2ZOTA

Crystal structure of human f-spondin reeler domain (fragment 1)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
141
structure length
138
Chain Sequence
CSRILRAQGTRREGYTEFSLRVEGDPDFYKPGTSYRVTLSAAPPSYFRGFTLIALRENREEEDHAGTFQIIDEEETQFMSNCPVAVTESTPRRRTRIQVFWIAPPAGTGCVILKASIVQKRIIYFQDEGSLTKKLCEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spondin-1
publication title Structure of the F-spondin reeler domain reveals a unique beta-sandwich fold with a deformable disulfide-bonded loop
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 25
structure length 138
sequence length 141
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02014 Reeler Reeler domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4060 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2zotA00
2ZOTA 3COOA 2ZOUA
chains in the Genus database with same CATH superfamily
3L3KB 1MELA 1AZNA 4DN3H 4BFOA 1PIFA 2EIBA 2Q76A 2C9QA 3IFPB 2D7TH 3RWEA 4ATWA 4PRAA 1DQVA 3F7VA 4QXVA 3L4VA 4W6WB 2ZUQB 3VGAC 4HJJH 2COQA 2I85A 1G7PA 1F4HA 4PJ9A 1IMHC 4KZDL 3KPSA 4UTCA 3PCYA 4HWBL 3OMIB 3CFDA 3RKDD 1A65A 3ASWA 1JNJA 3VXSA 1WAPA 3FAWA 4BSVA 1TPXB 4FA6A 4CA4A 2NUTA 4LCYB 1Q0EA 3KYMA 2WWMD 2FQGA 1F86A 4AUJA 3L7EB 3TNMA 2IBBA 4P46B 1AJ7L 3QEGH 1M7XA 1AS6A 4FEMA 1J1XL 4GS7C 4J12A 2W38A 1U8CB 5HHOD 2EVHA 4LLMA 4CN6A 5KSAD 3CFKB 2VR6A 3E6HB 4JRFA 4K8RD 3C2AH 5J1AA 1BF5A 3WEOA 2WTOA 2WIIB 2YFNA 2PPAA 5D4HA 5I1GH 1CDUA 4ANXA 1I9IH 3B9DA 4K7PL 5HPMB 4NKMB 4XBPB 1JTPA 2PWDA 3IRCA 5I24A 3PDGA 5JXAH 4HU8A 3U6RB 2EDMA 4PJCB 3DJRA 4FQ2L 4OH2A 4X80L 4N87A 3QQ3B 4HAGA 2L7UA 5E23A 4LRNH 4XNXL 4BFBD 5DUMH 2DEXX 2DEWX 2X4QB 1AXIB 2FAUA 2LT9A 2ZF8A 3HE7A 4GUPA 3ETTA 3FZUC 2HCZX 3I50L 1B2WL 3FF8A 5ECGA 2WZ5A 3UEQA 5H2BB 1KB5A 3CDZA 3R1GL 2JH2A 1FYHB 4ZT1A 3KLSA 3EF7A 1XMWA 4K3EL 4EXKA 4PJGE 4JZNA 4LSTL 2BK8A 2IADA 3UAAA 4PJ5E 3EBHA 3IDYB 3BRDA 5IMKA 3EFOB 5AL8A 1S9VB 4BK8A 2FJHB 4I4WA 1J9CT 2IQAA 4HUXB 4YVUA 4LEOA 3EZ8A 4TOYL 5BVPL 2MQ0A 4GSQA 4HW6A 4ZDHB 4FF9A 4XZUA 1JIBA 5E1IA 1R24A 4LNRA 3AZUA 1E9OA 4FQCH 5EO1A 4FFVD 3LOWA 4KI5F 2L7EA 3LKOB 4MXWH 5JHLA 4PJ8D 5T3ZH 3QPKA 4P4KD 5T3XD 2XPYA 5B1JC 1EHLL 1P7QA 1RHHA 1Q94A 5FYKE 2DQGH 3SIKA 3F6JA 4ZAKB 1KBGL 5HPOA 4MHHI 1XHHA 3S88L 5DMIL 1I3RB 4KRNA 5INCA 5F9WC 1QNIA 3R18A 3U9PH 3VFTB 1YNLL 5T1DH 2A9DA 2YO3A 4OF3A 2AEIT 4YSUA 4NYLB 4Z9KB 3VNZA 4MDIB 2MPVA 1SYSA 4HJGB 3QUZA 2EDEA 4LPXA 6FABH 3P4OA 4HCFA 5DMYA 3I02B 4QEGA 5KVFE 4Z7QF 1UZ6E 1H5BC 5T3ZD 3FYEB 1AVAA 1XAKA 1QPXA 3UMTA 3I2CH 2LABA 5JPNC 5BQ7A 5CSGA 5EN3A 5ID0B 4NM8L 4XVTL 1BYOA 3RGVD 3O2DH 2LVEA 1P5UC 2HRPH 4KK9C 3QDMB 4NQEA 4AEIH 1NCNA 4FXKB 4PW3A 5D7EA 1WBZA 5HJBA 3DX8A 1F1GA 1E9PB 1NCGA 4OI7A 2IPKB 4LHUD 2GUOB 4KKLD 5G4NA 3VWKD 1Q9WA 3DK2A 1KGWA 2R69L 4JREC 1FZJB 2DEYX 4B7LA 5DVOA 3WUWB 4X5WA 4CUCA 1XFPA 4MA7H 2B7DT 1M7UA 1BXVA 1KV7A 3IS0X 4NGHL 3TWYA 3EUDA 2MPAH 2YD1A 5M95B 3ZDZB 4QRQA 1MAMH 1X7QB 4M62L 1HXMB 1OGTB 4NBYB 1IAIL 1NCHA 1PZ2A 4UUJA 3BSGA 2V7NA 4R3SA 4YHLL 1CFTA 2Z0BA 3D06A 1U8LB 3AWFA 3C87A 4YVNA 5HYFA 4PQXA 4YX2H 4GY4A 1TLMA 2NR6A 2BX5A 2UV3A 4MNQE 3PWLB 5H37G 1NIFA 5F7DA 4HHGA 5EB9A 4M29A 4G8EA 5DJAA 3E9UA 3O9WD 4AH2A 4XMXA 1RZQA 2Z7ZA 2VSDA 3AQDA 5IBTH 3UCQA 3OKOA 4AC4A 4AQOA 3CH1B 1AH1A 3LZOA 3KS0H 5ADOH 3JV4A 2GY7B 2LFEA 2QSVA 3KH4A 3KPMA 3LQAL 1MLCB 3C5SA 4GXVL 4YZFF 2HT2C 4HUMB 3UBXI 4P9HL 2JXMA 3AXLB 1LO3H 2RFXA 4LOUD 5E4EB 2CBQA 3QC5X 4MSWA 5K9JH 4FQIH 1KLUB 1WIPA 4PJEE 3BKCL 2BOBA 2ED6A 4PGBB 1GPOL 1QPKA 1WF5A 2FNBA 2X9WA 3FB7A 2H32A 3BVNA 3LXCA 1SUJA 3O6FB 1KGCD 4GMTL 4H1LA 1BEYL 1NCWL 1BM7A 3GO1L 4GB9A 2HPTA 5I1AA 3PL6A 4AQ1B 2C7FA 2QADC 4G7YL 3ECBA 5B38G 4LGPB 4GUQA 4JM2D 2E27L 1SVBA 3QFJD 4M3JA 4TVUA 3S4SG 1AC6A 1TNNA 3DVNB 3VG9C 1FPTL 1YMHB 4JO1H 2YPVH 3MCKA 4KJWC 5J89A 3H9HA 1OTSD 1IGCL 3MGAA 1IGTB 2IV9A 1J10A 3DOIA 1G7LB 5K5YA 3CSGA 2AEQL 3QJFA 4JKLA 1CT8A 2HH0H 3KNBA 1OT2A 1P4UA 5ALCL 2E3VA 3FQUA 1XBDA 2EVFA 2OP4L 2Q20A 3S3JA 1U9KA 3WFDH 2PETA 4JS7A 3VFSA 4Q4EA 3UAEA 3TPUA 3ZDYE 1F41A 1HCFX 4ZNEA 5F3HB 1WLHA 1PD6A 1G6RH 3EFDL 3KPPA 3MSPA 4HT1L 4KUCD 4GSDH 1AKJD 3V55A 1QRND 4XMPH 3SDCC 2WUCH 4GQQA 4HUWA 2VLRA 4MAYC 3O6ML 2ITFA 2OK0L 1S3KH 4EI0A 2YGVA 1T0OA 4NB7A 4XCEB 3QP3A 2XTJE 3GYRA 4M8QA 3V6ZB 3JBG7 4R83A 2NW2B 3RVTC 2K7PA 4EZLA 2ICCA 2JQMA 3OZLA 4JKKA 4R4BB 4TSAL 1BSIA 2BIIA 2ZSVA 5E2WL 5JNYB 2M2DA 1IGML 4HGMA 3DMMC 3RDJA 2BVOA 3Q0HA 5B1JA 1FIGH 4Z7OB 5C2BH 5KS9A 3ZTNH 1CFVL 1YN7A 4QHKI 5JMOC 1FG2A 2NXZB 3GMNA 5TQ2L 4NHCH 4B9YA 4BK4A 3FB6B 2WQWA 3FCTB 1HHKA 1U8HA 5ACMA 4QLWA 2XPGA 3FJTA 2F18A 4NQDD 1JGVL 3QNXB 4FYRA 4OSUH 1EFXD 2CDEA 2HB0A 3A5VA 3OKDA 5KVGH 3VGGA 5I8KH 4NLAA 4BD4A 1ETA1 3KGTA 3NQIA 3AAZB 5IHHA 3QYNA 1CGXA 4IBTA 3B5HA 3FB5A 1IKOP 4F8NA 5J6HB 5IQMA 3S97C 4L3CA 1IU1A 3BDYH 3PIQB 2MCPH 3VFPA 7FABH 4OAWB 1IEHA 1UA3A 2HJKB 2R1WB 5EBLA 5B8CB 3GIVA 4U7SA 5DTFB 1NEPA 1ZS8A 2FL5A 4KHTL 4HIJB 1VACB 4XB7A 1VFOA 3DA0A 3TV3H 1N0LB 4M1DL 4ORGB 4OD1L 3SPHA 2LAAA 2MQCA 4D0CB 4OUOA 1J48A 3TN0C 3DKHA 1KWKA 1IAKB 3L4CA 4S11A 3HFFA 4WO4C 4PB0H 2D9CA 3JYBA 2Y7LA 4OGYH 3QFGA 4I87A 5C7ZA 3ZE0E 2JLPA 2O61A 4ODWA 2IAMA 2J6WA 5GISL 3E1F1 1G9ML 4QYOA 5EC2B 5T5FL 5FGRA 4DPRA 1RZKL 3ZTJH 4CRPA 3W38A 8FABB 1I1AD 1WRFA 3BGFC 3LKQB 4WI6A 5F1KC 1OSZA 2P5WB 4MBRA 4RESB 5ABAA 4N0UA 5I1LA 1WFIA 1RUKL 3A6CH 1KNOB 3VXMB 5KYUB 1TVDA 2R29A 5CZXC 2NSXA 1FNHA 3PNWA 3DETD 1N0XL 4AQAB 5C0BD 5ITFA 4J2QA 4F2FA 5I76A 2ROXA 3AGWA 4JNXA 3GJEB 2XQYK 5IF0B 4ZX5A 1EQWA 5JW3L 2WXJA 2JK5A 1M1XB 2H6OA 1QFUL 3KDMB 2BSED 4BH7A 2EZ0C 3CXHJ 2HFTA 3NACL 1J8HD 2K70A 3TA3A 1GGBH 4DZ8B 4XN1A 1BVZA 4KO6A 5D5MA 2YK1H 2BDNH 4QOKA 5E95B 1KSRA 1FZKA 3H54A 1CB4A 1A6ZA 3TO4B 3REWB 4GT0A 4M3HA 2R2HB 1K6QH 1L7TH 3KVDD 3W9EB 4N9GA 5CN2A 4A2DA 3T65A 5H8DA 3H6JA 1S7TA 1AHKA 2OCCB 2G2NA 1AD0A 1BVKA 5FDWB 1VGKA 4NRXA 5B1KA 1KEML 1AGEB 4PJIA 4UT6A 5CU5A 4HCRH 4P5TB 1QAWA 4O02B 3CAFA 5AOZA 5IVXE 3BQUC 5CJQH 2LTQB 1JGEB 3L3OB 4G9FA 1RV6X 4XPAH 1YPZE 4UU9B 4K71C 5D2LA 5E9AA 1PQZA 5ANMA 4JUTA 5KSAC 3LB6C 1YEFL 1ZHLB 1UKSA 4S1QH 2CGRL 5JW4N 2GSIA 1UM4L 5CD3B 4HISA 4MJIA 4PRBA 3FCSA 3EUUA 1UT1A 3HRPA 3RAJH 3D52A 4M6ML 4ETYA 3VFGL 3GRBA 3KLHC 1XB3A 2JE8A 4LRIC 5FKPB 3VXUE 2F7IA 3FFCD 1NAML 3P1VA 2XRAL 5DJ6A 2KZBA 3J27A 2GC7C 2VRKA 5IW6A 1N7ML 5EO0B 4E9SA 5LGHH 4R2GB 3MRQA 1E6OL 5I6OA 1NOLA 3GSQB 1AHWA 1U6AL 4PRHA 1AGBB 4HKXA 4X9YA 1KCUH 4JRXA 3V6OE 4R90L 4MAYA 4N25A 3FUJA 5EEXA 4XVJL 1E4XL 4Y9GA 1D6VH 4PP2A 4GXFA 4XCCH 4D8PA 4ODHL 2CXKA 1YUHB 3N2JA 4Y5YB 1YJDL 1INDL 5EA0H 5AOMA 1E90A 4PS3A 3EAKA 2V8LA 4GIAA 3QO1A 4KUZL 4FQJH 1UWXK 1UJTA 5JQ6L 1CYWA 2DDQL 3NFNA 4Z3GA 1Z2KA 4EN3B 1JDDA 1EGJL 2R27A 4E41B 4ZFFB 2UUDK 3H2QA 1LEKA 3CHOA 5IQ9B 2EXWC 1NPUA 1TJXA 1OT4A 3EJPA 1CYXA 1FLTX 1F6LL 4F7PB 4W9CC 1NCUA 3I74A 3GPSA 1OGAD 1T89C 4KFZC 5IV2B 3HI1A 1IC4H 3STLA 1DR9A 4B5ZA 1EZLA 3NH7L 4PGZA 4DPCX 4N6QA 2VN5A 1G7HB 2AERT 1NCBL 4UQ3A 4DETA 1JVOA 3W9DA 1DVYA 4M9OA 4PJBA 3WS6C 2B2XH 3L9BA 4G7QB 4XN8A 1ZVSA 3F7LA 1IRAY 1FL5B 3ULVH 1NKOA 4OJFL 1YEIL 4OGZA 4HJ0C 5DO2D 4F33A 2OR7A 5LKNA 1P4LB 5JO5A 4YSDA 3ECUA 1L5GA 2OMXB 1IO4C 5GZOA 1IM9A 1B0WA 4RMVA 4ZAKD 3WJLC 2EO9A 4OZGE 2R1XB 5DD3L 5DWPA 5GRUH 4M4PA 1NIBA 1N59A 4HJSA 5EIIA 3B6SA 3I6GA 1CLZL 4LGRB 3WV0A 4A7GF 3QI9B 1UD6A 2H0PA 3GHPA 2DI8A 2ZNXA 1DVFC 1KTDA 3CLFL 1XF2B 3NTCL 2AK4D 1RCYA 1QLEB 1YYCA 3SYCA 3SPVB 4DP1X 1SF3A 4QWWD 3ULVD 2QELA 5G5DB 1XL6A 2K9FB 4PLKD 5EN2A 4D9QE 3HCVA 4CDHA 3U0TB 3KL5A 1HVXA 1ZA6A 2N4IA 4JM4L 5IB5B 3VXSE 1O5DT 2ADGB 4PJDB 2R39A 3VQMA 3UERA 4MQ7B 4JGJA 1DEEB 4MJHA 4PN6A 1HCVA 3VMPA 4DOHB 3TXAA 4F2ME 4TF4A 1S7RB 4IKKA 2EIEA 3LHAA 2C26A 4YSAA 2GTWB 2QQNH 4KK8D 2YQ2A 3IXAB 4G7VL 4AZ8A 1R5IA 2DB8A 4HMDA 4DO6A 1C16A 1E42A 3SKMA 2JV6A 2MQ3A 4ZMPA 4CN1A 3GINA 1SY6A 5EFIA 4AW7A 3L4XA 1HZHH 1I8LA 1KXVA 3AMKA 1XGQA 4LSPH 5DUBA 4DGYH 3HVNA 4OFDA 3B34A 2OMNA 4M6NH 4QGTA 3RVUD 1EDHA 1XSIA 2B20A 2OMBA 3PQYD 4NO2B 3SDXA 2ALWA 3INUH 1Z32X 4OFVA 3CU1A 5IGXL 4G8IA 1E0OB 3ATEA 4LCWE 2XXFA 1XF4A 5KSUA 5GJSH 5FB8A 4OCSL 3DV4B 3BW9B 3TVMB 5K69A 1OLZA 1BVLB 4LLYA 5KZCB 3SO3C 1X5XA 2NPLX 1FL3B 2B1OA 1C8PA 1B0GB 3TJHC 5CCKL 3V9CA 2GAZB 4XI5C 4XBEL 3D0VB 4UV7H 2BNUB 1EEYA 3GLDA 3LSOB 3NCYP 1UM6H 5HHOA 3TBVA 1U95A 2DIBA 1FJ1B 2OL3H 5KSAA 1BQUA 3ASNB 1BFSA 1UJ3B 3OPZH 3QUXB 1NFDE 3M1CA 1JN6A 1TZIA 3KE0A 4HCIA 4ZUUA 5B3NA 2D03L 1HSBA 4FNUA 4PGDA 3MRLB 1OAYH 3MOBL 3ZE2B 2DI9A 3ZSSA 2AZAA 4ELME 1MFNA 1QSEA 4OCYL 1UGKA 1WH0A 3VI4E 3WO4B 5DDHA 3UZEA 4APXA 1DZ0A 2H8PA 3ARDD 2ZPKL 3RZWA 2YMTA 4F9LA 1ANUA 2F08A 2ENSA 3BUIA 2DTML 3G5XB 2CBOA 4BCXA 4BKTC 1UWGL 1SEQL 4KDWA 2PO6C 1CURA 1IQWH 2MSPA 4DKDC 1KENH 4ERSH 4U05A 1MFDH 3QDGB 4WENB 1ET8A 1QLFA 1NDTA 2AGJH 3KGRA 1EWHA 4LAQH 4BQ8A 4OLUH 5I18H 1G0DA 2VDML 5F9JB 3SCMB 4KY1L 1FVDA 3OM3B 2CBTA 1ID5I 5DMGC 1J8RA 2J88L 4IHBA 1TXKA 2GCYB 1C7SA 2BIOA 5ANHA 2GT9B 2IOOA 2NDFA 4QTHA 5DEFB 5J1SC 2WJ7A 1JK9A 1ZEAH 3HBGA 2QBWA 2BM3A 1AZRA 2QKIB 3NCMA 4ZUTB 1HINL 1N5YL 3T8XB 4XRCB 1BMGA 5IVZB 2H1PL 1X7TA 1AY1H 3MNZA 3OLIA 3HJ0A 5F96L 1JZJA 1GH7A 4PJ8A 3BP7B 3WY2A 4P4KA 4DK5A 1HIMH 3CPLA 3VU1A 1W0VA 4XNDA 3UDWC 2D7PA 2Y2YA 2R7EB 1V54B 2IFFH 4AGPA 4Q9CA 3O3UN 1HS6A 4U1HB 4P9ML 4IRSD 5DRXB 4FCAA 2XV2A 1IBDA 2ZYSA 4WFFD 4WU5B 5ELIA 1QWUA 1F3JB 3TJPA 5ICYB 2KI6A 2ZWSA 2CCWA 2WZPD 3BDBA 3MLZL 3AY4C 1TJMA 4OQ1A 3V9FA 1OZUA 4HS3B 1P1ZB 1O9WA 4DN3L 1A3QA 1TYJA 4N2BA 3O8XB 4HK3J 3UEZA 5IVNA 1G7MB 2WSDA 2D7TL 4V2CB 2G3ZA 5LNGA 4HJJL 4QJ4B 2J25A 3EOYG 4L05A 5C8JB 2HLEB 3GBNH 1QFOA 5I1JH 5KYXB 2G3XA 3BWUF 3RGVA 3A3YB 2K6YA 3TEZA 2N1TE 4KKCD 3PXHA 4ZQKA 4X5QA 4C55A 4TS6A 1PZ5A 4DFIA 2FHFA 2WO2B 4HKJA 3QA3A 4LHUA 1LO5B 1A14H 3VWKA 2FO1A 1A7PH 2B5IB 3KYKH 4ANKA 5A40E 5C0EB 5C08B 1GKEA 3R7RA 1XZWA 4PGCB 5DQJB 1CD8A 5C0CE 2GUYA 1ZGLB 3C2AL 2V8MA 3C8KA 1KPRA 2Y2TA 4HIIB 2CPUA 2W1NA 3FMGH 2IVFC 4QF1A 5I1GL 4LBEB 2MRYA 2QVMA 1S78D 3FCGA 1I9IL 3PYCA 3L3JB 1MCKA 4J3BA 2LLNA 2QPDB 4NS0A 1SEBA 2BNQB 3CSYA 3MJWA 4MJ6B 2F19H 4N2NA 4PRPE 5JXAL 4JFPB 2EACA 5AB1A 4FG4A 3WY4A 1KIQA 3HS0A 1X5FA 2XWJB 5HYQA 4LRNL 1HL9A 4R4FH 4RZCA 5DUML 4HETA 3WS3A 5A3IC 3MZTA 4G7RB 3N41B 5TK4A 1JUFA 5DT1H 4PVNA 1I8IA 5AW6B 3O9WA 1A0QH 2V5SA 4TL5A 5LGYA 5I15H 1PAMA 4WO0A 2H2PD 2IOIA 3EJZC 4PWHA 4GKNA 3O0RH 2XBTA 1LWJA 4GG8A 3GSOB 4GAJH 2HT4C 5I8CB 4GAYB 5A6MA 2FYVA 4J8RB 4B50A 3CHQA 1BM3H 4EI5D 5F3BB 2NY6B 3RTLA 5KBKA 2FDBP 3QEHB 3MRGB 4NQVB 3TO4D 5LBSH 4U4IA 3BZ4A 4YBHA 3QQ4B 4D0DA 1DQLH 3BLBA 4LAJH 4AL8C 4X0NA 3F64A 4FQCL 1NICA 3LMJH 3OHXC 4MXWL 1TPXC 5GGVH 4ODUB 2JI3A 1B2YA 5T3ZL 3K6NA 4WUUE 2FEDC 2G9HA 3D25A 1FFOA 5KSBE 4P46C 4ZPTA 4P5TD 3GEWB 2DQGL 1EIBA 1EJOH 1YYMH 3W5NA 4HPYH 4UZSA 4PY8J 3LZLA 3LZPA 2BVPA 5CP7A 4TVPD 4JMXA 4L8BB 1I75A 5TD4A 1EAOA 5JUEH 2HFFB 3BEWA 3KEHA 3BP4B 3O45B 1I9EA 4B3VA 1JZHA 2CNZA 1B4TA 3GD1C 4XX1G 3FO0H 4DP8X 1XCQB 3U9PL 5DHVH 5T1DL 1V55B 1A6AB 1E5YA 4N2KA 1ZGLM 4KO9A 1S7SB 3DBSA 3HKZA 3QORC 1TQSA 4G43A 4N2FA 1R5VA 1OPGH 4WEUD 4XGZB 2VIRB 4P59H 4K7FA 5FO8B 4FNQA 1HCZA 2EDKA 2J44A 1AD9B 1AKJA 1QRNA 1Y07A 2E56A 1AO7B 2OSXA 4QNPE 3BX7C 3L3GB 1JCVA 3I2CL 3T3PF 3OXRA 4AT6B 3NYKA 3IDIA 5CFAA 1AGCA 4LLVB 4PJAB 4R2GD 4JKPH 2XZAH 2HRPL 4X99B 3T0WA 2UZXA 2GI7A 4AEIL 2FEEI 3BD3A 5GGSB 1W6WA 4FTDA 1BPLB 4MJJA 2Y7OA 4IOIA 2ZG3A 2OJEA 3U9UB 3H2PA 4JN2B 5I8OH 1W72H 5E5UB 3WU1A 3ZXAC 4MA7L 2B3RA 1U8JA 2PPEA 2WIMA 3IDYC 1X7SA 2AK1H 3JTTA 4OT1H 3VGHA 1RJYA 4NQDA 2A2QT 2MPAL 5TDNB 4EN3D 1QX1A 1EFXA 3WTSA 4IK7A 4M61A 3U4BH 4E41D 4XMKH 1MAML 1EV2E 1ZVNA 2AEPH 4ANUA 3RB7A 4EI6B 2VABA 2XN9D 5INDA 3G5VB 1JZ8A 4N0UE 5CILH 1KF9B 5F8RC 2ARJA 4XNMA 4DPBX 2A6JA 3P3UA 1ROWA 1G5AA 4YDMA 5PCYA 3CFBA 1MHPH 5KYYA 2B1HL 3D0LB 1JGIA 5EMYA 3SKNB 2BOCB 4YX2L 4RSYA 3LN4B 2YKKA 3FQRB 4PJXA 3D85B 3DLQR 2ZNWA 3L3HA 1HNYA 2CBPA 5D96B 4G6AD 1J1OH 3FQXB 3RVXC 4IMKC 3GMMA 5IBTL 1T1ZB 4NUQA 1F6AA 4JL2A 2I69A 1E50A 2P9RA 4QMEA 3V5HB 4Y5VB 5ADOL 3QB7C 4KV5E 4OGQC 2CRYA 5IUSA 3K6SB 1ZHNA 1J0KA 4QOKE 3C12A 3GXMA 4O2EB 1MFBH 4FERA 3MV9E 3UAJD 1RMFH 3FQ1A 3PG2A 2VL5B 1LO3L 5F1OB 4X50A 1SXBA 1MJJA 4JFFE 5FA4A 4Z3TA 2G4EA 4LKXA 1L6ZA 5K9JL 4FQIL 3S8FB 4ENEC 5D7JB 4AV0A 2FNWA 1AGFA 5D9SA 1QEXA 3PGCA 1HK6A 1F56A 3MFFB 1I1AA 2D3LA 5IM7A 5ERWB 1JPTH 4ZSOB 4PJIE 5E1AB 3ILQC 4L8CB 3SO5A 3VXNB 4I18A 2MHAB 3IS1X 1IE4A 1F4WH 4JO1L 1BWWA 3E6FA 1RERA 2OLDA 2YPVL 5D1QB 5C0BA 2UXVA 3QEQD 5D2LE 1CCZA 4DZBB 1T04B 5LNDA 4HC1A 4F3FA 4MKMA 4ZJ9A 5EU6D 4KJPC 4OZIF 2Z0UA 1H19A 4L3FA 5HHNA 3RRQA 2BSEA 1J0ZA 2HH0L 5IK3A 4MJIE 1J8HA 1Z9SA 3FO9A 4U3SB 2GPZA 5MI0B 4WFHD 4MMYB 3KCPA 2PCFA 5FHAH 4A39A 1J18A 2B9BA 3WFDL 2WLYA 5FCSH 3N3EA 2CRZA 2WAQA 4RRPG 4U2ZA 5C6PB 5JIPA 1G6RL 2J8UF 2MKWA 2OMZB 4LLAA 5I74B 1OWRM 4GSDL 3L3KA 1UM5H 4XMPL 4OKDA 2WUCL 32C2B 4G1EB 4OJEH 1Y0LB 2CIKB 4GMSH 4IU2A 3IFPA 1S3KL 4B9JA 3RX9A 1GSMA 4NSKB 3DJ9A 5SX4H 4W9FC 2XWZA 3MODH 3VQLA 4PJGF 5I75C 5GGSY 1H3TA 3RDTD 2Q6WB 1ODAA 1M9SA 1SLXA 3EGSB 3IETA 3MLYH 4N2HA 2CKBH 4WJG3 3R0MA 1DP0A 3TVMD 2R23A 3PPSA 2D4FA 4K5NA 3L5HA 3L7EA 2F74A 1FHNA 3ZTNL 1F42A 2A6DB 2IDQA 1J5DA 4QRPB 1NAKH 1YNTA 4XCYB 4NHCL 2WINB 1YUKB 3DVFA 3GXNA 4QAMB 3G6JA 3WHXA 3OJ2C 3D5OF 4JFED 1CFNA 1I7ZA 2R9HD 3KWTA 5E4EC 4GP8B 3CFKA 1L0PA 3S96B 2F9BT 5C7XH 1DJHA 3HR5B 5BRPA 2IMNA 3NIFE 4ODSH 4OSUL 4PV8B 2QHRH 2DLEA 2FECL 3FFCA 1UC6A 4NJAH 4OW6A 5I8KL 3ROLA 3UYPB 4MD4B 3O6FC 2VLJE 2WIIA 1J05B 2AMUA 4H8UA 4I3RH 4LVHB 3WLBB 4AQ1C 3NZHH 5JMRA 2NX5B 2YAPA 2M1KA 5HPMA 3ZYIA 3UL4A 4NKMA 4W9GC 2CGYA 3BDYL 5AB0A 4ODXA 2MCPL 4M43H 1R3LA 3CHPA 7FABL 3MGTB 3VFOB 5IOPB 1E2ZA 3SGKA 4YHPB 3VD3A 4YXHH 3TV3L 4LPCA 2WKOA 4XHJD 3AG2B 1WSST 2E7LC 1EAPB 1QBBA 3R4DA 1DSWA 3FRPG 3UMNA 3CLEH 5H37A 3ZO0A 2ARJQ 5H2BA 3QDGD 4PB0L 4OVVA 1MQKH 2P7TB 3BUTA 1WAAF 3VCLA 4OGYL 1NUFA 4N9OB 3STBA 2PCPB 1NCTA 3QUKA 5I71B 1T0MA 3SCMD 3L2LA 4BXVA 4WI0A 2ZD0A 4PCKA 3S5LB 4OIBA 3EFOA 1S9VA 4U1NB 2BP8B 1OGAA 2FJHA 3VXRD 3QWRD 2C34A 2B4CH 4RFEA 3A6CL 1E4KA 2X6AA 2UWEF 4BA0A 4ADGA 3FKUS 4MDJA 4HIXH 4ZDHA 2XJKA 3JV5A 2DAVA 5BUGA 1CXLA 2X3CA 5LCVA 3LXAA 3EOAA 4UI2A 2O6CA 3RFRA 3ZZQA 3QHTC 4BDVB 3B2UC 2NXZC 1JZEA 5B38A 3J7HA 4FJZA 4L3ED 1KJ3H 4ZAKA 1U8MA 1GGBL 3QNYB 1XZ0B 3PWNB 2GBUA 1XGZA 2YK1L 2BDNL 2Y3NA 3ES6A 2CDGA 1I1YB 1I3RA 4YSCA 2GB2A 4LLWB 3JVFC 4W9LC 5GS0C 3V7AE 2CHZA 2DMGA 3H0TB 1K6QL 1L7TL 4G5ZH 2AK4A 4MDIA 1MCSA 3N40F 4HJGA 4PTUB 4YWGH 2N56A 5D4QA 3HLKA 3WI9A 4KKCC 3A4EA 1PVHA 4GSUA 2HLFC 3SDXE 4LKCA 2YD0A 3PY9A 1K5WA 3MV8B 4HCRL 2YXFA 1E3ZA 1XXFC 5CJQL 4RMSA 3O4LB 5D1XB 3QXAB 5B8CC 4Y2DD 5ID0A 4XPAL 3UIYA 4W81A 2ZUXA 2FECI 3QIBB 4FXKA 1J5CA 3Q6FB 1SFDA 4IHOB 4S1QL 2IPKA 2FH6A 1MDAA 4F7EB 3ATDA 3VDAA 3QUMB 3U0PB 2GUOA 3RWJA 1JPSH 3ZMEA 1ZPLA 1FZJA 5HD8C 3RAJL 1UTDA 3WUWA 4KAQH 5BV7C 5JPMC 3K6FA 1IAOB 2SEBA 5C9KA 1MWAH 4LXFA 1M42A 4K9EC 3RNKB 4YL9A 4JGUA 3PQYA 1KULA 2ITDB 4GFTB 2E0PA 5LGHL 1F02I 5DJ0A 2HTKD 1HXMA 5C3IA 4TNGA 2HKFH 2WO3B 4TQEH 2V9RA 4H0LC 3UZVB 1GOGA 1KCUL 3SE8H 3WEXB 3OC5A 2YKLH 4P4RB 5IB3B 3LNIA 5J11B 2VITB 1D6VL 4XCCL 5DHXB 4LEEA 2CM6A 2C4XA 4H25A 4GUOA 4UNTA 2ZP9A 2VQ4A 1N5AB 1TJIH 3PWLA 1NIAA 1RJZA 1D7FA 4TNWK 4JDEB 5CIPH 4DNLA 2DIAA 4GEIA 4FQJL 4OUUB 1BJMA 1K8DB 1UOKA 1XQ4A 4FYSA 1XIWC 4OZHB 5E6YA 4AGLA 2J55A 3KGSA 3M8OH 3L8QA 5JW5B 5FLVA 2P80D 3EW3B 3EYVB 4IBLT 3PU7A 1MLCA 4YPGA 4JHUA 3V4PB 3HC0B 2DH3A 5FW6A 4POZC 4YHZH 4GRLB 4LL9A 3X1NA 3U82B 3CC1A 1J7VR 2Q86A 3QJXA 4AYFB 4F80A 1IC4L 2FO4A 3C08H 4PGBA 2CHNA 3RJQB 5I5MA 4ZMTA 3DYMA 3UOAB 4HBCH 4XNBA 2B2XL 2IANE 3W82A 1P9MA 1IE5A 3ARDA 1RZGB 3ULVL 3T3ME 3NRFA 2X4UB 3RIAK 3CDFA 1W9XA 4QY8B 3AWGA 5DURB 1K3ZA 3U2JA 2VQUA 4RQQA 2NY3C 3NCWA 3MBEC 3SGDH 3ZE1E 1HE8A 2X09A 3MCLH 4HV8B 2V37A 5D93B 3AG3B 5F3FA 4YFDB 4DP2X 3O4OB 1G7LA 5GRUL 3RUGE 4GQ9H 2IH9A 4JG9A 4PWKA 1A25A 1BZ7B 1ZTXH 3FPYA 5C07D 3H42H 2XFXA 3H9ZA 1B9KA 1T6BX 4A7QA 1Z1WA 3CFQA 1LK2B 2DMBA 4CVXB 5SWQB 3D50A 2WC7A 3ZX1A 2DICA 3KS0J 4J23A 3MUGA 4MVBC 5JIIA 2JIXD 2ZX5A 4RA3A 5TE7H 5T3ZE 2Q5BA 4XP6H 5F3HA 1T2QH 3HW7A 4Y16B 2WWNA 3DRTA 2Z34A 1IGJB 4AVHA 1OK8A 1KYOJ 1UD8A 2KL6A 1AO7D 2I24N 4RGOH 1ILUA 2YWYA 5JDSB 3SJVE 3V6ZA 2B39A 3GRWH 5D6CB 2H47C 1A2YB 1ETZB 4R4BA 3JSSA 2EDWA 4Y5YC 3UAFA 3BAIA 2QQNL 4UBDD 1NOFA 4FQXB 4CBPA 2CR6A 2NUPB 3C6LB 4M03A 2BZDA 4EN3C 4LSQH 1SBBA 1M2OA 3SDAB 1KYOK 5EEWA 2WZPA 1A9BB 2DQ6A 3UTTE 2VDOL 3FBKA 3SPGA 2X7LA 4LSPL 1HZHL 4DGYL 2QFRA 1F0LA 3FB6A 3UG5A 3QXVA 4BUHA 2XC8A 3EYOB 2JKXA 4M6NL 4KTEH 4AYEC 1OPOA 4WGKA 3QNXA 1VFBB 2GK0A 3INUL 1D5BB 2BNRD 2Z9TA 3M45A 3UC2A 5HVHB 1JYVA 4F93B 1HZKA 4NN6B 5GJSL 1OW0C 3DROA 5D1ZB 2Y36L 4V1DD 2CJTA 5J6HA 1A7NH 3H4HA 4KHXH 4S1RH 2I9TB 1E2VA 3K46A 4OV5B 2R1WA 2HJKA 5B8CA 2HKAA 2HZHA 4UV7L 1FE8H 1BXUA 5DTFA 1CE6B 1UM6L 2F54D 2ZCLH 2OL3L 4HIJA 1IZKA 2JB5H 4BSWB 3OPZL 4ORGA 4PRNB 3QI9C 4D0CA 4WI7A 1T3FB 1IAKA 3DUHA 1ZMYA 1BPVA 4XVSH 2VLKD 2Y2WA 3S0PA 4HLZG 2WLIB 3L17A 3IU3A 4JFOB 1VA9A 1OAYL 1TO4A 2YBRA 3FRUA 4YSEA 1KGCE 2AJXH 4RBPK 1JOIA 4NNXA 2P5WA 2W60B 3QFJE 1KNOA 1T5WA 5KYUA 1CG9B 3VQ1C 2F8XC 4UT9H 5DA0B 1IQWL 5TDOA 4AQAA 3HZMB 3ZW3A 4EAEA 2UXGA 1U2YA 1KENL 4ERSL 1MFDL 3TV8A 3GJEA 3EJYD 3PAVA 4PYHA 1DJGA 2AGJL 4LAQL 1M1XA 2PLTA 4OLUL 5I18L 3KDMA 1R33A 4QDGA 5IFAH 5JHDD 1W16A 1OF2B 3VI3A 2XDHA 2AQSA 1M71B 4FNPA 2DQHL 3DV6B 2VDKH 5I1DB 4EI5A 1HXYA 1A6WH 3IE4A 1BXAA 4PM1A 2MTPA 3TO4A 3REWA 2Z3FA 3HZKB 1QRNE 2J5LB 1OP3H 3W9EA 1T66C 3O41A 3IWVA 3PP3H 1AY1L 4OF6A 4DEWA 4ANWA 5FDWA 2X4SB 3GKZA 2YRZA 1HIML 4TNVF 4NC1E 1AGEA 1JWUB 2C3VB 5MP6H 2PWHA 4EZJA 4P5TA 2ID5A 1XH3B 3KPRB 4R26H 3UZQA 4PAZA 2RQ8A 1BQLH 1JGEA 3MRFB 3RL2A 3L3OA 5EIQA 4FFTA 3RWCA 5BZDB 4UU9A 2H1XA 3H3BC 3I9IA 5C09B 5IB4A 1ZHLA 3QUXC 3T08A 5ISZD 2DWEB 5CD3A 5CJXA 5LBSA 4DEPB 3B9KB 3WDIA 3CZJA 2A83B 3VXOA 3K2MC 1DQIA 4IGBC 3ET9F 1YEEH 5T5NF 1U33A 2FBRA 2J72A 2JJSA 5DGQA 1OK0A 3ZZSA 2PCXA 3UPRB 4ZFQA 2W80C 1JF5A 3QWNA 2R59A 4GKSA 2ZOKB 3THMH 3JUYA 1Q9KA 4FLRA 1ZK9A 4KKQA 5KUMA 3LKSA 5CGYC 3OR7A 3WO4C 2XX0A 3NZSA 3GBNL 2D3VA 5I1JL 1MW0A 3HHRB 5EO0A 2OA9A 2X4NA 3QO0B 2EDJA 1A7QH 3BGAA 3E8UH 4OB5H 3GSQA 4UOQA 1KCRH 3DC0A 3JWNC 4PJXE 4IRJB 4X4ME 3CHRA 4BZYA 1JZ4A 3DURA 4XC1H 5FM8A 1A14L 1KDJA 1A7PL 1QI5A 3GWJA 3KYKL 3REVB 1E6JH 5DFAA 3HAEB 1YUHA 4FYTA 4ONHA 1R5WB 5KVGE 4XXCC 2Q87A 1JBJA 3PP4H 4MCNA 2IV8A 4GLRI 5I6XC 2BVYA 3FMGL 3TF4A 5D7IB 4XXWA 4EN3A 4E41A 1P5VA 1CXFA 1DZBA 4FG2A 3DIVA 2QKIC 4FA7B 5IQ9A 2CO3A 2ZICA 4XN7A 2XN9A 2UVEA 4F7PA 2F19L 4N90D 2RMNA 1NBCA 2Q7AA 2BSSB 4PJFB 3PABA 1WCBB 3VFVB 2BZCA 4F7CB 3RFZC 2FJSA 1JXGA 1MJUH 2BSTB 1WA0X 2J4WL 1A4AA 1MRCH 3ETSA 1N6UA 5CXPA 3W37A 4R4FL 3ISYA 4LVEA 5C0BE 3N44F 3BSZH 1FL5A 4NPYB 1H3VA 5DT1L 2AJUH 1A0QL 3OQRA 3N1PC 5I15L 1U8QB 4N5UA 5DJZB 1P4LA 1UACH 5MEND 3GTVA 5JW4M 1BMZA 3O0RL 2AKRB 4LESA 2DYRB 3VA2C 4GAJL 3HUJA 4HK3N 3DX6B 3X1FA 4S0HA 3SE6A 3O81A 1PX4A 3V4VB 3FONA 3LN5B 3EYQC 3K81A 3KXFE 4ZRGA 3O8XC 1BM3L 4MA3B 2E6QA 2KLRA 1BGXH 2YHGA 5LBSL 1L9RA 3BH9B 4IJ3C 1XF2A 4EUPG 1DQLL 3L1EA 3LRHA 3W0WB 2JJTC 3GSRA 1HEHC 1CGUA 5CAYB 2YUXA 3SPVA 4NZ8A 3LMJL 5GGVL 1O6SA 3L5JA 4PVLA 3FSVA 1EEZA 3QEQA 2Z6FA 5IB5A 1OALA 3DXAB 5LXVA 3ETBF 2ZX6A 4UINH 5FM4A 2ADGA 3O4LD 1EJOL 4PJDA 1YYML 5D1XD 5EU6A 4HPYL 3ZRSA 3BZEB 2NLJB 1E5AA 3D4YA 4RDQF 3PWVA 4MQ7A 1DEEA 1UOLA 3OG4B 3LPPA 5JUEL 3BH8B 3LS4H 3QIBD 3QZLA 1RK7A 4U6VH 2BIHA 4B9GA 2GTWA 3FO0L 3G6JE 2VDLH 3ATFA 4JN1H 4YDKH 4PWFA 1HI6B 1QBAA 2PCYA 4R7VA 3GMRB 4W4OA 5EZOH 4U33A 1R46A 4Z78B 5C0FA 1OPGL 4RAUA 2UZYB 4P59L 3FFCE 3MUUA 4IS6B 3VFRA 1NUNB 4DCQB 2HFEA 5CN3A 2BVQB 1ZLSH 4L4JA 1FL6B 2W0LA 3TBCA 2DS4A 3QZOA 5AZUA 4TM9A 1SVZA 5A2FA 4NO2A 5KBLA 2SODB 4ZW6A 4JKPL 3HZVB 3KPLB 2XZAL 3FOMB 1WS7A 3RDTA 5FYJU 3KBEA 5CGTA 2ZOUA 4GBXD 1NBYB 5B4MD 3BO8B 3HAEG 4MX7B 4MASA 5AW0B 1WT5A 3TVMA 2D73A 1BVLA 3C60D 4DGVH 2I07A 4I9WD 5BUAA 3ARGD 1FL3A 3P69A 4ZOCA 2W95A 3R0NA 5I8OL 3GHBH 2GJ6D 2GAZA 3QPQD 1EFQA 4JFEA 3LSOA 2L04A 2O5NA 1HYRC 1H8NA 2AK1L 4OT1L 2Y7MA 3RWFB 1UJ3A 4J27A 2Z8SA 2GVYA 2NY6C 3SE4A 5JYLA 2OZNA 4NC0B 3U4BL 4XMKL 5EF3A 4LU5H 2AEPL 4P5SA 2VDQB 4OFYD 3AREB 4AXWB 1CDGA 1OGAE 3E2HB 3IJ9A 1JGDB 4W9KC 4BKLA 5CILL 2J57A 4U6XB 4UM8B 4WTWA 2VWEE 1IIKA 1EUTA 2X53A 3QFDB 1MHPL 3OBAA 3TP4A 2BXYA 3D48R 1KJ2B 2EECA 3F04A 2F61A 5K59E 4TSCH 3H3PH 4ACPA 5E8PA 1NINA 1DO5A 4S2SB 4K55A 1YNKH 2AV7B 4H0HB 1J1OL 2AHIA 4F8OA 2HRGA 3G5XA 5KUKA 4KK5D 4J3UA 5DURD 4FA8A 5DMJB 2OTWB 5GGQH 2VDNH 4NO0B 3AS0A 1MN4A 4Q2ZA 2OZ4A 1LK3H 4PJHF 3ARFD 1MFBL 1HAUA 1MI5D 3QDGA 1RMFL 3HPJB 3RVWC 2Z1PA 1PEZA 3S36H 5F9JA 3SCMA 5F7YC 4R7LA 3EDEA 3ILEA 3GLEA 2AK4E 3LNFA 2WK2A 4KI5C 3WFCH 2XX1A 2H26B 3P73A 4TNVK 2AC0A 1P7BA 2LU5A 3VXRA 4F7TB 5DEFA 3QWRA 4Q9RH 5GHWL 1QHQA 1NWOA 4PW9A 2X40A 2RB8A 1JPTL 3EF4A 4KXCA 5I6LA 3ULVE 2LLLA 5TF0A 4AIZA 2P3YA 3A67H 2QKIA 3APNA 4ZUTA 1ORSB 4Y16D 3PUUA 4OY9A 3HG0A 2H2SD 4UBDC 1F4WL 4HIPA 2Z4QB 3BP7A 3V4UH 4QHLB 4NQQA 2WNXA 3Q2WA 4JRLA 4Y4FD 4FNRA 2FUTA 2R7EA 4L3EA 2W59A 4LP5A 4P05A 4RFOH 2DWYA 3JWDC 4NFDA 5FWRA 3ZKMC 1ET7A 5CBAB 1QWNA 3DHJA 4FQXD 1MOEA 4U1HA 4QAWA 3TEYA 3SQRA 5DRXA 1CDHA 2WBJD 3NPZB 5FHAL 4FG6C 4WU5A 5L7XH 3VVVA 2VLMD 5HGAB 4YEFA 5ICYA 4BFJA 5HHPB 1O6TA 1ZTMA 2I25N 3H7LA 1UM5L 4HGKC 4HZLA 4NZDA 2VSMB 4I1RA 3MRDA 4ZOBA 4N1CA 2BLFA 1G7MA 3FQTB 4GMSL 1LP9A 1MY7A 4L18A 1EO8H 2L7QA 2MNJB 3MODL 4AYGA 2PTTB 1ICTA 4WW1B 3TBWB 1XH0A 2JJTA 4Y2DA 5KYXA 4YZWA 2V2TA 1QZNA 3GTNA 1N70A 2RA1A 3CTTA 4WVRA 2GFBA 3MLYL 2CKBL 2IIJA 3L1GA 4YHNB 5D1ZD 1GYAA 5IJKC 1OB1B 3HRZA 2ZXAA 5BW7C 4JFUA 4Y5VC 1LO5A 2X38A 1NAKL 3IKKA 2AQ1A 2G9KA 5HGBB 3P3SA 5DJXB 3ELAT 4PTTB 1CXEA 2W65A 4WFED 2CUAA 4MZ3A 4PGCA 5MEOB 5DXWA 5DQJA 5IBUB 2VXUH 5D7JC 4A2HA 1WZ1H 3IYLW 5C7XL 2VR7A 3VD0A 4HJIA 2HVBA 4ODSL 5F97E 2QHRL 1ZGLA 2WLNA 4NJAL 3NBNA 1F1AA 3PWUB 4FTVD 1MW1A 3NCFB 1AZBA 1HDMB 2WJ5A 4I3RL 4RAHA 3ZR5A 5KS9F 1SRDA 3NZHL 4PJGB 5E2TH 2EUWA 2AQPA 2VW7A 4NJ9H 2WPGA 2DQIH 4PJ5B 2Z31D 4JO5A 1ED3B 2QR0A 3O2WH 1U93B 2O5YH 5K39B 4L0ZA 1Z6JT 5D1QC 3X1BA 3MJ8A 4M43L 4GP5B 4JFPA 1RUAH 4EMZA 1XGPB 3S5ZA 3IAQA 3QEUB 3H8NA 2E6JA 2JKSA 3TJEH 2I9LB 2XWJA 4YXHL 2CALA 1PAZA 4YFLF 1EK3A 3IN2A 4F37F 3JTSA 5F9OH 3WMSA 3QS2A 3WDJA 2Y23A 4QNPF 2WYIA 3CLEL 5C0DA 4EUPH 5KYNA 1YEJH 4D94A 3BKJH 1MQKL 3OMAB 1H6TA 2YZ8A 3ME0B 2P80A 1IGIH 3SPJA 4APQD 3IVKB 1SHMA 3HE6B 4YFLI 3EDDA 5I74C 4JVUA 3CMGA 4ZOAA 1UURA 35C8H 4KZCA 4FNTA 5F3BA 2AZUA 2B4CL 3QEHA 5IMLB 1RVFH 4HIQA 4AIEA 3QRFM 5FYJD 3M1BA 4HIXL 2XZZA 4M02A 1T83A 1IX2A 3T0EC 3D05A 4AYSA 1V7NH 1F11A 1O75A 4LCUB 3KJ4C 1L7IH 4AKQA 2CIIB 4JY6B 4LARH 2V33A 3KPRD 5GS3A 2YD6A 3GI8H 2Y5EA 4X6BA 5ECJE 3WBDA 1KJ3L 2HUEA 4HSAC 4KXBA 1VEOA 3PE9A 4WFFE 4E2OA 2W07A 1WUZA 3F83A 3FT2A 3MKGA 4L8BA 5SX4I 1ZLVH 4NZUH 1IFHH 3BP4A 2CCVA 3O45A 5C07A 4AOFA 1XCQA 4DQOH 2H9GB 5AAWA 3IGLA 4I13B 1XGRB 3NA9H 3B9KD 4G5ZL 1A6AA 1REIA 3T4AC 4YWGL 2JIXA 3DO7B 1S7SA 5E7BA 4XGZA 2VIRA 4ZX4A 1P7HL 1H15B 4MA1B 1Q1JH 1AD9A 4Q58C 4G59C 2YJLA 4ENZA 4I0PB 4MCYB 5KVGL 1AO7A 1AR1D 1IBHA 5D5MF 3RY6A 3CBKB 3N55A 3F12B 1GS7A 1ZCRA 3CFJB 4N1EA 1PG7X 4LLVA 5BQDA 4U1MA 1AGDA 5CUSL 2C9VA 5ABDE 3L5IA 4ZODA 4F58H 2VRAA 2CLVB 1JPSL 1TVHA 3DOHA 4MNQB 4PJIF 2HA1A 5AOIA 3U9WA 3WGVB 3U9UA 1NANI 4KAQL 5I71C 1R4XA 3QQXA 4PY8I 1MWAL 4XTRD 4LO9A 2CO6A 3G5WA 4XNQA 5ACZB 3Q9PA 5D2LF 1LJMA 3X3FH 4FI8A 5TDNA 1A6PA 4S0SD 4KZ0A 1KLFB 1NUGA 5L8JB 3UPCA 2DWDB 2BNRA 3T1WA 2HKFL 1WFOA 3QQ9D 2A9NH 4B6ZA 4KROB 4TQEL 5HY9B 3SE8L 4PJEB 2YKLL 2NYZA 4U1GB 4V1DA 3FQWA 1LE9B 4M8UA 2XPZA 3D0LA 2R4SH 1FLRH 2VAAB 1LEGA 3SKNA 3UYRH 4HAKA 4EIUA 1BLNB 1JZFA 3GGWB 3FQRA 1TJIL 1M1SA 3ULUD 1HH6B 4HS6B 5AKVA 4LNVA 5ESAA 2HRLA 2F54A 5AQ0A 1RZ8B 2DKUA 2KMWA 3ZUNC 1T1ZA 1WO2A 2YGNA 3NJIA 2P48B 2NXYD 4A7TA 3M8OL 3V5HA 5C9JB 3ZRCC 3VI3E 3ZR6A 5KN5B 4WTZG 3K6SA 2XVGA 2Z7UA 2YJQA 3HG3A 3BXNA 4O2EA 4I88A 3ZIMA 2VLKA 3L3DB 3QWOB 2VL5A 3LPWA 4YHZL 2LU7A 5EU4A 2N01B 3FRPA 3M86A 2BINA 1PSKH 3C08L 3LIZH 2BHYA 4HFWB 3AACA 3BRGC 4IRZH 4HBCL 4ZO6A 1ZV9A 5I5IA 3ZVVA 1PY0A 1HYSC 1P7KB 1UXSA 3ZDYB 1CK0L 2GJZB 4G2AA 4ZFZB 5E1AA 2HKHH 4L8CA 5JXEC 4U2YA 3VXNA 4BZ2A 1VZGA 5GS0H 4XOAA 2YEZB 4KNTA 3MO1B 1KTRL 4Y4KB 3CCHA 1T04A 2UX6A 2XTJB 3DXAD 1JMZA 3LKPA 4FXLA 5DC9B 4DKAA 1R3HB 1RUMH 1TEYA 3MCLL 1TTUA 5CHNB 3T8MA 5KBMA 4ZG1A 1V3MA 5GXBB 3TURA 3KWXA 1AC0A 1D5XB 4GQ9L 3OJDB 4NO3A 4PJBF 5JHDA 1ZTXL 4U3SA 4NKOB 2P24A 4AQ8A 1UB6A 3D1MC 4PGEB 3OWEA 4MMYA 4KJQD 4Z3HA 4BSJA 2NDGA 2JJUA 4M6OH 5TE7L 4XP6L 3DTXB 4G70B 1T2QL 4MCMA 1HZLA 1EANA 1G0XA 3BGMB 4HX1B 3RNQB 2GBAA 4G1EA 32C2A 3P40A 4RGOL 2CIKA 4OZFB 1TZGH 3GBDA 5J11C 1FHGA 2I60H 4KOCA 4NSKA 1BAWA 2D9QB 4ONOA 5BV7H 3GRWL 3FU7B 4MNHA 3RVVD 3IPBA 2O1AA 3RJDA 3EGSA 4JDZA 5L4FA 2ZXCA 4W93A 2VSCA 3N1GC 5DQDH 1GL4B 5ISZA 4LSQL 4FXGA 2VC2B 1T0PB 4A2EA 4ODTH 4XCYA 2WINA 4BV1A 2AANA 3TH4T 4GRLC 4X6EA 3WTXA 3BD4A 2OYMA 3X14B 1SMAA 4JPWH 4KTEL 3S96A 2AS5M 2AAVA 3FUDA 3MLUH 1ZA3B 4QHUB 2XN9E 4PV8A 2XHNA 3W2DH 4WGWB 3ZMNA 4MD4A 3ARED 3EGXA 1FNSH 3OR6B 2BIQA 3WLBA 3ZE0B 2C9PA 2ZONA 3K1KC 2TSAA 3JT2A 3AW5A 4WTXA 4W9IC 2CJSA 1A7NL 4KHXL 4S1RL 2C1PA 1I7RA 4XBMA 1K72A 2BIPA 1NGXB 2PXYB 3FF7A 3FNKA 2APTA 3MGTA 5TDPA 1MCRA 3VFOA 5IOPA 4I2XA 1FE8L 4FG0A 2ZCLL 1UUSA 3O4OC 4DGWC 2J2ZB 2JB5L 3KJ6H 1I1FB 1S9YB 1ADWA 4OJDH 3D0AA 4CW1A 4PLOB 1OP9A 2WZAA 4O02H 3B8YA 4OM1H 4Y2OB 3X13A 1IM3D 4XVSL 4HQQH 3LXUX 5DZ9A 1DBMH 4K4KA 4LMQI 1DUYB 2L4OA 2PCPA 2JKTM 4EDXA 3HB3D 3MUHL 3E38A 4A6YH 2AJXL 3GMQB 2WKLA 4U1NA 2BP8A 4AE1A 1ZPUA 4XMVA 1E3XA 4Y5XB 2Z4TA 3RKPA 2Z64C 3EYUH 4KDTC 4NRYA 2G5RA 4UT9L 4IU3B 2IPTH 5EU6E 4NPJA 5E8NB 5AVZB 1HX0A 1Y18B 1LEIA 3WNPA 4TRPH 1UATA 5JLZA 3C6LC 4R5TA 5IVXB 5MENA 1TCMA 4PV9A 4AGOA 3SDAC 4BDVA 2EXSA 4YAQA 2W0FB 4OIFA 4GW5A 3FW6A 1CQKA 1YPZB 5D8JH 5IFAL 3MBWB 2OYPA 2QKSA 4YQXH 4PCYA 1XZ0A 1G9EA 5LXGH 4QRRE 1HAWA 3PWNA 2N7SA 4WI3A 2VDKL 2D3NA 1W6LA 1I1YA 4LLWA 1A6WL 1KTLA 4B9IA 5T1MA 1BQ5A 4UM9B 4OCMC 3LS5H 4JPIB 3EGDA 3GZPA 4PTUA 4G72B 5C0NC 1SDAB 2N0MA 4PS7A 3RYMA 5IB1B 4NN6C 3BSZA 3VXUB 3BKYH 5FYLH 2AJSH 3VM7A 3LRMA 4BE5A 3WDHA 1X9LA 4L2LA 4L37B 5MP6L 5A2JH 4R26L 3I9AA 5D7SH 1BQLL 3O4LA 5D1XA 5BJTA 4X6CE 2XICA 3SDDD 3IJEB 3QIBA 4XHQA 5IJVB 2BHZA 3IDXH 3Q6FA 4IHOA 1UZ8A 1BDYA 1Q9LB 4JFEE 5K9QI 4F7EA 1WV7T 1WZKA 4KXDA 4IBQA 2G60H 3CJJA 2WQ8A 4LVOB 3DTUB 4H8WC 2Z92B 2XQBH 2UVFA 3H55A 3KR3H 4JJ5A 2E9BA 2DD8H 2R2EB 2E7BA 5CBEB 4K3HA 1A3ZA 2OMYB 3ZTCC 1SOKA 1LO4H 4G9DB 2FATH 2B8OT 3D9AH 2ITDA 1TR7A 1A7QL 2XLLA 4L2YA 4K7PX 1VERA 3E8UL 1IAMA 4OB5L 4PJ5D 1JZDC 2X4PA 1KCRL 4GG6E 1C12B 1T21B 3UZVA 4GBXA 4CC4A 3WEXA 5LGJB 4XC1L 5IB3A 1IB5A 3C60A 2VITA 4U1JA 2R83A 3ARGA 3DOSB 4Y8DC 1J9RA 5EULV 5J12C 4D3CH 5E6ZA 1E6JL 3P4MB 3QG6B 5GGUB 1JXJA 3TZVB 1N5AA 3U4KA 1I8KB 3ILDA 2GJ6A 2EEDA 4AIXA 4JDEA 4MXQC 1MNUH 1E67A 3PP4L 4FFYH 4L1TA 4Q4IA 3T4YB 3E80A 4OUUA 5T1KD 2NTFA 1MRFH 4OZHA 4ZS6D 5JW5A 5HI3D 3VWJC 3EYVA 2YQBA 3BEVB 2J5LC 1BIHA 3EO0A 3HE6D 4MMXB 4OFYA 4OZGB 1S9KC 3VXRE 1YA5A 2ZSWA 3PHSA 5DZOA 2VRQA 1SJHA 3S7GA 4AYFA 2BP5M 1MJUL 1MRCL 2ZUUA 2EXYC 2XSKA 3GLZA 3RWEB 4PRAB 4RFNC 3F7VB 5DFTA 4J2XA 4X7DC 1RURH 1PZAA 3BSZL 1G7PB 4WHYG 2AJUL 3ZJAA 4QT5A 1BZ8A 4EVNB 1ACYH 2JCWA 3OZ9H 3CFDB 4L3EE 1UACL 1VZHA 3BZFA 4QHNB 3SBWC 3VXSB 3KGUA 1C9SA 4Z1PA 2NUTB 4KQ0A 1UVQA 3N43B 4TPRH 3QQDA 3ARFA 1MI5A 4JE4B 3A24A 3TNMB 2PPFA 1MRDH 4F2MB 1C08A 3CFCH 1E40A 4L1DA 3PDDA 4ZMOA 4GPVA 5FCUL 4AVIA 1BGXL 4MHHG 3RZCD 1MNNA 4LE8A 1LK2A 2X9YA 4AV5A 4CVXA 3WHE0 3ML8A 4M7LH 1LP9E 1G4MA 4NQSB 1M3IA 3L5WA 3N44B 4Y16A 3MXWH 4KK6D 1T20A 1IGJA 5C0IB 1MCHA 3MLSH 4IRJC 3VMOA 3NIDF 4I0PD 1ZV2A 3P0VH 2EEFA 3B2VH 5I0YA 5JYMA 1IBZA 4UINL 5IROC 5CCGE 1TZAA 1OZTG 4Y4FA 2OMTA 2XQYG 3CVHH 5F6HJ 5AVWB 5D6CA 4D9LH 4LCWB 3DGDA 4OCXH 1ETZA 3LS4L 4OGAD 4U6VL 2BP3A 2NT1A 4DK6A 4R7XA 3QIUB 4AQZA 4UIKH 4FQXA 3WKYA 3EHBB 3AU0A 3FQ4A 2VDLL 4JN1L 2WBJA 4YDKL 4O2FB 4PI2A 4IQHA 5EZOL 2RAMA 1MFEH 4MNQD 2ZIDA 3SDAA 2FR4B 1A9BA 3D18A 1KB5B 1KXQA 5IWLA 3JWNH 3RIKA 7PAZA 5CZVH 2WLJA 3EDJA 2EVGA 5HDBE 4FKEA 1LE5A 1CD1B 4K7PY 4A7SA 3TEXA 1ZLSL 4WU7B 4BFGA 4Z7NE 1NFDB 1Q72H 2TAAA 3F7KA 1FAIH 4JZNB 1VFBA 2BC4B 3S34H 1USQA 2H3XC 4ONFH 1CDJA 3VFNA 1RZJC 4N0CD 4I4WB 25C8H 3WL9B 5C71A 1D5BA 1X5MA 1G0YR 4LEOB 3NJNA 3P4LA 5KSVB 3FN9A 5D1ZA 4XZUB 4ELMB 4JFQB 1E8XA 2C9UA 4DGVL 3VI4B 4KUCF 1E27A 1R24B 4LNRB 1NZRA 3L2NA 3QJOA 4OV5A 3EJUA 3GHBL 4JFDE 2FYYA 2X3BA 1P7QB 2UY7A 1ULVA 1RHHB 3Q7JA 3HZ3A 3FU9A 1CE6A 3BP6A 1YY9D 1MCLA 5FX3A 3TCTA 4PRNA 3AM8A 1T3FA 1DUZA 4FTVA 4JE0A 4LU5L 3BPOB 3JV0A 1X5JA 3MUY1 4LIQH 5INCB 3TCLB 3QZPA 5EG6C 3AB0C 3P9LA 3UBXG 2Z31A 4N20A 1SYSB 3U4AA 3SQBB 4H20H 1A4JB 3P4OB 4TSCL 3H3PL 1E9QB 3GJFK 1BBJA 3AY2A 1OL0A 1EMTH 2HMID 1QYGH 3AUVA 2W60A 4DUVA 5J3HC 1AQDA 1CG9A 1YNKL 1LQSR 2G30A 1F3DJ 2GY5A 5HI4C 4P2QD 1SMOA 4HLJA 3A4DA 1U3HC 1FFNA 5FHBH 3P2BA 5GGQL 1GHFH 3VE0A 2VDNL 1CXIA 1KCBA 3ARVA 5IW3A 1LK3L 2XTJD 5F7NC 4JFWA 1SXCA 2GJRA 5E0QA 5HHMB 3DX8B 5C07E 2V2XA 4APQA 3S36L 2XV0A 1G7JB 3Q2NA 1Q9WB 3T04D 3HKFA 3WFCL 5EBGA 6PAZA 5E9NA 5FO2A 4KTGA 5I1DA 1NBVH 2QMKA 4L8SA 2DRUA 4Q9RL 1R3KB 4IBSA 1N19A 4OLVH 3HZKA 4HUUA 4G8GE 3A67L 3S37H 1IAIM 3C5JA 2YAFA 5EUOA 4W6YB 4HH8A 4QRQB 4G42B 3RWIA 5EHFA 1F4XH 4UUJB 4EUPA 4JHWH 3BC9A 3V4UL 4FLSA 1JWUA 3CIQA 5FPIA 4TQPA 2JWYA 1ZTXE 3KPRA 3NMEA 1CFTB 4BK5C 5I16B 4R5VA 4M5SA 2QGEA 3MRFA 7PCYA 4RFOL 4KVNH 1KYDA 5BZDA 1AIFB 4WRLA 2JCCA 5A6IA 1E5UI 3LV3B 4H0IA 2Z8WC 5F7DB 2FX7H 5FXCH 5L7XL 1NEUA 2Y4SA 2DWEA 4G8EB 4TYUA 4AH2B 4JL1A 3B9KA 2A83A 3E2HC 3MI6A 3GDBA 2PTUA 4AY0A 3JV4B 3KPMB 5C0CB 3G7TA 4XH2A 3C5SB 4CU7A 2QQQA 1QW9A 3E3QC 5AG8A 2BNRE 1EO8L 2RFXB 1WFUA 3MRNB 1JF6A 3B5GA 4X8XA 4L9LB 5ICXA 4ETQB 5DHYA 5C0AD 4LOFA 3TGXA 4PG9B 1PZSA 1T6WA 2WBXA 4TNEA 4V1DE 3K8LA 2EP6A 3FB7B 2VXQH 3K80A 2H32B 3BVNB 3KW7A 4H1LB 5B7FA 4OR1A 2Y3AA 3PL6B 3ZY7A 5C1MB 4OJAA 3LJ3A 4PRPB 2XIDA 1QQDA 3ECBB 1B0RA 2DL9A 2F54E 2WY3B 3DI2B 1TTGA 1YMME 1TENA 3HS9A 2XA8H 3REVA 3V95A 3CFUA 5I8EB 5G4OA 3HAEA 4KPHH 2VXUL 1WZ1L 5H94A 2VLKE 1OP3K 2ORBH 1I3GH 1CT8B 2CMRH 3O0LA 3GZQA 2DWTA 3PP3K 1NIDA 1TU2B 5D7IA 2APFA 3TLRA 4QGYA 4WHYH 5E2TL 3JVGC 1PGRB 5LBVA 4H8QA 2H41A 4NJ9L 2X9ZA 2PUQT 2DQIL 1XD0A 2R51A 4MAUH 1E7VA 1YNTF 4UIMA 3SYQA 4C57C 2H3NB 1CLOH 3O2WL 3US9A 2O5YL 3TPUB 5JZ7C 4CSTA 4JCLA 3WN5A 2HWZH 4PJFA 2BSSA 4Z76B 1V3KA 2DTSA 3VFVA 3DWTA 4GQZA 1R9FA 4WSKA 1OO2A 2BSTA 4QRSB 2VLRB 3TJEL 1TJGH 4U3XA 3MOQA 1OGPA 1FBIH 2Y06H 2ISDA 4PG2C 4C56E 5F9OL 4ZYKB 1H9DA 4BRJA 4MBOA 1ZANH 4NPYA 2VE6B 3QAZB 4WUUB 5CGBA 2YR3A 3GDCA 1YEJL 4HGWB 5KSBB 1U8QA 5DJZA 1A7BA 3BKJL 3P30H 5JHDE 1OAKH 2P28B 3DI3B 4NM4H 2ZSVB 2AKRA 1IGIL 2NY5C 2EUVA 2BVOB 5L2JA 1T5XA 2Y72A 3DX6A 2G75A 4KX8A 4PJCF 1YN7B 1BEXA 4IIZA 3VD1A 3GMNB 35C8L 2LQRA 1R19A 1F97A 1N8OE 1D5MB 3QE5A 2WKOF 5DK0B 2WXNA 1OVZA 1U8HB 2FSEB 2FIKA 1BF8A 1RVFL 3Q8AA 1PYWB 4G11A 4OIAA 4HCGA 3QG7H 4L4VE 3AFLA 2CDEB 3H85A 3VXUD 3U46A 3CBJB 1V7NL 2AXWA 3RIFK 2KYIA 1X4XA 3RX7A 4WKZA 1L7IL 1H9VA 4LARL 2K4WA 3GI8L 3DXAA 2E4TA 2FJFA 4PP1D 4GQRA 2Y25A 4L3CB 4JFVA 3BZEA 3DRQA 2NLJA 4XWOD 3VFPB 5ISZE 4M56A 3R8BB 1CD0A 1ZSHA 5EBLB 4NZUL 1SXZA 3BH8A 1IFHL 3I6KA 1Q1PA 3IDUA 1CIDA 1ZS8B 4DQOL 2ICWA 3LIZA 2J7LA 3NA9L 1HI6A 3WFBH 3HG1E 1QHOA 4Z78A 1CTOA 1RPQA 4XN4A 1F13A 3UX9B 1CPUA 2UZYA 1OP5H 4YEEA 2FT8A 1Q1JL 3K4DA 5J8OA 2BVQA 1NUDA 3IU4H 4GRWE 2B16A 5FF6A 2G5UA 4Y0GA 3II3A 3GMPA 4WAFA 1DJSA 1QTPA 2CQVA 1WHOA 3KPLA 1XB6A 1M56B 4N0UB 5D2NA 5CSBA 3W11D 1MREH 1NBYA 1YHPA 2PP7A 4I2XE 4R7NA 4MX7A 3RWHA 4LZKA 4F58L 2IQ9H 3B9EA 4HG4J 1R6VA 4HOMA 1IVLA 2FH8A 2QZ5A 1XR9B 5ITFB 1VKXA 3POHA 1M6UA 4AIOA 3IPFA 5LB1A 1OIOA 2JK5B 4MD0B 3S3BB 1FYTD 1BFTA 1GGUA 3X3FL 3RWFA 5EO9B 2NCMA 3TA3B 2GSMB 2QVTA 4QOKB 2R56L 2A4ZA 2C1OB 3MV9B 2ZUSA 4N90E 5EDXA 1JZ6A 3AREA 4AXWA 4JFFB 2A9NL 2R8SH 1JGDA 1NBZA 2DKSA 1KCVH 3QULA 4U6XA 5DFVD 5FM5O 5KEZA 1DQJB 3QFDA 4N9GB 2KZ1B 2FZ3B 3K5RA 2VH5H 2IEPA 3NP4A 2R4SL 1FLRL 5HTSA 4Z7VA 3LNHA 1AD0B 3UYRL 1CUOA 1J8KA 2UUDH 4KC3B 4NN7B 4S2SA 4PJIB 4PLJC 1S4IA 5MENE 3ECQA 2L3BA 3QIWD 4J3OG 4P23B 5I1IH 3T0BA 5D2LB 2OTWA 1DQMH 3II2A 2YZ1A 1IM3A 1NBQA 3IM1A 4LF3B 2QV2A 3GSNH 3HPJA 2NY4D 2GSIB 3Q48A 2E7DA 3FYIB 4UQCA 4MJIB 7TAAA 3MJ6A 2FQDA 3FCSB 4UDTB 4FFZH 2IH1A 1PSKL 1DANT 3LIZL 2IMMA 2NZ9C 3GXTA 3WJJA 4IRZL 1NCIA 2XG4A 2AXFA 1SM3H 1HESA 2IH8A 2Z91A 3OKLB 4AC2A 2HKHL 3KWWA 4JANA 4Z7UE 4WI8A 1GS6X 1D7DA 3BWSA 5DJ6B 3EH5B 5J13B 5IW6B 5GS0L 2F7PA 4TQIA 2X0WA 1AHWB 5E7FA 1T0NA 1JD9A 4QHLA 4FLQA 5BZWA 3WXVH 4KKAC 1Y1UA 1A66A 4TLKA 1RPUA 5E9DD 1ZWIA 1BG1A 4D8PB 4XN5A 1WG3A 3QIUD 2JKNA 4N85A 3G04A 1EXUB 3QS3A 4Z3JA 3OAWA 1NH6A 5HGAA 3GQFA 1O5PA 4M6OL 3DPBB 5HHPA 1CI5A 1WWBX 3NFNB 4KROC 4M9PA 1KJMA 4XBGB 5LGKA 4RMWA 1LEKB 3BAXA 4MS8C 3IDMB 1P84J 4U1GC 1TZGL 3NIFB 4JG1H 2I60L 4ZMVA 1QATA 2ZXQA 4JW3A 1S7QB 2VLJB 5BV7L 2P5PA 3AQXA 2Z93B 2FLBT 5FECA 3STLB 5E5MB 4N5ED 3TBWA 3SDDA 1IARB 4UQ3B 4DP0X 4YHNA 3D08A 1BX2B 3BH4A 1PCXA 5DQDL 2OMVB 3CLWA 1ZVSB 2GJ6E 1ML0A 4OZ4A 5E6IB 1EHXA 1OY3B 4ODTL 5HGBA 4F33B 2Y1ZA 1ZLWH 5JO5B 4WUKH 1ZV5A 4R0LC 4OLXH 1L5GB 4WTQA 4JPWL 1MPAH 1TTBA 2VZ3A 3MLUL 1WP6A 1MG2C 3EXJA 3BWZA 3W2DL 1HNFA 4IKIA 2ZKXA 3B6SB 5I0DA 3PWUA 1HDMA 3Q5YA 1FNSL 3K6IA 4NKDA 4X4KA 4HK0B 3W81A 2QFPA 2A38A 3KH3A 3PPEA 5EBMA 4WW2A 1MCQA 3WXWH 4FLHA 3X2QB 4PJ5A 1ED3A 4FQLH 3DJSA 2Q7YA 3SE3A 1KDIA 1DVQA 3HIZA 1G7QB 4CU6A 4Y4KC 3ZLQC 1MFAH 5CEXB 3CN2A 5EN2B 4KRPB 4U6HB 1S7UB 1ZA6B 4Y7MA 2I9LA 4DGIH 3KJ6L 4WWOA 3HG2A 2ZAHA 4AYDC 3X3GH 1MI5E 1EZSA 3G6AA 1JZGA 3H4FA 4OM1L 1RZIA 2VDMB 5T1KA 4OCNC 4HQQL 3LZQA 3FUKA 2XIBA 4JQVC 4LDLB 4NN5C 3ME0A 1DBML 3MJ7B 1KCKA 4AZ8B 3MAWA 3FQYA 3HE6A 3B2DC 3NP3A 1OKEA 2X2HA 4PMEA 4A6YL 1OHQA 1OAUH 5TTRA 2BO0A 3H9SD 4WTZA 5L0QB 3QUMH 5EFIB 5BUPA 1TQWA 5F7AA 1LQBC 1XGQB 3V2AR 3ML9A 4P2RD 1BD2D 1DN2A 3MJ9H 5EEZA 3EYUL 4RNRB 3FTSA 3HNVH 4WI2A 1BG9A 3VH8B 2IPTL 4DESA 4YLBA 4FFYA 3SDXB 3A22A 5IMOA 4TRPL 4A7VA 4G8IB 4LCUA 5DJCA 1TKWB 2CIIA 4JY6A 2CLZB 3U6XS 4H5SA 5CN1A 5D8JL 4LLYB 3B2XA 4YQXL 5LXGL 5DVKA 1HOCA 2VLME 4XAKE 5GZND 4AGMA 3S3CB 4FZ8H 1KXQE 1PPIA 3RZCA 5AENA 3RHWF 2H9GA 1U95B 4KI1A 2EIJB 2X0UA 2WB7A 1XGRA 3LS5L 3PV6A 4NXSA 1N4XH 5TK2A 4Z3FA 1QFPA 3DO7A 3UJIH 5AKTA 5C0CD 1JN6B 2DPKA 3BKYL 1PEWA 1TZIB 5FYLL 2AJSL 5AALA 1UASA 2R0ZH 4Q0XH 3ZBMA 2NT0A 1HSBB 1Y7VA 2FIRT 2WGXA 3FTVA 4I0PA 4MCYA 4XO3A 3ULSB 3VI3F 1CBVH 2AAAA 5D7SL 3RI5K 4ZFOA 4RGNC 2JB6B 2PXYC 3CFJA 4BZ1H 1K5NA 1XX9C 5DDHB 3V9EA 4F7MB 2H8PB 1NMBH 1H3XA 2IGLA 3Q6GH 1YYLH 3WMQA 3IDXL 4AK1A 3CSTA 1DDTA 4PRPD 4A2GA 1OANA 1L9TA 2EYTA 3QDJD 4UYPA 5EBWB 3HR6A 2G60L 4S1SH 2CLVA 1OCZB 2YBGA 4MNQA 1NLBH 2XQBL 3KR3L 2FSDA 1PKOA 2AJVH 2DD8L 4XMLH 4FTVE 5E94B 3D2UD 2ZYRA 3FT0A 3OKMB 2EDLA 2VJ8A 3ZDXE 1LO4L 1FVDB 3SKJH 2FATL 3D9AL 3MRRB 5BOJA 2J73A 3CVHA 4QXWA 3EG9B 1MHCA 3SPCA 3WHE1 5IQOA 2ATKA 5HY9A 1JK9B 5GRWA 1PCSA 1KJVB 1QABA 2MKLC 4HWEH 4PJEA 3UH8A 1NFKA 2ZAGA 3IMBA 2XV6B 5ETUB 2YUWA 1LE9A 3DSNA 4MA8H 4D3CL 2IANB 4DHLA 3GGWA 4PJ8B 1OTUD 2ENJA 1R34A 3T3MB 3AADB 1MNUL 1SF5A 4FFYL 4W9JC 5E6UB 4WUUD 3UTPD 5EWIH 4Q8BA 1YEKH 3P0GB 1MRFL 3BN9C 4J8QA 1Y1DA 1WK0A 3ZE1B 4WF7A 4N1HB 4C4KO 4POYA 4EQ3A 4J3OD 3V7AG 3RUGB 3BCDA 3L1OH 1Z0MA 5FA3A 2GBTA 1TO5A 2ZQKA 3VH8G 2MFNA 1UXMA 5EUOE 4HFWA 2HTLD 5IBLC 2AJ3B 1RUQH 3AQYA 2PABA 1I3VA 3PWJA 3P2DA 1S7WB 3BFOA 4JDVA 2K3TA 1HC1A 1OWWA 1ZT7B 1RURL 2GJZA 4ZX3A 4ZFZA 3WLWD 1NGQH 2XCMC 4O2CA 4P2QA 1ACYL 1WPCA 2EAEA 3OZ9L 1M7DA 2ERJB 4E0RA 3RGVB 2XTLA 5F7UA 3Q1EA 3MO1A 4ZFOL 2JCCE 1WWCA 1X4YA 2EDYA 4TPRL 3SJVB 2NY2C 1KB3A 1QA9B 1R3HA 3QA3B 4LVOC 4WGVB 1MRDL 3CFCL 4F8PA 4NO5B 5SWSE 2R4RH 3NJXA 1H6UA 4I77H 5EU5A 2A74C 4XOEA 4JQVA 4PSRA 4C83B 4M7LL 3FSZA 3GSVB 1FGVL 1ZHBB 3FO2A 3VFUB 4N2IA 1KPRB 3DTXA 4N3TA 3P2TA 3EJRA 5GQBA 3MXWL 2WAHA 3BSHA 3HUJF 1NFAA 2J6EH 1LNUB 3BGMA 4HX1A 2CA4A 3MLSL 3RNQA 3Q2VA 5AOKA 5AW3B 2VQ1B 3P0VL 3V0HA 2HN7B 3B2VL 4YO0A 3ZKNC 5C0JB 2ADJB 1SEBB 2ICWJ 5EOCH 5B7EA 1Z3RA 3ZYZA 3FU8A 1HSAA 1XL4A 3CVHL 2OSYA 4D9LL 4OCXL 3TZVC 3FU7A 2DIJA 1OAJA 4KQ4H 4ZMAT 2ESVD 4N22A 3U25A 1KIQB 2V9UA 4UIKL 3G5ZA 5D7KE 4UYQA 4X5PA 4YDLB 1MFEL 1JUFB 2BERA 3CZLA 3DX1A 5HGGS 4ES8A 5DS8A 1I8IB 3IJSA 4I5BB 4MMXC 1FWXA 2CO1A 2J21A 2J71A 1ECZA 5CZVL 2NY0D 4PJDF 3X14A 1Q72L 3FTZA 1FAIL 1V27A 2BY0A 2QTVA 3S34L 4ONFL 1N6VA 4HMEA 4QHUA 4O9HH 2A73B 2XI9A 25C8L 3MV9D 5C0AA 5LQBH 3WSQH 2DN7A 4JFFD 4JFYB 3OR6A 4K3JH 4PY7B 3M7FB 1SJEA 1JSYA 4PJ9C 2JF1A 3BZ4B 4D0DB 5AYUH 4IMLB 2YAEA 3WEMA 4RISH 5GS1A 3PJSA 5F93C 1N10A 1D9KB 1U8IB 4H0GA 4KGJA 4B60A 4JM2B 3QFJB 4MXVE 1E2WA 1CL7I 3D25B 1FFOB 1QSZA 2VJXA 4MCZA 4NWTH 2J2ZA 2A5UA 5M7QA 4P23D 1I1FA 5CP7B 5KOMC 1KGIA 2A0LD 3DGGB 3G9AB 4Y4HB 4LIQL 1PLAA 5IJBC 3SSGA 2RTTA 3HMXH 1YC8A 3PXJA 5CZRA 4J3WA 2QVIA 1CWVA 4MKTA 2EYRA 2ZTBA 4H20L 4AMKH 4G43B 3IF1B 1R5VB 3ARTA 5GGTA 5GRXG 4K7FB 1QACA 5D7LD 1INQB 1EMTL 4RAVB 1QYGL 1AKJB 1QRNB 3AXHA 4Y5XA 3FHQA 3P9MB 4NZTH 2D4DA 1KG0B 3IWUA 4ZZKA 1GJUA 3OXRB 4FX5A 4LSUH 1EERB 4IU3A 1AGCB 5FHBL 1GHFL 5KWYC 1Y18A 4GIPD 1NC2D 1J0JA 2LLGA 2UZXB 3EHBC 3F7RA 5F7KC 1YECH 3HE7C 3ZE2F 1MHEA 1V5JA 4Q14A 4LVNB 4Z7OE 1LDPH 1EUUA 1AI1H 3JQOB 4DP9X 4UTBH 1GC1C 5KAQG 3ULAB 3MGOB 4JZJA 1NBVL 3KWVA 5I0VA 5DJ8B 3UC0H 1G6RB 4XP1H 5HXMA 1PNDA 3JTTB 3N1MC 4OLVL 1VCAA 1RJYB 1TZOA 2F2HA 3S37L 1E43A 3V5KB 1TQUA 1P1VA 2YA1A 4X98B 1EFXB 2BSRA 3FN0H 4M61B 4DPAX 1D5ZA 3OKEA 3VXUA 3UACA 1MY5A 1FIEA 1F4XL 1RY7B 3K7UA 4JHWL 5INDB 4HWBA 2QLVB 3C8HA 4WFGD 2VN4A 4L37A 4Y19D 5D2NE 3L5XH 2VDRH 4DUXA 1TFPA 6PCYA 2VLJD 4YSTA 3CFBB 1QPPA 4NEHB 1AQKH 4HHAA 4KVNL 3Q05A 1XCWA 3HZYB 3TL5A 4IBZA 3MLWH 4JEGB 4PJXB 3PJNA 3BDXA 3V6OA 5IJVA 1UXWB 2FX7L 1K85A 3F7QA 1E5BA 1KBKA 1XCTA 2KPNA 5DD6B 4L0PB 1Q9LA 2Z35B 1MIEH 2XQYA 3GMMB 1UENA 5E6ID 1F6AB 1KLGB 3VDCA 2Z92A 4TXVB 5T33H 4Z7WE 1G1OA 5HHQA 2R2EA 1WA2X 1FZOB 3QUZC 5DD5H 1J86A 2V5MA 3MA9H 4LKXB 3TC9A 3AJ7A 3HN8A 1AGFB 2WV3A 3C5ZD 5D9SB 4LPUA 3PGCB 4XPTH 2VXQL 4AGQA 1I1AB 1TDQA 4Z7VE 5IM7B 2EDXA 2OSWA 1C12A 1PZ3A 1T21A 3MTRA 2WLLB 3KBPA 4MQTB 4LPWA 4NAMA 4PJ7E 5AL0A 5LGJA 5ICUA 4EF3A 4Y2LA 1QWHA 5DEZA 4X6DE 4I18B 5SV4A 4ANVA 5KBPA 1LP9F 4FFWC 4XO8A 2QPEB 2XA8L 3E6FB 5C0BB 1EPFA 3P4MA 3KVPA 5GGUA 3TZVA 5HDOA 4KPHL 1I8KA 4N8CH 3L54A 1XEUA 5CWSA 1NCOA 2YXWA 1MAKA 2WMPB 4KKBD 5GSVA 2ORBL 2XWXA 1I3GL 5HHNB 1FYTA 2CMRL 3ARSA 4M1GH 2HSIA 1A7OH 3FSAA 1D7BA 3BEVA 3KCPB 4AX3A 5E08H 4OZGA 3FU5A 3C2SA 4MAUL 2VAJA 1CLOL 3IEAA 3KXFB 1I3UA 4H8VA 3GUFA 4LHJB 3MPCA 1CLYH 1Q4NX 2HWZL 5F7EH 4W1TA 3SBPA 1U58A 3X17A 4AV4A 4MJ2A 3MUZ1 1TJGL 1QP1A 4ZO9A 4IU2B 2VGLM 2XACC 1FBIL 2Y06L 3UBXA 4NENA 2P46B 5L2KD 1ZANL 2XWDA 2NR6C 3QIWA 4EVNA 4MLIA 4LQ1A 3P30L 1GS8A 1OAKL 4QHNA 3IETB 4NM4L 2BSDA 2BSCA 2R23B 1X44A 2F74B 4QO1B 3WD5H 4TLTA 2GTQA 4F2MA 4XP5H 4MD5B 1YNTB 1PJWA 4BELD 1INEH 2V3EA 3G6JB 3WHXB 4NDMB 1CFNB 1I7ZB 1ZAGA 4ODVH 3N41F 4XVUD 1FO0H 1RZFH 2WZ6A 1H3GA 2O6DA 3BLPX 4LFHG 3CG8A 3QG7L 2NZ1A 3LX9A 3FFCB 3ROLB 3DO3A 4NQSA 1XF3B 2BIMA 3UP1A 1CFMA 3PL6C 4BWWA 2EDRA 5C0IA 2CRIA 2ICEB 2VDQH 5I1HH 4XO4A 5KANG 4DKFH 5EORH 5LN4A 3NUKA 3CC5B 4ODXB 3QXDA 1R3LB 2EIZB 4GSRA 4GXUM 4LCWA 1OOWA 2F7OA 3ESMA 2O4EA 1QR1A 1LMIA 2R69A 3QIUA 2VDPH 4O2FA 4JO4H 3WFBL 4XMTA 4MQXC 5FYLE 2FR4A 1RZKC 1NMCB 3DVIA 4PWJA 1MFVA 3MV11 3VCLB 2O6FA 3FTYA 5CP3H 4X8JB 1CD1A 3IU4L 3QUKB 1TITA 3ZQXA 2O61B 1T0MB 2W92A 2WXQA 4UMSA 4WU7A 5AB2A 1NFDA 1YQ2A 2J8HA 3OKKA 2BC4A 4WI0B 1BQHB 3QISA 1OGAB 4JQXA 3WL9A 1SOQA 4IIQB 1UWFA 3JT0A 4RFEB 5E1QA 2FVNA 1BYPA 5AVRB 3QAZC 5KSVA 3ISWA 2X6CA 3Q01A 4MDJB 4P5MA 4JFQA 4ELMA 3CK0H 2IQ9L 1YCSA 2MEJB 2O6PA 4W9ZA 3VI4A 3J2PA 2IAND 5HYSG 3EOAB 3RGHA 1YO4A 3IBEA 2HT3C 3NJFA 4YDIH 2BWIA 4L1HA 4ZXBD 3ZTJG 3S9DB 3ZGHA 4PJAF 5B38B 2DJSA 4FC3E 1RD6A 3GHEH 3S4SB 1U8MB 2IWGA 4KH2A 4AITA 3A21A 3ES6B 4BWUA 5F21B 2AQRA 2CDGB 5DRWA 1OSEA 3TCLA 5HI5D 2R8SL 1UZGA 1KCVL 3FT4A 1JXDA 1WYJA 1CICD 2QLYA 4WV1A 2AK4B 2ILLA 4HFUH 2KLTA 2WWKO 2VH5L 3SQBA 2VR3A 1A4JA 4R8WH 1KXTB 1E9QA 1CDYA 2HJFA 4LKCB 3QHZH 4M1CC 2E9JA 2N59A 5I1IL 1P0SE 2Z8RA 2QGCA 4GI6A 4NCC1 2VM3A 2AXGA 3KCWA 2XKUA 1DQML 1T1YA 3APFA 3I75A 3SJVD 3GMOB 3GSNL 1LO2H 1TJHH 2BWDA 2G2PA 3QVAA 1Q38A 1XXDC 4L48A 1L9MA 1G7JA 4FFZL 3RWJB 4PI0A 4PCSA 4DSYA 2CO4A 3H9SA 2XWTA 2F68X 2IAMC 3BD5A 1SM3L 1KTJA 2SEBB 1R3KA 2WD0A 3CHXA 4Y1AE 4JRYE 4H8HA 4P2RA 4AQEB 1BD2A 3UTTD 4UZGA 3UJJH 4MB4A 4X4XB 4P3WA 4TNFA 4CL7A 3PQYB 4X7EC 5IHZA 1KZQA 2BFGA 4RMRA 5DJ0B 4UWQB 4G42A 3HOGA 3RY5A 4PRDB 2W94A 3WXVL 3OV6A 1YJDC 3S3DB 2ITCB 4BA8A 4BUGA 3NIGE 2NQ3A 5I16A 3QJTB 3J8F7 3PV7A 3ARUA 4X7SH 1U36A 4BQ6A 4I0KA 4WHDA 3WIHH 5DSCA 4FI7A 1AIFA 4H25B 1DYZA 4E9XA 1PFCA 4R97C 1CC3A 5GZNA 4N3UA 3LV3A 4KH9A 5AAMC 1RJZB 2G0LA 2VDOB 3TA3C 2C9RA 4TTDD 2X88A 3S3SA 4XP9H 3CN0A 3MJ9A 5B1CA 3OB0K 1T4KA 3NGBB 1BQHG 3OHMB 2EADA 5BS0D 1FNEA 3TEUA 5C0CA 1I8AA 2WXHA 4ODBD 4YPGB 2OTPA 4OV6F 2NSQA 1U92A 4JG1L 4TUOA 4F5CE 2GEEA 3MRNA 5FYKH 3HI6H 1TF4A 2ED9A 3T0DA 2F8VA 4L9LA 4ETQA 2Q86B 4E42A 3STZA 2FO4B 2J1WA 1GYWA 4MGXA 4PG9A 4NN7C 5I82A 4BGLA 1BWMA 2YUZA 3L3IB 3ARBD 1ZLDA 5ID1A 2F6AA 4UB0H 2PF6A 4P23C 1SFHA 3D12B 1RU9H 3ARDB 4PRPA 3JWNE 3VFWA 1D9KD 2OL3B 2V5YA 5AW8B 1CMOA 4DN4H