2ZOTA

Crystal structure of human f-spondin reeler domain (fragment 1)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
141
structure length
138
Chain Sequence
CSRILRAQGTRREGYTEFSLRVEGDPDFYKPGTSYRVTLSAAPPSYFRGFTLIALRENREEEDHAGTFQIIDEEETQFMSNCPVAVTESTPRRRTRIQVFWIAPPAGTGCVILKASIVQKRIIYFQDEGSLTKKLCEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Spondin-1
publication title Structure of the F-spondin reeler domain reveals a unique beta-sandwich fold with a deformable disulfide-bonded loop
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 138
sequence length 141
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02014 Reeler Reeler domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4060 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2zotA00
2ZOTA 2ZOUA 3COOA
chains in the Genus database with same CATH superfamily
2XVGA 2HYMA 3QVAA 2FHFA 1ZLDA 2YAHA 4OFIA 3T3ME 1YY8A 2A99A 5KVGL 1YEHL 2BNRD 1AR1C 3AT8A 4ABQA 3VFOA 1BVLA 1Q72H 3OL2A 3A6BL 4F8LA 1WT5A 3CVHA 5LGJB 1RZ8B 5IFJA 2BVPB 3MSPA 3SKUD 1KWGA 1JZFA 5FUCC 4EF3A 1MFNA 1THCA 3PGDB 4WUUE 1KYOJ 1HXYA 1PG7L 2EVFA 4FE9A 1AKPA 1H8LA 4W68A 3UH8A 3PL6C 5AAPA 4NHCH 2GFBB 3MZGB 4Q0XH 3HMXL 4LLWB 3B83A 1E42A 4LCCA 1H6UA 4M6OH 4BSWB 4YWGL 3T04D 5HYSA 5DFAA 3GB7B 3WNIA 2BRRL 2OZNA 3OPUA 3BW9A 4PV8B 4BJLA 1J1OH 4EVNB 4AYSA 4Y8AA 2FT7A 5T1DL 1OALA 3T6WA 2G0KA 1YYLL 3HA0A 3KS0J 3HG1E 2GVYA 2O5XH 2X10A 4PWFA 1SXAA 2RH0A 4LDCA 2IDCA 5GRWA 3T2QA 1INEL 4EBQH 4JFDE 1M1XA 3WYRA 2I9LB 2AJYL 4B50A 2FBRA 3KYKL 4JCWA 3Q1EA 4UTBA 2VLKA 1RJYB 3OLEA 4U7KA 3W9EB 5IVZA 1L0QA 4C83B 2E9IA 3GSUB 1ND0A 4KKLD 3SJVD 5IIEA 1LP9E 1W6WA 3B3IB 3ZTDC 4XAWH 3U83A 4PHXA 4LVNC 5I1HH 5KSBB 1M9WA 2K6ZA 2ZKHL 5A2BA 3H9SD 4L8SC 3BOVA 4U3SA 3DETD 2RACA 1P84K 1RURH 2F19L 3WHXA 2BFGA 3VJ6A 4XNDA 4E36A 3QJRB 1XCXA 4O5LL 4QRRB 3T0EC 3V5DA 3UAJD 4EN3D 1U8QB 5D1QC 5GRUL 5IBLC 4BFJA 4ONHA 7FABH 1JXKA 1SHWA 5K1NA 2J6EL 1HH6A 2XYCA 1NWPA 2WWNA 2Z7UA 1AD0B 3I9GL 4YR6B 2CLVA 1NAKL 4OQ1A 4AMWA 5ITBH 4NKMB 1DYZA 4UT6L 2AQRA 1CICD 1WCQA 4NAJA 4R2GC 1S9XA 5JHDE 1QSFA 1FPTH 3MI6A 4BFIA 2LE9A 2WP3T 5INDB 2OMZA 3OKLB 1EHNA 3BXNA 5MEND 3RVWC 3AGWA 3WIHA 3TBWA 1X6NA 5E6RB 1UA7A 3MJ9H 2J88L 2G9HB 4DEPC 2EDJA 3U6XA 1CFQA 1CD1A 4M3KB 4KROB 5I8KH 1VFUA 4M7LT 1AFVL 1IC5L 4LHJB 5BVPL 3HG4A 1CDJA 2VXSL 5KSAC 5C09A 2IMNA 4L9LB 4C56D 4OBSA 3T65A 4JVWA 2R29H 4F3FB 1FYTD 5K9OB 2W95A 1UTDA 3RL2A 5GGUB 2WXJA 5F1IA 1UB5A 3WD5L 5E2TL 2XETA 3UMTA 3WJLC 4DPRA 1NGQH 3FW6A 5E4IA 3VB9A 3BYYA 4O58H 1JBJA 3BAJA 5BO1H 3TEUA 3B8YA 3I74A 1EDYA 2UZXB 4X9HA 4QHNB 4LVOC 2Q2EB 4OAWB 4CVWA 1ZCRA 2J8UE 3S4SG 4NQXA 3WFBL 1X4ZA 4OF5A 4PLKC 4UF7C 3MFGB 1LEIA 2F74B 4RNRA 4WFHE 1ONQA 3KM1A 4LRIC 4XNYL 2FT8A 1G6RH 1I1FB 4FERA 5FHAL 3GBNH 4TLTA 1FFPB 3GUFA 4TNVF 4JMNA 3OR6A 4NQSB 2XWJA 2F68X 1XVSA 5FOJA 1Y6KR 5C0BA 4AQEA 1CD8A 1WBZA 2BVOA 3QS3A 1TNNA 2R56L 4L1DA 2V9TA 2ZOKB 2HFFA 4FXKB 1IAKA 1A0QH 2NY6C 2BIIA 5LO7A 4N8VG 1IJNA 1TQSA 2JH2A 4G43A 1CGTA 4Z7OB 1T20B 1P7QD 3C8HA 1E40A 1H8SA 3BX7C 4GOSA 5IJKA 4LLYA 2V2TB 1JPGA 2G9KA 1DUYA 4QT5B 4LESA 1KBVA 4AQ1C 5A6IA 2FWUA 1U3HB 4Q6IA 5I1IL 3RUGA 3PCYA 2X6UA 3CHRA 3G6DH 2EINB 1Q0XH 1I7ZB 1FHGA 1JGVH 1C08A 1I4FA 1YN6A 2EH7H 2VXUL 5C0AE 4MB3A 3RWJA 4HPOL 2V9QA 2WJ5A 4YHZL 4XNQB 4GSXA 1G1YA 3QQ4B 2EC9U 5E08H 1MN4A 1CFNB 3O2VL 1YA5A 4PJGF 4PJFF 1UB6A 1SJMA 3H6JA 3MX0B 3MRMB 2ISDA 3M86A 4D8OA 4Y5XB 3V6OA 3V95A 1I8LA 1XB3A 2DD8L 3I9PA 5IVXE 4KBPA 1GL4B 1M3IA 2AF2A 3CLFL 3ZKMC 4GKLA 4YLBA 5T3ZD 3OKKA 1IKFL 5BOZG 1OP5K 4MMXB 2CU9A 4HH8A 4MB1A 4YDJA 1DVXA 3FN0L 4CC0A 3BH8A 3QEQA 4NQDA 3RU8H 1U92A 5EG6C 2IWFA 3EH3B 4ZK8A 2QV4A 4JFXA 3V0AC 2PW1B 5IP4A 1IL1B 5C08E 3VX0A 4X6CF 1OGSA 3NCMA 5LWYL 3G7TA 3OLDA 4GUCA 3W39A 3MRRA 3G04A 4J2XA 1OAKL 3VRLF 4N3TA 5IJVB 1LNUA 5CHNA 3IFOB 4F33A 2RALA 2CPCA 1OM9A 1CE1H 4FJ6A 4M5YL 5A2FA 3TNNB 3L7EB 1LDPH 1ZA6B 4FG6C 5J6SA 4OLXH 1I7UB 1ZVHA 2MJWA 1CDYA 2VITA 2P8MA 3EGSA 4GG8B 1TJGL 1FF5A 3CHSA 3S3DB 4EXPX 1NPNA 4GO8A 1AXTH 1UFGA 2FIRT 3BI9X 3LB6D 3AWFA 1UD6A 2P9RA 5CSGA 1KTKE 2J25A 2Y3AA 2LQRA 3BUYA 3CFBB 3EO9H 1D7CA 3PIQA 5CS7A 1OVZA 5SX4I 2DWXA 4HWNA 4I4WB 3VYPA 3X17A 1N0XH 2DI7A 4WWNA 1HHHA 3VMOA 4GBXB 1DE4A 1DBBL 1IGIH 3IJYA 3SDYH 4L8CA 2A6DA 1AI1L 1XF2B 5DURD 3AQXA 1R46A 3LN4A 1BD2B 2MEJB 2HT4D 4ELME 4ECNA 5ICXA 4U4BA 1YQ2A 4P2OC 3MUUA 1OPOA 4PRNB 4KITB 4JM2D 5B4MD 3KW8A 1MCKA 5GIRA 4A7VA 2DM4A 3O3EB 5CJ5A 1YHPA 2CM5A 4JZOB 3V6FB 3V0GA 4JFTA 1V7NH 3D0VA 1ZRUA 3KCPB 4LSVH 3CSYB 3G5YA 3FYIB 4JFUA 4XHQA 3VXRB 3D69B 1YJDL 3P4NB 3Q01A 3WEMA 1LK3H 1RMFL 2AK4E 5F9AC 5KYXA 2R1XB 3M88A 2Z31B 4KJYB 4X5WB 2APFA 3QXAA 2ADGB 1J1PL 2DDQH 4MCMA 2DWDB 2ZP8A 5IQ9B 2CGZA 2QKIB 3KL5A 5T33L 1IBYA 1RIVH 1TQBB 4N1CA 1X5FA 3IDYB 4M6ML 3I6KB 5I73C 3KPPB 2WGXA 3GLAA 3F6IA 1MZYA 3LH9A 3QUYA 1ZLVK 3MRPA 2EDTA 3PUCA 4CW1B 4FXGB 5ESVA 1RUQH 2G5UA 3JZYA 3STBA 2PUQT 2NY5H 1XZ0A 2AEPL 1KLFA 3Q5YA 5C0DA 4HUWA 3TCLA 4LEXL 4OZHE 4ALAL 3IYLW 2JJSC 3FC8A 3I6LD 1E8WA 3MRGB 3MLWL 3LKSB 3HB3C 1TZHB 5DO2C 4EOWL 3V0DA 2VLKD 3D3VE 2PPFA 3AGVA 3NCXA 3RKPA 4FQQA 4A6YH 1JZJA 3LXCA 5DHVH 1C5CL 2EECA 4EN2A 3QEGH 1PNCA 3JVFC 2HX9A 3QCVH 1WC7B 5DJDA 2BS8A 5GSVB 2UYLB 4WU5B 1UA3A 2BY3A 2SEBB 2YLKA 1YMME 3H55A 1U95A 3FO0H 2OYKA 4OD3L 4K9EC 5JHAA 2ZP0T 4MA3A 2YFNA 3FONB 5GS1C 3BKYH 4HCIA 5ISZB 1HL8A 1QRNA 4DKEL 4ZS7L 3ZE2B 3ESMA 4MZ2A 5SWSA 3RL1B 1I9JH 4YHLL 4IBWA 5AB2A 4WUKH 1QO3B 2R2HB 2ATPA 4BQ9A 2HFEA 4KGLA 4AH2B 2DMGA 3VWKB 1DANU 2QTEA 3IU4L 5AQ0A 2OXGA 2QVMA 1PFCA 4D7PA 4FG4A 4AGLA 3MNVA 5D4HA 2ZWYA 4ZQKA 3CZKA 1QSFD 4U6VH 4KX7A 4MMYB 3PWUA 3QQ3A 1XD0A 1EJFA 4OJFL 1A1NA 1E2VA 1Q9KB 2QSVA 3KL0A 4N0UA 4PLJD 3RKDD 4N9GA 5TFSH 3RDTC 4QXGH 3EJJX 3EH1A 2D31A 1BIIA 1VERA 1QACA 2YRPA 1DQDH 2FD6L 5DXWA 3NGBB 2D8KA 4Z77B 3EHBD 3VGHA 1NGPL 3G6JF 1EUTA 4KAQL 2EE2A 3QIWA 5C09D 4KJPD 1AY1H 2PYEA 4LBEB 3DXAD 1PTZA 2UX6A 2MOGA 1U8CB 1NFDA 4YS4A 4LVHC 4QCIA 4UILH 5F6HI 4CJ1A 1IC7L 2IH1B 3TGXA 2L7EA 3GSXA 1UWYA 2JQAA 1M7IB 3BFQG 2AEQH 4LLVA 3LKOA 1KZQA 5E0FA 3GMQA 1RLBA 3V8OA 4FFZH 1KGXA 5IB3B 4YO0B 5I8OH 3GSRB 4HKBA 3V55A 4F8QA 5JW5B 3MODL 4OIIH 5FIEA 2R0WL 1O6TA 2X4UA 1G7QA 2XCMC 1NL0H 4J3WA 3TJHC 4Z7VF 5GGTA 5I18H 4ZO8A 3UTTA 1ZK9A 2ADIB 1IBFA 2HRHA 4L4JA 2FK9A 3LRSB 5BRZE 4G83A 2Q9OA 4MA8H 3D07A 4LP4A 1JF1B 4XB3A 3HKFA 3VWJB 1VCBC 1I75A 1DVFA 4X98B 1C5DB 2GPZA 3ERXA 5DHYA 3TM6A 5HVHB 5JUEH 1PZBA 1NMAH 1NCDL 4FL4C 5L2KE 1D5ZB 4NYLB 2N4IA 1F6LL 4HIJB 3SDAA 4FJZA 2HJKA 1Z9LA 4HALA 3KPRB 1F11A 5DJ8B 3KJ6H 4GRMA 2ED7A 5AUMB 3RPIB 1JV5A 3KLLA 1UCBH 4WW2C 2ITCB 2DQIH 2ZD0A 5JHBA 4WI5A 2AKRB 5FYJD 1KPRB 4JFED 4JGJA 3KDPB 4KK5C 2KPNA 3FN3A 3I9IA 3W57A 2OP4H 2NY7L 4NXKA 2YK1L 5FYJL 1MRFL 1O7DC 3FQTB 4JJOA 1VADB 2YD0A 3M07A 4KK9D 5DO8A 3I3DA 4JRXA 4Z7QB 3TS8A 3FQUA 1EEYA 1IFRA 4K3JL 3TBTA 1RZKC 3SDCD 4AI7A 4HHGA 3L3JA 4M1CC 4P9MH 1BECA 4ZODA 4D9QE 2OSWA 5DJAA 4ZX4A 3IJEB 1H8NA 2H5UA 4HK0B 4FJYA 2R9HD 3LNEA 3MLVL 2H9GB 2JKJA 4HUKB 4BGDA 3VRJB 3QIBA 4GRWB 4ZOAA 2HVKB 3OXRB 2XBZA 4K9JA 4PRBB 1R4XA 3UXFA 1HCFX 4OM0H 4WUUA 3SPGA 1FV1A 1U8OB 3I6GA 4TNFA 4ZAKC 2ZKMX 4Y4KD 1HNGA 2KS0A 4UBDD 4ZUSB 5ID1A 3ABZA 1AGCA 2UZIH 3ZX1A 1Y0LB 4UQDA 2GSMB 2AQ1A 5C0IA 1MRDL 2XVKA 3VFMA 4M3HA 1F58L 4AGOA 1W72H 2XACC 5JO5B 3T0BA 1ZHKA 3QG7H 1OTTC 2P52A 3F2LA 1OLLA 3NZUA 4BCYA 1YPZF 2OMYB 3W82A 2UVFA 1F13A 3O81A 4JQXA 4PMEA 2R7EA 3DURA 5HHNB 3STLA 2X42A 4JZNA 1F4YH 3FCUB 5FOBA 3NFPB 1LJMA 2L7QA 1P7KA 4BFKA 2VQ1B 3VI3F 3FQXB 3MRQB 4Y2DD 3KJ4C 3F01A 1T03L 3S96A 2AXFB 4PGEB 2DQEL 3K2UH 3WGUB 2NR6D 2VLLB 1MJUH 4EDXB 3SEPA 1CT8A 1LP9A 3O6FA 3S37X 1GC1L 1OF2A 4GXUM 1AD9B 4OJCA 4YAQA 4AYMC 4HVBA 5D2NB 4NN6B 2VZ3A 2X6BA 3OZ9L 4PIBA 4JFFE 4OZGE 4TUJB 3KYOB 4DSYA 4L4TE 3MRFB 5AZ2L 1OAUH 2V9UA 3D4ZA 4F7EA 3LDBC 1FSKB 1I8MA 3BWAA 3JWOH 1NAMH 4QHPA 3QORB 3MLRH 4BZ1A 4BE5A 4R97C 4HCRA 2W9EH 4RMQA 5G5DA 4MQSB 3FHEA 3BP4A 4UANA 2ZTBA 3HI6L 3BP7B 5L4MA 3JWDL 4UAOC 4RIRA 4JVUA 4U3HA 4M93B 5F7NC 3B9KB 2VDNH 1A2YA 3RPBA 3TNMA 4C4UA 2J8OA 4S11A 1DBAL 4QI3A 1G0XA 3G6AA 4KROC 25C8H 5AL0A 2N7BA 3QEUA 4QO1B 1E9PA 2A9DA 5L0QC 3ZDYE 1KTCA 1MCNA 4J3OD 1A5FL 1L6PA 1TTRA 2C7FA 3BVNB 3EOBB 3EGXB 5EF3A 3D25A 4KY1L 4IOIA 4GAJL 1T7ZA 1Z9OA 2CDGB 5AW0B 5I1GL 2JF1A 4E5XG 2CGRL 4L1SA 3F7QA 3B34A 4DO6A 3FF8A 1FAIL 4P46A 5HHMB 1ZT7B 1FVEA 3QUYD 1CR9L 1FWXA 4DTGL 1KJ2L 2WWKT 4TSBH 5K59F 1KPUB 4UM8A 3DX6A 2A6IA 5F7YC 3FOMA 5D71L 4GEIA 4XWGL 3QUMB 5IJBC 2IH3B 3EGDA 4B9PA 3KPMB 1FNEA 3QO0A 1NUNB 3VFTA 5DTFA 1RULL 4Z7UF 2G60L 4BQBA 3CVDA 2OLDA 2Q76A 4DGWC 3BZEA 3MMEB 4XP4L 4OLWH 1R3LB 2H2SD 3GO1H 2UXTA 4A2LA 3UYOD 1P6WA 1TPXB 1MDTA 1U8KB 1MW2A 3QNZB 5E5MA 2E8YA 2VB5A 2P8LA 4DETA 2XQYA 4AGNA 3LNHA 5KYWB 2G3ZA 5IMMB 2VLJB 2XZCL 2EUZA 3GMMB 4YHPB 4JJ5B 4F58L 5DD0H 2X1PA 1I9IL 3U7WH 4W4OA 1QRND 4ABUA 1OAJA 5LBSL 3ZIMA 5AAMC 3IFPA 5SWSD 4JFZL 4WNSA 5C3TA 2XNAB 2ZICA 2QGBA 1QNZL 1D6EB 2AXWA 3QHFL 4ODBD 3L54A 2BSDA 2Y72A 3HZKB 3G5ZB 3VYNA 5EO9A 4A63A 2F8VA 4HUNB 3EYOA 4F7CA 4KZDH 9CGTA 4PV9A 4R7DB 3UZEC 1NCTA 4W9EC 1C1EH 4JKPH 4TQ8A 1NCWH 1SY6L 2NYYD 5IEHA 4JHAH 2N0MA 4ONFH 1OT1A 4CA4A 1T7XA 4I1RA 3RX8A 4AZ8B 3K4ZA 5L88H 3BUPA 4JO1L 1NOAA 4WEBL 3CDZB 4N9OB 3SYQA 1U2CA 1SN0A 2IFFH 3O4OB 4HJ0D 4QRPE 4XN2A 3SKNB 1MDAA 3KLAA 4M43L 3RWGB 1GJWA 1S7UB 4JFHD 3WNMA 5DD6A 4ZW3A 3APFA 3O6ML 3FCSA 4WO4A 2AV1B 3NA4A 4YUEH 3P3SA 2WQ8A 1BVZA 1MIEL 4FQIH 4GYBA 2BJMH 1A25A 2R1YB 4DP8X 2PYED 1WGOA 3AG2B 2EEAA 5IUSA 2ZG2A 3I02B 4DW2H 3GI8L 3FHQA 3L6FB 1BQLL 4XXWA 2X6CA 4XVSH 1A7BA 2OCFD 2WUBH 1N19A 5CSZA 1BJMA 3F85A 5ERWB 5IVXA 1I53A 4DN4L 3NEEA 3BPOB 3IDIB 2FJFA 4OCNC 4APQA 5GGVH 3QZLA 1LWJA 1HL9A 4KMTL 3D9AL 3HR6A 4PSPA 4PUBL 5CZVL 4H8WC 1JPSL 1NEZB 1YECL 4YC2B 3R1GL 3TP4A 1QHQA 4UT7L 5I1LA 5HYJE 5KSBF 2WM0A 3HPLA 4QD2E 3C12A 3ROOA 4BZ2H 2KLSA 4PLNC 3HC0A 1L3NA 3EJPA 2C26A 4FLQA 5C08A 5CM1A 3P11H 2MHAB 4RGOL 5TF1L 4IIQA 4BHUI 5PAZA 4HPYH 2P24B 5GGTL 4Y4FA 4P5MA 1KGUA 1XXFC 2AJVH 4Z0XB 1PFOA 3KXFB 2DMCA 3MCLH 3BWUF 4NQVB 5EWIL 5JIIA 4HIEA 4HMEA 1U9KA 4TQPA 5ESQB 4EE2A 2ODIA 1E8XA 3DVGA 3LZOA 1OAYL 1MSPA 2GJ6E 1JI1A 3PQYE 2VAJA 5KBDA 4LXFA 2P8PA 2F8XC 2WTRA 4I89A 1BEXA 2YAQA 3SDAD 1R5VB 3GI9L 4FA6A 4GRLC 4Y16B 4JY5H 5AYUL 2C9VA 1RJCA 1OANA 4KOCA 1FVDA 3NIGE 3QZWG 1EZSA 4J27A 3MACH 1VFMA 3GNMH 3DRQA 1GW0A 4JFQA 3PABA 4OSUL 2FL5A 1VHPA 1FL6B 1UXMA 1VFOA 1WE5A 1A7PH 2YXVA 4OF0A 1FG9C 3HG3A 4OCYL 3PWNA 4BKSC 3TEYA 5GRJL 5KZCB 2AJ3B 4B9IA 4BQ8A 3C60D 4MYPA 1OARL 2J1XA 4G42B 3NPZB 5EZLB 3UAEA 4D9LL 4OR1A 2BY0A 4KJWC 5GS2D 3QXDB 4JO2H 2WPGA 2H6PB 1E4XL 4NO5A 5I1EL 1U8NA 1TJHL 3MRDA 3SCMB 2AK1L 2FX8L 4JHBA 4KXZH 4HUVA 1H5BA 1IBHA 1PNDA 2P3YA 4OFQA 2J43A 3T2NL 2OTWA 1HN1A 5E23A 3U2SB 2YPKB 3INUH 5IHLB 4L3EE 5D70H 5KJ4A 3QIBD 4O2FA 3WDJA 3L13A 3ZTNH 2R8SL 1GOHA 2ZYSA 2AK4A 3TBSA 3BRGC 1P53A 3HC3L 5DUPL 3TH3T 4NXSA 5C8JB 4Z18A 4BFNA 2B0SL 3ELQA 1MAJA 3VFVA 3O45B 4G8GE 1WFNA 4LHUB 5HHOD 1FJ1A 2ZSWA 1L7TL 1IAIL 1G87A 2IH8A 1MCRA 3KYNB 3OJDA 2F54A 3Q13A 1OAXL 1S9VB 3WIFA 3GQFA 3HNTH 5F6IC 2IGLA 5J57B 3F7VB 3O9WC 1OOWA 2WXQA 5IESL 1GH7A 3N91A 4KKCC 2VO8A 3ULAB 5J1TC 3WUWG 2VDOL 5CLTA 5D7IE 5DA0B 4L37A 4WSJA 3LH2L 3Q8FA 3F84A 4U3XA 4RFEB 1ET5A 1A6AB 1U3NA 3CX5J 1I1YA 3DVNA 4OZHA 4W9CC 5BZZA 2JKSA 5EU7E 1A7QH 5SWZB 2XA8H 3QEHA 2EDEA 5C9JB 5I19L 5I8CB 1EXGA 5KBNC 4WCYL 5D1XB 2XT1B 4DGVH 4Z7OF 2NW2B 4X6DB 1EHLH 4Q58C 2PW2A 1QEWB 1JK9A 5LGYA 1XF5B 4P3DA 1EZVY 4IKJA 2E46A 3UBHA 2J72A 2Z8RA 2J5WA 4G5ZH 4Q9CA 3O6FD 2A73B 2B4CL 4XBEH 1MFBL 4OKDA 1YMMA 2IPTL 3KNBB 1NSNL 1QX1A 5D7EA 1NBZA 1AQDA 2HLFD 2NY1D 3TBBA 2CKBL 4GXVH 3VWKC 2PKDA 1LEKB 2DAVA 4WWKA 4WI8A 3V4PA 4A7QA 4ZSOB 3S5YA 2PCFA 4FC3E 3O3DB 3A67H 2X4PB 4MD5A 1KOAA 1RZIA 3ARGD 3CCHA 4RQQB 4ZTOH 4NI6A 4BZ1L 4ENZA 3ABKB 4HCRL 4PGCB 1ZSDB 3OB0H 4LAQL 3P2TA 5DJ2A 1KT2B 2WLNA 1B88A 1BOGA 1OXYA 3TURA 3FAXA 5C6TH 3LQZB 1EO8L 4ETQA 3HAEA 3NDYE 2QQNL 1M6OB 5CGYD 5EORH 5C1MB 2EP6A 3FU7A 1MHHB 2QZQA 4H8VA 1HKFA 3ZQXA 5CR1A 5BZDA 5BV7L 3VSQA 4JQVC 1R19A 4MWFA 4LKCA 4HIQA 1QLFB 5F9WB 1AZVA 2G3MA 1M3JA 2VC2L 2DL9A 1PKQE 4MKMA 2C1PB 1KTBA 3RGVB 5FF6A 1BBJA 4ODHL 1JZEA 1AGDB 2DQTL 3HBGA 4R90H 2F58L 3D33A 3VRIA 2ZNWA 1VRSA 3EFFA 4OF3A 4ZMVA 3K3QA 2JTYA 1IE4A 2IAMA 1CGYA 3MV7B 2Y7MA 4GIPD 2F7RA 4JKWA 2AV7A 4N28A 1VFBB 3NAAL 3T8XA 4KXAA 3X12A 1ID2A 4OGXH 1INQB 5BQ7A 2QVTA 1HL5A 3B1TA 2YWZA 3HZ3A 5F88A 5JPMA 3P3TA 3GXTA 3HC4H 2MNWA 4BE6A 1CG9B 2PO6A 1JPFA 2WVVA 4W6WB 1J05B 3IU3B 3Q8EA 1JRHL 3T8MA 2BDNH 4FFYA 3LKQB 4G6KL 4MDRA 3UG5A 2DKMA 4YXKL 1P69B 2AQQA 2IPKA 5DT1H 1PZUB 1AGEA 1FBIH 4K71B 3LIZA 1UT2A 4RDQG 3VWJC 1S7WA 4W9GC 4WFHD 2DM2A 2W0KA 4WI3A 4EPSA 4MA7L 5BRZA 5AW5B 2HKFH 3UTZA 3QUZD 2AEWA 4FFWC 5IQOA 4YZWA 4HX1A 3LKPB 4UB0H 4NAQA 3OC8A 5L2KA 4FLSA 3POHA 1S5HA 4U1IB 1YAIA 3AU1A 4DP7X 1VEOA 2F53B 3LTVA 1FA4A 5KG9B 1E5ZA 3WLBB 1T1YB 2DKSA 4X7TA 3FRPG 1VAHA 2W88A 2FJUB 3ARBA 3U7YH 4LB8A 3LNIA 2PPEA 4ELKA 2CPUA 2WOBA 4AT6A 1N10A 1RD6A 4MSWB 1I3RB 1IFGA 1NC2B 4MB4A 1XR9A 3BZFB 4NZDA 1T0MB 1FFTB 3DSFL 4Y7MA 2CUIA 1YEDA 3RI5F 3CDGB 4HEME 2OMNA 2F2HA 1IM9D 4MJJA 6PCYA 4NQEE 4K5NA 4XPTH 3CH1B 2DMBA 3GGWB 5FK9A 2IQAA 1VGKB 3WXWL 4XVTH 4XOEA 4AMXA 3VGFA 4IRZH 2D0GA 2E8ZA 3DHPA 2NZ9D 5IR1A 1HYRC 1RVFH 3IS0X 3MLTA 3G08A 4JDVB 5LBVA 1Z9PA 3CN3A 4NO0B 3QGVA 4G72B 2O5YL 3DMMB 3VGAB 4HJSA 3HS8A 3GYRA 2JKLA 4QWWD 3MRKB 5DCCA 3SPIA 2VQTA 4G1MB 4PRPE 4HWEL 2Z35A 4AE0A 2AQPA 3CXDL 4APQD 5I76A 2WNWA 1LO5B 5DEGB 4Z7WA 4TLSA 1RPUA 5I71B 3ETTA 4H88H 4D3CL 5EZIL 1GAFL 1WIPA 4LCIL 1KCBA 1MFCL 2GJZA 4WY7L 5DD3H 2NXYD 3BAIA 5EIIG 2JI2A 4YDLC 1FI8C 3CXFA 5FA4B 3U0WH 3P4MA 4RFNB 3RIAF 1H0DB 1MVUB 4IHOB 3OAZH 1IM3B 1XMEB 1NCNA 1CL7L 1BFVH 1JNHA 2M2DA 2XV0A 3DJZA 5E2VH 1DSYA 3ZE2F 4ANKA 2ZXAA 2BVEA 1MUJB 3FB6B 4AENB 2J4WH 1MCWM 3MRJA 3FTZA 2WSDA 1ILSA 4RX4D 2OMUB 4YFDB 5HHQB 4MJ2A 5D6CB 5T5NF 2B9BA 3MJ9A 4XXDB 4XPHH 5KAQF 1EHKB 1YEKL 1H19A 4F2MB 2KERA 4X4ZA 4YX2L 1KC5L 5TK4A 1DQMH 5EBLB 4K94C 4TUKH 2WXFA 4QIRA 2G5BA 1REIA 5L8KB 4W9JC 1I9RH 3TT3H 2YSSB 3JVGC 5INCB 2R29A 4OZGA 1UZ6E 2YGOA 1QPXA 2DWTA 2I07A 1UM6H 4GAGH 2UY6A 4Z7NE 3Q05A 1AH1A 3DO7A 1ETA1 4DVRH 2BPBA 2GC4C 1U6AH 3FQYA 3IGAA 3WSQL 1RIHL 4TNEA 5HGAB 3GBMH 4K5PA 3RNKB 5IZ7A 2J5LC 2D0FA 3U36B 4KVPA 1LO4H 1EK3A 1MIML 1ZGLP 5IW3A 3P1VA 5DVMA 3MGOA 3QJFA 4PP2B 2DLFH 5CEZH 4H44C 1WK0A 2X4QA 3NIDB 2UX7A 4KUCD 2WQWA 1MI5E 4PTTB 1UJTA 4L4VE 2HRPL 3DV4A 3TTYA 3PP3H 1D2OA 1WEJH 4N2LA 4AW7A 4YIQB 3M1BB 1L4IA 1ETJA 4KI5E 4MX7A 3D18B 1G6RA 1TCRB 1I85A 2BOLA 3Q44A 1Y6MR 1FG2B 3WHE0 4WFED 3W5MA 4G7YH 2CDEA 4PP1D 1UACH 3DPBA 4KZ0A 2CHXA 3ARZA 1L0PA 1N2RA 4WHDA 4MJ6B 3UZQB 4NENA 1TZIA 3JUZA 3VXPA 3KPSA 2W60B 3FO9B 4FTVD 4ZO7A 1T1WB 1BM3L 1MCOH 2DH3A 4ZPVB 2PCYA 3GSWB 4Y2OB 5FXCH 2VR3A 4IBUA 3AM8C 2F54D 3GEWB 4GP4B 3TCTA 3LV3A 2OX5B 4GSQA 4BSVB 4G82A 4X5LA 4AEIL 1IFHH 2BRQA 1MREL 1Z9MA 1U8MA 4F7TA 1JDAA 1NANI 3ARDD 4MNQE 1OCZB 1SUHA 1T7WA 4KKAD 1G7LB 1ZGLM 3TEWA 2HB0A 4D0DB 4R0LB 3ECBA 1QYGL 1WICA 2A4ZA 2IV9A 3ME0B 4LDOB 2VDKH 5AVRB 4W9LC 4AM0A 1UC6A 4JHZA 5ETUA 4FQXD 3SJVB 5HHXL 5DQJA 1S5IL 5ID0B 5HI4C 1F18A 3EH4B 1K4CA 1G9MH 1FL3A 2HSIA 4XE0A 2XQ0A 3H9SB 3HRZC 2XG4B 1X5AA 4H1LG 3QHTC 1CDHA 4NUJA 3ULVH 1HZHH 3SKOA 3EDFA 2Y1YA 2R4SL 4B97A 2HFTA 3NFSH 4RGND 2OSLA 4EN3B 4DZBA 3F12A 4HIIB 3BN9D 3ZOAA 4Z7QF 1WIOA 3RBSA 2A9NL 4TSAH 1OM3L 2P7TB 4OZ4A 3PWVB 3KAAA 5E6YA 4WWKD 2LR4A 3FFCD 1CICB 2PP9A 3IDNB 1G7HB 2OR9H 3CN1A 4OZIE 3ZZ1A 2OMXB 2OXHB 4J3TA 1HYSC 1CURA 2VOTA 3BGMB 4DFIA 3MRHA 4ODUB 4TV3A 2OK0L 4O2EA 4PJFA 4YEFA 1KJMB 4GRWF 4XGZA 4AL8C 1Q0YH 2XWTB 1J10A 4MD0B 2O5ZH 4XAKE 2I9TA 1THAA 5EZJA 5T1MB 2Y36L 4X5XB 1HCVA 2NXZD 1UH2A 2Y1ZA 3EG9B 4XNUH 1ULVA 1XGRB 1JYNA 1CD9B 1ORQB 4MCNA 2GIYA 4QRPA 1QKZH 4C56B 1F42A 3B2VL 2YD9A 1IEBA 1FYTB 1DJZA 3SGEH 3K2IA 3RA7H 3DRTA 5EB9A 1KIPA 5AENA 1L6ZA 4U1KB 3TVMC 3JT0A 4OF7A 4OFVA 3V6ZA 4M4RB 3RWHA 1T0NA 5DVOA 3UOAB 3KR3L 2IAMD 3IM1A 1VACA 1F1DA 1T80A 2CZNA 3BQVA 4JN1L 1J0JA 1W0VB 3T3PB 4F92B 3REWA 1NWOA 2NPLX 5DJ6B 5L9DL 2LAGB 1ZIAA 1MWAB 4P2YA 1J0IA 2HLAA 1CLOH 2HVBA 2WO4A 4N0YL 3KGTA 4OD1L 4W81A 3DGGB 4WFFE 5BXFA 4WK0B 4YE4L 2CMRL 4M8QB 2JCWA 1URLA 5CWSB 2X1XR 4NUGL 2WIMA 1QQDB 4HIXH 3B43A 2V2WB 4FFYL 3AVEA 3U9UA 1DSFH 4ZUWB 2EXYD 3IMWA 4KKNA 1YEJH 3UP1A 1NLBH 1WA1X 2WIIA 3JV5A 2NX5E 3Q6GL 4ZJ9A 3S36L 2I85A 2C9UA 2VMCA 5EUOE 4JPVH 4PJEB 3MUGB 4WV1B 1PLGH 4IGBC 1YMHB 4WHYG 4E41A 3BFWA 1P7QB 3LKRA 4KFMA 2GJ6A 2EEFA 1U36A 1HHJA 4UUJB 1Z1WA 3STZB 2WSPA 4YHYC 5L2KD 2Z4TA 1OK8A 2JKNA 5DEJA 3FRPA 4G1EB 1SHSA 3PHOB 4NFBA 1TXKA 4RSVA 4IMKA 2ICWI 4NHCL 2XTJB 4Z78A 3K6DA 3S8WA 3PGFH 4F7PA 1JIBA 1NIAA 2CLZB 4QHKI 4UQ2A 4L2YA 3BEVA 1EZVX 4N22A 1BZ8A 2EC9T 5J9PB 3S34H 1M7DA 1A9VA 1X7QB 2F1AA 1JGDB 2APSA 5DRXB 2HTKD 2EH8L 1Z9NA 3UIYA 3ZMNA 4E2OA 1H3PH 4PWIA 5E8DH 3FB7B 1E9OB 1E9QA 4M7KL 3X1FA 2F5BH 4TYUA 2EE3A 2Q3ZA 3VSTA 4I77L 4EAEA 3GZPA 5AW4B 5HJDA 4E9TA 1HHGB 3OKDB 4EEEA 2PWFA 3VGGA 2Y06H 4KKBC 5DWUL 4A6YA 5DI8B 2BSBA 5DHVA 5IM7B 4YXHH 2HH0H 1E65A 1K5NA 2P5WE 4L3EA 3RTQB 4ENED 3ROLB 3S3PA 1AKJA 1Q0EA 3NQIA 1OAQL 1A4KA 4POUB 3F64A 1IGJB 2XWZA 3BVUA 5I17B 1DSWA 4LSRH 1TITA 1QTPA 1BQHB 2FEJA 3SBWA 4F37K 5J12B 3QT2A 3A4FA 1AXSB 1RURL 2KZBA 3MBED 1JNLH 4NX0A 4NO3B 4WSGA 4PGBB 4HGMA 4BSJA 4NWUL 3N9GL 1OIOA 1Z3GH 1HH9A 2ZXEB 1L9TA 3IDMA 4MMZA 5H2BB 5ITBL 2E4FA 5IQNA 5CLXA 4EKXA 3MYZA 2J1KA 2PR4H 3CQPA 1JV2A 4HSQA 4BUGA 2CJUH 4EIGB 2ZG3A 2ZX5A 3S5ZA 7TAAA 5E8EA 2ZOLB 2H1XA 3QFDA 2JJUA 4UAHA 1F4WH 3MJ9L 5FYLL 2HG5A 5IQMA 3MV9E 1DO6A 1FZMB 4G7QB 3DPDA 5B38G 3S97C 5CINL 2PABA 4MYWB 5DK0A 1FIEA 1BFOB 5DURB 2DLIA 4IOFC 2ZUTA 1DLHB 1TTUA 4LSSL 2R29L 5I0ZA 3BC9A 3FH5A 3GKWL 3LIUA 4DVBB 4P9HC 1G7JB 2FYYA 1XL4A 2BP8B 1QLEL 4LCUA 4QRSA 2FX7H 1YY8B 5L4FA 4J6RH 4FFZA 2JKRM 4M5SA 4QY8A 3VFOB 1BVLB 1G0YR 2FECL 5BO1L 3AUWB 4UIKL 2WXIA 3CVHB 3QR2A 5IFJB 1UOKA 1N6QH 2B1HL 3SYOA 5EU5B 2IWEA 4AUUA 3VFSA 4UWQB 4DQOL 1HXYB 1MEXH 3EW3B 4OFYA 3QCTH 4K7PY 3TFKD 1XGQA 3AUVA 4AXWA 4O9HL 3HLKA 4LCCB 3K6IA 5AAWA 5HYSB 4ZD3H 4N2GA 3AQZA 1Q1PA 3BW9B 3DROA 2J3SA 3KPSD 1RFDH 4XZ4A 4J7RA 1FNLA 4IKLA 1DZ0A 2DLHA 3LN5A 1H15A 5E4OA 2TAAA 2DQJL 1Q1JH 4NO2A 1A0QL 1M1XB 4UT9H 3X11A 5CKAA 4I3SH 1I3GH 2VLKB 4M8VA 5IVZB 3WEBA 3ATDA 2EJ1A 3L16A 3HR5A 3L3HA 4RAHA 2V8LA 1ND0B 5IIEB 4OKVA 4WIQA 1N0LA 1F3RB 5CXPA 2VZVA 2VMDA 3VG0L 4PVMA 5J6GA 5E51A 2EADA 5FPIA 3G6DL 1N12A 1A6WL 3VFRA 1JGVL 1K72A 3U7AA 3VJ6B 1UURA 2Q3XA 2ZXCA 1MG2C 1DANT 2VW4A 4NNXA 4PJ5E 2ED9A 3ZVVA 1SFDA 2AQ2A 3FQWA 3RVXC 4ONHB 4EUPG 4ZMZA 1LE9B 1HH6B 1QSEE 4IQHA 2CLVB 2VN4A 4FADA 3QWOA 2AGJL 1B3IA 4JQIH 2NY4D 1FZOA 4FI7A 5KS9E 5A3IC 3BUBA 2H0JA 1S9XB 1KIUA 1QSFB 1TZOA 5C07E 4AV5A 4BFIB 1IE5A 1B4LA 4KHTH 1T1ZA 2OMZB 2WO3B 2WHVA 2ICCA 1DTUA 2EKJA 2Y9RT 3PAUA 3BXNB 3H4HA 1W72A 1OP5H 5M94B 1KELH 3TBWB 4X4XA 1KCSH 1CI5A 1DBKH 4C4KT 4E68A 1CFQB 1CD1B 4P05A 2ZOTA 1MCCA 2IANE 3US1A 1C7TA 1CXLA 1XH2A 4P57B 3EHBB 1FE8L 1V3LA 5DJYA 5C09B 3FT2B 1R3JA 4M62H 4HEMA 1I1AD 4JO8A 3SPHA 3T65B 1NGYA 2P42B 2OSYA 3KEDA 2YUXA 4DGIH 4Y9CA 4NQEA 3MBXH 3RL2B 5E8OA 2LU4A 1HVXA 2FWOB 2KBGA 4PRHE 5F1IB 1QZNA 3QDJA 1UB5B 4FF9A 2FX9H 3NJHA 2A74A 1JGLL 5D5ME 1MHPL 5DWPA 5KSVA 3IBOA 1OW0C 3P0GB 4MQXD 3F83A 1M4KA 1A7OH 4I85A 3GS0A 3S5LA 1F4AA 1GYCA 4B7LA 4F8NA 1F2QA 4FFVD 4X6DF 1T83C 2A9MH 3FAWA 4NQXB 4XMKH 5EC1A 1J5HA 1NAMA 1H9VA 1PEWA 2VDRL 4XN1A 1VZIA 3ZTCC 1LEIB 3BCFA 5TQ0L 4RNRB 4RFNC 3EO9L 1ONQB 1BBDH 1KCRL 2B2XH 4NJAH 1Z6JT 4UMSA 4Z3TA 4B96A 4J5VA 4ZFGH 3ZKND 5CEZE 2EUWA 4ODWA 1WP6A 1IGIL 3P2DA 3BFOA 4H8HA 3WNJA 4IMLA 3OR6B 1KN2L 3FYEB 3D05A 1UWGH 1KB5L 4PY7A 3I3BA 1QWNA 1HIMH 2XWJB 1PS3A 4J2QA 5EO0A 5C0BB 4AQEB 1WBZB 2BVOB 5IJDC 1KBKA 1AIZA 3IFNH 2HFFB 1IAKB 2ROXA 3R19A 4JDTL 4TSCL 5JIHA 5AW9B 1X9LA 4ZMOA 1ACCA 1AOHA 3DDGA 1QI5A 3KCWA 4E41D 4OV5A 5GSRA 3BDXA 1UM5L 1JNJA 4LLYB 2ZAIA 4A7TA 5T1LA 1JPGB 4GUOA 4X0KA 1DUYB 2E6JA 4Q6IB 2X6VA 3NACH 3B56A 3RUGB 2PWDA 4FYRA 3KVDD 4Z8FL 1FFNB 3NJVA 2UXGA 3UBXA 3V9CA 1ZLVH 2YGNA 1C08B 1I4FB 1YN6B 1Q90A 3SDCB 4MAYA 3RWJB 1L7IH 1Z3RA 3H54A 1NBVH 4YQXH 2CE6A 4PJ8A 1G7MB 3VXQA 1HQ4A 1RUQL 2ZXWB 4ZDHB 1OV8A 2NY5L 4UNVA 1UB6B 1ZY9A 2JXMA 1P0SE 3SE4C 3BQUA 4CU7A 3K8KA 2GSGA 4Z76A 2D0HA 4IJ3B 2F9BT 1VGEH 1JZHA 2WTOA 4Y4KB 4E9YA 5K9KA 3ULVE 2X38A 1OE2A 1S7VA 3SE3A 1JK8A 5ES4B 3OKKB 3FO1A 3T8VA 5JTWA 1IGYA 2W07A 3AREA 4L3ED 4YL9A 3UJJH 4BK5A 1PY0A 1AKJD 4YDJB 5DGQA 4EI5C 3BH8B 4NQDB 4JEGB 3ZZQA 3QEGL 1U92B 3WE1A 2IFGA 5DEFA 4JFXB 2CXKA 2YD4A 5GRZA 4RWYH 1KDIA 2DN7A 2IF7A 35C8H 3FU6A 4M7LH 3RBGA 2JKWA 3T0AA 3EFDL 4U4IA 4Y4HA 3W39B 4ORZC 3MRRB 3TA3C 3G04B 4ZMYA 1SLXA 1I9JL 2FLRT 3ZDZB 1LNUB 5CHNB 4F33B 3PXJA 4P4KA 5CJ8A 4H0GA 1ZA3A 5ADOL 5JR1H 3P9MA 2JLLA 3H2QA 3BN3B 1PCSA 3EYSH 1EFQA 3WOVA 2IV8A 2VITB 4Y89A 3MXVL 4KGJA 4OZFG 2P8MB 3EGSB 2IGFH 2CA4A 1RL1A 1OE1A 1S2EA 2F1BA 4JPQA 5BQDA 3CGTA 1RZFH 4L3FA 3S37H 4GS7C 1UUNA 5AL8A 5TFSL 3UFIA 1ACXA 5I66A 1NCAL 1OCWH 3BUYB 5F1KC 3SDXA 4UOQA 3QJHB 4YSDA 1E7UA 3PIQB 4JRYE 5IUCA 1R34A 5IREA 2PP8A 4DERA 1QA9A 1QFPA 3G9AB 3PPSA 4FQCL 1DQDL 1HHHB 1DE4B 3IJYB 3SGDH 5LQBH 3OSKA 4XCNB 2A6DB 3EFOA 3KEHA 4GW5A 2FAUA 1HE8A 4Y0GA 3LN4B 2YBGA 2XWDA 5ICXB 2CGYA 2ZUUA 5T5FL 1WBXA 3TV8A 2E9JA 5GZNC 5GIRB 3GXUB 4S1RL 1YEEL 3QJZA 4MXWL 3LZPA 4UILL 4OZIA 3VG9B 2FGWL 4HWBH 3X1GA 5GGQH 4QKTA 2QGCA 3D0VB 1QR1A 4JFOA 3QULA 3CFJA 3HOGA 3E0GA 1ES0A 1YSOA 4GUQA 1QTYT 5C6PB 3OF6D 1BJ1H 1PZ3A 5AWNH 3DI3B 4PJ9A 5HI5D 4BZ2A 2VM9A 3MLXL 4XBPA 1LEGA 4BYHA 5LXGH 4GAYA 1IBBA 3QXAB 4OFYD 3TU6A 3OBAA 4AJ0A 2PWHA 4B9JA 3ULUF 3AS1A 4UOW0 1IGTA 2IH9A 3E3QE 4GMSH 4OLYH 2OJZL 3QUYB 3Q1SH 1GGBH 4KDTC 4A37A 3MRPB 5GJTL 2FWSA 4PQXA 1L0XA 3C6LD 5C71A 3U79A 1K8DA 3ZHNA 1CFVH 4TF4A 1A7RL 5ESVB 3PFQA 5F7LB 5HY9B 3F7LA 3SYCA 5IK3A 1XZ0B 1AGBA 1KLFB 3LN9A 4JG5A 5C0DB 4HUWB 5DA4A 3TCLB 1XBRA 3O3UN 1AQKH 4F80A 1WQVT 1ZMYA 1C8QA 4JMXA 4XNXH 2C9XA 2BLFA 2VL5B 4PGZA 1NOFA 3QJVB 2YEVB 4A2EA 3JTTA 2DQIL 5B39A 4FQQB 1QFUH 3UCRA 5DD5H 3RVTC 2JQZA 2TRHA 1RJZA 4OLZH 5DJDB 3VD3A 1SHXA 3L81A 1D9KD 1KEMH 1YNLH 2DEXX 1U95B 4AC4A 3SDDC 3VU2A 1MPAH 3AJ7A 4F20A 4DKFH 2DQCH 2XRAL 4MAUH 3ZRCC 4XBGA 4MA3B 3COOA 1NKRA 4N2CA 2NX5A 4LPUA 1QRNB 3APNA 4L29A 1BLNA 5SWSB 4K9EH 3V0IA 5EUOA 4K73A 4P9ML 5BUPA 2AJZA 1KYUA 3O2WL 1E28A 4P2QA 4K23H 2HFEB 5JXAH 1OPGL 4CC1A 3S8GB 4MS8C 2NY2C 2OXGB 2WNGA 3AMLA 3NIDF 4P3CL 1HXMA 5HYFA 3Q06A 3VW3L 2Y22A 3MNVB 1PX8A 1XMWA 2XJKA 4JKLA 3VQ1C 2LTQB 4ZQKB 2CAKA 4RH4A 4XHJD 3PWUB 3QQ3B 1ZOXA 4NIYE 5JYMA 3RFZC 1A1NB 4N0UB 4A2HA 1OGAE 4N9GB 1JHKH 2RQEA 3R0MA 2BS9A 1PJ9A 2D31B 1BIIB 1MNUH 3MKKA 4P23A 5JQ6H 4WO0A 4XMZA 3QG7L 1BJ1J 3K6SA 5I6MA 1AHMA 3CK0L 2ZUQB 3LRKA 5EH1A 2WGNB 4HS3A 4JDEA 3QIWB 3EDKA 5DLMH 2PYEB 1K8IA 1I1CA 3U9PH 3IEAA 1KBBA 3Q2LA 4JL1A 5AYTA 3ZPDA 2WV3A 4C47A 5CFHA 3QPKA 3CE1A 1NFDB 2DJ4A 1YQVH 4QCIB 2LW3A 3GIZH 2ICEC 4IOSD 4KJQD 2E9BA 3QDJD 4WWOA 3GSXB 3PLYA 5KBMA 3U1SH 4LLVB 5TK2A 3NPSB 4NI3A 3UMNA 5D1ZA 2P5WA 3GMQB 2NY3D 3AXHA 4XO9A 2O6PA 1OP3K 1IBGH 3CFUA 4RISH 3MV8A 4HKBB 4EXKA 5KANI 3H9ZA 2R15A 2X4UB 1X9RA 1G7QB 2RMNA 3N0PB 4L8BA 1SN5A 3DK0A 3CQQA 3FZUC 4PRAA 3UTTB 2IG2L 3JWOL 1R1CA 3P2BA 5I75C 2QT6A 4XVJL 3RILA 2AMGA 1SMOA 2X4SA 5EEWA 3WTVA 4U0QB 4NJ9H 2QQKH 2QADC 2R0LL 3LQAL 2XZQH 2VDQL 1IILE 1FNGA 1N4XH 5HDBB 4PJCE 5D7JA 1DVFB 5DHYB 1YNTA 4XP6L 1F6FB 5JA8B 3UTOA 4PSRA 2BSTA 2VDNL 5F9OL 4ZUVA 4AYID 3SDAB 1AO7A 2CO6A 2HJKB 2WB7A 4X7EC 5FUCE 2VDLL 1WZAA 3SODB 4TRPH 5T3XL 2D3JA 1F11B 1NUDA 4GRMB 1KYFA 1JV5B 2X9ZA 2B5IB 3IETB 1YVLA 2YRZA 2R69L 4MD4A 4B6ZA 1LWRA 2R4RL 5T1LD 3O0RH 3HPJB 3SE6A 5BS0A 1SUJA 3BPNB 4UNUA 5DFTA 1TR7A 4JM2C 5B4MC 3VI4E 2F08A 4JDZB 4PJGE 4ZNCD 4DP2X 3C5ZA 3H2WA 3KM2A 3C60B 1WYJA 4JRXB 5FKPA 3FQUB 4H40A 1EEYB 4B0MB 5F3HA 3TBTB 4ONGL 1DCLA 2KLTA 4MAYD 5TD4A 1NM9A 32C2B 1A4AA 2CK0H 2JV6A 3L3JB 4ETYA 4P04A 5DJAB 4G2AA 4TVPD 1PG7X 3CFKA 4PJ8D 5CZXC 1A6TA 1RZKH 3L5IA 3VA6A 4TVPL 1F56A 3QIBB 4XPFH 3BQUD 5D9SA 2J20A 4XCCH 4W4NA 2NCMA 1P5VA 2VXVH 3T3PF 4WUUB 1FV1B 1RPQA 3I6GB 4M6NL 1SM3H 5CGMA 3OR7A 3ZQWA 5ID1B 4JRFA 4ADJA 4OLWL 2YO3A 1GXEA 5IOKA 1PU0A 4KI5D 2WVTA 5AVZB 3WAKA 4N2HA 3ARED 5C0IB 3UO8B 4GLRH 3VFMB 4ALAC 1X7SA 3FQRA 1TTCA 5FYKH 2VDOB 3JV4A 4PJ7E 1AZNA 1P4IH 3T0EE 2ICES 1OB0A 5D1QE 4W9FC 4YHKL 3STLB 2R7EB 3DURB 5TE4H 2PLTA 1T0PB 4JZNB 4PY8I 5FOBB 5KVFL 1T7YA 4Y4HD 4YDKH 1P7KB 2ORBL 4LPCA 3WE6A 4D8PA 4FAAB 1B4JH 2QHLA 1XH1A 2GBUA 4X80H 3LOWA 4UDUB 2FUTA 3CZGA 5LDSA 1Q38A 4XOBA 4YXLH 2A6JA 3VFUA 3TZVC 4P4KD 1KDJA 6FABL 4CSTA 3S96B 4N25A 4XC3H 2PXYC 4OGAD 2Z7YA 4XTRC 1S3KL 5CGBA 3P0YL 1C1EL 4JKPL 1CT8B 1LP9B 3O6FB 4AYFA 1OF2B 5JORA 4YAQB 3LVTA 4ONFL 4N5UA 3H42H 1ET7A 1E4XI 3GPEA 3VGEA 2HJFA 3OJMB 5L88L 3GLZA 4WEEA 1XSJA 3P30L 1IAMA 4F7EB 1I8MB 2VN6A 2WLHA 4X8JA 1CI3M 1ASPA 4XE5B 4IRZA 2QDWA 4PJ5A 5G5DB 1X5YA 3ARGB 4YUEL 1ADWA 3BP4B 1EAPA 3X14A 2WTPA 3B7SA 5JXEA 1FH5L 1QSEA 1DDHA 1U2HA 2BJML 2RCSH 2GCYA 4RIRB 3T4YA 2NLJA 4NRZA 1MZZA 3LVEA 3RKDC 4Y5VC 1XGYH 1IAII 2H4EA 2AZAA 3BKCH 4P2RE 1A2YB 4DW2L 1D5XA 4PD4K 4BFRA 3QUXA 3TNMB 3WCYA 5I6XC 4MJ5A 3VXNA 3G6AB 5BV7B 2HN7A 3PDOA 5DK3A 3QEUB 4KKRA 2Q87A 1A02N 4CN4A 1E9PB 1D3CA 2M83A 2VC2B 1ZD6A 3MRBA 4XAKD 3CLEH 4XI5C 4FNLH 4JE0A 2IANA 3D25B 4XRCA 2ESVE 4QOKE 4CVXA 4IOIB 4U2ZA 3FQNA 3P11L 2BSED 3FMGH 1OAZL 1GYAA 4HPYL 2FVNA 4P46B 4BXVA 1FVEB 3UTSE 3BRFA 4I0PC 5CMAA 2V7NA 2OW7A 5ICYA 5DS2A 4UM8B 3P9LA 3DX6B 3BT2H 2A6IB 1I8KA 3LPGA 1BZDA 1NMBH 3MCLL 5IWLC 5MHSE 4PRHA 4X6FA 4Y9EA 3FOMB 3EOTH 4U1JA 2ZWLT 2GTZA 3EGDB 1J0HA 3QO0B 1FNEB 5D5MA 1JAEA 3MRNA 3VFTB 2Z65C 5DTFB 4HHAA 2NDFA 3GHPA 2KDYA 2WCPA 3LRGA 1UJ3C 4MTMA 3SO3B 2LV4A 3MACL 5HVWA 1E3XA 2Q76B 4KHXH 3BZEB 5AVQB 4YBLB 1TEGA 1A47A 1DL7H 1KGJA 4YSPA 3VD5A 4Q9RL 3GXFA 3ZHLA 3RQ3A 3WELA 2DB8A 4F15C 1A7PL 4BZYA 5D6DA 4XPAH 3AS2A 3V6BR 5E5MB 5BUAA 2P8LB 4IRSA 5E7BA 3L2MA 2XWCA 3QYNA 4P4RA 5GRYA 4PBWD 3IMRA 4GO9A 4AX3A 2NX5D 1HNFA 1SMDA 4JO2L 3KGUA 3UG3A 5L6YL 4XP1H 3VGBA 2WN2A 2WBKA 2EYTA 3IFPB 1FNSH 3T4AA 3F7YA 5IJCC 4JUTA 2O61A 4P2QD 5DYOA 3G9VA 5BNXD 3FUDA 5ITFA 4NC2B 3FOLA 1FORL 3LCYA 1RHHA 4MBOA 5D70L 5EO9B 3TV3H 4J4PA 3ZN6A 4F7CB 4JKKA 1G9NL 4NQCE 5IMLA 1JNNL 4PV9B 5ANHA 4KK9C 1GTFA 3V7AG 4YDIH 3NCYP 1JPTL 4GKOA 5IEHB 2E74C 2R83A 4UQBA 2H6OA 2WZ6A 2O6FA 1P5UA 4ZTEA 4TN9A 1CB4A 1DHKA 1CGWA 1PZSA 4N6RA 2W0LA 2IXQA 2EUVA 3KLAB 3UO1H 2WQAA 3HNTL 3AY4A 4S1QH 4JZJA 2HLEB 2WXGA 5BO0D 5DD6B 4AVJA 2XQBL 5SX4H 1V3JA 3FCSB 3FT3A 4WO4B 1WFUA 2V5SA 4CVZA 1JRHI 1CIDA 3PWJA 2YGPA 4NN5B 3TO4C 1HSBA 3LAFA 2A77L 3QH3A 4Y4KC 2KQNA 4Q9QH 1BEYH 4BUHA 1MFDH 4GO6B 3ESNA 3TN0C 2KH2B 1QLRA 1XCTA 3MOAH 2HRLA 4JK0D 1P9MC 3WMPA 5CSZB 5IVXB 5DFVD 2H3KA 5DC9B 1DUZA 3HTLX 5G4MA 2FJFB 2DL2A 2GBTA 4U49A 4APQB 4EQ2A 5KBKA 2FHCA 5D1ZD 2P5WD 1JZ6A 5CJQL 4PU2A 3CBRA 2G75A 3MLZH 2KT6A 5I1LB 2CHNA 3MV8D 3HPLB 1J1XH 2AVGA 3ROOB 3FB5A 2EDHA 3CFIC 3HC0B 5C08B 4Y2DC 1O7SA 1JHLL 4IIQB 4H8WH 2D2CC 5DS8A 2X1WL 1FGNL 2JB5H 1U3HD 5J5EA 1ZT1A 4PW9A 2NR6C 4JGUA 4P5MB 2BH0A 4ZTOL 3FU9A 4PJHE 5F89A 4HIEB 2CJSA 2X41A 5D7JD 1QEXA 2YD1A 3DVGB 4LAJH 1HEZA 3E8UH 1CZ8L 4FLRA 4HZLA 4N2DA 1PQZA 4HKXA 3L5XH 1OB1A 4NN7C 3RB5A 2P8PB 3WL9A 1D6VH 2WTRB 2ERJC 3UZVA 2XBTA 5C6TL 1AO7D 4OTXL 4WLCA 2F7QA 5D7KD 1ZLUK 3SB3A 1FVDB 4H2AA 4ZXBD 1DJYA 5C86A 2FH8A 2DWYA 3DRQB 3JWDC 1XEUA 5DZPA 4AV4A 4JFQB 4KKZA 4I88A 3PABB 2FL5B 2FH6A 2BXYA 2ZOWA 3FTUA 1ACYH 4JRYA 5CCGE 2J2ZA 5BS0D 2X5PA 3PWNB 2D03H 4E9QA 2PMZA 1T4KA 2OJEA 1RK1A 5EOCL 3QZPA 3C5ZD 3QK0A 3JSSA 2A4CA 3DX4A 2IDSA 2BK8A 2YAEA 4TULH 5HD8D 3CSFA 4NO5B 4XPBH 1U8NB 1NIBA 3MRDB 1RUPH 1QVOA 3B2DC 4R3SA 4HUVB 4PB9H 1H5BB 3AB0C 4N6QA 4XNZC 2HKHH 2QMJA 3OWEA 1BMWA 2OTWB 1SHMA 5J4MA 3HHMA 3S88H 4ZFQA 4O2FB 2MPAL 4OJDH 4TUOA 1YYML 5C97A 3UGUA 2AK4B 1CL7I 2H32H 3TBSB 4S1SH 1UD3A 5CJXC 3VFVB 2BSSA 1FBIL 1FIGH 3QIUA 3WFCH 4JN2A 3I2CH 4OBRA 2ZSWB 1XFPA 3HN5A 4YSUA 3OJDB 4ZFFA 2F54B 2DQGH 3U48A 4V2BA 2J7LA 1N64H 3WIFB 3IFLL 1H6EA 2FATH 3HE7A 1GOGA 3WN5A 4LQ1A 5GISH 3NJLA 1UKQA 2ZJSH 1WFTA 5KUKA 4L37B 3PRZA 4UB0L 2ZE0A 2VLRA 4TTDC 2VT0A 1IKNC 1V5JA 3WENA 2VZOA 5AG9A 1IJ9A 3DVNB 4OZHB 3QEHB 1G0DA 2O4EA 1OT2A 2VSCA 3WO4C 4R5XA 3OKEA 1QFOA 4DK5A 2PW2B 1JK9B 4P3DB 5EEZA 2W0FA 1GPOH 3VB8A 1GS8A 2DEYX 4RBPK 2JB6A 1RIUL 4BUQA 2FWLB 2WWMD 1OCOB 3KG5A 3FSVA 1V05A 3FFDA 4RGNB 1OL0A 1JD7A 1BWWA 4K07A 3RUGF 1AHWC 3D39A 3R06A 2W38A 4HS8H 1G1OA 3HE6A 1WHOA 1NBZB 1AQDB 2Y07H 1EJ6A 4R4FH 2WUCH 4HUXA 4WWKB 5FUOH 3V4PB 1E4WH 3GSOA 3MGTA 2NQDA 1GA2A 2PCFB 3NDZE 1N6UA 2VCOA 3CCHB 1RZIB 2XOTA 4K8RD 4MD5B 2IBGA 3LD8B 4QYOA 4XVTL 5JXED 2NYYC 3HZMA 4AE1A 1KENL 2W0PA 3GK8H 4PJIB 4UTAL 4V1DE 4L3CA 4K8RL 1YEGH 3K46A 3PDGA 1CWVA 4LASH 5DJ2B 1BOGB 2B3RA 3KE0A 4WDIA 1ZIBA 3INOA 1IGMH 4HJ0C 2CO2A 2WCGA 2MQCA 3AT0A 4DH2A 2CO3A 4ETQB 3HAEB 2NXZB 3EZ8A 3ZYJA 43C9A 2FQDA 2Q20A 5ACMA 4M5ZH 3VSVA 4Z3HA 1OGAA 2ARJQ 1E5AA 3FH8A 2BNQE 1NINA 4PJXE 5BZDB 4FA8A 1NMCB 4MWFB 2XZAH 4M7JH 4LKCB 5DD3L 4KK6C 2E7LA 2WAQA 4B53A 3PPEA 1E7VA 2OMBA 2O5NA 5FF6B 5KVEL 4NUMA 4A04A 1BBJB 2Z8VC 1R5WA 2NRDA 4O00A 4KNUA 4I5BB 2D3VA 3VRIB 1C5BL 3D30A 3WIIH 3EFFB 1YDPA 5I5MA 1UD2A 2Y7OA 2IAMB 3NPSC 2J4WL 4OW6A 4LSUH 3X12B 3HS0C 3ZDZF 2IDTA 3LMJH 3OKOA 4MNHA 4R84A 3T8XB 5BQ7B 3JT2A 2FB4L 4K5LA 4XPHL 5ISZD 1JN6A 2MKWA 1EHAA 2YGVA 5F88B 3RIFF 3WKNA 5JPMB 4E9RA 5JPNA 1U8HA 2PO6B 1JPFB 2K45A 2WVVB 3BVXA 4LBAA 2WBXA 2XU9A 4M1DH 1R0AL 2Z0UA 4JS7A 3TT3L 4JHWH 2IPKB 2Y2WA 1AGEB 4HK3J 3FRUA 1KXHA 1F90H 2EE9A 4GAGL 1WVZA 5IBUB 1S7WB 5JW4N 3O8XC 1WUNT 4B9GA 2MQ0A 2XVLA 3HI5L 5BRZB 3LJ3A 4IRSD 1PYWA 4KDVA 3UTZB 2OMWA 4OFKA 2OMTA 1G43A 4M9PA 1C8PA 2D3NA 4L05A 3WFHA 5GZOA 1G7IB 5L2KB 1TENA 1S5HB 4KV5F 3AU1B 1JZ5A 4OVUA 4YSTA 2Z93A 4OCRH 4LCWA 1HE7A 2I69A 1WEJL 3FUIA 4NZJA 3H9YA 2WBJC 4MGXA 4X7TB 4ES8A 2EEBA 4KDWA 2GJJA 1DVUA 4OH2A 1OCRB 3ARBB 4FNSA 3AMKA 3PL6A 4AT6B 1MJ7H 2ZCLH 5KJ7E 4G7YL 3BAEH 1WTGT 1MCDA 1UACL 3BJLA 4H2CA 4GXFA 4AMKH 1TYRA 3BD5A 1XR9B 2ZYRA 2YZ1A 5FDYA 2ALAA 4RGMC 3GMRA 4LOUD 1TKWA 3GRWH 2IPUK 3VI4A 1MJJA 1MRCH 1YEDB 4LDLB 2Q0ZX 2JKIS 1WAPA 1IFHL 4UT9A 1YC7A 1MFEH 1OLZA 5EEXA 5FK9B 2QKSA 2WVSA 1OTUC 2IQAB 2XWEA 1X9UA 2CKNA 1G84A 3GMLA 5JHMA 5IR1B 1XH3A 2VDKL 3DX3A 3MLTB 4FOMA 3G08B 3MA9H 3ZKSD 4BELD 3WV0A 1E30A 2OCJA 5FHBH 5FFLA 1HILA 3D0AA 4G3YH 5HDQH 5I74C 4JO3L 1X5JA 3WS6C 1KFAH 4QRRE 5CLYA 2Z35B 2Z7ZA 3ZE0F 4YK4C 3B4NA 4HHWA 3LS5L 1F1GA 4Z7WB 4L8SA 3TYGL 4LRNH 2OYLA 3RY4A 3SBPA 3ZSTA 1HZHL 3ARFA 3KPRD 5PCYA 4XVOA 2GJZB 5FAAA 4YSRA 3MRIA 1IC4H 3S2AA 5E9DE 3T0EA 2HFGL 3W2DL 5DZVA 3AS0A 3P4MB 2XN9E 4JQIA 5D1QA 2GEEA 1ML0A 3VH8G 3H6AA 2ZKXA 5IB5A 4N2BA 1TLKA 2J1ZA 3LRHA 3TONA 1IGFH 2DIJA 2OR9L 1NM4A 2OR8A 3QJUB 4NAMA 4R4NC 2YN3A 1UYWH 2EDQA 2MMXA 3MRJB 3NVQA 4KXCA 2B1AH 4DKDC 1T6BX 3WJMA 3RE0A 3RTLA 2P80A 4NPYA 2VUOA 1IRAY 5F21B 4O4YH 4ZTPH 2FEDD 3MROA 2NY1C 2NUPA 3F7RA 3TWCH 4NWTH 1BVOA 2G5BB 3DUSA 4FQ2H 2YPLA 1AZZC 4POZD 4OZGB 3D85A 5EU3A 2VIRA 3J27A 4K94H 2I07B 1LYQA 1DBJH 3ARGC 3ZHDA 2J71A 2UY6B 2YWYA 3CFQA 3QXWA 2GK2A 5IQ7H 5KSAA 3DO7B 1GGIH 1KF9B 3CSBA 4F57H 3IGAB 5I1CH 5F8QC 3ZJAA 5JIQA 1N59A 1OEZW 3ETBF 4FG2A 3U4BH 5G4OA 2MQGA 2AS5M 1HEHC 3RDJA 2VJ8A 3B8SA 3PAYA 3K6FA 3MGOB 3QJFB 4RA3A 2JCCE 4EI6A 3WJLA 4A39A 2X4QB 3QPXH 4HBQA 3WS3A 1NFDF 5E95B 3GM8A 3DV4B 1GGCL 4P2RA 1EXUA 2V2XA 1E5UI 4BFEA 5BPPA 3BKJH 1JS4A 3ZRSA 2ZYHA 2Q86A 3E6FB 1KCUH 4MKTA 4MX7B 1G6RB 2VMJA 4D9RE 4M1GL 4X8XA 3ZDYB 2EZ0D 2CDEB 1KV3A 3DPBB 2ZONA 4LRIA 1N2RB 4NENB 1TZIB 3VXPB 2ESVA 3KPSB 4QOKA 4GG6E 3PUUA 1JXJA 1HTYA 3ZK0A 3GHEL 4ZPTA 2IDFA 4GW4A 4N5ED 4KNQA 3EXJA 5E00A 3LV3B 2CWRA 4Z7OE 3UTSA 1U8MB 4JPVL 3C9NA 1LL1A 4F7TB 1AVAA 2D3LA 5D7LA 3RPKA 1AAJA 4FQHA 5HDBF 4HF5H 2GHZA 1I7TA 2VAAA 3ECBB 2VLRD 4YLCA 3IN2A 4AM0B 3KD4A 4D0CA 5CUSH 5ETUB 1T66D 3F05A 4RLDA 5B3JF 5B1AB 5DQJB 2YA0A 4M7ZC 4AQ1A 4WU7A 1K4CB 1FL3B 1M2VA 4NS0A 4FHKA 3GBLA 3IN0A 1HZKA 3LRLA 3QG6A 1BZQK 3OD3A 1QBML 3QUZC 4AOFA 1KFGA 4NUJB 3V4UH 3SKOB 2FECI 3L4WA 4CU8A 4K3DH 3P3YA 3AABA 4YSEA 4EMZA 2OSLB 3LZRA 2JQMA 4DZBB 4MS6A 2VISA 3MC0A 2F5AH 3F12B 3QWNA 1YN7A 3D39D 3HE6D 4OZ4B 5I1KH 5I6LA 1G94A 3CIQA 3MOQA 1F0LA 3Q8CA 3RVUC 1UG9A 1MY5A 2H1PL 2VDMH 4Q4EA 3MRHB 2OQJA 1BQSA 1TQTA 5HHMD 4B5EA 2K7QA 3NTCH 2W92A 3CVCA 4M61A 4O2EB 4PJFB 5C0RH 4LCYA 1CGSL 4XGZB 1DJXA 2GB2A 4WK2B 4ZW6A 5HSFA 4NQCA 1OSZA 2VN7A 4IRJC 2I9TB 2O72A 5EZJB 5FX3A 3SOBH 4V2CB 3OG4B 1T2XA 2JJWA 3VE0A 4AL8H 3VXSD 1TJIL 2E5EA 1IAOA 2Q8AH 1PLBA 4QRPB 4H0LC 1IEBB 2X0UA 4S0HA 2EXWD 3RYMA 1UWEL 3H3PH 1Z0NA 3DRTB 4GSDH 3IVKA 1T2QH 3ZUNC 1KIPB 1NUFA 4XC1L 1IT9H 1ICTA 2HJLA 4JM4H 4KMQA 4XPGH 3WKYA 1HU8A 4C55A 4Y9GA 1HINL 3KLSA 3V6ZB 3CC1A 4I0KA 3RWHB 1T0NB 4CILA 5LG1A 1VACB 4UDTA 1SEQH 1D5MA 3C87A 3N85H 3ZIYA 2CJUL 4YPGA 4MA1C 4TQIA 1WHPA 3MPCA 3REWB 3DECA 2NXYC 2Z6FA 3QCUH 4LARL 3DX9A 5EBGA 2ENQA 1NQBA 2HLAB 2W59A 2ED6A 2FTAA 5BXFB 1SF5A 2CNZA 1NGXA 1LP9F 3EBHA 1BD2E 4FA7B 2H8PA 1P4BH 2N3JA 1KSRA 3JV6A 1X4XA 2W9DL 2XYBA 5FCSH 3H1ZA 3C08H 3GMNA 4CADA 4P5TC 3MBWA 4B7IA 2WIIB 3OQ3B 4HWBA 4P2OA 5EA0H 4TNWK 1TTAA 5FB8A 3F6JA 4FCHA 2FX7L 4J6RL 4PJHA 1F8TH 2K7PA 5F93C 2VR6A 4E41B 1AR1D 3LKRB 3LX9A 5KN5A 4XOCA 1N6QL 3AC0A 2HRGA 2WZ0A 4KPHH 4LCWD 3FRPB 3AXLA 3GS7A 1YZZA 5T1JA 2BWQA 3EYUH 3NIGB 3QCTL 2BCKA 4WI9A 3BLKA 3HLAA 4Y88A 3RNQA 3X3FH 4G8EA 3VMPA 4Z78B 1M42A 1XV8A 4XMXA 3PL6D 4UQ2B 1CF8H 5E4EC 3BEVB 1JYXA 1FVCA 4G7RB 5EO1A 5I28A 1FRGH 5D72H 1M7DB 1O5PA 3OAYK 2P28B 3L08A 5CU5A 2R2EB 2FJGA 3UIZA 4W1TA 3K7UA 1F45A 1WWBX 2CO4A 2ZX6A 1E9QB 1E3ZA 5IQLA 3S48A 1CFTA 3Q5OA 2D4FA 1Q1JL 1ZE3C 4AK2A 4MCYA 3HMWL 3P4OA 2JJSA 1E6OH 4UT9L 3QWRA 4L0PB 3BZDA 1AYOA 4A6YB 1TQUA 1I3GL 4KTGA 5C2UB 1IZKA 1K5NB 4YFEA 4L3EB 4LPWA 3FUFA 2NNAA 3KXFD 1ZDQA 1AKJB 1JYVA 4AVHA 1MF2H 2YUZA 4K15A 1HCZA 1ETB1 4R6UA 2B7DT 2J8UF 3JBG7 5DQDH 3ZE2E 3L4TA 3ARDC 3HZYA 3B37A 4KKAC 5LBGA 4MZIA 4YSCA 5K9JL 4Y16D 3GTTA 3ATEA 4OLUL 5GS1A 3V0WL 1QZ1A 2X2UA 5GGSY 3VH8A 1N8OE 2WXKA 1OP4A 2CRYA 1TEFA 4FQXC 4DAGH 4G7VL 5J3HC 4DF9A 3WAJA 5KW9H 5D1QD 5IBLD 1HH9B 4CVUA 3IDMB 4MMZB 4U3CA 1NCBH 2K3TA 4FP8H 3ARRA 1JV2B 3I50L 4R2GD 2VR7A 5HHPA 1UKTA 2QSCL 3W9DA 4HFUH 2DI9A 2AI0H 2VDPH 4R7VA 4Y5YC 5SWQA 3W1ZA 2XFGB 4EKJA 5E8EB 2D7QA 2IDQA 2K78A 4U1NA 5DFWH 4C59B 3FUMA 4HAKA 3QFDB 4Y1AE 1HWWA 5DJXA 3SCMD 3LNFA 2P80D 3PY9A 3RVWD 2A1WH 4HOZA 2HG5B 4QUOA 5D55A 2C3XA 3RDTA 5IV2A 3CFDB 3RZWA 1O6SA 2DQUL 4P0DA 5TE6H 1T5WA 3BZ4A 1G1CA 5FFOA 2YPLD 5DK0B 5AW6B 1SVZA 5J8OA 1MCPH 1SXBA 1A7NH 2EIZA 1KPVA 2YMTA 2DQDH 5KSAD 4DKTA 4LLDA 3LNGA 1IV8A 5FDWA 2AAVA 4CAGA 2FYYB 5K69A 4NOFA 4X4KA 4LCUB 1F02I 1L6XA 4PJBE 4QRSB 5TPWH 2FX9L 2ZWNA 1KGCE 1TQVA 4QY8B 2NXZC 4P9HH 1GW6A 4PI2A 1ADQH 4V1DA 5DQ9A 1NBYA 1J48A 2ZIDA 4PAZA 3WEAA 1A1OA 4Z0BL 5F72S 4I18C 5I5RA 5IVXF 5MEPA 1XGQB 3X1EA 1G9MC 2O6DA 4AXWB 4CBPA 1NPJA 4F8PA 2BNQA 4PJXA 2YPVH 4Q56A 1BBDL 1ZTXE 1GGTA 2B2XL 4PG2C 4NJAL 5HYQA 5F0PB 1EEQA 3DROB 4LCVA 3NP4A 1J88A 2C9RA 3LN5B 2B9AA 3CMOL 3FXIC 3SD2A 1H15B 2DYPA 2AEIT 2X87A 3UTSD 2UVEA 1NEPA 1S9YA 1JFQL 4NO2B 5EOQL 2CD0A 2CUMA 4PR5A 5D7LD 2G0LA 2NY6D 5E2UH 3X11B 1J0KA 5A43C 4LDEB 1SEBA 2GTQA 2OA9A 4LPXA 2N56A 3TBVA 4QPEA 3ATFA 4WW2A 3L3HB 2F18A 1ZANL 1P7BA 4NQQA 5DZNA 4OKVB 4PMFA 3U0TA 1N0LB 3BGAA 2OYMA 1SBSL 2V17H 4QNPE 1EV2E 4L5FL 5J6GB 2XTLA 2HPOA 4NHUB 4N4YB 4XMPH 2OSXA 3GSNH 2NOYA 3DDFA 1BQ5A 1WTLA 4O2CA 3VFRB 3DX8A 1LO2L 15C8H 2MOQA 4NNXB 3RWFB 1UATA 3FQWB 1NBVL 2FEEL 3E80A 1FO0H 2Q2LA 4ELMF 4HQQH 5CEXA 3QWOB 2P4AB 1U93A 4KUCF 1FZOB 5H8DA 1TQCC 2NZ1A 4QRUA 3VD1A 3TLRA 3KPOA 1NDGA 3D0LA 3PG2A 4N0CD 3FH7A 1KIUB 5KUMA 5GHWL 1T1ZB 1DVSA 1T04A 3OGCA 3LXUX 4A2MA 4ZAKA 5JA9A 1GSKA 1W72B 4PV8A 4EVNA 4F9LC 3ZKMD 3OG6B 3NFNA 4KY2A 3NRFA 2HTKC 3UJJL 4X4XB 2LFGA 1QHOA 3VD9A 1ZHLA 3DJ9A 3QXUA 4HXBH 4YMPA 1FN4A 1LHZA 3QJSB 3OM3B 3BP6A 1RCYA 4R96A 2HP4A 1NGZA 4RWYL 1W8OA 3ABLB 3SYAA 2YJQA 1KYOK 4B3EA 4DHLA 1QWUA 5DJYB 1R3JB 4J28A 4OFPA 4UOZA 1NGYB 2OI9B 2I60L 3GUTA 2BVYA 2OULB 4ZX3A 4NQEB 4X7SH 2GUYA 4QKXB 4XCFH 5E8OB 2X7LA 5AVXB 2CHZA 3QDJB 4WGWB 3TT1H 2A74B 3D8MA 5B8CC 5CCKH 5KSVB 1KJVA 4OZHF 4FG6D 4AZUA 4CNIB 3C09B 4R8WH 5JOPD 2ENPA 1AANA 3S5LB 3VVVA 4Z7AA 2IGFL 3HJEA 3AACA 3BPLB 2WK2A 3THMH 3C5JA 3MBEC 2V37A 3V4VH 3NSYA 1XO8A 4H26A 3S37L 4ELDA 5EC1B 1NAMB 2D4DA 5IHUH 4HISA 1OCWL 3VXTA 4JG0H 4U7MA 4K2UH 5CLWA 3ALPA 1PBYA 2Z64C 4KH9A 5GGRY 4IU2A 5IBTH 3Q6FA 2WJ7A 5D4QA 5T5NG 4ODWB 3KDMA 5E9DA 4IMLB 4AKQA 5KAQG 2XN9A 3QBTB 4TOYL 2EC8A 4JO5A 4PY7B 2VDNB 4AVKA 5EO0B 4BFOA 2NQ3A 1QBLL 2VDLB 3Q9QA 4RFOH 5AW7B 4P2OD 3SY6A 3BWZA 4FNPA 1OD7A 2QPDB 1MAML 2WB1A 5HHVH 4YEEA 4HWBL 3MNWA 5IMOA 1NANH 4G5AA 5EUKA 4DP1X 2R0ZH 4P59L 4OV5B 4HDIA 5GSRB 5J11C 1UFUA 3VDAA 3EBGA 1AHKA 5AWNL 1VPOL 1UGKA 3SKJL 1CC3A 5IVNA 1G5GA 5T1LB 3PP4L 4X0KB 4C57C 2XWRA 4CN1A 4P8QA 1BPVA 2X4OA 2VZ1A 4UQCA 4NZUL 3WLWD 2G4EA 4X9IA 5KOMC 3ZKXC 1NZRA 2X4TA 3DMMD 3UBXB 2ZF9A 1GGBL 2FBJL 1EVUA 1YEHH 2IO5A 3EYFA 3FU3A 4MAYB 1NCCL 3KPTA 5DVNA 5KVGH 1CBVL 2ID5A 3L3IA 1QSVA 5ADPL 4N85A 1EIBA 1MY7A 2YD2A 4GKNA 4PJ8B 5KVDL 3VXQB 1HQ4B 5JIMA 3LEXA 3EUUA 4N8CH 2JCCA 3MLPA 2YAFA 1KCVL 3TFKC 1PG7H 2DTML 5EMYA 5C3IA 2JXMB 4WFGE 3BQUB 2GSGB 2OPCA 2HVJA 3FDWA 3MUY1 4JFVA 4Z76B 5EU4A 1CK0L 2V5RA 3HMXH 2WMPA 4XNXL 3HN3A 4HXAL 4YWGH 4N2KA 3DV6A 3FSZA 5K9KB 1XT5A 1S7VB 1JK8B 3HB3D 4G80A 2COVD 5DO2D 3FO1B 1KEGL 5C0EA 1UXWA 5I5IA 2A6KA 3LEYL 1IGYB 2W07B 3AREB 3B5TA 1FFPA 5EV7A 1YYLH 3NABL 1JWUA 1X5KA 4Z7UB 2DYSB 5DD5L 4HBCL 5D4IA 3EOYG 3QDGE 3D52A 3LKNA 3ARYA 1T5XB 3ET9F 5DEFB 1ZLSL 2M26A 3WI9A 5JPNC 3ABMB 2DQCL 3FT9A 4GG6A 2UZYA 4U0RB 4PIRF 3ZO0A 3PWPE 1INEH 3HZVA 2AJYH 2LVCA 5JW3L 4L8DB 4Y4HB 5IF0A 4XO5A 3MOBL 3KYKH 4K9EL 4GAAA 5AAMA 3O2DH 1YAZA 3ARPA 3SZKC 5JXAL 3KLHC 3K5RA 4P4KB 5LCVL 1BYNA 1ZA3B 4AQ8C 1BGXL 2AQNA 3P9MB 4G6ML 4KRMB 3DOHA 3MCG1 1DDTA 2GJPA 2ZKHH 3UZEA 1XQ4A 1V27A 3DWTA 1VESA 5GZOC 4WEMB 3I3EA 2F19H 4FCAA 1DQQA 4UQEA 1WIUA 3RRQA 3RVVC 3V9EA 2MPVA 3M45A 4O5LH 1JHKL 4GIAA 2NNCA 4CSPA 5I66B 5AOLA 4W9KC 3SDXB 3MTRA 2HT3C 3OHXC 5C0JA 1JVOA 2J6EH 2WD0A 2VN5A 3QQ4A 3M8OL 1QA9B 2NY4C 1NAKH 1PL3A 1TSHA 3BVVA 4UT6H 3EFOB 1WITA 2NTFB 4GW5B 2JK5A 3GS4A 5DLML 4MVBD 1CN4A 3AFLA 3B2MA 4HW6A 1WBXB 2K9FB 1N9PA 3L8QA 4OCXL 4H0HB 5ICZA 4FHJA 1R17A 5EIVA 4OZIB 3GIZL 2TSBA 1V3MA 2H7WA 2VSDA 2PETA 2N1TE 1QR1B 2EO1A 2J88H 3QULB 3CFJB 4JFOB 2R27A 1M2OA 4M03A 4OCWL 3H4FA 3U30C 1ES0B 1BF5A 3D2UA 2L4OA 4UQ3A 1NFAA 3CN0A 4A2DA 4KTDL 2YKKA 5C0CA 4PJ9B 1OP3H 2WYZA 3EJYC 3HN8A 4XBPB 2VXSH 1I1AC 2X6MA 1PZCA 1QI4A 3E2HC 5DD1L 4GAYB 3S6CA 4FLOA 5T1KA 2E3VA 3CMGA 4YLQT 1U58A 1IGTB 4Z7WF 1QFWM 3OB8A 3NSDA 4PW4A 3TJHD 3VXOB 3Q2VA 4Y8DC 4AIZA 2WXMA 4QRQA 3WD5H 5E2TH 1WWCA 4QAWA 4X4YA 2QQKL 4MQXC 5KTEL 4FZEL 1K8DB 3WU1A 1WBYA 4UV7L 3A6CL 1N4XL 3ARFC 1TG8A 4XXCC 1A1MA 1JZDC 4JB9H 4V33A 2WC7A 1A3RL 2HG0A 2PWEA 2CSPA 5IK3B 4R9HA 1AGBB 1WZMA 2DYPD 2JKXA 1TYEB 3DHUA 3HUJA 5I82A 5FGBC 4GRLA 2YEZA 2NMSA 3KBFA 1QWHA 2BWIA 1R47A 4JREB 3JTTB 3P40A 4XNBA 3ZKNC 1JUFA 3RWCA 5TDNA 5D96B 5B39B 4BH7A 2X40A 1RJZB 2E7HA 3KHOA 4FABH 4KK5D 1EAOA 4DK3A 1D5IL 1FC1A 5MP6L 3V10A 1T89C 5HDRA 3RY6C 4OZGF 2R56H 4GW1B 2F1EA 4XBGB 5D93C 3UTPE 5ALBL 1XB8A 1XIWC 2NX5B 1RKRA 3O3AA 3UYRL 2BP5M 1XH0A 1AR2A 3F3HA 3GRGA 4L29B 1BLNB 5EUOB 4GI9A 4TNVK 2AJZB 2VH5H 3LZNA 4WHCA 3MJ7A 3RFRA 1E28B 3FFOA 2ITDA 4P2QB 4X6BA 2DBJA 3T6QC 4EO5A 3BGFC 3LSOA 3LY6A 2JI1A 2XICA 4WNJA 2H32A 1HXMB 4MLIA 4OM1L 5I1IH 4DESA 5I0DA 3P3RA 2VXVL 3VNYA 5EC2A 1H6TA 1SNRA 1UADC 4JPWL 5BW7C 4JG1L 1SLUA 4MJIA 1GS7A 3C75A 5DMYA 2VXUH 4XT1C 3VGDA 3PAVA 4N2MA 2EIMB 4HPOH 5FYKD 1ZLWK 3CQFA 4YHZH 4HJIA 4XCEA 5BMFH 3ZDYF 2W5PA 3RZCC 2F0CA 2IBZX 4FEIA 3TC9A 5FYKL 4P23B 4QJ3B 5EZOH 4OGZA 1B3JA 4CDGC 1P4IL 2NT1A 3O2VH 3K6SB 3NH7L 2Z92A 3O9WA 1PAMA 4Q89A 2FDBP 1P4LA 1OTTD 1FNFA 5TDOA 4RMUA 4HS3B 4JDEB 1YLBB 1WLHA 1MWAL 3MRGA 4ORGA 5D1XE 1K8IB 3ZHKA 3CHXA 3TPUA 4YSQA 3N1FC 5E94A 3CLFH 4W9HC 4BKLA 1B4JL 4X80L 1SLWA 1IKFH 1BAFL 4XB7A 3L3OC 4FGMA 1KNOA 4JAMA 2BP0A 5KBLA 1KCWA 3FN0H 3CZFA 3IWUA 1QRKA 2YA2A 4PCSA 5D1ZB 2P5WB 4ZW5A 1QPPA 1TMQA 2I5YL 4ODVH 3EO1A 4U6XA 3H42L 12E8L 3MV8B 2WN3A 4LMQI 2WZPD 5LWYH 3CH8A 4YGVA 3BAXA 1OAKH 1BQRA 1H3UA 4L8BB 3WTXA 1KY6A 1AE6L 4PRAB 1KTRL 4QXTA 4JPSA 3D1MC 2MCPL 2ODHA 3TJEL 3V5KA 3VWKA 1QP1A 4M5YH 1AGFA 2X4SB 1RUML 2XTJD 1FAKT 1TETL 1O0VA 4OCMC 1FNGB 1TVHA 4CU6A 3VXUA 3HNVL 3DC0A 2GI0A 5D7JB 2H1LM 4PWGA 2KUTA 2ITEA 1YNTB 2CR6A 2GIXA 4RESB 4TXVB 3UC0L 1NDMB 3QDME 5HYEA 2BSTB 3D12B 4ILDA 4ZUVB 3WMSA 1AO7B 4BCXA 5EF1A 2F7IA 4ZXBB 4WI2A 3IRCA 3UAFA 4Y1AA 1JE6A 2AJUL 2DIEA 4WEUD 5F71A 3IXAA 4MD4B 5H4YA 3O11A 3QZOA 3QAZC 4Q97A 1AI1H 3GXDA 5BS0B 3SE8L 4JQVA 4FNLL 3W0WE 7PCYA 4PVNA 4APXA 1D5RA 5CN1A 5DR5L 3WEOA 3C5ZB 3RTQD 1GZQA 2CLRB 3MV7E 4OQTH 2P5EA 3FMGL 4LOVA 1F3DH 4CMHC 5T3ZL 3AROA 4NKOA 5FKPB 4XH2A 1A3LL 3QFJE 5H4ZA 5F3HB 2H0PA 3D4YA 2CRIA 4OLEA 1UASA 4KVCL 3GXNA 3SE9L 5C0ND 1NMBL 3N1GC 5ELIA 2CH8A 3CFKB 4PJBA 1A6UL 5D1ZI 1A6TB 4NNPH 1RMFH 2VE6A 3ZTJH 4R7XA 2Y25A 5HBBA 1WS8A 1NEZG 1J1PH 5D9SB 2OL3H 4WWID 1BREA 2I26N 3BH9A 4FQ1H 1P5VB<