2ZOTA

Crystal structure of human f-spondin reeler domain (fragment 1)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
141
structure length
138
Chain Sequence
CSRILRAQGTRREGYTEFSLRVEGDPDFYKPGTSYRVTLSAAPPSYFRGFTLIALRENREEEDHAGTFQIIDEEETQFMSNCPVAVTESTPRRRTRIQVFWIAPPAGTGCVILKASIVQKRIIYFQDEGSLTKKLCEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the F-spondin reeler domain reveals a unique beta-sandwich fold with a deformable disulfide-bonded loop
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Spondin-1
total genus 25
structure length 138
sequence length 141
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02014 Reeler Reeler domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4060 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2zotA00
3COOA 2ZOTA 2ZOUA
chains in the Genus database with same CATH superfamily
3AM8A 2FD6H 4JLRB 3OSKA 2NSQA 1JK9B 3SGEH 1WAAA 4XAWH 5EB9A 5DK0B 1N59B 1PG7H 3K6DA 4PJXE 1TFHA 3UTSE 4NZJA 5T3XH 1E4XH 3RDTA 2UXVA 1JE6A 1T22A 3LRMA 4L4JA 4NN7B 4O51A 2X6VA 4YVUA 3DVNB 4AQZA 1CXLA 4JVPA 4QF1A 2AVGA 4WHTB 4JFXA 2NUTB 4K3HA 1QBAA 1P2CA 4ZMLA 1IM9D 3L4UA 1YUKB 2WM0A 2KLTA 3VGAC 1BFVH 4QRBA 4GW1B 3N50A 2VDPL 1ES0A 3Q8CA 3PYCA 4GQZA 1F8TL 2OXHA 4X9GA 3RPKA 1IGCL 5BS0D 2D2OA 4ZAKC 1BW8A 4JR9L 1A0QL 2CHXA 3LZLA 1KCRL 4AX3A 3CVHA 2NTFB 4CJ0A 4CMMA 1VEMA 2Y36H 2O30A 3REVA 1E3FA 1G7QB 4G7RB 3VXPA 2XVBA 1U8JB 3D05A 4JFQA 3MCKB 4K23H 4M6ML 5D2NC 2EC8A 5IVZA 3JWOH 1KV3A 1RERA 2EYTB 4UV7H 5AOMA 5K93A 2ICES 2VN6A 5ESAA 4WJ5A 1NCJA 2YK1H 1I1CA 4HGMA 3PWPB 1KYAA 5JYLA 2AS5M 2VC2H 3CLWA 3N85L 1F4YH 4LIQH 4ADGA 5K9JL 3DX8A 5FOJA 3BZEB 4PVMA 4OZHF 4ODXB 3T4YB 3FT0A 3NTCH 4H25A 2X89A 1X5HA 2CR0A 2Z8RA 3INOA 1H3WM 4IGBB 4H2CA 3PDOA 1NCCL 5A16A 1T21B 2BX5A 3B8YA 2QGDA 4OCLC 5DQDL 3O6FA 3CX5K 1NGYB 2PWGA 2X1XR 4IOFC 5GS2H 2XWBB 4AK2A 1TVBA 4XNQA 1ZLUK 2VLLA 2HLAA 4OM1H 5HYJD 3M1BB 1LWHA 5FM8A 5FO8A 2B2XH 5JIIA 2JKRM 3R18A 1FIGL 2YPKB 3FQTA 3H7BB 4R83A 5JQHC 1DO6A 4EDXA 1U58A 2WZ0A 1RULH 4KKAC 4M5YH 4X98A 3UZEA 4AM0Q 4I0PB 5H4YA 2E7HA 1NH6A 3FMGL 3RGVB 3QDJE 4KRMB 5CP3H 1TJIL 1N64L 1XEDA 4Z3IA 4ZUVA 3DPDA 2P52A 1FYTB 3FH8A 1XXFC 4LGPB 4HBCH 4PR5A 5E00A 3RYMA 5E8PB 5GGRA 3SHSA 4WHYH 1CU4H 3UTTA 4YJZL 1O6VA 1GPOH 4A7GA 4ABQA 5C8JA 4BZ2A 3MJ7B 5FF6A 4ZMTA 4NQDD 3TF4A 4L8BB 2ZWYA 4ODXA 3T4YA 3VWKC 4OIIH 1J18A 2PTTA 3V4VL 5F7EH 2ATPB 3O4LE 4LLUB 4LRNH 5MI0B 2FECI 2HWZL 3OF6A 5FHAL 1FQ9C 4HIEB 5HY9A 5ABZA 3MKGA 3VB8A 5T3XE 1T2JA 5EF1A 4TMPA 4UIKH 1N0LA 3QHFL 1U8JA 4JPIA 1UVQB 4JY5L 1MRDL 3B2UC 5IHBA 4FQCH 4XNZC 3I3BA 5DQ9A 1A65A 2R56H 5MERB 1H19A 3N1GC 3KWUA 4HIPA 3PWPE 4KXZH 2AI0H 3BVVA 3P0VL 1WWBX 3QPQC 4MMXC 4ETYA 4F2MA 3QEUB 4KK5C 4MZ2A 4NFBA 3QJRB 4UQ3B 2JQZA 5SV3A 1ZV9A 5MENE 2K7QA 1ES0B 1YNKL 5FDYA 1WTGT 5F9JA 3PWJB 4BINA 4ODVL 3NRFA 4YDKL 1WEJH 4CAGA 3QNYA 3BD5A 1OCCB 4MLIA 1S7SB 3MJ9L 3SE8L 4J7RA 4OF8A 4L23A 2QGCA 1O5DT 2CUIA 2R69H 4OKDA 5CILH 3Q43A 5DURD 3FT4B 1FDLH 2E0PA 3WFZA 2X0WA 4A2DA 5DEFA 1A4JB 5FDWB 5L4IA 3PU7A 3QZWA 2XZAH 4OAWA 5E6IB 4HZLA 4M9PA 2NW2B 1MVUA 4GG8A 3S4SA 5F6HI 4R4NC 1HHGB 5AW7B 4Y4KA 5BV7L 1QHPA 1AY1L 4J2XA 3EJQA 3IPBA 1QTSA 1HYRC 4P2RB 5AVXB 1J0IA 1E9QB 4P2QB 3OSVA 4X8JB 2VDQL 2Q2LA 2XQYK 3GI9H 3HS9A 3QDME 5IQ7H 3LKOB 5MEPA 3ULVD 1CLZL 3RWDB 1FZJB 4N2KA 3ASOB 3X1FA 4FJZA 4K23L 5ERWB 2BRRH 4AVKA 4Z7OF 4NKOB 2LW3A 1KWKA 1FVCA 3DDFA 5FUOL 4PWHA 1BHGA 5ISZD 4NQCA 3SSGA 2KQMA 1FNSL 3V0VA 1WS7A 4NKIL 5BUPA 2JELL 4B9CA 4H8WL 4A04A 4KTEL 4XWOD 3LNIA 4YXHH 2VOTA 1FE8L 2Z9TA 3HZKB 4FULA 2XRAH 3WCYA 3WY3A 2WXGA 1JFQH 3D2UD 1XVSA 2DD8H 1YYML 1P6AB 1T2QH 2MQ3A 4Z0BH 3IT8D 3OJMB 2NYZA 3IU3A 2XTJD 2N56A 1LK3H 3WY1A 4MXVE 4N1HB 3SDCD 4DWHA 5JA9A 1HEZB 1UJ3A 3BCDA 3CMOH 3GSRB 1I9EA 3QJZA 1MNUH 1ADWA 3L1EA 3KW8A 1JI2A 4HK3J 4QLRA 1YN7A 5HP5A 2A6JA 3MRDB 4FQXC 4HC1H 2PWDA 5A2KH 3OWRA 4U1JA 4MMZA 2Z7ZA 5I19H 2QSCL 3ZZSA 2Z64C 4Y0GA 5EOTB 2EEXA 3L4VA 3H4HA 3LMJH 3TFBA 5CMAB 3KWWB 2VAJA 4DGYH 2CLZB 2P49B 5T1KA 3D3VE 4IIQA 1KTLA 1CGUA 2EAEA 5DRWB 4EN2A 1E42A 2EIJB 4CJ1A 4P8QA 3P3YA 3U36B 4KUZL 2YR3A 4HKBB 4PJDE 3VFGH 1ZTXE 3HC0A 3HE6D 3VI3E 3NRQA 3VJ6A 4MASA 4ZTEA 3FQUB 4I4WB 3QUYC 5T8IA 3BZ4B 3TZVA 1HFUA 2J8HA 4WU5A 5IHUH 1EEQA 3IDUA 2KMWA 1D9KB 3EXJA 4QRTB 2F18A 3TASA 1H0DB 3WD5L 1A64A 3OKOA 3VFTB 3FH5A 2ZNWA 5TK2A 4BFNA 2QVIA 1H6FA 3H7LA 4YHLL 3QJOA 4LRNL 4LOUD 5E5MB 4ZS7H 4I0CC 5C09B 2F7QA 1Q0XH 5FA4A 4XZUB 3S3SA 4AL8H 3IMTA 2YEZA 5ISZE 4ZFOA 1RVFL 2ZCLL 1X5AA 2B1AH 4O4YL 5EOQL 4KKRA 3S0PA 1PZBA 1HHJA 1KIRB 3VGHA 4LKCB 1SEQL 3RIKA 5K9QI 1ND0B 4EN3D 4N0UE 3TS8A 1SXCA 4MA1B 2AQSA 3L2MA 4YX2L 3HHSA 4ONFH 3JYBA 2WLMA 4GRWB 1PEWA 1E9OB 3N5AA 2CCWA 3T2QA 3ZMRA 1OTUC 3HG4A 3QCUH 1CQYA 3QNYB 2H6PB 5HYJA 4POZD 1NUGA 5CCJA 5DUPH 2HRHA 3EYQD 3IBEA 1BECA 2IWFA 5EZOL 4I48B 3M7FB 5KBLA 1KGJA 2J6WA 1AYOA 3ECUA 4UT9L 4X7FC 2XXMB 4R4BB 2J71A 3IDXH 2B9AA 4TXVB 2VO8A 4I0PA 3QUZC 4HIIB 3CN0A 5KANI 3M8OH 3TO4C 2N7AA 4TUOA 4W9DC 3SPGA 5C86A 4ALAC 1JTOA 1F42A 2Z34A 3W0WE 4LXFA 1DZ0A 1EHNA 1PD0A 1YO4A 3C8DA 4WWKD 4XMXA 3QIUB 3HG1B 4X6DE 4JGUA 1CN4A 3BAJA 3K6SA 4XBMA 4QJ3B 4AQ1A 5F1OB 1HI6A 5F70A 5IUCA 3T65A 5E03A 2A6KA 4KK9C 4U6XB 3N42F 1N19A 1OTTC 4YHKL 3LQMA 1LK2B 5FW7A 1PYWB 3MOQA 4WCYH 5KSAD 5DQDH 4F8PA 1YLBB 3QDJD 5CN2A 4YH6A 4KITB 5CMAA 5KZCD 4A7SA 4KUCD 1LQBC 4TLSA 4EIGB 5D2LF 4YPGB 4JKWA 5BS0A 3IDYB 3TA3B 3WNOA 4EE2A 3IDGB 5AVWB 2OP4L 4Z0XB 2GY7B 1I1AA 4PB0H 1BAGA 3BP4B 4HK0A 4XOCA 3W37A 3I3DA 4MCYB 5J6HA 5FYLL 4HUCA 4YDKH 1UKTA 3WNLA 1F6LL 2ZKHH 4HPHA 4GQ9H 3V6FA 2WXNA 1CGTA 2VDNH 1QD0A 1MHEB 3LCYA 3APDA 4XNBA 2B0SL 4XT1C 1BAWA 1Q8MA 3WEBA 3PWUA 4JO4H 4PH8A 1MY7A 5EU4B 1TJIH 5FUZL 3RURA 4KZDL 4AUYA 2QR0A 3FFCD 4RX4A 4ORGB 3EYVA 2NDGA 1YDPB 4GG6B 4KNQA 4E9RA 2CM6A 1AQ8A 3KPSD 5E7BA 2OAAA 3H55A 4W6WB 4K94C 5DVKA 3D39B 1T03L 1CFQB 3PQYD 3BKJL 1AZCA 1RUML 2DKUA 5KVEH 3CHSA 3DUHA 4RMTA 1DEEA 3SDCA 5IOKA 4WENB 1E27A 2E7DA 4HHAA 3V4VH 1WBYB 3S98A 4A7TA 3QGVA 4N0YH 1EAPA 2PTUA 2RACA 1AKJA 3NQKA 1NBCA 2ED9A 4MZ3A 1ONQB 3VO0A 1P5UA 3KJ6H 4KI5D 4J3WA 4PRNA 1IC5L 4MJ6A 3T8VA 1N59A 3UIYA 5C97A 1TG8A 1IC5H 5F7UA 2PWEA 3GMOA 1EUUA 3RUGB 2VJXA 4WF7A 3BI9X 3QNZA 4NKMB 1KUMA 4JFPB 2OTUB 2D4DA 1I7TB 3FT3A 3P73A 1AAJA 2F0CA 2Y22A 4NP9A 4ONHB 4DOHB 3TO4B 3UYPA 3BDYH 2RCSH 5A1AA 3MACH 3LD8B 4FQLH 1G7MA 3U9PH 2OA9A 3MRLB 3TO4D 2O5ZL 5EC1A 5I15H 3OVUB 2A9AA 2EDJA 1R5IB 5DRZA 3TEYA 2AK4B 4BSWB 3IFNL 2Q6WA 5IREA 3F04A 5FYKE 1W0WA 4UDUB 3B5TA 1N68A 2IAAC 4NNYB 4MD5B 3CN1A 2NR6C 3KLQA 2WN2A 4RGOL 4WQOA 5T1MB 3ARDC 4K5LA 1FCGA 1JGDB 1T89C 1F5WA 3WNMA 3CSYB 1PSKL 3W39A 1BZQK 5I71C 1I8IA 5I19L 4PUBL 4KJWC 4OCSL 2VCOA 3VXPB 3GZOA 3C8HA 3JZ7A 4ABVA 2F54B 2WZ5A 2Z31A 3T0ED 3QARA 4MAUH 1KPVB 1QLRA 1VSCA 2MOVA 1IFGA 4KDTA 1MFVA 3ESNA 5GRZA 1EDYA 2ROXA 4ZUSA 4L8SA 3MV8A 1LILA 2P28B 3FQRA 4IU3B 4LPUA 1ZHLB 2VAAB 2DLTA 2P7TA 4P4RB 3SGDH 3ARBA 1IGJB 2L7UA 2WUBH 1DQDH 2WTPA 4ZOAA 5E6YA 1FNGA 5D4QA 3CVDA 3MR9A 3VXSA 3MUHL 4U0QB 3TBTB 4FFVD 5DRNA 5CD5C 4RZKA 4R4FL 1XF4B 3LHPL 4ZOBA 5ISZA 4GAJH 1HAWA 2GYSA 4KZ0A 5JPMA 1AQKH 1TQCC 4QF1B 3R06B 4K0OA 5I0ZA 4JY4B 4I18A 1GIGH 2CK2A 2CUHA 5I2IB 5FGSA 2DWXA 4D0BB 4K3EL 2WCSA 1SBSH 2ADFH 2V33A 3QAQA 3U7WH 4ZYKA 1FL5A 3WFDH 2NCEA 4XBGB 1TZOA 1CGWA 4FCHA 1IC1A 4ZO6A 1TYRA 2GEEA 4ECNA 4NENA 4PRDB 4Z7UE 3GS0A 2YGPA 2H0PA 4N5ED 3V6OE 4EUPB 3SPCA 4FZ8H 3T3PB 5HYFA 3CZKA 4Y5YB 4NRYA 1DVTA 3BH8B 1ACXA 2HFFB 4R3SA 5GRYA 5IJDC 3ORJA 4F8TA 5SV4A 2JQAA 3WN5C 5HDWA 3BH9B 3CDGA 4OD2A 3T77A 4JFOA 1DCLA 4OV6F 1BXAA 4JW3A 3H9SD 1S46A 4B50A 4NT6B 4HLZH 3LAFA 2OJZH 3O45A 3OKNA 4UBDD 2H6PA 2BOBA 1BBDH 4KRPC 1OAQH 2DZEA 4XO5A 4H8QA 2VLJE 4NSKA 4MRBA 2A73A 2P24B 5FKPB 3F7LA 4NC1E 5D8JH 3HS0A 2K78A 3V8OA 3F6JA 1YNLL 5IB2A 1FZOB 3CSGA 2R0KL 4IRSD 1MSPA 1ADQH 4M6MH 1F18A 5DLLA 2HUHA 2PPEA 1P6FA 3LKSA 2B08A 2Y7LA 2Z93A 3EBIA 2QV4A 3HRPA 4ZMXA 3HW7A 3LN9A 1LGVA 4NC1C 4BV1A 2ISDA 2WSDA 2HVKB 2X87A 1JD9A 4XE0A 3MNMA 2IFFH 3QG6A 4MD0B 4MKTA 5SWZA 3ESPA 3EGSB 1BF2A 3BWUC 4HWUA 5I66B 1DQIA 1Y7VA 1M7IB 4JAMB 1E27B 5HGDB 4G9DA 5KG9A 4F24A 2CXKA 5IF0B 5LVEA 1CYXA 1Q90A 5I76A 2ESVE 3UFIA 1ACYL 1E4JA 4F7TB 1WA2X 2OW6A 3DV4A 1XEUA 1X5YA 4N90E 5LCVH 7FABH 2PXYD 4Y8AA 2BVOA 2OTPA 3CFNA 1RFDL 3HPJB 3DTXB 1XF2B 4HKBA 1JPGA 1QSED 5EOCJ 3RFRA 5G2NA 1EQWA 2VDPH 1RZ8B 2APFA 4IIQB 3WIIH 1WFNA 3VTTA 1Q1PA 4P3DA 3AAZB 4TV3A 4G6AC 1KJ3H 3V6FB 5ADOH 1PEZA 2CO7B 1IAMA 3QEQD 4H13C 1KBVA 3L6FB 1CC3A 4MCYA 4NQEB 3BH8A 3M7OA 4EBQH 3B6SB 4EBQL 3NZHH 2WO4A 4RMSA 4IEFB 1JZ5A 3BVWA 5CP7B 5KYWA 4G3YH 3WIHA 3LS4L 5GXBB 1YEDB 4NERA 2VJ8A 3UROR 4RA0C 3SGKC 4XAKE 1A9BA 2DI9A 3L95A 1RIVH 2JJSA 1RK1A 3RY6C 2IFGA 4K3DH 1Q72H 3NCYP 2AK4D 1OSYA 2COVD 4YE4H 4D2NA 1IKOP 5TPWH 3SDAB 3DUUB 1G6RH 2P5EE 2X3BA 1LEKB 3QZPA 3Q6GH 4PBDA 2OM5A 3LPFA 1AS8A 4PJEF 1T5WB 1PCSA 1DLFL 1T7WA 1FZJA 1MIML 1CDCA 5ABAA 1Z5LB 3U7YH 1FFOB 4PGDB 4P57B 4WK2B 2Z6FA 1E8XA 1EMTH 4JCMA 3SKNA 3RZCB 2E59A 4ZSOA 1KNOB 2YWYA 5JOFA 3HZMA 3EHBD 4H1LB 2FEDC 4AQAB 3AXLA 4QXGH 4F3FB 2DLFH 3RVVC 4IMLB 3V4PA 2WLJA 4QXVA 5DUJA 2CK0L 2X2UA 3JTBA 5A2LH 2WBJB 1I8LC 1DBMH 3RPIB 4X6EA 1KIUA 2VZOA 1FDLL 5AOZA 3G9AB 3M1OA 2Q6WB 4JFOB 3U1PA 1G87A 4HG4K 2HJKA 1I9RL 4I88A 4Z3FA 4FQJH 2A83B 4UIMA 2VXUH 1AIFA 3LXAA 2YSSB 3KLDA 3WAKA 1TENA 4JFYA 3WJLA 4L29B 1IGFL 1ECZA 2R4SL 3TEXA 1BD2A 3LSOA 1IGFH 3CG8A 1KFAH 2CBOA 2NXYC 2XXGA 3MLSH 4N2IA 4TUKL 5GZNC 1WF5A 3E38A 3HRZA 1DSWA 5CEYB 1G7PB 3EFOB 1X5LA 3BVDB 4BE5A 1KXHA 4OCWL 4RMRA 4WW2B 5CEXA 3LHPH 1AFVH 5J06A 2VUKA 5KUMA 1BQHB 1KLFA 3H9SA 1QRNB 1G9ML 2QBWA 3PP3K 3LRKA 4F7KA 1ZS8A 2PYEA 2FEEL 1HINL 4XMPH 4ESKA 1SBBA 2Q8BH 3ML9A 2J6EL 1QSFA 3GBDA 3WFCL 3ZKQD 1EJ8A 1RZJH 2HX9A 2A9NH 1CLOH 3T0EE 3QEHA 5JDSA 4L37A 1ZTXH 4Y16C 1EPFA 2ORBL 1IBGL 3EDEA 2DM3A 5INCB 1FYTA 1KCWA 3GQFA 1AZUA 2PO6A 3GSWB 5HD8D 3O0LA 4OLZL 1ZTMA 3POCA 2HCZX 3CAFA 3NJIA 5ENWB 4N8VG 4FEMA 2EEAA 4JM2D 2QVTA 2HAZA 3QI9A 4AXWB 1KCSL 1F8TH 2H32B 2JKTM 3DA0A 4KTDH 4UMGA 1RQ5A 2ITCA 2K70A 1MJ7H 1UTDA 4F7PA 5HYSA 5GRJL 3V0WH 1D5RA 3HCVB 4JG0L 4M4PA 4JRXA 4KJYA 1BVNP 2H9GA 1L6XA 1FAIH 4XPGH 1UD2A 3AUWB 3F6IA 4RISH 4OTXH 3GZKA 3FUJA 3PDDA 2VXVH 5SWQA 4EVNA 2ZUTA 3ISYA 4KJQC 1HHHA 3I3EA 3QNZB 1G0XA 1NLBH 4O2EB 1U8QA 2VR9A 2B3IA 1ZHKB 2NZ9C 3J2PA 5K9JH 4I1NB 4WNQB 4XMLL 4OCXL 1MXDA 4MDIB 3A67H 1DR9A 4Z7WF 3PWPA 3F12A 5CJXA 5F3HB 3NN8A 3HUJB 1ZLWH 4LO9A 4MNQB 1IE4A 4W4NA 5EBWA 4GIPD 1D5MB 5EPMB 1JOIA 3MDJA 1DQTA 4RSVA 3B3BA 3QUMB 1J88A 2CGRL 1XD0A 3SDDA 1XZ0A 3DOSA 3S4SB 1DBAH 4FNLL 1BREA 4A2EA 2ZSVA 3EH2A 3L2LA 4UANA 3ALPA 5LCVA 1CFTB 4I3GA 5A7EA 2VR7A 2X70B 3KWTA 5IT2L 1N4XL 1SRDA 3KLLA 4S1SH 4PJEE 1DQQA 3PREA 3KYMB 4OJAA 4JFFE 1YMME 4NDMB 2GEQA 4OCNC 1WFMA 4ZAKB 2E8ZA 1U8NB 3OGCA 2HH0L 3QXUA 4XNUH 5FUZH 5K1NA 4KZDH 1KMGA 1MCOL 3MRQA 2F53A 3T6XA 1UWXK 1W0YT 5C2BH 3DMMA 3Q5OA 1KLFB 1W8NA 5E51A 1WAPA 3TVMB 3BESR 5EUOB 1CLCA 2EH7H 3ILQC 1UOVA 2XX1A 5A6LA 2AJVL 4OD1L 4Z7UA 1UZ8A 2JCCA 5MEOB 1N0LB 4XO8A 2Z8WC 3CN3A 2LVEA 3ARZA 4A6YA 5MHSE 4F33A 3X12A 2P8MA 5EEUA 1JF6A 1QSFB 3KXFD 1NGWB 1UB5B 3S3DB 5IW6A 1I1FA 2FJSA 3ZR5A 4B7LA 4C47A 5IGXL 1SLXA 2H3XC 3GD1C 1I1AD 2AJ3A 4ZFZA 2OJEA 5ALCH 5AUMB 4WCYL 2VISB 2X41A 4JO5A 2Z91B 5BZZA 2LTQB 1NUFA 3VX1A 3QR0A 1H5BA 1RMFH 2XIDA 5E4IA 2AZUA 3Q13A 3EYFA 1BEYH 5CXPA 12E8L 1DQMH 3N9GL 5KVFL 3KBPA 3LEXA 5D6DA 3PL6B 1R5WB 4JFDA 3ME0B 4YHOL 3QJHA 1XDTT 5HJ3A 3GM8A 4LFHG 2X2HA 2DQDH 3QDJA 3GHPA 4LRIA 5ESVA 3QI9B 1NPUA 3KPRD 3S5LB 3LHAA 1UEYA 1GC1C 1WIOA 5D7IA 1T4WA 2XKNA 3B2MA 4G8GD 4UBDC 1EX0A 4C56E 4WGWB 4Y9CA 5JOFB 4F7MA 2OMYB 1NAMH 3HE6B 4P04A 4AITA 1BZ7A 4MB5A 5DD6B 3FQTB 3E80A 5JXEC 2DYPB 2ESVB 2HTLC 3CFBB 4RAVB 1TZAA 3FN3A 1GOGA 3FTGB 7CGTA 4GP5B 5KYUA 4IRJB 2IVFC 1OP9A 3FQNA 5E2JA 4O2EA 1I85C 1OCZB 3RPBA 3BLPX 2BHYA 1HWGB 3FB6A 1Q94B 3MZTA 2QSVA 3GEWB 1S7XB 3WS6A 5AAWC 1WDAA 1OGPA 4JRWA 4TVPD 1S7WA 4Y5VA 5C92A 1GXEA 1I1FB 4U0RB 1UM6H 3PJSA 1IFHL 1A7RL 3D33A 4YDIL 3FFDB 3RUGE 1CE1H 2PPCA 2EYRA 2ZUXA 3N1QC 4ZZFA 5I16B 4Y4HA 4IRZA 1MREH 5JUEH 5DVOA 5EOQH 5CEXB 1O9WA 4H8VA 4QGTA 3ZSTA 3SYPA 3UMTA 3NEOA 3KYKH 1F41A 2WUCL 3BUPA 3QCVL 4KMTL 3FB5A 3IK2A 2Q8AL 3SE6A 3GNMH 5C0AA 2DB8A 4M8UA 2JXMA 1KJ2L 3DPBB 3L5HA 4G80B 3MLUH 4NB7A 4FXTA 4YDMA 2IAMD 4DPCX 3IGUA 3ARFA 3L7EA 2FCBA 3EG9B 2W9DH 4XODA 1MCLA 3U4BH 3KYMA 2Z7UA 3S34H 2V5MA 1J05A 3U36A 2IPUG 2AXHA 1TZHB 1OAKH 5E5LA 1CDJA 3J8F7 3O3BB 2GHWB 3MXWH 1GS7A 5IQNA 5BRZB 1EV2E 5DVPA 1ZVNA 2ZOLA 4DP4X 2F5AH 3QFJA 1AJ7L 2FYYB 1M4KA 3GIZL 5D5MA 1XT5A 3SDDB 1AGBB 5T1JA 4EQ2A 3FQYA 3L1OH 2PABA 4GJTB 2OZ4L 4K2UH 1GZHC 2GTWB 5M94B 1A7QH 3OKEA 4KTDL 3EGSA 1IZKA 1EZSA 3N44F 3GB7B 3WIFA 4P2RD 4MB3A 1AE6H 5JMOC 3R8BB 1JNNH 2B5IC 4PRIA 4TSAH 3HZKA 3GF8A 2VUYA 3IFLL 4PJDA 1FLTX 3GUFA 3PNWA 4E9XA 2VDLB 3Q3GB 3NPZB 3BZ4A 3P30L 3ESVF 3N40P 4F7TA 4G83A 3N55A 2WUCH 4ZOCA 5B3SB 4JX0A 2VQ1A 1QWHA 1JZ2A 1FE8H 2AK1L 1GHFH 3BWUF 5J1SC 3S3BB 4HUVB 4LLYB 2H3KA 3B2XA 2Q8BL 4PB0L 2JCWA 5CO1A 4P46C 4JRXD 5JIMA 3G04B 3KWWA 4M93C 4IMLA 1SXNA 2HG5B 2YAHA 4GQ9L 3VFUB 3D0VA 2ARJA 3TIEA 3NJJA 2CDGA 3OMNB 5AW3B 5E2UH 5LXGH 3SZ6A 1MCWM 3KLAB 3JBG7 4XGZA 2KHAA 3MPCA 3R4RA 1MEXH 4OZGA 3IF1B 1PSKH 3MRBA 4YSUA 5GISL 4YO0B 2FHBA 3C60C 4MXWL 4MDJB 2XV0A 5L9DH 4HWBH 2DIJA 4JBSA 4PBXA 4UT7L 1FGNH 1B4TA 2HRPL 3MRKA 1MUJA 3DGGA 3FXIC 5C0CE 3GMPB 1EO8H 1JK8A 2A74B 4QWWC 1PG7W 1D5ZA 4MCZB 2NZ1A 3RI5K 1A9EB 3ILEA 2BNUA 1FZKA 1A8ZA 3OG6B 4D8PB 1DSFH 4UOQA 4NFDA 5JOPE 2E9WA 3OTTA 1DSFL 1Z6JT 2DQFB 3PF2A 4FFTA 3QUML 4WI2A 5EV7A 4DP0X 4FHBD 4JO1H 4FFYH 4CILA 3GLEA 2D8KA 4R4FH 1MCCA 1C7TA 1YPZA 3IJ7A 3RIAK 2JKJA 3DHMA 1X5ZA 2VXVL 4I3SH 5EORH 1UYWL 2W94A 3WSQH 5KYWB 4I3RH 3EDJA 4NZUH 3HBGA 3CFIC 1TVHB 4Q9QH 1MW3A 2NY5H 1F90H 2R15A 3GKZA 4KXAA 4OGXL 1HNGA 1HIML 2VSKB 4HULB 4LIQE 5IVZB 1JFQL 3SO5A 3D4CA 4Y5XA 5JO5B 2BDNH 5JW4R 3MBEA 4U1KA 3BUYB 1QASA 4FL4B 5DEZA 2CCLA 4XC3H 3P4NA 4L4TB 5FGBC 3ZGIA 2BSTB 4JM2A 5DC4B 1SEQH 3ABGA 3MJ8A 1BIIB 5B1AB 5LNEA 1BV8A 2DQCH 3AM8C 5HI5D 1DHKA 2NYYD 2FYYA 4ONFL 5LLIC 1JL8A 3ULSA 3EF4A 5C0DB 1YYCA 1A6VL 1P4BH 2PNDA 4XC1H 2C5DC 2C7FA 5DMKB 4BSVA 1BX2B 3L08A 1NBVL 4D0DA 1BIHA 2VN7A 1B3JA 1KZQA 2VAAA 4YWGH 4N90D 4I7ZC 3RL1B 3VH8B 4OZGF 1BXXA 5E1AA 5I1AA 3C5SA 3W0WA 4TUJA 3DUSA 1ANUA 3QS3A 5DC0A 2XFXB 2F5AL 1IBZA 2V5SA 2ERJC 1MAKA 4GS7C 4NKMA 3B7TA 4MCMA 3JWDH 4NQDA 1H9DA 2WTOA 1A14L 2YKLH 4ZXBD 3W39B 1CU4L 1C12B 1EVTC 4GXUN 5TDOB 2ZYSA 1IU1A 1T5WA 3ZZ1A 4CKQA 5KSBA 2JJTA 2ZE0A 4GIOA 4XP6L 4W9IC 4AIXA 1XCQA 2O5YL 3DROB 5GS0H 1YVLA 4OCXH 2IOMA 4NQED 4CSSA 3BUBA 5DS8B 5IW3A 4L8CA 3MRLA 4ZX3A 2X1WL 2CRZA 2V37A 1JPEA 2P4AB 4NQSA 3WFEL 3DX8B 5HDBB 3BZEA 3BDXA 3RILA 3MROA 3WJJA 3V4UH 2I9LA 3TBSA 2YLKA 4RWYH 4GH7B 4KBPA 3SY0A 5E1QA 1WV7T 2WGXA 1B6DA 4W6YB 1CICB 4UNTA 3T9WA 2UX7A 3TP4A 2CRMA 1BQLH 4P5KB 1ORQB 4YBQD 1Q9LB 2QQLL 4DJMA 2IANA 5E1AB 3O6FC 1JXKA 5B38G 2AQNA 2QADB 3UGXA 1VFMA 5I1DA 2HJFA 3PAVA 2Y2WA 1S78C 4KKCD 2HLFC 4ELMF 4N25A 4KKLC 2G2PA 3FT2A 2E6PA 4YK4C 1A7PH 4BXVA 5DLML 2PR9A 3FB8A 4MFHA 4PJ9A 3P2DA 3FCBA 4UU9A 5I74B 2DW5A 3SKMB 1FCCA 4HBCL 1ZD6A 2YXWA 5J11B 2G5RA 2NY3B 3BKML 3C5ZC 1NC2B 5B4MC 5DEGB 1GW6A 2X4PA 1WHPA 3PAUA 4MJ5B 1KEGH 1QYGH 1XF4A 4PTTA 3H42H 5BUAA 1ZXQA 4U1KB 2ADGB 4U1NA 3ESMA 1LNUB 5DHYB 4RLDA 5F7FA 5LAXB 3UYPB 4LE8A 3ZRCC 4ONHA 5IHZA 4PWIA 2P8PA 3ENEA 4PY7B 3GFUA 3PDGA 1Z5HA 3AS2A 2EO9A 4IU3A 1AGCB 5DJ6B 5BZWB 4Q6KA 2ICEC 3L9YA 3KPPB 2H26B 4X6DA 3MLXL 4XO9A 5LNGA 5LBSL 2KZKA 2B16A 1E9PA 1JWSA 3GHBL 3L17A 2YD5A 3HUJE 5D7IE 1QPKA 3KH3A 4M8RA 4FG2A 4WEEA 3X1NA 4A66A 4G70B 4JZOB 4QHMA 5JNYA 3KXFA 5CEZE 3CSYA 4KC3B 4HIXH 3RL1A 2K9FB 2QL1A 4FXLA 4YXLL 1CL7L 2FQEA 1D5BA 5IEKB 2MJWA 1BVZA 2P24A 5FKPA 4D0DB 4ZUTA 2TRHA 5IR1B 3G5WA 1A47A 1CFNB 5BVJA 2WXIA 4LMQE 3GXPA 1JYWA 1BYOA 2VL5A 4OZFH 3QXDB 1JZ7A 1YJDC 2ZXDA 1H15A 1GR7A 3U2IA 5DHVH 1TNNA 5F9WC 1LXMA 1AO7E 5EUKB 4E41B 4PJ8B 1GMEA 4HIIA 4EI5C 2W07A 2CBTA 1J8SA 5I73C 3L7FA 3OPUA 1NWPA 4ANXA 2KPNA 4PW3A 3UZQA 4TNVK 1MW1A 3L3OA 1SJHA 4K5NA 1OANA 5FGCE 4U1MB 1ZWIB 4Z78B 1A6TA 1J5OH 4IKJA 2XPGB 3VH8A 1IE5A 1QATA 1FIEA 1KBPA 2X28A 3FYEB 4K5MA 4PJBE 1MJ7L 1SDAB 1EGJA 4PY7A 3J07A 5AB9A 1VEPA 4JL2A 3OXSA 5B22A 2H1XA 2ZOOA 3QQNA 4S1RL 1OD7A 3AQZA 2Q5BA 5GS3A 2XUWA 4QHKJ 1D6VH 2D7TH 2WW8A 4M7ZC 1KLGA 3CHRA 2AJSH 3EGXA 2AQ1A 4V1DE 3RGVC 1BMWA 5F1NB 4LHQB 3P0GB 1LHZA 2FQGA 2F54D 3T0EB 4AC4A 1IAKB 4PU2A 1H6EA 4HZ1A 4JM2B 4C55A 4PLJD 5H37H 4LKCA 1BVLB 2FT7A 4LEOA 1N8OE 3V8CA 4EVNB 4FLSA 5DRNB 3VI4A 5HGHB 3WS3A 2VMEA 4KV5E 3CZGA 3A67L 3HKZA 1F1AA 1MF2L 2XV2A 5IQOA 5DJZA 4G72B 1JZ4A 3M17A 1ML0A 4G9FB 2ZAGA 3CHXA 3QUXC 4M8QA 1XBDA 3LVEA 5C0JB 2YD0A 5FPIA 3D3VA 4G7VL 1YUHA 5EN3A 5AVSB 1NM9A 5C3LD 3CFTA 4G6FB 5LCVL 1TEYA 1BZ9A 3GLAA 4K3GA 3UJTH 4K8RC 5HVWA 1K3IA 5FX3A 3QFJB 5AVZB 5AYQA 4AEIL 4ZQKB 2JIXA 3HLAB 3K2MC 3FN0H 5F7AA 4AGQA 2KZWA 4X0NA 4I4WA 3ATAA 3D2TA 4Q97A 3KH4A 1LO2H 5JIDA 3HNVH 32C2A 3PHAA 2H2SC 4XCYB 1XGTA 2VRQA 3AACA 3PWNB 5DRZB 5A7BA 2BP5M 4LPXA 5IEHA 3BO8B 5T1KB 5GZND 2MPVA 4C59B 4GUPA 1JNLL 4JKKA 1IKNA 5DZLA 1BMGA 5A43C 1AHWA 1YEKH 3IJ9A 2AQ2A 4LPWA 3VWKB 3ZDYE 5F9WB 2EH7L 3Q2VA 3BE1H 4LOVA 4OFIA 2AAAA 3QXAA 2DLIA 2N7BA 5FYJH 2D03H 5JZ7C 4QYAA 4PJ5E 4HS3A 1DVFA 5FHAH 4LCCC 3WEOA 3GEFA 1KTJA 4W9GC 2HVBA 2KPWA 1P84K 4X5XA 2Q7AA 5E5UB 2WXKA 4OKVB 3L4TA 4F15C 3DECA 1I8MA 4YGVB 1Q9OB 4XOBA 5D1ZD 3UP6A 5B39A 3MLVL 4XCEB 2Z31D 4LPVA 3T0EA 1KYOJ 3QDGA 1RCYA 5DO8A 1YDPA 1DBAL 4GG6A 2X05A 1KENL 5CCKL 2VLRA 1S8DB 3D3VD 3LV3A 4FD0A 1R47A 5D1QE 2BZCA 3MRHB 1A6ZA 3ZO0A 2JI1A 1F86A 3HVNA 2K4AA 5F9OL 4K7FB 1E6JL 1KGIA 5D9SB 1XR8A 5LWYH 3TNMB 4F80A 5J12B 2CA3A 1SMAA 3CVHH 1SEBB 5KBKA 1CIDA 2QQQA 3SJVD 1EO8L 3ETBJ 4MA3A 2DTML 1JPFA 4P4KC 2JXMB 4NWTL 1PLGL 1U9KA 1O75A 2FX9H 2CDFB 3B4NA 3A6CL 3BP4A 4HK0B 3ROLA 5JHDA 1BAFL 3RIAF 4CU6A 4Q58C 1TLKA 1KXVA 4TPRH 5FYJU 4MAYC 1SLVA 4JN2B 1V3KA 3VXQB 3WKMH 4FMFA 2WZAA 4C56D 4G8GE 1BFTA 2FBRA 2RFXB 1QX1A 2I60H 5K69A 1X9RA 3PHQA 4X9BA 2C1PA 3BSZL 3C75A 4K8RD 2GJ6B 4XB3A 5CJ5A 1N7ML 1WD9A 2BVQB 3QUZA 4XP1H 1DN0B 2ZUSA 3PV6B 5SX4H 4ZNEA 2EUWA 3QJFB 1F13A 1SM3H 4Z8FL 1TUPA 1IC4L 2N3JA 1BZ8A 3IJEB 1DLFH 3GK8H 4IHOB 4BQ8A 4JCLA 5E6RB 4JNXA 5GGSB 3E8VA 4BA0A 3JYCA 4PJBF 4KY1H 5C0AE 5C0EB 5BW7A 5I6NA 1EMTL 2NX5D 4Y88A 4KY1L 3RY4A 2V3EA 3KPPA 4RGMB 2NNAB 2HFEA 4PCKA 5BJTA 1S7QA 5FKAB 4N0CC 3IVKA 2LU7A 3X3FH 1FJ1A 2H0JA 1V54B 2QQLH 2MNJB 1OE2A 1JPFB 1BQLL 3RGVD 4NDMA 2ADJA 3R8QA 3NACH 3TU6A 1WCQA 1LE5B 3B7SA 5F1KC 5DJZB 3TWYA 3VGDA 1EFXD 4DAGH 2ZF8A 2NNRA 4P5MA 2B1HL 1RZIA 3FQ1A 4NJ9L 2XKUA 4OZFA 1AP2A 4AEIH 4L4TE 5C8JB 2ZZUT 1TZGL 5C07B 4JFZH 2Y25A 1H15B 2BVOB 3KXFE 1XH1A 3LPGA 5HDBE 3LS4H 5E9NA 2CUAA 2E6JA 5MHSD 3OR6A 4H1LH 1WZ1L 1W6LA 3PL6C 3FHAA 3Q8FA 4LGRB 4BUGA 5DWPA 4PJHA 3N85H 1WPCA 3M46A 4D94A 3CQFA 4NZDA 2ZNXA 3L4WA 1M1XB 5CJQL 3VQ1C 3F12B 4GB9A 1SOSA 3UBXG 5E6ZA 4G5ZH 3MOAL 4PS4H 3DNKA 2EH8H 3BAXA 1OAXH 1OCOB 1HU8A 1QFPA 3ALWA 3TL5A 1MQ8A 3FT1A 4FQHB 4PJIB 3ZYJA 3BUTA 3A4FA 4ODUA 3SDCC 2WMPA 2NR6D 4E41D 4K7PX 1ZLVH 1HCZA 3TV3H 4MX7A 3S2CA 3TZVB 1YJDL 3TJHC 1P5VA 5DEFB 2BVUA 2CKBL 2B8OT 2P8LA 3DYOA 5FDWA 5IW1B 1M7UA 2JTYA 4AT6A 5J13C 3FO0H 4V2CB 2UYLA 3D69B 1A3QA 3W5NA 2AANA 4NO0A 2EZ0C 3OKNB 5GS1A 2OK0L 4UF7C 2BVPB 3QVAA 3C6LA 1SQMA 4Y16B 5MI0C 1R17A 2DQCL 5HVHB 3VD5A 3ULUE 5LB1A 2XTLA 3RDTD 4QCIB 4TOYL 1XCXA 4HWEH 4YFEA 3FH7A 2KL6A 4ZDHA 3WTWA 3ROOA 2YXFA 2YRLA 4E9QA 3IMSA 3UADA 2WC7A 3RNQB 2GIYA 1NOFA 2IMMA 1ZDQA 3N0AA 1DQJB 3ARDA 1AGCA 4Y2DC 5DZAA 3TC9A 3F85A 4YSCA 1JZHA 1NC4B 1J0KA 4KK6D 5E95B 2CDEA 5DZJA 4PJEA 1OWWA 4UTAL 1T1WB 4XNDA 3RVWC 2JI3A 4G43B 2FZ3B 4Z76B 4KDTC 1EJOH 3K72B 4MNGA 1T21A 1MWAB 2FH8A 4HUMB 5AOKA 2X4SB 1VADA 1SVZA 1YEWA 2IGTA 2YPVA 4K73A 2R8SH 3T0WA 4I3RL 4LEBA 2BCKB 4X5QA 5GGRB 3DVGA 3ECQA 5KSVA 3ESUF 2BWQA 5I6OA 4OLUL 5GSVA 4GG6E 1BG1A 3SOBL 1YAIA 3SQOL 2ZUWA 4HUWB 3UABA 1JAEA 1NIFA 2BP0B 1AGFA 3P2TA 1VACA 4DO4A 4YHKH 1M1XA 3VVWA 3O2VH 2ETWA 3GMMA 4H26B 1J8HE 4PV1C 2W9DL 2EXWC 5EU3A 1DJWA 3FOLA 1UWFA 3NGBB 5C0FA 3ES6B 3NESA 4KY2A 2XTSA 3WELA 2NCMA 2DYRB 5LGJA 1DLHA 1MEXL 1XL6A 4PRPA 4HVBA 1A6VH 3DI3B 3G7TA 3CVHB 4K9JA 3NZ8B 1AHMA 1QFWI 3FBKA 4MNGE 3VMNA 5F0LB 5L9DL 1P53A 2MKWA 4HAKA 1AMYA 1GCYA 4JRFA 3SKJH 1PZSA 1K2DA 4KKAD 3QYCA 1LE5A 2GJZB 5IT2H 5DMKA 2YD4A 5E2WL 4G7QB 1PMYA 5FFLA 2BXYA 1U4FA 2H5UA 2C9PA 3EJSA 4P07A 4UNUA 5ETUA 3REWB 3MN8A 3QZOA 3E2HC 3X12B 1OCRB 2EVHA 1FV1A 1XF5A 2IANB 5I1HL 1DBJH 1XGQB 1PU0A 4APXB 3NCBB 4MX7B 1CTNA 1W72A 3QUYB 1G6VK 4BK4A 3S48A 3RDTB 1K5WA 3FUKA 4Z7VF 2WMPB 1N0XH 1RIUH 1KCKA 1MAJA 3HZYA 4M7LH 3TCLB 4DUXA 4NJAH 4A39A 2VZTA 1LO4H 2XYBA 2EICA 1KCVL 4DGWC 1UGNA 1FWXA 2DWEA 3HS0C 1CJYA 1NFAA 1G7QA 3VG9C 4ZMOA 5LBSA 4Z18A 3NA9L 4QRPB 1DN0A 1OTUD 3VA6A 1M9WA 2C9XA 2OQJA 3IAPA 4KJQD 4PJAB 3PHSA 4L8CB 3ILQD 3MCG1 5ECGA 3P11L 1UCBH 2FUTA 4KROB 1E40A 1D6EB 1ZT1A 3GJFA 3KYKL 4Y4KD 1WITA 1XTLA 4MXVF 4NGHH 1GOHA 2A7BA 1IAII 2VR6A 1EEUA 4X6EB 2Y7OA 4IEFA 2QR0B 3BN9C 3PXJA 4UT6A 5L7XL 3G6DL 4ZZKA 2GJ6E 1ZLSH 4OCYL 1JMZA 4H88H 3CLFH 4R9HA 1ZCRA 1CG9B 5L8JB 4IGBD 5IFAL 1BQHG 4NWTH 5E2WH 4L29A 1Q9LA 3U6XS 4WJG3 3VFGL 3EZ8A 5I24A 1SJXA 3A6BH 8CGTA 1AXIB 1G7IB 2JQMA 4XGZB 1IT9H 1QQDA 3FPXA 2PWFA 3P3RA 4QHKI 3M8OL 2BOCA 2VLME 4JPKL 3BKMH 2EVJA 1CS6A 3UMNA 1SN5A 4G7YL 1QSFE 3WN5B 1CD8A 4CVZA 1S2EA 2X6AA 35C8L 3HAEB 3RB5A 4MJID 5A16B 5CEZH 3LRLA 4LCVA 2B4CC 3MREA 3F6LA 1VESA 1G5GA 3GUTB 1ZIAA 5AOIA 4B9KC 1D9KC 1JNNL 4RESB 1SUJA 2WYZA 3SKNB 5I28A 1HXKA 2VLKE 1DVQA 3EYSH 1IB5A 2VZSA 5AVQB 5AZEL 1OAZL 4G8IB 3SGKA 1PY9A 1JZJA 3TONA 2YBRB 4X4KA 3TBYA 3KDMA 4OV5A 1BQUA 5BO0D 1MIMH 4LOFA 2RB8A 3F5WB 1YMMB 3MRGB 3MOBH 5BXFB 5DYFA 3S35X 4KO7A 3KPNB 1FNFA 4LASL 5CAYB 4ODVH 3JT2A 2X9ZA 5I8OH 2J73A 1FFPB 3ARFD 1A7OH 2WCGA 4GKZB 1USZA 4NZRL 4TKWA 5T33L 4J3OD 2W95A 5IJVA 1A7OL 2XTJB 4NZRH 3GSNH 4NO2B 3QULA 5DHVB 5D96C 2MCG1 2D0FA 4D8PA 3BRDA 4Y2OA 4M02A 3D8MA 4FQXD 5DUBA 3RWGB 1K8DA 2X42A 3M07A 4J4PC 5HHME 3IRZA 4AL8C 4UZGA 4AUUA 3KPSB 3E3QE 4N1EA 4LLVA 3RTQA 3ZLQC 4Y4HD 4F57L 1TTCA 3DX2A 1PVHA 3JTSB 3O6FD 43CAB 3DKHA 3ULAB 1Z2KA 1BPVA 1QKZL 1V05A 2OKMA 4G42A 5HVGB 3VQ2C 1IQDA 4JQVA 4UQCA 2VITA 1OK8A 4NS0A 1O9VA 3O4OC 1KV7A 3BZDA 3P9MB 4X9FA 5K1JA 4WKZA 4I9XA 1AR2A 4PS7A 5F7NC 4NRXB 5AB1A 1LLAA 4HHWA 2BP0A 4M29A 4HT1L 3WFBH 1F11A 2EE6A 2ZT9C 2B59B 3GBLA 3ECWA 1F02I 1MCEA 2JLPA 1B9KA 1H3VA 1UB6A 1L5GA 4FRWA 1LO4L 4DGUA 3ARPA 5F1NA 3CFCL 1NICA 5TQ0L 2ICWB 4MQ7B 2B9BA 1MXGA 4JFFB 1QRNE 4OZHB 1HQRA 1YEEH 4TVPE 5GGQH 4M03A 3FQXA 5KW9H 3TN0C 3MBXL 2HFTA 2GVYA 3QULB 1EXHA 1K2DB 3V0AC 1KBWA 3GDBA 3CH8A 2R0WL 3DJ9A 3HB3C 2F1AA 5EU6E 3SZKC 1JK8B 3GMPA 3EOAB 4L8SB 2Y6SC 1NCGA 1MRCH 3LJ3A 1HCYA 2K8QA 2R7EB 3CN2A 4I87A 5DFWH 3IFPA 4D9LH 1OK0A 3SDAC 3LEYH 4L4VD 3QORB 1MJ8H 4BSJA 1OZTG 4K9EC 3FYIB 1AR1B 1S7RA 4QHPA 1MCPL 4MNQE 43C9A 3KLAA 3C9NB 5C9JB 5KBDA 2Q9OA 3V6OA 4N3TA 5SX5H 4UM9D 4C57C 1UURA 1I7ZB 1VFUA 4NAQA 2GJZA 3R19A 3NSFA 1USQA 1G5AA 4MRCA 5LG1A 4HFUH 4DN4L 1A6PA 3MCYA 4N2GA 3F7YA 4FFWD 2YPVL 1OARL 4HLZG 2FX7H 2MCPH 2DI8A 4AIZA 4LP8A 5EU6B 4YGAB 1DYZA 4RFOH 4CVZB 3MHZA 2NRDA 3VXNA 3LQAC 2F7IA 3EGDB 4LU5L 1KCLA 4PB9H 3A4AA 3MGOB 5BZDA 4R3SB 3BAEL 4GAGH 3UAJD 1IM9B 2BJML 1YY9C 4Z7IA 4NLHA 2OMVB 1ZVYA 1HHKB 3ALXA 4KAQH 3CVBA 2KLRA 3C5ZB 3SDXB 1ESOA 4IRZL 2XG4A 4LDCA 1EK3A 3MRRB 3G6AA 2V7HB 4Y7MA 2X6MA 1M6OA 1JDAA 4PSRA 4ZYKB 3AZUA 1XGPB 4WTWA 1CF8L 3GMLB 5FWQA 4AYMC 1C1EH 1HHGA 3U7YL 4NPKA 4FHKA 3IB4A 5E94B 2LAAA 5GIRB 2KT6A 4FN0A 2ZX7A 4HIHA 5GISH 4RQQA 3VFRA 5CJXC 4GSUA 1ZK5A 4KRNA 2AF2A 2O5XH 4GOSA 1LE9A 1OOAA 5EEYA 1INEH 1D6EA 3GJFB 3BHBA 5K9QG 1A02N 2ZAIA 3FTGA 4O02L 3PWPD 1CF1A 3EO1A 1VGEL 2PYEE 3F65A 1DEDA 1PLGH 2UWEF 3TPUA 5LN8A 3HIZA 3IRPX 5LN4A 4LLMB 5DD3H 4L18A 4PJFF 2BSSA 1WBXA 1E5AA 1HILA 3ES6A 4O9HL 2X6CA 4EOWH 3UAAA 1KOAA 4PD4K 3CN4A 4BK5C 3QG6B 2CG9X 1FUNA 3SIKA 3TN0D 3MXVH 2F74A 4PWFA 3S5LA 2V17H 4MYWB 4QRAA 4L4VB 2MOGA 5E99L 2BS71 3WD5H 4BH7B 4NN5C 1M42A 4KVNL 2IPTH 3KHOA 3TBSB 3QR2A 2Y07H 3BYTA 3DVGB 1QBMH 2AEQL 4WWID 4IBYA 5KSVB 3D1MC 1MNNA 4GT7A 1A3ZA 2GT9A 4H4NA 1R34A 1YSOA 2JVUA 3BD4A 1FVEB 1N6VA 2B3RA 4GW4B 4WSGA 3ZN6A 4OCWH 5ETUB 2P8LB 1U3HB 2ADGA 1EEZB 1T0NB 3ARWA 3NJNA 5SWSB 1T83A 2TSBA 4IKLA 4RBPK 2AV1A 4L8BA 4OZIE 5ILTH 4B6ZA 3QEQB 3MODL 1CGSH 4FCAA 4N9GA 4P2AA 1LP9A 1QAWA 4QXTA 4MVBD 4M7KH 5HHMB 1WIPA 1QFWL 4FTVD 3UYOD 4KTGA 2V2XB 4Y2LA 3NZ8A 4GSQA 5IB4B 4AENA 3GRWL 3MV7A 3P77B 4FNQA 4U6HA 4DH2A 3VD9A 4JG1H 3EBGA 4P5TD 4TNFA 3FDWA 2E27L 3DX9B 4NBZB 4Z9KB 1EXUA 5GJSL 1ZTXL 1IGCH 1JHKL 1TJHH 3OLIA 4Y9EA 3QUGA 1TXKA 5GS1B 3WIHL 1CB4A 4B9PA 1INQA 5E8DH 5F0PB 5EIIG 4AE1A 2CBMA 4PBWD 4UQ2B 4DFHA 2RHEA 1L9PA 2LHAA 3ZQXA 3QQ3A 1KGUA 4LHUB 5KS9B 4JPKH 3KPSA 2Y5QA 4HLJA 3GO1L 1LK2A 4OZFB 4N2BA 5BZDB 1L9TA 5IMOA 1MWAA 4NEHB 3K72A 4MNGB 1YEIL 4GFXA 4ES9A 2DOCA 1E4KA 5D7LD 1CICC 4PRAB 4Y4FC 5IQ7L 1RIVL 1KJ2B 3F7YB 3UTTE 2EVGA 1A3LH 4U7SA 4APQA 1KXQA 4PREA 4ZPVB 3APCA 1MCKA 1SM3L 3G5XB 4HBQA 4GMSL 4MAYD 4TQEH 2OBGA 1KNOA 2V0AA 3A0OA 5TE4L 1SUHA 5BVPL 4DVRL 3KYNB 5EZIL 4XHQA 4CRPA 1CT8A 4HGKC 2HRGA 2AEIT 4BH7A 5AWNH 5GGSY 2YQ2A 4NCC2 2FO4A 1RUKL 2VQUA 5A3ID 1YPZB 4AGNA 5AW2B 2PO6B 1FRGL 3GSWA 3QQ9D 5FYJE 5L4MA 1W9XA 2FECL 1DFXA 3C6EA 5SWQB 1FNAA 3T0BA 1WBXB 1WK0A 5D7HA 1B0GB 3ZKND 4DZ8A 4NC2B 4UIMB 1GCFA 1U3YA 4YC2B 1XGTB 3AS0A 3PWNA 4U3HA 1NAKH 4OJFL 3MMEB 2PCPA 4QXGL 4R2GD 1Q38A 4GLRH 3SYQA 5ADOL 4YR6A 1OP5K 3KR3L 3B5GA 3HE7B 4M5ZL 3ETTA 3P0YH 3L5WA 1KJVB 1NDTA 5D4JA 4TNGA 2BOCB 2BHFA 4MXWH 4JMNA 3DOSB 5E2VH 3S36X 5IM7A 3O6KH 5IZ7A 5SWZE 1BIIA 1BM3H 1D5IH 1S7RB 4DP1X 1IGTB 1J12A 1BQHA 1RZKH 1QHOA 4J12A 2J88H 1WCBA 3SE4A 4ADIA 2W81C 2WUBL 1NGZA 2P1YA 3MSPA 2Y36L 3BZFB 2I07A 3EJUA 4X42A 2NLJA 3A4DA 1RV6X 1FSKC 4YMPA 4FHJA 4EI5D 5CGBA 2FBJL 4OFKA 4WNQA 4YDVB 1B4RA 1A6UH 4G11A 2K45A 2OX5B 4WRLA 1NGQL 1WS8A 1ZY9A 5DD1L 2WWNA 4HJSA 4Y9GA 2CHZA 3BLKA 4PW9A 4JFHD 4NOBA 4DESA 1U2CA 5EU6A 4NKOA 3T2PA 5I0YA 3AT8A 4ZW6A 3T6QC 2EDEA 3ILPB 5FYLE 4N0FA 2VWEC 5BRQA 4KZEH 3IDYC 3TA3C 4L9LC 4JQIL 2NY4B 3ZUCA 4BHUA 4JFHE 4DGVH 1HE7A 3GDCA 5E5MA 4HS3B 4F9PC 2CHDA 2Q3XA 5L6YL 3ZE2B 2H32A 2DQIL 5E4EB 3MRKB 1N26A 3KLHC 1K3ZA 1V8HA 3IM1A 12E8H 3N9GH 4PG2A 2XWJB 4PJGB 5BRZD 5KVFH 1C9SA 4OLXH 4AH2A 4RVBA 2N7SA 1AS7A 2HA1A 3DO3A 2B1HH 1JPTH 3VSTA 1W72B 5GQBA 1V7NH 1UJ3B 1DJIA 2AJZA 3RE0A 1OB1A 4XWGL 1WISA 3QIWC 4OT1H 2AGJH 1NFIA 2VLRB 4RNRA 4J3UA 1A3RL 1RZKC 3NIFF 5B1JC 4BM7A 1UWEL 4XNZB 3L3HB 1BXVA 2FIRT 2Y7SA 4RGMC 2X4RA 5EO9A 1I8KA 5GRJH 2VIRA 3NIDF 2EC9U 4GRLA 3BPOB 3U1SL 2W65A 3V0VB 3BIBX 4KO9A 1GGUA 2WWMD 1NTDA 1S7UB 5TE6L 2FSEA 1L3NA 1QFOA 4NI6A 1O7SA 4BRVA 1KCVH 1TVDA 5HGDA 1E9PB 3P69A 4YVNA 2YD3A 3GSRA 4QRQB 4JN2A 2VLRD 1L0QA 1Q9KA 3K8LA 4DKDC 3SDYH 3CE1A 1LM8V 3K71B 4PJCB 3IU3B 4XP1L 2EIZA 4LLDA 4YE4L 5GGUA 4CVUA 1B4LA 1T20B 1XGRB 5J9PA 4XO3A 2I85A 4QRRA 3VRIB 1YYMH 3PJSB 4ANKA 4PJIE 4NI3A 4XMZA 1MJUH 4U1NB 1WZAA 2KBGA 2HG0A 1AZNA 3KVDD 1S7XA 3Q7JA 1G9NC 1RZ8A 1FG9C 1A25A 3JV0A 4YFDB 3AQYA 5T3XD 5A6MA 1OCWH 3VMOA 3ZE1F 5I8CB 1R6VA 2WGNB 4O02A 4OIBA 4RGOH 4OLXL 1CIUA 4F2ME 3ASNB 4NSKB 4M6AA 4XVSH 4Y5XC 3KZ8A 3GJFH 1GGIL 3L9EA 4I77L 3CZSA 1R9FA 1HEJC 1A4KA 3FO2B 1U92A 2MWCA 3EH1A 1NCDL 1NAKL 4OJFH 2YUWA 3LN5A 4U05A 3WTTA 2PR4H 2ZUVA 4EZLA 2QVMA 5DA4A 5ESVB 3V7AE 3AABA 2DWSA 4HP5A 4KQ3L 4M48H 3LXBA 1IAIH 2BSEA 4NWUH 1PFOA 3BPCB 5DS1A 3NCXA 4DSYA 5CP3A 1HL9A 2EKSB 3ULUH 1OF0A 4L1BA 4QCIA 5J3HD 5GZOA 4DF9A 4LVNB 3B3IB 5GS0D 5DJ6A 5BZWA 3TV8A 2CBPA 2OR8A 3L16A 1EJ6A 2J5LB 2Z91A 2YA1A 4GNKB 2VISA 4WK4B 1PY0A 4OZIA 5T3ZE 4KMQA 3KW7A 1G1KA 4WFFD 3ZO9A 1WT5C 2MQCA 1KPUB 5E9DD 4XPTH 4ZUTB 2F08A 4CW1B 4AT6B 1S9WB 1MCJA 5JLZA 2GUYA 1VPOL 3F62A 3RVTC 3TBVA 1YECH 3MREB 3DDGA 1AZBA 3UBHA 3WTXA 3HMXA 5PAZA 3O3AA 2VDLH 4PI2A 4R5VA 3L3DA 1FGVL 5HHOE 4NO3B 2EYSB 3FS9A 1ETA1 2O26U 4TNEA 3AADB 3E3QC 4K7PL 4HJ0C 3DOIA 1KENH 4OGAC 5DTFA 1UXSA 3HC3L 4FMVA 1YMMD 1E4HA 4JFFD 4PRNB 1ONQA 2G0LA 3WNJA 1BZDA 2AFNA 1VCAA 2GJJA 1MAMH 5IVNA 2W07B 1UWGH 4CMMB 3QAZC 1RZJL 3MUUA 3ET9F 2ZJSL 3U2SA 1NCWH 4HW6A 3IS0X 3KGTA 2OK0H 2D3VA 1UT1A 3RVXC 3LNGA 1A7BA 2GC4C 3BT2L 4WI7A 3TT3H 2VDRB 1RUQL 1JV2B 2GB2A 3E1ZA 5FK9A 5HHNB 3PXLA 2VSMB 2XZAL 1G94A 3FN9A 4XN8A 5IR1A 3PWLA 4F57H 1JSYA 1Y0LB 2ALWA 1QSEE 1PL3A 2VZ3A 3H1ZA 3B43A 3NGBC 1XZ0B 3IMVA 2X4SA 4X9IA 3PWUB 1O0VA 1JZ8A 4DUVA 3IWVA 3JWNE 4OSUL 1OIOA 4P4KD 4HMEA 2Q3AA 4Y4FB 4A68A 5DK2B 1PZ5A 3MLSL 5EUOE 1J5IA 4QRPA 4BBWA 4PJ9C 2W9LA 3MOAH 4PS4L 3PHOA 5CINL 5J7CC 3A23A 5TE4H 1I1AB 4L1LA 3IDGA 5F89B 4P2QA 1T1XB 2XPGA 4L3CB 1V3LA 3UP1A 4ZUSB 5IB1A 4JFDE 4KROD 5E7FA 2EDTA 4LARH 4XN5A 3ZL1A 1BM7A 2VM9A 2HLFD 3EDDA 5LBSH 1ERNA 2WXLA 2Q8AH 1YG9A 2H7WA 3B9KA 1G7HB 3PGCA 5IB5A 1Q0YH 3R06A 3CU7A 1HYSD 4ABWA 1QFHA 3X11A 1IZJA 3PCYA 4H25B 1E65A 5D7SH 5EN2A 1Y1UA 2EQDA 1YQ2A 2GSMB 2IGFH 3WHXA 4KKBD 4GBXD 2R2EA 3T1WA 1PS3A 3C8KA 4PUBH 1G7JB 2NZIA 3O6KL 4TTDD 4U1IB 2WNWA 3QORA 2WZPD 3DRQA 3QJUB 4PRBB 2V9RA 1TR7A 3D25A 2IH1A 3JV4B 4NRYB 3GMOB 4KRPD 4EXPX 4X7SH 4BZ1H 4JDEA 5TDNB 3ARRA 5KJRL 3GI9L 3HEIB 2VDQH 4HFUL 1F3JA 1Z0MA 2BW5A 4PP2A 1EO5A 2AZAA 1MN4A 3IDMB 1UA6L 3D50A 5EC1B 5MP6L 2VQ1B 1NLBL 3MJ7A 2VN5A 4HKZB 1BMZA 4KVPA 2OXGA 2IJ0C 1UYWH 1ETZA 1S5IH 2QPEB 2GIXA 1VB9A 3HAEH 5AWNL 2GJPA 3U30C 2Z4QA 4XI5C 5KSBB 1ZPLA 3OX8A 4PJDB 4W9CC 4P2RE 1FL3A 5HGBB 3HFFA 3H9ZA 3T4AC 3VFOA 4DUWA 3APNA 1FNGB 3C60D 4HX1A 1KTKE 1OXYA 4WAFA 5CBEA 5C6TL 4IQHA 4JANA 3RGVA 1T20A 3QRBA 4XAWL 2GK0B 1DDTA 4UQAA 2XA8H 4H20L 5F21B 3C12A 5L6YH 3BPOC 4FDWA 3WHE0 3DYMA 3IGAB 2IG2L 4G6MH 4F93B 2OSLB 4UTBH 4G8EA 4DHLA 4EN3A 1VZGA 1HWHB 3C08L 3WNKA 3FU6A 1UZGA 2FSDA 1JS4A 2O5XL 4M1CC 5E2TH 3QUXA 2IV8A 1MJJA 3C60B 4DK6A 2QTEA 3HB3D 1F2QA 4HSCX 1F97A 1MLBB 5B39G 1UFGA 2WLZA 4Q6IA 3LYRA 2X4TB 3UO8B 2UYLB 3SDAD 5I71B 1O6SA 3SKOA 5E24E 4WO4B 2IF7A 4HD9A 4N0RA 3B2DC 3H9HB 2YRBA 4MQTB 3KG5A 4KI5F 2DMBA 2IQAA 3PP3H 1NSNH 3AREA 2UXTA 3MRGA 2J20A 1GPOL 4XBEH 5TF0A 5IJKA 2F7RA 5F96H 5LO7A 1PTZA 4ODUB 2VERA 4PRHA 2O6CA 3B3IA 4LF3B 1WE5A 2YRPA 3SEPA 4QUOA 4NQDB 2ED7A 2F7PA 2XN1A 9CGTA 5F3BA 4X5RA 1NGXA 4PHXA 4Q6YA 2WQSA 2IDTA 4QOKB 3VG9B 4AY0A 4AL8L 1AHWC 4RFEA 4FABL 4APQB 5FIEA 4JPVL 4JHAL 3TEUA 3Q2LA 1NCAH 4R90L 1T66D 3BGMB 3H3PL 3MJWA 1A9BB 3L95B 1AMXA 3UTQB 1O6TA 2XT1B 4UMSA 1L7TL 2GJ6A 3VI3F 1UXLA 1XX9C 2XQYA 1AO7B 3K46A 5JA8B 3EJRA 4WVRA 3BAKA 2X4NB 3G6DH 1Z0NA 2NY6B 2YAMA 4ICXA 2PXYB 3P4MB 1G7IA 3PP4L 3KVPA 2Q20A 2DYPA 2ESVA 3RU8H 1CXFA 4O51B 1WEJL 3J7HA 1KIRA 5DUPL 1QSEB 4BWWA 1XIWA 3ARVA 3OGOE 3K6NA 2R69L 1QZNA 2K1MA 3VYPA 4PLNC 5HTSA 2ZUYA 1ZVHA 3Q6FA 1CZ8H 3MV7D 4YEEA 3BW9B 2Y1AA 1TF4A 4EUPH 4W9ZA 4Z77B 2FNBA 3CH1B 4J3VA 4ZW7A 4A7VA 5HYJB 1OGSA 3OPZH 3U7AA 4G7YH 1WRFA 3ZOAA 1M6UA 1U95B 1M7XA 3O2DH 4ZW8A 3O9WC 3PWVB 3STZA 1PYWA 5D2LA 4JHVA 5IF0A 5H4ZA 2NXYD 5F7EL 1KG0A 3MKKA 1L0XA 3RJDA 2QHRL 3WEMA 4TVPL 3IMBA 2H8PB 5E8EA 4IYKA 2ZXBA 4OGXH 4N0YL 4K3DL 4AGPA 1YECL 5HHXH 4QT5B 5IEKA 2BNUB 4S10A 3MRJB 2DL2A 2FDBP 3UBXI 4DP2X 4ZPTA 3ML8A 5EZJB 3HG1A 2P26A 2HVJB 1AOHA 5EDXA 3OZLA 5D1XC 1MFNA 2CGRH 2X9YA 3H9YA 1IGMH 5IK3A 2BC4A 2NY1D 4KHXL 4IBQA 5TQ2L 2ENJA 2ICWI 1D7CA 3US9A 3WNIA 1I3RA 3SCMD 2ZOLB 2QQNL 3HTLX 3W9DB 4HSAC 5G55A 2IQAB 1U21A 4OD3H 1FN4A 5IFAH 3FQUA 2ZKHL 3MRMB 2QPUA 3FMGH 3H9HA 2CPUA 4PLKD 4JZNB 4ODTL 4H7VA 5EO9B 4F27A 1E43A 1CMOA 2XWXA 2QSCH 5HYSG 1AJ7H 3BCFA 3L54A 2V8MA 5ACLA 4CVXA 1NDMA 2YUVA 3KVQA 3QRFM 4QRUA 4F1ZA 5BOZG 2VLJB 1LP9F 1I9RH 2AGJL 1DLHB 1MELA 2AJZB 4ZQKA 1BQKA 2I26N 4R8WH 4GT0A 3TYGH 1C5DB 1MFCL 4JFWA 4KVNH 5IW6B 3W2DH 1YEJH 4Q9RH 1JPSH 2PXYC 1U8CA 1UOWA 5JR1H 2FBOJ 3GXIA 1CLVA 4GRMB 4EZKA 1IFHH 4YDIH 2OMXB 4X7EC 1FO0A 3UDWC 3R0MA 5C71A 3UAJA 1NGZB 1EZUA 4HUWA 3NTCL 5FO8B 4M3JA 3LZFH 4Q0XL 4H8UA 3V9EA 3FU9A 1NANH 3QUXD 4LF3A 2OMTA 4OIAA 1WG3A 1A4AA 1G6RB 2OJ1A 1AI1L 4P5SA 4PJCE 4MAZA 2AJXH 4JKPL 3CIAA 4KO6A 1NMCB 5IG7B 3ZTJG 2PTTB 2ZXEB 2WQUA 2WN3A 4PJ8A 1J1OL 1SYVB 4HKZA 4GPVA 5EUKA 1NKOA 1LO3L 3G6JA 4NN5B 5F93C 2LVCA 3J27A 4GW4A 3II2A 3U4EB 3CX2A 4XTRD 2XKSA 5J12C 1OAUL 2IV9A 3L9RA 3EO0B 2CLZA 5A3IC 1OSZB 1LO0H 1KULA 2WO3B 1J8HB 1OHZA 4GKNB 4UQ9A 3SD2A 2WKOF 2Z92A 1FBIL 4UINH 2GSGA 2ENPA 3WXVL 1F4XH 4L4VA 3RFZB 4Q14A 3PFUA 4Z6AT 1G1YA 1P1ZA 3EFFB 4FEIA 4ETQB 1YEHL 2ZYHA 3UTSB 1HK6A 1EGJH 2C3VB 5EO0B 4F91B 4QRFA 5D71H 1KGCD 2NR6A 4E41A 1RIHL 2WVVA 5BRZE 2FL5A 3ZVVA 1KFAL 2FRGP 4KKQA 2EDQA 1U3HD 3G5XA 3FF7A 1OARH 4L3EB 4JJHA 4NKDB 4BFKA 4EMZA 1EEZA 1T0NA 3QFDA 3EIFA 5SWSA 5L0QC 3A5VA 2GKIA 1FL6B 2MTAA 4U2ZA 2G5BA 3KPRA 3BGMA 2IBZX 1XCWA 3BP6B 4ZW5A 2WYIA 2XNAB 4MMXA 3K6IA 4WWPA 5TE7L 2VYRE 1B2WH 2BSTA 4AKQA 5GJTH 3K4ZA 4L4TA 4NPJA 2NW3A 3QCVH 3SE9H 3KPOA 4LKXB 4P9ML 3T4AB 1RUKH 4Z7UB 4LB8A 4OW6A 2CLVB 4IW4C 1NFDF 2V3DA 1G6RL 4I0PD 1AH1A 4L8DA 4NAMA 4XNMA 5C0CB 5BOPA 3L3GA 2AXGA 5ICYA 2Q10A 4EXKA 4RBPH 3X14B 4EDWL 2OL3L 3U4BL 2OPCA 1WGVA 1TVHA 3IXTA 3LN4B 4O58L 1ZHKA 4LLMA 3P9LB 4L2YA 2X4UB 4PMEA 3T0VA 3CD4A 3DURA 1G7JA 3TA3D 4X99A 3MLRL 2BVTA 2R2HB 3QG7H 1NMAH 3OG4B 5E6UB 2W59A 4KWUA 1RURL 1I7UA 3ECBB 1CD9B 2FJFB 3ARQA 4R7DA 1WVZA 1J87A 5FFOA 5SX5K 3UYRL 4F7PB 1N3NA 2EXWD 5L2JA 2R9HC 5TK4A 4JR9H 2JLLA 3TO2A 3OR7B 1MCWW 4DEPC 4DK5A 4L9LB 3NFNA 1DVUA 2V4LA 5E6IC 3VRJB 3Q5YA 4H1LA 3IAGC 4JKLA 3RWJA 3PUUA 1A9VA 3DETC 3HG3A 4FI8A 4PW4A 1QW8A 1DE4B 1NJ9B 1N10A 3QIWD 1LEIB 4DGIH 2DJUA 1I7TA 3FT3B 3BRFA 3DSFL 2XPYA 2BY3A 5GGSA 3DGDA 5B8CC 3KPOB 4LKXA 1RZQA 5CBEB 3W0WB 4U3SA 3WE6A 1IGYB 2F74B 4CMHB 4UM9B 4Y19E 1DBKH 1SJMA 2Y23A 2YPLA 4XE5B 3RLSA 1WIUA 3K5RA 1H3XA 4M6NL 4ODHL 4WZ9A 4D0CA 2A2QT 1ZV2A 1MJUL 4NKDA 3V9CA 5IGXH 1BWMA 4IJ3B 4U6TA 2ZSWA 3HA0A 1P9MC 1AXTL 5K9OB 1GGTA 5JXAH 4XN7A 1J1XL 4BSVB 1ZVSB 3LPOA 1JGEB 2YN3A 4DFIA 3QIUD 2E4TA 2IADA 3KWXA 4K7PH 3D52A 2A3TA 4XCNA 3QDGE 1X7QA 4OFPA 3C2SA 1IO4C 1L0YA 4I5BA 4LLWA 1IRAY 3UTSA 3VXUA 2WNGA 1JGUL 1C12A 1DFBL 5TDOA 1V10A 4FQ2H 1N9PA 1ILSA 1JTTA 1PBYA 3EYOA 2AQ3A 3OAUH 1OAQL 2V7HA 1RUQH 1LJMA 1LO0L 3DHJA 2QADD 2JKWA 1UG9A 1ZJAA 1J7VR 2E47A 2HUEA 4LGSB 2J72A 2YPKA 4EOWL 1I53A 1OPOA 4JHWH 3EO9L 4F7EB 3JT0A 4OLZH 3KPTA 2NT1A 3OLDA 3VFWB 3VI3A 3HHSB 3ZK0A 2J8UA 4IM8A 4GW1A 1B90A 2OR7A 3BSZA 3PUCA 2G9HA 2BIHA 3S2AA 3X17A 2Y1YA 3FCSA 5L2KE 3EGDA 1LEKA 5AW5B 4N5UA 2X9WA 2QZ5A 3VD4A 3GBNL 4NRZB 1TZHA 4WV1B 4F2FA 1JP5A 1OEZW 3KPQA 4HZAA 1QA9A 1F56A 4GRWE 5ITFB 4B3EA 1GZQA 3CUPA 4RFEB 3LKNB 5TPWL 4ODHH 4AI7A 4CN6A 3TBCA 3UX9B 5KVGH 1MCQA 5KVGL 2YPLD 3K6SB 5I5IA 4MMYB 5D1ZB 4EQ3A 4WUUD 3GXTA 4PJ7B 4WTZA 1MFDH 3WEXA 3GHBH 1MI5E 5CBAA 2YN5A 3V52H 3UACA 5C09E 1U3HC 1P7QB 1INDL 4LDOB 4PJ5D 4KHTL 5D1QB 3SODB 2J5LC 1AXSB 3M86A 5C3TA 1FH5L 5I1LA 2DQEH 2HKFH 3H54A 3VXRD 3EZJB 4X7CC 4I48A 4HUUB 1O6SB 1RXLA 2DEXX 2L7QA 4HEPA 3CFUA 2G30A 4L3ED 4ELKB 5DD5L 2BCMA 2VLMD 1Q94A 2EXYD 6FABH 5IJVB 3L5JA 3Q01A 1KY6A 4JRXE 2XV6B 3OV6A 4AQAA 4UILL 3KPMA 1A6AB 5CD3B 1CTOA 3AG3B 1PJWA 3CC5B 4AMKL 4FNSA 2BC4B 3ZL4L 3Q3GA 5I5JA 3VUAA 3AWFA 5JQ6H 1E8YA 3OB8A 3VXRB 3GTNA 4OZGB 1KTDA 1F4HA 1CBJA 2X1QA 1Z1WA 4P9HC 5HHOD 2AV7A 2OTWB 3OMIB 4QRRB 1Q72L 4XN4A 3U0PB 3VRLE 3HMWH 4JRYA 5DRXB 1UKSA 3RX9A 1TTAA 3RWEA 3SPHA 4LEEA 3K71A 2K9UA 5GSVB 3ZDYF 1NLDL 3TFKD 3RUGF 3FQXB 4S0HA 2DV6A 3DX6A 2BK8A 4LLYA 4CNIB 4JQVC 4RWHA 1I9IH 4JE4B 2PPDA 3MJGX 1SHMA 3HRZC 5TQ0H 5ISZB 1ZDSA 4NRZA 3UTTD 5A2AA 4ZMAT 4L1SA 3O4LD 3FBQA 3TYFA 3CSTA 5BRZA 2CGYA 3VXSB 4RMVA 2HYMA 4YDLC 1KIUB 4UUJB 4G6JH 5KS9E 1MWOA 2A9NL 4QTFA 4F7EA 2LFEA 4PTUA 5IMKB 4KPHH 3WU1A 2A74A 3BW9A 3VSQA 1S6NA 4GINA 1PX8A 3MLTA 4X9YA 1RUPH 3UJJH 3ZHLA 4AQ8A 1NFKA 4KUCF 1KN2H 3V7AG 2XDHA 2Q3ZA 3VFMA 1MQKH 2HFFA 4HJJL 5CBAB 2ZF9A 3K6FA 3WXVH 5F9OH 3RVWD 1BA9A 1OF2A 4G5AA 3TESA 1RURH 3P4MA 4ZX6A 1EFXA 2VERN 4KQ4H 4Y16A 1EGJL 4LEXH 4EIUA 3D4YA 1KJ3L 3LH2H 3RTQD 2J4WL 1MG3C 4XVUD 4WW1B 5FA3A 1JZFA 2R29H 1DUZA 1RP8A 3KL3A 3WEAA 4UV4H 4X6FA 1SQ2N 3BJ91 2D31B 2EIEA 4OVUA 2ZPKH 1J11A 3DX6B 4BH8A 2I7SA 2EXSA 3SOTA 3BE1L 1LD9B 4UQIM 5EOCH 1C8PA 3G6JE 4FFZH 4JM4H 1QRND 1PAMA 1QNZL 3HHRB 4XNYL 5DD0L 1QNZH 4XNYH 2WLNA 3MR9B 5DD0H 2NXZD 4IRJA 2D03L 2FO4B 3B2UD 3SE9L 4DTGL 2Q76A 3KYOB 4IDLA 1KSRA 2NY1C 2CLRB 5J11C 1SOXA 3GI8L 5AVVB 4HJTA 1BYNA 3LKSB 2ATAA 3G5YA 1VIWA 3IN2A 3VFSB 3ZQWA 3WLWC 1FL5B 4EDWH 3LKNA 2DI7A 4U1GB 5JPNB 4DPRA 1RLBA 4OLYL 5C6WH 3UCRA 3D51A 1FG2B 1IAIM 3UJTL 1DQML 4Z3JA 1JGLL 2W0KA 1G0DA 3O45B 1F6FB 1MQKL 1JXJA 1CK0H 3CFEB 4FNLH 5ANME 3DV4B 1JV2A 2G9HB 5ID1A 2YAFA 2P7TB 1WFTA 2VN4A 2EDFA 3CFJA 3D0LB 4OUOA 5BNXD 1IAOA 2H3NA 2IO5A 4ZUWA 2YOCA 4QRSB 5FGCB 2X09A 4LSTH 4L0ZA 4OF3A 3EG9A 4YDLB 2C3HA 4ZFQA 2YXMA 1AO7D 4KQ3H 1KZYA 1KPRB 4JDVB 4CUCA 5JPMC 1A14H 1FI8C 5DWUL 3KJ4B 3IKCA 3QPXH 4FQQB 4AZ8A 4K07A 4NP4L 2CLVA 4H0IA 4MJJA 2F6AA 2ZXWB 2NW3B 3DX7A 3IJEA 3LEVH 4IHOA 4F9LC 1V7ML 3C09B 3F7QA 4BK5A 1ZT1B 2B5IB 3IJHA 4QHUB 3HS0B 5HHXL 3E6FA 3R1GL 3MX0A 4FLQA 3VRJA 3G6JB 2UY7A 4E9WA 3U46A 2EUZA 4HUNB 1XCQB 3FW6A 1NC4A 3ZE0B 2D9CA 5I9QB 5T5FA 3LPPA 2P5EB 4AGLA 2MNWA 3PGDB 4ZNEE 4M1GH 2CO1A 5EBGA 2CIKA 1RFDH 3QC5X 4WNSA 1PD6A 1N5AA 1PW3A 1DJZA 3DRQB 2NXZB 1EIBA 2XFXA 2H1PH 3LIUA 4OJYA 4ZDHB 1NMAL 3ROLB 3C2AH 4P23C 1ZLWK 2YGQA 4K15A 2L0DA 5IVXE 1H5BC 3F01A 2C4FT 5IBLC 2WY3B 4GXUM 4PEEA 3OR6B 1BCIA 1EFQA 3D0AA 1U8MA 3QPKA 4GKOA 4U6VL 4YPGA 6FABL 2MH4A 1HDMA 2GBTA 3D69A 4BE6A 4FNPA 2JIXD 2F5BH 2WK2A 4LRIC 2FAUA 3BAWA 2UUDK 3GIZH 4YHPB 2VKWA 3DTUB 3CFEA 1YNTF 3NBNA 3RVUD 4GI6A 2I60L 1OM3H 2CR3A 5JQ6L 5I1JL 4YFLI 1MDTA 2WBJA 4YHYC 1JV5A 3E2HB 4JG0H 4IOSA 5DJXB 1IKFH 2XG5B 4BK8A 5DVMA 5JPNA 1AOZA 4AYSA 4ANVA 4Y19A 3ZKMC 2GITB 1DO5A 4XP4H 2BXZA 5IWLC 1DQJA 3L3GB 2NNAA 2PLTA 5C0CA 2ITDB 2JF1A 5BRPA 4EIBA 2BFVL 4HH9A 1EDHA 2A77L 3UO1L 4KNUA 1UOLA 1X5XA 4HHAB 5ESAB 4AYFA 2AJXL 1ZSDB 2CAKA 1WBZA 4JKPH 4HU2A 4F15B 1TPXC 1BFOB 4JFQB 4NQEE 3RFZA 2IAMB 4LCYB 4OZGE 5JIPA 3F7KA 4Y4FD 3RWHA 1WWCA 1T6VN 1MCRA 1N3NB 5J6SA 4Y4HC 4B53A 1PKQB 1T2QL 3DK2A 4ORGA 1I7UB 3ECBA 1A22B 3MV9E 3HC0B 2O6DA 5D7EA 3T8MA 1PG7X 2X4RB 1A21A 5I1KH 5D2NB 4FQXB 3OAUL 1TJMA 5HI3C 1NANI 4G6AD 5FO9B 3EYUL 3LH8A 2CBQA 4GUQA 4LL4A 4Y9FA 1JVKA 1MRFH 1YN6B 4HKXB 1UD5A 4YDZA 5KVFE 4YIQA 3S37L 3OZ9H 4HA1A 4JFXB 5J6HB 2HTKD 4YBLB 3SPVB 2NX5B 1KACB 2GSIB 3LKPA 2HZHA 5GSRB 4R5XA 4Z0XA 4L2LA 1UXSB 3BQUA 3MV8E 3D07A 5CFHA 1Z3GH 3L3IA 3MO1A 5T3ZL 3D0VB 3TIEB 4X7DC 3HBQA 4FNUA 5FOBB 2VMCA 3PPEA 5GRUH 2AP2A 4GKSB 3U1SH 3MNDA 3ZRFC 4KKPA 3C87A 3C6LD 4ZPTB 4HH8A 3QWOA 5AKVA 2MCPL 1CTMA 1BD2B 2KZ1B 1HXYA 4A1RA 3MUJA 2QKIC 1K4DA 3D09A 1MRDH 1XGYH 5IROC 2YMOA 4M7LT 3PWVA 1REIA 1DBKL 5LG6A 5GGVY 2H9GB 4G9FD 4JO2H 1WAEA 5CCHE 1J1PH 1NCCH 4I13B 4WW2A 1YNKH 2H4EA 4YHYB 5DS2A 4S0SD 3MRMA 3H3PH 3BUIA 4G7VH 5JXAL 3IMWA 4WTZG 2WKLA 4OBSA 3FL7A 1QPXA 4Z78A 3Q44A 2DWDB 1CFVL 1NCBH 3OKDA 2E4FA 3LSOB 4Y4KB 1XIWB 5HDQH 4FXKA 1LDSA 3B9VA 3AQXA 1Z9SB 1AIFB 3AREB 1AGEB 4XC1L 4F9PA 4P5TB 2XI9A 1TPXB 4HEPG 3ATDA 5ID1B 4MNHB 4L37B 5LHDA 4O02B 4HJEA 3QDGB 5F1IB 5C08D 2XN9D 1J9QA 3JWOC 4XCEA 2E9GA 4XWOC 1I1YA 3EDFA 3PWJA 2YLHA 4ODBD 3A3YB 2HMID 1MJJB 3C60A 4WI3A 3ZDXB 1NMBH 4JE0A 5DZOA 3HN5A 4BYHA 4R7LA 3V5DA 3H6JA 4G71B 2P5ED 5EOTA 1A6WL 2PP8A 1IV8A 3KEDA 5C0NC 4M1CD 1XGRA 5D93B 3FB5B 1ZS8B 3CQQA 2WLIA 1M6OB 4OJDH 4Q2ZA 5DQ9B 3I2CH 1WBZB 1L9NA 1HSAA 5TE7H 5D70H 5HI3D 2ZCZA 3SDXA 1OE1A 3RWDA 5C0JA 3Q2WA 2QDVA 2HJLA 3CFCH 3WEXB 1BOYA 4OCRH 5F71A 3M17B 5JHMA 3NFSH 4HG4J 5DT1L 4Z7WB 1Q0XL 4DCQA 2VDKL 3ISWA 3UTZB 5I17A 3OAYK 4F8QA 4FG4A 1NCAL 2NMSA 3P3UA 4R90H 1KJ2A 1XZWA 1IBDA 3TNNA 4V1DA 1ZHBB 1YYLL 2F54E 3QQ4B 3T1FA 4A7GF 4QMEA 1QSEA 5G4NA 5ANMA 2FGWL 1M2VB 3ARGD 3E9TA 3K91A 4BH8B 2AKRA 1R24A 2K3TA 1ZA6A 4K7FA 4LOEA 3QZWB 4MHHI 4U3XA 5D9SA 3QORD 2WZPA 5JPMB 4OQ1A 2EXYC 4XCYA 3GNML 2FHCA 4KNSA 3T0XA 4ELMA 1KTBA 3HKFA 3OC5A 3QQ3B 4YHOH 4B9JA 1WO2A 1NCOA 3BC9A 3VXQA 5E5RB 4OT1L 4A2MA 4PGCB 4MA7H 4HXBH 5FGBA 2H6OA 1HHJB 5I1IH 5AVTB 1K72A 1T80A 4JM2C 4NUJB 3PE9A 5LKNA 4PLJC 4JDEB 4G8AC 4ODTH 4AVHA 1IBHA 3DX9A 4J3BA 4KJWD 5AW1B 1CD0A 1DVFB 1NMBL 4HPYL 3Q8AA 1KB5H 4OB5L 2NNFA 2R7EA 2HX7A 2G4EA 2B4CH 3I9GL 3MV7E 3V10A 4I8DA 3II1A 4BWUA 1BBJA 1JPGB 1AQDA 3I84A 1I75A 4X6DF 2H2PD 5EU7C 1M7DB 2AABH 5EF0A 4G8IA 2VMFA 4IS6B 2UVFA 5D7LA 1TQUA 3MROB 3A47A 1SGKA 2P45B 5EBLA 1F3RB 2LU3A 1HH6A 1AE6L 5L2KD 3L48A 3V0JA 4IGBA 4ABUA 1NKGA 1IBYA 3VJ6B 3CMGA 4AC2A 1X4XA 4EI6A 1U8OA 1FC2D 4LNRA 3DO7A 1IJ9A 2UY6B 3JTTA 4P2YA 1XO8A 3PNRB 3HAEA 5CF3A 2MTPA 2JKLA 2VE6B 4NBXB 2YMXH 4DERA 4MBOA 3OHMB 4BKTC 1FAKT 2ZXQA 1I3VA 2XU9A 3DJRA 1Q0YL 1WA0X 3D30A 1QQDB 5F89A 5IBTH 5AW6B 3AGWA 4YXKL 1DFBH 1AQMA 1AG6A 2UWEA 5C0ND 5EEXA 4KKZA 1T66C 4MA7L 1ZT4B 2ZXAA 1O5PA 5I6XC 4OLVH 5IB2B 4IBLT 3NT0A 5JHAA 1CFVH 3TCXA 4WO4A 4JANB 4OF7A 4RGND 3ETSA 3QUHA 2VDOL 4R0LA 4TYUA 2PUQT 4IDJH 1XF2A 2I5YL 4KK9D 2BW4A 5ALBL 4BZ2H 3D12B 4C4BA 4JCWA 1BZOA 5JIQA 3V7MA 3RG1C 1QI4A 3ZDXE 3WL9A 5J1TC 1D5BB 1BJMA 1UUNA 5DFVC 5FK9B 2K6ZA 5HHNA 2CQVA 3PFQA 3ARTA 2UX6A 5FW8A 1CXIA 1Z3GL 3OHXC 4LP4A 2R23B 4R8WL 4QY8A 3TXAA 1F0LA 4JQXC 4IOSD 3UPRB 3WJMA 3ZT5A 3FRPG 2CALA 5IQMA