1MCCA

Principles and pitfalls in designing site directed peptide ligands
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
216
structure length
216
Chain Sequence
PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Principles and pitfalls in designing site-directed peptide ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
total genus 35
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mccA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mccA02
4G80A 2DWDA 1OAYL 5T3XL 2K7PA 3Q6GH 3AMKA 4X6EB 4Z7WA 3KWWB 1LEKA 3GNMH 3CD4A 3NFSL 4Y4FA 4WWKD 2F54B 1R0AL 3DRTA 4BSWA 3SY0B 4FQXC 4HKJB 1PZ5A 2FRGP 2C26A 5ETUB 3DV4A 4QGYA 4U3HA 5KVDL 3UC0H 4GXVL 4MJ5A 4O2FB 5LCVL 2JIXA 4DKFL 4YHIB 2PYEB 3GSWB 4U6VL 2VLJA 5DUBA 1UKSA 5TQ2H 3WXVL 4L9LA 5CS7A 4PJHF 4QTIL 1XGPA 2OL3L 1S7WB 3O11B 1NL0H 1G9MC 4JAMA 3HG1D 3D85B 2C1PA 2X89A 5EBWB 4JKMA 1X5IA 2V7NA 1UG9A 3HE7A 1XGYH 3REWA 1GGCL 1UM5H 2FO4A 3V95A 4F9LA 5F7DB 1PDKA 3QFDA 3FOLA 4ODBD 2B4CL 3BDYL 3FN0H 1HHKB 4PJGE 3C8HA 4JZNA 4EIZC 5HGBA 2DDQH 3MLRH 4WNQB 1MHPH 1YDPB 4N9OB 2N7BA 3HRPA 5GISL 3EOTH 4Y4FD 2I25N 2XN9A 1QBLL 5AYUL 4DGVH 4OLVL 4OV5A 5SWZB 2R4SH 4XC3L 2R2HB 1VPOL 4KWUA 3KDMA 4HWZA 4HDIA 5FCSH 2Y06L 3GSNB 4JHAL 4OTXL 1WFOA 3K1KC 3BD3A 1CICB 2YN3A 1AO7B 3UTSA 1HWHB 1KT2B 2D31A 3G6DH 1T3FA 3Q48A 3DX9A 4POYA 2G9HB 4LARH 1AIFB 5JQHC 5I1EL 3OKOA 4GBXC 3OJ2C 4Y4HC 2FX7H 2NPLX 2R39A 3BEVB 3A6BL 1Y18A 3VXQA 3HMWH 4D94A 3EJJX 3ET9F 4ZD3L 1JZ6A 4IRSC 4OF3A 1CICC 4YWGL 4LSTL 1MFEL 4OUOA 2EDFA 1CI5A 3UTTE 3QI9D 1AFVL 3OJVC 3LKRA 1FC1A 4WW2F 4HZAA 3TBTB 5DEZA 1ZLVK 1AR1C 1RU9L 3QUYC 3AGVA 1G6RL 1JNLL 5HYSA 3CH1B 4U1SA 4IRJD 3BKCL 2LE9A 4QRRD 4HUNB 3LB6C 3KPMB 3QIBC 5HVFB 4PV9A 5KVEH 2X7LB 4I48B 4N0RA 1ETZA 3MUGA 2DI7A 4PRDB 4WFED 1F3JA 5I17B 1MFCL 4JKKA 5IB3B 3QCUL 1H3GA 5T3ZE 2C9AA 5E24E 1T7WA 2WBJC 2HFFA 3DX7A 2DQEL 3D18A 4XNZC 3ULSA 4JZOB 4GBXA 2IQ9H 3D6GA 4NSKB 1U36A 1R6VA 3EAKA 3WXWL 2HLAA 5CJ8A 3SE4A 1AHWC 5DWUH 1LEGB 4U1JB 2GTZA 3U7YL 3CX5J 3QUXB 4M6AA 3WSQH 1CFBA 3VRLE 1BZ7B 3KXFD 3SGKA 4JFQB 4C59B 5F89A 3O2VH 1SYVA 3B43A 5E00A 2AK4A 2YUZA 4M7ZC 5DF0A 3SO5A 4D0CB 2EH8H 4Y5VC 4HBCH 4PJ7E 5J56B 2N1KA 1QSEB 2DB8A 4GRWF 3I50L 3TN0B 3ESUF 3BN3B 1PAMA 2HJLB 1NFDB 4WI2A 2DTML 2JIXB 4WU7A 5DR5H 1GOGA 5C08E 4BSWB 2EYRA 2EDTA 3PWPE 4UV4L 4BKLA 1ZA3B 1KT2A 4JM2D 5ETUA 3RJQB 2OSLA 3DUUB 3JTTB 3CFBA 2YC1A 2BK8A 5A2JH 2OMNA 3DSFH 1ZT1B 1L0YA 3FTGB 5IBUB 1FGNL 4XCEB 4DN3L 3RVUD 4OM0H 3SKOA 4N9GA 5D1ZD 4Y2DD 1QR1B 5GSRA 5M95B 2CO7B 5DQDH 4HPYL 3AY4A 4MYWB 2IG2L 3L1OL 4P46C 1KIUA 5CD3B 4WO4D 3WV0A 2DQJL 3AC0A 1J8HA 3IAPA 5C0FA 4LMQE 3S88L 3OKNB 4PJIF 3QAZC 2AERT 3B9KD 3LKOA 1JV5B 3BD5A 3P4NB 4OKVB 1W72L 4KY1H 5CILL 2CR3A 3TA3D 1D6EB 3L6FB 2L7UA 3G5ZB 1UEYA 2QHRH 1EMTH 2NR6D 2H2SD 1KELL 3U0WH 1D6VL 4LLWB 1JMZA 3GSWA 4PRBA 4MJID 4E5XA 1U9KA 1WLHA 3P30H 3PWPD 4LLYA 4KROC 3IDIA 1XZ0B 2FB4L 3CAFA 5FAAA 5I16A 1QRNE 4UUJA 2AEQH 2XTJD 3QWRA 1R3JA 5J9PB 4IS6A 3QCTH 3O8XA 4O58H 2DBJA 5TPWL 3GI8L 3QHTC 4JPVL 3REVA 1TVHB 3DX8B 1Q0YL 3BZ4B 3O4LE 3O2VL 3DNKA 3MA9H 5C7XH 3U7YH 2D03H 1A2YB 2HJKB 1MVFA 2GK0A 1WISA 4PJDA 3BKJL 4LP5A 4PR5A 4UTBH 5E6YA 3QUZA 1QSEE 1YNTA 3VXRB 3NACL 1ODAA 4JFYB 3T3MF 3VG9C 3WXWH 5BW7C 4OAWB 2JCCE 3W39A 3WNNA 2EO9A 3HPJB 3KYKH 4N0FB 4ODWB 5C9KA 5C0CE 2W9LA 4GG6B 1IQWL 5MEPB 5SWSB 3QO0A 2VLJE 32C2B 3MCKB 3BP5B 1GXEA 1INDH 3CSBA 2KDGA 2VMFA 3ECBB 1QPPA 4S1QL 2BY3A 3IJHB 1NSNH 2WWKO 1GH7A 1NUFA 3RL1A 1MCIA 5AAMA 4YHNB 5EUOE 1IGIH 1INEL 5CUSH 1FZMB 1PGRB 1BD2E 5KVFL 3EYQC 2Z9TA 3BDBA 1A4JB 4ZO9A 3T4AB 5CZKA 2DQDL 2IFGA 1IAOA 2A6DB 4KJQD 1P53A 1G6RH 3X13A 4Z7VB 4Z7OE 1V3LA 5CD3A 5E8DL 1GRWA 1ADQH 3AXLA 3EOBB 4QRQA 2G5RA 3RVXD 2V17H 4YO0B 4HUVA 5SWZA 1BREA 3HA0A 1MVUA 3QDGD 3VFSB 3J8F7 2R23B 1VFAA 3KGRA 4QRSA 4LLMA 5DRZA 4L3CB 3ZLQC 1CDJA 3X14A 4ZFGL 2CLZA 4PJ8B 4TNVF 4LLDB 2ED9A 3DUUA 1U93B 2EH7H 4OGZA 3KPPB 3WFDL 1DEDA 1PY4A 2VISB 3DLQR 3CFEB 5EA0H 2CDEA 4PBVC 3EJYC 1QNZH 3BQUC 5F7KC 1UZ6F 5EC1B 3TP4A 2O5YH 1KENL 2EDLA 3TVMD 3MJ8A 1JZ5A 5IVXB 3LQMA 5C0RH 4HSQA 4OZ4A 1OSZA 4HWEL 4R96B 4Y16D 1VPOH 3PWVB 1ZGLB 4DVBA 1T1XA 5GRJL 1E6OH 3BGAA 1NMAH 4GMSL 2DBLH 4ZUWB 1L7TH 3H7BB 1AGCA 1UWXH 4BH7A 4DTGH 5H94A 2C3HA 3OGCB 4I77L 4UAOC 4X9IA 1T1ZA 3SDXE 1V7NH 4AIZB 1MSPA 1MCBA 2DDQL 1BJ8A 5E08H 2AXFA 3FQUB 2AK4B 2BNRD 3X3GH 4P5TD 3G5VA 1RVFL 2PN5A 1C7SA 5F9JB 4ONHA 3O9WA 1MRCL 1ZMYA 3RZCA 3RKDC 5FK9B 4G6KL 5D7SL 5GS0C 1F2XK 4GG6E 2QQLL 4N68A 3PWNA 2RFXB 1G7QA 4ZFOA 2WW8A 3AM8A 5I1LA 4CMHC 2BHUA 1P4LA 4ODUB 2DWEA 2FEEL 4Y16A 5D72H 5JIHA 1SBSH 3LPGA 3D9AL 4K71C 2NR6C 3L5WB 2R4RL 3GMRB 1T1YB 4PD4K 1Q9KB 4HK3N 3O6FB 5EIQA 3ARED 4PJGA 5MEOA 1NUNB 1MAJA 1G1CA 1TNMA 2Q20A 4MVBD 1A4JA 4K7PH 4JG0H 1OW0C 4FTVD 1NEUA 3CDGB 3GI9L 4J4PC 3VMOA 1P6FA 3BKMH 3ARFA 3S36X 1J5OH 1P7QA 2VL5A 2YBRA 5E5UB 3GUTB 1Q9KA 3C5SB 5D7IF 4Z6AT 3CFDB 4LSSH 2HLFC 4YDVB 5IJKC 1PEWA 3K80A 2BDNL 3STZB 2BC4B 5FKPB 5C07D 1S9WA 3MO1A 1EFXA 5GJTH 1A7OL 1U8IB 2UUDH 2H45A 2WP3O 3WEXA 1ZHKA 3ULVD 4M7KL 4XPBL 2H32A 3HR5B 1Q9WA 1F4WL 5A16A 4GW1B 3OKOB 5GGSY 5L88L 3FB6B 5IVXE 1JZ7A 1CLCA 3H0TA 1F3RB 1V3JA 4RDQG 1JHLL 4NN7C 4PGEB 1Q0XL 5BMFL 3MR9B 4WCYL 3TYFB 2AXGA 3CH8A 1I1AA 4FQXA 5CIPA 2ZCHL 1GC1L 3GB7A 5EWIH 1WIUA 2WINA 4JKPH 3I9GL 1YYLL 1T7XA 1MJ8H 2XWJA 3VXUD 3CLFL 1B0RB 1UXWA 5I1HH 5C0DA 1BVKB 3HS0A 2GITB 3U6RA 5L2KA 2DKUA 3VFPA 3WN5B 5SX5K 3T0XA 1G7JA 4LSSL 2I07A 1VGKA 4CW1B 4PJHB 4PPTA 2NY6B 3MRMB 3EYVA 3UYOD 4RAHA 4X4XA 3FKUS 3P0YH 1FZKB 2VUOA 5DZLA 1FNEA 4XVJH 3CZJA 1XF5B 4JFEA 5BW7A 1C5CH 2GITA 1PG7W 2D7TL 1H0DB 5D7JD 3IJHA 5EIIA 2P7TB 4LLDA 1P84K 2CLVB 3MCG1 1VGKB 2WMPA 4G7VL 5FO8B 1DBAL 2A1WL 3B9DA 1A6TB 4FP8L 4XNYH 3HUJE 4DGYH 5TDPA 4NT6B 1ZXQA 1JTTA 5DK2B 5DQJA 1IAOB 1P5UA 3KPRE 3QPQD 1FG9C 1PEZA 3MV8A 4FFZH 4OFYA 4PB0L 4JFYA 2VXVH 3V5KA 3IJSB 3RP1A 4U0RB 1CGVA 1ZT1A 2VZ1A 5JIKA 4NN5B 5JLZA 2C7UA 3RPIB 3OKMA 2RFXA 5F7UA 4LSPH 2W92A 4XNUH 5IB4A 3ILPA 2AI0L 5GPRA 1LD9A 2F8VA 4FTVB 5AD0A 3BP5A 1BD2A 1H3PH 3G5VB 1D9KD 1RZKL 3F5WB 4Z7OF 4QXUL 2B7DT 3LKPB 4E42B 1OAQH 4AM0A 5JXEC 3BP4B 4WI4A 3RUGF 1ZLVH 3MV9D 5DJXB 1X7QB 3DGGB 2Y72A 1VERA 1JHTA 3IFOA 2VLKA 1KENH 4HK3J 5I75C 3D69A 4BYHA 2OXHA 5HHMB 3T2NH 5T1MB 4CGTA 2FSEB 1JI1A 2EH7L 2G9HA 4R0LB 2QL1A 3V7AG 3L9RB 4HUXB 1AGDB 3UTQB 1R3HB 3CIQA 1RZGB 2WWMD 2HMID 1S7XB 3I6KB 2Q3ZA 4Y4KC 3T0EA 2EKSA 1H8NA 4LSVH 4J4PD 1NLDL 2A6IA 3TM6A 1QSFE 4LLWA 4NO0D 3QWOA 3UPCA 3IDIB 1NANI 1AC0A 3HC3L 5D2NC 4GQ9L 2HTLC 2DQDH 5FYJL 3ZE0E 2H2PC 4OD2B 4L4TE 1ZLUK 3DYMA 1LO4H 3X13B 5C0GB 1KACB 3WLWC 4R3SA 1FVDB 4GKSB 3G5YB 4KZDL 4BZ2L 4HKXB 1FRGL 4JM2A 1N5AA 2EE3A 3V0VA 3H3PL 4G6MH 4PTTA 5EOTA 1B88A 5IMLB 1T1ZB 1QLEH 3OXSB 2DF3A 1T03L 4YGVA 5HJ3B 4OSUH 1D5ZA 5B39A 1CT8B 3JV6A 3RU8L 5EBMA 4LPCA 3CXDH 5IEHB 5F1IA 2XT1B 2P4AB 5KANI 4OT1L 1H3PL 4EUPB 3BKJH 2DAVA 3RBGA 3IGAA 1JNNH 4H1LA 1JZ4A 4LPXA 2IBGA 2QEJA 3WUWG 4G7YL 1J0ZA 3ULUC 5I74C 1E28A 1A9EB 4PG2C 2BJML 5GRYA 1IBGL 5CP3A 5IESH 1AGEA 1WFUA 3W11D 3DROA 4GT7A 4HC1L 1UXSB 4G8EB 4OCWH 1EO8L 3MRJA 5HHQB 1NCDL 5L6YL 2BVOB 3A6OA 2V9RA 4HCRH 1MCOL 1NKOA 2MWCA 2PXYA 1DE4B 2RIKA 5EIIB 3MV7B 2VLRE 4CNIB 1AD0A 1Y6NR 1KN2H 4XCCH 4ZUVB 4P2OB 3WYRA 5JMOC 1T83A 2RCSL 2AGJH 5IK3B 4R0LA 4WHTB 4PGBB 1S7TA 1RK1B 3T0ED 2D7TH 1EPFA 3VXRD 1TJGH 3LSOB 2WIIA 4PY7A 4G5ZL 4QOKA 1AE6L 5D7LD 5B3NA 2IH3A 3E0GA 4FMFA 5HDBE 4X4YB 2ARJA 1CCZA 1XIWC 1T5XB 5DS8A 1U6AL 2HKHH 1YNLL 1RULH 5IM7B 3OB8A 4LCYB 3KPOB 3OV6A 5F1NB 3QXWA 1UH4A 5J6GB 2XTJB 2VXUH 1R3KA 3QJFB 4HF5L 1BD2B 3CLFH 3HG1A 3IAQA 1UGNA 4M93C 1O0VA 4TQEH 4G9FD 4NDMA 5ERWA 4MWFB 3MR9A 4MQSB 4V1DE 2R69H 1EK3A 3D0LB 3PDOB 1XFPA 3W39B 1HCFX 5BO1H 2JELL 2VQ1A 4NQDD 3PGFL 3MGTA 3NA9L 3MOAH 4HS6A 3OR7A 4LFHG 1UZ6E 5LBSL 3VXQB 3B9AA 5BVJA 3VFWB 2VSCA 4PRIB 1LK3H 2P24A 1BMGA 4U3XA 1K4DB 5J9PA 5DMKA 2DIBA 2J8OA 4MWFA 3MLVH 3U9UB 4KMTL 3ZKXC 5FHAL 4I0PD 1KJVA 3LPWA 4M4PA 5INCA 4S11A 1F4WH 5KN5A 4RGNB 1J1PL 2FD6L 4NCDA 4HUKB 3RVTC 4XTRD 1MWAH 3ULVL 3S35H 3AUVA 3NA4A 5GJTL 2E5EA 2PO6D 4JFEB 4DUXA 5D8JH 3NAAH 1CZ8L 2PR4H 4ZSOA 4GXUN 3FAWA 2QHLA 5MENB 3ZTNH 4M4RA 4N0YL 2J4WL 3VD9A 1WZ1L 4P9HH 5ALCH 1NC2D 3CUPA 3PE9A 2BVOA 7FABL 3B2UD 2HT3C 4R26H 2NY4C 3HS0B 4DCQA 1K2DA 3QIWA 2CH8A 4F9LC 5GS1C 3SDDB 5ESAA 3GBLA 3HNSL 4NNPH 3OL2A 3WFCH 4YHPB 1V3KA 1CFNB 2VQTA 4MHHG 1D5BB 1K85A 1ZHLB 3ARFD 4HLZG 1RMFH 4JRWA 4ALAH 4ESKA 2X9WA 3KXFB 4XAKD 5TFSL 4YAQA 5IKCA 3ALWA 3QUXD 5LJYH 3OB0H 4BQ8A 3BAEH 3FO9A 2B20A 1RHHB 2VDRH 2IPKB 1FYTB 2ZOKB 3KLAB 3CC5A 4NPYB 2ZOLB 2AXJA 4OFDA 1MFEH 1T0NB 1RUML 4PREA 2BVTA 3BIKB 2YUVA 3N1FC 3QG6A 4P5TA 3WL9A 2BNRA 1WBZB 3H42L 4W68A 2APVA 3H0TB 1JN6A 1HZHH 2DQFB 3NN8A 4PBWD 2OJZH 5IBTL 3V4VH 4HQQL 1P1ZA 4PP1D 5I1EH 1P7KA 5CEYB 3F7YA 3AB0B 1P4BL 3HI1B 2C3XA 5LAXA 3P2TA 3D25B 3LMJH 4XC1H 4M7LL 4H1LG 4UBDD 4XCYB 4KUZH 4D3CL 3KHQA 3DRTB 4L4JA 3HZKB 4HUMB 1M05A 2VERN 1NEZB 2BOBB 4ONFH 3WJJC 4NRXB 4AEHH 2NQCA 1S7VB 3GHEL 2XOTA 4JRXE 4NRZB 5I1IH 1CG9B 4PRIA 2VE6A 1HQRA 3HC4L 2HVKB 4JLRB 3WHE1 4Z7QF 4L4VB 4O4YH 5TGBB 2VIRB 3EZ8A 4KK9D 4FQHB 3RBSA 1DVFB 4MA1B 1V05A 5IHZA 3EOTL 5CBEB 1S7QA 4L8SB 1RZ7H 1UKTA 3V52H 3EHBC 1F58H 3RQ3A 3QJHA 4JFEE 4UUJB 1GPOL 5DZOA 3LEXA 3GK8H 3NPSC 3GSVB 4KKCC 4Z76B 2BP3A 4XVTH 2IEPA 4ONGL 4ORGA 2V5TA 3KPOA 1XGYL 4JPKL 3TBTA 2PO6B 3UO1H 1YMME 3DXAD 3S3PA 3RVWC 3VXOB 4RWYL 5ICZB 2H9GB 3BAEL 3KPRA 3PL6D 3W0WA 2ID5A 5CEZE 2YSSA 5DURD 4XMLL 1YEEH 2EDBA 5FOBA 4M9OA 4Z8FL 3EFDL 3BMVA 3HMXH 2MQ0A 1OGAE 5E2WH 4NNPL 3FHAA 4DUWA 4Q9RL 4PJGB 3SE3A 5T5FH 1HQ4B 4PRID 1KNOA 3D3VD 1CIUA 5F9DC 4PG9A 1CBVL 4AH2B 4NKMA 1WZ1H 3GNML 4YUEL 3WLBA 3D2UA 3DPBA 1FN4B 5GGQH 4HHAB 1FG2A 3QFJB 4GKNA 4S2SB 3PJSB 1WWBX 5IFAH 4WFHE 3BVNA 4XX1E 4O02H 1QFOA 2KZWA 3C08H 4HH9B 2ZUQC 2XZQH 4NQVB 3BT2H 4I3RH 4XP6H 3HG1B 5IB5B 3EYFB 4OF8A 1EJOL 5IMKA 1S8DB 2YA2A 4Q74A 1A7NH 2XIDA 1OF2A 2VLRA 2VITB 5K9OB 3O2DL 3TJHC 4G8GA 4TTDC 5F1IB 1MFNA 2BFVL 2OYPA 3MLVL 5D7LB 4MNQD 4WU7B 3TBYB 3B2UC 4P46A 3SGEH 1IM3B 4QOKB 3QQ3B 3M1BA 4Y89A 3MOAL 5E2VL 4WIQA 1DBMH 4ELKA 2D4DA 1KN4H 1MRFH 2Q3AA 1NGZB 1DBJL 4LMQI 3IFLL 1I7ZB 5EO1A 5D7LA 3UAJC 3P9LA 4P2QE 4NQEB 1Q1JH 1SVZA 2OJEB 1REIA 5K59F 3N1QC 4FQ2H 1S7RA 4CADB 2RR3A 5C0AD 2DJ4A 1R5IB 4LK4A 5CIPH 1FNAA 1YY9C 1NDMB 4EI6A 2VZVA 2WBKA 1JF1B 1KBGL 3BH8B 4NQCA 1KF9B 1D5XA 4QXTB 4L1HA 3QXAB 4EVNA 2ERJB 2R1WB 3CDCA 4BSJA 3ARTA 3IDMA 4UIKL 5C86A 2W1NA 2DN7A 3G08A 3H9HB 2EECA 1YZZA 5DD6A 1GJIA 2V2WB 3RWHB 5EU3B 4XCCL 2PUQT 5IF0A 3CJJA 3V8OA 4DEPC 2BOCB 4QY8A 2Y5TA 4POZD 2NY7H 4K3EH 4MS8D 5DR5L 2CXGA 1MJ7H 3TT1L 2XQBL 1A6VH 4UB0H 3I50H 5DJ0B 1RZJH 2PO6C 3ORJA 4GRLB 4QYOB 1M7IA 2PO6A 1IBGH 5ICZA 1JRHI 1G7LA 3T0WA 2Y5TB 1NGWB 4JY6A 4ZTOL 2IANA 2FJHB 1MCWM 3EFFA 3G5ZA 3OAZK 4W4OC 2NY6C 4O51A 3ULSB 3IDYC 2PW2B 2UV3A 3A67L 4MVBC 4RMRA 1L0XA 5IW1B 4Y4KA 1NDGB 2BNQB 1E4XH 2B2XL 4RA0C 3L3JB 3VXSE 4EN3C 5AZ2L 3IF1A 1UWGH 5FDYA 4QOKE 3FO2B 3C6SA 1IC4H 4KDTA 4IOIB 5I1DB 1Z6JT 3VWJC 3UJJH 4KZDH 2VRAA 4E5XB 5IFHL 1XMWA 4UU9B 2V9QA 5JDSB 1LO4L 3EDKA 2CIKA 3V6ZA 5JO5A 3QEQB 1X5JA 3PABA 4CAGA 1I3VA 1YMHB 4W6XB 3T4AA 3MLPA 2CK0H 4LLQA 1KJ2A 2MSPA 3HC3H 1ZA3A 4POUB 1CE6A 3OXRB 1NQBA 2HN7B 3KYNB 1OAUH 2DYPD 3P4MB 4V1DD 1Q38A 1U8PB 1IM9D 1D9KB 4OLEA 4X7EC 4HGWB 1LO0L 4L1DA 3KYOA 3CX2A 4K7PY 4J6RL 3BPNB 4ACPA 1W0WA 4B53A 3BWAB 2A2QT 3W82A 3EIFA 1FL3A 4UOW0 3MJ7A 5DD6B 4X6EA 5F1SA 3GIVB 3EYSH 2GYSA 3IFPA 4IRZL 3V0VB 2PXYD 1AXTH 4NOBA 1IC4L 5AEAA 4K23H 2GTZB 2DQCL 5HSFA 4AH2A 2VWEE 4A6YA 2UZIH 1CU4H 3HRZB 3OKLA 3QIWB 5BCAA 1G7IA 4PJ9A 4OCNC 1M1SA 1FG2B 3HKFA 2B4CC 1RUAL 2BVUA 3GMPA 5E8OB 3ARVA 3IKKA 4JY5H 3VJ6A 3VU2A 5DQ9A 4O2CB 2IALA 2ATPB 2VLME 4MAUL 4WENB 5GISH 4L3EA 1WT5C 5GGVL 5L0QB 5CJXA 4FS0A 5I16B 5KW9L 4QKXB 3JWDL 3BE1L 1B2WH 5L8JB 3MRKB 1Z9SA 1WCBA 3VXSB 5JHDD 1WEJL 2BNQA 2XZCL 3ARPA 1YY9D 1GZPB 1MJ7L 3TT1H 5JQ6H 3FB8A 3LEVL 2ZCLL 5EUOA 4IOFC 5FUZL 4HWBL 4F57L 2O61A 3BOVA 4JR9L 4OF5A 3SCMD 5TQ2L 5FGCB 3DV4B 1K5NA 4LSDA 1HHHB 2AK1H 3MV7A 2GKIA 3L5XH 1KPRA 2IAMD 3MBED 2HA1A 3B4NA 3CZFA 3AY4C 5MERA 4OCLC 4QY8B 2CKBL 3F7RA 4FTVA 1BVLA 5DK0A 3QH3B 2CLRA 1Q9OA 2WUCH 5BZWB 1R0AH 1KBGH 5LG1A 5J0BA 4MS8C 5EH1A 3CFKB 2OQJA 1JYNA 4PJBF 1EDQA 2ATKB 2AJSL 1G0XA 1YNKL 3FTGA 1TZGH 4WUUE 1U3HB 5HHVH 1F90L 4NQCB 4WW1B 1FC2D 4G8GE 4AYFA 2VLMD 4NZRH 1T2QL 3EJZD 3C5ZB 1U8IA 2X1PA 2ZSVA 1SEQL 4I18C 2CPCA 3F8UB 2Q7YA 3DI2B 3WIIH 4H20H 4OV5B 4JKWA 5FA4B 1DL7H 1U8OB 3T65A 5EDXA 2OR9H 4L8SA 3O9WD 3ARWA 4WI7A 5HYIA 2ENSA 1J9CT 1T5WA 1JHLH 2AK4E 5I73C 2ESVD 3S37H 4G42B 1CGSL 1C5BL 4GO6B 2OJEA 4TSCL 4BZYA 4YHOH 1U8MA 3RJDA 5EN2B 1XIWD 4LEOA 2EO1A 3PHOB 3GSQA 8FABB 4KPHH 3ZL4L 5C08A 3QA3A 2YPKA 3NCYS 3QUZC 3FOMB 5CP3H 4UTAH 4LAJH 2H1PL 3PV6B 4LL9A 1JE6A 1URLA 1FH5L 3DX7B 4L9LC 5L2KD 2XZQL 4TUOB 3TBVA 5EB9A 1Z9OA 2VLJD 2AKRB 3T2PA 2BDNH 3K3QA 1W0VA 1YEJL 1NBVH 2YPVL 3FMGH 4TNVK 1OT1A 3LHPH 5HGDB 3EYUL 3H2WA 2D4FA 4WJ5B 2J3SA 4WUUD 2BNRB 4UT7L 4ODVL 5CJOL 5AZEH 4FABH 1FZOB 3WFHA 3HZVA 3RNQB 2EC9T 2G75A 2YD6A 3CLEH 2W0KA 3MV8E 3EOYG 5C0BD 1QLFB 3KPLA 3LS5H 4PRHB 4RMQA 1OP3K 3RVVD 4KC3B 4X9HA 3BKYH 4Y4FC 4ZQKB 3TYFA 2CIIA 4IDJH 3NPSB 2MQCA 3LPFA 1LO5B 4GFTB 1A64A 1DQTA 5I74B 1UC6A 3MACL 35C8L 1X4ZA 4QF1B 3W2DH 3CCHB 4BELD 4KUCF 1IAII 2Y07L 4U33A 1YEEL 1MJJA 4KRLB 4LSQL 1KJ2B 5D72L 3QIWC 1MY5A 5C0BB 1KOAA 2UVEA 5KZCD 3UP1A 2BSTB 4XX1G 4XPAH 5SX5H 4P2CG 2B5IC 2I24N 1FYTA 4G6KH 2Q8AL 5BRZB 5GZNC 3QIBD 4E0RA 4GUPB 3FN9A 1BOGB 4EDXA 5DEFB 3GK8L 5DI8A 1GZPA 1BX2B 1U92A 2YEZB 5TDOB 5EU4A 5CEZL 5GRVK 5I1KL 5E08L 4Y1AD 4FA8A 3QDGB 4NNXB 2V2TA 4JDZA 1E4WL 1MQKH 2VWEC 4Q7DA 2X4TB 3CK0H 4LFHD 3V6OE 3WDIA 4DTGL 3VWKA 2NX5A 2NLJA 4TUJA 2W9DL 4KI5F 4HIHB 1XIWB 1E4WH 4YDIH 5C0RL 3NVQA 3THMH 5J6GA 4AEHL 4JDZB 3SOBL 3U1SH 4J7RA 5I1KH 2O5YL 4ONOA 3WIHA 2ESVB 3O81A 4IS6B 2MFNA 4D3CH 1QNZL 3QIBA 1K5NB 5DFTA 3F12B 1OARH 1NGYA 1UVQA 5F7FA 5FK9A 1J1XH 3JTSB 4H0GA 4QCIB 5DQ9B 1NJ9B 1T4KA 2R56L 4PRBB 4FQHA 4EJ1C 5DRXB 5J6HA 5D2NA 1H3XA 2I9TA 3N50A 3MGTB 2BMKB 4OLWH 1I1RA 1R5VA 4PJIB 4LSQH 5TF1L 3X12B 5GJSL 2FGWH 3FQNA 4B41A 2DQIL 3RIFF 1WIPA 1RZ8A 4WEUD 4HMDA 1OAXL 4KK8D 5JA8B 2CSPA 4AM0B 2MHAA 1FPTL 4NN5C 5I8KL 1UA6H 1N5YH 3G6JF 4HG4K 5ILTH 3DO3A 5A3IC 1NMCB 2IMMA 1R3IH 3RZCC 1ZANL 2AV1A 4MNGE 5IB5A 1JL8A 4FABL 3DXAA 5E4EB 1INEH 4JFDE 1CE6B 4KVNL 1OOAA 4R7NA 4CVXA 3U9PH 3WUWB 4BFBD 1VACB 4M48L 4DZ8B 1NC4A 2IAMB 2G5BA 1T7VA 3MBEB 5E2JA 1OP9A 4IRSB 2VC2L 3MXVH 1HYRC 4W70A 1C1EH 5ESVA 1JGEA 5FA3B 2H1PH 2V7HB 2JJUA 2QSTA 4ODVH 3MZTA 1FL3B 5T3ZL 3SDCD 3U36A 2E7CA 1RJCA 1X6LA 2YZ1A 3JV6B 4ELMF 5JHDB 3QA3B 1DBKL 3VXSD 1O5DT 3W81A 4WU5B 4JN1L 3PV6A 5I19L 2YA0A 4JFFA 3B9KB 4LDOB 4LPTA 4NKQB 2VZSA 3WS3A 4QNPE 2A6JB 1I8IB 3ZDXF 3H9ZA 3WIIL 3QWOB 3ARQA 3OR6B 1A7BA 2P8MB 3CDYA 1Z5LA 1W0WB 1VDGA 1BVKA 2NY0C 4JPIB 2E6JA 1MREH 4R0LC 3RAJH 1QSFB 3T1FA 3SKJL 1ED3B 3MV01 3V0AC 4OQTL 2E9IA 3F58H 3R0MA 1U8PA 3CVHL 3QQ4A 4JM2B 4XZUB 5DRXA 3WNMA 1AGFB 3PGDB 3VD7A 4PLNC 5J6HB 3EGSA 3H3KA 2XKSA 5GXBB 1CDIA 2CKBH 3AS2A 1Q94A 3S34H 4NRZA 1EEYA 1BFTA 5CMAB 4RSVA 4MQ7A 4GAYB 4KMQA 5GSVA 3IU4L 4P2RD 4XAWH 3VH8G 4OV6F 3VFNB 3MA7B 3AS1A 2DYPB 2MHAB 1M7IB 5F93C 3KAAA 3JBG7 4HPYH 3WJLC 3N85H 5DK2A 5DQJB 4NUGL 3NCYP 3QWRD 1U8HB 3QEQD 1ORQB 5CJBA 4LQ1A 3L3KA 1R3LB 3OKDA 3QPQC 2ARJQ 1I1FB 5IW1A 3ZTJG 1W72B 4FG6C 5I1GL 4ORGB 2VNCA 2YHGA 3BE1H 1S7TB 1U41A 5I9QB 4UV4H 1KFAL 3SHSA 3BRDA 4LCWA 4KTYA 2GCYB 4H0HB 4JQXA 4GRWB 4PJDE 4CNIA 3L5WA 1LDPH 3R8QA 5DMGC 3S96A 4Z78A 3F7VA 1R3LA 1NAML 4C58B 4JY5L 4RMWA 5DJ0A 5AYQA 4E9LA 2BNQD 5JHDA 3DTXB 5IQ7H 1PX4A 1NCWH 1DQDL 1A1NA 4FQQA 3EO9L 3JWDH 3QDHA 4FQLH 1IAKB 4G9DA 4NHCL 1HHIB 1PSKH 4OT1H 1OTSC 2FBJL 3QI9B 4GRLD 3HAEA 1AQKH 5ID0B 3M17B 2WUBL 4W6YB 3RTQD 2YPLE 5I18H 1KLGA 3GJFA 4N9GB 2DQEH 2FL5B 4KHTL 1U8KA 1MI5A 1JWSB 2P5WE 3VRIA 1EO5A 3GSUA 3S4SB 3IVKB 5DFWH 1BQHB 4QXGH 1J0KA 3O6ML 4G6ML 3T08A 3BQUA 3WLBB 4IRZH 5J3HC 2ADGB 3MJ7B 3FRUA 1G7PB 3V5HB 2Z8WC 3P11L 4IMKA 1CD8A 3OKKB 2D7QA 2F54E 1XF2A 1BFVL 1JPGA 2E7LC 1AO7D 3WNPA 1IZJA 2H2SC 1JWSA 2CK0L 1BQLH 4U1HB 5KS9A 4FQCH 1BEYL 1K4DA 3NCJH 5I76A 1YMHA 2YXFA 3KXFA 3ZKSD 4OZFA 12E8L 4PJ8A 5E99H 5CCKL 3KYNA 3GUTA 4EBQH 5DMJB 4LSTH 5J12C 3I3EA 3I02B 3PHSA 4ZD3H 2P1YA 3EO0A 1T6VN 1WTLA 4Y2DA 5DSCA 1UWGL 4K3JH 3GBNL 4Z0BH 2XFXA 3UBXB 3PHOA 4FZEH 3ZKNC 3SJVE 1T1YA 5ID1A 3T8XB 2AP2A 2AQ3A 2NY4D 1XR8B 3O4LA 3PG2A 4H26B 2D0GA 2OL3A 3ZKMC 4Y8DC 1PSKL 1M6OB 5D7JA 3TZVA 3OPZH 2Y6SC 4AIOA 2FECL 3N1GC 5D9SA 1BJMA 4NNXA 1FFPB 4I5BA 4UDTB 1HH6B 4RGNC 2HVKA 3QULB 5JOFB 4PJEB 2AJ3B 3LVEA 4GG6F 3MYZA 4DGVL 2ORBH 3ZT6A 4GG6A 5IVOA 4K71B 1QVOA 2A83B 3BPOC 1MHPL 5K9KA 1X5GA 4M1GL 4LF3A 2PXYB 2ARWA 1IQDA 3T77B 5BVJB 4YHMH 1CFTA 3MNVA 5KS9F 3HN3A 3SKMB 3O4LD 1A1OA 1RZJL 2EDNA 3DX9B 5F9WB 2XPGA 4PB0H 2C3VA 1RUQL 4ODSL 1FDLL 5F3BB 3T0EE 2AEWA 2A83A 1FAKT 4XVUC 4XP9H 4DUVA 1N59B 5BVPH 3S5LA 4QHUB 2R9HC 2XG4A 2OL3H 5E9DB 3MLZH 1IVLA 4M02A 5CSZA 3TYGL 4FP8H 3AREA 3SJVD 4YR6B 4ENEC 1T1WB 4PRPA 5KVDH 5IM7A 4BZ1L 3QSKB 3VRJA 3QP3A 1NCBL 1KB5B 1VEOA 1PX3A 4JJHA 2GSIA 1NUDA 4WNQA 5FKPA 3M45A 4GQPH 3PWJB 1FIGH 1R3JB 5MI0C 5AAWA 3D3VA 1K2DB 1FQ9C 3LZFH 3ZE2F 4ENED 4Q97A 3JV4B 3F58L 1MHEA 1QRKA 4F15C 2BSSB 3QNXB 5D7IB 9CGTA 4PYHA 3BH9A 4K8RD 5BV7C 2WAHA 5DJAA 2W60A 4LRIC 3QEQA 1ZLSL 2HH0H 3STLA 4CN4A 3GHBH 1G6RA 3MGOA 4C83A 5ALBL 3GEWB 4CDGC 2O93L 4FFVD 5HPOA 1EHLH 3UTOA 1DBML 3IDGA 5FYLE 1U95A 5F8QC 5IVZA 2LQRA 5B38A 2QR0A 3DUHA 3HNVL 3MCKA 5CINH 4UQ2A 3ARGC 5I19H 1KB5H 1T66C 4U1NA 1N8ZB 1BBDH 1DVFC 3QDGE 2R0KH 3S7GA 5L2KE 2A74B 3O2DH 3QEUA 3WUWA 4J3SA 2DM7A 4YXLL 4JO4L 4MQXC 5HHNA 5DJ8B 4QRUB 4GKNB 4XXCA 4FOMA 1CWVA 3TO2B 4ZOEA 1RIVH 1CTOA 3VCLA 5KTEH 2ZUVA 1KYOJ 3C8DA 4P4KA 4YBQD 2P46B 4HH9A 1OY3B 4OZIE 3AAZA 5F6HI 3LRGA 4LIQH 4R4FH 5EO0A 3C5JB 3C08L 3MLWL 4KKAD 1ZWIA 5IFAL 1J0YA 1FGVL 5EBMB 4TPRH 4LEXL 3G9AB 1I7RB 4X99B 5DO2D 4Q9RH 4CUCA 1QFUH 1N0XH 3BP4A 1QKZH 1YC7A 3KJ6H 3HE7D 1I3GL 1MVUB 3W9DB 4M61B 4QWWC 5E9DE 4PRNA 4P59H 3MC0A 1ZANH 2ICWA 4JFFD 3ARFB 1GSMA 1KCSH 3IJYB 4AJ0A 2C4FT 2EDQA 1U93A 4HH8A 1QFWI 4WFEE 4YDVA 1X6NA 4KH2A 2MPAL 3HMXL 2BY2A 3QIUA 4MJ6B 4WHTA 3HG1E 1FL5B 4D0DA 4U7SA 4XMLH 3MRPB 4MNQA 1B0WA 1HH6A 1LEIA 3QQ9C 3ULUE 4P2RE 4MD5A 3EOBA 5GRWA 1EXUB 2BVQB 1MCPL 2WBJB 3C6LC 3E8UL 5FYJD 4JFDB 3K8KA 3LKSA 1CN4A 5MEND 1ORSA 1XGRB 1FCCA 3QIUB 4MJ6A 5I75B 3WIFB 2KBGA 5I1IL 4N0CC 1EZVY 5TDOA 1XGUA 4XBPA 3NZHL 4MNQB 4JDTL 5K93A 4UNVA 4M5YL 1G0DA 4YPJA 3VFRA 4YDIL 1AGEB 4RX4D 3QQ9D 3MRHB 2A9NL 2NZ9D 4L4VA 3LMJL 5T1MA 2AV7A 1OP3H 3K81A 4X9GA 3TEUA 3VGEA 4YFLF 2OBGA 2C3VB 2HTKD 4WY7L 3RVTD 4HWEH 4MXQD 4WTWA 4L9LB 2P5EB 4Y2DC 3U0PB 1D5MB 2JTDA 2OJZL 3OKEA 3NZHH 5DC4B 4UIMB 5DYOB 4N8CL 1JPFB 5I1JL 1D5ZB 4P99A 1MY7A 3RWHA 3V6FB 5C0FB 4R2GC 3WJJA 4LDEB 1OHQA 4KZEH 4GKOA 3GMLB 2F58H 3SBWA 1WBYA 2PETA 1U8KB 4JREB 2BNUA 5IBTH 3V5DA 2DLEA 3AAZB 3VH8B 1IFHH 2Y07H 4L8BA 4PJCE 1M7DA 1TNNA 4K94C 4MZ2A 1BIIA 5A2FA 1QQDB 1NBZA 4NM8H 3ARDD 3LN9A 4PJXA 4TRPH 2X6MA 2X4QA 4IIQA 4WV1C 4P9ML 3VXUE 2J8UF 1U8QB 4LCUA 5J89A 1KIPB 1XZ0A 2GY5A 3P4OA 5E2UH 3OAUH 3P9LB 3PL6B 3TV3H 2LTQB 5EZIH 5BZDB 5C6PB 2BVPB 4V2CB 1HI6B 4JFQA 4PJ9C 4JANA 1FO0H 3V4UH 3WFCL 3KJ6L 4LGRB 4LEOB 4WHCA 2A6KB 2H6PB 3EYUH 4MJIA 3QIUD 5I9QC 5GGUA 3N1PC 1VACA 4JFDD 3TN0C 4AQ1B 2X4QB 3BVNB 1A1NB 5GGRA 4LDLB 3MLWH 2LU3A 4P2QD 1C5DB 4KGLA 4DKDC 3RHWF 1UADC 2XZZA 3VDAA 1FH5H 4AT6A 3IYLW 2C5DC 5IEKB 5LXGL 1JUFA 3L95B 4N0YH 2IGFL 1MHEB 4KPHL 3GFUA 3SGDI 1HQ4A 2W38A 1X7QA 5J11C 4XPGH 4TSCH 5IV2B 1B0RA 1CVSC 1VFBA 4R7DB 3G6JB 1X44A 1BLNB 2AQ1A 3RRQA 5T5NG 3TVMA 2KH2B 1PZ5B 4L8SC 4D9LH 1F8TL 5B8CC 4GLRI 3HZMB 3AROA 2ZSWA 1SYVB 4XXDB 4R8WH 1XH3A 4XVUD 2NTFB 5T3ZD 4PRDA 5DJYB 1BIHA 2HMIC 4YR6A 5JW4M 2R69L 4DOHB 5HYQA 4KMTH 4O58L 5EO9B 1A6UL 1TZIA 4OZHE 5KOVC 2M26A 4RNRB 2BSTA 4APQD 3FQXB 5CFHA 4QTHB 3LN5B 3P73A 5HY9A 2JJWA 5F7MC 3HR6A 3QPXL 3UEZA 4TVSa 3FFCA 3LZFL 1AGFA 1ORSB 1CR9H 3HE6C 1YEKL 2VUYA 2Z4QB 4MAYD 4U1IB 4NT6A 3UJIL 4D0DB 2C1OB 4AL8H 5KSAC 5IMMB 3WHE0 2X09A 5HTSA 3WD5L 2DD8H 2GCYA 4I3GA 5D71H 3CPLA 3QG7L 2AGJL 1RZFL 2AAVA 3A6CH 3JTSA 1KN2L 3O6FA 3OWEA 4P23C 4NO0B 5F7WC 3QCVH 4X5XB 4PRNB 3UZEA 5JOPD 2WSKA 5F7EL 3SDXF 4F57H 4HCRL 4G5ZH 2YUWA 1IMHC 1RIUH 5MHSE 5FUZH 2VXTH 2ZCLH 4H0IA 2R15A 3B8SA 4K3DL 3O3UN 4LSUH 1FYHB 5D1XC 3MYJB 3ULUD 3QWQB 4Z77A 4XWGH 4FFWC 1ZT7B 1C16B 3CSYB 3OSKA 2YRLA 5HHMD 1NEZA 2BOBA 3BZEB 1HH9A 1A9EA 4CJ1A 2Y7QB 5E0QA 3WJLA 3C5JA 5EZJB 4BM7A 5HYJE 5FDWA 3RZCB 4LQFL 3SDYL 5A3ID 4CVXB 4GJTB 2HRLA 1CL7I 4HBCL 4WV1B 3TNMB 3SJVB 1I7TB 2AEIT 3GSNA 2YN5A 3PP4H 2UZIL 2IAMA 1JN6B 4KJPD 3S5LB 1ONQB 4HX1B 2Q7NA 2XA8H 5E8PB 3ARBD 3V5DB 5GRVL 4CMMA 2DMBA 4UQ3B 4DCQB 1DN0A 3DURA 1FN4A 3MOQA 4HPOL 4OGAC 2H3NA 5I2IA 4MXVE 1HDMB 3M8OH 5IOPA 1QEWA 1Q9LA 4OSUL 5E5RB 5JO5B 3ZYIA 4M5ZH 1C8PA 1FORH 3L5JA 3GSUB 3S4SA 3IVKA 3EDJA 4OD2A 4YH6A 2XI9A 1LO0H 3TZVD 4DZBA 4FZ8L 4E41B 2R0LH 4MA8L 1U8OA 3T65B 4NQCE 4QXWA 4CW1A 1WICA 2IH1B 4RFNB 2BSSA 2YD9A 3QNXA 3ZKQD 3UTSD 4NQSA 1D5IH 3AMLA 1A3LH 5I73B 5DUMH 2D7PA 3LEXB 3T0EB 3ZHKA 4RMTA 2X1WL 1CD1B 3GMQB 2YD5A 3MLTB 5I1DA 1ETZB 3RVWD 1JCKA 5IWLC 5BOZG 3AXLB 3BZDA 5HVGB 4HLZH 2FX8H 3QUYA 5IB3A 2R0LL 3MV7D 2NY4B 1LK2B 5CIPB 3ARRA 1MHHA 1X5XA 4W81A 3RGVD 5C0EA 4ZS6D 4PJ8C 4G80B 3MRRA 1KJVB 4BSVB 2H26B 4JO1H 2ICWJ 3QUYD 1JMXA 3OKNA 2DYPA 3G6DL 1QP1A 4NQDE 2ATPA 5IT2H 4O9HH 1QHPA 2XA8L 1ZHBB 1Z2KA 2DLIA 1I8MA 3MOBL 1B9ZA 3Q2CA 1F45A 2Y06H 5F9AC 4PJEA 2QQKH 3HI1A 5BV7H 5C0ND 4QXUH 3VD4A 1AH1A 1YEGH 3RWJB 1MNUH 1F5WA 3ARDC 3FCTB 3S8WA 5CHNA 3ROOB 3BHBA 4FG6D 3FN0L 5C07B 3RWGB 2P42B 4U49A 2YMXL 4PJFB 2AABL 4NFCA 4NBYB 4G6FB 1OW0A 3UCRA 4J4PA 4UIKH 5F6IB 1OTUD 3BN9D 3D2UD 1U2HA 1U2CA 2F53B 3MJ9A 4I1NB 2WZPD 1C5CL 1J0JA 4XVJL 5B8CA 3MRPA 3G6AA 3DOSA 3MFGB 5HGAA 3WCYA 3ELAT 5DJCB 4OZIB 3NZ8A 4YQXH 2DMKA 4XNYL 3QXDB 1S3KL 3O6FD 2JB5L 4X9FA 1GGYA 3R1GL 1IGMH 4H8WH 4PGBA 4PG2A 5J1AB 5HHOD 1K6QH 4UZGA 4JFZL 5BZDA 3KNBB 3KPNA 2HG5A 4KKLC 4YHZL 1FBIL 4PTUB 1AGCB 5GHWH 1JPTH 5EPMA 4Z7VF 3L3IA 3LRSA 3V6OA 5IW6B 1I7TA 2M2DA 5D1QD 2PXYC 3U0PA 2FL5A 1DANU 5LGJA 2ESVE 5DJDA 1WCQA 1JTPA 3WNKA 4XNXH 2R1XB 1KEMH 3DHJA 5JXAL 4KKLD 2VDQH 3GGWA 2X4SB 5J12B 4NC0B 1ACYL 2IFFL 3WFBL 5SV3A 4AEFA 1BF2A 5KVGH 5B3JF 1CXKA 1JFQL 2NNAA 4EUPH 5LQBH 4GW1A 4P2RB 4WW1A 1L0QA 4WCYH 2BY1A 5C0AA 2VDQL 3UBXI 1HH9B 1ZHBA 4PY8I 2NXZD 3MRCA 5DRZB 2GK0B 4PR5B 3P9MA 5L88H 3BIBX 4G6FD 5DA0B 1P7QD 2NY1D 3DVNB 2ZPKH 2Z8RA 4GAFB 2ZUXA 1PG7H 5CBAA 5L9DL 4JJ5A 2PYFA 4LPYA 4MNGB 2QBWA 4KJWD 1BHGA 1DLFL 1WGOA 2IANB 4S0TD 1JWUB 4NUJB 1NBYB 1FCGA 3SDXB 1N4XL 1T0PB 3T3ME 1WIOA 3CU7A 4I5BB 4UDTA 4D9QE 1BGXH 4P3DB 3TCLA 1HINH 1I8IA 2P43B 3PGCB 1S3KH 4YHNA 3RL1B 3V5KB 4JFDA 3RGHA 4XT1C 1FE8H 4HJGA 4MA7H 5DLMH 3BKML 3UTTB 4S1RL 2F53A 3BO8B 1QO3A 4K9EL 1HYSD 1XF4B 3GKWL 3U0TA 1ZEAH 3QDMD 5IFJA 1J0HA 3GJFK 4MHHI 5I8KH 4CADA 2NY6D 4FQ1H 4JPKH 4PJDF 4TRPL 1A6AA 1UQSA 4W4OA 4PJCB 1MLCA 3HTLX 5D7SH 3WO4B 4ELME 1S9YB 5F7HA 4UBDC 3T2OA 5ADPL 4OUUB 1MRDH 2QLVB 2VDKH 4UNTA 1OAZH 5C9JA 4MA3B 4YHLH 5JW4N 1V7NL 4H88H 1P69B 3VD5A 1Q94B 1Q9OB 5LGHH 4WW2A 3H9HA 2R2BB 1T0MB 1NMAL 1R24B 3ARBC 4GMSH 2YRZA 3DBXA 2DQUL 1GOFA 3WHXA 1I4FB 1T80A 5IVXF 1NFIA 4O5LH 5IVXA 2B39A 3DYOA 4HWBA 1H0DA 5HVWA 4X6BA 1UB6A 1PFCA 2CUMA 5EA0L 4BUGA 1NGZA 1MCSA 4OQTA 3WFDH 1KYOK 3QR2A 4NN7B 3P0VL 4ZFGH 3VI4F 1U8NB 6FABH 2UWEA 2CIKB 3V4VL 1H3VA 3MRFB 3TH2T 5DVMA 3AU1A 5HGAB 1PKQE 4I2XB 3H42H 1NC4D 1UENA 3GSRB 3ZDZF 4EI5D 5DVLA 3PWPB 4ODTL 3D39A 5F72S 1UT9A 1AHWB 2YUXA 1NCAH 5JXED 3LRSB 4YBHA 2FO1A 2X2YA 3B5HA 5HHXL 3R06B 1PYWA 4PJ5D 1GC1C 2OZ4L 5M7QA 4G9DB 4HULB 1DLHB 1BOYA 3W2DL 1BPVA 3RX5A 3PWPA 2Z31B 5EORH 1WVZA 3E1F1 1VFUA 4N1CA 1HE7A 3RZCD 1NBZB 3AM8C 4KHXL 3U48A 3BEWA 1MFBH 2HTKC 2H9GA 4MCYA 5HI4D 3QNZB 1SHMA 1XGQA 3HE6B 1U91A 2XWJB 3GJFH 4M5ZL 4P59L 3RTQC 1FYTE 5DJCA 4OCSH 3DVFA 4Y1AB 1T89A 2EXYC 5J06A 3MX0A 4JZOA 4YLQT 5AWNL 1AI1H 1N0XL 1A5FH 1G9NL 2FSEA 5FYKU 2GAZA 4JFHD 2FEDD 2VITA 5D6CB 5BRZD 2YD7A 3VXNA 1UJ3A 3HUJB 3BZFA 3D0VA 2SEBA 2E7MA 4MA3A 2VLLA 4JO2L 3WKNA 1E27A 1IQWH 1IGJA 1AP2A 4I48A 4Z7WF 3MRBA 3B8YA 3U2SB 3P73B 2H32B 3HR5A 1BQUA 4BSVA 4YXLH 1XGTA 4P4RB 4YHOL 1MFDL 2Y1VA 4D8PB 3INUH 2YPLA 3G9VA 3TVMB 1CK0L 4KTEH 2XV6B 5L2JA 3JWOC 1CD1A 3GMQA 5DHVB 3PGFH 2CMRH 5FIEA 2DIJA 3PGCA 5BO1L 3U0WL 5DTFA 3BESR 1UFUA 1I9RL 4IJ3B 2DICA 1QBMH 1T89C 4LIQE 1ZLSH 1OPGL 1RIUL 3MJ8B 4WHDA 4XXCC 2FB4H 5FM4A 5C6WH 1I9IH 3QCVL 3GSQB 3BRGC 4I9WE 1LE9A 4LRNL 1AD0B 4NHUA 1XR8A 4ZO7A 2R9HD 1XF1A 3V9FA 4PJHA 3MROB 1AY1L 1CXIA 1A0QL 4WUKH 2Z4QA 3UJTL 5D71L 2LTQC 1FZKA 5DJXA 1AE6H 3P4NA 1T21A 3LV3A 1W72H 1DLHA 4XBEH 5T1KB 5JNYB 3L5HA 4BZ1H 1AY1H 5HDOA 2V5YA 3MRIA 5GQBA 3O9WB 4NKOB 3QDJE 1IGFH 1U8JB 4EDWL 4LRNH 2X4PB 1CVRA 4NQDA 3TNMA 1LO2H 2XWTB 4Z5RA 1MCOH 1ZGLP 3I85A 4Y1AE 2FWOA 4F7MA 5DK3A 1S7VA 1VEMA 5CHNB 1YEHH 5A43C 4YC2C 4PJEE 1JPST 2A73B 1JWMA 3DARA 1UM4L 4HJ0D 1FDLH 5GZOC 1LQSR 4ZO6A 5FF6B 3LD8B 1HXYA 4PTUA 1RUKH 1EBPA 1UB5B 3FONA 5MP6L 2NW3B 1WAAF 3BQUD 4J3VA 1H8OA 4KTEL 5B38B 5GGVH 5FO9B 1ZT4B 1GIGL 4NOFA 4OZGB 4RGMC 5DMKB 4JFHE 4ETQB 2IC2A 5C70A 3ARDB 2YRPA 4QT5B 2FO4B 2J6EA 4CRPA 3BPLB 3CFDA 4KI5C 4YXKH 2IQ9L 1X5ZA 2WK2A 1PLGH 1CFVL 2CGRH 5KJRH 2OR7A 4Y4FB 3W0WB 1MCLA 3HPLB 3SCMB 4EN3A 4XB8A 1FFOB 4NWUL 4OCYH 5EOCJ 1BP3B 4U6HA 1EH9A 2AJXH 1EV2E 2AJVH 1FFPA 2G2RA 1KJMA 3I6GB 2YBRB 1PZUB 1QFWH 2Y4SA 4PFEA 5HD8D 3VDCA 4UV7L 4JHWL 1A5FL 4X83A 3L3JA 4F15B 3OF6A 4U1LA 5CEZD 5BQ7B 1FZMA 4WTZG 2HJFA 3C6SB 3K7UA 5CJ5A 4AQOA 2DM4A 3KPMA 4KXZI 3VGDA 3QUZB 1CGTA 2AJZA 1RU9H 2PYED 1IAIH 3HFMH 4D0BB 5I6XB 1F4XH 4YWGH 4LSVL 2R2EB 2ITCB 5KSUA 3EGSB 3NCJL 3QO0B 1S9XA 3A6BH 5ACZA 5D1ZB 1N59A 2D0FA 3JXAA 4XHQA 4IIQC 3ZT5A 3C9NA 4IRJA 3OJDB 2VE6B 3PDDA 3QDJB 4JM4H 3O6LL 4MAYA 1A7QH 4KAQH 5T1DL 1F6AB 4BQ6A 4OJFH 2WBJD 5DJYA 4P3CH 1AFVH 1BAFH 4P5KA 2J1KA 1SMAA 1JPGB 1GVIA 5HDQL 5I1JH 1MCQA 2A77L 1I3RA 3NFNB 2EYSA 5EO0B 4OGYH 1P9MC 5D96C 3P9MB 2HT2C 4RNRA 1CICA 2RHEA 5IIEB 4Q9QL 1YEIH 3AB0C 4GAYA 4WY7H 4Q6YA 5I18L 5FF6A 3O3DA 2R1YA 4HCRA 1ZGLA 1QFHA 4KK8C 3A67H 4V1DB 5J4MA 1I8KB 4Y16C 3O3EB 2VN4A 1SY6L 2NZ9C 2OX5A 1PYWB 1Z5LB 4TSAH 2H2PD 3MLRL 5EU6B 1AD9A 1HILB 3RL2A 4JHAH 4OTXH 4AG4H 5JIPA 2XFXB 3DX6B 3UBXA 1BECA 2AKRA 2UWEF 3LQAH 1CLZH 1DQDH 2NY3D 4PJCF 3SE8L 5E94B 2NY1C 3VWKB 3DROB 2FLBT 4UB0L 4HJGB 3ZSSA 2X1XR 5TDPB 4U1GC 4CU7A 3TF7C 1JNHB 5DRWB 4H1LH 1KV3A 5L8KB 5TE7H 3RKDD 3FB7A 4KK5D 4U6HB 3IU3B 3NIGE 4Z78B 1HN1A 2YK1L 4HWUA 4YHYC 2Z0BA 5HI4C 3NABH 1LP9E 4F7CA 3UC0L 4NRYA 1QQDA 4HV8A 2Z91A 3PDGA 4O2FA 4WI9A 4P0DA 2W0LA 1K9TA 3H9SB 4QRRB 1EIBA 1XGPB 5ISZD 1AC6A 1G7LB 1WUNT 4WI6A 5FYKD 5IHBA 4GXUM 4JQIL 1A7PH 4K9EH 3SKNA 1ORQA 1HI6A 2ZSVB 1OTTC 2DI8A 4DKFH 3OXRA 1TMCB 3U36B 5I1CH 3O41B 4X80L 4AEIH 3S6CA 4GXVH 1AKJB 5FA4A 1CLYL 3RDTB 4P2RA 1FGVH 1D9KA 3LOWA 4ZPVB 3IDYB 4FQ2L 2FH8A 4OB5L 1EHXA 4RRPA 4Q9BA 2AV1B 1JPSL 1TQCC 4L8BB 2F19L 4NKMB 5JNYA 2VOTA 2G60L 3O41A 4MDIB 4UILH 3CVHH 5KSBE 1A4KA 1HYSC 4Y5YB 5JHLL 5IW6A 3LCYA 1OD7A 1OT2A 3L3IB 2YD1A 3VW3L 4ELMB 1ZV5A 1IC7L 1CICD 3QUKB 4HD9A 5HVHC 4JREC 2EYSB 1B4JL 1KULA 1KPVB 4ZO8A 5FKAA 4PJ5A 5H37G 2ZWLT 2FYYA 3WNLA 4JB9H 1TQCB 1KIQB 1BWWA 1JFQH 1EXUA 2BVQA 3G5YA 2BSRA 4HFWB 2FATH 4A2MA 5LQBL 3L3HA 4M43H 1IT9L 2X44D 4OIBA 1YN6A 2HLAB 1ZHNA 1I8KA 1NGXB 3BGFC 4G42A 1PBYA 2Q76A 1S9XB 3RDTC 2AQ2A 4O02L 1C12B 5E4EC 1JTOA 4JCLA 4YK4C 3VXSA 3TPUB 3L3HB 5D1XB 3UXFA 1H3UA 4YHZH 4A6YL 3ULUL 4OBSA 3D85D 3I75A 4R97C 3VWJB 5CBAB 1E4KC 4PJXE 4U1SB 1YEFL 4W6WB 4JPWH 2JF1A 2DLFH 2PW1A 4LNRB 4M1CD 2X7LA 5T5FL 3FT3A 1JHKL 4BK4A 1P4IH 5DD5L 2XKNB 3BDXA 3IFNH 5EBLB 4QRRE 5SV4A 1B6UA 2XKUA 1A7PL 1BX2A 5DFVC 1QR1A 2VDML 4GKZA 1RAMA 1BZQK 1OGTB 4WWKB 2XY2A 3O3AB 2AJZB 1ZT4A 2W0PA 3KVQA 1J87A 1D7FA 4YHKH 3VFPB 1LP9F 3NFPB 4XRCB 4NQTA 1OAXH 4YEEA 1XF2B 1DQJA 3B3IA 3RDTA 3TO4A 1RVFH 2YK1H 3G6JE 1I75A 4NJ9L 4ODXA 1GHFL 2YPLD 1P1ZB 5DD1H 3NN8B 3CFCL 1MNUL 1OSZB 2D31B 3W0WD 4QRPE 1S7UA 3RVUC 3FT2A 2ORBL 4WW2B 1V5JA 5EZJA 3UYRH 3MLUL 2H6PA 1M4KA 4PLJC 5BV7L 1H8SA 2A0LC 3QRFM 1A14H 2Z91B 4AMKL 5D2NB 5FEBA 3PWUB 1J1OH 4OKVA 3LQAL 4OZHB 4TULH 3SOBH 1N6UA 4UNUA 4M93B 5DJAB 1NAMB 1KEGH 3OPZL 4ZOBA 5DDHB 4HFUH 4MD0B 4N5ED 2FECI 2K7QA 2GIYA 4F2MB 4I3SH 4KQ4L 2IADB 2AJYL 3L3OB 2VZTA 2X42A 1HSBA 4EOWL 1YEIL 4B50A 3WMSA 3F6IA 1MQKL 1OP5K 2NXYD 3BYYA 4QHLA 1HZHL 4S0SD 4OF0A 3AU1B 3ARUA 2OXGA 2QV2A 3TT3H 4OFKA 1JWMB 2A6DA 3RTQB 5IGXH 2EEDA 3VGGA 1KJ2H 5E8NA 1SEBA 3B2VH 5T1DH 4YPGB 4ZUTB 12E8H 2ZP0T 4L4VD 3L3DB 4XPFL 1X4XA 2ZUTA 2SEBB 3L7EB 1K3ZA 2I5YH 1BQLL 3FQNB 4FFYL 2Q8BL 3U7WH 3MACH 3P77A 1HXYB 2XPGB 3C5SA 3SJVA 4OCRL 5IBLC 3JSSA 4FTVE 3L3DA 3BGFB 5C6TH 2X70B 5F97E 4L8DA 1P2CB 4N8VA 3VXMA 4IHOA 3K46A 4K7FA 4QXGL 4ISVA 3CLEL 1NAKL 4Z0XB 5HYJB 5CSZB 5F70A 2H32H 2WLZA 1U8LB 2GJ6B 5GZOD 3M8OL 4Y19A 1VGEL 4K2UL 4YK4B 2Z35A 5JW3L 2DJSA 4UV7H 3GO1H 3FB5A 3DMMA 1CQYA 2PR4L 3NAAL 4HMCA 1FYTD 4M6ML 3UTTA 3MXWH 3WO4C 3BZFB 4UQ2B 4QRPB 4FQLL 2NY0D 2D7NA 1CDYA 3EO9H 4JFPA 1LEIB 2GUOB 3SDDA 1HHHA 1S9VB 3P3YA 5DMIH 4F3FB 4LVOB 2FZ3A 4RGOH 4OFVA 5DC0A 4ZMAT 1YY8A 3VG0H 1FL5A 3VE0A 5C8JA 1LK3L 1I1AC 1AO7E 1C5BH 4PJAB 4PP2B 3WDJA 1V7ML 5LWYL 5JOPE 1MPAH 2BSED 3DV6A 3E2HB 2LVEA 1YMMD 5JW4R 5C0BA 5ICYB 1OWWA 1NCCH 4P4KD 1J8HD 1WJ3A 2A6JA 3HHRB 1KIQA 2QQQA 3F7YB 5DD0L 1FLRH 4X99A 5MP6H 3BXNA 4TOYL 2ZJSH 3WKMH 1CLOH 3FFCB 2UY7A 1EMTL 4GBXD 2B5IB 4M61A 2EE9A 2W59A 1YEHL 4HX1A 4BQBA 1LVEA 3CDFA 4N90E 3FRPG 4HK0B 4U1KB 2ICEB 3HE6D 2WP3T 3MUHL 4U0QB 4DVBB 1LO2L 2ZUSA 1G7IB 3HLAA 4UQ3A 5TH2B 1TZGL 1IC5H 1TJHH 5C2BH 1IC5L 5C2BL 1RZFH 2NW3A 3I02A 1KCLA 3CGTA 4AENB 4I0PB 3VCLB 4NFDA 3KS0J 1Y0LB 2Z31D 2OR8A 2VQUA 3QXAA 4JHBA 4OD1H 3FQUA 1D5XB 4QXTA 2UWEB 4QHUA 1KC5L 3O6FC 1TVBA 2MNUA 4AL8L 3QEQE 5F71A 4DN3H 3DO7A 4R7NB 1FGNH 2OZ4A 5I8OH 3PNWB 2E9JA 1TJHL 4I18A 4NQDB 5DD0H 2ZG1A 2IADA 5EPMB 2AK1L 4OQTH 5IVZB 3IF1B 3TJEH 4EI5B 5C3LD 2X4RA 1OPGH 4N0UB 5DHVH 5KSVB 3VXRA 4FMKA 5IROC 3VG0L 1WEJH 3JWOH 3FJTA 3WKML 5JPMB 1ZVYA 1NJ9A 1T4KB 4ZYKA 1YECL 3TPUA 1F6FB 3KPQB 3STZA 1F8TH 4RDQF 3GRWH 4OI9A 5C07E 4MB3A 3EJZC 1A1MB 5EFIB 3MV11 3RI5K 4YEFA 5BS0B 4PJ7B 1RJZB 4XPGL 1TDQA 4UT6L 2X05A 1S9VA 5LKNA 3ILQD 2F53E 2P48B 1QLRA 1AQDB 4P2OD 1U3HA 5ESQB 4Q6IA 3L9RA 2CDFB 4F7EB 2OMBA 2VL4A 3ES6B 1JYVA 2BX5A 5ISZA 1A2YA 4K23L 2FDBP 4KKBC 2BRRL 1MCFA 4GKZB 4MX7A 1DDHA 2HLFD 4Z0XA 4PV9B 4M6MH 1ZSDB 2R0ZH 3O0RH 2VZ3A 2X40A 5JW3H 5JZ7C 4JVUA 3QQ4B 2CDFA 1JV5A 2NY3C 4WDIB 4MNHB 3WN5C 2XTJE 1MI5D 5DI8B 1JPFA 3OAUL 1E27B 4Y4HA 3CNKA 1T22A 1XH3B 4P9MH 1H9VA 4N1EA 4JO3H 4XCNA 3OAZH 4MLSA 2EDWA 1LO5A 5F44A 3BI9X 1OGAB 2IBBA 3CU1A 1QG3A 2C7UB 4EN3D 1MEXH 3SE9L 3QDAA 4FFYH 5EC1A 3H9SE 4NWTL 3W11C 2ZUUA 2A0LD 3QISA 5C0EB 5EZLA 3T0VA 5GGTA 2IH3B 2OK0L 4ELKB 3QIBB 4RRPG 3ZO0A 1CGWA 4OIIH 2BSRB 2XN9D 5AG8A 5HHPA 5HGDA 1R5IA 3V4PL 3TIDA 3LB6D 5KZCB 3L3OA 2NY1B 5FGBA 4YHPA 2BERA 4X7SH 1U58B 4NO5A 3ROLA 2PF6A 4PGCB 3HZVB 4JZNB 1DQML 1L6ZA 4TUOA 3TBVB 1RFDL 1PQZA 1N8ZA 4Y2OA 2NY2B 3KPNB 1J88A 2QKIA 3T0EC 3FHQA 1OAQL 5TGBA 5GZND 3KR3L 5A2KH 3UYRL 1QBLH 5AYUH 5L7XH 3PWNB 2IANE 3KPQA 3CVIL 1VFMA 3VFGH 1P9MA 1GGUA 1SJEA 1TTFA 3DX6A 4RFNC 4RISL 5FO7B 1G1YA 1AD9B 1HILA 2V7NB 15C8L 1MCDA 3DRQA 2D7MA 4I13B 4NZDA 5CZXC 5GRUL 5DUPL 3LN4B 1GGCH 3MLUH 3OKDB 1WC7A 1UB5A 3FONB 5H94B 2VLJB 4XPAL 3BP7A 5A2IH 1JNHA 5LGHL 4K3EL 2NY7L 3RUGA 4M6NH 4QTIH 4CMMB 4NJ9H 1OAZL 4M1CC 3DO7B 3VD3A 3PWLB 4KDVA 2Y36L 1G9MH 1QYGL 1RZ8B 3MREA 2FHFA 4WV1A 1T6WA 3HCVB 5SWQB 1JHKH 5T1LD 1C08B 1DP0A 4FXKB 4L8CA 2IF7A 3GKWH 1JVKA 1UM6H 2CLZB 4IOIA 3RWEB 5ERWB 4JFXB 2DQGH 1JI2A 1FSKC 2ATKA 4X4ME 3GSVA 2OQJB 3D2UB 3UTPD 2VQ1B 1KTDA 1EVTC 5IG7A 1YEJH 3RWIA 4GAGL 5D6CA 1DBBH 4P46D 3UTQA 4KJYA 4KI1A 3ES6A 1CD0A 1LMKA 4JVPA 4P23D 1DCLA 3IT8D 4NP4L 5ACLA 1RIVL 1KJMB 1AXSB 2ZCHH 1DTUA 3E2HC 5CJXC 5HDLA 5DT1H 3MZGB 4PB9H 2OCFD 2NX5E 2HAZA 5D2LB 1M6OA 5D7JB 5HYSB 3TVMC 1X3DA 3VMPA 1QA9A 1HKFA 4X0KB 4C54A 2RB8A 4FQJL 2N4IA 1KTKE 3QQ3A 4PB9L 5JPMA 1P7KB 4M43L 3QUYB 2W0FA 1PY9A 4OBRA 3K4ZA 4P2OA 3OX8A 3L7FA 5ANMA 4WGVB 2APXA 3W9DA 3GHBL 3CVHA 1IC1A 1P2CA 3VXMB 3EKCA 4XP6L 5D2NE 3PP3K 1KTLB 4NRXA 5C09E 4Q9CA 3HI6L 5IMKB 2V2TB 2GJZA 4XXDA 1F90H 4K8RL 4OM1L 4JLRA 4KGJA 5HHNB 3UROR 4XMPH 4UILL 5HYQB 4YBLC 2G60H 4M1DH 1QUNA 5H37H 3NGBC 3GI9H 2W65B 4XZUA 1DSFH 2CRZA 5AUMA 4GW5A 8CGTA 3C60C 2H8PA 4G8IB 1CF8L 4D9RD 4RBPK 5I8CA 1LO3H 4OLZH 3R1GH 3C6LD 4PS4L 1NANH 4ZUUB 3DMMD 5FYLL 4X80H 4ZUWA 2R4RH 1SYSA 4E41D 4NBZB 1C5DA 4YQXL 2W65A 4PJAF 3W5MA 3OR6A 4KQ3H 1JGLL 3Q5YA 3T3PE 4XNZB 3DHMA 5JQ6L 2DWDB 4WUUA 5D4QA 2LAAA 2QQLH 3W5NA 5D7IE 3IDXL 4QCIA 1FHGA 1MRCH 3C6LA 3R8BB 1B2WL 1ZHLA 4EI5A 1GPOH 3WE6B 5JUEH 3QUMB 4L3CA 4OLXL 5FYKH 4M1GH 4GSDL 5A1AA 3ARBB 1IILE 4RAVA 1IM9B 5I0DA 1I1AB 2UY6A 4U1MB 4Z7WE 2VABA 4ZFZA 2OTPA 3GMRA 2Y9RT 1L7TL 3AREB 2EDEA 2NX5B 4O4YL 4XCEA 3PWUA 4S2SA 4M3JA 5IHZB 4L4TA 1WBYB 3OR7B 4Z7UF 3QHZL 2ZKHL 5EO9A 4OLYH 2DQCH 1G7HA 1SJHA 1XF3B 2FJFB 3O45B 1S7XA 1DQMH 3I6KA 4AZ8A 1UCBH 3V0WL 4C56E 3UX9B 2WNGA 3QI9C 4NCC1 2W0FB 4LP4A 2Y25A 4WTXA 4MCZA 4FZEL 4U3CA 3V8CA 4ZXBA 4K3JL 4RMVA 3GIZH 2DQHH 2VLKB 1I8MB 1U3ZA 3SE9H 1BQHA 5F7YC 1X5HA 3QXVA 3GSXB 3EDDA 1FVDA 5E8NB 1B6DA 1OAUL 3B5TA 4D0BA 4KAQL 4MCYB 3DX8A 4GMTH 4XI5D 1A8JH 3BIKA 4KRPD 1MHHB 4XP4L 5D2LA 1A3LL 43CAB 3V7MA 2FYYB 1RJLA 4UAOB 1BFVH 1IGIL 1X5KA 1ED3A 5DJZA 3REVB 1F11B 2R0ZL 1NFKA 3FT4B 5I17A 2AJVL 4FXGB 3VXNB 3SGEI 1VFAB 3MRDA 4KK6D 4QRSB 2ZZUT 7FABH 4NUJA 2EIDA 4NN6C 4M62H 1H15B 1JZ3A 5IMOA 4JPIA 2CGRL 4YDKH 1EAPB 1YPZF 4YXKL 4Y19B 3ZTNL 3EYOA 1E4XL 2K9UA 2R29L 1GZQB 1XGTB 4MQXD 1EA9C 3GMPB 1AQKL 2Q6WB 5J1AA 4DAGH 1MCJA 4HZLA 5EIVA 4ZUSA 3QZWG 1TITA 3IXAA 2AJXL 1LNUB 4ZDHA 1X9QA 3IFOB 4ZTOH 4NWUH 5KOMC 3ALPA 2E8YA 3MRCB 2ICWB 3CXHK 5KJRL 4DW2H 4NCC2 1J1PH 1NCWL 4OZFB 4GG8A 4J12A 1ULVA 3NIDF 2Z92A 3GI8H 5LAXB 4LASL 4IMLA 3B9VA 2ED7A 3VFNA 1DQJB 3B3IB 4BH7B 2ZUQB 4FN0A 3CCHA 1SYSB 5DD3L 3WHXB 1PKQA 1VSCA 3IXTA 1KB5A 4GW5B 3JV0A 3OKEB 2W91A 3BPOB 3KJ4B 4ZAKC 5FHBH 4L8CB 1HHJB 2F5AL 2OSLB 1QRNA 4C56B 4XWGL 1HHGB 1J05A 2R2HA 1GGIL 3F6LA 3LH2L 3ZHLA 3V6OC 3S98A 4NUGH 2D0HA 1I9JL 1KB9J 5T33L 3SQOL 2QQNH 3LV3B 3CMOL 2VJXA 1UB6B 3TIEA 4F58H 2QKIB 4NGHL 4Z7QE 3MRIB 3TIDB 1KLFA 4XWOC 2JLLA 1NEZG 5DC9B 4FFWD 1K3IA 4IIQB 4FQQB 3OG6B 1NH6A 3DXAE 3SGJA 5DQDL 4R4NC 1FO0B 3QZWB 2HTLD 1Q1JL 3BPNC 2YSSB 5EBWA 3NCEB 4LLQB 1A0QH 4WUKL 1YEKH 2AJ3A 3WLWD 1UZ8B 3F62A 3QFJD 4PJBE 5FYJE 2A6KA 4MJIB 5HGHB 2AV7B 3IDUA 5B4MD 4NO0A 2I9TB 5CGMA 1IGYB 5MEPA 3VFVA 4M7JL 1NCDH 5L6YH 3B6SB 3TA3B 1MFDH 4UI2A 3C9NB 4HC1H 1QBML 2OI9C 5GGTH 1I9RH 1S7SA 1BIIB 1I7RA 5DMIL 1A7NL 1Z9LA 4HG4J 3ILPB 1TQBB 5D6DA 5IHUL 4KROD 2CJUL 3HPLA 4I3RL 3SCMA 2NCMA 5CEXA 1FVCA 5IROA 1KSRA 5DWUL 3ZYJA 4BFIA 2MKLC 3BUYB 2WV3A 4MDIA 2RQ8A 1KB9K 4ODHH 1MLBA 2IGFH 3OX8B 4YDKL 5IJVB 3D0VB 1FFQA 1NAKH 1EFXB 1UJTA 1C1EL 3ZYOA 3RGVA 3H3PH 4OF6A 4NNYB 4PP1C 2XYCA 5ITBH 4JZJB 1DVFD 5E56A 2ADGA 5FGRA 3RY5A 2FCBA 2JIXD 4ZQKA 1GAFH 3KLSA 4WW2C 1X5YA 4ZG1A 1EEQA 2ZUYA 2E7BA 4J3WA 1QSED 1AI1L 2R2EA 4L5FL 4HKXA 4KVNH 4Z8FH 2J12B 4JFFB 4R9HA 3BKCH 1P5VA 2OZ4H 5E2UL 5HHXH 1V3MA 4U1NB 5FYLD 5ILTL 3SDAA 3NCFB 1EEZA 2ZNXA 3VGHA 3DUSA 2FHBA 43C9B 4MXWH 1KJ2L 3FQRB 3OHXB 4NO2A 4ZODA 2R8SL 1U95B 2A38A 4LBEB 1DFBH 1M71B 4MAYC 3TT3L 2Y5EA 2XTLA 3O2WH 5FUCC 6FABL 1TETL 4MJIE 1EEZB 2E9WA 1RZ7L 1IEBB 2PCPB 1F42A 4RAUB 4CN6A 5J3HD 1KXQE 5DJZB 3BGMB 4LVNB 3FT2B 2QJDA 1ADQA 1J1XL 3I84A 1U58A 1UWEH 2WBWB 4NO5B 2PYEA 2JK5B 4O5LL 1ZLWH 3U1SL 1U8NA 1JNJA 1ITBB 5FFLA 5DA4A 3M1BB 3P0VH 3OQ3B 4JQVC 5GRZA 5CEYA 3VFMA 1NGQH 3ZE2E 4MJ2A 3H7BA 1LWRA 1ZVSA 4OLVH 2DL2A 3KYMA 2HJLA 2VR4A 1T2JA 4HAFA 4F7MB 3NFNA 4JGUA 1CDGA 1ONQA 2APFA 4ZFOL 4FHBD 3I6LE 5DYOA 4UIMA 5DVOA 4LSPL 4KRPC 2DL9A 1BQSA 4X8JB 3Q6FA 3KPPA 3IDXH 4UT9L 5CZVH 2VXVL 5F3BA 5H2BA 1A6ZA 4MDJA 1FL6B 4JFED 1D5BA 1RIHL 1G84A 4FXGA 3CMGA 1NKRA 3FO2A 1NL0L 4EVNB 4MB4A 3VFRB 4OD3H 1A22B 5BZWA 4S1RH 3O9WC 1CYGA 4RGND 5T1KA 3F12A 1KUMA 2X4UA 1FE8L 1ZHKB 4MA7L 2VABB 5F6IC 4EKXA 1C12A 1U0QA 1CFQB 3DTXA 3TJHD 5E6ID 4DKEL 1DQLL 5TQ0H 4Q6IB 1N4XH 1OD9A 3KXFE 1CF8H 4JY4A 1ZEAL 1YQ2A 2GT9B 3U4BH 5E9DD 3P0YL 4ISVB 4R4BA 1ZE3C 4HIXH 1Z3GL 4BH8B 3NFSH 2VLRD 1EGJA 5F9JA 3GBML 3K1DA 1CFQA 3BUTA 1BD2D 3RWIB 3H3BC 1F2QA 3SDDC 4X9BA 3JWDC 3D48R 3ULVH 2PKDA 3U6RB 1BM3H 1HIML 1T04A 1L7IL 1O7SA 2XQYK 1G7PA 4XPTL 3TCXA 3SQBA 5IB2B 2Z93A 4GS7B 5KVGL 1IAIM 2MMXA 3BW9B 3PQYB 5H8DA 1EERB 2X4NA 3UMTA 4FQJH 4HKBA 3HUJA 1RK0A 4Z7UE 5C09D 1M7DB 4X7TA 1BLNA 1TPXB 5BXFA 3P40A 2NTFA 5JHLH 1JPTL 4MB5A 3KLAA 5HBBA 1SEQH 2F19H 3VFSA 4U1LB 3SEPA 5GGRY 4HF5H 5GS3A 1A7OH 3CVHB 5J1SC 4HGMA 4JFZH 2PW1B 2CRYA 4XH2B 1T2QH 5IEKA 2P5EE 1T21B 1KPUB 2P5WB 4X6CB 3WS3B 4GAGH 1MAML 2HN7A 4H25A 3WNOA 43C9A 4RCAA 1RURL 2VISA 1QOKA 5HGHA 2EC8A 3K4AA 4HGWA 3WL9B 4KXZH 5JR1H 3MNZA 1ERNA 4PTTB 2XICA 2VDNL 2YR3A 4HIXL 4WFFE 2BMKA 2BVEA 4JQIH 4CMHB 1FIGL 4D2NA 3L3GA 2GHWB 3VXUA 4QHLB 3G6AB 5FYKE 2P5WA 3LKNB 3OB0K 1EAPA 1LDSA 2ADJB 1LE5B 4PRPE 1UYWH 2VLKE 4RQQB 3IRPX 3BGMA 4F3FA 2B0SL 4Q58C 1LE9B 3UTZA 2HYMA 4WFFD 3VWJA 4C4KO 2DI9A 2AJUL 4JG1H 2DKMA 1CQKA 5I0ZA 3HNTL 4CVZA 5E8PA 1A47A 3ZDYF 2E9BA 5KS9E 1AJ7H 3BJLA 3ZDYE 1AR1D 3DIFA 2VXSL 3FQXA 1TQBC 1RUQH 4NZTL 1IEHA 1MIEH 3GMMA 3SE8H 2LFGA 3S36L 2E3VA 3BZ4A 2BNUB 1BVLB 1YJDL 3BSZH 5DK0B 1MWAA 2IAMC 2NY5L 5KW9H 1CGYA 4I77H 3ETBF 2I27N 5HDBF 3QEGL 3WDHA 4DGIL 4QHKJ 5J11B 1T0MA 4OZGF 4YDJB 3PQYE 3LKPA 2APTA 4MSWA 1A9BB 3DGGA 2HFEB 3I2CH 4GRLC 3O4OB 1S9WB 1LEGA 2A77H 3X12A 4X4YA 1OWRM 4Q2ZA 4R4BB 5TE6L 4X7SL 3VGFA 3PV7A 4JO1L 4BJLA 3EYQD 3K2UH 2C4FU 3LKQB 3W9EA 3QNYB 2XWBB 5JDJA 3O6LH 4J3OC 2QSCL 4KMLB 4ZUTA 4DN4H 1HK6A 3X17A 5LGJB 3IDMB 1IKFL 4GQ9H 3VXTA 4XBGB 1EFQA 3EOAA 1KCUH 2NY2C 3QBTB 2V2XB 2I9LB 4NN6B 2ZSWB 1W0VB 1AKJD 3C8KA 4ZPTB 4DQOL 2CKBA 3UPRB 3OTTA 4HXAH 5CCKH 2J8UB 3IDGB 4FZ8H 4KK5C 5ITFB 1U8QA 1CXEA 3GDBA 3KLDA 1QFWM 1X5FA 5DEFA 1A1MA 3L3GB 2M8XA 1U8LA 3CFIC 2HWZL 1D5IL 4OKDA 3OKLB 5IFHH 2X41A 4YZFF 3EO1B 4LCCA 4XNMB 2UZXB 1R5WA 2OM5A 4YHIA 5EOCH 5FV2A 1QSFD 4X4XB 1G9NC 5BS0E 4OCYL 1KPVA 5I76B 3SE3C 3ECBA 3OXSA 1UKQA 3ZKXB 4QHNA 3VWKD 3MBEC 2WUBH 3KYKL 3E6HB 3BX7C 1CXFA 3DBXB 2G5BB 3MBEA 1R5WB 2L4OA 1A3RL 1LEKB 4BQ9A 1LNUA 2B1HH 1GIGH 3LY6A 4NHCH 4M8QA 1B4RA 5C7XL 1FNGB 4OFIA 3NIGF 5CP7A 2V5SA 5IHUH 1E28B 2XY1A 3TO4D 3ZYZA 4PGJA 5ISZE 1OTTD 1RZKC 4JRYB 1JGDB 1YECH 3BJ91 1IJ9A 4GKSA 4Y0GA 3MV9E 4R97B 5HXMA 3JWOL 3MLSH 4LQFH 4ZS7L 3MYJA 4LSUL 1M71A 4LPWA 2HP4A 2VXSH 2ENYA 1PKQB 4B5EA 3QUMA 4U4BA 2AJUH 3SDAB 3TJEL 4X8XA 4RQQA 3SGJC 4DGYL 2ED8A 3QUML 1MLCB 3U7AA 3SKUD 3ALXA 3QNYA 5EUOF 2ITCA 5KSUB 3IDNB 2VAAB 5F96H 1TFHA 4XNQB 1J8KA 25C8L 1L9NA 4OD1L 1RJYB 1FFRA 2MQ3A 4OZIA 5DVKA 1CR9L 1X5LA 4YC2B 2VAJA 4JE4B 4X6BB 1LILA 1ZVHA 3A6CL 4XP5H 1RURH 1WZLA 3QUZD 3L1OH 4N90D 5IG7B 3HI5L 1I3RB 1NFDF 4U2YA 4KTDL 2APBA 1JHTB 1I9JH 5E9DA 1MAKA 5CEXB 1J10A 1GGIH 3MQIA 1E4JA 4TOYH 4E41A 3MA7A 1NMBL 3WS6A 5JLZB 2KPNA 4FRWA 4YBLB 4HS6B 5E2VH 4ODUA 1VB9A 3ESVF 4XTRC 2BXZA 4U1GB 5GIRB 1MIML 1V7MH 2Z8VC 4A2LA 5CAYB 3PWLA 3TA3A 1N0LA 5BJTB 1Q72H 4YNYB 3KYAA 4F9PC 4MNQE 3VGBA 1T20B 3V79C 3K4DA 1AIFA 2E27L 4PV8A 1AQDA 3NIFF 5D1XA 5ESQA 4NKDB 5HGBB 2BC4A 1EJOH 1OAKH 4OI7A 1UWXK 2B8OT 3BO8A 3QNZA 1AXIB 3KNBA 3IS0X 1QLFA 3KPLB 4PRHA 3O6KH 4PLKC 2VSDA 4KK6C 1RZJC 5HGGS 5JOFA 4NC2B 4WRLA 3UTZB 5GGQL 3C60A 3C2SA 4K2UH 1QEWB 4P5TB 4Q0XL 3MRMA 1Z3GH 5C0IA 4OCSL 3ZKND 1E4XI 1F4YL 4K7PL 5FGCE 5E7BA 5DZNA 5E6IA 4DKAA 3GSOB 5KSAB 3QCUH 3VA6A 4JRXA 4A6YB 2JCCF 4KHXH 4F37F 1OF2B 1EEUA 5D1QA 1UEMA 1D3CA 4P9HC 1JRHH 4X4MA 3U9PL 5E2WL 1WWAX 2DTSA 2WINB 4PJFF 1Z9MA 4LAQL 1FO0L 4TVPL 5I1LB 4NQVA 5EU4B 4EQ2A 1UXWB 2DMCA 4XPFH 3ROOA 4LCWB 1MJUL 4Z7NE 2Z35B 4WUUB 2R1YB 1RPQA 4PJFA 1EBAA 3PQYA 3WFEL 1T1WA 4F7TA 2DQIH 4AENA 3RWDA 1N6QL 2FGWL 1DUYB 3K8LA 4N8CH 2I26N 1II4E 4K3HA 4W4NA 5IMMA 3SDAC 1CDCA 5L2KB 4OI8A 2ICEA 3MCLH 5D70L 5E1HB 1KPUA 5HPMB 3TZVC 4R96A 3EO1A 5L0QC 1QSEA 4FQXD 5CGTA 1NGQL 4LCWD 4YIQB 5AUMB 3VI4E 3HC4H 3LIZH 5MEQB 2P5EA 2PTVA 5ANME 5I15L 4ONFL 4KRMB 4LF3B 5BV7B 4MXQC 1QHOA 1BBJB 1WSST 4KKCD 4M7LH 1A6AB 4UDUB 4UOW1 2CKBB 3UPRA 4NKOA 2X1QA 2JKXA 4XB7A 4Y4KD 4B7LA 3BIAX 4HDIB 5CLWA 4XAKE 1XF4A 3ULVC 3MCLL 5B22A 1M7XA 5F9OH 5DD1L 4JDTH 4DWHA 3O2WL 2VLKD 3LQZB 4LSRH 1Q8MA 4RAVB 2HVJB 4APQC 1EJ6A 3WUZA 1RUMH 2V17L 1U3HD 2BNRE 5DGQA 1AHWA 1MCPH 3E8UH 3C60B 5E8DH 4PBXA 5E7FA 3VFVB 5ADOL 3RWCA 1MELA 1HSAA 4YE4H 5IB1A 5CUSL 4LGSB 5EUKB 4WFGD 3ZE1F 2Z31A 4K7PX 1OB1A 4WI5A 2Q7YB 4NZUL 1QFUL 2BCKA 2CQVA 1BOGA 1HINL 1GAFL 4EIGB 1NSNL 4DEPB 4IDJL 4PV8B