1MCCA

Principles and pitfalls in designing site directed peptide ligands
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
216
structure length
216
Chain Sequence
PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
publication title Principles and pitfalls in designing site-directed peptide ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mccA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mccA02
1F8TH 1A2YB 1BQLL 3WUWA 5HGBA 3P73B 3P4LA 4OF6A 2CLRB 3SKOB 2XWBB 3STBA 3HC0B 3KPNA 3OR7B 5C0GB 5EBMB 3GNML 1RI8A 2V9TA 5CGYD 5L0QC 2I9TA 4C56D 2O26U 4YHOH 3EDJA 4JFEE 4GSDL 2J8UB 4QRTB 5JW4M 4PJCF 5IMLB 4NYLB 3U7WH 7CGTA 3ULVL 1YPZA 3GSVA 1GL4B 4BM7A 3P3YA 1G9MH 4X9HA 5DEZA 1OTUC 5E2VH 3EJYC 2VDML 3BE1H 2Q1EA 4KI5C 2AS5M 2C7UA 1Q9WB 1TFHA 4HH9A 1DBBH 3BZEB 1RAMA 1U2HA 4P49A 2JELH 3W9DB 1O0VA 1EHAA 3K7UA 5F96L 3MUGA 3MOBH 3O0RL 2P46B 3QQ3A 2G5BA 1N2RA 3MLSH 3T09A 2QR0B 3O4OB 2YD4A 3HC3H 1A4KA 2E7LA 4UAOC 2Q7YB 1GC1H 1H3WM 3UJJL 4WI7A 4S0TD 4FFYL 2W0FA 4PY8J 3KPLB 2JE8A 4OZ4A 2E7LC 4OV6F 1EDQA 3IGAB 2AABL 5IB2A 2ZSVA 4ZUTA 1XZ0B 2NY6C 1O7SA 1RZGB 3IDGB 5GGSY 3BISA 5L0QB 3WUWB 5HGBB 5TF1L 2XY1A 5F9DC 3KHOA 2YD7A 4HIXL 5CEYA 3KPNB 1DDHA 2I9LA 4NFBA 2I9TB 4GH7B 1MQ8A 1U3ZA 2OS7A 1A6AA 1NMBL 3RL1A 1U95A 3TPKA 1G6RH 5E8NA 5SX4H 2VZUA 2Z4QA 1G9NH 1YPZB 3GSVB 5F1OB 3ARXA 2QADC 2WLYA 3MGOA 5ABDE 3TM6A 4LIQE 5TFSH 2BVQA 2WBJA 5J1SC 4LAQH 2YC1A 2C7UB 4HH9B 1NGQL 5DDHA 3L3KB 2WBJC 1YMME 5AAWA 3C5ZA 3WFEL 5GXBB 4XHJC 2VDNL 1OTUD 3EIFA 3EJYD 4QRQA 4KI5D 4N0YH 3MUGB 4UAOB 4KY1L 1M05A 5J06A 3QQ3B 4NC2B 2G5BB 1N2RB 2OR9L 2YWYA 4KFZC 3C5ZC 3FQNA 1A4KB 4ORZC 1NDMA 3P0YH 4LCWE 2DDQL 2QSVA 3OKOA 4HWUA 2BMKA 4W6XB 3T65A 4DN3H 3CSPA 4JO2L 2W0FB 3VFSA 1T0NA 4OZ4B 1N5YL 5ILTL 3TIDA 4XVSL 2W92A 1BBDL 5IB2B 2CSPA 2ZSVB 2F5BH 4ZUTB 3QNZA 1KULA 1ZT1A 3KDMA 3U7YL 1I7RA 2FO4B 3IU3A 1MOEA 1MAMH 3F7RA 5DJ0A 4JFEA 3SCMA 5CEYB 1DDHB 4OLZH 3FJTA 1LEGA 2I9LB 3GSNA 3SGJA 4ODSH 1MWAH 3T8XA 1T4KA 4IRZL 5TJWK 3TPUA 4PJHF 3SCMC 5HYSG 2FBJH 4BZYA 5CIPA 1A6AB 1TMCB 3RL1B 1U95B 5E8NB 2QADB 3SGJC 1H3TA 2Z4QB 4G8EA 1OAYL 4PGDA 1ZWIA 1MRFL 4OFIA 3VMNA 4MJ2A 5GISL 3OKKA 4RGMC 2QJDA 4GOSA 2DN7A 2HH0H 5ECJE 3MGOB 4JM4L 1P84J 2BVQB 2WBJB 5LQBL 4WTZG 3U30B 2APVA 2YC1B 1AGFA 1TETL 1WWCA 1ACZA 2GCYA 5DDHB 1C5BL 2Y5EA 2QADD 1UWXH 3C5ZB 1A6ZA 3D69A 5BVPH 4GS7B 5IEHA 4ISVA 4ZUSA 1OCWH 3B6SA 2EYTA 2BY3A 4QRQB 4Y2DA 2WLZA 4PYGA 1M05B 4R97C 3I3DA 2DLGA 3MRGA 4PREA 3FQNB 1MJUL 4M5YH 2OZ4L 4Y2DC 1NDMB 4KK9C 3CXDL 4XHJD 2XFXA 3OKOB 3GRWL 3BD3A 4PJCB 2BMKB 3T65B 3FCTA 3VFSB 1GH7A 1T0NB 1P4LA 5IMOA 2E9BA 3C5ZD 5E7FA 3GK8L 3TIDB 1ZT7A 5LGJA 1M7DA 4JFPA 1PLGL 2X4SA 5IG7A 3QNZB 5ID1A 1ZT1B 4NBZB 1F2XK 3KDMB 4D9LL 3QHFL 1I7RB 3IU3B 4WW2C 4FHBD 5DJ0B 2ZOLA 4JFEB 3SCMB 4YDJA 4OLWL 2D9CA 3OG4B 3K1KC 3RU8L 4CMMA 3GBLA 5D71H 4BZ2L 5IBTL 4OCRL 3T8XB 1T4KB 3BPLB 3TPUB 4N8VG 5CIPB 4RGMB 1Z6JT 5I16A 4JDZA 4G8EB 4G6MH 1ZWIB 1F02I 1FIEA 2BHZA 4JFED 3TZVA 4NQTA 1UG9A 4U6XA 2APFA 3A6BH 1KCUL 1OSPH 1YMMA 4WENB 4G3YH 3TZVC 1AGFB 4WTZA 5GHWL 4KRLB 4AEFA 2EECA 2GCYB 4PJEE 5FYLL 4D2NA 1A6ZB 2W38A 3D69B 5IEHB 4ISVB 2UVFA 1H3PL 3B6SB 4LCWA 1TZHA 2EYTB 4I3SH 4ZUSB 3EZ8A 1G1YA 3IDUA 3BESR 4LSRH 1A5FH 5DF0A 3MRGB 4PREB 4TVPL 4XXDA 3GHEH 4XPTL 2OI9C 1NAML 2W0KA 4KGJA 4OKVA 5GS2H 2XFXB 3O2DA 1JF1A 1P4BL 4XC3L 5M94B 3FCTB 4O2EA 1MCOH 4R90H 2X44D 1FSKC 5DD0L 4PJEF 1P4LB 3K46A 5IMOB 1MAJA 1ZT7B 1GGCL 3QA3A 4RIRA 1M7DB 5LGJB 4KK9D 5EBLA 4JFPB 4KRPC 3RBGA 5B4MC 2X4SB 1WZ1H 4HJGA 3QUML 5ID1B 1QG3A 4QY8A 2A9NH 1BAFH 1U8OA 1YN7A 5C6PB 2ZOLB 1UC6A 3KYOB 4DGIH 1DQLL 4YDJB 1FVCA 5IFHH 4CMMB 4AIOA 2MWCA 1NCCH 2ZG2A 5FM4A 5I18L 2VSDA 4LL9A 1DBJH 5MI0C 2Y36H 4LHJB 3EYUH 4N8VA 5HPMA 4FQPA 3Q5YA 3CFCL 5I16B 1FCCA 4JDZB 1J11A 1N5AA 1BVKA 1UENA 3LIZH 3TZVB 1ED3B 3W2DH 4U6XB 5DMIH 2H26A 4HWZA 4P2RE 3V95A 1YMMB 1NMAH 4EBQH 4JN1L 3O3BA 4JHWH 3LQAL 1ZLSH 5T5FH 3TFKC 3GIZH 1D5XA 5J12C 1T2XA 3RIFF 1TJGH 4OLYH 4LCWB 1TZHB 3TZVD 2I5YH 4AIXA 1ZXQA 4WCYH 5FKPA 5GGTH 4XXDB 1YMMD 5SX4I 1FSKB 3H9HA 3G5XA 2APBA 1UWEH 4OKVB 2FYYA 2R0ZL 1JF1B 4PJGF 4KRPB 2DQCL 4O2EB 1QSVA 4OCXH 3VH8A 2O61A 4E42A 5K9JH 2GI7A 4YGVA 3O3EA 3PL6A 1PAMA 4LCWD 3QA3B 4RIRB 4TNWK 1BF2A 5EBLB 2J8HA 1I4FA 3B2VL 1QBAA 1RK0A 4W6YB 5F8QC 1IARB 4HJGB 4YO0A 4MB5A 4G9FD 4QY8B 1E4WH 4TTDC 3PL6C 3ZT5A 1U8OB 1J0HA 5H37H 1YN7B 4PJ9A 1BP3B 4HS3A 4FQQA 3VFTA 2NY5L 3SOBH 1CU4L 5AG8A 4KRPD 1FVCB 1LO2H 5EZIH 5B4MD 3ULUE 4Q9QH 3IFLL 4PJ9C 3GMPA 3TBVA 5CEZE 4IOSD 1J87A 1MF2L 4N8VB 5HPMB 4TSBH 5I19H 2F53A 2HFGL 4YZFE 1N5AB 2KQNA 1JPTH 1CWVA 2HFTA 12E8L 3WUZA 4CN6A 4PJEA 2Q3ZA 3LKOA 2H26B 4HWZB 5J12B 4FQJL 3RQ3A 4I77L 3ULUF 3O3BB 2FGWL 4MA7H 5FO7A 1IC7L 2ZUXA 3MJ7A 3PJSA 1D5XB 5SV3A 2CRZA 1UZ8A 2C3VA 3U2SA 3EYVA 1E6JL 4YZFF 3MRLA 3O11A 4IJ3C 1AE6L 5C0NC 5CJOH 3RJDA 2DQUL 5FKPB 5FYJL 3BEVA 3WV0A 3H9HB 3G5XB 3BOVA 2BOBA 2FYYB 2O61B 3AM8A 4YGVB 2LU7A 3O3EB 1XF4A 3PL6B 2XT1B 1JNLL 1MCBA 3QXDA 4ZFOL 4IRSA 1I4FB 5FYKD 3NVQA 1RK0B 1EERB 3KLSA 1EZVY 3AM8C 1V7ML 4AMKL 4YO0B 2LU3A 4NQSA 4PJ9B 4IRSC 4HS3B 4NJAL 4FQQB 3VFTB 1PG7X 5FV2A 2ADGA 5JW4R 3VMOA 4JPVL 3NCYS 4TTDD 3GMPB 3PL6D 3TV3L 4LLMA 4X6EA 3FT4A 3CAFA 3WDHA 3HI6L 4N8CH 3OSKA 1HINL 4OFPA 4P2RA 2YKLL 1UZ6F 3LRGA 2F53B 5C0RL 4HDIA 2IMMA 3VA6A 5K9KB 4APQC 3WDJA 4FABH 1MQKH 1GPOL 1IILE 4O02L 4PJEB 3LKOB 2WANA 5GGRA 3FQRA 1YYML 2XZCL 4PJ5E 2IALA 5L6YH 1JYWA 3K2MC 1ZVHA 4LPWA 2VWEE 5FO7B 1KF9B 4IJ3B 2X4NA 5K33A 3PJSB 1MCWW 1SEQH 1UZ8B 2C3VB 5F7NC 3U2SB 2BX5A 2F53D 2VUYA 1RJCA 1DQDH 1II4E 3PP4L 1C1EH 4HKBA 3MRLB 4I3RH 3O11B 1VADA 3KLDA 2F9BT 1RZKL 3JWDL 1FNFA 4XXCA 1KN2L 3B9VA 5F7YC 2BOBB 2X9YA 2WAHA 3LB6C 4NM8L 4UQ3A 5EUKA 3QIBA 2CQVA 3DUUA 3LKPA 4XXCC 1RHHA 4N9GA 3F65A 1XF4B 1S7RA 4D0DA 5KVGH 3VE0A 4WVRA 4J4PA 3C2AL 4IRSB 2ZJSL 3DGGA 3QIBC 4Z7VE 1C7SA 1MVUA 2OR8A 2VDPL 4XH2A 2P43B 4U1GC 4NQSB 2A6KA 4J4PC 2WIIA 4YHML 5CZVL 4BQ9A 2IQAA 4F8QA 2ADGB 1S9YA 2XN9E 3CX5K 3ULUC 1QYGL 3OKYA 4NNYA 3BKJL 4LLMB 4M1DH 2FX8L 3FT4B 4MDJA 4IRSD 4X6EB 3W11C 2N7AA 5DC4B 4TN9A 1F58H 4EXKA 4P2RB 5E8OA 4BUGA 4HDIB 2UWEF 3PV7A 4MXQD 4NKOA 2BVUA 5AWNL 1R3KA 2ZSWA 5GGRB 3FQRB 3EDDA 3T2PA 2IALB 4S0SD 4UT9L 2PTTA 5C0DA 1CGTA 3QUXC 5DRXA 5C6TH 3RFZC 3JV6A 2X4NB 5E9DE 2F5AH 4P2RD 3O4LE 1YY9C 2ERJC 2NTSP 3L6FA 4GLRH 3VXNA 2P44B 1UKTA 4HKBB 2YD2A 1VADB 3QO1A 4FNLL 5GS0H 4ZO9A 4X4ZA 1MCLA 3MOAH 2J6EL 2MMXA 5D72H 5I1CH 3EHBD 4UQ3B 4DFHA 3BH8A 4Z95L 5EUKB 3QIBB 3VGBA 1H8SA 3DUUB 1RHHB 1KYOJ 1X6NA 4N9GB 5JXAH 1S7WA 2AXHA 3VE0B 2F8XC 5I1HH 5GGQL 3DGGB 2YUZA 1WIOA 1MVUB 4XH2B 3JWOH 4AIZA 2A6KB 2WIIB 3LEXA 3STZA 1R3JA 4HBCL 4NUGH 3GBNH 3T2OA 4TULL 4Y89A 2IQAB 1S9YB 1JCKA 3QIBD 1OLLA 4I5BA 7FABH 2FJGA 4NNYB 1JMXA 4ONOA 4J4PD 4MDJB 1UWGL 3MC0A 3O45A 4N9OB 3RUGE 3BKYL 3FQUA 5E8OB 3RVVC 3ULUD 4PJ5A 1HYSC 1E28A 4NKOB 2R69H 5CEZD 3HI5L 3W11D 3WS6C 1R3KB 4X8XA 2ZSWB 4M03A 5IEKA 4P4KA 4IMLA 3V0WH 2ERJB 1JGVL 1X6LA 1F3DH 2PTTB 2VWEC 3BGMA 4OCWH 5DRXB 5C0DB 2FB4L 3JV6B 1PG7H 3FT2A 3TO2B 2OL3A 3RUGF 3HZKA 3BWAA 1A47A 1M71A 3L6FB 3VXNB 1T04A 2DL9A 1VB9A 2YD1A 3QO1B 1JWSA 2LAAA 3N50A 1OAKL 4MVBC 5E08L 2A2QT 1YY9D 4JO4L 3AFLA 2VDOL 3SE4A 1MHHA 3QZWG 1M6OB 3OMZA 1QHPA 3BH8B 2NQCA 3AMKA 4NNXA 4S1DD 4XHQA 4Z0XA 4FZ8H 5C86A 1S7WB 1EMTL 5IMKB 1OGAD 5ELIA 5E7BA 3SE4C 1RIHH 2XN9A 1MCQA 1FE8L 3LHPH 4DEPC 5CD3A 4AIZB 3LEXB 3STZB 1LD9A 1R3JB 5DR5L 4JPKL 2XQYG 4HXBL 4RMUA 3FN3A 3RX5A 3S9DB 4I5BB 5KSBF 4KTEL 2FJGB 5DC0A 3RBSA 2X4OA 3QPQC 4F8TA 3O45B 1RMFH 2H2SD 3FQUB 3NIFE 2GQHA 3RA7L 5J1AA 2VIRA 2R9HC 4PJ5B 5HI4C 5E2JA 35C8L 2CKBA 5IHBA 1E28B 4K7PY 3IAGC 4CVWA 4UT7H 1KJ2A 3D18A 5E9DA 5HVFB 4RNRA 1F90H 1SM3L 3O4LA 2AXFA 4P23C 5IEKB 5AZ2H 4P4KB 1NL0L 4IMLB 2OXHA 3MACH 1HYSD 2JJTA 3BGMB 1BOGA 5T5NF 2EDOA 1HKLL 4NQXA 1EEYB 3FT2B 2OL3B 1IEBA 2Z91A 3NIFF 3HZKB 3BWAB 4PJ5D 1M71B 3ZHKA 2JJTC 1T04B 4R0LA 4EXPX 3Q1SL 5DZOA 2RJMA 5DA4A 3M17A 1JWSB 1ULVA 4PJXE 4P4KD 1NCNA 4R0LC 3QHTC 3UPRA 4PJBE 4AQ1B 3BAEL 1MHHB 1PD6A 4MB3A 4NP4H 4HUKB 3HR6A 5LAXB 4NNXB 1IAIM 2HG5A 3T3PF 4Z0XB 1YEJL 4MVBD 4DEPB 4M8QA 4NFDA 3MREA 3KPQA 2ZCHL 2XN9B 1X7QA 3VG0H 5F7KC 4RMQA 5CD3B 4XBEH 5T5NG 4L5FH 1W8OA 4J3UA 1LD9B 3WBDA 4ZYKA 2N7BA 1QRNE 5CLWA 3CDCA 2JK5A 1X5ZA 4PJBF 1OGTA 3RUGA 1YEKH 3HMXL 4Z18A 3WO4C 4RFNC 1DN0A 2X4OB 3ZT7A 4JDTH 2XN9D 4K9EH 4Z77A 3BRGC 5HDQH 5HXMA 5J1AB 3RKPA 2VIRB 4U1SA 1P2CA 3H0TA 3OB0K 2CKBB 4LCCA 5CP3H 3GSWA 4Z9KB 3VGGA 1A14H 1UACH 3QPQD 1J5OH 3AROA 4QLRA 3D18B 5E9DB 5FGSA 4RNRB 2C5DC 4XPGH 4UB0L 3O4LB 2AXFB 3T4YA 3UTSE 3FL7A 4LCCC 5SWZE 5CEXA 2E7CA 2R9HD 5HI4D 1BOGB 4PJDE 1HZHL 4NQXB 4GT7A 4YEFA 4NBXB 1IEBB 4X4ME 2Z91B 1MHPH 1Z9LA 3O81A 4TSCH 3C6SA 4R0LB 1F45A 3NCEB 3UTZA 1OQXA 3M17B 5E9DD 3RX8A 2CIIA 4G8GE 3O4LD 3ARZA 4XMLL 3VD4A 1IC5H 1R5WA 3NFSL 1KB5H 3NH7L 1A7QH 4K71C 3UPRB 4UILH 4BZ1L 2FHFA 3ROLA 3VWJA 3QWRA 1J1OL 1FGVL 4CJ0A 2HG5B 2H2PC 4Z7OE 2YD6A 2YD5A 5TE4H 5FB8A 1U8QA 2HJFA 3ULVE 1IM3A 4M8QB 2AKRA 5EIIA 4ZUWA 3VWJC 1F3JA 3ARPA 3MREB 3KPQB 1WT5A 3TIEA 1X7QB 5EBGA 5F6HI 2YXMA 2BVPA 5DD5H 1X5HA 4YIQA 3WO4B 4UT6L 4GLRI 1X4XA 4RFNB 1CT8A 4ZYKB 1HIMH 3GEWB 2JK5B 3ET9F 2CPCA 1OGTB 3RUGB 1ZLWH 1W72H 4NCC2 1DN0B 2CD0A 3NCMA 2BVOA 3NIGE 5TPWL 4RQQA 3WNNA 4Z77B 2YS4A 4U1SB 1P2CB 2OP4H 3H0TB 2APTA 3QIUC 4LCCB 3GSWB 2NY3C 2NY2C 1H3UA 4S1RL 4G6FB 2R4RL 4XP4L 3T4YB 4F7CA 2EEAA 1A7RL 3HNSH 2KQMA 3QCVH 5HI3C 1OTSC 5HDLA 3QR2A 1BFTA 5CEXB 1DL7H 4LLYA 3P30L 2B1AH 4NRXA 1JI2A 1LILA 4PJXA 1HWHB 2YWZA 1YECL 2Y1VA 1P6FA 4O9HL 1NLBL 1Z3GL 3C6SB 4PJBA 3SPVA 4K71B 4LLDA 3UTZB 3WLWD 4OZGE 3HFML 3ZDZF 3KPTA 4LHUA 4G6FD 4LP4A 4KQ4L 2CIIB 4FFZH 1DE4A 4J1UA 1R5WB 4UOJA 4XWGH 1I9RH 1ZHBA 4PS4H 3VWJB 4PV9A 2ZPKL 3TA3A 3EOTH 4ODHL 2NXZB 4E41E 5FB8B 4MXWL 4KKCD 2HJFB 2ID5A 1IM3B 5EIIB 2AKRB 1OAXH 3EAKA 4ZUWB 1F3JB 1QRNA 3TT3H 3TIEB 1TQBC 3Q6GL 3TA3C 1Q94A 2BVPB 5A3IC 3TH4T 4YIQB 2H2PD 3FONA 4PRAA 4IMKA 4P48A 5F8RC 4FQIL 1CT8B 1WZLA 3VWJD 1V3JA 3QWRD 4M1GL 5BV7B 3OR6B 1MCCA 2B39A 3P40A 4HK0A 3VFOB 2NXZD 4YHIA 4IMKC 4LVOB 4L8CA 5IB4A 3OXSA 2XXMB 2AJXH 4R7NA 5IW1A 2BVOB 1RY7B 4RQQB 2NY3B 1EVTC 2BSED 5D1QA 3DROA 1NUFA 3UTSA 1QPPA 5FK9A 5SWZA 1CDGA 4JLRA 2VYRE 5ICXB 4AQOA 3R0NA 1AY1L 2APXA 4PJDA 3QFDA 1DQQA 4CAGA 4BK4A 4X4MA 5EPMA 4F7CB 5TH2A 4O5LH 1WITA 4H8WC 4LLYB 1KELL 2VDKL 2XKSA 3LPFA 4NRXB 4G8GA 4PJXB 5EUOF 2JKXA 3QDGE 4MJ5A 4XPAH 5HI3D 4PJBB 1OTSD 2J5LC 3SPVB 5E6YA 4LLDB 2ICWI 4L3EB 3E6FA 4U2YA 2W9LA 1DE4B 4J1UB 5ADOL 1I8LC 3VDAA 1ZHBB 2HFFA 5IHZA 4PV9B 2EXYC 1HI6A 1TQBB 3TA3B 1YJDC 3S97C 2JJVA 1RFDH 3ULVC 4LSTH 1JZ7A 1P9MC 1RURH 1YMHA 4JR9H 2X05A 3MZGB 2F54E 1QRNB 3TJHD 3C5SA 4L3ED 5DK3A 1Q94B 5F7WC 1FRGH 3ZTNH 5CKAA 2HJLA 3FONB 4PRAB 1I8IA 4OQTL 1MVFA 4OI8A 1N0LA 3LS4L 4FFYH 3TA3D 1VFBA 4HK0B 2C3XA 3WNMA 4YHIB 5A3ID 3FN9A 4L8CB 5IB4B 3OXSB 1I7UA 2AABH 3TEUA 5J4MA 4ZFFA 1QRND 4R7NB 5IW1B 2BNQE 3CVHA 2N56A 3BDXA 4HS8L 5D1QB 3DROB 4N0FA 3UTSB 5FK9B 2FEEI 5SWZB 4JLRB 4M6ML 4BH8A 5LG1A 5H94A 5TF1H 3ARDA 4PJDB 3QFDB 1DQQB 1QFWI 4CDGC 3W0WE 4KJQC 5EPMB 5TH2B 2DKMA 2Y6SC 4WU7A 3MMEA 3ARDC 4OZGA 4X98A 2J5LB 1GHFL 3MJGX 1PVHA 3RX7A 1A3RL 4G8GB 2O5YH 3MRDA 2EE6A 5D1QD 5BQ7A 5SWZD 5DUPH 1IEAA 3MGTA 4MJ5B 4QYOA 1VERA 1EO5A 1S9WA 2EDTA 2IQ9L 1Q0YL 3E6FB 4XNZC 4KRNA 2OCFD 3MJ9L 3P77A 3QISA 1AI1H 1CD0A 1G0YR 2HFFB 3W82A 5IHZB 1CFVH 4XPFL 3RJQB 1HI6B 4G8GD 4JQXA 3W9EA 3RWGA 1JYNA 1SVCP 3INUL 4PTTA 2RQ8A 4NO3A 1YMHB 3N1GC 5HDBE 3TBSA 3NA4A 4KY1H 3C5SB 4JQXC 2DYPA 2OR9H 2EXYD 3OGCA 4OLVL 2HJLB 5E99H 5GZOC 1I8IB 1TVBA 1ZOXA 4Z6AT 5BW7C 4HD9A 5T1DL 4HUXA 2R1WA 4JO2H 4HT1L 4I2XE 1N5YH 5ILTH 1VFUA 1I7UB 1JTTA 2QSQA 4P2CG 1N6UA 1FVDA 1EH9A 1LK3L 2P47B 2WMPA 5T3XD 2YA1A 3U48A 4ZFFB 4TVPE 1OT2A 3CVHB 4JFYA 4N0FB 2DM7A 3DYPA 3LAFA 4RFOH 3WFCH 4BH8B 5H94B 1WWWX 4HUMB 3ARDB 2FD6L 4Q74A 4F9LA 2FX7L 1CL7I 3QDGA 2YRZA 3FO2A 4XX1E 1J0KA 3BP6A 4WU7B 3MMEB 4WV1A 1M1SA 1MCFA 2ZCKL 4X98B 3VRIA 4F9LC 4JM2F 2PKDA 1FGNL 4BH7A 3MRDB 5BQ7B 1IEAB 3MGTB 4QYOB 1AP2A 4WV1C 1EAJA 1OAYH 4BJLA 1S9WB 1JP5A 3ARDD 5GISH 4HK3N 3T4AA 4HEME 4F7EA 2CXGA 1WEJL 5EA0L 3P77B 2E27L 3EYOA 4JM4H 4LDOB 5LQBH 4NKIL 4WFFE 2F54A 1GOHA 4C57C 1OL0A 4I1NB 1TIUA 3IRZA 4HS6A 3MLPA 3W9EB 4M7JL 1SJHA 1IFHH 1C5BH 4TNVF 5L7XH 4YC2C 4ESKA 4PTTB 4NO3B 1J8HB 3B4NA 3TBSB 1OB1A 2LTQC 1DLFH 2OQJA 5EIQA 2DYPB 1A3LL 4LQFL 3V4UL 3V6OE 3IVKA 2AQ1A 3WHE1 4U1MA 4GMTL 1TVBB 1VESA 4U6HB 2QHRH 3GRWH 5HGAA 3WXWH 5I71C 1SVZA 2R1WB 3DECA 5E94A 4LOUC 2DQTH 5JQ6L 5CIPH 3PDDA 1FVDB 1JRHH 3KR3L 4F9PC 4M7KL 5GZOD 1LMKA 1J8HD 1H0DA 2ARJA 3W0WA 2JJSA 2DYPD 1ZKAA 2MKWA 4JFYB 4D0BA 2IPKA 3QHFH 4D9LH 4P2OA 1ZGLP 5ESQA 1MH5A 5K9QG 1AJ7H 2JJSC 5I1EL 3QQ9C 5I1KH 1KSRA 3RU8H 4P2OC 3QDGB 3VXPA 3FO2B 3BP6B 4KAQL 1KBGL 4OCRH 2E9WA 4S1SL 4WV1B 4BUHA 3VRIB 1RPQA 5ADPH 4QTIH 4BH7B 1F3RB 1L0QA 4HXAH 4OSUL 1N26A 1AP2B 3UYRL 5DWUL 3CSBA 3VFGL 3LH2L 1MHEA 3T4AB 4F7EB 5I15L 3EYOB 3MFFA 3QDGD 4OIIH 2F54B 4LSSL 5EC1A 3NCCB 5GHWH 1FBIH 4LSVH 4HS6B 2LTQB 5FYLH 4YDKH 1OD9A 5DSCA 5E1HB 1SJHB 4JPWH 1WLHA 3CK0H 2E6JA 4XNQA 4U1JA 1ZTXH 3RWFA 1OB1B 3WSQL 1TTGA 2OQJB 4N1EA 3IS0X 5KSAA 5I71B 4I2XA 3IVKB 3LVEA 4U1MB 5JO5A 2F54D 5HGAB 3WFBL 5KSAC 5B3JF 5E94B 4LMQE 5C2BL 1NMCC 4LIQH 4J2XA 1H0DB 2ARJB 5FYJE 3W0WB 5BS0B 4JFOA 4ETQA 1HDMA 25C8H 4XCFH 3G04A 4D0BB 2IPKB 4LOUD 4YWGL 2NCMA 4P2OB 5ESQB 1MH5B 1I3RA 1GGYA 1VKXA 4LK4A 4LKXA 2P49B 1JIBA 1HE7A 3VXPB 3BDYH 5I74C 2VC2L 3DURA 4K07A 5K59E 2A1WL 4K3JH 3W0WD 5BS0D 1AKJA 2NXYC 2RBLA 4KKNA 1WFOA 1L4IA 1I7ZA 1FC1A 1XFPA 5ACMA 5GS1A 1MHEB 2IBZX 4DGYL 5D5MF 2BSTA 1CXKA 5EC1B 1P1ZA 5GS1C 3LQAH 5K59F 1TTFA 3QB7C 1IQDA 3VDBA 5DSCB 3V6OA 5ISZE 1EO8H 4XNQB 3BJLA 4U1JB 3RWFB 1MCNA 3V6OC 4OGAD 5KSAB 1BJ1H 4I2XB 1MFCL 5JO5B 3Q5OA 3ZKSD 4JRXE 2R0ZH 4OD2A 3F7YA 3OX8A 5GGVY 1X44A 3CFDA 4L8DA 4XPBL 3ECBA 2ADFL 2H1PH 2ATKA 5INCA 5CZXC 1JHTA 1Z0MA 3K4ZA 4JO1H 5D7SL 4JFOB 4ETQB 1HDMB 5KSAD 3G04B 3CXHK 2XTLA 1MFNA 5I74B 1I3RB 1H15A 1L7IL 1MCRA 1CU4H 3WYRA 1VKXB 4LKXB 2ZUSA 4Q58C 1XEDA 2LU4A 4RRPA 2NXYB 3HZMA 4OGXH 4ZAKA 3VFUA 5D2NE 1HNFA 4Z8FL 2OTPA 2R2CA 3NFPA 5F21B 5E5RB 2UV3A 1AKJB 1MF2H 3K81A 4PD4K 4UDUA 4ZAKC 5FYKH 4OT1H 4ELKA 1TZGL 4WI4A 1I7ZB 12E8H 5I9QC 5GS1B 4MQXC 1WZKA 3OPZL 1FCGA 2NXYD 4FQJH 4KKLC 3BMVA 4LRNH 2BSTB 2FGWH 4LSPL 5DD1L 4G7VH 4Q9CA 1P1ZB 4J6RH 4OFVA 4PRNA 5MEOA 1AKJD 1IQDB 2P48B 1WFUA 5EORH 5IBLC 5ACZA 3MOQA 1CFTA 2Y9RT 4OD3L 4WFFD 5FHBL 4MNGE 1AE6H 3BO8A 5DMYA 5TQ0L 5FOJA 3TGXA 2DQUH 3L3JA 1G7QA 2WWKO 5ERWA 3ZDXE 2ZUQC 3D39E 4OV5A 4OD2B 3F7YB 1B4RA 4L3CA 4X7SL 3CFDB 1JI1A 4L8DB 3SJVA 2AK1H 4K94C 5GZNC 5J1TC 3ECBB 1IE5A 3PHOA 1D9KA 1DVFA 2ATKB 1QLFB 5INCB 5TE7H 1FAIL 4LPXA 1JHTB 4U0QB 1Q9LA 3CH1A 2I27N 3UTQA 4DUWA 3UZQA 3MSPA 3PWPE 3DX7B 4LNVA 1D9KC 5DD3L 1DVFC 4XP6L 3WKMH 3PQYA 4K8RC 1H15B 3GMMA 4M62L 2D7TH 1U36A 5F44A 3DBXA 1KCRL 4X9GA 3HZMB 1VEPA 4ZAKB 3VFUB 3RWEA 3TV3H 3NFPB 1FNSL 3UPAA 1Y6KR 1ZAGA 5I9QB 1YEHL 3DV4B 4UDUB 3C09C 3QQ4A 4ELKB 2YZ8A 3IB4A 4XNYL 4AG4H 4GKNA 1IEHA 2R23A 4OTXH 5JNYA 4PB0L 1DEDA 5KOVC 3CNKA 4O02H 1RJYB 1YYMH 3MUY1 4OB5H 4ZAKD 4OBSA 1KEGL 5AYQA 1J0ZA 1AXIB 1S7SA 4PRNB 5MEOB 2AW2A 4UV4H 5ACZB 3X3GL 3PP4H 1CFTB 4JRXA 1IGFL 4KKLD 2P24A 4PBWD 3BO8B 3BN9C 2XWJA 4NIKB 2A9ML 5IMMA 3L3JB 1G7QB 5ERWB 1RZKH 5GSVA 1KN2H 5IBLD 1QVOA 2YN5A 1KACB 4OV5B 1MEXL 1RUPH 3CX5J 4NM8H 4ZFGL 4L3CB 4RAVA 2H41A 5C7XL 3SJVB 1MJ7L 1UYWH 3DPBA 2AEIT 3PHOB 5HYEA 1D9KB 4NDMA 1V3MA 3BKMH 1Q9LB 3CH1B 3UTQB 1RVFL 3BD4A 3IKCA 1LDPL 3NCJL 2VDPH 3VXME 5D2NA 3PQYB 2HRPL 5CAYB 3GMMB 3CVIH 1UM6L 3SJVD 3DBXB 1QYGH 4U31A 5D2NC 3C09B 3QXAA 1D9KD 4FTVE 1CLCA 1KLGA 4BSVA 1Q8MA 4NZRH 5EO1A 5GRJL 5J3HC 3RWEB 1AHWC 4EOWL 4K8RD 5JOPE 2G60H 2GIYA 4MZ2A 5CSGA 5A16A 3NAAL 1X5GA 3PE9A 1H3XA 4S2SA 4GKNB 4RGOL 2R23B 5JNYB 3PQYD 2BJML 2LVCA 4G42A 5AWNH 4ODUA 4XNUL 1F00I 4J3OC 4UT9H 1EGJA 4LP5A 2H6PA 3DV6A 1NQBA 4MNGA 4Y16A 4N0UE 1S7SB 2V2TA 4HHAA 3D39A 2MSPA 4KHXL 5ESAA 4K2UH 2NYYC 4JRXB 4QTHA 4LPUA 3B9DA 1N3NA 3ULUH 2P24B 4FNLH 4NWTL 5DO2C 2XWJB 3DNKA 5JDSA 5IMMB 5HPOA 2RFXA 5GSVB 2J6EH 1QVOB 2PW1A 4DVRL 3DJ9A 3UYOD 1MFAH 2DM2A 4RAVB 4Z95H 3PWPA 4EVNA 5DJDA 3T0EC 3BN9D 3GJFH 1GYAA 1Y6NR 4YGAB 2QQLL 4NDMB 3OAUL 1I1FA 4JRXD 4JQVA 4M6NL 3BIKA 4PLKC 5H2BA 2D7OA 2NY0B 5KSUA 3IKCB 4HFUH 5D2NB 4P9HL 3P11H 4JQVC 1CN4A 4YPGA 1YNLH 4HBCH 3RPIA 4KK6D 3I2CL 4WHTA 4TULH 4F37K 1IAMA 3S37L 3QXAB 1KLGB 1JHLH 4FZEH 5EO1B 3FHQA 1KN4L 5C0CE 3LN4A 4JO3H 5A16B 2NY0D 1ADQL 4LSUL 4S2SB 3PXJA 1BFVL 2B1HL 3EDFA 4G42B 4XP9L 2YR3A 5CJBA 3NOIA 4ODUB 2VZVA 4KMQA 4GXVH 3RWCA 1RZ7L 2H6PB 2R0LL 3DV6B 4M7LH 1ITBB 1F8TL 4MNGB 2VXQH 1I3VA 4Y16B 2FB4H 4WFEE 1RSFA 2XYCA 2V2TB 1VFMA 4WTWA 1R0AH 4HHAB 4OD1H 3D39B 5ESAB 3NZ8A 4QTHB 2DIAA 1N3NB 2YUWA 2J7LA 5JDSB 4TOYL 2RFXB 1IBGH 3TESA 3SDYL 2PW1B 1N6VA 2HT2C 3U7WL 4Y16D 5I8OH 3PWPB 2BRQA 5DJDB 5DO2D 1G9ML 2VLLA 4GXUN 3VXMA 3D39D 3O8XC 2VZOA 1I1FB 3BE1L 3BIKB 5H2BB 1N4XH 1DBBL 5KSUB 1K4DA 4FTVA 3L9RA 5GRXG 4YPGB 4U3HA 1B3JA 2A83A 2JELL 3RPIB 4EEEA 4WHTB 4HXBH 4NN7B 3MOBL 3PWPD 2QSCH 4PLKD 4EQ2A 5A2JH 1XF3A 2DJ4A 2V7HA 3MLSL 3WIFA 4LNRA 3WHE0 2SEBA 5L8KB 4U6VL 1XIWA 1GC1L 3LN4B 2F58H 3VI3F 1N7MH 2A6DB 3HCVA 1XR8A 2N4IA 1XIWC 3ZDYF 4N0UA 3JUYA 2DQFA 1LEIA 1NL0H 2KL6A 2VR9A 2I26N 3RWCB 2WV3A 3OJVC 1HKLH 4FQ1H 5D7KE 1M4KA 4G6AD 4KDVA 4OCLC 3O6KH 1A9BB 2X41A 5JPMA 3NZ8B 4GAGL 1JGUH 4JFQA 2GFBA 3TNMA 2EC8A 1Y0LA 4HC1A 4ZTPH 1INDH 1AD0A 1CQYA 2VRAA 1G9NL 4U1NA 2VLLB 1BREA 3KYNA 3X11A 4MQSB 3VXMB 5L88H 5IB1A 5TFSL 1JTPA 3BP5A 4NUJA 3QH3A 4LAQL 2D31A 2ZCHH 2CKBH 4U3XA 5MHSE 3SE8H 5IW3A 1K4DB 4FTVB 3L9RB 4D8PA 1S78C 5BRZE 5GRYA 2A83B 5C0CA 5KANG 4B50A 3O6MH 4PLJC 2COQA 2CKNA 1XF3B 3VXMD 2V7HB 3WIFB 3G5ZA 4LNRB 2SEBB 4M48L 3HMXA 3P0YL 1XIWB 1MCWM 4L8SB 1CFNA 2D7NA 4C4KO 4DN3L 3H8NA 4ZSOE 4FTVD 1ZS8A 3HCVB 1XR8B 3QJHA 5IB3A 2WQRA 3LD8C 5F9JA 1MY7A 2Z31A 5JOPD 3A67H 4M5ZL 2F5BL 3KLAA 1LEIB 2UVEA 3S8WA 3ARSA 2B5IB 2GJ6E 1WWAX 2Z31C 1XIWD 2VR5A 1DTUA 4WEUD 4JY5L 5FKAA 3DARA 4QWWC 3ZYOA 2C4FU 2HWZH 5C07E 3LZFH 4OLZL 3G9AB 5JPMB 1ZHLB 1CGXA 1F4YL 4ODSL 1MWAL 3GGWA 4JFQB 4HWBH 2GFBB 3TNMB 2FBOJ 2FBJL 3S7GA 1Y0LB 1RZFH 1IGTA 3DETD 4XMLH 3RAJH 5BVJA 1AC0A 1KC5L 1A9EA 1OLZA 4TPRH 4M4PA 4XCEB 4OZIE 2EDEA 1AD0B 4YJZL 1UH3A 1YEEH 4U1NB 1BJ8A 4H1LG 2IADA 3KYNB 3X11B 4NO5A 5IB1B 1DFBL 3VWKA 1IGMH 4NUJB 1BBJA 3QH3B 4Z7WE 2D31B 4BKLA 5DJ8A 5MEQB 3S34L 4D8PB 3IF1A 1IC4L 2X10A 1NFDF 4ZUUB 5BVPL 5HI5C 2CDEA 4EN3C 1GGIH 1KT2A 3QQNA 4H25A 4X83A 4M9OA 1A6UH 2H3NA 3G5ZB 6CGTA 4M5YL 4AT6A 2RR3A 4LLQA 4OZHE 1NUNB 4FMKA 1CFNB 3GKZA 2VB5A 4PLJD 1KIPA 4FXGA 3BXNA 1ZS8B 2UUDK 5FXCH 5BO1H 3QJHB 5IB3B 4C59B 5F9JB 1FNGB 2Z31B 4S1RH 1K5NA 2R56L 2R4RH 1A7RH 5F7HA 4YNYA 5L9DH 1C12A 1I9JH 3WNKA 1CGSL 5FKAB 4CN1A 2HYMA 2JTDA 4JFZH 5F1KC 4PGEA 1NLBH 2X1WL 3I75A 4L29A 5D71L 5K9OA 3T3ME 2V5SA 3GGWB 3HFMH 2Z31D 4WFED 3MV9A 1BQUA 5LXGH 1BQHG 5BVJB 4QWWD 5BV7H 1A9EB 4X8JA 1VPOH 3RY6A 1U0QA 2DLTA 2YRPA 1JZ5A 2GKIA 1ZLVH 2ZPKH 2CK0L 2V5YA 2IADB 3A6BL 4ODHH 5F7EH 4H1LA 1OSPL 4NO5B 4MXWH 1NFKA 4EDXA 1NSNH 2YMXH 3VWKB 4LKCA 2MOVA 1BBJB 3GMOA 3Q6GH 3RI5K 3AS3A 4BKLB 5DJ8B 3BZ4A 1I75A 3PP3K 4Z0BH 4GKSA 3D3VE 2AGJL 3IF1B 2YK1H 3ILPA 1MUJA 5IHLB 2CDEB 1N8ZA 4OF0A 1KT2B 4LSRL 1A22B 1RIUL 1JPSL 4ZSOA 1OP5K 1BFOA 5F1SA 2H3NB 3VWKD 3IDMA 4XTRD 1OTTC 4AT6B 2YPLE 5HI5D 4I3GA 1FVEA 4LLQB 5HD8C 3QWQB 4WHCA 3E3QC 1CVRA 1PZUB 5C0BE 3LMJL 1KIPB 1MCOL 4FXGB 4R90L 5F1NA 2DQDH 3BXNB 2GJ6A 3SEPA 2G5RA 3EFDH 5KVEL 4F15C 3QPXH 3K0WA 3VXUE 2YUVA 1K5NB 4K3DL 1WZ1L 5C07A 2GJZA 3S35X 2A9NL 1BAFL 4YNYB 5M7QA 3E0GA 4HK3J 1M7IA 1C12B 4DGIL 5L2KE 5IFHL 1C5CL 4PGEB 4UI2A 3I75B 5K9OB 4OZIA 1DR9A 1NCCL 4UIMA 1DBJL 2CR6A 3MV9B 5D7KD 3EYUL 2VQ1A 2R0KH 1BQHA 4GQ9H 4X8JB 3H3KA 5ADOH 1KEMH 4MA8L 4Z7WA 4LVEA 5I1IH 5JTWA 3N0PB 4WNQA 3W2DL 3WIHA 4XVJH 4H1LB 4EDXB 4ODTH 1NMAL 4EBQL 2IJ0C 4FQXA 4LKCB 4PGZA 3GMOB 3MV9D 1NBYA 1ZLSL 5T5FL 2R1XA 4P46B 3GIZL 4H8WH 1SYSA 3BZ4B 4LPYA 4NNPL 2PN5A 4OLYL 3ILPB 4FXLA 4Z5RA 1MUJB 1N8ZB 4OZHA 5MHSD 3LCYA 4D0CA 1AD9B 2I5YL 3VW3L 4ZSOB 4WCYL 4XMKL 1BFOB 3IFPA 5GGTL 1PX4A 3IDMB 4NN6B 5DFWH 1UWEL 1JNNH 5EOQH 4F15B 1AGEA 1FVEB 2WBKA 4XNMA 1E27A 2WINA 4P46D 2EYSA 3WXVH 4FQLH 5F1NB 5K9JL 2GJ6B 1CCZA 1NKOA 1FPTH 3V9FA 5HD8D 4ZPVA 3FTGA 3ZHDA 2YA2A 4J3SA 5C07B 1NCAL 2GJZB 1E4WL 1GIGH 1RULH 1WK0A 1VSCA 1M7IB 1GHFH 3KJ4C 3SOBL 5T3XH 1LO2L 5EZIL 4KXZH 4Q9QL 2GJ6D 1NEZG 1TNMA 4TUJA 3FQTB 4OZIB 3B83A 3CFKB 4UIMB 5CILH 2AJYL 1P7QA 4XP5L 4NSKA 3KYAA 3R4DA 2VQ1B 5C07D 1BQHB 3JXAA 3PWUA 5I19L 1JPTL 1MELA 4Z7WB 2CIKB 3WO3B 4L9DA 3BJ91 4XPFH 5INDA 1W8NA 4RMSA 4WNQB 1INQA 3INUH 3D3VA 2OJEA 3CVHH 4XMPH 3ALPA 4FQXB 3L5IA 3UJIH 4LSQH 4MA7L 1NBYB 3O3DA 4RGNE 2R1XB 4JDVB 3SDXE 1SYSB 3DMMC 2A0LC 1SYVA 1XF5A 3SO5A 4HMEA 4Z5RB 5CGMA 3GI9H 2YPLA 5T1DH 4YK4B 4KH2A 1P69B 4OZHB 2B7DT 5CJOL 5C0BA 1MFEL 2ZG1A 3T0WA 4D0CB 5KAQF 4KPHH 1KV3A 5B38G 1LK3H 4FQXD 4GAJH 3VXUA 3QT2A 1AGEB 3MLVH 4LCYA 4XNMB 1E27B 2WINB 1WV7T 2FJFB 3LEYH 2EYSB 4X6CE 4CVXA 4ZTOL 3S96A 3GO1H 1TTUA 4MMZC 3CZFA 4Y5VA 1L0XA 4NQEE 4Q0XH 5GIRA 2OSLA 5L2KA 4OF5A 4ZPVB 3FTGB 3D2UA 2RCSH 4Y5VC 3GM8A 4U4BA 5C70A 2ZCKH 2CRIA 4JY4A 4ELME 4PGJA 2AQ2A 2E5EA 1MCIA 3U7AA 2LFGA 4M61A 4TUJB 5E24E 4FA8A 5KAQG 4KJPC 3QULA 1P7QB 3ARUA 1V7NH 2PETA 4KDWA 5D96C 4NSKB 4N8CL 3VXQA 5LGKA 2P8PA 3PWUB 5FHAL 4NKIH 2MKLC 2HVJA 4LCUA 2EDYA 1JBJA 2XNAA 2MCPH 2W1NA 3BP4A 4O2FA 3U0WL 5INDB 1U3HA 4M7JH 3WFDH 1DZBA 1DLHA 1OWWA 3V2AR 2OJEB 3V7AG 3S35H 5L6YL 4L3AA 2D0FA 5C0FA 5BZDA 3C5JA 4XT1C 3UAJD 1U3HC 1P7QD 3NZHL 1U92A 3O3DB 1S9VA 4AEHL 1A3LH 1CR9L 3C87A 1SEQL 4LLWA 1SYVB 1XF5B 2LV4A 3H42H 2GTZA 1DQDL 1Z2KA 2CJUH 2YPLB 3OBAA 3FO9A 1FZMA 3U0TA 3IDYC 5C0BB 3D87B 4ZD3H 5ANME 4C4KT 5CKGA 2BVYA 2A0LD 3KR3H 5HHME 3VXUB 2HVKA 4BQCA 4LCYB 2CGRH 1OOAA 4WGWB 4UNVA 1UXSA 4GBXA 4CVXB 3HUJF 3S96B 2XZQH 3CZFB 3ILQC 2YPLD 5GIRB 5I1EH 3PF2A 2OSLB 1JE6A 3OAYH 5L2KB 5EZJA 5C0BD 5LWYL 4GBXC 3D2UB 4MNQE 4KUCF 1KBGH 1X9QA 4S1SH 4OGYL 4JY4B 3VXUD 4DOHE 4DK3A 5B39A 4RA3A 5DZLA 4CRPA 3AB0C 5D96B 2DIJA 4OSUH 1UXWA 4M61B 3QULB 4JFXA 4M1DL 4UBDC 5T3ZE 3UTPE 3A6CH 5L2KD 3CFIC 1F58L 3D2UD 3VXQB 2P8PB 2OJZH 2NW3A 1FNHA 4LCUB 2XQBH 4R8WL 2XNAB 4O2FB 3BP4B 4KJPD 4KUZL 1MNUL 1U3HB 1MFDH 3SDXA 5HVGB 3V4VL 1DLHB 4KKBC 4PY7A 3C60C 3F12A 3PDGA 2EDQA 5C0FB 5BZDB 5C6TL 4RGNC 1JGEA 1QR4A 4CU7A 4PJIE 1U92B 1S9VB 4FG6C 4MAYD 3IDYB 2CMRL 3BHBA 2F5AL 1NGZA 5IP4A 4RWHA 2GTZB 2HFEA 5KVDH 1SHMA 3FO9B 1FZMB 5GS0L 3U0TB 2MNUA 1U3HD 4X6CA 1T5XB 5A2FA 2QQNH 2ITDA 4URTB 1T6VN 3MOAL 3R8QA 43C9A 2Z8WC 3DSNA 4NQEA 4DN4H 5D72L 2VXSH 2HVKB 5FDYA 2ATPA 3F58H 1UXSB 3I02A 1AXTH 4GBXB 5DXWA 4GMSH 1D5BA 4ELMA 1EAPA 4NQDE 4JFFE 5EZJB 2IAMA 5CZKA 1DEEA 3GJEA 3AVEA 3AB0B 3L7FA 4Q6IA 3ILQD 3GBNL 2A1WH 2IAMC 5B39B 1K4CA 1RUML 1RZ8A 5FYKU 4GBXD 4OCSH 5I8KH 7FABL 1UXWB 1CGVA 2GY7B 4YHNA 4Q6IC 4PJAF 5EN2A 1T21A 5TE6H 4JFXB 5B8CC 1FFOA 1OAZH 1TPXC 2A6IA 1K8DA 2NW3B 4Z7QE 3ZKMC 2R69L 1BLNA 1W0WA 2WBWB 3MNZA 4RGNB 4UBDD 3SDXB 1U8JB 4FQHA 4PY7B 1U8KA 5EZOH 3O6FA 3F12B 3TH2T 4OCWL 2H32A 1NLDH 1JGEB 3CSYA 3CXHJ 1PG7L 5ANMA 1T1YA 3BHBB 1HN1A 1QP1A 1UB5B 4KXZI 1NGZB 5E8EA 4KKBD 3UBXG 2HFEB 5E6IC 3VD3A 4WFGE 4MS8D 1VCAA 4Z7QF 1FL6A 4NQUA 4RGND 4HGKC 3LN5A 4X6CB 2ADFH 4FG6D 2ITDB 2BY0A 43C9B 5D7LE 3BPOC 4XAKE 4NQEB 1NAKL 4PD4J 1CDCA 2ATPB 3IAPA 3S5LG 1B2WH 3I02B 4MNQA 5C08E 2EE2A 3HS0A 1J86A 4FZ8L 1D5BB 4A6YA 3P4MA 4ELMB 1L7IH 1EAPB 4GFTB 1RIHL 2IAMB 1DEEB 3GJEB 3FZUD 4Z7NF 4AH2A 5IOPA 4Z8FH 4MNHA 3L7FB 4G7YH 1QFOA 4Q6IB 4NQED 1WBXA 3QXTA 4PGCA 1FO0A 4QCIA 4LDLB 1K4CB 3VGDA 1EA9C 1RZ8B 3C6LA 2OMNA 2QEJA 1RZJH 4UZGA 4YHNB 1H8OA 5EN2B 1T21B 1JGDA 5I0ZA 1RMFL 4L9LA 3C6LC 2IAMD 1FFOB 5ICZA 1Q9KA 4OZFG 2A6IB 2KUTA 1K8DB 4RAHA 1C8PA 5C9JA 1BX2A 5KN5A 4L9LC 4OF3A 1W0WB 4PJIA 4UT7L 1BIIA 4NCDA 1F90L 2B4CH 4FQHB 1SJVA 5AZ2L 4PP2A 4OD3H 1AQKH 3O6FB 1GXEA 1XMWA 2H32B 1D6VH 1KTKE 1X4ZA 3TN0A 4EUPG 5TQ0H 3CSYB 3KPOA 1EUTA 4WEBH 1T1YB 5ANMB 5BMFH 2DWEA 2QQKH 2RB8A 3SKUD 5E8EB 3P0VH 1IVLA 4KTDL 3TN0C 4JJ5A 5HHMB 3H9YA 1HQ4A 1ZGLM 5ID0A 1FL6B 4X7SH 1FAKT 4YBQD 3MXVH 3LN5B 1IKNA 2BSRA 1DQMH 1NUDA 2XTJE 4AENA 3O6FD 4WO4A 4NQDA 4JFFA 1IKNC 4NP4L 4POZC 3HS0B 3ZE1E 4PPTA 4CBPA 4A6YB 1ZSDA 3P4MB 5HHMD 4M62H 2VJXA 4DOHB 3VG0L 4HWNA 4AH2B 4XBEL 5IOPB 4L5FL 4LPVA 1A6VL 3KNBA 4MNHB 4ORGA 2RIKA 1FNSH 1WBXB 3V5KB 2NZ9C 4UNTA 4PGCB 1FO0B 4QCIB 1YEHH 1YEKL 3C6LB 3IJHA 4XNYH 3HPLA 2MFNA 3QWOA 3ZE1F 4K94H 1JGDB 5FGBC 3RVUC 4L9LB 4K9EL 4JN2A 5ICZB 4OJFH 5HDQL 1Q9KB 1AH1A 2Q7NA 2P4AB 1YC7A 5C9JB 1BX2B 5KN5B 1A14L 1J5OL 5T3ZD 3UTPD 4PJIB 1CXEA 2OTWA 2H45A 1BIIB 3CU1A 4XPGL 3C6LD 4K8RH 3QDAA 2WSKA 4XBPA 2BY2A 3SGEH 4PP2B 5JW5A 4N0CC 3TN0B 3GDBA 1VDGA 4GRMA 4EUPA 3KPOB 1EBAA 2ED8A 2A9MH 2DWEB 4WUKL 5D7LA 3TBWA 1MHPL 4JJ5B 3I6GA 1HQ4B 5C7XH 5ID0B 1GSMA 1H9VA 2BSRB 5C08A 3RIAK 5ICYA 1KB5L 3VRLE 4AENB 1A7QL 4O4YL 5JOFA 3BPNC 1ZVSA 4WO4B 3TN0D 4LASL 4NQDB 4JFFB 4KV5E 2DQIL 1RVFH 4BSWB 1LDPH 3MLYH 3IETA 1EPFA 4U1LA 5TE4L 1S7TA 1ZSDB 2R2HA 4LVHC 4WDIA 4NZUH 2FRGP 3PGDA 3T2QA 2HJKA 1KIUA 5DD5L 1B6DA 2VE6A 4POZD 3KNBB 4ORGB 4WO4D 4DGVL 4NQDD 4JFFD 1HIML 1T89A 3RNQA 1QBML 1WAAE 4KI5F 5CJQH 1E6OL 3IJHB 1JHKH 4KV5F 4ACPA 5HTSA 1W72L 4JPIA 3HPLB 3E8UL 4CKVX 3QWOB 5C09D 2BJMH 5L8LB 2UZXB 4H0IA 1U9KA 1T89C 2NZ9D 5J6GA 4JN2B 5IWLC 5I76A 3ARTA 1TLKA 2OP4L 4PP1C 3V4PH 3WUWG 3K4DA 2F19L 2R1YA 2OTWB 4JQIL 3KHQA 3RVUD 3BSZL 2OR7A 5E2UH 4KHXH 1CI5A 2GK2A 4XBPB 3QCVL 3OL2A 1CLOH 1DL7L 5JA8B 5JW5B 1LHZA 2NY4C 5HHNA 4GRMB 4EUPB 2AJSH 2QTEA 1TJIL 2V2WA 5D7LB 3TBWB 3VG9C 5I75C 3U83A 3I6GB 2NY1C 3BPNB 1TITA 4GJTB 3FRUA 2XTJC 4YQXH 2UZYB 5C08B 2Y07L 4JCLA 3V8CA 4GW4A 5ICYB 1TQCC 2HAZA 5C9KA 2IG2H 2ZP0T 3BUYA 4WFGD 5CSZB 2IANE 1ZVSB 4GKZB 1JZ4A 4LVHB 4PS4L 4HX1A 3EOTL 1R24A 1TCMA 3IETB 4U1LB 5D7LD 5DURB 1X5XA 4J3TA 4XAKD 2R2HB 4WDIB 1T83C 3GSQA 3MROA 3PGDB 3TT3L 5HHQA 4NFCA 2HJKB 3QAZC 3S37H 1N64H 2VE6B 5K9QI 1Z0NA 1EHLL 1T03H 4CVUA 3FT3A 1KN4H 3WNOA 3V6BR 4P9HC 2KPNA 5JZ7C 3RNQB 1ADQH 1FFPA 3OTTA 1QTYT 1XCQA 2EO1A 3DVIA 2FECL 4JPIB 5DURD 5F93C 3FAXA 3DUSA 1YN6A 4X7DC 2Q8AH 5EU7E 2AJXL 1SMAA 5J6GB 5D2LE 5I76B 5DMKA 5E2WH 2X89A 1A6PA 2R0LH 4I0PA 2R1YB 2Y4SA 4OCNC 4HAFA 4M43L 2R4SL 2R8SH 5DTFA 4O5LL 4I0PC 5CJXA 3VG9B 5I75B 4PP1D 3H7BA 3MV7E 5HHNB 2NY1B 1JZ6A 2HMIC 4TOYH 1NANI 1UM5H 2V2WB 2E8ZA 2XTJB 3SDYH 5CJXC 1WICA 5D2LF 4XPAL 3NABL 2C26A 4CVZA 32C2A 4HLJA 4QOKB 3MPCA 4YDLC 2R2EA 3FRUB 4J3WA 4M3KB 3P9MA 5GJTH 4GW4B 3BUYB 4HJJH 3V0VA 1XGQA 2NY1D 4HX1B 1QFHA 2VQTA 5CD5C 2Z92A 3QAZB 1R24B 1CLYH 1RFDL 4LSTL 2V9RA 2X2YA 1RURL 4JR9L 3GSQB 4QHKJ 3MROB 4QOKD 1CXLA 5F3HB 4C55A 5BJTA 3VJ6A 5HHQB 1WAAA 2VZ3A 1LE9A 1FRGL 3GSRA 3CFJA 3ZTNL 3ZLQC 4JVUA 3KPSE 5DUMH 4CJ1A 3FT3B 2FH8A 3QEHA 4U6VH 3KLHC 5DQ9A 3I3EA 1F42A 1FFPB 3QEQE 3KG5A 1XCQB 5IBUG 3DUSB 1YN6B 4MX7A 2EKJA 3PHQA 1NGPH 4OAWA 3SE3A 5JZ7D 1GC1C 4UTBH 4Y4FA 1ORQA 5DMKB 4YR6A 4W81A 4J3VA 4I0PB 2YPKA 3SE3C 3G5YA 4FN0A 4R7DA 4AZ8A 3SY0A 4YXLL 4Y4FC 1T66C 4OCYH 4AL8H 1L9MA 2AXJA 4HF5H 4OLEA 5DTFB 4PR5A 4HW6A 4GAGH 3H7BB 3LPGA 3A6OA 4U2ZA 4YDLB 2IEPA 2O5YL 5DVKA 5DUPL 1VA9A 4U1KA 2X89D 2IANA 4CVZB 32C2B 4I0PD 1G6RA 2R2EB 4WW2F 3SDDA 2HMID 1AI1L 3P9MB 3ZZ1A 3C8DA 2X4PA 3V0VB 1CF8H 1CFVL 1YEFL 3SDDC 3JTTA 2V5TA 2FZ3A 2Z92B 4ZNCD 4L4VE 1G9NC 1WCQA 5EWIH 4WI8A 3SDCA 4LVNC 3MLUH 1WWBX 5I1GL 2PW2A 5BJTB 3VJ6B 2IPUK 2DQHL 3R1GH 1LE9B 2D9QB 5CD5D 1EVUA 2M8XA 3CFJB 3GSRB 1UKQA 3OGOE 3SDCC 4M48H 3UDWA 5E99L 4JZJA 3QEHB 5DQ9B 4KJYA 3O2WH 3CLFH 2H9GA 4JREC 1N59A 2EEDA 3QEGH 5D2LA 3FO0L 2NY6B 2XOTA 3UDWC 4JZJC 1PYWA 5EU7C 4HC1H 4MX7B 4LEXH 5HVHC 3MLXH 1MCPH 3KLHD 3GUTA 4OAWB 4YAQA 4M5ZH 3VFNA 4Y4FB 1ORQB 4YR6B 1X5FA 5CINH 1AR1C 4RFOL 3RZWA 4BYHA 1OW0C 3WFCL 2NW2A 2YPKB 3OWEA 3MV7A 4ODBD 3RHWK 2O5XH 3G5YB 4JY5H 1B6UA 3SY0B 1QA9A 2NY6D 4BQBA 1O7VA 4PR5B 4TRPL 1J0JA 1F4YH 5JR1H 4Y4FD 1KC5H 1VGEH 4U1KB 2VR4A 3HPJA 2IANB 4QGYA 1FHGA 3HNTH 1G6RB 3EDEA 3VGFA 3SDDB 1DUYA 3G6JE 2DLFL 1DFBH 4JKLA 2X4PB 1IKFH 2C4XA 3BD5A 5GRWA 3JTTB 4QO1A 2FZ3B 1UGNA 3S34H 1IFHL 5HHPA 5L7XL 1IC4H 4CW1A 3KPSA 3MUJA 2IAND 1KB9K 2PW2B 2DICA 4JVPA 5GRUH 1DLFL 1NFIA 4PRPE 1IZJA 3QEQA 4WFHE 3MFGB 4JREB 3SDDD 2HT3C 2VH5L 2WBJD 1SBSH 4JZJB 4KJYB 4OFKA 2QHRL 2ZNWA 5D93C 2H9GB 4ALAH 4HIIA 3GHBH 5HVHB 3WXWL 1N59B 2G9HA 5D2LB 1C16A 2DQTL 2HKFH 1H3VA 2DQGH 3FFCE 1PYWB 5IBUB 4QEGA 2BFVH 1JRHL 4WW2A 3FQWA 1SY6H 2R56H 4GXUM 4HUVA 3GUTB 2X5PA 4YAQB 4NQCE 4B7IA 1XT5A 3VFNB 1AGBA 4F80A 3VCLA 3NPSC 1UJ3A 2R29H 1QUNA 2Q6WA 4KWUA 2NW2B 3MV7B 1AJ7L 3UXFA 1CGSH 5I1KL 2AP2A 1QA9B 2WZPD 1UJ3C 1LEGB 2DL2A 4HKZA 4BQ8A 1AR1D 3GSNB 1RD6A 4ZXBC 5ADPL 4QTIL 1IQWH 4HXAL 4DAGH 3HPJB 3IRPX 1RUQL 2EICA 4PGDB 1CFQA 3MV7D 5I0DA 1X4YA 1KPRA 1QLEH 4HCRA 2CK0H 3OKKB 3SCMD 4L4VA 1DUYB 5I8CA 1AXSA 4OIIL 1I9IL 1FBIL 4LSVL 4R97B 4YDKL 1QFPA 5KG9A 4JPWL 1TJHH 2AGJH 2EKSA 3CK0L 5HHPB 1WIUA 4CW1B 3KPSB 3W5NA 5JMOC 1KGCE 2LQRA 2DIBA 3MUHL 1ZTXL 4Y2DB 2C3WA 4MHHG 1ZA6A 4WTXA 1NFIB 5FECA 4R4BA 4G80A 1RIUH 3QEQB 1JPSH 1P7KA 2DLEA 3CLEH 4N0RA 1G7LA 3VMPA 2GSIA 3NTCL 1CDBA 4HIIB 3VH8G 5AUMA 2G9HB 1NCTA 3LMJH 1C16B 3ZMRA 4ZOEA 3KPSD 5KVEH 2Q76A 2FDBP 4WW2B 3FQWB 2NZIA 4Y2DD 4LIQL 4LHQB 4K3DH 4OKDA 5IG7B 1CS6A 3QEQD 25C8L 4XCFL 1AGBB 2UYLA 3FRPG 3VCLB 1UJ3B 4H1LH 2Q6WB 2OYPA 1EO7A 2BOCA 1CE1H 1C5CH 1ODAA 4ZO7A 3BDYL 3RY4A 4HKZB 1WC7A 1BF8A 4FFWC 4DW2H 3Q0HA 1YEIH 1DBMH 4K3JL 5LKNA 3FMGH 1CDUA 2EDDA 3G6JA 3FHAA 3OAZH 3IDXH 1WZMA 3MGAA 4MA8H 5C0IA 1UVQA 4O51A 4OFDA 1CFQB 1KPRB 5IR1A 1D6EA 4L4VB 3O2DL 4N1HB 5I8CB 3R06A 1AXSB 3EOAA 1XCTA 4U7KA 1TCRA 4PRPA 4EQ3A 2QV2A 5KG9B 4NNPH 2EKSB 3SKNA 4ZUVA 1EO8L 2D3VA 1W0VA 3T1WA 2OI9B 3HLAA 1ZA6B 5J7CC 2NLJA 5DD6A 5FECB 4R4BB 4G80B 3VW3H 2IFFH 3B3IA 4L4VD 4XMKH 1OP3H 2BNUA 3KPPA 3H2WA 5IGXH 1P7KB 2QBWA 1K6QL 1G7LB 1NEUA 2GSIB 2FCBA 5AUMB 4TQEH 5A40E 1DSFH 5IVOA 3U1SH 3EW3B 4MQTB 2H1PL 2Q76B 2KBGA 4JO1L 3IU4H 1IL1A 2YA0A 1NCAH 1Z9OA 3WIHH 3HB3C 4NGHL 3FRPA 3QEUA 5F7DA 4Q9RH 3B5HA 5MI0B 2BOCB 3LV3A 2A38A 4HPOH 5IW6A 3MYJA 4NQVA 4OGXL 4PG2C 1WC7B 1MRDL 2D2OA 1KOAA 2AJYH 1JFQH 1T80A 4CN4A 4XP5H 4XAWH 3WLBA 3S3SA 3PGFH 3TWCL 5FYKL 4OT1L 3K1DA 1BVKB 5C0IB 1UVQB 3GBMH 4O51B 2FX9H 5IR1B 4M6OH 4HULB 3BIBX 3GB7A 1D6EB 2GYSA 1WF5A 3C2SA 1LO3H 1SBBA 4H88H 3QCTH 3I6KA 1PG7W 3Q6FA 1AO7E 4N5UA 4ODVL 3R06B 4FFVC 3EOAB 1XCTB 4LRNL 1TCRB 4G7VL 5A2IH 1VHPA 3BH9A 4HMDA 4J6RL 4PRPB 4YBHA 5TF0A 5DK2A 5EORL 3MO1A 3G08A 3SKNB 4ZUVB 1UJTA 3WIIH 1W0VB 3HLAB 4GW1A 1IGIH 3NACH 4Y7MA 1I1RA 1MFEH 2JJUA 2NLJB 5DD6B 3TCLA 3TFKD 3B3IB 4ZS7L 4HLZG 3LKQA 4KROC 2BNUB 5FUZH 3KPPB 1DBAH 4HBQA 2AJUH 5CGTA 1DUZA 2AI0L 2EDFA 2Z35A 2A6JA 4PRPD 4WFHD 3VH8B 1FQ9C 2AK1L 4ZTOH 4E42B 1GZPA 6FABH 4KZEH 5TE7L 5HSFA 3WEXA 4CUCA 4TTGA 3CD4A 4K23H 1DANU 3UROR 1IL1B 3CPLA 2LE9A 4HMCA 3SQOH 2L4OA 1VFAA 3LQMA 2IPTL 3WKML 2C3GA 3QEUB 5F7DB 2D7TL 3LV3B 1G7JA 5HJ3A 3NA9H 3BIAX 5IW6B 2EH7H 3MYJB 4OM1L 1WBZA 1QSFE 4EDWH 3HB3D 3TBVB 2F15A 4APQA 3WLBB 4LRIA 5KTEH 2J8OA 2I24N 2WW8A 5FHAH 3HZVA 4AG4L 2KZ1B 4OTXL 4ONFL 3M45A 4PJ9D 3U0WH 4R26H 4I8DA 4LRIC 1QFUH 3GB7B 1Z5LA 3FQXA 3RTQA 3I6KB 2HN7A 1LQSR 3Q6FB 4KVNL 4OB5L 4F3FA 1LK2A 1J0YA 2ZNXA 3BH9B 3NZHH 4AEHH 3MJ7B 1CR9H 5DK2B 3QXUA 3RTQC 3SGKA 3MO1B 4JAMA 4UV4L 4KROB 1DN2A 3G08B 5DVMA 5I1JH 3EYVB 1I1YA 3DTXA 4FFVD 2AJZA 2DWDA 4GW1B 3CC5A 1BM3H 1MI5E 3ME0A 3SGKC 2FHBA 2X4UA 3TCLB 4JFHE 5JPNA 3LKQB 4XZUA 5KANI 4F7MA 1A6WH 3BEVB 1KGCD 1DUZB 4DZ8A 2Z35B 1RUPL 2A6JB 3D0VA 2A77H 3MXWH 2W0PA 5C0ND 3K74B 1UYWL 3NBNA 1D5IL 5ETUA 4KROD 3VGEA 1JYXA 3WJLA 3WEXB 3QXDB 4C83A 2RGSA 1E4XH 3BKML 1S9XA 3CPLB 5LWYH 1OAUH 1VFAB 2EDWA 3WJLC 4Y2OA 4OGYH 3MZTA 4GG6E 1J12A 5EFIA 5F72S 3CVIL 4K7PL 5HJ3B 3BUTA 5HHOE 5DJAA 4OM0H 3CMGA 4NZRL 3ZHLA 4APQB 1PY4A 5DA0B 2G60L 3HHRB 2BY1A 4TNWF 4Z7VF 1AO7A 3HZVB 4JEGB 4R8WH 4I48A 4H0HB 3QUXA 4KUZH 4GG6F 4U1IA 1MNUH 1KTDA 2B2XH 2UUDH 3V4VH 1Z5LB 3AS0A 3FQXB 3RTQB 1IT9H 2HN7B 4WGVB 1U42A 4F3FB 1LK2B 3GMQA 4APQD 4ODWA 4U33A 1T0MA 2DOCA 1IGYA 1A8JH 4EZMA 2CMRH 2PR4L 3ALXA 3ULSA 2C3HA 4JAMB 4QKXB 4K2UL 4N1CA 2YZ1A 1I1YB 3DTXB 3ULUL 2D7PA 2AJZB 2DWDB 2XXCB 3CC5B 3OHXA 2X4UB 5CEZL 1CXFA 4XZUB 3RTQD 4F7MB 1JJUA 1WBYA 4U3CA 2BHUA 5LBSH 3ZTJH 4DZ8B 1MFAL 5SV4A 3D0VB 3KS0J 3GKWH 5CS7A 3LKPB 5GS0C 2DBLL 5ETUB 1X5AA 2V2XA 4D0DB 1S7RB 4U1GB 1CXIA 3KYMA 5DS8A 4C83B 5BOPA 3BW9A 1S9XB 3EBAA 3LB6D 3TT1L 4MSWA 1A7BA 4HFUL 1QSFA 3NCYP 3P11L 1YNLL 4X7FC 5EFIB 4IM8A 3PV6A 1RUMH 1G7MA 2F74A 3UZEA 3MRIA 2K9UA 3UO1H 5DJAB 1JHLL 5D70H 4FZEL 4X7CC 1KG0A 3JWOC 4X5WA 3VXSE 1O5DT 4JO3L 3WS6A 5CBAA 1AO7B 4KQ3H 4ONGL 4I48B 3QUXB 4U1IB 1KTDB 1FLTX 3N85L 4RBPH 4IHOA 1Z9MA 4GXVL 3C08H 3BYYA 4KMLB 4RMTA 1X5IA 3GMQB 4M7LL 2VXQL 4ODWB 1MI5A 1T0MB 3MRHA 5E0QA 1V5JA 1IGYB 3G9VA 3AAZA 1R0AL 3ULSB 5LVEA 4OD1L 1AO7D 4W4NA 2P5WE 4Y8DC 3EJJX 1WVZA 3QUXD 4LPCA 4QGTA 1PDKA 3VGHA 1Q72L 3OHXB 3RZCA 5FCSH 5E8DH 5FV1L 1CD9B 1IBGL 1NAKH 3C9NA 5I8OL 2HA1A 1U3YA 1E4KC 1BIHA 1CDYA 3RZCC 4Z7VA 2XV6B 1EV2E 4CU8A 2V2XB 4BA8A 4OGZA 1KYOK 5D9SA 4GG6A 4YPJA 3ZKNC 3KYMB 5DS8B 3EYQC 3DHJA 1B4JH 1N4XL 3BW9B 4MSWB 2VAAA 1I9EA 5HHOA 1WGOA 2X4RA 4QRUA 5EC2A 4M7ZC 1MLBA 3PV6B 1T7YA 1G7MB 2F74B 2H32H 2QSCL 4PY8I 3MRIB 3E2HC 1EJOH 4IS6A 2OL3L 5DVNA 1XGUA 4HUUA 5IFAH 1AGCA 1KG0B 4X5WB 5GJSH 3I50H 2F58L 1AIFA 1A7NH 1N7ML 3B9AA 3NPZB 5CBAB 5FYJU 2ICWA 3LEVH 3X17A 3RWDA 4P23A 3QHZL 2FL5A 4Y5XA 3HG1E 4BFBD 3UTTE 3VGAC 1T1ZA 3W39A 4JB9H 1Q1JH 3IFOA 1Q38A 1DBKL 1CVSC 2YRLA 4P3DA 1H5BC 4Y5XC 5FA3A 3Q48A 4IHOB 3RVVD 1JMZA 4NZTH 4OBRA 5J13C 3PWJA 3TC9A 3IS1X 1MI5B 3MRHB 3BDBA 4FQ1L 1QHOA 2XZAL 3AAZB 5JDJA 3O6KL 1MFBH 4KTDH 4XC1H 1WFNA 5TDOA 1OWRM 5DYOA 4Z7UE 1JGUL 1KJMA 4S10A 5FGCE 3RZCB 5T3ZH 4ZTPL 1INDL 2JCCE 2OBGA 3C9NB 1MI5D 4Z7VB 3QG6A 4JFHD 3U46A 1ZHKA 3RDTC 5L88L 5D9SB 1GGUA 4HKXA 4GG6B 2CKBL 2LVEA 4M7ZB 1VACA 2VAAB 3SE8L 3RZCD 1IAIH 5HHOB 4RISH 4R2GC 2X4RB 1A6VH 3E2HB 4GRWE 4PJXF 4QRUB 4OUUA 4XCCL 3ZKND 5EU5A 3VFMA 5EC2B 2JCCF 3EYQD 1QLRA 3VXSA 3O6ML 1MLBB 3NMEA 4S1QH 2O93L 3N1PC 2AEPH 2EC9U 4LSDA 2GK0A 4IS6B 4JGMA 3GFUA 2X9XA 4JHBA 1XGUB 4HUUB 4DFIA 1AGCB 2NPLX 3VGAB 3QXVA 2IBGA 5IB5A 2VITA 1AIFB 4J8RA 5HHOD 2ICWB 3RWDB 4P23B 1OF2A 2FL5B 4R3SA 4Y5XB 1MLCA 3F7QA 2R2BA 3D25A 2WK2A 4MLIA 5J13B 4GRWF 1T1ZB 1WJ3A 1E4XI 1KJ2B 3IFOB 3A67L 3ZYIA 4P3DB 3BKCH 5EB9A 4K9EC 5FA3B 2MCG1 1KJ3H 3RWIA 3U0PA 3PWJB 1HHJA 3HE6A 3H9SE 1XF1A 1T6WA 4WUKH 2HWZL 4P23D 3LZFL 3OKLA 5TDOB 3SKJH 5DYOB 4LHUG 3HE6C 4HWBL 1KJMB 1B9ZA 1RZFL 2G75A 3RAJL 1J8KA 4XPHH 1FG2A 4O4YH 4KK8C 4TPRL 4JY6A 4LASH 2DQIH 1YEEL 3QG6B 4PJDF 1DP0A 3U46B 1ZHKB 5I17A 4HKXB 1IGML 4OZFH 3VI4E 1RUAH 5I2IA 4HGMA 1VACB 1RZIA 4NHUA 2CR3A 5JIIA 3IYLW 1JPFA 3OQ3B 4MD0A 4I0CC 4PJ7E 4OUUB 4DGVH 5KZCB 1EFQA 5EU5B 5FM5O 3VFMB 5FGRA 1QLRB 4I0KA 3VXSB 4NCC1 1GGIL 1QBMH 2EE9A 1CGWA 1E6OH 4MA3A 5HGGS 2G2RA 2X4TA 5DJYA 5IHUH 1NDGA 4EUPH 3E8UH 1A6UL 2GK0B 3HG1A 2DS4A 4Z7OF 1CXHA 3QIUA 3UTTA 3ES6A 3ULVF 4JG0H 1W72A 5DFVC 5M95B 3QIWA 3MODH 1S5HA 2ICCA 5IB5B 2VITB 3BT2H 4J8RB 3VI4F 2D4FA 4R3SB 1OF2B 3TO4A 1MLCB 2R2BB 3X3FH 3D25B 1CZ8H 5BO1L 5DMGC 5KZCD 2F19H 3QIWC 4KVCH 5E56A 4PJ7F 2AJ3A 3VXSD 4JQIH 1KENH 3BSZH 1CICA 3TO4C 3QNXA 3Q3GA 3RWIB 4Z7UA 3U0PB 5DC9B 1HHJB 1X5JA 3PXHA 5L9DL 1I9JL 3HE6B 1LO5A 1CICC 1OM3L 1TJIH 3NIGF 3H6JA 4JFZL 2K7PA 3OKLB 2JCCA 1ZT4A 5LXGL 4WUUE 2G75B 2Y07H 4O58H 4YFLF 5BV7L 1FG2B 3DOSA 1VPOL 4JY6B 1QZ1A 3ROLB 3S98A 5DZNA 3HE6D 1C5DA 5DLMH 5F7EL 4PJFE 1U8LA 1U8QB 5DHYA 1NSNL 5I17B 1KCSH 2YMXL 4M93C 1I1AA 1BZQK 4KK8D 5I2IB 4NT6A 8FABA 4OZGF 1RZIB 4NHUB 5CSBA 3ARVA 2XI9A 1EHLH 5CGYC 4Z0BL 1BWWA 1JPFB 4MD0B 2YK1L 1I1AC 1A02N 1A6TA 5JA9A 2XG4A 1MCKA 3SKOA 1KIQA 3V52L 4MA3B 4KU1A 2G2RB 2X4TB 5DJYB 1NDGB 3QIUB 3UTTB 3ES6B 3QXWA 1F4HA 1IC1A 3QIWB 1S5HB 2NY2B 3P4OA 1FV1A 1H8NA 1FIGL 2DQDL 2XRAH 3TO4B 4YXHL 4NRZA 3EFDL 2JB5H 5F3BA 3V8OA 3WD5L 3QPXL 2AJ3B 1JTOA 4M43H 3H9SA 2Z9TA 2R4SH 1OPGH 5DFVD 4GAYA 4BFEA 1CICB 2E6PA 2X40A 3LPWA 3QNXB 3FO1A 1D3CA 3Q3GB 4Z7UB 3QIUD 4YHZL 5DMGD 4C54A 3QIWD 2NY3D 2NY2D 1LO5B 4IEFB 3S88H 1C7TA 2AVGA 2JCCB 3NABH 1JWMA 4PUBH 1I8LA 1ZT4B 3G5VA 1OVZA 4KI1A 3KS0H 4MJ6A 4PRBA 3HRPA 4WY7H 4LHUB 3ARBA 1CICD 5T1LA 2R0KL 4GQ9L 1KEML 1P9MA 2VXUH 5I1IL 4M93B 3ARBC 1PJ9A 1IAOA 2VTFA 1C5DB 2DKSA 1A7OH 4XVJL 3S4SA 5D6DA 1U8LB 5DHYB 4GRWB 4BFGA 4ODTL 1DQJA 4PJ7A 4DQOL 1I1AB 2W60A 5KJRL 4LHUD 4PJCE 4NT6B 8FABB 1FLRH 4HWEH 4H8WL 5D6DC 3E1F1 3EO1A 3G6DL 5DQDH 1A6TB 1QACA 1KIQB 5E6ZA 1J10A 4P57A 1YC8A 3DO7A 4JE4B 1I1AD 3CMOL 1JNNL 5EOQL 3IXTA 4PYHA 3RP1A 3P4OB 5EOCJ 1YEDA 1FV1B 3WXVL 4FQLL 2HLAA 4NJ9L 3OXRA 3THMH 4NRZB 1FPTL 2XWTA 5F3BB 1YJDL 4YXLH 1MSPA 3H9SB 5HGHA 2GITA 1AFVH 4GAYB 4MZ3A 1IAII 4JVWA 1P4IL 4OI9A 4DZBA 3FO1B 4DKEL 1GIGL 1RULL 2ARWA 4HFWA 4WI3A 4LLVA 1B0WA 4WUUA 1QNZH 4JFDE 5T3XL 1EZVX 3L3KA 1GAFH 3UTSD 5J89A 1HCVA 2OM5A 3CZJA 1JWMB 5FEBA 1V3LA 1R5VA 3G5VB 4PRBB 4MJ6B 3HA0A 5CILL 3H9SD 3UBXI 3ARBB 4PJFA 4XVTH 4E41A 5T1LB 3L5JA 3B9EA 3MA7A 1IAOB 1YEFH 1AC6A 3O9WA 1UA6H 4DKFH 3S4SB 3CVHL 3MUZ1 1DQJB 4PJ7B 4XMPL 2A74A 3O41A 1YNKH 3DX6A 5BW7A 5I1GH 3UJIL 4LSQL 2W60B 2DQHH 2JB6A 2ORBH 3O9WC 2VDLH 1DCLA 1PX3A 1T22A 3ARBD 1A64A 2OK0H 2R39A 3EO1B 5T1LD 2FO4A 3ULVD 4JHAH 4UQ2A 3JUZA 3GI9L 5FYLE 3J7HA 1FDLH 4KMTH 5TDNA 3FO0H 1VFBB 4P57B 1BFSA 1AGDA 3MQIA 4KPHL 1ZANH 3UZVB 1PEWA 1I8KA 3DO7B 2ZWLT 3BYTA 4ZS6C 4GAJL 3T0BA 5HDBF 3IXTB 3MLVL 3T2NH 1YEDB 1T7XA 3LEYL 2HLAB 3OXRB 3GO1L 2XWTB 4Q0XL 5ALBL 2CDGA 4YHLL 3UPCA 5HGHB 2GITB 2RCSL 4DZBB 1ORSA 2CO6B 3FFDA 4TRPH 1QBLH 4HFWB 3RKDC 4OZGB 5SWSE 2WP3O 4LLVB 4WUUB 5K93A 4XNZB 2VXTL 5KW9H 4KJQD 1KLUA 1KB9J 3U30C 3W81A 2Y6SD 4P9MH 1YY8A 1R5VB 1WISA 1PGRB 1U3JA 2HKHH 1V7NL 3CSGA 1RV6X 4PJFB 3ARFA 4E41B 2DLFH 4GS7C 2V7NA 3KVQA 4NPYA 3HE7A 3MA7B 1CTNA 4PJCA 2MCPL 3WFZA 4WUUD 2WIMA 3ARFC 3O9WB 3Q2CA 5GGVL 3RWGB 1FYTE 3WFDL 4G9FE 2Q87A 5D1ZA 1HHIA 4PJHE 1JF6A 3HE7C 4I18A 2E9IA 2A74B 3S35L 2EDNA 3O41B 4ZFZA 3DX6B 3I6LE 2KKQA 2JB6B 4XP1H 3RVWC 4ZG1A 5AYUH 1T22B 5D1ZC 4E41D 3MRFA 3OGCB 5D1XA 4I18C 2GT9A 2VH5H 1KPUA 3H42L 4UQ2B 2CJUL 4F9PA 2BNQA 1EJ6A 4HUXB 3GSNH 4I9WE 2OZ4A 5TDNB 3O9WD 4UIKL 5D1XC 1JYVA 4ZD3L 1BPVA 1AGDB 3GRWA 1I8KB 1R3LA 1G7HA 3RIFK 5CLTA 4YEEA 1YQVH 3MLZH 2CGRL 1A1OA 3IXAA 4XX1G 4L8BA 3MCKA 3HZYA 1G0XA 3BPLC 2XZQL 1X5YA 5FUOH 3T08A 2JLLA 2CDGB 4ZS6D 2EE3A 4JFDA 2UZIH 1CBVL 2P8LA 3MRPA 5LJYH 1ORSB 3FFDB 3T1FA 3IT8D 5ITBH 3LS5L 1HSAA 4ZPTA 1CD1A 2DLIA 2AJVH 2X1OA 2J1KA 4CNIA 5B3NA 3CFBA 1KLUB 1HXMA 2FECI 3RNKA 3ZE0E 5F7UA 2XA3A 1RUQH 1YY8B 1PSKH 3V6ZA 3T04D 2DTSA 1I8MA 3RKDD 1EFXA 3A6CL 5F6HJ 5AD0A 5IKCA 3OKDA 2VNCA 3ARFB 2YPVL 1U8PA 2V7NB 4NPYB 3ISWA 2OJZL 4YC2B 1AR2A 3HE7B 2E7MA 1I9IH 2XQBL 5FYKE 2C9AA 4YHPA 1MFDL 5D1ZB 1HHIB 2YN3A 3ZKQD 2XA8H 4I18B 3ZE0F 1HEZA 4ZFZB 4Q2ZA 3F8UB 1FH5H 2LAGB 5IV2A 3ARFD 3ARGA 3MRFB 5D1XB 1KXTB 1TDQA 2GT9B 1KPUB 2B0SH 3HE7D 3KYOA 2FEDC 3NTCH 5KVDL 2BNQB 5FO9A 3QDHA 3EO0A 1NAMA 3ARGC 3RVWD 1HHHA 4R9HA 4FXKA 4YDIL 5D1ZD 2FWOA 2QQNL 2ZUUA 1R3LB 1G7HB 2IGFL 4DN4L 2VXSL 2HLFC 3F58L 3K2UH 1FL5A 5HYSA 1A1OB 3IXAB 4OF8A 4L8BB 4TUOA 1AXTL 4HCRH 3MCKB 5D1XD 3HZYB 4GMSL 3GJFK 1NBVL 3QUMA 4G9DA 1LO0L 5LGHH 2FSEA 5SWSA 1ED3A 3MCG1 2BNQD 5KVMC 5FF6A 4RRPG 4JFDB 4EKXA 3S36X 2P8LB 3MRPB 3WS3A 2F53E 3T1FB 4NC0B 4AEIH 3M8OH 4V2CB 1OT1A 1HSAB 4ZPTB 2Z8SA 1IJ9A 1HNGA 1CD1B 4FQ2H 3QQ9D 3GMNA 4J7RA 4CNIB 1UM4H 3CFBB 1K8IA 1CFBA 1HXMB 2VN4A 3ETBF 1KCLA 4OCSL 1CGUA 1GOFA 4P2OD 5I8KL 2KH2B 4NKDA 2VAJA 1K3ZA 1F3DJ 3V6ZB 5TE6L 4AK1A 1I8MB 3ARRA 1EFXB 4JFDD 2VMFA 5AD0B 1FYTA 3OKDB 3O2DH 4G9FA 1OAZL 5IKCB 3MFFB 5ESVA 1KUMA 1U8PB 4PJHA 1EX0A 1EEUA 3QSKB 4KC3B 4YE4H 4YHPB 3TYFA 3N1MC 1XGYL 5EZOL 3L3HA 4DJMA 1HEZB 4Q2ZB 1NLDL 4K7PX 1EFXD 1KIRA 3GI8H 5IV2B 1G6VK 2BXZA 4FRWA 5IVXE 3LQAC 3ARGB 1U2CA 3HC4L 2X4QA 5CHNA 1MRCL 1K6QH 2D03H 4M7LT 2JJWA 1NMCB 5FO9B 2QKIA 4XCNA 3EO0B 4YX2H 1NAMB 5F88A 1RK1A 4AJ0A 1HHHB 4FXKB 1U8HA 2FWOB 4W4OA 1J9CT 5FYLD 3JV5A 3O3UN 2FEDD 3MCLL 3DIFA 5HYSB 1FL5B 1KLFA 2IF7A 3RRQA 3MYZA 1B2WL 1QKZL 4OF7A 4TUOB 3ARGD 3NCFB 4RFEA 4W4OC 2DD8H 4NGHH 5IVXF 2V5RA 4HGWA 3QUMB 4G9DB 2VLME 2FSEB 2CDFA 5SWSB 1EHXA 2ICWJ 4TVPD 5FF6B 3H9ZA 2HLFD 4A2MA 4M00A 3WS3B 5DRWA 2GJJA 1MRDH 4H26A 3DURB 4G7YL 2CK2A 4HV8A 4PJGE 2YSSA 2GHWB 5C8JA 3GMNB 3ARYA 1F4WH 4QXTA 3TWCH 2NY5C 4Y1AE 1K8IB 4K55A 2WUCH 1ZGLA 2GSGA 1RZJL 2I07A 1G1CA 4NKDB 2DI7A 3IDNA 5SWSD 2Q20A 5F71A 5I1AA 1FYTB 3VD5A 4G9FB 2DBJA 5ESVB 5I30H 4ODVH 4PJHB 4TUKL 3D9AH 1T2QH 4KHTH 4WIQA 4YUEH 3TYFB 1EK3A 5CMAA 2B4CL 4MGXA 4LBEA 3L3HB 3T0AA 1AQKL 3MLWH 4QF1A 1D6VL 1KIRB 2ZZUT 1FZJA 4ZS7H 1FYTD 3QCUH 5BMFL 2EIBA 3MV11 4WEBL 4GAFB 3V6FA 1NCWH 2X4QB