QHMB 5C86A 1S7UA 1P69B 1YEFL 2RCSH 4LRNH 2QADD 4NZUH 1ZVHA 1RK1A 1MCHA 3RWJB 1I7UA 1FGNH 5GIRB 4KTEL 2B5IC 2CXKA 1T21A 3P0YL 2W59A 1LK2A 1NC2D 1V05A 2VXUL 2VR5A 4L4TB 3ZE0F 1DSFL 3FT4A 3IDNA 4GRLB 4GRWE 4X8JA 5E6ZA 1MHHB 1A6UH 3B3IA 2WZPD 3I3DA 4DGYH 4PP2B 5F3HB 1X7QA 1HZHL 3BP5B 1U8OA 3RWGA 3GSVB 3EZJB 4NM8L 1BFOB 3BHBA 1BF8A 3VFPB 3WNNA 4NBYB 1T7YA 4QT5B 2X6MA 5DD0L 5E6ID 5J11C 1VKXB 3GEWB 4GKZB 1NGPL 3MLXH 4JO2L 1A0QH 1C08A 1OAYL 4FQLL 3TC9A 4P3DA 3WIFA 4Z7VB 5JHLL 2VOTA 4PRHE 4HIXL 1RAMA 4ZQKA 4OLYH 2EXYC 3TBTA 1A14L 1QUNA 3NFSL 4AQ1B 4D0DB 4H26B 5IMKA 3O2DL 2XYCA 2M2DA 1BFVL 1XZ0B 3FO9B 2K1MA 4KDWA 1VDGA 4KH2A 1XGPB 2BHUA 2LFGA 3NIGE 4LHUD 5GISH 1DZBA 5GJTL 3TFKC 4J3SA 4GG6A 4N8VG 5EO9B 5C7XL 3SE3C 2VAAA 3PE9A 3GJEB 3R0MA 1N26A 1KELH 3BP7A 4F7PB 4WI6A 2EYTA 3HFML 2JELL 3VWKC 3WBDA 2IFFL 3U7YH 4Z7QE 3NZ8A 4LU5L 4N1HB 3S4SG 4DN4H 5HBBA 3ARED 1ZAGA 3L3IA 4L9LA 5B21A 4PLNC 1Z9LA 3N1GC 1TTUA 2W65A 4XHQA 1BGXH 2DQGL 3KDMB 3WHXB 43C9B 3DUUA 1S7QB 2E6QA 3G5ZA 3U30B 4M9OA 5DRWA 1DEDA 3ES6B 2DIAA 5DDHB 4HIIA 3TT3L 1UC6A 5LGKA 4FQXB 2XG5A 2VDQH 5MEOB 4RMWA 2F5BL 5HHXL 2ZNXA 5HYSG 1RZIA 2A0LD 5EO0B 4Q0XH 3PWUB 3MCKA 4ODHH 3NGBC 4EDXB 1QSFA 3KR3H 5F1NA 4DK3A 3TPKA 2GJ6B 5C1MB 3DX8A 3PP3K 3LPWA 2R56H 1FZKB 4GQ9H 4M6OL 3QUKA 3Q6GL 3FQNA 3HC0B 4QHNA 3QPXH 2HN7B 3NACL 5BRZE 3O6FC 4HFUH 1G6RL 3AU1A 4Z5RA 1DCLA 3LQAL 4KUCF 3W9DB 4HSQA 4X9GA 2CUMA 2VLJD 2RFXB 5IMOB 1G0YR 2ICWB 1ZHBA 3ELAT 1ZS8B 1A7OH 2C5DC 3GJFA 4ZTOH 5LGHL 4NC1C 1JFQH 1KB5A 2BCKB 3VFGH 1OTSD 4POZC 1KOAA 1AQKL 2GFBB 4XMPH 4XP6L 1DN2A 4YPGA 4KRPB 4P5TB 3GSWA 3MZGB 5T3ZD 5DWUL 4A2MA 4YGVB 3HB3C 4WV1C 2BY3A 2Q20A 3LPGA 1VADA 3ARFC 5BO1H 1GHFL 4APQB 2PO6B 4NDMA 4O2EB 1YY9D 4ONGL 4PBWD 4IRJD 1FYTD 1FL5B 2Q86B 1KT2B 4LEXL 4NFDA 2LU4A 1I8LC 3W9EA 2AQ1A 4U1HB 2HJLA 2X70A 3G04A 3TJHD 4U1JA 5MERB 2IQAA 3VGBA 2KZ1B 4PJCB 3BUYA 5F8QC 1BAFH 5HPMB 1O7VA 1KCRH 3WFDL 3LIZL 5EOQH 4LLVB 4Q58C 4CJ0A 1PQZB 3L9RB 2QQNH 4PLJD 3H42H 1EEQA 3QUXD 2OMBA 1T22B 3O45B 3VD3A 1I7ZA 4L8DB 1WICA 3U1SH 4K3DL 5CBEB 3NBNA 3QUMB 4MA7L 4LPWA 4PY7B 4YFLI 2X4PA 5JZ7C 4MS8C 4CVZB 3TF7C 1MCPL 1ACYH 5B22A 4JFOB 4JFFA 4IOSD 3C60A 4F3FA 4YFLF 1UM5L 4OKDA 2IG2H 1CIUA 4MB4A 1JYNA 1R3HB 2JCCA 4YH6A 3VCLA 2W9EL 4H88H 2VZ1A 4PY8I 3REVA 1RIHH 5IKCA 4DCQB 5H2BA 3WO4B 4W4NA 1KUMA 5I1IH 1QHPA 2X4OA 3OAZH 1ZLWH 4K9EH 4KKAD 4P2RB 4WFGD 1QKZL 3VRLE 5FO7A 2VC2H 4Q9RL 2ZJSH 5IMMB 4MDJB 3RIAF 1RZJL 1AIFA 1HQ4B 4F7MA 4KK8C 1A7NH 2XZAH 1J7VR 3QDMA 3IFOA 3EYQD 2ZP0T 4RA0C 2Z0BA 4XPTH 4JFFD 4FQIL 4ZDHB 2NTSP 1KNOA 3RJQB 4BSVA 1Z5LB 4FQJL 1PY9A 4ZOCA 1NFDB 1CICC 3MUHL 3I02B 4JZNB 5DK0A 5CWSA 3DV6A 5FGSA 4KJPD 5HTSA 1LO2H 1IGMH 2CLZB 4P48A 3MJ6A 1S78D 3DMMD 2ATPB 5JXEC 2YZ8A 1Z0NA 3P30H 2ADGB 2C7UB 1P4LA 4EI5D 4JQVA 4JB9H 5SWZD 3FRPG 4OUUA 3BD3A 1QFWI 1GC1L 1WLHA 4R2GC 1I1YB 1ONQB 2VLMD 4GJTB 3WSQH 5SV4A 4GRMA 1D6VH 1FNSL 1E4KC 3GHEH 3MV7A 1U2HA 4DKEH 4OCWH 1S3KH 4NOFA 5T3ZL 5FFLA 5AWNH 5JOPD 2ED9A 3MV8D 3K4ZA 4K7PL 5CZXD 3HI1A 4P5KB 1ACZA 2RBLA 4R96A 4X7TA 2NY0C 1MJ7H 4MJ5A 4XCEB 1T7XA 2YS4A 5J12C 2R2EB 1UFUA 1VEOA 1A7QL 1TJIL 5D9SB 2P5WA 4K3JH 5CBAA 4HKJB 2XY2A 1IE5A 1CTNA 1NMBH 5JDJA 2A73B 1S9WA 4M61A 3AMKA 5DJCB 1DN0A 1IEBA 4TVPH 2VXSH 5C08B 3LQZB 3KPNA 3BH9B 4HJ0D 3MNWA 3WEXA 4LCCA 3F12B 2OZ4A 2JIXB 2QSCH 4PJFF 5EUOB 5D71H 2J88L 3LEYH 2HKFL 1MJ8H 4YHPA 2JKXA 5J6GA 1C16A 1CLZH 3V0VA 4PJ5B 5JUEH 3CDGA 3WFHB 5F7YC 3U9UB 3D39B 1IT9H 4OZGF 4MQTB 1HIML 1Q38A 3MFFA 4OZ4A 3MR9B 3VGGA 2CMRL 1XT5A 5CKGA 3EJYC 4JRYD 4HS3A 5B39G 3QWQB 3IDIB 3OHXB 4P4KA 1D5BB 3NPZB 3BPCA 3ILPB 1NBYA 1F4YH 3HUJE 4IOFC 3EO1A 3KJ4C 1OT2A 4KJWC 4U4BA 2WANA 5DK3A 4FA8A 5HHOD 1CDGA 3LRSA 5D1QB 3QQ4B 4P4RA 5LVEA 4PJGB 1R3IL 2GTZB 1UXSA 2VDLH 2VLRB 2Q6WB 2F5AH 4X5XA 2XN9A 4JDTL 4L3CB 1N8ZB 4QTHB 1F8TL 4ZUWB 1LO4L 5HPOA 2VLKD 5CZKA 2F74B 4K94L 2R2CA 4YX2L 2BERA 2O5XH 3VRIA 1X5YA 1T03H 1CFTA 1EZVY 3IXTA 4F9PA 3CH1B 3C6LD 2VWEE 4UAOB 3MLSH 1OAQH 4Z7UB 4P4KD 2FCBA 1IFHL 4QRPA 5MENA 2HVJB 1X5GA 3MBEA 3HC4L 1KPUA 1FFPB 2J6EA 4U0RC 1A9EA 4FNLL 2XV6B 5E1AB 2P24B 3GSOB 5CJXA 2YUXA 1CVRA 4RGNC 2XN9E 2VL4A 2VZOA 3MROB 5JR1H 4YDLC 5CEYB 3SOBL 1ZT4A 3DOSA 3SQBA 1GGBL 3MRLB 4LSRL 1S7SB 3WFZA 5HI5C 5JORA 4HK0A 3O8XD 4H8WL 4NSKA 2X4RB 1KTRL 1OQXA 3PV6B 2I26N 2VB5A 3O9WC 3OAYH 3CIQA 1DBBL 3EFDH 5F89B 4MA3A 1JZ2A 2X41A 1T04A 4FZEH 4X6FA 4NKDB 1FAKT 4QRPD 4Z7VE 5MEND 4RCAA 4W4OA 4RA3A 3AM8A 4CRPA 1PYWB 1GPOL 1RU9H 1YYML 4PJHB 2F58L 4YO0A 3RIFF 1Q0YH 3FQUA 2DM3A 4RFNC 1S7XB 1JHTB 3MFGB 4C54A 4NUJB 4OQ1A 3F5WA 2FLBT 4U2YA 2NYYC 3MUJA 4PJAA 3UZEA 5IR1A 1DUZA 4H1LB 1J1OL 3J7HA 2BSTA 4HWNA 5DMGC 1NAKH 5JA9A 3V5HB 2XICA 5LWYL 4HIJA 2FH6A 4GW4B 1FBIH 1FFNB 1AGBA 3DETD 2YUVA 2NZ9D 4NGHL 4U49A 2P7TA 3MOBH 3O6ML 4GXVH 5GS0C 3E8UH 1MY7A 1RZKC 3IF1A 2MKWA 4KRLB 1B88A 3ARQA 2OP4L 1R3LB 2Y06H 4NQDA 2RCSL 3W5NA 3P4LA 4WI4A 3OPZH 3TIEA 4R4BA 5HYJA 1OAKH 5BZWB 3TT1H 3TO4C 1GZPA 3IB4A 4WVRA 4X6EA 5CUSH 3GBLA 4P2OC 5L2KB 1YNKL 5KBNC 1NANI 4N1CA 1P5VA 4IRSD 4GKNB 4JPVH 3PWVA 3VH8G 4JY5L 4LPXA 2NY3C 1I9IH 1UZ6F 4MMZC 1S5IH 4XPBL 2VDRH 3OAZK 3OKLB 2D31A 5C6WH 3X14A 5JQ6L 3BDYH 3Q5TA 3U83A 1ZHKA 3KPTA 1D9KA 5T1KD 4PJEF 1J1PH 4CVXA 3KPPA 4NQDE 5LCVH 4ONFL 5ESVA 2AK4D 3BZFB 1T1XA 5C07A 3S35X 3NPSB 4QHKJ 4EN3B 4QRRA 1OP3H 4LCYB 3TO2A 5HYJD 3MLWH 1DL7L 5EBWB 4P99A 1IARB 4TUOB 1HNGA 4ZXBB 1WCBB 3FT2B 2GK0B 1DVFC 4F37F 3P0VH 4JQIH 4NNYB 3V4VL 1JNLL 3VMOA 1F4WH 3ARDD 1H3GA 1HHIA 3DVFA 2YKLL 4OQTA 4JVPA 4LARH 1XGYH 4WUKH 3IS0X 1SYVA 2NY5L 2GUOA 1CGTA 5GRZA 2XFXA 3NVQA 1RV6X 3NZHL 3QH3B 4YHOH 3B9KA 4N0UB 2WK2A 2NW2B 2AW2A 4DW2L 5C9JB 3IFPB 3QQ9D 2HFTA 3PL6B 4XRCB 1T2JA 5C07D 4PGCA 1QFWM 4NWUH 4KVCH 5C92A 1GGIH 3DVNA 1GZQA 3CSPA 5EPMB 4KRMB 4XNQA 5EOTB 4PJCE 4GS7B 1UB5A 1JWMA 2VKWA 4I13B 3QULB 4GMSH 3ULSB 3ARUA 5I18H 5BJTA 3VFNB 4LMQI 5GGVH 3B9KD 4U05A 4M8VA 1WBZB 3P9WB 3W5MA 2IH1B 3WNOA 3MTRA 4N0YL 3QR2A 1UYWL 2P42B 4WFFD 1KCSH 1RULL 4XZUA 1TMCB 5DMKA 4JKWA 2YXMA 3GIZL 5I8CB 5C0RH 4PGDA 3GBMH 3CH8A 4BFIB 3QFJB 4PGJA 1P5UA 1ZLVK 4XNUH 4OZFA 4JN1L 2AI0H 3GIVB 1AGDA 3IU3A 4OV6F 3U2SA 5TE6L 3TWCH 1EJ6A 2L4OA 5D1XC 4XVSH 3ZTNH 5KVEH 5IBTL 2GY5A 4JPKL 3MLUH 1DQML 5KG9A 4ODHL 1B2WL 4XH2B 4BFEA 1UA6H 5IHBA 2FX8H 1W0WA 1J87A 1WFOA 5GQBA 5EIVA 4D9RD 3SE9H 3KJ6H 5JHDE 2Q8BH 4KVNH 3CLEL 2DWDA 4HHAA 4AYFA 2XG4A 3RU8H 4HCRA 2GI7A 3VDCA 3C5ZC 3HR5B 2OL3A 4E5XA 5MHSD 1KGCD 1ES0A 2P8MA 2PXYC 4J7RA 4I5BA 5J1SC 2DD8L 5BVPH 4LPVA 32C2B 2P5EB 3SGEH 1NFDE 2VXVL 4G43A 3MA7B 5F3BA 3SO5A 3E6HA 1LMKA 2XTJC 1JGLH 4O00A 4LCIL 4UV4L 4BZ1H 2DL2A 1NUGA 4GBXD 4MD4B 5J13B 1A3LL 4TNVK 2X1PA 4Y19D 4Y2DC 3SE8L 1IEHA 3L3KB 1EHLH 1FCCA 3EDEA 5DEFB 1YUHB 1ZLUH 2V5RA 3RWFA 3GSUB 5DTFA 4MNQD 2H32A 5IJKC 3ARGD 2F19H 1DBKL 1RZFH 2R1YA 1I3VA 3K8MA 3IGAA 3K81A 3T0DA 1ITCA 1U3HB 2XOTA 5DS8A 4HUUB 5I17B 3ZL4L 4L3EB 3V6ZA 3ROOA 4LSPH 5CEXB 4H0GA 2J2ZA 3TH4T 4MA1C 1XCQA 5FHBH 4FTVD 3KPQB 1RSFA 2MKLC 5HDBF 3OAYK 3IVKB 5I73B 2EEAA 3P3YA 1RURH 1IQDB 2D4FA 3EO9L 3GSNA 1CXFA 1JPTL 3IFLL 3OBAA 2W9DH 1N4XL 3WDJA 4BYHA 2YD7A 4LCWB 3FB6B 1QEWB 3V8CA 1EPFA 3C87A 1F6FB 3HPJB 5IVXF 5FUOL 5C08E 5IM7A 3DARA 5TE7H 3EOTL 4KI5D 1FG9C 1RUPH 1MELA 3BESR 5FUCE 4QXUL 5EUOE 3C5SA 3TYGL 4YHKH 5EIIB 2R23B 1C5DA 3QNZA 1YEEH 4EVNA 2CLVB 3SJVA 5F9JB 5H94A 3L7EA 1JNNH 3CX5J 4PJ5E 4NN6C 2AXHA 3ZDZF 1WT5A 3DUHA 3MXVH 1A1OB 4KHXL 1EO7A 2BOBB 3B5TA 3WNPA 3RPKA 3EHBC 5GZOD 5BS0B 3C9NB 4XAWH 1U6AL 4HF5L 3QCVL 3UBXG 4I0PA 4OD1L 3MMEB 3O6KH 4WEMB 1CL7L 3D69B 2P8LA 4PJDF 4UBDD 2WBJB 4PJGE 2NR6D 4LK4A 4JFHE 3SDXF 2BSSB 3QUZA 2XWTA 5C0BB 1YDPA 1BQHA 2VZVA 3KYKH 3QDHA 5F6IC 3UP1A 1E4WH 1JGEB 3B2UC 3SJVD 4YHMH 3C8KA 4KMLB 1XGTA 1KV3A 2B0SL 1V5JA 2B5IB 2X1QA 4OM1H 1JGUL 5ID1B 2ED8A 1A4JB 4RFEA 3VGHA 4J6RH 1A1MB 4NBXB 2OR9L 4Y1AD 1DE4A 3D3VA 2X4QB 2AP2A 1NCWH 4XNYH 4XAKE 5EU3B 1CU4H 1OSPL 3D6GA 4JE4B 4U1SB 3GHEL 3G9AB 1OVZA 3NCJL 3QDGA 5D7LD 3P4NA 1V7NH 4KKCD 1QA9A 3QISA 5DK2B 3LZFL 3T0ED 1L4IA 1MI5B 2BNUA 4K8RH 3BKCL 2NX5D 4LSSL 3VMPA 3VWJD 4CUCA 3L3JB 3VXUD 2YXFA 2HRLA 5J11B 2VMFA 1FPTL 5ISZA 3WS6C 1NAML 2F54A 3CDYA 1U8HB 5IV2B 3P4OA 3K80A 1KXVC 5HYQB 5B3NA 1OY3B 4WHTA 1NUFA 5CP7B 1I8IB 3H7BA 4UQ2B 5ILTH 2RAMA 2J1KA 1LDPL 3MOAH 2VXSL 2J4WH 2AJSH 2X09A 3ZDYF 1J9CT 1MLCB 1X6NA 5J89A 2DRUA 1R24A 4B0MM 4PJFB 3A67H 1PZUB 3WS3B 3K3QA 5HJ3A 3SGJC 4YNYB 3QIBC 4M3KB 3L3OA 4X6BA 1I8MB 1XAUA 2R0WH 4PP1C 3V4UL 1UENA 4BFBD 1AO7D 2PR4L 4JJ5A 3VXOB 3EGSA 3VGAC 4OZGB 1ZKAA 5EZOL 1HH6A 4DEPC 3U6RB 2YEZB 1AXTH 2ADJA 4JM4H 1L0XA 5EOCH 4MXWL 1F4XL 3ZO0A 2QL1A 1TXKA 4XXDA 4MJIA 2D0GA 3VXQB 2VDNL 4RAHA 1S7TA 3VWKB 1F4YL 1S7VA 3EO0B 1FVDB 3L7FA 1CBVH 3RWHA 5AZ2H 4FFZL 4WUUA 4PGEB 1S7RA 3LKQB 2VXQL 4Q9CA 5CJOL 3GJFH 3TBWA 2CGRL 3QO1A 4LLUB 4BH8B 4F7EA 5E7FA 1KB5H 4Z78B 1S9XB 1AKJA 3QEHB 4HPYH 1HCFX 2DQDL 2CIKA 3NFPA 5F9OL 2MQ3A 3R0NA 3S5LA 1FSKC 1RUQL 5EU5A 5C8JA 1OAQL 2I5YH 1FP5A 1BOGB 4JFQA 2UVFA 3ZE0E 3QQ3B 1N2RA 4LSQH 1QNZL 5JIKA 2ATKB 3NGBB 5DJYA 2IEPA 3VW3H 3IETB 4WUUD 5I8EA 1YC7A 3SBWA 5J57B 3L3GB 1UXWA 3RZCC 2MNUA 4GKSA 4OI9A 4P23D 3MLRH 3VXSD 3DO3A 4AEFA 4K7PY 1OD7A 4JO3H 1MREH 1A3QA 1LO0L 1J0JA 3ALPA 5BXFB 3EOBA 5K9JH 4BSWA 3R4DA 1U8KB 5I16B 2Z31D 4CW1B 1CZ8L 1AY1L 4N90D 4DVBA 2A9NL 4TRPL 3SGDH 4GAJH 1LO3H 1QRND 4XMLH 5F7HA 2IFGA 1AH1A 4OZHE 5TF1L 2DYPD 1DLFL 3RX8A 3O3DA 3CFCL 3MBXH 1NLDH 1M4KA 4WV1B 3RTQD 1N3NB 3VXNB 4MWFB 3ZTJG 4C55A 4N0UE 1Q9WB 5BCAA 4D9LH 4U6HB 4JFDB 4ONHA 4YHNA 1V3LA 5I74C 1MCLA 1NCBH 4HWBL 5IB5B 4R7DB 4PBXA 5IB4A 3SCMC 3IJSA 4C83B 4JZJB 4J4PC 4XCCH 1OM3L 1BLNB 3WYRA 3B5HA 4ZUSB 4LRIA 5H35B 3GSQA 4NRZB 1Q1JH 4OV5A 1N0XH 3FOMA 1DBJH 3Q2CA 2PN5A 1P4BL 2Q3AA 1LVEA 3P73A 4HJJL 3CXDL 3FB5A 3T3MF 5FDWA 4E41B 1HK6A 4ODSL 4ELKA 1CE6A 3R1GH 1H3PL 3DECA 4XCNA 4PJ9A 3D2UD 1OWRM 1CDBA 1UM6H 2CRZA 3RL2B 5EO1A 4TULL 3EYOA 4UILL 4HUWB 2X4SA 1OAXL 3CAFA 5GGTL 2AEPH 4PRPD 2MQ0A 4Y7MA 3SDAB 3PGCB 2GJZA 2H3NB 4PFEA 1CR9L 4ZPTA 4AL8L 3GUTB 12E8L 4ZNEA 5ICXB 5AD0B 3KYNB 3O11B 4G8GB 1YC8A 4HKXB 2DTMH 4JPVL 3MLVH 4RGMB 2R0ZL 3MRHA 1VGEH 4GW5A 5EZLB 1NL0L 3ROLB 2NY6D 4PJXA 2FEEL 3SQOH 4M7LL 2Z4QB 2IAMC 2NY2D 2AV1A 1CD0A 1CG9A 4PJEB 3A0OA 1LK3H 1PEZA 4MSWB 4EOWH 3MGOB 3QJHA 5IOPB 1H3TA 1NCCL 2QQLH 5MP6L 4YHIA 2WNGA 2CH8A 4IRZL 2IWGA 2V7HB 2N4IA 5IIEB 1BEYH 3HNTH 3MLPA 2A6JA 2P5EE 5SX4H 4CMMA 5EH1A 4JQIL 3RVVC 3MZTA 5GGUB 3NH7L 2QKIA 4S2SA 3V4PL 1U8QB 2CDEB 4M48H 1A02N 4JHAL 3ARTA 3HTLX 4KMTH 5F21B 1OTTD 1A6PA 3SKMB 1BD2A 4MCZA 5DSCB 3FQTB 2IBGA 2V2XA 1MH5B 4DVRL 3QXDA 1IKFL 3HE7D 2OZ4H 5E8EB 4MXQC 1AGCA 3QZWA 2VH5L 4PRIB 4R2GB 1HOCA 3ARPA 1TCRB 2X4UB 3WD5H 2QR0B 1ZA6B 3S37H 2CLRA 1D7FA 1J8HA 4PG9B 4PRDB 1CFSB 1CFQB 1OARH 4U1IB 5CGMA 4PTUB 4C4KT 3AAZA 3FFDA 1EGJL 3RBGA 5JPNA 3RVUC 3KXFE 3ZDXF 1S7WA 5GRVK 3I9GL 1U95A 5J12B 5IK3B 4DFIA 1TJGH 2DKSA 3BD5A 3TJEH 3MV9B 1T66C 1WEJH 2BVOB 5DO2D 5EOCJ 3O4LA 3H0TA 3VI4F 4HXBH 3VMNA 2QBWA 4O5LH 4L8SC 3MREB 4XVUD 3AS3A 2FZ3A 1JHLL 1MHCA 5C09A 2IPTH 4PRHD 1N7MH 2XWBB 4LCWE 4BH7A 5DJAB 2CDFA 3X12A 3FO0L 1TCMA 1X5JA 1QSZA 1TITA 2HWZL 2RIKA 4XPGH 4G42B 1J8HD 4WHYG 3I84A 4DQOL 4YXHH 2ZPKH 3L5HA 1AGFB 2W38A 3EJZC 1NEZG 4E42A 4ZFFA 1EVUA 5C0IA 1MFCH 1T0NA 4K3EH 1S5HB 5FA4B 3TWCL 2DQIH 2MQCA 5DQDH 2G60H 3ARBC 3KNBB 1AE6H 1PSKL 1T6VN 3RVXC 3HAEG 4RQQA 2IBZY 1BM3L 2J6EH 2V2WB 3MCLL 1BVLB 1RJLA 2AEWA 5DZOA 1LILA 1F6AB 2ZSWB 3UTPD 4UQ3A 2QQKL 1E4XL 4LBEB 3KJ4B 4NO2A 4GG8A 3KPSA 2D0FA 5BVJB 1A1NB 1A6AA 3RU8L 1J8KA 3AS1A 3Q5OA 4X7CC 4UT6H 5GS1C 4U6XA 3GJFK 1SYSB 3G08A 5J1TC 5I19H 1Q9LB 1NKOA 1AXSB 2ZUSA 2OSLA 3P40A 1I7RA 3T77B 3AY4A 5F1SA 4N0CC 4NQCB 3L5WB 3LDBC 4NOBA 2C3VB 1W72A 4BZ1L 2ADIB 1JBJA 3PHQA 3S96A 2ZUQC 5TE4H 4TUKH 1I9RH 1WZ1H 5LAXA 4FQ1H 2QEJA 4UDTB 4JREC 4U0RB 1UB6A 4HAGA 4F15C 4MCYB 2VITA 1DEEB 5D2LF 2F19L 4UZGA 4G7VH 1CDJA 4RGNB 5DGQA 1N5YL 4Q6IC 1YMMB 1LP9A 4LASH 1C5BH 1YPZA 4NQXB 2BX5A 3IKCA 2XNAB 2ITDB 3BGMB 4MNHB 4K7PX 5BRZD 3VFWB 5IFAH 5I75C 3OG4B 3BEVA 5D7IF 3LN4B 4Y4FB 3O9WB 1K6QH 2VXTL 4Z0BH 3GMNB 1YMHB 4X4YB 1HKLH 4MAYA 2FYYA 4O4YH 1KLGB 1K2DB 3ZT6A 2CJUL 4HDIA 5D6DC 2IGFL 5IVXB 4RFNB 5E00B 2Z93B 4TTDD 1NKRA 2X44D 1J18A 4YIQB 1FIEA 5JDSB 1FZJB 5IT2H 4OI7A 5I1LA 2BMKB 4JFPA 3OG6B 3LKNA 2OR8A 5TPWH 4XCFL 4P59H 4WTXA 4FQCH 4WTWA 3KGRA 5KSAC 4FXGB 4XP4L 4TNWK 4RX4A 5DUML 3EFFA 2F53A 3U0WH 3TNMA 1TDQA 1JV5A 2FEDC 4AEIH 4G5ZH 5LG1A 2IH3B 1JPSH 5D7JA 2W0FA 4XWGL 1ED3B 3BN3B 1U8JA 1JWUA 4PJDB 4LOUD 3TA3A 4YEFA 1FG2B 3K1DA 4ODWA 4UDUB 5E4EC 3SDXB 3CK0H 3GMMB 3TN0A 2DOCA 3DJ9A 1T1YA 1XGQB 5CLWA 1KJ2B 4NM4H 2HKHH 3FFCA 5IQ7L 4AENB 4J1UB 1KPVB 3C6SB 3BN9D 2CUIA 4OQTH 3TO4B 1QR1B 4YXKH 4R26H 4P2OB 5ESQA 3DSFH 1HN1A 3QAZC 2YC1B 4PPTA 5AYQA 1FRGL 3HE6D 4KY1H 5D5MA 2NY3B 1XH3A 2GCYA 1Y6MR 5HGHA 4RAVB 3Q6FA 4LVOC 5T5NF 4P2QD 4MHHI 1CCZA 3C5JA 4XBGB 1Z3GL 1C1EH 1I9JL 3DIFA 5IESL 1EUUA 2IJ0C 2XIDA 1U8LA 4KUZH 3B2VL 3EW3B 2F8XC 4YJZL 3BPOB 3CUPB 1Q72L 1NCDH 5TDPB 3BKJH 1DVFB 4NC1E 4KPHL 5F70A 3VDBA 1G7QB 5C70A 1WIOA 5E9DA 3V6BR 1CF8L 1QLRA 2DJUA 1H5BA 1MCNA 3BMVA 3KLHC 3HS0A 4Z0XB 3RWEA 4YDKH 1IC7H 4MDIB 1RHHB 2HT2D 1T80A 3IDMB 5IMLA 4RWYL 4Z95H 3JBG7 2BZDA 4JFDE 4H25A 4OZFH 1K85A 1MNUH 4NKMB 5F6HJ 1S9YB 1IM9B 4NO0A 4M1CD 3STLA 2WUBL 3G6DH 1A3RL 4OI8A 5C0GB 4DKDC 3CVHL 1X4ZA 3N0PB 5E8PA 3VFOB 4LQFL 2UYLA 4G7YL 3KPMA 4M43H 3E6FA 5T3XD 4E41E 3HZMA 4HCRH 2OQJB 4N8VA 2OL3H 2DQHL 4F33A 1YEIL 1Q9KB 5E2TH 3MV11 4S11A 5FO8A 2FO4B 4WHCA 3B43A 5IB3A 3X3GH 5K9OB 3KYOA 4NRYA 5CD5D 1JN6B 4OLZL 4HUVA 4UINL 2HMIC 2HJKA 3S4SA 2ICEB 2UY7A 4NO5B 1KCVH 5FM5O 3U4AA 3VA2C 5K9QG 3C2SA 4QHMA 1HSAB 3QEQB 2I5YL 4IJ3B 2APWA 1IBGH 4XI5C 1AQDB 5GIRA 4RWHA 1UZ6E 1VENA 5DD5H 2WUCL 2EYSB 2H32H 1QYGH 4PRBA 4K3HA 3MLTB 1TNNA 1JNHA 3ME0A 2FIRT 5HYSA 4L4TA 4PJEE 3RX7A 5MEQA 4S1SH 1BBDH 4JFZL 1D3CA 5E99L 2DQCH 1G9NL 4JY6A 1F00I 1MAKA 5I8OL 5EC2B 2VE6B 3OQ3B 3JWOH 3T3PE 2NTFB 1H15A 2VRAA 3DTXA 1CFNA 3BP5A 1UQSA 4LSVL 5F93C 2ADFL 3CFEB 2R2HB 4FQQB 2XTJB 1LO3L 4HWEL 4XMLL 1RMFH 1F58H 2MSPA 1ZLSL 4PJBF 1YNTB 2OTPA 4XTRD 8CGTA 5ICYB 3SDYL 4AG4L 1NLDL 4QT5A 3I2CH 4Y2DB 5IG7B 4PUBL 4R4FH 4ZTPL 4AMKL 2VABB 5CCKL 2ICES 4K07A 1F3JA 4OGYH 1J0HA 4M5YH 3OKOB 5CS7A 2B20A 2KH2B 4L4TD 1NLBL 4PRIE 2E7HA 2YN3A 3DRTB 5C0DA 3A6CL 3STZA 3TLRA 4GRLD 1G7LA 4CN6A 4AEHL 2QTEA 1X6LA 4A6YA 3T09A 2Z92B 1EMTL 1D5IH 2IANA 5BV7H 2OR7A 1JZ4A 3MRRA 5ITBL 4C56A 4XC1H 4F2MA 5T1MB 1UCBL 3GI9L 5MEPB 1N0XL 4FXKA 2ESVB 1YN6B 3QI9C 3MV9E 2A83B 3QIUA 1QD0A 2ARJQ 1X5XA 4DUWA 1X5ZA 4FFWD 1ND0B 1SBSH 1KIRB 5EO9A 4JCLA 1QFUH 1CWVA 4LF3B 4Q9QL 4ODUB 4Y4KC 2CIIA 4O2CB 1FN4A 5FF6B 5JW4R 4LMQE 1BWMA 3ILQD 1BVZA 5JOFB 3PIQB 5TF0A 1NPUA 3GI8H 1AC0A 2P47B 4TNVF 5T3XL 5DUPL 3HZYA 5KVFL 1ZANH 4WRLA 5CSBA 5JIIA 4C56E 1UWEH 3AMLA 4NN6B 2BK8A 4D3CH 4M7JL 2VQ1B 1TLKA 4HV8A 1WCQA 1IILE 3KDMA 5HHMB 4J3UA 5ENWA 4LIQH 1S7QA 4YGAB 2DL9A 1RI8A 2O5YH 2OS7A 2E9WA 4OIIL 1KF9B 1L9NA 3EOAB 3PQYB 5EBGA 4U7SA 3L1OH 1JGVL 3OL2A 4G6FB 4D0BB 2FJFB 3LQAC 5EZIH 5LQBH 3RHWK 3WJJC 2B4CH 1G9MH 4OCSH 4EDXA 2DDQL 3LV3B 4H1LH 4HC1L 2ZG1A 3TCLB 5DZNA 1CD1B 2GJ6A 1FZKA 5F6IB 4KGJA 4PRAB 1RUKH 1PX3A 4HX1A 1CK0L 1FVCB 1FHGA 4JM2F 1OAZH 4NQCE 4XXCA 3W9DA 2E3VA 4DGVH 1X5FA 2A9ML 2V7NB 3FO1A 1DFBH 5E5RB 5KVGL 4IIQA 2ICWA 3S34L 2E8ZA 2D03H 1F11A 3MXWL 5E6IC 1MIML 4L8CA 1BECA 3WLWC 4FQXD 5HI4D 2Q7NA 3RNKA 4MD0B 4ORGA 4JKKA 1R0AH 4P5TA 1PG7L 3T4YA 2IQ9H 1JCKA 4JDVB 4JFYA 1A5FL 2ZKHL 1UADC 2DM7A 2FBOJ 2DIJA 1ZHNA 4RGNE 1RIVH 2GJ6D 1NC4B 1YMME 3FRPA 2RGSA 3C08H 4YDJB 1G7JB 3OXRB 2DI7A 1TZGL 3OJ2C 1FL5A 2JB6B 4AIOA 1U36A 5EA0L 1DQLH 2ZCLH 4WO4A 1CLCA 4G8FA 4U1HA 5HDBE 3VJ6B 3VFSA 1C5CL 2HFGH 1EA9C 2YD5A 3PHOA 4YZFF 3KPLB 2E9IA 4E0RA 2V9RA 3W81A 3O3BA 2V17L 4KRPD 4P5TD 1P9MA 5SWSE 1FNEA 3HMWL 1CGXA 4ODVL 4S1RL 5T1LA 1T22A 2NY7L 1ZEAH 4L5FH 5E8OA 3OKDB 2YPLE 5CBEA 1A9BA 4LVNC 4PY7A 3QIBB 4OD3L 2PO6D 4APQD 2EDEA 3AREC 1JF6A 1ETZB 3DX9A 2BHZA 5FHAH 5KW9L 4FN0A 4KU1A 2DQIL 4G6MH 2EH7L 4FZ8H 3WUWB 1IRAY 3BX7C 2X4TB 4HH9B 1K4DB 4DEPB 3C6LB 4K7FA 3SEPA 5L88L 1J0YA 3FT3A 4P3CH 1CE1L 35C8H 4K8RC 3W0WB 3X3FH 2DBJA 4PJDE 2FX9L 4HS8L 5B39A 2ZUUA 1DJSA 5EB9A 2NW3A 3U7WH 2EKSA 3BD4A 3SPVB 3PUCA 1NGWA 4MDJA 4L9LC 5E2WL 5EZJB 3NCYS 5IGXH 1JZ5A 4KTDL 3DX6B 4HFWA 4WW1B 4V1DB 2VDKH 3ULUH 4YPJA 1I3GH 1UVQB 3M07A 4MXVE 2ZNWA 3HPLA 4IHOB 1CGSL 3FN0H 1FSKB 1IQWH 3CFJB 4JZNA 2ZCKL 3QCTH 5F96L 1OTSC 1BX2A 1KC5L 1T0MB 2WV3A 4QRSB 4ELMA 5EFIA 2R8SL 2CLZA 5KZCB 4N5ED 2YSSA 2ATPA 3CLFL 4LSUL 5D2LB 1MFBL 5C9KA 3NN8B 2EIEA 2C7UA 4S10A 4FG6D 4P2RD 3RZCB 2APFA 3IDXH 1FFRA 5JHDD 4MAUL 3GMLB 3HG1B 4BELD 2BVPB 1YY9C 4UTAL 4XP9L 3MLYL 4XWOC 3TBYA 5CINH 5D7IB 5D7SL 2XXMB 2MFNA 8FABA 5KS9F 4FFVC 1AD0A 2FH8A 4YDIH 4EDWL 4XCEA 1CLYL 1A7RL 2FHBA 2L7UA 4BK4A 3WE6A 2B39A 1RQ5A 2R2EA 1JNJA 4TPRH 4ZUTA 3GO1H 4NNPL 3ZHLA 5CGYC 2YD4A 4LLDA 5I74B 3OGCB 3D25B 3F6LA 4WEBH 1HEZB 3OX8B 1FGVL 3ULVD 3P11H 3LSOB 3MJ7A 2ZUVA 3GSXB 2AJ3A 2HLAB 4NCC2 5DFWH 5DJ2A 2JIXA 5D1XA 5AUMB 4WWKA 3SGEI 3TNNB 1U0QA 4ZSOA 4NQVB 3NABL 4RISH 4AEIL 5J6HB 5T33L 2YA1A 4HG4J 3ZSSA 5ICZB 5HGDA 5I1AA 1IGIH 1JPSL 3Q0HA 3WFHA 4LKXA 3D39A 3INUH 2DQTH 2DAVA 2APBA 1JJUA 2AKRB 1NGXA 2CKBA 3OHXA 4XX1G 4LFHD 4KKAC 1D5BA 1CGYA 4UOW0 3BZ4B 3F58H 3QIWA 1RUAH 4K94C 4MA8H 1U93B 2BP3A 1P7QB 5C08D 3UTSB 3F65A 2H26B 3KAAA 3E0GA 3JSSA 2VLRA 4OCRL 2JIXD 1TVBB 3IJHA 4CVWA 3DSFL 1LE9A 1BJ1H 3U0PA 1N8ZA 1CXEA 1QQDB 3QHZH 3QEQE 4JR9H 4Y5YA 1K4CA 1HYSC 3QUML 4F58L 4PJ5D 2BDNL 2AABH 4U1MB 2F74A 3BSZL 4HG4K 3D39D 3W2DH 1FC1A 5JIPA 4Q6YA 3FB8B 1U8NA 2IAMB 1D5XB 3VH8A 3CH1A 3F7RA 5I9QC 4DK6A 3OXSB 5I1GL 3HLAB 1FIGH 1N6QL 2VQUA 3JTTB 4LLYB 3OKEB 4HUXB 5B8CB 1FFPA 2IPKB 4H8WC 5D1QD 1KJ3H 4JFHD 3IDGB 3WIIH 3ZKQD 5DVLA 2VLRD 4LSTH 2I07B 1XFPA 2XI9A 1K8IB 2UWEA 5H37H 1IAKB 2W1NA 4XBEL 2NLJA 1SJHA 2XTJE 4DAGH 2L0DA 3T04D 2HH0L 1KFAH 1M7DB 4NNXB 3LCYA 4JN2B 3MRLA 5FYKD 2R2BB 4X80H 3OB0K 3NFNB 5I15H 5DJXA 5GGSB 1P7KB 1IC7L 1T4KA 3A6BH 4Y16A 1R5WB 3STBA 3QCUL 4DFHA 2BVTA 1EJOH 2EC9U 1BWWA 4Z95L 3HRZA 5IBLD 2OTUA 3S97C 4JQVC 1FDLH 1FL3B 3MV01 1PYWA 4XAKD 4WU5B 4PJHA 2D9QB 3FQRB 3VXTB 4HJ0C 3U46B 5E5MA 1S7XA 1TETL 3GNML 3P77A 2ZUTA 3LEXB 4JO4L 1UZ8B 1V3MA 2UWEE 5HHPB 5D7KD 1FL6B 3QA3B 4KHTH 1JMZA 2IALA 3H9SB 2Y07L 1U2CA 4RMVA 4KKBC 4ZFZA 1OLLA 3DVGA 3T3ME 2A6KB 3MRDB 3U0TB 1HINH 3MRGA 3JWDH 3ULVL 3UC0H 1P4IH 3EYSH 1Q9OB 4L8SB 4I3RH 3VFUB 1EEYB 4Z8FH 4P46A 1M71B 1HQRB 1Y0LB 1NSNH 1ZTXH 3JXAA 4KQ3H 1T89A 1FLRH 4OTXH 1JWSA 1VFMA 3RWDB 2FB4H 2PUQT 5B4MC 1MPAH 1XR9B 5DD6B 1GAFH 5FA3A 3CZFB 1M7IB 1EEZB 2EXWD 1DQQA 2X89A 3BPNC 2YK1H 5DHYB 3BXNA 4WI9A 5DYOA 4AT6A 1HHGB 1W72H 3L3HB 3B6SA 5C0AA 1R3LA 1ZGLB 4RZCA 5IFJB 1YJDL 4L29A 3ARBB 5ID0B 5ADPL 2Y7QB 4G9FE 2H2SD 3RWIB 1IBGL 4P57A 4KMQA 4GG6F 3S3JA 4Y19B 3CVIH 5HGAA 4YK4C 1M05B 5TFSH 5L2KA 2EDJA 3PQYE 1DBML 2CDGA 4PJ8A 4GKNA 4P4KC 4MNQB 3WHE1 1BBDL 1Z9OA 4NC2B 5GS1B 3BWUC 4L1HA 4ALAH 4XPHH 1KIQA 1RZ8A 3HCVA 5DR5H 5C0CB 5F88A 5JO5A 1PLGL 4UV7H 4G8EB 1HI6B 3G5VA 4DZ8A 3RDTB 4H0IA 4EN3A 3UPRB 4IMKA 4FTVB 4PJBB 4DKFL 2MCG1 3FT2A 1KCUH 5I1KH 5L2KD 3HMXL 2MCPH 2YUWA 4F9PC 5KSUB 1AGEB 4JREB 1LD9B 3OR7B 5FIEA 4F15B 4CNIA 2HRPL 4BKLB 3GBNL 2OJZL 3MBEC 3V0WL 4N9OB 4XVJH 2HT3C 5FYKL 5E2UL 4Q6IB 1N64H 4K3GA 1KTDA 4HS6A 5CJXC 2CRYA 4UUJB 4X7SH 4HLZH 4UMGA 1MIEL 3IFPA 5EU4A 1ZT1B 2BNQE 4ODTH 3ZDXE 5I75B 4R0LB 1FYHB 2X1OA 4I1NB 4ZXBD 1VA9A 5AG9A 4JVUA 3TEUA 4KXZH 4OFPA 3DETC 3QULA 4XVTH 4UTBL 4YE4L 3BMWA 2BVQA 1WZKA 4W4OC 5KANG 3MNVB 5BZDA 1DBAL 3AM8C 2MOVA 5GRJH 2R39A 3MUY1 4QRTB 2ERJC 1WBZA 1NMCC 4OJFH 5DJ8B 3RY5A 2VNCA 3VXRA 4QNPF 3PL6D 4PD4J 4HXAL 3T0XA 3NCMA 1UWEL 5KSAB 4EUPB 3V0AC 5GZND 3SKJL 4RMQA 5TQ2L 1N0LA 3QFJA 5TGBA 1JHKL 3RNQB 2VR9A 5IW3A 3GIVA 2JB5H 2P44B 2R69H 1SJEA 1T1ZA 4GAGL 4BSJA 5IW1B 1FAIH 5I30H 1A6TA 1K8DB 3T0WA 2KL6A 4PTTB 1D5ZA 2DQEH 3W0WE 2X42A 5ERWA 2VIRB 4WY7H 5E4EB 5E8DH 3UBXA 1IGJA 4FMKA 1MWAA 2N7AA 2DQJH 4L8BB 4PJIA 1YEKL 3FTGA 1MFNA 3IU4L 2MPAL 3VWJB 3WFEH 2GIYA 4JM2B 5T1DL 3KPOB 1IGYA 2EEBA 1CGUA 4V1DE 3RGVA 3RVTD 3QFJD 3QAZB 1EBPA 3EDDA 2H2PD 2WWKT 1SEBA 2JCCF 4WDIA 3D0VB 5DJ6A 1NGQH 1H3UA 3MA7A 3LEVH 1BHGA 2DLFH 4O51B 3KYAA 3WIHA 5ADOH 1BZ7B 1UACH 1MRFH 4LVOB 1PAMA 3GGWB 4TNWF 3O3EA 4U1LB 4JFEB 3IDUA 5HDQH 3DUSB 1X5AA 3MUGB 4RGOL 4PJIE 1D9KC 3QPQD 5IFHH 3HG1E 4QGTA 2P8PB 3EYVB 2AV7B 3QQ9C 4UIKH 2E7LA 3RA7L 5F7DA 1EO5A 5DF0A 5I76A 1HE7A 3I50H 4KUCD 4TSAL 1WC7B 5D7IE 4B7IA 4I0KA 3GB7B 3E2HC 3OZ9L 4TYUA 2X7LA 5EU6A 3MA9H 4KK9C 1G7HB 2P5ED 4HKZB 3LS4H 2EIZB 5DRZB 1H0DA 4WHDA 5FYLD 4IS6B 3RIAK 1QSEA 2AXFA 5TQ0L 3EYFB 3CU7A 1KN4H 1QFHA 2XKNA 3KPQA 4H5SB 5E70A 3MRIB 3IVKA 3O6LH 1TVHA 5T5FH 3UTQA 3B9KC 5DFVD 4PB9L 3VXMA 1E27B 2R9HD 1OGAB 1JGDB 1NCUA 4NQEA 3WXWH 1MLBB 1W0VA 5DI8A 5DQJB 1QOKA 3MODL 1ADQA 3ZE2E 5SX4I 1U3HD 5HHNB 3BH8A 2I9TB 5HD8C 2P46B 4XPAH 4L3ED 4W6WB 1ZVYA 5EWIL 5FKAA 3DRQA 3DX7B 3DO7B 5F97E 4F8TA 3RWCA 5HI3C 1W8NA 4F7CA 4JAMB 4KDTA 1WJ3A 3C9NA 3QEUB 5BS0A 3ZYIA 4O9HL 5GS3A 2DMKA 2VLLA 3MMEA 4NQTA 1K5NB 3MLZH 3MRBA 2J8UE 3V7MA 4LCWD 1XF5B 3D69A 1IC1A 4MNGE 1QVOA 2VZSA 3UTSE 1A7BA 2WBJA 3J8F7 4NJ9L 2VL5A 1TQBC 3JV6A 1FNGB 5C0BA 2GEEA 3UJTL 3HI6H 2XPGA 4WGWB 3E3QC 1MRDH 4OD2A 3RKPA 5EORL 3M8OL 4M6AA 1BPVA 1KEGH 3SDCB 2DYPB 3QCTL 4JVWA 4M6MH 3JZ7A 5TDNB 3BE1L 4WENB 4OGXH 1U8IA 3O2WH 3PGDA 1SY6A 3T0AA 1A7PL 3QEGH 1WTLA 1XEDA 4HZLB 1BBJB 3VFVB 4A6YH 4HPOL 2DQFB 4O2FB 3WN5B 1I7TB 1YY8A 3MYJB 4HT1H 1XIWA 3JTSB 1R3JA 3C09C 4OT1L 4Z7NF 2WBJD 5ETUB 4NKQB 3LKPB 4QCIB 1TZIB 5DJZA 2BNRA 5C0BD 2WQ8A 5IROA 5KS9B 1TPXC 1A47A 4OCYH 5ACLA 2FDBP 3MRNB 2XWJB 4X9FA 4X5WA 1KIUA 3D85D 1L7TH 3IYLW 3ZT5A 4Z76A 1EFXB 2ZSVA 3ECBB 4NO3B 4XPFL 1YN7B 4NZTL 1T7ZA 1F45A 1MFEH 4QOKB 4QRUA 1Y18A 1FJ1A 3BKMH 4KKLC 2YHGA 3MNZB 5GSVB 4PRPB 4Y89A 4EBQH 2CK0H 4NYLB 1I1AA 4GW1A 3MRFB 5FYLL 5IHZA 3WIHL 1NMAH 1I9EA 3MACL 4U3XA 1JI1A 5DLMH 4KKNA 3O4OC 5FOBB 2BXZA 3S6CA 1LEIB 3DI2B 1MHPH 1MAMH 4NT6B 5E94A 3D18B 6FABL 4PJFA 2FD6L 3K1KC 3AXLB 4OF8A 3ZKMC 4L4VB 5CZVL 3JVGA 4B50A 3QI9B 1MI5D 4OAWA 3H9SE 1AHWA 3V52L 4YUEL 3JWOC 1V7ML 2A74A 4OF3A 4OZGA 1VPOH 2W0PA 1MQKH 5D8JH 4ZFGH 5I71C 1IGFL 3ARYA 1QTYT 1WBYA 1IL1B 2B2XL 3OB8A 4HUNB 3VU2A 4Y4KB 1KENH 5C6PB 4OKVB 4ISVB 3RAJL 2EXYD 2FJGB 2XZQL 2HFFA 2ARJA 4U6YB 4KFZC 3Q48A 3UJJH 4PREB 4LAJH 3U79A 1YEJL 5AYUH 1OGTB 5FM8A 4PGEA 4F7TA 1NGYB 5J1AB 4Y4HB 5GGQL 4DGIH 2YPKA 4PJAF 1C8PA 1F2QA 4J3VA 4JR9L 1GIGH 3HZVB 4OF7A 1LO5B 1UM4L 1OPGH 3FMGL 3OKNA 4ZOBA 1VACA 3VFTB 3RIFK 1GH7A 1S9KC 3TFKD 1WT5C 2Y36H 4LSDA 2BFVL 5BV7C 2V6HA 1EO8L 2FSEB 1ZVSA 3ARSA 1NFIA 4G9DB 4UIMB 3KPRB 4I0PC 2FECI 4QHUB 1BOGA 3DYOA 3L3DA 3DV4B 5I1CH 1HXYA 4HH8A 2I60L 1FO0A 1Q0XL 1RJCA 4OLWH 3VWKD 15C8H 1MCRA 5IF0B 5J56B 3GMPB 4LCUA 5GPRA 2CD0A 5IQ9B 1C7SA 4XP5H 5C0CE 3N1FC 3QUZC 4N0RA 4QRQB 2YN5A 3LH2H 4UU9B 3S35L 5SWQA 4LVHC 1T1WA 3IFNH 3D87B 4TVPE 5DT1H 4KKCC 2ZOKB 1RK1B 1MF2L 1JF1B 4PJBE 4J3OC 4S0TD 3BP6B 1B0GA 1OW0A 5C0JB 3A6BL 3D9AL 1YQVL 1A6VH 5F1IA 1LK2B 2FRGP 3BQUB 1IC5L 1E28B 4K23H 1AFVH 2ZUXA 2EIDA 5D6DA 3FT4B 5C0NC 3IDNB 2RHEA 2Y6SD 3NA4A 4X8JB 5DC9B 1ITBB 3B3IB 2Y5TB 2EDTA 3VXNA 1J1XL 1PG7W 4WFEE 1X7QB 3OKKB 1KN2H 1QHOA 4PYHA 4YWGL 1U8OB 2O5ZH 3PF2A 3RWGB 5I8KH 2VQTA 5D72L 5FAAA 4ZS7H 3BHBB 5J9PB 1G9MC 4JQXA 3MO1A 3PABA 4JZJA 3TZVB 1I3RA 3T65A 4N8CL 4POZD 2BC4A 1C08B 4P3DB 3WIFB 1J10A 4RDQF 2X1WL 1ZTXL 1TJHL 2VJXA 3DLQR 4ZQKB 1QFWL 3HB3D 3TBTB 3AFLA 3IKKA 3OJDA 1T7WA 5EU7C 4LVNB 4NN5C 2XKSA 5GRUL 4XT1C 1P53A 3H3PH 5KTEL 2B7DT 4JFDD 2GYSA 1U58A 1A2YA 1MCEA 3DXAA 2AJYH 1XF3A 1QR4A 4XGZA 1IAIH 1F90H 2AGJL 1NEZA 2GTWA 4L1DA 43CAB 2C3XA 4YHLH 4GG6B 1QBML 1YEGH 3PWPE 3NAAL 2R29L 1RZ7L 3HAEA 3M17A 3O11A 1LDSA 4G8GA 3ZYOA 1MVFA 2R1XA 3BP7B 3BVNB 5L6YL 1WIPA 3P4MA 5HHVH 4J8RA 4E41D 5EZLA 3BRFA 4YR6B 5FUZL 4G6KL 1TTFA 3H3BC 2EH8L 4WGVB 3NZ8B 2Z4QA 3L3IB 5JZ7D 1N59B 1JZ8A 2G5BA 4GLRH 5DVNA 5D70H 4P2CG 3NA9H 1U8PA 1NDMA 1I3UA 3SDAD 3DUUB 3MYZA 5K9KA 2BY2A 3QNYB 3G5ZB 5DRWB 2V7HA 3PP4H 4TSBH 5K59E 5KVDL 2H9GA 4HIIB 1KCUL 5L8LB 4GMTH 1GOGA 1WK0A 5CEZD 1XGRA 3EYUH 4G8GD 5DD1H 5GGUA 1RZIB 3JWNC 3ZKND 3MCKB 1RD6A 5F9WC 1QSFB 1MH5A 5F1NB 5L7XH 3AROA 3DX8B 4XCYA 2UZXB 2Q3ZA 5E8EA 3SBWC 3QUKB 5EC1A 4QHNB 3FQNB 4ZAKA 1EIBA 4KK8D 1TCRA 2R0LL 4JKPH 2QR0A 3AU1B 3WV0A 4M4PA 4Z5RB 3LKRA 4RMTA 1XGUA 4M7KH 3M45A 1Y6NR 4PRDA 1CFSA 1CFQA 1B3JA 4G6JH 2AEQL 4ZFOB 2EZ0C 1ZHBB 1JPGA 3GJFB 3TV3L 4XP1L 3T2NH 1KB5B 3THMH 3T2QA 4UB0H 2PYEA 1QO3A 2CKBH 1FORH 3GSWB 1G7PB 2MWCA 3ULUC 2ZUYA 3DNKA 2Q7YB 2FGWL 3WFCH 1I85A 4FQ2H 1VADB 2C1OB 3UTZB 1L7IH 5CMAB 1QLEH 2AK1L 4LAQL 2Z8SA 3MREA 4NDMB 2I9LA 4PRID 4R2GD 2LV4A 2XWBA 5CJ8A 5DJAA 1OGAE 3I6KA 3FONB 3BT2H 2ICWJ 1KACB 1MUJA 5CILH 5HY9A 3S36H 3TVMA 4HMCA 3W9EB 3PDOA 2FLRT 5IEHA 2BVEA 3G04B 2IQAB 4U1NB 4LRIC 1CD9B 1F42A 3BUYB 2EEDA 5CJQH 1S5HA 1PKQA 1IGTB 4NKOA 5I6XC 1GGCL 4GUPB 3MV9D 1CN4A 1HHHA 4ZOEA 2LQRA 4PLKC 2NXYC 4O02L 2Y9RT 4J3WA 1I7ZB 1WAAA 1XF2B 4PJ9C 3G6JA 1MRCH 4Q97A 2R15A 2NY2C 4DWHA 2WP3T 3S3SA 4LBEA 2Q8AL 2DBLH 3CFKA 3UCRA 1A1NA 3MRKA 1FQ9C 1ODAA 2COQA 3GM8A 2YD8A 1KBGH 1MJUL 7FABL 3L5XL 3C60B 4U6VL 4F3FB 4AEEA 1AXSA 3UX9B 1AR1D 2JCCB 2LE9A 5AZEH 3HR6A 3VCLB 4NP4H 5ELIA 1HYRC 3CMOL 2AJVL 5LGJA 4ERSH 3L5WA 4OLVL 5IKCB 2C3VA 5E56A 5H2BB 4X6DA 4HULB 4PS4H 2IPUK 3MJ9H 3EJYD 4KAQL 1GVIA 4JPWH 3V5DA 4JRXA 5HDQL 5FO7B 4D0CA 4IOFD 4KJWD 4Q9BA 5DMIH 2Z8WC 1AIFB 5CEZL 4R90H 5LXGH 1DEEA 3QDMB 3IFOB 1QACA 2RB8A 3IXAA 4UT7H 1QZ1A 4GAFB 2C1PA 4LLQA 2UZIH 2VO5A 1KNOB 3UTTA 2KZWA 4BSVB 5KS9E 2DQUL 3QNXA 1E6OH 4NQXA 2ZCHH 2R0KL 2XNAA 2OM5A 2ITDA 4MNHA 5CWSB 3DV6B 5MI0B 4BK5A 4NQCD 4ENED 2DI8A 1U41A 4M7ZB 4X4MA 3OV6A 4X4YA 1WFUA 3HI5H 2CSPA 4QOKE 4OLEA 3QDJA 1IEAB 2C26A 4OLXL 3BAEH 5J3HC 5ITFA 5IVXA 3WXWL 3MV7B 1MHEA 4BQCA 5E00A 1NCAL 2BRQA 1YNLH 4HBCH 3O3AA 4RGND 3UZVB 1YMMD 4I48A 3CC5A 3ISWA 5JDSA 1FZJA 4S1QH 4R96B 2E27L 5BW7A 1DDHA 4X7TB 3SO3C 4OSUL 3SE4A 4MJ5B 5HI5D 3H8NA 4XNXL 5GS2D 4PLOB 3QP3A 1VESA 1T3FA 3QG7L 2Y5EA 4FXGA 4Y4FD 2P5WB 4X5LA 3O9WD 1KEML 4YAQB 5TJWK 3K74B 5CBAB 1G6RA 1EV2E 4DZBA 5I1JH 2XZCL 4M00A 1S9WB 1LEKA 4X99A 2IH3A 3JV0A 1IEBB 3HNSL 1ED3A 1MFAH 3KPNB 3AB0C 1JPFA 3MNWB 3WEXB 3VXPA 4LCCB 3G9VA 3GMMA 4QLRA 3UJIL 1SEQL 2NYYD 1TZHB 4K2UL 4AENA 5J6GB 1C16B 1FVEA 1CLOH 4J1UA 1KPVA 3V0VB 3C6SA 5JA8B 5D6CA 2HT4C 4OBSA 5E03A 5B38G 3CDGB 4LNRA 5DMGD 3O2WL 4YK4B 4OZ4B 4LLWA 5E6IA 3QHFH 2A1WL 1FZOB 4W68A 2YC1A 3KPRE 4FMFA 3BPCB 2G5RA 1NBYB 2H1PH 3EO1B 4HKBB 5GS0D 3LRSB 4P4RB 3JWDC 1IMHC 4R7NB 1UXSB 3O41A 2AJZA 1JTTA 4YXLH 4X5XB 3WDIA 2XN9B 2GITA 2BVUA 4JLRA 3MC0A 1IM3A 5FM4A 3AY4C 5D1ZB 2DS4A 3BKYL 3TO4D 2L7JA 4MGXA 4LHUA 1EERB 4XBPB 5TDPA 4OCXL 1QSVA 2YD2A 4P2OD 4CADA 1CFTB 1ORQA 2VDML 2YMXH 3IXTB 4R6UA 2B1HH 4PJ7A 2QLVB 4OZHF 1I4FA 4I77L 3U4BL 2NY3D 3R06A 1MFDH 4PV9A 1INDH 3MBEB 1NGZA 1TTGA 3O0RL 1KPUB 4M1GL 4Z0XA 1A9EB 2YD1A 1RHHA 2ITCA 1H3WM 3F62A 4HWUA 1MCOL 2WINA 4NWTH 1OCWL 1WWAX 3AREA 4ZD3H 4X6CA 1ZT4B 4KQ4H 1ZWIB 3MRJB 3V5KA 4H20L 2ED7A 4KZEH 4UOW1 4HK0B 1FNHA 2Q76A 1DVFD 3RKDC 4NSKB 2J3SA 2A77H 1MWAH 3OR6A 2BSRB 1NBVL 4MAYC 4X6FB 1T04B 4D2NA 3ULUF 1E6JL 5JOEA 1MEXL 1OL0A 2NY4C 3CXHJ 4Y2OA 3SKNA 5H8DA 4YO0B 4ODXA 2ERJB 3FQUB 4Y5XA 1NMCB 3UJJL 1J86A 4NPYB 1FNAA 4JG1H 1U42A 2QHRH 2Z8RA 3O81A 3F5WB 1KCKA 1AP2A 4LNVA 1OF2A 4PJAB 4X6CE 1UWGH 5IR1B 3MRCA 1IM9D 3WFBH 3N1QC 1DUZB 3FHQA 2VLJA 3PJSA 2ICEA 2BSTB 1D5MB 5IHUH 4GG6E 1CD8A 4HIJB 2XQBL 1AGBB 3HE6C 4JPIA 1G9NC 3EOYG 2P7TB 5BOZG 1B9ZA 4ORZC 1P84J 5D7JC 4M1DH 5AEAA 2OK0L 3TA3C 5FYJH 3MLTA 5BMFH 4DTGL 3HN3A 3TN0C 4NQDB 1CXLA 2XACC 1SJXA 1FC2D 2CQVA 4X4XB 4P9MH 2C9AA 4IRJA 1EAPB 1Z0MA 1FYTA 2YWYA 4QXGH 3TIEB 1NBZA 5EC2A 2VE6A 1GRWA 1GZPB 4NQSB 4X6EB 3PGFL 5GS0L 5JXAL 2AXGB 4P3WA 1BVKA 3LN5A 1IGCH 3PWJA 2DWEB 3WLBA 1RZKL 4FQQA 3GK8H 5I1EH 3QEQD 2DLHA 1AXIB 4BZ2H 2O26U 3SDDB 1KJ2L 3SKOB 4FABH 1OTUC 2D31B 5T3ZE 3UYOD 2E5EA 3X14B 2JJVA 4PJXF 1QSFE 3QUXA 2GAZA 5FECA 3JV4A 5JW3L 5C6TL 2EE3A 2HT2C 1D9KB 2BOCA 3F7QA 5INDA 5DD3L 4CVXB 1P6AB 3KPPB 4J23A 1ADQH 5ESVB 1K3ZA 1T1XB 4RSVA 1JL8A 3PWLA 2R4SL 1KJMA 4QRRB 4QHLB 3TO2B 3N85H 4OB5H 5KOMC 3E2HB 4QF1A 4XB7A 2MHAA 2R4RL 3VRJA 1HHIB 2XTJD 3UROR 1CQYA 1SYVB 1H5BC 3NOIA 5IHLB 2ESVA 1YN6A 2GUOB 2XA8H 4CL7A 2A83A 2XFXB 4WFHE 4FP8H 1FH5H 4Y2DD 4NCC1 3L6FA 2YOCA 3HC3H 5ALCL 1RVFH 2FHFA 2YBRA 1MSPA 3HA0A 4ODUA 4QNPE 1JRHI 1UJ3C 2J5LC 3RI5K 4PGCB 5CLTA 3PIQA 3QO0A 2V9TA 3BO8A 3DVNB 4V2BA 1SY6H 4XNQB 2YPVL 5E8NA 1UB5B 1JWMB 2CO7B 5IBUB 4D8PA 1HXMB 1YEGL 4FFYL 3G5XB 3VE0A 4M62L 2FGZA 2D3VA 2IMMA 2ESVD 4JG0H 3DMMA 3WL9A 1QRKA 5BJTB 4MB3A 1QBLH 3NIFE 4MD5A 2A6DA 2D4DA 2OI9B 3R8BB 4AH2A 4WFGE 4EI5A 1WZMA 5JHDB 5SWZA 3P9MA 2PW1B 4RFOL 4D0BA 4XZUB 4FQHA 5DMKB 2EYRA 5HDLA 1TQBB 4PGDB 4JFFE 4JO1H 2P49B 3MV8A 3PP4L 4OZFB 1AGDB 3IU3B 3U2SB 2JCCE 3LB6D 4KV5F 2G75A 1CFVL 3S88H 5ALBL 5KJRH 1ORSA 5HHMD 1F5WA 1GSMA 2YD3A 3U9PH 5KG9B 3EHBD 3GRWH 1BIIA 4Z7OE 1HKFA 5L7XL 3PQYD 5GJSH 1W0WB 2DTSA 2QJDA 5SWZE 4HHAB 2DWDB 4PB0H 4MD0A 4G6FD 4XMKH 2RR3A 3C09B 4Q7DA 1RJYB 2OL3B 1INEL 3QDME 4JDVA 2P8MB 4I5BB 1C12A 1TPXB 1D6EA 3WXVL 1YYLH 3B2UD 3RZWA 4G43B 4YQXH 4F57L 5F3BB 3E6HB 4NRXA 4NKIL 2FX7H 1S8DA 4ZMAT 4ZPVB 2GJJA 2VSDA 2AJUL 4HLJA 3GHBH 3VJ6A 4QKXB 4JHWH 1F3RB 4NCDA 4JRYA 4TSCL 3U7AA 5TH2A 1A6WH 1PX4A 3LKOA 2BRRH 3RWFB 5DTFB 4HQQL 2H32B 5HHOA 4QTIL 3BT2L 3ZHDA 3MV7E 2R1YB 3ILQC 3O4OB 1M7XA 1RIUH 3IGAB 3G6AA 1NC4D 5DS8B 3V6ZB 3ROOB 5FKPA 2VLKA 2DIBA 4XNZC 5IBUG 5I1HH 1T20A 2M8XA 4OFYD 3QIUC 1FO0H 5GHWH 5I71B 2P5WE 1T2QH 3WKMH 1UH3A 3C6LA 2OTWA 3UO1H 2BJML 3GSNB 4JRYE 3N9GL 2DF3A 5LBSH 1BZ9A 4HMEA 4MZ2A 3BPLB 1LE5A 5IM7B 1R5VA 1YEHL 3QRGH 4C59B 1ZOXA 3C5SB 3W39B 1C5DB 3QIBD 3QNZB 4M5ZL 3SPVA 2R1WA 4OZFG 2XRAH 4OM0H 5AZEL 4EVNB 4X0KB 5EZJA 4NP4L 2FBJH 4PP1D 1RK0A 2HA1A 3O8XA 3CJJA 1IC4L 1FE8H 4HW6A 3DURA 5BV7B 2LAAA 3U30C 2NMSA 4DOHB 4HJGA 3MJ9L 4IHOA 4KXZI 4I0PB 1SBBA 3BIAX 4WI3A 3CFJA 4JPWL 3F7YA 4MYWB 5C0FA 1DUYB 1J12A 1T0MA 3W0WD 2CUHA 2X10A 4Y0GA 5KAQF 4EUPH 3QWRD 3MRMA 3RVWC 4Z7NE 5D2LA 1RUML 2XWTB 1YDPB 1BQHB 2Y1VA 4LVHB 5CIPA 5E2VH 3C8KB 3WNMA 2DLGA 4NHCH 1XGTB 5C2UB 5D93C 2DM2A 2VERN 4V1DD 4XC3H 4XXCC 5F7EL 1PW3A 2GQHA 2VZUA 4G3YH 3IAQA 5E08L 1RFDH 4GSDH 4IIQC 5D5MF 4DN3H 4KK5D 3D3VB 2W07A 1JE6A 1UGNA 5MENE 4QRPE 1W8OA 3CFDA 3K2UL 4LFHG 1B6DA 4P5TC 2FWOA 3UEZA 5KZCD 4G8IA 3F8UB 4WHYH 3X17A 3UDWA 1J5OL 4UT9H 3AS0A 3QDGB 5IJVA 3RZCD 3ESVF 3P4NB 4NZJA 1HSBA 4WCYL 3HG1D 2BVYA 4YHZH 3HAEH 3OX8A 4M6NH 3GKWL 3MRPB 2ZOLA 2DI9A 2DJ4A 4U3CA 4OLUL 2AXJA 2FATL 4WO4C 9CGTA 2HLAA 5ISZB 1YECH 4M8QA 4ZUUA 2F54B 4FQPA 3HNVL 4IRSA 4LKCA 4NQVA 3I75A 1AR2A 1AJ7H 3S8WA 4TQEH 4WHTB 1DQDH 3H7BB 1P9MC 4NN5B 2ORBH 5T1KA 1YEDA 2AK4A 3LS5H 4LRNL 4R8WH 4NZUL 4PJAE 1MCWM 4X6BB 1SVCP 1SJVA 1U93A 4X9BA 5GGRB 1FGNL 4J4PD 3KG5A 4JJ5B 3EGSB 2HJFA 5CAYB 1TVBA 1BQUA 3WNKA 1VB9A 1HH6B 3ARDA 2ADJB 2APTA 4XXDB 4TVSa 3KS0J 4MJIB 5KN5A 2VDPH 4KZDH 1ZLWK 4XHJC 4LPUA 3MRQA 1S7VB 2P4AB 1A6UL 4CU7A 3RWHB 2WM0A 5CP3A 2Z35A 2Y4SA 4U1KB 4DGYL 1S7RB 1X44A 3VG0H 3TBWB 2RQ8A 1A4KA 3QO1B 4F7EB 1AKJB 3EDFA 3OKEA 4WW2A 5B8CA 2NXZC 2GSGA 2EDFA 1P7QD 3UTSD 3T3PF 5HYJE 1EVTC 3IDGA 4DUVA 4U2ZA 2CIKB 3NFPB 1JUFA 1K8IA 1YEFH 5CSZB 2HTLC 3S5LB 3MLXL 1A0QL 1U3ZA 5EU5B 4NNXA 4OZHB 4JFQB 5C0EA 1N2RB 5F9WB 2X9YA 4KTEH 5DJYB 3FQXA 4OLYL 1UEYA 3P0YH 1A6ZB 2IAMD 2VXUH 5I8EB 3CFBA 2WMPA 3CSYA 1DSFH 4ZD3L 1UXWB 4GKSB 5IB1A 5C07E 3OGOE 4QRRE 4URTB 3ULVC 1T7VA 4H1LG 3EOBB 1KULA 4BSWB 4PV8A 2OXGA 5GISL 1HZHH 3LEXA 3B9AA 3BIBX 4DVBB 3RVVD 3QYCA 3QA3A 3KYMB 4NM8H 4PYGA 1KELL 1H8NA 2WBKA 5DGRA 3B4NA 1ULVA 1QPPA 3REWA 3U0TA 5DD0H 2I25N 4JJHA 1NGPH 2EDXA 4JO2H 2HP4A 1OAYH 3U7YL 4MXQD 1YJDC 4FQLH 4DN4L 1EEYA 4ONHB 3MJ8A 4YHNB 5JHLH 2WIMA 4HIXH 3RWDA 3GMRA 1BGXL 1A14H 5IB4B 3NFSH 3IJSB 5DHYA 3RVUD 1UJTA 5ACMA 3O2DH 4ZG1A 1ZGLA 2HVKA 4WWKC 4OV5B 4DJMA 2VDQL 5I6XB 3FOMB 5L9DH 1T66D 2VISA 1ZHLB 4C58B 3P73B 3H9SD 3I6GA 3FB5B 4Q0XL 2QHLA 4GBXA 3SGKA 1CE6B 2NXYB 4R4NC 5GJTH 6CGTA 5F7WC 2A6IA 1ERNA 4Y19A 4XCNB 5A3ID 4PJ9B 3KR3L 3FRUA 5C7XH 5EO1B 2R56L 4GQ9L 1JK8A 3EYOB 3NCBB 3QPXL 2X4SB 1KLUB 4MNQA 4EI6A 4HFUL 4JEGB 5E4IA 3VI3F 3HFMH 2JELH 3QWOB 3QIWC 1NAMA 3ARGA 5MHSE 2IFFH 2GJZB 1V3KA 1WBXB 2IBBA 1QLFA 4ZPTB 4LU5H 2UY6A 3T2OA 5DQ9B 1A7OL 4ZTOL 3E3QE 4CN1A 1JFQL 2SEBA 3VFGL 5EBLA 3ARBD 1IKNA 1KG0A 4XMPL 3RVXD 1GYAA 4Y5YC 4U3HA 2DQGH 4YBQC 4FTVA 3MRHB 4GW5B 5DHXB 3AUVA 3GDBA 3PG2A 1YZZA 3TT3H 1FZMA 4PJXB 1LEGA 1PDKA 1OOAA 4X4ZA 2AV1B 2F5BH 5HHXH 5BO1L 3EUUA 4UAOC 4U7KA 1N5AA 3FB7B 4BKLA 3QJHB 3HZKA 1G7IA 5L0QC 2E6PA 4Z7WA 5C0CD 4M6OH 2ICWI 3Q6GH 2A6JB 3KXFB 3NACH 1P1ZB 4CMMB 3RDTD 1G6RH 2VDOH 3D0LA 1KCLA 1BAFL 4TVPD 4N0CD 4R0LA 1KCRL 3LQAH 4OZIA 5EOQL 1BD2B 5JW5B 4LP4A 2QQNL 3H42L 5LGHH 2V2XB 3LRHA 4Y16C 4P49A 3U1SL 1AQKH 2KQMA 1T5WA 3ZKXC 1HOCB 1MVUB 2D0HA 3QUYB 5DWUH 2HG5A 3CZJA 2EC8A 1OHQA 5IVOA 2CLRB 2P1YA 4HIEA 1ACYL 4KJQC 4WFED 5FCSH 3AAZB 4Y5VB 3FFDB 1CVSC 5JPNB 1GHFH 2IG2L 4LL9A 3SO3B 4ONGH 3BWAB 1S7WB 5FCUH 3L95A 4H88L 4LEXH 1RIHL 3GMOA 1WUNT 1HILA 3G5YB 3O4LB 2NY1B 1F6LL 5I1IL 1EHNA 4Y1AA 3RUGA 3MPCA 4K9EL 4OFDA 1WISA 2VC2L 3RRQA 2ZJSL 3T4AB 1K8DA 1URLA 3WFDH 3LIZH 2FZ3B 3RL1A 4P46C 1MHCB 5C09B 4BH7B 1BP3B 1T89C 3S3PA 3X12B 2CDFB 1A7NL 2XZAL 5KVMC 5FK9B 3DYMA 4XPTL 4K3DH 2FR4A 5D7LA 4MA7H 3BW9A 4E42B 5C0IB 4GAYA 1T0NB 3SJVE 3T0EA 5KSAD 1MCPH 2NX5A 3VWJA 3D85B 1XF4A 3CX5K 1LO2L 1IGML 3KPOA 3VXUA 4MXVF 1CTOA 1B0RA 1UM5H 4PGZA 4WU7B 4DOHE 1RJLB 3P30L 4R3SA 2FEDD 2W9EH 4HWBA 4UQ3B 4JB9L 4NO2B 4PJ8C 4PB0L 2JK5A 2FJHA 4GG8B 3KPSB 1X4YA 1A6AB 2AQ2A 3WSQL 1OP5H 4MX7A 4U6XB 1D6VL 3G08B 4DKEL 4BQBA 1MAJA 4OCWL 4U1LA 4JFEA 1S3KL 1QKZH 4Q9RH 5AWNL 5D7LE 1OP3K 5ACZA 3V7AE 1CT8B 3PHSA 1I7RB 1RZJH 1MJ7L 2P8PA 1EXUA 3O2VH 2AV7A 1IAII 4EN3C 4JM2D 1AO7A 4IMKC 1W72B 1G1CA 1P6FA 3TM6A 4FQIH 3PHQB 4IDJH 3S96B 3VXUE 3TBSB 5AAMA 4FQJH 4K3JL 5LAXB 5GGTA 4JHWL 1G7HA 3D3VE 1I1FA 2PYFA 1NMBL 4I2XA 5DRZA 4ELMF 4IS6A 3MGTA 4LIQE 1KTLA 1UB6B 3GM0A 4L3AA 4TVPL 1DR9A 3QJFA 2PTTA 2VITB 4H5SA 1LNUB 4JFED 3QDGE 2QSCL 2OJEA 5HVFB 5D71L 3IKCB 5EULV 5IB2A 3LEYL 3BUTA 4GLRI 1GC1H 4B53A 1MJ8L 1CLZL 5CD3B 3ZT7A 1JGDA 3BEVB 1FNSH 2MJWA 3N1MC 2JJSA 5JUEL 1AO7E 1MLBA 1IT9L 5T3ZH 3DROA 3ZZ1A 4G80A 5DQJA 5ISZE 3QQNA 4K7PH 2ILLA 2F54E 4MAYB 2FYYB 1WITA 1EEUA 2X1XR 2EDNA 4GS7C 4HDIB 3DO7A 3KLHD 3P9LA 2NY4B 1VFBB 1A7QH 1HWHB 1TJIH 3H3KA 3TCXA 5EU7E 3U82B 2VDLL 4JAMA 5KSBA 3QEUA 2F5AL 2V5MA 3GKZA 1K5NA 4P23A 5I1LB 4JFPB 4PR5B 1MY5A 3VXSA 3LKNB 4OM0L 4ZO7A 3OKYA 1OGAD 3FL7A 3SHSA 1XR8A 2VR4A 1KPRA 2O5XL 2Z31A 1FE8L 4MQXC 4BQ9A 1T03L 2F53B 2J88H 4BJLA 3TNMB 5JPMA 2HKFH 1QRNA 3MLSL 5DJDA 3I6LE 4MJIE 3SDCA 4C4KO 2DYPA 2HLFC 5D7JB 2W0FB 3CPLA 1U8JB 1JWUB 5EUKA 1EGJA 1AC6A 3PNWA 2DKUA 1HIMH 3RTQA 5TDOA 3TA3B 1FFOA 4ODWB 3IRZA 4WUUE 3VFVA 3TN0B 1DQJA 3O6FB 5JR1L 4IM8A 4O2FA 3FFCB 3QPQC 4AIXA 3VXSE 7CGTA 3ZHKA 1L9MA 1R3IH 2HMID 3DI3B 3RY4A 5ESQB 3RGVC 1TZIA 4JDTH 3FO2A 1WWBX 4N90E 3WHE0 1F8TH 1LO4H 3ARXA 3EFDL 5D5MB 3EDJA 4FZEL 3LPFA 4XI5D 3SDCD 2XWJA 4K94H 1XH3B 3AVEA 4YX2H 2GCYB 2APXA 4P9HC 1RU9L 2JJTA 1ZLUK 5HGHB 2VZTA 3D2UA 3DHJA 3Q6FB 1Q0YL 1UCTA 1DLHB 1FNFA 3ARFB 3EJJX 2GSIA 5CSGA 3C5JB 1IFHH 2K7PA 2VTFA 1IAOA 4BFGA 4JDZA 3HC4H 3O3UN 2EE9A 4PRPA 3TPUA 4FNLH 5D2NA 2E7LC 4NHUA 2YRZA 2UWEF 4OCLC 4N8PA 1HHKA 5I66A 1NAKL 1L6ZA 1BZQK 4JFXA 3SOBH 1R5IA 1FBIL 4JZOA 3WO3B 1GGBH 4L4VA 4N9GB 1QLRB 1H5BB 4LSRH 3Q1SH 3ULUE 2X05A 3HS0B 3RWEB 1W0YT 4H8WH 3MOBL 4PG2A 4GXVL 4EXKA 1EFXD 5IMLB 3E8UL 3V6OC 1DBBH 5I73C 3OMZA 3N1PC 5ANMA 4QOKD 2Y06L 4GOSA 4HWZA 1R3KA 4NJAH 2J5LB 4NO0B 3BGAA 1GPOH 1YYMH 2F58H 3OPZL 4R9HA 1OAKL 4PREA 3TT1L 3JV5A 5CUSL 5E8PB 4Y4HA 2UYLB 1MCQA 4HLZG 4L4VD 5GRXG 2OXHA 3QI9D 2C3WA 2EO1A 1LO5A 3PWNA 1I9IL 1J1OH 1S5IL 2VDRL 3E6FB 3MJGX 3HZMB 1SVZA 4N8VB 5FO9B 5LWYH 3BDYL 4QXTA 2NZIA 3HE7A 3MCG1 4KDTC 4WI2A 4G9DA 1J1PL 4NGHH 5FO8B 4AM0A 1KLFA 5IB3B 2XY1A 4Y4KD 5LCVL 4AIZA 3KYOB 4NRYB 1PBYA 3O6MH 4HUVB 3DGGA 3UYPA 4J3XA 3SN6N 3MLWL 3X11B 2Z91A 1Q8MA 1RZGA 2HJKB 3BP4A 2WBJC 2OP4H 4ETQA 1T5XA 1CICB 4ZNEE 1HHJB 4Y4HD 3P0VL 4CVUA 1F4WL 3ZMRA 5JNYA 1HH9A 4LARL 2G2RB 1XGYL 4TUJA 4WUKL 2ZOKA 3RI5F 3P2TA 4OUOA 1JF1A 4GFTB 4NQUA 5GRWA 3PXJA 4S1DC 4PRBB 3BP6A 3BRGC 4YHOL 1YNKH 5C0JA 4PJXE 5L2JB 1JNHB 1ZSDA 2F15A 2DLTA 1P2CA 1VFUA 3BQUA 1OP5K 3KPRD 5HYSB 4M93C 4JY5H 1E28A 5MEQB 4PRHA 4XPBH 4JY6B 1XIWC 5JQ6H 5BOPA 4NWUL 5DUBB 4KVCL 2Y5TA 5M94B 1H15B 3LMJH 1GGIL 3OF6D 2EDBA 3OKKA 3DTXB 1CFNB 1UQSB 2NY0B 1KJVA 1Z9SA 4ONFH 5IROC 4WTZG 3E1F1 2E9JA 2ENYA 1DL7H 5J9PA 4GMSL 4MLSA 1BD2E 5I18L 4GQPH 1IAIM 3V6FA 3TZVA 5GGVL 1U9KA 4B5EA 3V4VH 1AD9A 1JNLH 3WLWD 3X13A 1F3JB 2YKLH 3BQUD 4LLAA 4GKOA 2NY5H 3VD9A 1X5KA 1KCSL 5IW6A 5C0DB 3STZB 3OKMA 1I1AC 1G7LB 3NZHH 1J8HE 5C0RL 3GBML 4A6YB 1O7SA 1OSZA 4XNUL 2IANB 1U91A 1U8MA 4DW2H 1DTUA 2AI0L 3MRRB 1WFTA 4C56B 4F2MB 4XVSL 3ZTNL 4XNZB 5KVEL 5IVNA 1SM3H 2X40A 4FXKB 4QWWC 5C3LD 3JVGC 2O61A 4Q2ZA 5L9DL 5DEGB 3BZDA 3QIUB 3MLUL 1AHWC 3O4LE 5F7MC 3TZVD 1H8SA 43CAA 5HHQA 3S9DB 1UA6L 4DKAA 2FX8L 5E0QA 4PRNA 3SY0A 3UTPE 4LHJB 3SE9L 3KJ6L 3VDAA 2Q8BL 4KVNL 1ZT7A 5C09E 5CIPH 3BVNA 3T1FA 2CIIB 1FN4B 4CN4A 5M95B 4YR6A 3M1BA 4N0YH 5BVPL 2EDWA 3HZYB 3KWWA 1UYWH 1RULH 5BRZA 3BIKA 1N59A 1JGLL 4KV5E 5IVZA 3GIZH 4HV8B 2EDQA 1CGVA 5ENWB 3QNYA 3B8SA 4I4WA 4JN1H 3UBXI 2FIKA 4S0SD 5TE6H 4Y88A 4RNRB 5FGBA 1EHLL 3FAWA 4LEOA 5IBTH 4K8RD 4JPKH 3Q3GB 3KPSE 2ZZUT 1DQMH 3CVHA 1B2WH 2Y6SC 4Z77A 1RZFL 3LKSA 1CDUA 4PJIF 4YDLB 4GXUM 3BGFC 3CLEH 4MQ7B 4HX1B 4LSPL 1S9VB 1IJ9A 2VDOL 1JYWA 3DVIA 5D93B 3MQIA 4QY8A 5FHBL 3FKUS 3FO1B 4ZFOA 2DD8H 4IIQB 3K8LA 3NCYP 5F71A 1V3JA 1RURL 1F11B 4PBVC 1OW0C 1IAMA 4L8CB 2VXVH 3FQWB 3H9YA 5BQ7A 3TBVB 2W9DL 1VEPA 4LCIH 4UV4H 4ORGB 3FZUC 1RJZA 3RNKB 4EJ1C 5HVHC 1G7PA 2Z9TA 2FL5A 3T4YB 1J11A 5SWSB 5TE7L 4JFYB