2ZOTA

Crystal structure of human f-spondin reeler domain (fragment 1)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
141
structure length
138
Chain Sequence
CSRILRAQGTRREGYTEFSLRVEGDPDFYKPGTSYRVTLSAAPPSYFRGFTLIALRENREEEDHAGTFQIIDEEETQFMSNCPVAVTESTPRRRTRIQVFWIAPPAGTGCVILKASIVQKRIIYFQDEGSLTKKLCEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the F-spondin reeler domain reveals a unique beta-sandwich fold with a deformable disulfide-bonded loop
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Spondin-1
total genus 25
structure length 138
sequence length 141
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02014 Reeler Reeler domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4060 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2zotA00
3COOA 2ZOTA 2ZOUA
chains in the Genus database with same CATH superfamily
4H2CA 1DP0A 4Z7NE 2C8NA 4X7FC 2AVGA 1QFWL 3NEOA 4OZFH 2FHCA 4GRLD 4DP8X 3DOSA 4L5FH 1IGTA 4DP0X 2BNQA 3RX5A 2RIKA 2WKLA 3BEWA 2AXFB 1OGAB 3OKEB 3PAUA 1QI5A 1J12A 1BFOB 4D9RE 1BXXA 1F58L 4QRRA 1A7QL 1KIRB 2Q87A 4NPYB 1AKJB 3GB7A 5IR1B 4JFOA 4MSWA 5TDOB 4ANVA 2WD0A 1J1OL 3VYNA 1G0DA 4GXUN 5EBMA 3BZ5A 5DURB 2VR7A 4JFEA 4P3WA 2AQ1A 4JY5H 4XOCA 4PRHA 2EKSA 1F0LA 1PAZA 4QD2E 5I8OH 1HIMH 2Z91B 4LVNB 3F6JA 4OGQC 4YHLL 1I8MA 4HVBA 2YQ3A 4LARH 5FGCE 3VRIA 2V17L 4J3OC 4CC1A 1URIA 4LCWA 5EC2A 3KPTA 5F9AC 1BDYA 3FQUB 4OJEH 5D71H 1MHCA 3GSWA 5DWPA 5E9NA 4XPAH 4LSVH 3PWJB 3KCWA 2BVYA 4LLMA 4QXWA 4AUJA 4B0MM 4GSRA 4AY0A 1R4XA 1VFBB 2JTDA 4XVJL 3HKFA 3NPSB 1JZ8A 1ET5A 2X9WA 5IMLA 4PEEA 1NICA 1BVLA 2DKMA 1KFGA 4OZGF 1D6EA 3VWJA 4F9PA 5MEPB 2Y6TE 4RQQB 2EIKB 2O72A 4P23A 3C5XA 1KCVH 2OW6A 2CKBA 2WSDA 4Y2DA 1C16B 6PCYA 1U4FA 5CEZE 3GZQA 2C3XA 3G6JE 3TJPA 3ZXAC 1OV8A 4PJHE 3LHAA 1GW6A 4PGDA 3WFDH 2ZPKL 1BVNP 5D7IB 3AU1A 4XP4H 3DROB 4XRCA 1XL4A 4G7QB 4MAZA 2Y6SD 3A47A 2R69L 2VXQH 5ENWB 2X89D 4DO5A 3GGWB 1FFPB 3TO2B 5SWSB 5IKCA 4LCWD 5KYWB 3AS1A 5BVPL 1ZGLM 1BZ8A 5JZ7C 3AB0C 4Z7WB 2CIKB 3BVVA 3RL2A 2GTWB 4AQ8A 5I17A 3FMGL 2C3VA 2Z7UA 4XP5L 1FFTB 1W80A 3S35H 1W72H 3LZPA 1THAA 3ALPA 5AUMA 4I87A 3TIEB 3P9MB 1EERB 1IT9H 3V7AG 3ZL4L 4HUVB 4XO9A 1PPIA 3GK8H 1YYCA 3ARWA 5ESVA 1TYJA 2NXZC 2ZX8A 2Z64C 3KDMB 4H25A 4MWFA 4XNMA 4WFGD 1HEZB 5FOJA 5ICZB 2QKIC 3HE7B 4HFUL 3TC9A 2AK1H 2ZOLA 3EBIA 4KKCC 2VO5A 3QUYC 4I89A 2R51A 3TJHC 1EFXD 1U3NA 4XB7A 4GW5A 3FU8A 3T6VA 4FTVE 3GJFB 3UBHA 4Z7QE 4G9FB 3Q5OA 4ZG1A 2HN7A 1CK0H 2ZYHA 5GRVK 2ATKA 2VXSL 5DVKA 4EMZA 3FN0H 5I75B 2E7DA 4H1LG 7FABH 2CUIA 3VXOB 4MTMA 5B4MD 4N28A 5I0YA 3ZZQA 2OR7A 5E1QA 5ANHA 1E3XA 1HHGA 2J72A 4H4NA 4NZDA 4Y4HC 5D2LA 5D70H 2GSIB 4BQ8A 5DHYB 1MWAA 1OAXL 2XV3A 4PGBA 4MJJA 3TTSA 3WN6A 4DAGL 1T3FA 3TWCH 4GAJH 2WN3A 2GYSA 1I82A 1UEYA 5AAWA 1JZGA 3STZA 4X7EC 1JHTB 5D8JH 2BP0A 4Q6KA 5BXFB 5I8OL 4P48A 1S9WA 4JKPL 4FTVA 2ED7A 1UYWL 4IBUA 2PWFA 1X7QB 1MCSA 4Y4KA 1OY3B 1ZVNA 2BP8A 4FJYA 4JW3A 1CUOA 2V9RA 1WHPA 3J2PA 3V6BR 3FUNA 1AXIB 2ZX9A 1Q0EA 2NW2A 1FZKB 4FEIA 3TBCA 1IC4H 4ENZA 3DVIA 3H9SA 4P5TC 2WZPA 4XC3H 5GXBB 1I3UA 2RQ8A 1AOHA 5LDSA 2BWDA 3HRZA 3P4OB 3REWB 1FNGB 3I6GA 5IROC 2XNAA 1VESA 5CKGA 1A7OH 3O9WC 3CGTA 2K45A 3MBEC 1MHEB 2RALA 5JO5B 4AQZA 3IWVA 1H3XA 2GSGB 5KYXB 3B2UC 1KY6A 1UCTA 3LQAC 4WUUB 3IS1X 2DQ6A 3OKNA 5HVHB 2EDJA 3GBML 3PWNA 4PJCF 4R6UA 3IMWA 5EORL 4PI2A 4RESB 3FW6A 5EZJA 9PCYA 3KLHC 2YEZA 5C07E 2R0ZH 1DBAL 1JHKH 4PBDA 2IWKA 5KAQG 3VD7A 3LIZL 1UXMA 1LDPH 5EU5B 3D4YA 1OWWA 1BEXA 1JYVA 1PS3A 3GBLA 3NK4A 3ULSB 1ZGLA 1KXTA 1IC7H 1ZT7A 2XFXA 4P4RB 4K3HA 5D4IA 4KPHH 1GTFA 4OGYH 2MJWA 3QHZH 4Z77B 4IK6A 3WTTA 3GRGA 3N41F 4E41B 3WEOA 5BS0A 1BVOA 4XCNB 4Y2OA 1BZ7A 4LCUB 2R56H 1XGRB 3EHBC 4WV1C 1XV8A 3BEVB 1ETZA 2DQDH 2FBJL 5EUOE 5LUMA 3QJFB 1FF5A 5FV2A 5KEZA 4DP6X 1AGBA 4H5SB 3SDCD 3SJVE 3TZVB 1UM4H 2JKJA 1ZT1B 3Q8FA 1NANI 3L9YA 3NCEB 4KKRA 3CWGA 3D4GA 2RD0A 2QVMA 3THML 3D12B 4IMLB 5TQ0H 3W2DH 4HPOL 4DNLA 1CIUA 1T83A 8CGTA 3WNNA 5JDSA 3UERA 1LVEA 4CKVX 1E8WA 1OE3A 3BZ4A 4S1RL 1D9KC 4MRBA 1H0DB 4AZUA 5TDPA 4WLCA 3ZTJH 3ZYJA 3MV8A 2Z1PA 4H2AA 1NEUA 4ETQB 4XCYB 3DK0A 4XVOA 4OF8A 2MCMA 2MTAA 3UTSA 1TZIA 5C0BD 2Z4TA 1FGNL 2YGPA 4HIIA 2VSDA 5CCKH 3RWIA 5ENWA 3EO9L 4MJ4A 2PWEA 2OSWA 2ERJB 2VC2L 4RGOL 3B6SB 4JUSA 1KCUH 4L8DA 4HSQA 3QZOA 5B21A 3TT3H 2NY0D 2FX9H 3RTLA 1BWWA 1IC7L 3GM8A 2NY2B 1P69B 5TDNA 1P4BH 4V2CB 2WLIB 3GJEA 1RFDH 2CGRL 1SDDB 2Y2WA 1F42A 4LHUA 3SKOA 4DO4A 4ALAC 2ADYA 4N8VG 3D4CA 1GKEA 5GGTH 4OZGB 4OD1H 1A9EA 4OUUA 1KDJA 5IVXB 2CE6A 2P8PB 4LOUD 4OU3A 4NHUB 1N3NB 1P1ZA 4CSZA 1WBXA 3JTSA 1A7PL 3D34A 1SPDA 3NRQA 5IB5B 1I8IA 1U3JA 1U2CA 4B0MB 5I1CH 1SXCA 1QOKA 3CDZB 4G72B 2RR3A 4M8RA 3T9WA 2QPSA 3Q01A 4ABVA 4XOBA 3LXUX 4I3SL 4YC2C 5BPPA 3ME0B 4PJ5A 3WE6A 4PRPD 1OM3L 4LP8A 2PWHA 3LEVL 1E8YA 3ILEA 4CILA 5BMFL 1YDPB 1CFVL 1QLFB 1SHWA 2BERA 2D9CA 3FTWA 2QSQA 3VH8A 1WZ1L 2BVPA 2HFGL 3OKKA 3MLWH 2I27N 5FUZH 4WU7B 4AEEA 3L1EA 4FXKB 4GLRI 5I1GH 2DYRB 5DHVH 1BX2A 3L3IA 5FGCB 3SD2A 5A7EA 5EC2B 3TX4A 3G04A 3O4LB 5F96H 1QKZH 2MIZA 5KBLA 3DRQA 2VERN 1CIDA 4I1RA 3ZTJG 3D3VD 1TJIL 2VQ4A 3BFWA 1YEGL 4RAVA 1O7DE 1XL6A 2MNWA 3GHEH 4KROC 1YEFH 1RUQL 4JFZH 3VXSB 4AG4H 3BAEH 3OKMB 4ZPTB 1QUNB 4XNUH 1RK0B 4FS0A 3ROOB 4NUPA 2VSKB 5JOPD 3V4VL 3BSZA 3V4UH 1MHHA 4F7PA 4TVPD 4JPKL 4R7NA 2FHBA 1Z9SA 5DRWA 4N90E 1EO8L 2AERT 1CD1A 4JPQA 2BCKA 5CEYA 3I3BA 1C5DA 1SXZA 2ZXWB 3ROLB 4OGYL 1X7QA 4Y4KB 5BZXA 5BV7L 3FCBA 1TCRB 3STLA 1FBIL 4YVUA 1E28A 4PJCA 3GIVB 4EZMA 4MHHI 3N91A 5HHME 4CU8A 1UADC 1JSYA 4M8VA 4P46D 1G0YR 4G7VL 5EIIG 2QPUA 4E2OA 3MN8A 1LO2L 3NZHH 5C09D 2FNWA 2NXYB 2PWDA 1J9CT 4JQIL 3RKPA 3UBXG 3EXLA 2ZF9A 3LN5A 5C0GA 1DBBH 4FE9A 1X3DA 1ZVHA 5IJKC 2D7NA 5DSCA 1X6NA 3IMRA 1M3IA 4QRPE 2WYIA 3L16A 1NCDL 3NSCA 2BCMA 1AC6A 1BBJA 3RWHB 4TOYH 1PY9A 5EORH 2C5DC 1HWHB 3GZPA 1JHTA 1ZE3C 5FAAA 4KZEL 4RRPG 3FQRB 3ULUE 5HSFA 2YAOA 2Q2EB 1MJ8H 2GG1A 2JQZA 2VDPB 4OI8A 1R3HA 3WY4A 2X2IA 4JFEE 4G6FB 3NH7L 4H7VA 4RGND 1DQQA 1S7VA 1VERA 2FVNA 4NKMA 3BDXA 2DBLH 3WLWC 1BYNA 3DVNA 3UYRL 4UIKH 3TFBA 5K9JH 1S7WB 1UQSB 2BDNL 3PGDB 4C8XA 1ITCA 3NABH 3P4NA 4WJG3 5DJ2B 1GHFH 2W60B 1KJ3L 4FQLH 4WHTA 3EOAB 4NO2A 5C0IB 2YO3A 1UVQA 3NZ8A 1VFOA 3IFLL 3WIAA 4DCQA 2UXGA 1V8HA 1OAKH 1QAWA 4ZO8A 2H6OA 5AB2A 4WI0B 5C08D 2OMVA 4QXVA 4RZCB 5FUZL 1GH7A 3THMH 1CD0A 2BSRB 3VM7A 4GXFA 3WMQA 1WIUA 4KQ3L 5FCUL 3F7KA 3WAJA 2XOTA 1SJXA 3HMXA 1LE5B 3L1GA 1BECA 4P0DA 1HQ4A 1K3IA 3ZE0B 3QR2A 1MLCB 4JRYE 2PW1B 1JNHB 5MERA 5FDWA 5E99L 2VXTL 4WW2C 5E08H 1XH1A 2JQMA 1KCRL 3SYQA 3SCMC 3GUTB 5F1IA 1ORSA 1T2QL 2VAAB 3HMXL 3ZIYA 3PJSA 5J1AA 5I5IA 5JORA 1C5CL 4JAMB 3KPQA 2QKIA 4WEMB 1TZOA 3UABA 2RCSH 4NYLB 1RUAL 5K9KA 3FU7B 4G7SB 4UQ3B 4WWKB 4ANXA 2VWEC 3DXAA 5D7EA 1NANH 4Z18A 2JB5H 2EEDA 3CHRA 5IBUG 3BDBA 5CJQL 3TCLB 3BISA 5MP6L 3TESA 4NOBA 2ZWNA 3P0YH 4TVSa 3T0BA 1TQSA 3ILDA 4YLBA 3ZT7A 1FVCA 1MN4A 1E4XI 2AK4B 3O3DA 4DEPC 3QCTL 5CBEA 2WXKA 2WLIA 3SE3A 1JS4A 1YQ2A 2CALA 2E56A 2Y07L 1KYOJ 3X13B 3HPJB 4PJIA 1O6TA 1GOFA 1A3QA 4XCEA 3QDJA 1R3KB 4XAWH 2HFEA 2WPGA 2AABH 1OSZB 2OJ1A 1MCJA 1A4KB 1S8DB 3VWJD 1OCCB 1AFVL 3PV6B 1C7SA 3FHQA 4LQFH 4WUKL 4NWTH 2CLRA 4GEIA 2BO0A 2B1HL 2WXRA 1DBJL 2X7LB 3DTUB 5BUAA 3MV9D 4AQEA 3TCXA 4G8GE 4HIIB 3BW9B 1QW9A 4ZSOB 2DMBA 4LPVA 2QQKH 3X11A 4C54A 2BY3A 1DVFA 1HCVA 1NEZB 4NENB 4BDVB 5D1XE 4D0BA 4JO2L 4AQ1B 1WP6A 1MCCA 2EDQA 3COOA 3AWGA 2G2NA 1HL9A 4J3SA 5LBSL 1MI5E 2HUHA 2WCPA 3CZNA 4OT1H 3NAAH 5HHVH 3N1FC 3S97C 3VI4A 1Y18B 1X44A 1WWBX 4LAJH 3U48A 4N2NA 1EAJA 1W0WA 5TE4H 2ED8A 4JFED 4POZD 4Y2NA 3D39B 4ANUA 4YHML 3W37A 1RUAH 3OPZL 4YGVB 1W0VB 1MVUB 3M7OA 3KL3A 5IVNA 3QUZC 2Z31C 3HKZA 2G60L 4F58L 3SYCA 1ZDQA 3BQUB 5B8CC 1JK8B 5B38A 3F6LA 5FEBA 4DOHB 1HH6A 3I50L 3ATEA 4ZXBB 3AQYA 4MBOA 4XMKL 1MEXH 3M1OA 3MLWL 4GAGH 2VLKB 1UWEL 3CSYB 1OCOB 4XPAL 3GJEB 4K3EL 4JQXA 2YD7A 1I8LA 3WUWB 4JY6B 1N67A 4L3CB 1DQML 1KWKA 5FV1L 4ATTA 4QOKD 4XTRC 4QHUB 3FFCD 1VZIA 3ERXA 1T0NA 1E27B 1N59B 3FU0A 3MV8B 4G7YL 1HE8A 3DV4A 2QLYA 3N9GL 2WBWB 3PS6A 1AD9B 4P5MB 4KZDH 2DPKA 5E2TH 1Z66A 1HXMB 3T0AA 4JFHE 3GHEL 4XHJD 1PD0A 2Y1VA 3K2UL 2AVFA 4JO2H 5B3NA 4LLWB 1WGVA 4NPJA 3VFVB 2QVTA 1CLZH 1D5MB 1V3JA 2BSED 4R4BA 5MENE 3RFZB 2BK8A 1LEKB 5E2VL 3VA6A 4YSCA 5IB4B 4IQHA 4XHJC 1F1AA 3PRZA 1ES0B 2W5PA 3GXPA 3MV9E 5E2JA 4WKZB 1L7TL 3WSQL 3BUDA 3BO8A 4PN6A 3BSZL 2H1PH 2XU9A 5A2LH 4ONHB 3P0GB 1KTBA 4LCIL 1BEYL 5AKRA 4U6HB 5IVXE 3ARGC 2XPYA 4JRXD 3U46B 1U21A 2C9AA 1J8HE 3NFPA 4N26A 4XAWL 2E7LC 2P28B 3L3OB 4Y16A 4ZMAT 4ZNCD 3CZJA 4L8CA 3H9YA 3TVMC 2K3TA 4QJ5B 1O6SA 4P23C 3AMKA 4UOW1 4XBEL 1UCBL 2CO6A 2F74A 4QXUH 1PVHA 1UWEH 1JGDB 3BXNB 4OCYL 3REVA 4OM1H 1MVYA 1OCRB 1UXWB 2AJXL 1RHHA 1U8KA 4XBMA 1U6AL 2QQLL 4QF1A 4HS3A 4X9IA 4WV1B 4WEBL 6CGTA 3FSAA 1TETH 1ASOA 1I3RB 4AZ8B 2CCWA 4NRZB 3T5WA 1SBSL 3OBAA 4GXVL 1U8JB 4M4PA 1IC1A 2BZCA 4G71B 4G8FB 1KT2B 1MW2A 1WZAA 3O3EA 4P5SA 4LOVA 3TA3B 3K6OA 2ED6A 2GJ6D 4FXTA 5DF0A 3Q2NA 4YPJA 5BO1H 4UTBA 1LEIB 1PNCA 1CK0L 3U4AA 5BVJA 2DLGA 4PLNC 1ADWA 1HKFA 3H0TA 3DGGA 1RZIA 1MI5D 2IQAA 3CVHH 3FRUA 3ECQA 4ZFFA 1N6VA 3MXVH 3IKCA 1EMTH 5KTEL 3ZYIA 3A0OA 1J18A 3MV7E 1W72B 1XF5A 3HZKB 2YPVA 1MCWW 4M1GL 1GZQA 1HI6A 4FLQA 1N2RA 3IBOA 4K8RL 3U0TB 3OF6A 4TQHA 1NEPA 4KK6C 5AOLA 5EU3A 5BQ7A 5M94B 3B7TA 5HDWA 3ZL2A 3ULVE 1THCA 1FIGH 1FFRA 2K7PA 3MAWA 2JCWA 5EO9B 2ZAHA 1I3GL 5CINL 3MRQB 4YHIB 4Y1AD 3JWOC 3U2SB 4XT1C 5FHBL 3H8NA 1YO4A 2P4AB 3A3YB 4MD5B 3FB5A 2P5WE 1IBGH 4PGEA 3WKNA 3IU4H 1E50A 2H0JA 2EVGA 4UNUA 5JXAH 1DSFL 1XD0A 3P30L 4E5XG 2AMUA 5G4NA 1NCOA 1SBBA 2XWZA 4MDJA 1QPPA 3RIAK 1ZLDA 3MOBL 5CJOL 2AV1B 4GAGL 2XDHA 2IAMA 2WINA 5DURD 1QSVA 2YD2A 3J07A 1DBJH 4L3AA 1RUKH 2PR9A 2AGJL 3CVHB 2CRIA 3V6OA 3F58H 5I19H 5KVDH 3GYRA 5C0FA 2FGWH 3EOBB 3O4OB 2P1YA 5F7KC 1N6QL 5L7XL 2I07B 3I75A 4IW4C 1OQXA 1T22B 1F41A 3I2CL 4KHTH 2H32B 1AY1L 1M7IB 1FZKA 2XV2A 1RMFL 1WBZA 1WFIA 3O8XA 4JY4A 4K8RH 5HHMB 1Q9KA 3H54A 1KGXA 3VD9A 1YYMH 1ND0A 2DOCA 3D0LB 3D48R 3KPOA 4EI6B 4Z95L 1R24B 4HK0A 4B9ZA 4ZUUB 1G0XA 3BKMH 3HNVH 4M7JH 4UOW0 1WD8A 2YQBA 4N85A 2VXUL 3NZ8B 2B2XL 3FQNA 2B9AA 4BGDA 1MOEA 4PWJA 2DN7A 3GTNA 4ZW8A 4IRSB 1HZHL 4GUPA 3QJRB 3EADA 5E2WH 1EJ6A 1DSFH 3P30H 3TT1L 1ZDSA 2GCYA 3GF8A 4BHUI 5CBAA 3LS4H 3GSNH 4HUVA 1LJMA 4HF5H 1ODAA 4YR6B 4PJ9B 4GLRH 4BFIB 1TIUA 4XH2B 5KN5B 4X9FA 4WI7A 3DIDA 3WFHB 3B5TA 5ADOH 4F5CA 1QBLL 3KPRE 1SM3L 1T4WA 2OXGB 3E7JA 3ESVF 3VXUE 1YMHB 2A0LD 3UO8B 4NB7A 4FA7B 1V7NH 1U6AH 2QQLH 3OKEA 5AW4B 4TUOA 3T8VA 5LWYL 3AG4B 1M71B 2P5WD 3PHQA 2HG5A 1RZKL 3KCPB 4I2XA 1BOGB 2H0EA 4G7RB 4ZOBA 3VFOB 5IB2A 4PSPA 3MV7D 2WBXA 5JW5B 3BUQA 3N0AA 2FLBT 4ADIA 3I2CH 2BMKA 3EJRA 3FNKA 3PAVA 3SGKC 1E4HA 4LLWA 1BMWA 2J5LB 3MGAA 1NMCB 1F13A 1AQDB 3RX8A 3UZVA 3DPBA 2IDQA 5DMIH 4I7ZC 2LW3A 5FF6B 5DVPA 5DK0B 2YMXH 3EZJB 3OAUH 1S7UB 1S9VA 2GK0B 1ES0A 2XWBB 1W15A 3U0PB 1WIPA 3EYVB 4D0DA 4EIBA 4GFXA 4P23B 1GPOL 4PU2A 1MWAB 5CHNB 1AZRA 5IMKA 3F12A 3GMPA 5C0DA 4F1ZA 1OT4A 2A73B 4GBXC 4W4OA 5DJXA 5DXWA 3R7QA 3UAEA 2R2CA 3V6ZB 2O93L 3VXUA 1C08A 3T2NL 1TJGH 1FO0A 4APQB 3FTSA 2MCPH 3KPLB 4JZJC 1JGIA 2LU5A 4ZAKA 5K9OB 4OD1L 4A7SA 4LLMB 3STZB 5GZND 4JJHA 3OXSA 1RV6X 5D7IA 3WNMA 4ZXBA 1T04A 1A9BB 1CXFA 3RPIB 5FHBH 1TU2A 1JFHA 1MCIA 2LE9A 4EDWH 3QUZB 1H3GA 3MBWB 1J1OH 1LWHA 1S7TB 4FMKA 5EA0L 3ZMEA 3WEMA 4OCRL 2B8OT 1I7ZB 3S34L 1NFKA 1ZTXH 2Y5TB 3VWKD 3U6XA 4A7GA 4A6YA 3ENEA 1ZK5A 2MOGA 4ZDHB 2V2WB 3O3AA 4PB9H 3PLYA 5DO8A 4CADB 4MJ5A 2APBA 2BRRL 3IJSB 5BMFH 3K6IA 5JUEH 3BKYL 3DX6A 4CW1A 3H2WA 1YPZE 1UZGA 5E8DH 3FT3B 4DHLA 4MMXC 3EFDH 2VDOH 2A1WH 4QI3A 2XTJC 5D71L 3SE6A 2KLSA 1AGEA 2NY7H 5IHUL 4MB5A 4JG1H 1XH0A 1UWXH 4PGJA 1KF9B 1CGSL 3RGVA 3DMMB 4K94C 4AMXA 5EZJB 5JR1H 2FSEB 1MAJA 1XAUA 4KBPA 2C3VB 3SBWC 1MFDL 1GGIL 1INQB 4G42A 1GGYA 3BH8B 3QPKA 3QUML 4JB9H 1TT6A 2VDNH 3CH1A 3EGXB 5EOTA 1QHPA 3WUWA 2FUQA 3FAXA 4XMLL 4KO5A 3RGVD 1TJGL 1SJMA 1LEGB 3KWWB 2PR4L 2YXMA 1FL3A 4JL2A 2YN5A 2AJSL 3MRGB 4PJGB 4XPBH 1X5XA 3JVFC 1DO6A 3L5HA 5PCYA 1A6ZA 2AZUA 2WQXA 4M6OL 3VXMA 2CBPA 3DX2A 4XNAA 5I5RA 3QK0A 4JRWA 3CK0H 4NFBA 5C08A 4YAQA 2P80A 1NAKH 2XQBH 1J0JA 2HFFA 4YHOL 1Q9OB 1RXLA 2AQTA 3GS7A 2FEEL 2FUTA 1GYAA 1OP5H 2MKLC 3HRZB 3REWA 4JDTL 1MCKA 3I74A 5DVNA 5GHWL 3CFKA 2WJ5A 3IAPA 4IKNA 4ZS7H 4TTGA 3DA0A 3SKMA 1IGCL 3CLWA 3MRRB 4MMYA 3T0XA 4F2ME 5HHQB 3IVKA 3DUSA 5F97E 1XH2A 4WFFD 3EH3B 1XHHA 4XNYL 2R1YA 4DK5A 3VD4A 1P7HL 3HE7D 3LVEA 4FYRA 2BNRB 4N0FA 1WA2X 4MNQA 4QRRD 3MVSA 5ESAA 2VDOL 2Z4QB 4FTVB 1U30A 4Q97A 2V7NA 5LN8A 4EUPB 3D2UB 4JG1L 4JFSA 4JY5L 1Q9LA 3KPMA 3VFRA 3ZKSD 1A4BA 1ONQB 2O26U 1BVKB 1NMAH 1X5KA 5I18H 4DQOH 3KLSA 5DYFA 3HC2A 3ARSA 3LIZA 3UZQA 3PWPE 5HI4D 1UXWA 2D3VA 3MRHB 4DEPB 3ASNB 4X4XB 2K8QA 3K8KA 1XZWA 3Q8BA 3QYMA 2BXYA 4GG6F 2YEVB 1E4KC 1AH1A 1BZ7B 2VN7A 3HS0C 4JPVH 3KPSD 1WITA 1AZZC 3L4UA 4M9PA 3T3PB 1ED3B 2XWTB 2VZTA 3EJYD 3WTWA 1REIA 5D7SH 3QRGH 2YHGA 5E9AA 1M05A 3EFOA 3QNYB 3BUPA 2R1WB 5C09A 3QORA 2Z35A 5AW5B 3ULUF 3APNA 1A3RH 4G1EB 4NO3A 3ATFA 4LIQL 4KV5E 3O6LH 5GRZA 4Z7VF 3N50A 4WTWA 3BD4A 4WW1A 1TFHA 1CGYA 5GHWH 4ABWA 3MU3A 1KB5H 2ZF8A 3CAFA 3LN9A 4TS6A 1P5VA 1XEUA 3EJJX 3WKML 2IH9A 5DJ8B 2IXQB 2MPAH 2MCAA 4Z3IA 3W0WD 1NM4A 3WIFB 1VF5C 1YUHA 1AIFB 2NY3B 1BQHB 4XPGH 2D0HA 1GYVA 1U8HB 3C8DA 1PZSA 4H0HB 4OJYA 3JWOH 5EU4A 3SE4A 3DURB 3T6QC 5TF0A 2HKHL 3GSQB 4TNVF 2G3MA 1FZOB 5IGXH 2X6AA 5F0MB 4I0PC 4XCNA 5TK2A 4CVZB 3BZFB 4M7KL 3VD1A 4G6KH 3AG3B 1DJYA 2I32A 5C0BB 1FRGH 3VUAA 3H4FA 4QIRA 4GUPB 2DIEA 3P0VH 4LLVB 2QADB 3TN0B 2A4EA 2EADA 4I5BB 2HAZA 2PO6B 4CBZA 3HFML 3RWEA 2Y2TA 4YNYA 1AE6L 5IIEA 5CF3A 5G2NA 3VE0A 1YVLA 4ILDA 2VLRE 3ETSA 3GEFA 4KXDA 1A66A 4PCKA 3ZDZB 4OUUB 3SPJA 1U91A 1PW3A 3KJ4C 1TQTA 1FNAA 4Z7IA 5E5RB 5IVXA 1CICA 1JTPA 5FECA 1H0DA 1J8HA 1G7JB 3CMOL 1A6AA 1EA9C 1QRNB 2EE2A 2YAMA 3FOMB 5I30H 3HZMB 2C9PA 4CUCA 2X3BA 5H4YA 2XV6B 3DI2B 2COQA 4LIQH 3ARPA 1QLEB 5CWSB 2Q1EA 4I4WB 1MELA 4TQEL 1VB9A 5EHFA 5D7JA 1T04B 3IAQA 3DX4A 2P80D 3ULVL 2E3VA 2BIHA 1S3RA 2R29L 3KYOA 5CO1A 3ZHLA 2EO1A 1FPTH 4YR6A 2D31B 4E41D 2ZJSH 3N43F 2WUCH 2F7IA 3QJSB 1KIQB 3R0MA 3UDWC 4IMKC 1F8TL 3CXHK 1XIWC 3C6LB 4MRCA 4DPRA 4R96A 5E70A 1ADQA 1WBYB 1WFTA 3WXWL 2EUXA 4M5YL 3CSGA 1QSEE 5EC1B 5CJ5A 5T1DL 4KJPD 3HA0A 5IBTH 4OM0L 2F1BA 3MPCA 4B9IA 3K2MC 1CT8A 3APMA 2CDFB 1CU4H 1H9VA 1T5KA 5KJRH 2F7RA 3B7SA 3EIFA 3P4MA 4N3TA 5HY9B 3JVGA 1DE4A 2DQJH 2XRAH 2OP4L 3UTTE 1ZPLA 2R9HD 3B37A 1NKRA 4LCCC 4UAHA 4HWBH 3RE0A 3UG3A 2CLZA 1MHPL 4NKDB 4C58B 2HVKB 5H37G 1L9OA 3CFNA 3QR0A 1AG0A 1QUNA 3ZDWA 4JM2A 2A83B 1KTRL 1YEHH 4J4PC 3NTCH 5SWZB 1BYPA 3CU7A 3WN5C 2QFPA 1YDPA 1U4EA 4J3OG 4J1UB 4X2UA 2XN9D 5JYMA 1FAIH 4HGWB 2C34A 1RPUA 2I5YL 2KPNA 1S7WA 1UQSA 3DK2A 2IIJA 3NCBB 3UP1A 3PHOB 4HBQA 3VRIB 3SDDB 4M6OH 5FB8A 1U95A 1BOGA 3WLBA 1MY5A 2PO6C 1U2YA 4NCDA 1F3JB 3QJHA 4LVHC 4U1KA 1MFVA 3EOAA 4PJ8C 1LD9A 5IBLD 4WENB 1H3WM 2Y72A 2B3IA 2E9WA 4MYWB 3FB6B 8FABA 4Y1AA 4I3RH 3L4WA 5DFWH 2VE6B 1ZVSB 2W95A 2OL3L 4OZ4B 2QBWA 1M6UA 3LKRA 3NSJA 3SOBH 4KH9A 2BVPB 4G6ML 5EWIL 4HZLB 2D8KA 2E9JA 2F19H 2AJYL 4NM8L 1KYFA 4NZUL 3KYNB 3CSTA 3VD2A 1UGKA 1NOFA 1Z5LA 2D7TL 2D0GA 2UZXB 1AACA 3C08L 5KVEH 1QABA 1AHWC 1ML0A 1QUPA 4GOSA 4UAOB 2DI8A 3ATDA 1ITBB 4OZFG 5EF0A 3VXUB 1RD6A 1TCRA 1EAPB 1BVKA 3EJYC 3MUJA 2H1PL 4NWUH 4LKXB 2VLRD 4AYGA 3AU1B 5HHOD 3GKWH 2D3NA 3IFPA 5K9QI 3HG0A 5KSBE 5D1ZA 2J43A 4OLYH 5K9KB 3WJMB 3QUGA 2YR3A 4UT9H 2VDKB 1KJMA 2Y36L 4ZMVA 5C6TL 3FULA 4UQDA 5GZOC 4J6RH 1OAYH 2UZYA 4PG9B 4E9TA 3KJ6H 3MO1B 2UVFA 3IJHA 3PIQB 1NZRA 4DKFH 2C3HA 2FGZA 5FUCC 5IB4A 3CIAA 4XHQA 3WJJC 1EEYB 6FABH 3SCMD 5AYUL 3WTVA 1VSCA 4PD4J 4YLCA 4J6IA 2VQ1B 2IVFC 4MJ5B 5KJ4A 1RJZB 2Q20A 4Q89A 2HX8A 3KBPA 4NN7B 4QGTA 3QWNA 5BRZB 4ZMQA 2VDKL 4XCCH 2YRBA 4I3RL 1P0SE 2X6UA 4K9JA 5F88B 1QW8A 5GZNC 2O6FA 2MQGA 3D18B 2J55A 1J8SA 3WN5B 2FR4A 4F7CA 2E6PA 4QO1A 3O81A 2B4CC 4IBSA 3L3DB 1L9SA 2DTMH 3CN0A 4P2YA 2JSFA 4OSUH 5I8CB 3SGJA 3SBPA 1N0XL 4LKCA 2FSEA 3QJZA 5HHXH 3FZUD 1DL7H 3T2PA 1BF8A 1PBYA 2F1AA 1RZFH 4KKQA 2AAVA 3D4ZA 5EU6E 5JPNA 3KLAB 3ECWA 3H3PL 5SV4A 1PG7X 4M5SA 4WJKB 5CU9A 5D1ZD 3WU1A 5DVMA 2XETA 4RAUA 5E6YA 4GQ9L 3PCYA 1QTPA 1ACYL 5LJYH 3K6SA 1QVOA 1I8MB 1S5IL 5DK2A 3SZ6A 5HJ3B 2FBOJ 5C3LD 3BRFA 3R4RA 4GSXA 1DQQB 2F8XC 2YAEA 4GKZA 1OOWA 1SEBB 3S36L 1U8OB 1VCAA 1NMBL 3F7PC 2NX5E 4GRLC 3QC6X 4JFYB 4OLZL 3BFOA 3LNDA 2PCFA 3V0HA 5IZ7A 1A7RL 1PJ9A 4ZO9A 3B5HA 3PFUA 2DWTA 4Q0XL 5IG7A 4A68A 2BNQB 5ACMA 3JZYA 1QBMH 2YRPA 3RKDC 3P3TA 1KIRA 3ARFD 3QQ3A 4MCZA 2P46B 2VR5A 4BINA 1UZ6E 3D25B 4NGHH 4AL8C 5J13B 2X70A 3MOBH 2NT0A 2X7LA 2GW5A 2GC7C 1CF8L 3AWEA 1ZHLB 3DO7A 3SQOL 1V55B 3SDCC 4LL1A 4PJEB 3VFNA 2C1PB 3FUHA 4PGDB 4WF7A 1KB9K 1PX3A 3IFNH 4KTDH 4FKKA 2ZCKL 4JM2F 1NGPH 2X4TA 1P7KA 1YQVL 1HWGB 3D87B 4KGLA 3TPUB 4XCEB 2B15A 4MJ6A 2VAAA 1A0QH 4K3DH 4WY7L 4ZFOA 3HHSA 4CMMA 4YDJB 5TF1H 3FH5A 3NA4A 5KYXA 3G5XB 4YIQB 1G1KA 5LCVL 4Q9RH 1U3HA 2NQ3A 3ZUCA 4ZOEA 4AKPA 2GY7B 4EXKA 2DJUA 5DC4B 1IKFL 4G80A 2CHDA 3CLEL 4NERA 4YZFF 3CVBA 2B1AL 1P6FA 4RFEB 2XY2A 3F85A 2Z8WC 2W07B 1EWHA 4D8OA 4DN4L 1IC0A 3BVWA 2BJMH 3FB7A 2EZ0C 5DCCA 1DEEB 2EACA 5ICZA 4L2YA 2NLJA 4EN3A 2F54A 3IB4A 4IRJC 3WNLA 1KLGB 2ITCA 4HG4K 3ULVF 1T7VA 3LV3A 2ZG2A 3PDOB 4JR9H 1NGYA 4PRDB 4PP2B 4UIMA 3C5SA 3BH9B 1J1PH 4Z7QB 4O58L 3T71A 1V7NL 4UAOC 5L8JB 4Q9CA 2VR9A 3HS0B 3IJ9A 3N40F 1IBFA 2XG4B 4AV4A 2ATKB 2RFXA 4H20L 2EC9T 2H5UA 1UM5L 4R5XA 4N2OA 5IF0B 1ZV5A 3CZGA 1ID5I 1NGPL 4YN3A 4JFVA 2BC4A 3BWZA 4IMLA 2IH1A 4H1LB 1RJYA 1XFPA 1RJCA 3H9HB 2FECI 4I85A 1HAUA 3GM0A 3MSPA 3P02A 1MPAH 3BQUD 3C75A 4OKDA 4I9XA 4NIYE 2E75C 4LVHB 5JOPE 2HX7A 2NX5D 4QEGA 1XIWA 4G5ZH 3TEWA 1KBBA 1M56B 1M57B 4ZFGH 5C0AA 1JZ6A 5H2BB 1MH5B 1U8PB 3KPSA 2ZTBA 2OMNA 4L29B 4G6MH 3CHSA 4I13B 4OAWA 2BOBA 1JZ3A 4AW7A 3EH2A 2BFVL 3X12A 3RUGE 4AEHH 3QG6B 1BP3B 3R19A 5KVDE 3EHBB 1ZD6A 3LKNB 4Z3FA 3G6JB 3CZLA 1AGDB 3MO1A 3AAZB 5EEWA 1Q90A 1IC4L 3TYGL 4DOHE 3HZVA 4HAGA 3CFEA 3UC0H 4D0DB 3W0WA 3C87A 1MRDL 1AMYA 5I66B 1R3JB 1D5IH 1AKJD 1L6PA 2WSKA 5FM5O 4QRPD 3BPNB 1P9MA 3A6CH 4IEFA 3VSTA 3HG5A 1QLRB 2YD3A 1TSHA 1UOWA 2H7WA 4Y1AB 1EXUA 2ZQKA 4HWZB 3N42B 1M9WA 3S2AA 3IF1B 1N26A 4KVCH 3X3FH 5D2NE 1RVFL 2JJTC 5EIIA 2HTKC 3JYCA 1GZQB 1RK0A 1FFNA 3KPSE 4HJSA 3OHXC 1I9JL 4HZLA 5CMAA 2X4SA 2X4RB 3BP5B 4F7PB 1T1XA 1CLOL 4Z9KB 5A16B 1B3JA 1XX9C 5DEGB 1LDPL 1MXDA 2YD1A 2GEEA 1G7LA 5EZOL 2ICEA 3LX9A 2DM3A 4U6HA 1OCWL 1SOKA 1SUJA 4MS6A 4XB3A 3CQFA 4CU6A 1P1VA 4WU7A 2ZG1A 2EEBA 3WKQA 4FN0A 2XFXB 1SLWA 4DZ8B 2WZ0A 1JXGA 3NACH 5FCSH 1I7UA 4JLRA 1X5FA 4ONFL 3W0WE 4HCFA 3DXAD 3RDTA 5F7MC 4KRMB 3EOYG 1IGFL 4FX5A 5F89B 1F58H 5KOMC 1P5UC 1G7HB 1A7QH 1D5BB 3OAYH 4XX5A 1AGEB 4MQSB 3MRPB 35C8L 5AVRB 4PREA 4CAGA 1CBVL 3KMDA 1TMQA 5TE6L 4TVPH 4HMCA 4MMZA 3ZW3A 2WWNA 3GSNB 4IJ3C 2PO6D 4ODTL 3RU8H 1VJSA 2O6DA 3IDMA 5K59F 2GCYB 3ARGA 2ZUYA 4DGWC 1FG9C 1INQA 1GGBH 2B20A 4GH7B 1YEIH 4MX7B 3QIWB 3TH3T 5E8EA 3FRPB 5LO7A 3GXTA 4MS8D 3QDJD 5HYIA 2A6JB 5GPRA 3PWNB 4I0CC 3B9KB 5C0JB 1HIML 5C1MB 3MI6A 1PEZA 2LGNA 2FH8A 1CFNA 4B60A 3ZQXA 4Z78A 4ODXA 5HGBB 5BW7A 3VFMA 1ZXKA 3V9EA 1MRCL 5KUMA 4HWBA 4H8PA 4B9JA 3WXVL 1A4AA 4KTDL 2Q3AA 2JNZA 3KHQA 1MCBA 2D2OA 3DC0A 2WNXA 2DKSA 2FEDC 5DZ9A 3VGAC 5KS9A 4RFOL 4ZFGL 1HYRC 2Z93A 2OX5B 3CZFA 1XMEB 1MZYA 2A7BA 3TBYB 3ZKNC 4ADJA 2R23A 4QJ3B 4UT6A 3GPEA 4V1DD 2VM9A 2AV1A 2J8HA 4LPCA 4IKLA 4FL4B 2SEBB 1D6VH 3PWUB 3C09B 1FNFA 2Y3AA 4ONFH 3PABA 1ZLVH 4M3KB 4WSJA 1JVKA 2NYKA 1IKFH 3SDAA 1DQVA 3NP4A 2XTJE 5J06A 4IIQB 2DQMA 4ZD3L 4MNQE 3UADA 4Z7OE 2MQ0A 2CLVB 4OUOA 1CBVH 4MD4A 1H9DA 2NUTA 5HI3C 4PV8A 3DUUA 1JYWA 3C2AH 1MLCA 4ORGB 2J71A 5LGJA 3MLRL 5C0EB 5F6IC 3K1KC 4BZ2A 2F8IA 1F90H 4NBYB 1KENH 1BD2D 4U6VH 3ARXA 2AJUL 4JR9L 5JIQA 3O3BB 1I85C 4GY4A 4ZUTA 2NCMA 1JPTL 4LSRL 1E6OL 1K4DA 5FKPB 4DQAA 3EJUA 1P4LA 1Y1DA 3ABKB 2KQNA 3LTVA 5FO9A 3EO1A 1T03H 4HIHB 3T0EE 4YH6A 4P46A 1RAMA 4RZCA 2IDTA 4GI8A 1YMME 4AT6A 4PQXA 1NCBH 2DLIA 3RZWA 2AK4A 4YPGA 1H3PH 3PAZA 1D7FA 3AXLB 2IFFL 5HYEA 2LR4A 3X14A 4YDIL 3GMOA 3BIAX 1HQ4B 2PXYC 5DYOB 1IGTB 2E9BA 4PLOB 4NQCD 4X6CE 2MCG1 4FNPA 2A73A 5DJXB 2HRHA 1AE6H 2P7TA 3BIKA 3U25A 1IVLA 1H8SA 2YXFA 4F2MA 1MFCH 1U42A 2JK5A 1UB6B 2QSTA 2OKMA 3EUUA 1JBJA 1MNUH 4UM8A 5AOIA 4PRDA 3MHZA 1J86A 4ZSOA 2ZSVA 1IAMA 1QFPA 2VW6A 3LZLA 5EBGA 4F7KA 1ECYA 2G5BA 3Q8EA 5FWRA 2LLNA 3SDXE 4Y5VA 1A25A 4Z76A 4V1DE 5F3HA 1T2XA 5D7HA 2HJLA 4JFHD 4YZWA 3GIVA 1SXBA 1TNNA 2VZUA 5D9SB 4ZFQA 3VFPB 1F3RB 3HAEB 2K9UA 2X6BA 4LLQA 3WD5H 4P04A 4DVRL 4BCZA 5LN4A 2FT6A 1UHVA 5EN2A 4HCRH 2Z34A 2FWSA 3RY5A 3NA9H 3RU8L 3II2A 4ATWA 2ZX5A 3KLLA 3AU0A 5CP7A 3O4LD 2X4UB 2XIIA 2DAVA 3DLQR 4X6CA 1S3KH 3I02A 4CN1A 2HRLA 3CXFA 2BNQE 1T7XA 3HOGA 4WFHE 3UGEA 3Q8AA 4NSKB 3B9AA 2OI9B 2Z1KA 1XGQA 4KZEH 1JN6A 3UEZA 5IF0A 2BNRA 4YDLC 1IAIL 1QA9B 5DQJB 2RH0A 2O61B 5EIIB 3TV3H 4G83A 4XI5D 4U6YA 1D6EB 3VWJB 4ZPTA 1W8OA 2HRPH 1W91A 4JJ5A 5AW3B 3U0PA 2G0KA 3ULUC 3K0WA 5IB3A 4HKJA 4P2RE 1ZHKA 1LMKA 2GJJA 2DQFA 3RWJB 3LB6C 1KGUA 4BXSV 2ZT9C 4PJBF 4WFGE 1TKWB 2NLJB 4BSVA 2B1HH 1FO0B 4RMVA 1QSFD 3GT6A 2X53A 3V0VA 2TRHA 4HWEL 1SF3A 1WWCA 2ZKHH 1AS7A 1A6ZB 1T5XB 3BH9A 2DQIL 1QBBA 3BKCH 4N2BA 1AC0A 1D6VL 1WG3A 3Q2WA 1YY8A 1R47A 3LSOA 4U05A 2IOIA 4RIRB 2FJFA 2WWKT 5LVEA 3OLIA 4R97C 3P3YA 3K80A 3OR7A 3OWRA 4Y2DC 5J89A 3VCLB 3AY2A 4YWGL 3WIHL 5CGMA 5GZOD 1SOQA 3WFDL 2ZPKH 5K1JA 1TQBB 2GIXA 4W93A 1UT9A 1DBMH 4F93B 1M7UA 2W1NA 1OP3K 4P3CH 1TZHA 5F7LB 1TTRA 1KPVA 3TZVD 4HIXL 1QTSA 3ZKND 3ZLQC 1GPOH 3NIGF 2OZ4H 3IJ7A 5DVLA 1T83C 2F7PA 5DTFA 3ZGHA 2NY5L 1WTLA 2XXGA 5GGUA 3RNQB 4OV5A 2OXHB 4F37K 2H26B 2XN9A 4MAUH 3TS8A 2Z65C 4BH8B 3ZU8A 2KERA 4ODHL 3VXQB 1B0RB 1KN4H 3KAAA 4JDEA 4JHVA 5I6PA 4F2EA 1XWVA 1IE5A 2YD8A 1BPLB 3DJ9A 1MUJA 4JO4L 1HNYA 1EHKB 3NFNB 3GDBA 1R5VA 1SGKA 3TBWA 3DHMA 2CD0A 1IVTA 5J3HC 5EOCH 5CIPH 5BRZE 5DC0A 2R1XA 2ZX7A 4PHXA 4TKWA 5I0WA 3QEUA 3GBEA 5AOKA 3SJVA 2R0WL 2X9YA 3MV9A 4HS6A 2F61A 2FSDA 3U46A 5ADOL 3WEXB 1HHGB 4IDLA 5I0VA 1QFUH 4RFNC 1R3IH 4RMQA 4TSAH 2WLLA 1DDHA 5T1KD 1IZJA 1A64A 2VIRB 2QV2A 5CWSA 4PW9A 4FQLL 1UJ3B 4G8IA 1QSFE 4EBQL 4JFQA 4FQ1H 4W9HC 4R83A 3FT4B 2WQUA 4JZOA 4JN1H 4XOAA 2UY6A 4OQTH 3W3BA 1VIWA 3AXIA 1QNZH 3BAIA 4NJ9H 4LSVL 2WZPD 4MCMA 4E0RA 1OTSC 4MA1C 4KH2A 4Q6IA 1PZCA 2OYLA 2YK1H 3KVQA 3D3VB 1UA6H 3POCA 4A2HA 4ELKB 1FE8L 2GFBA 2CMRL 4D8PA 1XMWA 2YARA 3D2TA 2JKSA 5BVJB 4FXGC 1XSIA 1NAMH 1OAQL 3LEXB 1XBRA 1MRFH 1TG8A 2WOBA 4ODSL 3KPPA 1E7VA 5DHYA 1S9XB 2GJPA 1WUZA 2WOYA 1WFJA 4HH9B 1EZLA 1OT1A 3T3MB 3T3PF 5JIDA 1GA2A 3GZOA 3OXRB 4WI2A 3FTGB 5GS0C 1UGNA 1AXTH 4ZO6A 5EUOF 4KNSA 5IJVB 2VMJA 1CFTB 3FPXA 2XWTA 4URKA 4PSRA 5AVXB 2IAAC 4ZS6D 3KGSA 4Z1PA 3DX8B 3P0YL 1FZOA 5A2FA 3B2MA 1WZ1H 5HPMA 4AK2A 4FG6D 1UD5A 1BQSA 2ESVA 4GNKB 4JEGB 3SKJH 5KVEE 3MGTA 4O00A 2ZKHL 2E7LA 3HNSH 1FNSH 3LZFH 4Q2ZA 2IANB 1LO5B 4ISVB 3RVVD 3TVMA 4AJWA 1QR1A 3FQWB 4OQTL 4DQOL 3H9SB 2NY5H 1R24A 4LVEA 1BXAA 1Y18A 4B5ZA 3GK8L 1PZ2A 1HXKA 4F7MB 2XQYG 1YRKA 3EFDL 1U91B 4PB0H 4Y9BA 3UAJA 1PG7L 4DFIA 4R4BB 2DZEA 2VR6A 4LF3B 2EDRA 3NYKA 5FLUA 3WE1A 1CGVA 3TA3C 2VWEE 3MA7B 3MJWA 5GRJL 1XCQA 4NN5C 3GBDA 3FYEB 3WHE0 4QRBA 4KTGA 2Q6WA 2A99A 3BPCB 2CJUH 3FFDA 3DO7B 5CD3A 3DVFA 3RBGA 4JJ5B 1WT5C 1FC2D 1NIAA 3TJEH 3CX5K 4IBQA 4KQ4L 5JHMA 5TDPB 5B3SB 3HAEA 3C6LA 4ODHH 3FOMA 1R9FA 1H6FA 4U1NA 4KKLD 5EN2B 4LGSB 3EDJA 1IM9D 1KJMB 1TO4A 2WO2B 4XCYA 2WVUA 4F58H 5BUPA 1TENA 4H8WL 5FKAB 4YSQA 3FOLA 5L7XH 3L2LA 1ZLSL 4KNQA 1XB3A 3N43B 3D2UD 2X4NB 1A1MA 3QHTC 3RWGA 2V9TA 2GI7A 5B39G 3AFLA 3QO0B 2OSLA 4KMTL 4BFFA 1U41A 4ZMXA 3RI5K 3H7BA 4DK6A 5TDNB 2BIPA 4JFTA 1QFHA 1SYSB 2XCMC 3E3QC 4IYKA 5D9SA 1LE9A 1I7TA 3LD8B 3LQMA 4P8QA 2CBQA 2JB6A 3IPBA 4LCWB 1Y0LA 1KCUL 4I77L 2AKRA 4X98B 3PP3H 2C9SA 5DR5L 4PBWD 5ALCH 4QGYA 1D2PA 2JVUA 4L4VD 4U1JB 1HYSD 5DA4A 3CE1A 3CFJA 4PJ8B 3P9WB 1O9VA 4JN1L 2H9GB 1P84K 2JCCF 4ABUA 4HKBB 2J1ZA 2VW7A 1ILUA 1UB6A 3HBGA 5T5FA 4OFYA 3ISRA 3C6SB 1FNLA 3MV8E 4IRJD 4EN3D 1G9MH 2Z7YA 3IKKA 1DE4B 4J3OD 4GPVA 3MBXH 1YEGH 5EU3B 3CDFA 3EJQA 3FFCB 3T0VA 3BXNA 5BQ7B 5DGRA 1II4E 4LPUA 3ZKQD 4AMKL 2HUEA 4FNRA 3MX0A 1MG2C 1QBLH 2ESVE 2YA0A 3JT0A 5L4IA 2GABA 4WV1A 4XBGA 4IRJA 2W0KA 4OLUL 5DD6A 3ZQ9A 4AJYV 1CVSC 2AITA 3WDJA 4HIEA 2AEQH 4OCNC 4U1IB 3HFFA 3ZPDA 2VZOA 4U1LA 1WF5A 3NIFB 1OTTC 1QPKA 4X8JB 1OSEA 5E8OB 1GJWA 4UILH 1F8TH 3DDGA 3LRLA 4YFLF 5TQ2H 2V7HB 4IBVA 1IFRA 3DX6B 5TJWK 2BVEA 4R3SA 1H19A 1CFVH 1E4WH 3U30B 4ICWA 2B5IC 2QTVA 1C12A 4JVPA 4NQEB 1IAKB 2UV3A 2YAFA 1E65A 2X28A 4FXGB 4LKXA 3LN4B 4EBQH 2QR0B 1C5CH 3QVAA 3MR9A 1FG2A 1UB5B 5ITBH 4CSTA 3BVUA 3GLZA 2VDPL 4H8VA 2YBGA 4BFBD 2P45B 2AMGA 1AHMA 4AQ1C 4UBDD 4TPRH 4M7KH 5IM7B 3UTZA 3RA7H 2YGVA 1E9OA 3VO0A 3KZ8A 4FCAA 3FU3A 5F1SA 4LDLB 1PIFA 2WV3A 4WI5A 2EIEA 5CILL 2EDNA 5HJDA 1WC7A 3T0EA 1OSPH 3TBSB 3U2SA 3ARFA 4ZS6C 3SBWA 3PL6D 2OR8A 1UH3A 4FXKC 5LXGH 3VW3L 5D2LF 2BRQA 3TLRA 4RFNB 3RI5F 4HWUA 2DYPA 2Q8AH 3GXMA 3H9ZA 3IXTA 1B0RA 4JDEB 3ZZLA 3OSKA 4YXHL 3QJFA 4DP5X 4U3SB 3AJ7A 5MI0C 2EXSA 3AUWB 1G7IA 5IVZA 5A6LA 3SE8L 1PLBA 3OJDB 3ZE1B 3ZOAA 3ZY7A 5GS0L 2IALA 1FE8H 3JVGC 1JMZA 5CP3A 4JZNB 3MRJB 2MSPA 2K6YA 4UM9D 5C8JA 3A4FA 4YLQT 2BW5A 3ABZA 1DEEA 2CHNA 1UD4A 3MGOA 4JL1A 1F2QA 3GRBA 4PYGA 5KVEL 4YDVB 2VDLL 1J9SA 1N18A 3FBQA 1IEBA 3DHUA 4L1HA 4Q52A 3FCSB 4MQ7A 2SODB 1JD9A 1HXYA 5IBLC 2FQGA 1DQJB 1T6BX 3HPLB 4LKCB 3RYMA 3DX9A 1RULH 1IJNA 2K78A 2ZUUA 5IHWA 4OIFA 4MA3A 5EU7E 3X1GA 1KNOA 5I76B 4Z0XB 1J0IA 4A38A 4HJ0C 3SSGA 4AMKH 1U0QA 5L2JB 1M6OB 5DS8B 4DKTA 1T0OA 4UIKL 1UFGA 2IDUA 2TSBA 1SYVA 2VJXA 4BZ1H 4YMPA 4J8QA 1ZJBA 2PMZA 3IRZA 4PJDE 2GTZB 5I15H 4ZX5A 5JW4N 4KAQH 4NT6B 2Y23A 5DRNB 3QFJB 3NSYA 3NCFB 4IOSA 1DJHA 2GTQA 3EYFB 1J05B 4XCFL 5AL0A 4JDTH 2NR6C 5C86A 5DJ0A 4ZFZB 4BJLA 3E9TA 3MGTB 4TQ8A 5DJ8A 2N0KA 5K9OA 1ZV2A 3IN0A 1CL7H 1TFPA 3I9IA 4RRPM 4X80H 4JFOB 1MFNA 4A2LA 5E7FA 1RZJH 3HI1B 5D72H 1M71A 4ELME 4MLIA 2KLTA 4OF3A 5E8PB 4MCZB 4Y2LA 3RPKA 4IKIA 3Q06A 3NJFA 4AUUA 1U8QA 1ZLSH 2X38A 4EZLA 4AJ0A 3DJSA 2VRQA 2JCCA 2YD9A 5CGYD 5IHZA 3KDPB 3IFLH 5C0BA 3MA7A 4LNRB 1XGUB 2XVBA 5EU5A 5LXVA 5LAXB 2OMVB 4AVHA 3TN0A 2OMZB 1IT9L 3ZL4H 4BSJA 3QEQB 5DD0L 3H56A 4MJ2A 3M88A 1X4XA 1M7XA 1TQVA 1AXSA 3WJLC 2PCPB 3QCUH 1KC5L 2AJVL 2FH6A 4F57H 4AC4A 2GK0A 1T03L 5B1JA 2OMUB 3ARDB 3VFSA 3EYVA 3HC4H 4OLZH 5FHAL 1XGRA 4HXAH 3SE9H 5A6MA 2ICCA 1X5GA 3HG1E 1I9IL 3RGVB 3BHBB 4KK6D 2XIBA 3QDGD 1U93A 5TGBB 3C60D 4RDQG 3HC3L 3OKMA 3RTQC 3IDIA 3RVXC 2G9HB 3NIDE 1XIWB 4N0YH 2APFA 4ELMA 3BD5A 2LV4A 1IKOP 5I1KL 5DC9B 2XN9E 2G5RA 3I50H 4LCYB 4L1TA 1YJDL 4IOFD 1BREA 4PJGF 2CQVA 2J4WL 3EAKA 5ISZD 3P9LA 3LIZH 4TRPH 4W9IC 2NSXA 1CF8H 4EEEA 4KVNL 3MRGA 4JFEB 4HEPA 4PJGA 3VXTB 5CJBA 2ADGA 4P4KB 5I8EA 3QA3A 2AHIA 3AXLA 1NFDF 2C9RA 2BC4B 4E42A 2ZUWA 2OMWA 2NY4B 4PRPB 4F3FB 3GSRB 3KLQA 2CR0A 1JWUB 1UD3A 3UTSB 2F54B 3BVXA 2IBGA 2C7UA 1TITA 3OGCA 1O7SA 4E36A 2WZ5A 4HAFA 3GSVB 4P5KB 5F7WC 1UEMA 4CC0A 1HHIB 1PNDA 3CUPA 3IXAB 4NQVB 4NZTL 5E6ZA 3FRPG 1JPFA 5T1LB 4ZTOL 1CD8A 2X4NA 3MRBB 4N86A 3QRBA 4FABL 2K4AA 2PNDA 3QIUD 5E9DB 1P2CB 3GSXB 5E4OA 4GO6B 3ZE2F 2A3TA 4M93C 4N0FB 3AREC 3E1ZA 2OR9L 3MLXL 2CLZB 5I15L 4Z7UB 3W82A 2BW4A 5M7QA 4KJYB 3V6FA 5FYJU 3CZEA 4NHUA 1J8HD 1KIQA 1OP4A 3BDYH 5EDSA 1ZXQA 4DIXA 5E0FA 2DWDB 2Y9RT 5FA3A 2X44D 1P6WA 4BK5A 4BKTC 4JE0A 1F02I 4R2GB 5D6DA 3CFIC 5IP4A 5FXCH 3C8KA 1WCQA 1WLHA 2EDWA 2V5YA 3L6FA 5CS7A 5T1MB 4B53A 3SGDI 4GS7C 5CLWA 1AIZA 3QQ9C 3E6FA 4RGNE 5EH1A 4DEUA 3VM5A 5GGRY 2FQDA 4LCWE 2JCCE 4K2UL 4N8VB 1CE1L 1CFBA 2VISA 4PLJC 4ADGA 1D5MA 2ZOKB 5CN2A 2B3RA 1HH6B 3BKCL 1HCFX 3GIZL 2QELA 3S8FB 5HP5A 3HMXH 25C8L 2KBGA 3NGBC 5I1LA 4X8JA 5F44A 3HE7C 3C09C 4BFJA 3HCVB 1BVNT 4YDMA 3EYOB 4GAYA 4HK3J 5FYLD 5AW0B 4X98A 2FYVA 3E38A 5CUSH 5FYJL 1HL5A 2A74C 4K07A 1QG3A 3MLUH 4F80A 4P2RA 4FZ8H 3VDCA 3BKML 3HNVL 4JGJA 1F11A 4HKXA 4PJ9C 3IFNL 2UZIH 4TNVK 1ZWIA 2P5EB 1XF4B 2Y07H 4NC2B 4LZKA 4JDVB 2BHZA 1YEJH 1JGDA 1WWAX 2ZKWA 3RDTB 1ZKAA 4YX2H 3GXNA 2VLJE 2MEJB 3FO2B 4X8GA 2W92A 1IGCH 3HPLA 1TQCC 2FWUA 3NTCL 2JIXD 5CR8A 4L4TE 1OAZL 2X4RA 4XBGB 2V3EA 3EYQD 5D1QE 3HG2A 4IS6A 4WDIA 5IEHB 1KN2H 1EGJA 3ZRSA 1BQKA 4JCMA 4RMRA 5J5EA 4DZ8A 1L7IH 5C09B 5CFHA 2APVA 2A6JA 3WOVA 4OFPA 4J28A 1TJIH 3H0TB 2L7UA 3QXUA 1R33A 1TXKA 5HXMA 5J11C 1C1EH 1BJ1H 4E5XB 2ZCZA 2APSA 2CBMA 2WVVB 5CLXA 1KULA 4BKLA 1QRKA 2R0WH 3S35X 4WHDA 1RSFA 1K5NA 1YJDH 4PBXA 4X7DC 4XNUL 4XXCA 2F19L 3C2SA 5HJBA 4OM1L 3NPSC 3MROA 1YY9C 3CBKB 4HW6A 1RVFH 4UQBA 3QI9B 3QRGL 1BM3H 3Q43A 3MXVL 2J8UE 4GP4B 1Z2KA 3MJGX 3O4OC 2FJSA 3QXAB 4QXGL 2BIIA 4OQTA 4XMTA 4MDIA 4FFZL 1EO7A 4OLEA 5D1QA 1JPST 3O6FB 4QAWA 5FA4B 1NDGA 4ZUVA 5LGKA 1LO2H 3NZHL 4CC4A 1Q9WA 1IKNA 4RMSA 5HI5C 1RMFH 3WEXA 3QNXA 5L6YL 1I3GH 4LCUA 2XZQL 5CINH 5CCGE 3IE4A 1Z3RA 4KY2A 3C60B 1QRND 2F7QA 2GT9B 3LPGA 3ILPA 4NLAA 3AY4C 4NO0B 2DQTL 5CIPB 4B9FA 1JOIA 1W72A 1OKEA 1T3FB 1EEZA 1T5WB 4AIXA 1NSNH 1JAEA 2CBOA 2ENPA 2WXHA 5E6IA 1U93B 1HILA 4LRIA 1DR9A 4O2CB 1XF1A 2DKUA 3UJIH 3OKDA 1NUDA 2DD8L 2P24A 2VL4A 4TULH 5E1AB 5TPWH 1V3KA 3TFKC 5DK3A 2J8UA 2G4EA 3TV8A 3O6FC 3R1GL 3KPRD 5IQLA 3NJGA 4P9MH 4XMUA 3B2PA 4Y4FD 3ZTNH 3FN9A 2OTPA 2L04A 3VMOA 5JUEL 2G2RA 3SDDA 5D7IF 3BJLA 3QEQA 1I1AB 4L0PB 2VLKE 4XI5C 1F3JA 2NNRA 3QJHB 1AZUA 4NN7C 2DB8A 3L13A 3GO1L 4OIIL 2CCVA 2WXIA 2UZPA 2IG2L 4LBEB 4PRIB 1QFOA 3ZDYF 1YAIA 3CQPA 3EDKA 2V2TB 1JG9A 4CNIB 1MHEA 2CIKA 2KZWA 5EWIH 2DWEA 2WXJA 1JZIA 1GY1A 3V4UL 5FW7A 2PPCA 2PYEB 4L9LA 5BZDA 3EUDA 3MUZ1 5GS2D 3L9BA 4WUUA 4TUKH 5I8KH 1MW0A 1QO3B 2QV4A 1LP9E 3B2VL 1Z9LA 4W81A 1PG7H 2B14A 1CFSB 4AL8H 5C0RH 3ZRCC 3T1WA 4G8AC 2DY2A 4GXVH 5I16A 1IM9A 5C07A 1OGAA 1C1EL 1G5GA 3OD3A 3VX1A 1XGPA 4XNMB 5GZNA 3CDGA 2WGXA 2CUAA 2WVTA 2NY2D 4O4YH 5ETUA 2CPCA 3TNMB 1OW0A 3WJMA 1DQIA 2WTPA 4HS3B 3P4LA 4UIMB 2VQUA 3OZ9L 5AW9B 4V2BA 2VN4A 2J56A 2PCYA 2YA2A 5T1LA 2B2XH 4UTBH 2G5BB 2CJSA 3DHPA 4LNRA 4EDWL 1ETB1 1TLKA 5IWLC 4M93B 1XD1A 1AD0A 1XGQB 3QSKB 3VXTA 1NUGA 3QEUB 4H8HA 2P5WB 1FHGA 3WS6C 3M1CA 4W70A 5KUKA 2WXOA 2EDHA 4RFEA 1S5HB 2R0LL 3VJ6B 3GSRA 1XH3B 4NZJA 4NQXA 4PGZA 2CDEB 1MCFA 4Z7UF 4AYFB 5DFVD 3MLUL 5HGHA 4XP9H 5JLZB 5IEKA 1SM3H 1DVYA 4TUOB 1G6RL 4RCAA 1VPOL 4X6CB 3MCLL 1KSRA 4G6AC 4L8SA 4ZTPL 4K15A 1WQVT 5CGYC 1PGRB 4KROD 4ELMB 4R7NB 1FO0H 2I7OA 1CGSH 3SGEI 4QRTB 1R3LA 4I18C 1J0YA 2P3YA 1MCDA 4UMGA 4RQQA 3SYOA 3UTSE 4M9OA 2OCFD 2RFXB 3NVQA 3CSPA 2OW7A 4YSSA 5JDJA 2VXQA 4KK8C 3IJYB 2A6DB 3MJ9H 1KEMH 4Y1SA 1E27A 3IMUA 4EI5B 3FONA 3O0LA 5ICYA 3WHXB 4E42B 2W65B 2NXYC 1QYGH 3ARFC 4UDUB 3LNGA 1G7MA 3AREB 4P5RA 3MLSL 4HT1H 1RLBA 2BS71 1HE7A 2VABA 5FWQA 5B8CB 2WUBL 3MKGA 4LCCA 4BFGA 4DN3L 4OLUH 4X9GA 3U1QA 2FWOB 3HMWL 4G6AD 3S34H 3KS0J 1Q38A 3LEYL 4ELMF 1HINL 2B5IB 1IGML 3LSOB 3OR6B 5B1JC 4GIPD 4HLEA 4U3XA 5EUKB 4N24A 4PTTB 3ARUA 5IHBA 2R0LH 2VDRH 1PJWA 4B3VA 2DWXA 2C4FU 4PWFA 4KUCF 5DWUL 4ZO7A 2X5PA 4G6KL 5BUGA 1CTNA 4W1TA 1GGTA 2X4SB 1U3HC 4EXPX 3LCYA 1DBKH 1IO4C 5EZPA 3TIDA 2NZ9C 1T22A 5E6UB 5GS0D 3CCHA 2VDKH 4XCCL 5GS2H 4MDIB 2AFNA 2R9HC 2WNGA 3QUZD 4JK0D 3MYZA 2DQCH 3MRFA 4I18A 1MAMH 5FC9A 5B1BB 3L48A 4NUJA 3L95B 1JF1B 4M48L 2JLLA 2X4TB 4XXCC 2EXTA 4ZUUA 1FORL 2ZCHL 1PZAA 2ICEC 2E7BA 2J8UF 4Z7WE 3LRKA 2EE0A 2AEOA 5AOZA 4Y19B 3P73A 4G3YH 4LSTH 4NWTL 3JYBA 4N0UB 3RIAF 4PG2C 1XQ4A 3MRPA 1YPZA 2DQTH 1GC1H 3S3BB 3QUXB 1OTUD 4AKQA 2G4GA 1U8LA 3NOIA 3MRRA 3PHSA 1R46A 2QVFB 4A7GF 2EVJA 2HYMA 4KNUA 4GW4A 1JPEA 2ZUXA 5JIHA 4D0CA 2FYYB 3V9FA 1A2YA 1S5IH 2OJZL 2IEPA 4UDTA 1CYWA 3VRLE 3GBNL 5HBBA 3L3KA 2R7EB 4TUJB 1IQWL 2Q9OA 1H8OA 7PCYA 4N4YB 1MQKL 1I9RL 3K6NA 4UTAA 4V1DA 1MCNA 2IPTH 1E28B 4PD4K 2FJHA 3MCLH 3CHOA 1I4FB 4XPTL 3V4PH 5KSAD 2XXFA 3M45A 3DBSA 2J3SA 2XT1B 5DFAA 3VI4E 1IC5H 5KS9B 5KJRL 2WO4A 5D1XB 3VXME 1NAMB 2F08A 3QNZA 5IFJB 1RJLB 1IBZA 2FX7H 3RG1C 1OARH 3MXWH 5DHVA 3N3EA 4YDJA 3CC5B 3HJEA 3CPLA 4HCRA 1BBJB 4L9LB 4L3EE 4UCFA 1YYML 4I48B 4QRQA 2Y7MA 2Z35B 5SX4H 2R8SH 4R7XA 4XMPL 3RHWK 5DS2A 3W5NA 2AJZA 4WU5B 3O11B 4G7YH 3BEWB 3QJUB 3LEXA 1OAUL 2VMCA 2ZCLH 1HEHC 3LXBA 2XYBA 5TE6H 4M3JA 4F9LC 1NIDA 4BGLA 2F5AH 1MG3C 2VLJB 4QHNB 3VXSE 3HVDA 4K7PY 2DIAA 3GXUB 1A14H 3KGUA 1AIFA 2F1EA 2ICWA 4ZMZA 5DQ9B 1MH5A 1JXJA 3WIHA 3WS3B 3M17A 4APXA 4AGMA 2K8MA 2R2HA 1FFPA 3QZWB 4WO4C 5DJ2A 1CLZL 3TNMA 3TO2A 1MCOH 1SN2A 4MGXA 1KYDA 3EFFA 3QUZA 4H8UA 5F7AA 5DQDH 2EYSA 3OKLB 4HJ0D 1AGDA 4Y9FA 2KYIA 1IL1A 4JANA 3OLEA 2EIZA 1ZANL 4DN3H 4WWKA 1N7ML 2E7HA 2EYTB 5IQ7H 3IGLA 1R0AL 4WFED 1QI3A 4K0OA 4WK4B 2JKWA 2JJUA 4LEOB 1MFDH 2J1YA 3HN8A 1IC5L 3O6KL 1CFSA 3O6MH 3QXDA 1F5WA 3UPRA 3LRMA 4KI5F 1XH3A 2XHNA 2CUMA 3K4DA 3OPUA 3MJ8B 3HZ3A 4FQXA 1YEKH 3LQAL 2YXWA 2CR6A 4ZI8A 1X9LA 3PL6A 1ROCA 4GSUA 2D03H 5I6MA 3O3UN 1Z3GH 5A3IC 5I1EH 4M1CD 4X7SH 3O3BA 5F3FA 1GKOA 1ZPUA 3N1QC 3VSVA 5JIMA 5AAMC 3BH8A 4NUMA 2LU4A 5EOTB 1ZIBA 3PJSB 3ZO0A 5F7HA 5J1AB 5JORB 4Y7MA 2CKBB 2IO5A 2OZ4A 3GEWB 3U4EB 3U0WH 3ZTDC 2Z8RA 4KI5C 3E8UL 5I24A 1PX4A 1KPUA 4MMXB 1NCHA 4L4TB 3SEPA 3L3HB 3H6AA 2VT0A 4PYHA 2F0CA 2NZ1A 4NCC1 4G3YL 4LSTL 3B3IB 3QJOA 1RZQA 4A6YH 2YD6A 3HFMH 1F18A 2YBRB 4YK4B 2E4TA 4Y4HA 4PREB 4CNIA 3Q3GA 2X2YA 1SY6A 2Q8BL 4Y16C 3RX7A 3CXDH 5HGHB 3NG5A 4URTB 5AKSA 1CR9L 2V9UA 2VTFA 4LCVA 3ZDZF 4NHCL 5ADPH 5HHQA 3IVKB 3TT1H 4FKEA 3HR5A 2VDRL 3DSFL 4NFCA 4WW2A 1ZS8B 4NQQA 3VG9B 1HSAA 4TQIA 3K2KA 1FN4A 5DDHB 4I3GA 1BV8A 2YKKA 2HCZX 2AEPL 1KTDB 1D5ZB 4JM2B 3VI3F 1OZTG 2P8PA 1KCWA 1J5CA 1OW0C 4AVIA 1DVFD 2FX8H 3KDMA 3LRHA 4JHAH 4MWFB 4AYFA 1CG9B 2WO3B 3INOA 8PAZA 5JQIB 4WO4B 2CMRH 3DOIA 5EC1A 1EDQA 2KH2B 3O6LL 2DEYX 5JR1L 4L23A 1A6WL 1I7UB 3I6GB 3NJXA 2F5BL 4RWYH 4UQ9A 4YXKH 5IOPA 3KXFD 4FP8L 2R2BA 5EDXA 1R3LB 3HVNA 2CRZA 3G5ZA 2SEBA 2BY1A 3GMQB 5HVFB 2PTVA 4JRLA 2CRYA 4KDTC 1M2OA 3PWPB 2A6DA 4BZ2L 1AO7E 3Q6GL 2YRLA 1GY2A 3ARGD 3CV5A 3R06B 1RU9L 2OMXB 2CUHA 2JJSC 3VJ6A 4M48H 1FLRH 4EUPG 4WKZA 3TONA 1C5BL 1ACCA 3LY6A 2DWDA 3M7FB 5B4MC 1RL1A 1OGTA 1PYWB 1T0NB 1IBDA 3J7HA 4Z95H 4OFVA 5KSAB 2QGEA 2Y3NA 5LLIC 4P5TA 1S78C 2DL9A 4NM8H 1FNEB 3F5WB 3E8VA 4K5PA 3RL1B 1DN2A 1O6VA 1M7DA 2V5RA 1FP5A 2X0VA 4GBXD 1BD2E 3BAJA 2YC1B 3ROOA 3SDDD 4Y2DD 1HWWA 3IS0X 4BK8A 3VXRD 3U0WL 1OARL 4WJ5B 3WENA 1RERA 2MOQA 2WLYA 5ES4B 1BAFH 4N2FA 2PWGA 3FONB 3GKWL 5E8NA 2HSIA 1QHQA 2P43B 2ORBL 4BFRA 5ICYB 1FZJA 2BRRH 4WI6A 3PQYB 4OLYL 3AACA 3CPLB 4X42A 4NAJA 4UDUA 2IF7A 5GRUH 1I9RH 3EYOA 4GAYB 3FQ1A 4NKQB 4PJ7E 4ZXBD 3EOTL 5HYFA 4HETA 4XN7A 3VXOA 4AKOA 4DETA 5HD8D 5D5MB 2D7TH 2WUCL 4HIPA 2UVEA 4FAAB 1E4WL 5E94A 1ZAGA 3CIQA 3TJEL 3D18A 5DRZB 3HZYB 4HUKB 1G4RA 5F72S 2EDLA 1NC2A 2GBAA 3QGVA 3MLVL 4Z7UE 3UC0L 1XF5B 3HZKA 4QT5B 2HT3D 4IU3A 2HWZH 4L37A 2H3KA 2AP2A 4GG6A 1M42A 2WBJB 3P9LB 5HDBE 5F0JB 5JHLA 4HJJH 4LSQL 4RRPA 2H0FA 3IJHB 4UT7H 1I3RA 3FTYA 3GI9H 1M7IA 3IDYB 4JY4B 1KOAA 2ITEA 3FCUB 3I6KA 4YBLC 4M61A 2OYPA 3KYMA 1OHZA 2EO7A 3L1FA 1AO7D 2R0ZL 4HCRL 1IGIL 1ZEAL 4FFYA 5EU6B 5HD8C 5I6XC 5MEPA 5D6DC 1RZFL 2WQRA 2I60L 3GMNA 3MODH 3MV9B 2I9LB 4L48A 1WD9A 3T09A 5JHLL 1P7QA 5EO1B 2VMFA 2KDGA 2E76C 4JFFE 3ESPA 5I71C 1CT8B 5SX5K 3D3VE 3L3DA 4WUUD 5H35B 3UEQA 1JI1A 1HESA 1TJXA 1AO7A 2EXWD 4ACPA 5C70A 3KXFE 5JO5A 3BH4A 5HHNA 1Q0XH 2NTFA 3NIGE 4CC4C 3FB8A 5AAPA 1K2DB 4WWOA 1D5XB 5DD3H 3SKNA 3V7AE 3W38A 2ZONA 1YN7A 4I0PB 4YSTA 4MZ2A 1J0ZA 1NDGB 2EIZB 4W9KC 2RQEA 2VMEA 3NDYE 4I2XB 4N2GA 3LRSA 3S35L 3NSXA 1INDH 4XZ4A 1BW8A 3VYOA 1YY8B 2JFCA 4NC0B 5IK3A 2OMTA 4MNQD 5GRYA 2R56L 2Z8VC 5ACZA 3KR3L 3L8QA 3NSDA 4Z77A 4Y4HB 5FFOA 3MJ7A 5I1DB 2GJZA 2WSPA 2BZDA 3VFVA 4LL4A 3TL5A 3T1FB 1VACA 4J3XA 3WKYA 4IIQC 1P5UA 3IJ8A 4TSBH 3JWDH 2D7QA 1TQBC 4IRSA 2NY2C 2I69A 5E9DA 3PWLB 1CLYL 2G75B 1HS6A 4IBWA 2QHRL 2OZ4L 4R97B 1LNUB 4PVNA 5LCVH 1TTUA 4Q9RL 1E4KA 4Z5RB 3O2WH 3UIZA 4R7DB 4S0HA 5FGBC 1DUYA 5AL8A 5ABAA 1E4JA 2LLLA 5IB3B 1LO5A 1OGPA 1S9YB 1VGEH 3MKKA 4IDJH 5I8EB 3PJLA 3SJVD 3QJXA 4FNLL 2WZ6A 3GMRB 4X80L 1W0YT 2AQQA 3RP1A 3ARBA 4NKIH 4HK0B 5D72L 2NXZB 3OMAB 1ZK9A 2K3HA 3LV3B 3PDOA 4FFYH 4PJCE 2XXCB 4RGOH 2OULB 2VRAA 2AZAA 2DWEB 1DVUA 2X10A 3ESNA 5HVGB 1N0LB 3SKJL 1MFEH 6TAAA 5IW6A 4FFWC 4PJAF 3SO5A 1NDMB 2HLAB 4ZAKD 4KKPA 4O2FA 3VI4B 1IGIH 1ZEAH 4M7LT 3FFDB 5AWNH 4IRSC 5AKVA 5DUMH 4KKCD 1D3CA 2ZUTA 1DSYA 3B3IA 3TBVA 2I60H 1NL0H 4ZFOL 5IV2B 3HUJE 4A2DA 1HU8A 2JJVA 4JJOA 1TDQA 5I74B 1T6WA 3RZCC 3TJHD 2JKNA 5K69A 2IWEA 3BPOC 3I3EA 1PDKB 2X2UA 3HB3D 4O9HL 4WSKA 1EHNA 5DJAA 1KZQA 4E9VA 4PAZA 1P1ZB 4P2RB 2R27A 3LPWA 1GIGH 3MJ6A 4G1MB 2X6VA 1RZ7L 3RL1A 3MNVB 1JVOA 1NCIA 2WLKA 2KQMA 3U6XS 4XXDA 5T1MA 3D33A 5ICUA 3ARZA 4KVCL 4L29A 3QDGB 1TZ8A 1ULVA 1KXVA 5IQMA 3D8MA 4KQ4H 3LKNA 3FAWA 1ZLVK 4W6YB 3PP4L 3CFTA 1FO0L 5K5YA 3N5AA 1WAAE 3OLGA 5DMKB 4IS6B 3DVGA 3R06A 4LT7A 4Q74A 1QASA 3KEHA 1XGZA 2WWOA 2P48B 3DMMC 4W68A 4YDLB 1SJEB 2W9EH 1Q9OA 2WWMD 1NFIA 2XG5B 3BGFB 5D7JD 3QBTB 1ID2A 4UOQA 4FLSA 1DBAH 1JHKL 2VZVA 3FB6A 5JW3L 3WJLA 2Y25A 1TCMA 4LLDA 1E43A 2AJUH 2E8ZA 4LLUB 4HHWA 4N1CA 2KT6A 5DGQA 4BXVA 3WL9A 3L4YA 3RVVC 2F53D 2WWMC 4G5ZL 4Y5XA 2VUKA 4FG4A 3S6CA 4KOCA 4MXQD 4NFDA 1DANT 2XFGB 3CH8A 4IU3B 1O75A 4D9RD 3S5LB 5J0BA 2QGBA 1E40A 4AGPA 4GFTB 3DJZA 1B2WH 1RIUH 4LLYB 4P4KC 4FJ6A 5CJQH 3LNHA 4O02H 4WJ5A 1CYXA 1FH5L 1YEDB 4OGZA 5DZPA 4KHXL 1NCJA 2IWGA 1T21A 5E8NB 2FB4L 3EF4A 2VRKA 3PP3K 2H41A 5BRPA 4YDIH 2LTQB 2B7DT 43CAA 2DWYA 4WKXA 4HJEA 4HKZA 5D96B 4ZDHA 5IREA 3UFIA 2V3DA 2L7JA 1I1CA 3W9DA 4K5NA 3BWAA 1AR1B 5EF1A 3FN0L 3I6SA 3PP4H 3GTTA 1ED3A 3EF7A 2C7FA 3LJ3A 4OQ1A 1CI3M 4RFOH 5D5MF 2CLRB 1DLHA 2PXYB 3WMPA 3WFCL 2R1WA 3QDJE 3ARDC 4F91B 3HG1A 4OZFB 4XMWA 3INUH 3RWDA 2Q6WB 2AK4D 3FUEA 3DRTA 9CGTA 2P5PA 1G7IB 2EIDA 4WFFE 5IVZB 5FGRA 5I1KH 3C8HA 3S36H 4AG4L 1XF3B 4QRRE 1K2DA 2J88L 2YKLL 3WNOA 4ODWB 5DJCB 4F27A 2VSCA 3EO9H 1NCWL 1LEGA 5T5FH 1DHKA 1EDHA 4UMSA 5DT1H 5KSAA 2FJGA 3QUYB 1A7OL 1CFNB 5IW1B 5FA4A 1WC7B 1YEIL 3KPMB 1B9ZA 2XQYA 1AI1L 3VGAB 5F7FA 1FJ1A 5DHEA 2BDNH 3TCTA 4F20A 3GUTA 3VXMB 3KVDD 3ATAA 4OCXL 1B4RA 1CWVA 3FK3A 3PNWA 3O45B 4OCWH 4XP5H 1D5BA 1N9PA 2X40A 5BOJA 1MQKH 2UX7A 1FH5H 4MXVF 4MA3B 4PLJD 1TO5A 4PJDB 1F2XK 1KTLB 2FB4H 4LSUL 4NZTH 4PJEE 4MMZB 1PZ5A 2IADA 5EO9A 1WAAA 4G2AA 2OZNA 2GB2A 2Y2YA 2WP3T 3JWNG 2GEQA 4Z7VE 1TOXA 3NGBB 1I9EA 2DICA 4QRPA 1RJYB 1VKXB 4UU9A 1DO5A 1V54B 4HFUH 4JFYA 4NCC2 1EZVY 3CNKA 2XKSA 2C9QA 1JV2B 1G7JA 1OIOA 1ILSA 1T2JA 1QEWA 5KSBF 5HGBA 1WIOA 1EO5A 1BFOA 3RVUD 2G2PA 1SXNA 1B0WA 5K33A 3E9UA 3Q5YA 4HQQH 4P9HL 4QRUB 4C4KT 3BP7A 2ID5A 1J1XL 1YYLH 3SE8H 1T2QH 2UWEA 1E9QA 4KTEH 3DX9B 2XZCL 1A47A 2WANA 5I5JA 4WUKH 3T0ED 4PJXF 1RJLA 2COVD 1GR7A 3KNBA 5DT1L 4JPWL 3IJYA 5LBGA 2V6HA 3P1VA 4PJBA 1CE1H 1PFCA 5IB1A 2GTWA 1BFTA 1BJ1J 1ANUA 4NQED 3VGHA 3OHXA 5HYSG 1H15B 4LSDA 4GP5B 4QRQB 3PXHA 3U1SL 2L4OA 3WSQH 3RY6A 3DO4A 3FQYA 3P3RA 5DUPL 4ENEC 4N8PA 3H7BB 3NEXA 3BQUC 4D9LH 2PO6A 4HBCL 4M5ZL 1YC8A 4OT1L 4DP1X 1BG9A 2JB6B 5ANMB 1IGJA 4C4BA 4F8LA 2A4CA 2IXQA 4LOEA 1R75A 2FAUA 4AQOA 4WFHD 5T5NG 2KZBA 3AVEA 3ULAB 3G5XA 2H3XC 4U2ZA 2G9KA 3HLAB 2R4SH 4HUWA 3MRIB 1YN6B 2Q76B 3AUVA 4A63A 7TAAA 1KLUA 3FO1A 1URLA 1NFAA 1CB4A 1U3YA 2KMWA 2N0MA 4OFYD 4JKNA 3FB8B 2TSAA 1FFNB 2VDQL 3MRMB 2FZ3B 4X4KA 5GJTL 1ZSDA 3WFEL 2ZP8A 3OAZK 4PJFB 5CGTA 3ZJAA 1K4DB 2YRZA 4BWTA 2YUXA 3RZCA 2GKIA 1E6OH 2B08A 2H1LM 4TVPL 3DGCR 2K6WA 3IDGA 4WVRA 2C26A 1AHWA 3BVTA 1NCWH 3UYOD 3RUGB 4R7DA 3JWDC 5JPMA 2X1OA 1XCTB 3BAWA 5DMKA 5H4ZA 5I1CL 3A23A 3DROA 4MXQC 3KCPA 1GRWA 4ETQA 5IIEB 3WDIA 1AQHA 3TXAA 5A6IA 5D70L 1P4IL 2FD6L 4WNJA 4NI6A 1IBYA 1YPZB 1OB1A 1TMCB 2EH7H 2YLHA 1WRFA 2A9BA 5ETUB 5EG6C 2VB5A 5I9QC 5JW3H 4E68A 2X3CA 4XAKD 2BFVH 3ZT6A 3CFMA 4LASL 3DJRA 4DERA 3T1FA 3CX5J 5LDUA 5CZVH 4U1GB 2WNWA 4WW2F 1OAJA 5J6HB 3G6DL 5SX5H 5MHSD 3PUCA 4CA4A 5J6GB 2L7QA 3QORD 3UTTD 3DPBB 4UM8B 2J1WA 4EOWH 3KYNA 5DMJB 1CMOA 2R1YB 2Y06L 2ATPA 3QC5X 4HEMA 4JZNA 4TUKL 1PKQB 1DBML 2XWBA 5ELIA 3RWFB 3X3GH 3B3BA 4AQ8C 4X83A 4X4YB 4XVUC 2Y69B 3MRQA 3HN3A 4DUVA 5L4JA 3I85A 3BFQG 2OTWB 4M29A 4LNVA 3QWQB 3WBDA 5E56A 2I9TB 4ESKA 4ODUB 2X12A 1PKOA 3FCSA 1AS6A 4NJAH 4ERSH 3M6DA 3GMRA 5I23A 4ZXBC 1SJEA 1JF1A 3J8F7 5IR1A 4JFZL 2E8YA 4UB0H 3EJTA 3P4OA 4KX8A 2HLEB 1A7BA 3AGVA 4PRHD 5DHVB 3V0IA 1J5OH 1AYOA 5BCAA 3QFJD 1UWGL 2X4OB 5H37A 3CFDA 1R17A 1XDTT 2Y1ZA 3KVPA 3RX9A 4YXKL 5CSZA 5DUBA 1QKZL 4A6YB 4UF7C 3TA3A 1A1NB 2ZSWA 5DQJA 4YHKL 3UJTL 1UTDA 2NX5B 1T7ZA 1A4CA 2Z0UA 4IIQA 1IAIH 2VNCA 3IDXL 3UTTA 2BNRE 3VD0A 4L9LC 4NQEE 4U7MA 1A4JB 3TM6A 1BJMA 2BFGA 2KS0A 2RMNA 5DJAB 3VDBA 3V6OE 5CCKL 5I8CA 4AK1A 3D69B 3FPYA 3KPRB 4K7FB 3AS0A 4HDIA 1C5BH 4X5QA 2L7EA 4JHZA 5E4EB 4R7LA 1NBZA 1S46A 2Q7YA 2G0LA 4GI6A 1O6SB 5F8RC 1IZKA 5F9JB 3ESOA 4I9WD 4TL5A 3IFPB 3MOAL 3BP5A 1H5BB 4A7QA 3MCYA 4FHKA 5M95B 5AEAA 1DTUA 1X4ZA 3EW3B 1CD1B 3O2DA 4BH7B 2JXMB 4M4RA 3WTUA 4K7PH 2ZAGA 3T2LA 3W9EB 4FF9A 2FATL 2CWRA 5C6PB 4PJCB 4LVOC 1A1OB 3MMEB 5DJZA 4NN5B 2EIBA 4HXAL 4TNEA 3ESMA 3SE9L 5DFVC 4IOFC 3VI3E 1YMMD 4HS6B 2Z31B 4QPEA 3K8LA 3ML9A 4P2QB 3LMJH 4N5EC 4EZKA 4M6NH 1CICB 2IAMB 2WINB 3OC5A 2ZOWA 1OM3H 3UBXA 4XC1L 3CU1A 1PIGA 1HL8A 4PM1A 4QO1B 3QDGE 3PE9A 1FGNH 2VN3A 3QUXA 3EO0B 5ABZA 2AEWA 1J8RA 3NCJL 4ALAH 1AXTL 4Y4KC 4ZQKB 3F6IA 1PZ3A 3ZDXE 5FIEA 1N2RB 5EU6D 2HFTA 1R3IL 2CBTA 2DQUH 2G3XA