2ZOTA

Crystal structure of human f-spondin reeler domain (fragment 1)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
141
structure length
138
Chain Sequence
b'CSRILRAQGTRREGYTEFSLRVEGDPDFYKPGTSYRVTLSAAPPSYFRGFTLIALRENREEEDHAGTFQIIDEEETQFMSNCPVAVTESTPRRRTRIQVFWIAPPAGTGCVILKASIVQKRIIYFQDEGSLTKKLCEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spondin-1
publication title Structure of the F-spondin reeler domain reveals a unique beta-sandwich fold with a deformable disulfide-bonded loop
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 25
structure length 138
sequence length 141
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02014 Reeler Reeler domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4060 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2zotA00
2ZOTA 3COOA 2ZOUA
chains in the Genus database with same CATH superfamily
2CIIA 3LDBC 1ERNA 1F6AB 3BKML 5AZEH 3DPBB 1KJVA 5HDBE 1BVZA 1G7HA 4HZLA 2AXGA 2VDNH 3TJPA 5IQ9B 1YMMB 1WGOA 1YEDB 1AANA 1BHGA 5IW6B 5DJCB 1GZHA 1YAZA 5DD3H 4QRQB 3ZKSD 1RZGB 5DZAA 2VC2H 4Y19E 4N2DA 4J3OG 4PJGA 1QKZH 2FATL 1QACA 2E7DA 3B43A 1KGJA 3BPCA 4PJXE 4DIXA 1TU2A 3U1SH 3HW7A 4HYTB 4HIQA 3UO8B 1F0LA 3NTCL 3CD4A 3W2DL 1ZJBA 4UNVA 3WY1A 3DWTA 3P73A 1SYSA 1I85C 1CGUA 1YY9C 3G6DH 2R29H 2BC4B 4LDEB 3S98A 4JG0H 3T8VA 5B1BB 4XMPL 1SQ2N 1QABA 3OJDA 5H94B 1ZGLB 4EEEA 1U3HD 4P48A 1E6JL 1JYVA 1BQUA 2VABA 3Q01A 2EUZA 2P5WD 5EOTB 4XPFH 4S1SL 3HG1E 2GTWB 3CHPA 5DJXB 1DEDA 3OKNA 1A1OB 1TVBA 2DQGL 5GXBB 1MKFA 2DWXA 2XQBL 1QR1A 2X1PA 4G7QB 2W60A 4G72B 3VSVA 4MZ2A 2OTWB 3UO1L 1JE6A 4G6KH 4A2HA 3NUKA 1N5YL 2ODIA 2NY5C 1QAWA 2V5SA 3DBSA 3FO2A 1BSIA 4J6IA 1N6QH 4LRNL 4NN6B 1KBGH 1JGLH 1WWBX 2XBDA 4W9ZA 3AS1A 2GJ6B 3LQAC 2BY1A 1F5WA 3U0TB 2LQRA 3U30C 4EBQH 3SGEI 3W9EA 5CZXD 2W0LA 3FU3A 1HCFX 1LO4H 4EPSA 1AP2A 1INQB 4ZXBA 1ZHKB 1FAIH 5IKCB 4HJ0C 1EX0A 1UVQA 3NBNA 3L2MA 4F7EA 3VMPA 2AZAA 1WK0A 1OCCB 2BNRE 5ELIA 3RWGB 4OV6F 3QO1A 4NJAL 4AITA 1FL5B 1KGYE 4A7SA 1C8QA 1PGRB 1Q38A 2BSRA 5B1CA 2P4AB 3CXHJ 4JRYD 5CP3A 1MRFL 3PWVB 2NT1A 2GVYA 2IBGA 4WSJA 3QG7H 4RSYA 3TO4D 4PIRF 2XJLA 5CWSB 4MJ5A 5IR1B 3ATAA 4D9QE 3QQ4A 4MMXC 5C0BE 3RVVC 2FK9A 4N25A 4D8PB 1F8TL 3QUKA 3OWRA 3V4PH 2J88H 1AO7B 1N0XH 1JDDA 3C12A 3CQFA 1P4LA 1U91B 4Z3GA 1FVCB 3APCA 2KZKA 2PTTA 3EUDA 4NRYB 3U7WH 1XSKA 2HT4D 2OLDA 2WYHA 1CTMA 4RX4A 4LPTA 2E0PA 4KKNA 4P59L 3T0WA 3PUUA 3P4NB 4Z7AA 2BOLA 3FUDA 3CG8A 1JTOA 3CVIH 3QUZD 4IRZA 5IM7B 5J5EA 1KEGL 1DVFC 4G8EB 3U79A 4AV4A 4HLZH 2IPUK 1EA9C 2PP7A 4ZD3L 4DGVH 4UTCA 2FWOA 1QEXA 1TTAA 3FJTA 3BOVA 3Q8EA 5BRZE 4AZ8B 2O6EA 2BIOA 4GW4A 4ETYA 1OAZL 3EKCA 4BSWA 1VEMA 1XF2B 5BV7B 2VO5A 4P2OD 2ADGB 3H9HB 4PJCA 3L2LA 4MJ6B 1ZSDA 4MYWB 2JIXB 3F01A 4EZMA 1BFOB 3AAZB 5C08D 1BQKA 3IJEB 2HB0A 4EN2A 2ESVD 5T5NG 1D7DA 1V7MH 3MN8A 5HHPA 1I4FA 1UHVA 3COOA 4AGLA 2BIMA 1KN4L 2VL5A 5EO1A 2UZIL 3G5VB 1ZLWK 4PY7B 2YPVH 4ZTEA 4KTEH 5F7EL 1DQQB 3FF7A 1E2VA 2WZPD 3L3GB 1JK8B 1OARL 4J8RB 1NCCH 1U8MB 2KLTA 4UBDC 3L3HB 4FQIH 3S3PA 2VXUH 3TN0A 5CR1A 1U92A 1N26A 1FVEA 3BLKA 3FK3A 3SO5A 3DXAA 4ODWA 1XGQA 3GNMH 2B77A 3P77A 1TEGA 4M48L 5B1JC 1G6VK 1JAEA 1CD0A 4X6DA 3DUUB 3PG2A 5KSAD 4W9HC 1MIMH 4M62L 1OP4A 1OT4A 2F54D 2HYMA 4RA3A 5DC9B 3K6OA 1R5WA 2NY1B 3V6OE 1KYOJ 3BSHA 2IF7A 1X4XA 4FNQA 3WO4C 1JF6A 3RX5A 3QP3A 2XG5A 3B7YA 3KVPA 3M8OL 3ZDYF 4G9DB 3H42H 1ZA3A 1IFGA 2ZNXA 3IWVA 2CCWA 1IBDA 3DJZA 3S9DB 3FONB 4FNRA 4N0CC 3VGBA 1BVKA 4NQEB 4XAWH 4H2AA 4JRXA 5DDHA 5DLML 3L3DA 3X2QB 3K8MA 3BWAB 3D2UB 4NNXA 5CKAA 1PYWB 2AJUH 3DVGA 2O6FA 5IROD 4F9PA 2L7QA 1EPFA 3C09C 3FU0A 4MS8D 2QMKA 2ZCKL 1MWOA 1FO0B 1HSBB 1NOAA 1Z9PA 2MQCA 2O5XL 1FZJA 2W65B 5I1HL 2XNAB 3U0WH 4ENED 1XBDA 1I85A 3S8FB 5KBDA 3KLHD 1EHLL 3UTSD 1SOSA 3MCLL 4Y0GA 1OP9A 4JHUA 3B2XA 3HHMA 3DMMD 4D3CH 3K1KC 4LHUB 4Y5XC 5I1IL 1F3DJ 4K5LA 4M9OA 2BZDA 4WO4A 3RL1A 1S7QB 4U1MB 1S7XA 3EYVB 4G2AA 4MNHA 1JG9A 3V0GA 43CAB 4WJ5B 3VI4A 4OV5A 1RSYA 4GUQA 1KN2L 2QR0A 4L3CA 3MLXH 3OM3B 4P49A 1YEJL 2CR3A 4GIPD 4YXKH 3K6FA 1I7TB 2FX7H 4XVSH 1HOEA 2R2HB 1YHPA 1ZEAH 3CHSA 1ZLSH 2XICA 5CGYD 1KC5L 2VDLB 3L5JA 4XXCA 3CPUA 3F84A 1FL3A 3BAEL 5CD5C 3N85H 1PY9A 3RBSA 3VRLF 1OAQL 2DTML 4J12A 5IHZB 4G8IB 1SNRA 3ZZ1A 4JM2A 1ZLEA 1ED3A 2PO6D 2VXQA 3VFVA 4A7TA 4AXWB 5AYUH 3VJ6A 1M7DB 1CFNB 1PEWA 3W56A 2FQGA 3SY6A 4JJOA 5KVGL 3D18B 1I8LC 3GZQA 2YMOA 2IADB 3C5JA 3E7JA 3MA7A 3ZE0B 4U6HB 4GQ9H 5EOCL 1IEHA 4RGMB 1H6UA 4YSTA 4GIOA 5BUAA 1KFAL 5JPNA 2ZOUA 3PWJB 2DOCA 4L9LA 4LQFL 4DHLA 2J55A 2AMUA 1NGPL 1O6SB 2DLHA 2VB5A 3BZFA 3NIFE 3PHQB 2AVGA 5KS9A 1IBZA 4OAWA 4OLWL 5F1IA 1XCTA 2CMRL 4AGMA 1U3YA 3C5ZD 1OT1A 3KPPA 1ZVHA 2CUAA 2IH3A 3EGSA 4WNQB 1DBMH 2OSLB 3KYOA 2HRPL 4P05A 3QIBB 4GW1B 1HWWA 2JCCF 3S96B 3IDNB 4R2GC 2BHZA 3U36B 2NZ1A 3Q2VA 4BA8A 4KJYA 5K9QG 1RUKL 1G0YR 2FQFA 4LLUA 3UCRA 3BKMH 4OGZA 2FEDD 5IG7A 4BXSV 4N90D 4AYDC 1RQ5A 2UZYB 3NZ8A 3KPRA 2FJHA 2GCYA 4KZDL 4G9FD 4GSXA 1XF4B 1T1WA 2IGTA 1ES0A 4OJDH 2P8LB 4NQUA 4Y5VB 2FATH 2ZP0T 3QEGL 2BY0A 1RFDL 4A63A 3LIUA 2ZYRA 4NN5C 3QQ9C 2QMJA 3NTCH 2PN5A 1EZVX 4LAQL 1B9KA 4P46A 1LO5A 4IRZL 2E7CA 3TURA 5AG9A 4NZ8A 4Z7IA 5C0CB 1Y18B 4WEBL 4ELMA 1EXHA 1D5MA 4XMPH 2XVGA 1F13A 2CHWA 3UTZB 2A74A 3NCCB 1NLDL 4WDIA 4Y2OA 4S1SH 3PV6B 3FHAA 1ZS8B 4XNYL 5C07D 1GJUA 1P1ZA 5EC1A 1YECL 2DQGH 4P4KD 4F91B 2XQBH 5K69A 3L3IB 4GKOA 3C60D 1ZLUK 4HSAC 1MCFA 3WUZA 2ZUTA 5E1GA 1ETZA 4LRNH 1F4YL 2YQ3A 4E41B 4B9KC 4G6FB 2ICWB 3MV7D 3RUGE 3LHPL 4MLIA 1Q9KA 2QQLL 3BWUC 3FUEA 4GXVL 5EH1A 2CH8A 4UNUA 4LDLB 3RVWC 3RWFA 4JRYE 4H0LC 4JFQA 1WIUA 1SJHA 2PTVA 1QA9A 5D2NA 2WVVA 3NGBC 5FCUL 5EU7E 1H0DA 5ECGA 3KXFA 3DO7A 2Z1PA 3SPHA 5D7JB 4GW5A 4NJAH 7TAAA 2Q86A 3Q6GL 4KDTC 4W4OA 1FG2B 1DQTA 2BDNL 4E9TA 4GRWE 4QTHA 5CNHA 3GMLA 1MRFH 3IDUA 2I26N 3KG5A 1J88A 2FIKA 5E2UL 2WXNA 3NFPB 4FX5A 4JO4L 4TL5A 4BDVB 1HCYA 1F8TH 1E4JA 2NNXA 3AU0A 3CFCL 1A4BA 4MA3A 5EIIG 1XCQA 4YQXL 1DBJL 5GIRB 2DQFB 1A5FH 2IBBA 2XTJC 3QUXA 4RAHA 3IMUA 5DUBB 5T3ZD 1HYSC 3F83A 1ULVA 1FHGA 1BX2B 3QI9A 5I8EB 2KDYA 2CBQA 3QJFA 2Y7MA 4PS8A 1GY2A 4P59H 2Y1YA 3SYOA 1EMTL 4ESKA 1EEUA 3FTYA 3NAAL 5DJ2B 4WU7B 1KEGH 4FEIA 2H45A 1HYRC 3DBXA 1DSYA 2ICEC 3MX0B 2QEJA 4ZD3H 1UOKA 5MEPB 2XVBA 2W9EL 5C08E 1I9JL 3NP4A 1MCBA 2ESVE 3UAFA 3L6FB 3MV9A 4N3UA 2DZEA 4HOWA 3L3OB 4EUPH 2FYYA 3QIUC 3AMLA 2CO6A 4I0PD 3CPLA 3EJPA 1KB9J 3QFJA 1MXGA 4WTXA 5E2JA 4RRPA 2M1KA 4N5UA 1VESA 1MHEA 5HJBA 6PAZA 3QUYC 4TUKL 2WBKA 4ACTA 5EB9A 1ID5I 1LD9B 4N0YL 2OJZL 2RGSA 3LEVL 3QNYB 5ICUA 3ZOAA 1KN4H 2ZJSL 3K2IA 3RHWF 2UZIH 1ANUA 1OCRB 2CXGA 5F7EH 1JGEA 4Q8BA 1ZDSA 1DDTA 2F54E 3M1BA 1PY4A 3QDMB 4K5PA 5E6SB 1OARH 4CVWA 3CC5A 4YHLH 3NJJA 1Z3GL 4ZK8A 2YA0A 2B7DT 3EHBB 5FWRA 3ZKNC 5ESQB 3KBPA 3IDXH 5D1QA 3VXTB 1GGBH 3L7EB 4M48H 3MCKB 5ES4B 1CDIA 1W8OA 3FCTA 1RJYA 4DZBA 3KVDD 1HC1A 1I9RL 2P52A 4M62H 4Q9CA 4GP4B 2UY7B 1RU9L 2WW8A 3N43B 3GMOB 5HDOA 3GXMA 1JIBA 3OLIA 1BVLA 2ZSVA 4FLOA 4OJFL 2YEQA 4GXFA 4DN4L 1J0YA 3BESR 5FKAB 1BOYA 4BQCA 1YRKA 1CCZA 3M8OH 1A4AA 3B9KB 1ZXQA 3HVDA 5D93B 3IKCA 4H26A 3BSGA 6TAAA 3J2PA 3LQZB 3NN8A 4UTAH 4ZUTA 2B16A 3QRGH 1Z1WA 2BSED 2LU3A 4NENA 5JORA 5DLMH 4G1MB 3EGXA 1EK3A 3OF6A 4ORGB 3UTSE 2ED6A 2FL5B 5D1ZI 1AIZA 1BD2D 2BNUB 2RCSL 5CGTA 2YS4A 2ZCKH 4UV4L 2HVBA 3ARWA 4NN6C 5ETUA 2O5XH 3B1TA 2PCPB 5FW7A 5IGXL 5GQBA 5DJ8B 4HJSA 4JJ5A 1A8ZA 2QVTA 3MCLH 4FXKB 5E6YA 1SJVA 2K6YA 3X1NA 2PW2A 4Z7VF 3ZIMA 3L81A 1P5VA 5I1IH 1CFQB 2V2TB 4RIRA 3FB6A 4HULB 2QVFB 3CBJB 5CCKL 4X0KA 3KM1A 5K33A 4RSVA 3SQRA 2B0SL 1YEJH 1PZAA 4NQXB 3CFDA 2WIMA 5E00A 1RH8A 1NFIA 4GRMB 1KC5H 3SBRA 5TGBA 1X7SA 5M94B 1OAQH 2DTMH 5EU4B 4LIQE 2VDKL 4XP4L 5EU5B 1J8HB 4PYGA 2V9TA 1KCSL 1ND0A 3JWNE 4OCWL 3IGAA 1NDMA 2ENQA 4KVCL 4M1DL 4BFKA 4F8QA 5JOFA 1OGTB 4KKQA 4RFEB 4X9IA 4BE6A 3SQOL 1OB1B 1YNTB 1QNIA 5KVGH 5DC2A 3DPDA 1T03H 1JPGB 4KBPA 1AMXA 3SDCA 1BXXA 5GS2H 2X4NB 3BT0A 4NIYE 5EOCH 4Z3EA 3ARTA 1TFPA 3HUJE 1KFAH 5ICZB 4ELKA 3DHJA 4MQ7A 5GRXG 3STBA 1LMIA 4LQFH 4HCRA 3TNMB 1CK0L 1IAOA 2X6AA 4Z76A 2Y22A 1H15A 1NGPH 2IANA 4LLYB 4W6WB 4APQD 3P02A 4YHYB 2MOVA 3K0YA 3HFFA 1MJJB 4YMPA 2FEJA 5BV7C 3JXAA 4IU3B 3ZZQA 2VXVL 4OLWH 4NC1C 2CMRH 4FJ6A 2CDFB 3X1GA 4KROD 3K46A 1RUAL 5AYQA 4F2ME 4BKLB 1SJXA 4Z0XB 2HRPH 2WLNA 2YXVA 4N90E 1IGJB 4JFED 3B8SA 4G9FE 4CBZA 2VAAB 2VTFA 3MRGA 1LHZA 4CC4C 2ICES 2IMMA 1RUKH 5DVKA 1E8YA 3W37A 5CP3H 3TA3D 3L3JA 3IMBA 3TH4T 3A24A 4KU1A 5I15L 3MJ9L 2EDRA 3NK4A 4OQTL 1JFHA 1ZHBA 3H3BC 4I4WB 1IBHA 4IJTA 1QBML 3CUPA 3HKZA 3INUL 3N0AA 2FJFB 2IGLA 1RFDH 3QEGH 4K94C 4FQXB 1FYTB 2DB8A 3EW3B 2LGNA 1FGNL 2NY1C 2VLLA 3JTTB 1HU8A 4NRZA 2D7NA 2X9WA 3E9UA 5DJDA 5M95B 4JZOB 3WELA 5T1JA 2HTKC 3ZR5A 3IETA 4LAQH 3N44F 4BFBD 4IRZH 5C07E 2AAVA 4ZS7L 1S78D 1FDLL 1QWHA 5ERWA 1F6AA 1MCOL 5JZ7C 4WEBH 4KGLA 4JPVL 5CLZA 2QGEA 3Q2LA 3CFUA 4P2AA 4ADJA 1YEDA 1NLDH 4YXHL 5IW6A 4XNYH 1QRKA 4KX8A 1KZQA 1YECH 3MV7E 3EF7A 3A5VA 4GUCA 4NCC2 2CJTA 2FB4L 3BJ91 4PW4A 5JW3L 5KJRL 2XXGA 5G4MA 3VWKA 5I74B 1JNNL 1F4YH 2YEVB 3BH4A 4BV1A 4GG8B 1II4E 4IRJD 3LHPH 2BC4A 2GHZA 2QQLH 4X99A 4GXVH 2C5DC 2Y6SD 5DTFB 2BHYA 1ZGLA 5EOCJ 4X7DC 5H94A 4CSSA 4UOW1 5CJ5A 1IILE 4QRTB 1X5KA 1AY1L 4FTVD 4QRPB 4NAJA 2FTAA 2PWFA 5FCUH 2FLRT 3SD5A 3FAWA 2QDWA 1ZLWH 4XB8A 2DQMA 3R0MA 3TA4D 5ALCL 2P80A 5J12B 4AVKA 3HPJB 1FZKA 4NO2A 3Q6GH 4PJ8D 3ZDWA 4NZDA 4RWYH 2BDNH 9PCYA 1H3UA 4AEIL 5T3ZE 2A38A 3SKJL 4BFRA 3T0DA 4H5SB 2FT6A 4JBSA 4Y4HB 3OZ9L 3T1WA 2WBJD 2Q8AL 3EFOB 1IM3B 1JNHB 5E2UH 4JO4H 1CZ8L 3B37A 3GM8A 1B4JL 3CFCH 4YQXH 5A2KH 5AL8A 2WN3A 4OFDA 1X5ZA 1DBJH 5FYKL 4KY1L 3U0TA 2DMBA 2YRZA 4L8DA 4MAUL 1MCLA 4WV1B 3LNGA 3HA0A 1MUJB 3HZ3A 3FB5B 1ZLVK 3U9WA 3OVUB 2WYTA 2OSWA 4MDIA 1KLGA 2WLHA 1EMTH 5I0VA 3SKMB 1FL5A 1UACL 4K3HA 5ABAA 4PLOB 3H9SA 3NIDE 5IVXB 1U8KB 4NZFA 4Z7UB 3OLGA 3MRIA 1AGBA 3B83A 3TPKA 4X5LA 2RHEA 1P53A 4WI3A 4D8PA 2GPZA 1HVXA 1I9JH 4ABWA 4Z0BL 1AO7A 2E75C 4Z95L 5C97A 5IHWA 3VGDA 4U33A 2Z92A 1WAEA 3BEVB 2NZIA 5AVSB 3TLRA 3QIBC 5I6XB 4TUKH 1UADC 4L3EB 4MD5A 5CFHA 5TPWL 3DOSA 3EJZD 3P4NA 3D7PA 1HL4A 1JZ7A 1CT8B 4N0YH 2OJZH 5EUOE 3UH8A 2P47B 3LEVH 4C57C 3QNFA 4G8EA 4TNWK 2ZJSH 3FQ2A 3OR7B 2EDBA 1R3IL 5CJ8A 3V7MA 3BX7C 4ZQKA 2IWKA 1AKJD 4H8VA 3V7AE 2VITB 2VR4A 4OF3A 3BIKB 3HE7B 3QQ3B 4N0UB 2EE6A 3V0VB 1Z3GH 4MD4B 5I2IB 4GB9A 1OK0A 2ADGA 4Y5VC 5IUCA 2HFEA 3LKQB 4PYHA 4MJ6A 1FRGL 4IOIA 1G9HA 4NP4L 1I9RH 5I8CB 1XMEB 3KGSA 1EAOA 1RU9H 1IC5L 4JY5L 3UJJL 4OZIF 5EBLA 1AZVA 1JS4A 1ASQA 2IIJA 3LKOB 4OJFH 4CC4A 2EKJA 4DN4H 1ETA1 5GGQL 3NCEB 5I5RA 5D7LB 4JFXA 4X7TB 4DEWA 3EJCA 5EBWB 5I1KL 3ZL2A 3L3GA 4LPYA 1BD2E 4GBXB 4NRXB 4HX1B 4XP9L 5EF0A 5FF6A 4O51A 3L3HA 4RAUB 2IJ0C 2YJQA 1YPZF 3NIGE 3VW3L 4ZW6A 1CR9L 4W9CC 3DTUB 3EDKA 4TVSa 4U3SB 1I8UA 1N18A 3MRLB 4L4TB 1SVCP 5E2TL 2CALA 4JHBA 5E5MB 1P7QB 4L8SA 5E6IB 3MLSL 4E5XA 3CJJA 4KMTL 2RCSH 1QSVA 2F74A 5I24A 1J9RA 2LW3A 4XZUA 1JHTA 1UKSA 2GJJA 2PYEB 5AAPA 3HG4A 5HVHB 3SYQA 3T77B 1EXUB 2COQA 2ZAHA 3QR1A 5IGXH 3CZFA 4P2RD 5C0AA 3AG1B 1WTLA 4UZSA 3U6RB 2C7UB 2EH7H 4X6FB 3MJWA 2F5BH 2DQCL 3WAJA 4R7NB 4CKQA 3TOPA 3TGXA 5DMIL 3RG1C 4FG6C 2J5WA 2YXFA 2ZPKH 5CCKH 3HAEB 1P84K 3PCYA 1MI5E 4X9HA 1JXDA 4QWWC 5D7JC 2CO2A 3F62A 5EZOL 5FDYA 4NO3B 4XI5D 1BQ5A 4ODVL 1PYWA 2PYFB 2Y9RT 3ARBD 2C7FA 2B0SH 3GMPB 1ORQB 3H7BB 4G70B 4ZQTA 3LOWA 1FO0A 2K4WA 3WS3A 1KXQE 1SN0A 2A83A 3OKEB 5JDJA 2JXMB 3AVEA 3WNNA 2VDKH 4XP4H 5ID0B 2IALB 1JZ5A 1NGYB 4K4KA 1M7IB 3PREA 1D5XB 3AT8A 4XT1C 3VRJA 5C0IA 1M4KA 4OCWH 4M1DH 4KVCH 4MX7B 4D0DB 3PFUA 5B8CB 2C9RA 1UWGL 2A6IB 2OMYB 1E3XA 2RB8A 4KJQC 3SQOH 4A7GA 1U8HB 3CQQA 2VZ3A 3LKRB 3QA3B 4WJ5A 4J27A 3DJSA 4HIIB 2ZYIA 4PRID 4TM9A 5K39B 2F68X 3E3QC 2YPLD 1OSZB 4I1NB 4K2UL 4XO9A 4NKIL 2Z65C 1F56A 4NQDA 1V05A 3P0YL 4F20A 5EIIA 1CK0H 4B5ZA 1QI3A 2NY3B 5DC0A 1IKOP 4JFEE 1UM5L 2CQVA 5HYSG 4U1GB 3CN2A 3L3OC 1ZLUH 1IVTA 1IM9D 5B39B 2VXVH 1A3RL 2PP9A 2R4RL 4PJ7F 4B7IA 3I2CL 4PJAB 4QOKB 4CRPA 1Z5LB 3NRQA 5DVLA 2F1BA 2XN2A 2VGLM 3D18A 1LLAA 4G43A 2DIEA 1WAAA 4A66A 4WHCA 5H8DA 5HGDB 4N0FA 3L13A 1B4LA 1XV8A 3AT0A 2RJMA 5L4JA 4HJEA 3PWJA 3CH1B 2ZG3A 2OMBA 4D94A 2ITCB 2LAAA 2N0MA 2XA3A 4NFCA 5CEXB 3L16A 3WBDA 5I15H 3MJ9H 3EHBC 1TMQA 4H40A 5CGBA 2MSPA 3WNIA 4OQTH 4TL4A 3TJHD 1HH9A 2E6PA 4WTQA 1QBMH 3INUH 3G3LA 3DSFL 5B7MA 2PXYB 1A7OH 3QIBA 1FGNH 1AQDB 5B3NA 2OTUB 3HLAB 3MBED 3ORJA 3BQUD 5F9JB 3U36A 1MWAA 2CR0A 4ZS7H 5FKPB 1TCRB 3T4AA 1FDLH 1TTCA 2GIYA 1MCOH 4X5XB 3B9KC 5D93C 4JPVH 1AKPA 3N0PB 1YUHA 5DU7A 5T3XL 1QFWL 2UZYA 3DOHA 4J2QA 1VRSA 2WXIA 4YXHH 2DEYX 3PY9A 4MASA 4F7TA 5FM5M 3EO0B 5FW6A 2OZNA 3WO3B 3EFFB 1UYWL 2QT6A 3CFQA 3CN3A 1ZTXL 4FP8L 4PJHA 1ZIAA 4OLZL 1MY7A 2X4RA 4K9JA 4N2OA 2DJMA 2AVFA 2EEXA 3WEXB 4QHNB 2FB4H 4OBRA 1YN6B 4AUYA 5KJRH 5E4EB 3CFMA 4R7VA 5E9NA 1MLCB 1JNNH 2VLKA 4FTVE 5G4NA 3ZQ9A 2HUHA 1QBAA 4FXKC 1TQTA 6FABL 2W0PA 5KYYB 4P23D 2J8UF 3EOAB 4GSQA 3BUBA 1B9ZA 4FYRA 2VDRB 1OZTG 4XAKD 1AY1H 1FN4A 3KEDA 5FXCH 3VH8G 2H0EA 4WW2B 2LR4A 3RIAK 5C86A 4R7LA 2WO3B 4PJHF 4RGNB 1C7SA 3L08A 5ALCH 3THML 3L3IA 2WPGA 3K6IA 4AEIH 3DX7A 3SKJH 4FNSA 2OP4L 4OCXL 1GGCL 2QKIB 4LSRL 1EUUA 3OZ9H 3PABB 4AK2A 1HEHC 2Q8AH 4E41A 5IEKB 3NJXA 4MA1B 2ICWA 4GP5B 3P2DA 1BVNT 5CBEA 4AQZA 2FBOJ 3RWCA 1CZ8H 1B4JH 3FSVA 3LEYL 1NSNL 2W9DL 1ZS2A 2GTZB 5FYKH 4YJZL 4KY1H 3RPBA 2YRBA 4PJFB 5JHDB 4HC1A 2F7PA 4J3OH 5GRVK 1C08B 2OXGB 2W1NA 4FNPA 3RWEA 3W1ZA 4AUJA 5MP6L 1QSFA 3AJ7A 3EYSL 1LP9B 4Q4IA 2R9HD 2Y5TA 3VWJD 3PUCA 1E28B 5HPMA 1X4YA 2X09A 5KJ4A 4XP1L 1UACH 1FG2A 2OXHB 3S8GB 3VXNA 3RIAF 5IVZA 2IOMA 4KUZL 3BVNA 3M86A 4C83B 3LAFA 4JY6A 4CGUB 5IFHL 4BDVA 3NFPA 4YHYC 2VQUA 4ADIA 2BP5M 2AHIA 1S5IL 2OMVA 4XMXA 5DURD 5DZVA 1KB5A 1KLFB 4Z0BH 5LN4A 3D85B 3RZWA 2AERT 3DURB 4Z95H 1WJ3A 1CDGA 3RRQA 2VUKA 3QW9A 4XO3A 5GJTL 2UZXA 3CDGB 2FZ3B 5F9WB 3UEZA 2MEJB 3QULB 1U93B 2OMWB 3ASOB 4R9HA 4NM8L 1RZFL 4KO7A 5TPWH 1JFQL 1KIQA 1V8HA 4E0RB 1RHHA 4HIXH 5HDBB 1BXVA 2WQRA 3VXPA 1HQRA 1EERB 3DTDA 3LPWA 2E4TA 1MHPL 1BW8A 1XDTT 4FI6A 4C4BA 4ZMQA 1AZZC 1R3IH 1YMHB 1L9PA 3MLZH 2GG1A 1WA2X 3LPOA 1E7UA 3O3BB 1INEL 2V4LA 4XX1G 2LFEA 1SJEB 3H1ZA 4H1LB 2GAZB 2JJUA 3CC1A 2Z35A 3ULVC 2XV2A 3L6FA 3WTVA 1G7LB 1ZPLA 4GAGH 3P54A 1EHAA 5HJ3B 5ANME 4APXA 4CW1A 2FO8A 2E9IA 5KSVB 3NZHL 5LDSA 4TSAL 1SQMA 3KE0A 4G7VL 2IVFC 1TZHB 1FRGH 4FQXC 3BMVA 4NP4H 2GFBB 2ZQKA 5FYJL 1HIMH 5L2KB 1NDGB 3MRJA 3RVTC 4KK6D 1DN0B 2DWDB 1BZOA 1DDHB 4JY5H 4S0SD 3UJJH 4UOZA 5C0JB 3FQRA 2OYMA 4K7PL 3VD4A 3RWDA 2BVPA 3KYMA 2GBUA 3O41B 5I1KH 3MYJB 1XH3B 3HG1B 4HS8L 4CSPA 1OY3B 1ILUA 3GT6A 3GXIA 4L2YA 4PGDB 4XP9H 3CWGA 3IJHB 2IOOA 1TITA 3O3EA 3VW3H 2HCZX 2BOBB 2NNAA 4MMYB 4L0YA 3MBXL 3OKYA 4P2RE 2XFXA 3MCKA 1RHFA 3SGJA 5FGRA 5HI4C 1CLZL 1NIEA 1OW0C 4OCRL 3KWUA 3MLSH 2Q76A 1K4DA 3ARGA 2ZXAA 3K71B 2Y4SA 4HJGA 2FVNA 2NTFB 5I74C 4HS3B 3GMOA 1UH4A 3LVTA 5D7SL 3WTXA 1SDYA 5A2IH 2PTUA 4PSPA 5T8IA 3MFGB 3MRHB 5DA0B 3DJ9A 2ZCZA 2AJZB 5GISL 1G7JB 1C1EL 2WBXA 3DVNA 4YGVB 1T66C 3CU7A 4GIAA 2N0KA 2DQCH 2XIBA 4XB7A 5DMIH 3AQZA 3OQRA 3TF4A 4CC0A 4S11A 3AUWB 5HD8C 4Y16A 5J12C 3D0LB 2VQ1B 5EZOH 5FHAL 3SDXF 2WXHA 3OV6A 3QWRA 1DJZA 1QRND 2FL5A 1SGKA 1P7BA 1NFDF 5B38B 4AV0A 3ARUA 1XZWA 1B0RA 2F7RA 3LN5B 3RTLA 1TVHB 4Y4HC 2FHCA 2YRLA 4EXPX 2UVEA 4OLYL 1T0OA 1WD9A 1SYVA 4DTGL 1OQXA 3O9WB 1OE1A 1T0MB 3GSRB 4XO4A 4ZW7A 4PRIE 4KJWC 4PP1D 3OSVA 5CGMA 2YPLE 1GS8A 3UAJC 1CFQA 2XV0A 8FABB 2XYBA 4DKTA 3KLLA 5DUML 1P9MA 4PLKC 2YWYA 1HX0A 3T3PB 4PAZA 4X4ME 1SDDB 4X0NA 12E8H 4HG4K 2R83A 4JFFB 2NW3A 1T1XB 5BRZB 1KDJA 4PJ6A 4K2UH 1X7QB 4NKIH 4UB0L 4Q4EA 4X6EB 4JKLA 3L5WA 1ZE3H 4JFHD 4AQAA 4JDVB 1UM5H 2W5PA 4KMQA 5EU4A 5IMKB 4HUXB 1FFNA 5GS0D 3HS0A 1J8HA 1MN4A 1FYHB 3HC2A 1WEJL 2IPKB 2WZ6A 1A3RH 3GSUA 1E30A 4DW2L 1OAYL 2R4RH 4XTRD 5KSBB 5AEAA 3TN0D 2GQHA 1OGTA 1K8IB 5I6XC 3PJLA 1EEZB 1OPGL 2Y2YA 4RVBA 1U41A 5L8JB 2FO4B 3OG4B 1EBAA 5AWNL 2FHBA 3GMQB 1I1CA 4RQQA 1DCLA 1S3RA 2AV7A 2IDUA 3QJTB 3ETTA 2MNUA 1S7TA 4L8BB 3TNMA 2VDPB 3HE7C 2EDNA 4OVVA 5I0ZA 1Z9SA 2HG5A 4PBWD 5ACZA 1I8MB 2ZUVA 2Q5BA 3V6ZB 2PPDA 4A7VA 3EOBA 2V8LA 3K74B 3MOAH 3P0GB 5E9AA 3VMOA 2F53D 3AC0A 3B9EA 2P45B 1L9TA 3VI3E 3QYNA 2CDFA 2YQBA 2PPFA 3PP3K 3G04B 1M2VB 2EINB 1RULL 5DEZA 3DSFH 4AMKH 2BERA 2APTA 4X5QA 4ZTPL 4MWFA 2F7QA 2WIIB 3PPEA 4AENB 1ETJA 5FFGA 1GKEA 4U0QB 2QELA 3L17A 2MRYA 3A4DA 4EF3A 2JV6A 2N7AA 4XNXL 5DUPL 3MBWA 3UTQA 4TQPA 1ZLVH 5E1QA 4AMWA 2I25N 3BWZA 5T3XH 1QFWH 1GL4B 1O5PA 1YY9D 1E7VA 4GBXC 1NFDE 4B53A 3DX4A 5CJOL 5CF3A 5FO7A 1KB5L 2CRMA 1IU1A 3DETC 3SOBL 3QQDB 1RSFA 1T4KA 1PD0A 2XWEA 4R5VA 2ARJB 5I1DB 1R3HB 1ZTXH 2EABA 4FP8H 1P6FA 4OLZH 3B7UX 5E6IC 4IMLA 1V3KA 3UAAA 2FYVA 3JTTA 3Q44A 2AZUA 5HVHC 3V8CA 4JZOA 4MJHA 5I1AB 1U8PB 3BVDB 4JG1L 4XAKE 4DKEL 4KNQA 4GG6A 2DDQL 4LBEB 2H32A 1R3JA 1VCAA 2HMIC 3KYKL 1NPUA 2CBTA 4HGMA 6FABH 4ALAH 1UZ8A 3QS3A 1WZLA 4J7RA 3SE8L 1JWMA 2YKKA 3QZWG 4ORZC 2GI0A 1QFHA 1DJSA 3D39D 3MLYL 4PJIF 3QXAB 3KBHE 2G5BB 4CILA 4HKXB 2B1OA 2VRAA 3BLBA 3THMH 4AQ1B 3NCXA 5FM4A 1IL1B 4HJ0D 4CU7A 1AGEA 2OP4H 4RZKA 1CFVL 1GGCH 4LSRH 2J2ZB 4BELD 4ETQA 5ICYB 5IK3B 1XF5A 4OZ4B 3BP7B 4QHMB 2WLKA 3RILA 1KPUA 1J0HA 3WD5L 3LEYH 1NSNH 2W9DH 4Y2DB 1JZ6A 1KNOB 1ZK5A 2D8KA 5I1CL 5B8CC 1HHIA 4XN8A 4QRPA 5FFLA 4HCGA 2WVUA 4BZ1A 2AITA 1ESOA 5D5MB 5MP6H 3V10A 1HHKB 1P1VA 3EYSH 5HSFA 3QXUA 3GBNL 2QPSA 1P2CA 4FABL 5E9DA 3HPJA 3DROB 3JSSA 4XP1H 5JQ6L 3HEIB 3CVHB 3VQMA 1SOKA 1DLHB 5DJYA 4OFPA 3FFCA 4FA7B 4LL4A 1FFPB 3FB8A 1PZUB 1BBDL 4NZUL 1ZGLP 5CCHE 3MNZA 3N1QC 4JZJA 2NY3C 1JNHA 1GPOL 5IFHH 1DVFD 5AL0A 3X1FA 4KZEH 4U1GC 1S5IH 3FT9A 2GYSA 4ENZA 2QFRA 1A6TB 4UQ3B 3TFKC 3TZVB 1XR8B 3GS4A 1CXIA 1QZ1A 1JMXA 3MV01 1PZBA 5GJTH 5AUMB 4HP5A 4WV1A 1NBQA 5DD6A 2OMUB 5JQIB 3QB7C 4NM8H 1RZFH 1JFQH 3NJMA 1GCYA 2R59A 5CILL 2Y5QA 4Q6IB 3SKMA 3O6FC 4CMMA 1MHPH 4AGNA 1AGFB 1M56B 4I3GA 4WU5B 3AREA 3B2MA 1N68A 3SGKA 4OZGF 2P1YA 3VACA 3SHSA 1INEH 4QJ5B 3MXVL 4UOW0 1OGAB 3C5SB 4HIHA 3SJVB 2FX8L 3NJNA 2HVKB 3RNQA 5KN5A 3NPZB 3UTPD 1TNNA 3N91A 2HJFA 2AJVL 1YEFH 3HI1B 4X6CF 4TSAH 4G7VH 4UBDD 1TEFA 2PXYC 4J4PC 1WBZB 1JPFA 2ARWA 1T1ZB 2OULB 5FYJH 3QZNA 4F8LA 5IB1B 5A40E 4EI5A 3EBAA 4GMSL 2ODHA 4OFVA 4FQCL 3OAZK 1S7RB 2UXTA 4D0CA 5JHLL 2YAPA 3QJUB 2LHAA 3HVNA 4G83A 1QLFB 2ADJB 4HIJA 2XG4A 4K7PH 2XWXA 4RH4A 4XCFL 3FUFA 3OR7A 4P9HL 1SMDA 1F11B 1NBZB 1LM8V 2WC7A 2VITA 4NO0D 4X4XA 4HS8H 3IGFA 1EV2E 4GKZA 2XBZA 5AD0B 4UIMA 2IH1A 5FDWB 3KNBA 1IT9L 2XPGB 4RZCB 3R18A 3MBXH 3WJJC 4G6AC 5FO8B 4W93A 2B20A 5CEZD 3VXUB 2YD1A 1TTUA 4N0CD 3T65B 4E2OA 1CLZH 1AQKL 2V17L 3FQYA 3CX5K 3LXBA 4W1TA 4OCRH 4LZKA 1E8XA 5ILTL 2R8SL 5I6KA 3KXFD 5E4EC 4CN1A 1XEUA 5D7SH 2N3JA 2YD5A 4OM1L 1JN6B 3OX8A 4QTIL 3RVXD 4UQAA 5BO1L 3LKOA 3ARQA 5DYFA 4OFYA 1A2YB 2DLEA 1AFVL 4HKJB 5GISH 1QRNE 2MFNA 4JMNA 1S9WB 2DQ6A 5EBWA 5EDXA 2PCXA 1KIUB 4FJZA 4GNKB 4I3RL 3V5HB 1OAJA 4PRAB 1D5BB 4QYOA 4WW2C 3E38A 5BVPL 3UMTA 4XMWA 4NAQA 3L4XA 2UY6B 4RGNC 4JPIB 3QUXD 4UDUB 4XC3L 3RA7L 3GJFB 5DC4B 5TH2A 4IIQA 1L4IA 3ZKQD 4CC1A 2DI7A 1FH5L 4TUJA 1J5IA 2BM3A 3WSQL 5D6DC 2QKIC 3EF4A 3ZTDC 5CD3A 4OLYH 5FK9B 4MA1C 2VLRB 2VL4A 5JYLA 2PW1B 1A22B 4DTGH 1Y1DA 1ROWA 2H0PA 2VKWA 2YBRB 1WO2A 5J8OA 1LK2B 5H2BB 5CD5D 3UPRB 4UQDA 2DI9A 4LRIC 3VH8A 5EO0A 1HHHA 1JTPA 3QWNA 1U8NB 4HUUB 1MVUB 1P84J 5IQOA 1TSRA 2ADIA 2QV2A 1HS6A 4CDGC 3HAEA 1BYNA 4JFHE 3GMRA 3QFJD 4P2OB 1Z9NA 4YZFE 2HH0L 1GZQA 4LEXL 3NA9H 3FH7A 1L0YA 3H7BA 4YBLB 4OT1L 4PMEA 3T0EA 4UB0H 5E7FA 1SF5A 2DIAA 1TJXA 1TNMA 4MAYC 1DFXA 3GIVA 1U8JB 3LIZL 3OKEA 4N8VG 4XP6L 3KL5A 3QWQB 5F0JB 1QD0A 4E42B 3T5WA 5DD5L 4ANXA 1NGYA 4HJ1A 4X6DE 2J8HA 4WGVB 1WEJH 2Y2WA 1D5XA 2VRQA 4M3JA 1WVZA 4DW2H 3UZEC 5F9WC 1AXTH 2ZP9A 4LL1A 4AIEA 2A6IA 4GKLA 1OPGH 1N8ZA 2YMTA 4N2FA 4NQTA 5JTWA 1U8HA 2G60H 2F1AA 1BWMA 1YEGH 1GW6A 2C3HA 3CGTA 3JQOB 1FGVL 3KPOB 3QUMB 2CO1A 4HIIA 5AWNH 1F02I 1UA3A 3HBQA 3AXIA 3B9DA 2BP8A 2F53E 3WGVB 5KYUA 3UTTB 5GZOC 4AT6A 4DFHA 3VX1A 5A3IC 4R2GD 2EXSA 3VA2C 2CDGA 3VXQB 2NUTB 4N22A 5BXFA 1S9YB 2FUQA 3WLWC 2BMKB 2UWEF 1GSMA 1KJ3L 3QVAA 5FGSA 4JFPB 2YD7A 5FECB 4H7VA 1RULH 5INCA 3OWEA 3KPNB 5LAPA 5IB2A 2B15A 4BZ1L 4J39A 1HL5A 1MCRA 2QHRL 3OXRB 3EXLA 3O6LL 4OUUB 1VHPA 4BH8B 1BAWA 2RALA 3TP4A 2IO5A 1QW9A 1MDAA 4WK2B 4XNXH 1B4TA 3QQ9D 5BVJB 3Q5OA 2EICA 3TC9A 3SN6N 2EEDA 4PJBF 4HU2A 4DETA 4D0BA 2M26A 1JGVL 1W0VA 5CO1A 5AOIA 2OMTB 4GRLB 4BUGA 1KB5H 2VR5A 3SOBH 1TLKA 1NBYA 4MSWB 1MCHA 2AFNA 4PP2A 4NUGL 4U6VH 2GHWB 5E8PB 4Z7QE 2GUOB 1QHOA 2X7LB 2GEEA 4PWIA 4TLTA 5DZNA 2JJTA 3MREB 4NZRL 4UDTA 2PXYA 4DKDC 1AG0A 1KJMA 3HLAA 1PTZA 3WFHB 1YEIL 2ZNWA 2HX8A 3P3RA 3NCJL 3QNZB 3D39E 4JG1H 2MCG1 2C4FT 4DKEH 2DDQH 3BGMB 3KBFA 3KYKH 3PGDB 5H37G 4PHXA 2GABA 1QLEL 3QAQA 5E1HB 3WFDL 2Z0BA 1G1OA 1S7VA 2BVEA 4UOQA 5FGCB 2F19L 3HBPA 4JO3L 4KKLC 2IAMA 1B90A 3SE8H 1HXKA 4PGBB 4UT9A 3EO0A 3MLYH 3EFFA 3O0RL 3ZUCA 3RVWD 2WSPA 5AKRA 1OTTC 2CLRB 2GT9B 3RDTB 2D31A 1BVOA 1IKFL 2XWJB 1DE4B 1ZMYA 4PRHB 5DMKB 5FUZL 4X8GA 1IQDB 2DAVA 1M53A 2Z6FA 1JWSA 3GI8H 4CUCA 2VR3A 4N9OB 2ZIDA 1DEEB 1CFVH 1YZZA 4YHIB 1IE5A 3QPQD 2D9QB 2GK0B 1G9ML 4KXDA 5KS9E 2L8AA 2I07B 4X7CC 2KKQA 3CXFA 3O9WC 5IB5B 4EO5A 1KY6A 3WD5H 5F1KC 1N0LA 2C8NA 5A2JH 4NHCL 2YWZA 3EOAA 3K72A 5I1CH 2DWSA 3FTZA 7PAZA 2OI9B 5IFJA 1OCOB 4I88A 4JHWL 4N6RB 3ZHDA 4WEEA 3P0VL 2XTJD 1FJ1B 3ZUNC 3GBNH 4FABH 2ALWA 3D3VB 4IBSA 4P5TB 3O3AB 1LO0L 3SDYL 4YDVA 2UWEE 1BBDH 4NZUH 3BVVA 4N26A 5IEKA 3DSNB 4FLRA 3WFCH 1GPOH 1UA7A 1WFNA 4FFWD 3HZVB 3TCXA 1VENA 3QCUL 5F3HB 3B1UA 2B59B 2QVIA 2NNCA 1NBCA 2IQAB 1AC0A 4PJFA 1BFTA 4B60A 4AQEB 1NC4D 1S9XB 2DF3A 4LCWD 2FWSA 3OMAB 2OXGA 3QIUD 1KPRA 4OFIA 4G80B 2CLVA 4Y1AA 4PJBE 4ELME 1A1NB 4S10A 5CILH 5E4IA 1RD6A 3IN2A 1T22A 5TD4A 2KQMA 4Y9BA 3UTPE 3VU2A 4I48B 5DMJB 3QUYD 4AVHA 2Y6TE 2C1OB 4XN7A 4AUUA 3IDIA 4L1SA 5EEXA 4IDJL 4ES8A 3VXSB 1WG3A 2WTRB 1BDYA 5A7EA 3MXVH 1SM3L 4WQOA 2FX8H 5J1TC 1DP0A 3TBCA 4NYLA 4MQXD 3DURA 1YMMD 4OIBA 5EBGA 2XETA 4LARL 3UZEA 5IJDC 4FHKA 3RFZB 2UYLA 2BPBA 1U93A 2JSFA 1RUML 3KPTA 2DRUA 1HNFA 4YUEL 1JWUA 5C07B 4GMSH 5JR1L 1P6WA 5D72L 4E0RA 4FQCH 5H4ZA 4P4KB 3UMNA 5JHLH 4A2DA 2IAAC 2WAHA 1W91A 1ZIBA 1BLNB 2X41A 1B3JA 1I7ZB 3GZOA 3QJSB 4HFWA 3M45A 4XCFH 3MFFB 4P9HH 5CEZE 5E2VL 2D73A 5HVGB 2ED8A 1WD8A 5BZZA 5PCYA 1G7PA 4YSEA 1B4RA 2R7EB 1MCWW 2GAZA 2LU5A 3KW8A 3KXFE 3FUKA 5J6GA 2C4XA 2DMHA 4X7SH 4C4KT 1KIPB 2APSA 2VDOB 2JE8A 1BMWA 4UM9A 2GJRA 1NCTA 2OR9L 4NOFA 4POZC 1AQKH 2V17H 5IMLA 2R8SH 2P5EB 5ILTH 3GXDA 4QXTB 2ERJB 2ZYSA 2UZPA 2P80D 4K07A 5A2CA 5GSVB 4RLDA 4PI0A 1PZ5A 3KPLB 4QTIH 4WKZB 5EU6B 3SPGA 1F1DA 1W0WA 4BCZA 4YS4A 3UOAB 1Y0LB 3QJHA 25C8L 2X89D 4QLRA 1TTRA 4XBPB 2MCMA 3MRDB 4MS6A 2Y1VA 3WNOA 5EEWA 2FH8A 4PGDA 2VN4A 4I3RH 3ARYA 2HJLB 2GJ6D 3QJOA 5BVPH 3E2HB 2QGBA 1TF4A 1U8QB 2D2CC 3NSYA 5BOZG 1G7MA 4MMYA 4XOCA 3RA7H 3OHXB 4OFQA 1LEKB 3P9LA 4AQ1C 3FOLB 1T80A 2Z93B 1R0AL 2I85A 4UTBL 4L0ZA 4V11A 4HIPA 3WSQH 5DHVB 4Z7WB 4IYKA 2JTDA 3NDZE 1NCBL 2AI0L 2AKRA 4I2XA 3PP3H 1QFOA 3QFJE 1U8IA 4JAMA 3UG3A 2AJZA 1ZVSA 4Y2DC 4YGVA 3SCMB 4YSOA 1TVDA 5JW5A 3QZWA 3JWOC 1KUMA 4O02L 3BWUF 4LHQB 2M2DA 2FX9H 1AO7D 4JN2B 2Y72A 2APVA 2FWUA 3U9UA 4HV8B 4F37K 1UGNA 3ML9A 5CIPA 3WTWA 1BFVL 5D1ZB 3FQUB 4M7LL 4RBPK 3NRPA 5D4HA 1NJ9A 2HH0H 2X4UB 4LEXH 3LN5A 1DVXA 1TVHA 3NCMA 4Y7OC 4ZNEE 1DVUA 1UASA 4OT1H 4XNMA 3IRPX 4YLBA 4OI9A 4ODTH 3GSNL 4LNRB 4FA6A 5E0QA 2BIPA 4J1UB 4O2EB 3LIZH 3R8QA 2H32H 4XP6H 3NCBB 1MFDL 3K5SA 3O9WA 2XQYG 3TZVC 4PTUB 1OKEA 5DD5H 3U46A 3UJIL 3UAEA 3BZ4B 5DCCA 1J0KA 2AJXL 3PV7A 4KQ0A 2J5LB 4AGOA 4Y9FA 4JQXA 2X44D 1OF0A 1RJZA 4UT9L 5EUOB 4D9LL 4LPUA 1L9OA 3RX8A 4CU8A 4HG4J 4JRWA 3VVWA 3A6OA 4Q6IC 3UYRL 2RD0A 1A4JB 3L54A 1QASA 3HTLX 1Z0NA 2P7TB 4HVBA 2ITDB 5BCAA 2YUXA 2RIKA 4OLEA 2BHFA 3WV0A 3ME0A 3ALXA 3QJRB 2ATKB 5F0PB 3O45B 1AH1A 3RIFK 3MRFA 5IMKA 1FPTL 4HUXA 4OJYA 2IBZX 2IPKA 4UCFA 1X9LA 4DVBB 1S5HB 3BD4A 5L7XL 4DGYL 1KJ3H 2VMJA 2J6EL 3V0JA 5JOEA 1QFWI 3PS6A 1K8IA 4U4IA 3L5XL 2NX5B 2QHRH 4C56A 3TNNB 3CSTA 3BSZA 4LNVA 3O6LH 2KZBA 3ASWA 2FWLB 3DX2A 3QRFM 4RDQF 2NY1D 4IIZA 3TPUB 2BOCA 4HBQA 4BFFA 2V3EA 2WTPA 4PJAF 1PIFA 3F7QA 2HTKD 4BRJA 2DBLL 4L8BA 2ZXBA 4UU9B 2ZXDA 2X4SA 4QHLB 3DVFA 3PQYA 4LLDB 4NDMB 1JGVH 5JZ7D 4M8UA 2VDNB 3ML8A 4NUGH 2JJSC 5E8NB 1VFUA 3IM1A 4UI2A 4IBYA 1A9VA 1EEYA 3RIFF 3VCLA 3AS3A 2DW5A 4NQED 4NZRH 3PF2A 3FQTA 4LKXA 3LPPA 1PKQB 2VC2B 3ZTCC 2WIIA 3D2UD 1ZANL 2H5UA 2D7QA 1YEIH 3D07A 4FMVA 3T6VA 3NCJH 4Y9GA 2AEPL 1JZHA 2A4EA 1LJMA 1N10A 3ALWA 5SV3A 1QLEH 1CTOA 4WEMB 2A9NL 3JTBA 2DM7A 5TDOB 1T83A 2F19H 4JO3H 4WI9A 1MI5B 5K9QI 5GGRB 1RIUL 4QHKJ 5I6LA 1FFQA 4YIQA 1MG3C 1UWFA 2X87A 3MODL 3Q8AA 4U3HA 3O0RH 3IDMB 1IZJA 1OF2B 1U6AL 1IKFH 2HT4C 5A2FA 1DO6A 5FUZH 1R3LB 4HXAL 1BZ8A 2LLLA 4H8HA 4AIXA 5DR5L 3K2UH 5I30H 4YO0B 5I1AA 3HI5L 1G9MH 1UCBL 3MRRB 3EDFA 1ZDQA 2FLMA 2BIQA 3LXCA 3IBEA 4K23L 2XTJE 4L1HA 3CXDL 4JO2L 2YQGA 4NQDD 2VW4A 3E1F1 1R24B 2BY3A 4NHCH 5KVFE 3OAZH 1OZUA 4GO8A 4IHOA 5JPMB 1DSWA 1Y07A 5AAMA 3Q1SH 3GLDA 3VXMB 4JHWH 1Q9LB 3RQ3A 1AJ7H 1E5UI 4P2OC 3ZE2E 2G5BA 2AQTA 3P0VH 3QH3B 4QAWA 1JV2B 5KTEL 1X5MA 1JZ2A 4YBLC 2X9ZA 1LO0H 3SDYH 5HDLA 3O4OB 3FB7B 2BRQA 4LEOB 2J2ZA 3WCYA 5MEQB 2KLSA 5EU3B 5IK3A 4YPGB 2DKSA 2W81C 3BP7A 2F08A 1BYOA 5E24E 2DQDL 5HHNB 2DM4A 3QCUH 4ZX6A 1K8DB 3U0PB 4MB3A 3KPQA 3V4PB 1E4KC 4Z7NE 1FORL 1M71B 3MLWL 2ZAIA 2OW7A 4JE0A 1OSPL 3LV3A 4X4YA 3DK0A 4JDZB 3R1GH 3VD0A 3HPLA 5F7YC 1WZMA 4N4YB 2PUQT 4RMQA 3QIBD 1N2RB 1YMME 2XDHA 4Y2LA 4IDJH 1FFPA 5FO9B 4N8VA 2YD9A 5MHSD 1CFSB 1JPTH 3L4VA 5GS1B 2XTLA 3U4EB 3P3YA 2B3RA 4LSDA 3ALPA 1D9KA 2SODB 5L4IA 3PXJA 3TEWA 5D4JA 1K3ZA 1A6TA 4FC3E 4UQ3A 3TZVA 4KQ4H 1XR8A 5FB8B 2R1XB 4PRNB 2YEZB 1VGKB 4C4UA 5I1LB 4LARH 4HF5L 2ARJQ 4M61B 4FQQA 1FZMA 1RUMH 1TPXB 2FDBP 2OMUA 4YUEH 2EKSB 3EOYG 4ZW8A 5LBVA 2WV3A 5JR1H 5D72H 4OKDA 2BY2A 1OM9A 3T4YA 3MOBL 3UG5A 4JL1A 2KUTA 4GUPB 2HSIA 3TWCL 5I6OA 4HHAA 1MFVA 1T7VA 1AGFA 4DPRA 5IROC 3NRFA 1CICA 2FBJL 2XX0A 4WLCA 3HJ0A 5E2VH 1EHXA 5C0CD 2NY7L 3FQWB 1OGAA 4JLRB 4GRLC 1P6AB 1QFUL 1EFXA 2VM9A 1KACB 4Y5YA 4IKNA 1JNJA 1JDAA 4NZTL 1BQHG 1I7UA 3ZRFC 4XOBA 4H0HB 3HI1A 1NEZB 3SKNA 4DP1X 3K6SA 2QPFA 2OR9H 3FTXA 1E9OA 4LHJB 3KPSA 4DKFL 3EJYC 3GHBL 3IU4H 2HLAB 5ABDE 5C3LD 3S5LB 4M7LT 4NPJA 1S7RA 1Q94B 2GJ6E 4C59B 2JQMA 4PJ8B 3RIKA 1HHGB 25C8H 3QNXB 1AMYA 5CGYC 4E41D 3W5NA 3KDMB 5AD0A 1N19A 5IESL 3MV8B 3UL4A 5C0DB 3K8KA 5TQ0H 1PDKB 5FEBA 5FDWA 4UILL 2XPGA 2A5UA 4XMVA 3RDTC 4RZCA 3WL9A 2JJSA 3CX5J 1EDHA 1MFAL 1HXYB 2R4SL 5I6PA 1R0AH 4FG6D 3LRKA 5IMOB 4UTBH 3CSYB 5CFAA 1D2PA 4XODA 2R2BB 4QWWD 5D7JD 5GZNA 1VZGA 3MJ7B 1SXBA 4K8RD 1AO7E 4QXVA 5H37A 5MENA 3BSZL 1C16B 1NCBH 2OMZB 3MRBB 4GAAA 1UUSA 4TQEL 4WHDA 4YDNA 2J7LA 1MPAL 4H8WL 1GA2A 2JI1A 4G5ZL 4O00A 1E5BA 2WB7A 1S9WA 4G1EB 4J6RH 4YBQC 5ESAB 1MW3A 4O02H 5D55A 1I7RB 4ODHL 2DH2A 2OI9C 4A6YL 3PJNA 4JDTH 1CJYA 3QEQA 1YAIA 4UDUA 1BFVH 4M7LH 4CBPA 1M6OA 3KLKA 4XWOC 1OAKL 2F0CA 1W15A 4P5TC 3EDDA 4MNGA 1HDMA 2GEQA 5FC9A 1JGUL 4FULA 3GSNH 3II3A 1BAFL 1EH9A 2PW1A 4J23A 4YDJB 2QLYA 3GMMA 1MFDH 4NC1E 3LH2L 1CIDA 3DA0A 4F7PB 1CD1A 3UJIH 3ZTNH 4AGPA 3Q3GA 1AKJB 3IFNL 3AU1B 2WVSA 2J21A 4Z78B 4FQHB 3LZQA 4YHNA 5I75C 1P69B 4E9SA 4Y1TA 4D9LH 3D0VB 3AG4B 1HL8A 3HMXA 3UYRH 2F8IA 2CGZA 2QZQA 4OZHA 1V55B 3PYCA 1J05A 4WENB 4ONGL 1RY7B 3VM7A 1XD1A 4ZI8A 2FO1A 1E0OB 2QL1A 5EULV 1DVZA 4OTXL 4WI8A 4GAYA 1JJUA 5TFSL 1FPTH 3T6WA 3L1OL 1H3WM 4FMFA 4FQLL 4FTDA 3EO1A 1K9TA 2YD8A 3KH4A 1FWXA 4RMTA 2G3XA 4UT6A 2B4CC 2QSCL 1SXSA 3QDMD 4UUJB 2J6EH 4JKKA 4OGYL 4DGYH 1N4XL 3RFZC 1NUDA 3EHBD 3L5XH 2VN6A 4WIQA 3NJKA 3P3UA 3RWHA 5DJAA 1IE4A 1N9PA 4FLQA 4P4KC 5C0AE 4J3TA 3SIKA 4GEJA 4F9LC 4KUCD 3WJMB 1OLLA 1G7IB 4HK3N 3UTTA 5FFOA 1CI3M 5DGQA 1KXTA 4QNPF 2DBLH 3F58L 2WWKT 2CRIA 2NUTA 2EDTA 1CBJA 4TLSA 1UB5B 2YO3A 5G5DA 3B9KD 4HQQL 4DO4A 3G5YB 1ZK9A 4Z77B 3BKJL 4U2YA 3EYUL 2B1AL 1QVOB 3CLEL 3P4OA 1XR9B 2ZKHL 3D2TA 5GPRA 5E8DL 1ACZA 4PJ5A 5IFAL 4RRPM 2ENYA 2ERJC 3L9EA 2H3KA 4PHZA 4U4BA 2EDMA 2G0KA 3QWRD 4FLSA 1UKTA 5I8KL 1JZJA 2P8MB 3O0LA 4N1HB 2AEPH 4RAVA 5I66A 3G5XB 4MDJB 3SBWA 3GKZA 5F44A 5BVJA 2A6JA 1XGPA 2A9NH 5DWPA 4W70A 1RKRA 3TL5A 1VFBB 1CC3A 1RIUH 3E2HC 2IDCA 4GRLA 4PG2A 2O26U 3QSKB 3NVQA 3MODH 1I8IB 3ESVF 2R39A 5KBPA 1ICTA 1U6AH 2X7LA 1DHKA 1L7TL 5DQ9A 1BF5A 4HUWA 4NQDE 5AW4B 1A66A 1IKNC 4HXAH 5K59F 3G08A 3REVA 5DR5H 1AR1B 5HHXL 4L18A 3G6AB 4IW4C 1J1OL 3HI5H 1UCBH 1AGDB 2X70A 3ATFA 4JFTA 4K23H 3LEXB 2ZSWA 4F24A 3SCMC 2H6OA 2R2CA 3CXDH 4JO2H 1WC7A 2JI2A 4LGPB 4FF9A 3MC0A 4L4JA 1J8HD 2ZOTA 1JBJA 3ZE0E 1IM9B 5D1ZC 5E8OB 3KLAA 4N3TA 1NFKA 1N5AA 3WNLA 5DA4A 4UM8B 1KV3A 4PRHA 5F8QC 5KTEH 2OCCB 2WJ5A 2I9LB 5EG6C 3VE0B 5F0LB 3TBYA 5DFVC 5LXVA 4PJEB 2AGJL 4WHTB 4RMUA 4YHIA 2GK0A 2WNXA 4G6MH 5DYOA 1TQUA 2BVTA 2I07A 3HC0A 4TF4A 3HNVH 2DQDH 5IB5A 5JLZB 4NUPA 1JD7A 1M9WA 4MKMA 4HAFA 1NUFA 5F6HJ 2J5LC 4UMSA 1HZHL 3K2KA 4YDLB 3MLWH 5MHSE 3MMEB 1OSPH 4XO8A 3AM8A 2XQYK 1E4XL 1G87A 1VGEL 5IJCC 3IAGC 2P46B 4L4VB 1T5KA 3D3VA 4D7BA 3D8MA 4O2CA 4M56A 2CA3A 3GBDA 4WO0A 4B9FA 5IHUL 3VA6A 3GYRA 3ZSTA 4AVIA 5DEFA 4ZMWA 1OE3A 5I76A 2C9QA 2XQYA 2FJUB 5LBGA 4ZAKB 2WOYA 3VI3B 1Q9WA 3D87B 1QQDA 1YSOA 4PRPA 2JFCA 4MJ2A 4U31A 4KI5C 3QRBA 4CNIA 3BO8B 1RMFL 2A77L 4UNIA 4HF5H 5E8EB 1WZAA 5KVEE 3ULVD 1HKFA 1S9XA 2VLKE 4QRBA 3N1FC 4EUPB 4KZEL 4NO5B 1EVUA 5JO5A 4DP6X 5C0CE 3A4FA 1QSEA 2Q8BL 3NFSH 1HSAB 4WI4A 5A6IA 5HGHA 4FQXD 1FYTD 1S7UB 1KCUL 1ZOXA 4KV5F 2JKIS 3TWCH 2ALAA 3RVTD 3UYOD 2ZUQB 3WKML 1KOAA 2FBJH 2NY6B 3BP6B 1HNYA 3F6IA 3EJQA 4HJUA 4OGAC 2WTRA 2W0FB 1B0GB 3L9YA 4XXDA 4NNYB 4OR1A 4RBPH 3V0EA 3ZHFA 1E3FA 2EQDA 5K59E 1QFUH 2A0LC 1FCGA 2CNYA 4NZTH 1ZT7B 1UD3A 2WY3B 1DFBH 3UYPA 5EC2B 1AZNA 3ECQA 3RFZA 3TONA 4E41E 2NW2B 4ZMLA 4DKFH 3DOIA 1L7IL 4A38A 4U1IB 3O8XA 4F8TA 3GHEL 5HI4D 3IE4A 4Z5RB 3PDGA 4EVNB 4GKNB 1DSFL 3Q9PA 1T6WA 3Q2WA 5ICXB 3D12B 1LDSA 1SEBB 1JF1B 1WFOA 3BJLA 3TESA 3ARFB 3A3YB 1GGUA 3GTTA 1QSFE 2D7TL 5IESH 4MNQA 3ILEA 4JFOB 1J7VR 1GC1L 1E4WL 4U6XB 2EILB 5F7NC 4UILH 1KIPA 3CFJB 3F5WA 1T66D 3Q6FA 3UGXA 1YN7A 4YWGH 1T7ZA 4LOUC 4QRPD 5LGHL 2RACA 3LZFH 5K9OB 1MFAH 2R4SH 2IV8A 3SQBA 3IT8D 5CN1A 2P5EA 1YLBB 3W3BA 1KCBA 4QXTA 3QO0B 5HD8D 1DQVA 1OALA 4KH2A 5E9DD 2VJ0A 3BSZH 3MDJA 2G3NA 4TQEH 3CLWA 1SRDA 1Y0LA 2NMSA 1UM4H 2Z8WC 3FQXA 2XXMB 3RAJL 1IVLA 1MOEA 1MPAH 4H8WH 2W07B 4G5ZH 4OZFB 4MJJA 4XBPA 4Y4HD 3V0HA 3AABA 3NJIA 5JPMC 2CIIB 43C9A 4ODHH 4A6YH 1XIWA 1ET5A 5DURB 1UOWA 4J3SA 1G7HB 4HZLB 2AXGB 3ARDA 1PQZB 3E3QE 3OHXA 3QK0A 2DYPB 4KROC 3UAJD 4JM4L 4LOFA 3X1BA 2ILLA 5A7BA 1BQLL 3FOLA 1OAKH 2GB2A 1C7TA 4OIAA 1YDPA 4Z7WA 5DRNA 2EDLA 3O4OC 4PJGB 3WAKA 4CJ1A 4BCYA 2NYZA 1BAFH 3QFGA 1EO7A 3V6FA 4H25A 3PWPB 1TU2B 3IB4A 1B6DA 3LH2H 3TBTA 5C0EB 1X9RA 2H41A 2KQNA 3P73B 1IGML 4FHBD 4NHUA 3FSWA 4YX2L 3TH3T 4S0TD 2QGDA 2O5NA 3TTSA 5E7BA 1SLVA 3EJSA 3G6JA 1ODAA 4TPRL 4U3CA 2VABB 4HH9B 1AYOA 4EI5D 2VQTA 3OKNB 4ONGH 4X42A 4CN6A 4ZDHB 3QDME 5GGVL 4AH2A 1NKOA 5GS1C 1IAMA 1PPIA 2JKSA 4OTXH 1QR1B 5CMAA 1NWPA 4ADGA 1S78C 2BRRL 4ZFOA 1K72A 1Z32X 5TFSH 4PTUA 4FQLH 3FO2B 1ZV5A 2CUHA 3BZ4A 4ZMYA 3HE7D 1KSRA 3ARZA 2QSCH 3EJTA 3V9FA 4OGYH 2WLMA 2FQEA 1N4XH 3H2PA 4Y9EA 4AE1A 2EVFA 1TPXC 3G6JF 3LB6D 5GGSB 5LGJA 3KH3A 1RCYA 1AP2B 4ZXBB 1ZRUA 1O7SA 1WWAX 4U1KA 1UVQB 2OFQA 2P7TA 1HCVA 3VFPA 1BM7A 2XHNA 4F7EB 1LNUA 3F58H 4GSDL 3QO1B 3ZDZF 1QFWM 3F7LA 1JK9A 2BSRB 2V7NA 4XMKL 4ZYKA 3MUGB 1RZ8A 5D7LD 1QZNA 4MJ5B 3BKJH 3AWFA 3EYUH 1LQSR 3QQ4B 4PJDA 1EUTA 2B1AH 4GBXD 3CLEH 4JKPL 3D0AA 5EBMB 2ZKHH 2D0GA 3QUKB 3MSPA 5E8DH 1DL7L 3VD5A 5IFAH 1KBKA 1F4AA 1AXSA 1P4LB 4NCDA 1QTSA 1X5AA 3T3ME 4R4FL 5DVOA 2PTTB 3GUFA 4L4TD 4JFDA 3CFBA 2EIKB 2BW4A 1P7QD 3OBAA 4PJ8C 3F7VA 4LPWA 5KYXA 1SVZA 3LRSB 2BXZA 4YSCA 3BRGC 4KK8C 3BXNA 4GXUM 3LQMA 4QHLA 5AKSA 1A3QA 2HMID 3BFWA 2QV4A 3FQNA 1GYWA 3VD1A 3MCG1 1REIA 3ZO9A 2FWOB 2XFGB 4PM1A 1TJGH 2J43A 4WUKL 2ZCLL 4GW4B 3EDEA 4LT7A 1L7TH 1KXHA 1RZKL 4JEGB 4XMZA 4BSWB 1G9NL 4D2NA 4WSGA 4DZ8A 4GQQA 5JPNB 4R90L 1CXHA 3U7YL 4ODSL 5K9KA 4PJCB 4QRRA 5JHAA 4Y4FA 5AW0B 2EUVA 3DV4A 1J8HE 1J1OH 1ZSDB 4TVPD 2ENPA 3QG6B 4ONOA 4K94H 5D4IA 3L3KA 1PLAA 3ARRA 4NEHB 3T0ED 2X9YA 5EEVA 2ZUYA 3DV6A 1UKQA 5HHPB 3W81A 4QJ3B 3BEWA 3QJXA 4PEEA 4MXVE 4BFJA 2VL5B 1YEKH 5EO1B 4GLRH 2HWZL 1ZXKA 2Q3AA 4QPEA 2XV3A 5GGTH 2NY4B 3C6LB 3MLTA 3BUQA 3F7PC 2X10A 3IDMA 3U4BH 3ZDYB 1S8DA 1Y6KR 3BHBB 3F7KA 4MCZA 1W80A 2JF1A 3WLBA 1XWVA 1U92B 3SKUD 4I1RA 3DXAB 4GFXA 1JPEA 1X5HA 4ODWB 2MJWA 2AGJH 3U4AA 4HSQA 2WP3T 2F15A 4HEPG 4LBAA 2EACA 2WUCL 1RPKA 3QXTA 3PIQA 1R5WB 2OMXB 3JT2A 4I0CC 1L3WA 3S6CA 2NY3D 1DQJA 2XG5B 3MJGX 4ERSL 1H8LA 5EF3A 4NI3A 4JCLA 4NQQA 1ZA3B 5EF2A 3DX8B 3QH3A 1PNCA 1E4XH 2NR6C 1JV2A 1VGEH 4YFLI 1BVKB 5L2JA 5T1MA 5JIPA 1NANH 1N7ML 4JRXB 5IHUH 3L3DB 2ICCA 1XSJA 3C8DA 3ULVE 5EU3A 4IMKA 2Z1KA 3P30L 5IVXF 3DVGB 3EBIA 2EIMB 4Z7UF 3SE4A 2Z9TA 4MJIB 4F1ZA 4HZAA 2JCWA 3CFKA 1RZJC 1FYTE 3CZLA 4KWUA 1RMFH 1FZJB 2A77H 3KD4A 1C9SA 2CE6A 1E6OL 2X3CA 4NGHH 1OCZB 1MCWM 4JDZA 1EXGA 2Y23A 2Q8BH 3VSQA 2NZ9C 1HTYA 3N6YA 3RL1B 3IPFA 3QPXL 1FFRA 2Y25A 4WO4B 4ZUUA 2PXYD 4LOEA 1KCUH 3H0TA 1S7XB 3MNDA 4MNHB 2B3IA 3WKMH 1WFTA 4ILDA 2Y07L 3GXTA 1WT5C 3RDJA 5J3HC 2BSDA 2CGYA 3KPMA 1V5JA 3Q5YA 5DJZA 3OGOE 3VI4B 1JZIA 4BSJA 1JHLL 4P5MB 2YD0A 4NP9A 3AY4C 5T1LA 1URLA 4WWKA 3US0A 3NEXA 3NG5A 3FNKA 5FB8A 2YEZA 1FL3B 3ZYIA 3L2NA 2AEWA 1HZKA 5FYLL 2OCJA 4E9LA 2NY2B 1L7IH 1NKGA 4JM2B 5DXWA 2EKSA 5CP7B 1ED3B 1G0XA 3VFVB 2B5IB 1AHKA 4G6AD 3VJ6B 3GHEH 3WNKA 4MFHA 3N9GL 1D7BA 3OMIB 1F4XL 2XI9A 2VW6A 4MVBC 1M6UA 2EDJA 1BMZA 2FD6L 3C5JB 4QRPE 3GXPA 2WINA 3FU8A 3BPLB 5AOLA 2JCCB 3ELAT 1MF2L 1KGXA 3IAPA 4IOSA 3NSFA 4FE9A 4ZFOL 1J0JA 1T2JA 2HKAA 1UH3A 1GC1H 1E4WH 1JZFA 2KPNA 4P57A 5E9DE 3VB8A 2JKJA 1UENA 2QLVB 4K7PX 4L9LB 3C9NA 3E8VA 5C0NC 4B6ZA 1V3MA 2E3VA 2FGWL 3K1DA 5LGHH 1O7DC 2VE6A 3SYPA 1A1MA 4KH9A 5KS9B 4RGND 1XB6A 1AR1C 4OAWB 2N01B 5D2LA 1I31A 5F1IB 1XCTB 3S5LA 1EO8L 3CDZA 1UD8A 4FZEH 2IH3B 3EGSB 2KMWA 2CXKA 32C2A 2IPUG 3NH7L 3PAVA 3IN0A 3KYOB 4FQJH 3RZCB 1CDBA 2VSDA 5T1DH 3QNXA 1MW1A 2E46A 3RAJH 4IM8A 1ASOA 5LKNA 3CQPA 1KT2B 2PWDA 4XP5L 2VLJA 1MNNA 4KJYB 1SVBA 4QCIA 3VD9A 2EDQA 4OCSL 5CSBA 2XOTA 4NKOB 5IG7B 1K5NA 1A65A 4EQ2A 3NZ8B 3KPRB 3NMEA 1XX9C 3APFA 3RWJA 5IVXE 5JHDD 4JM4H 1T1WB 4Z7UE 2R1YB 1BQLH 3T2PA 1PX8A 1ES0B 3RY6A 4Y1AD 1IZKA 2KL6A 1MRCL 4M6NL 4HEMA 5F96L 1C16A 3L4UA 1QYGH 1A4KA 2DKUA 1R46A 2ZONA 4XE0A 1JHKL 3R0NA 5HHOB 4P46B 2DKMA 4YSPA 1LO5B 1MVYA 1IGMH 3B8YA 2C1PA 1I7RA 2H3XC 4YX2H 3BN9C 4YDLC 2F2HA 2VDKB 4DJMA 2BS8A 1D5MB 3WNMA 3VRIA 2HT2C 4ZJ9A 3PGFL 2A74B 4PB9L 4TPRH 2J73A 3T71A 2WP3O 4Y2OB 2P3YA 3FN0L 2D4FA 1EIBA 5DD3L 1P1ZB 4N0UE 1BMGA 5TDPA 4PMFA 5ADOL 5GGVH 3OHMB 4IBQA 4GT7A 1WWCA 3FCBA 3GZKA 2X12A 1E2WA 2TSBA 4XBMA 4LCIL 2K6WA 4ZAKC 2BRRH 3Q2CA 1FA4A 2X2JA 1E5ZA 3WXVH 3S88H 4MMZA 2W9LA 4TTDC 5A3ID 1ETZB 2YKLL 1PFOA 2DWEB 3UJTL 3AU1A 1TYRA 1UTDA 1Q9KB 2OQJB 4FQHA 3WLWD 4QGYA 3BGAA 4HJJH 1SOXA 2OV0A 2TAAA 3IFPA 1T89C 5FW8A 3RWFB 3GS7A 4JFQB 2NR6A 5D7LE 5L2KD 1SJHB 4XPFL 1JGDA 1AR2A 5D2NB 3UGUA 2ZUQC 2EH8L 2WVVB 4AMXA 4GQRA 5DWUL 3OKDA 1H0DB 1NKRA 2NY6C 1XGUA 3ETBJ 5IIEB 3DO7B 3EUUA 4LVOB 1WTGT 5AB2A 1IAII 4GW5B 2Q86B 2CHZA 3BFOA 4I18A 4QTHB 4Z1PA 5C0RL 3GMLB 4XMKH 2ZXQA 4L4TE 1WFJA 1MCPL 5J1SC 2D3JA 3ECWA 5FGBC 4E9QA 4P23C 3AFLA 5FUCC 2OYPA 1MELA 4UUJA 2FIKB 4JKPH 2LV4A 4MA3B 5B21A 1DL7H 3HG3A 3RTQA 1W6LA 1S6NA 1Y6MR 3ILPA 4EBQL 1L9QA 4FDWA 3QUXB 4R4FH 3WEOA 3CZNA 2WXRA 1LO4L 2H0JA 2XZCL 8CGTA 3VDAA 4P5SA 3BE1H 3QI9B 3NJGA 1ROCA 4OI7A 1PG7H 5D7IF 3QJFB 3QIWB 1J1XL 2EDHA 3ARFC 3RGVA 1CFMA 1J9TA 2CM5A 4PG9B 3G5YA 4HSCX 4Z77A 5I0XA 4TVPE 4XVUC 1QVOA 4AK1A 4WUKH 1JPST 3PAYA 4KKLD 2MCPL 3T0EE 2C9XA 2ZCLH 1RZKH 3LNIA 1G9NH 3MV9B 4QF1A 3NCWA 2X2IA 1XF1A 4ZNCD 5DSCB 1MJUH 2CO6B 2D9CA 4FYTA 4R90H 4ODSH 5H35B 3U7YH 2FE0A 2YGVA 4HALA 1AQMA 3VWJC 1X5GA 2P8MA 3PWLB 3PL6A 2J3SA 1KB9K 1VJSA 1MHEB 3G5XA 4MDJA 4ZS6D 1H5BC 1Y7VA 5HDWA 2EDFA 2WQVA 4LLVA 4I87A 1E8ZA 1HINL 2B9AA 3O9WD 1I3UA 2VSMB 2HWZH 2YAQA 2Y5EA 4XCEA 1GJWA 3SDDA 1I8IA 1QO3A 3UBXG 1ADWA 1Q90A 1JGEB 4XMUA 3MGOA 3M1BB 4WW2F 3CC5B 4AEEA 1L0QA 1GZHC 3ZKXB 5A43C 1UATA 4PWHA 4R4BA 3ZMRA 2WXKA 3WS6A 5D1QB 1FCCA 2XN9A 2LABA 2NSQA 5J06A 1H3PL 3FCTB 5GRJL 4CVZB 1HH6A 1RJYB 4JFFD 2WUCH 2XWRA 3FOMA 3LEXA 1BREA 3QAZB 4W6XB 2JKTM 4L5FE 4JB9L 3DHUA 3VD3A 1ZHNA 4A39A 4AKPA 1BVLB 2ZSVB 4DPAX 4ZPTA 4HPYL 4L37B 1UM6L 4XN5A 1NCGA 4ERSH 2DJUA 4U7MA 1CDUA 1M1XB 3WIHL 3IKCB 4H26B 2FGZA 4CKVX 1J48A 3B9AA 4DESA 5KZCB 2X0UA 3WTSA 1KZYA 4Z7VB 4DNLA 5CCJA 1WSST 3NN8B 2VXUL 4ZUTB 4EXKA 2I9LA 4WWID 1LP9F 3VE0A 2J56A 1N7MH 3EJRA 2YIHA 4NENB 5JORB 3GNML 4WHTA 3EGXB 4EOWL 3WOVA 4J3BA 3E9TA 3SE6A 3ULSA 3P30H 4OUOA 1SF3A 1H9DA 2X42A 5BJTA 3H7LA 3JWDL 4JKNA 1UB6A 2YAEA 3ROLA 1JTTA 5BQDA 2BCKA 2VJXA 5JLZA 1JGIA 2L7UA 3B9VA 4Y19A 5C9JA 3CZKA 5IP4A 1E2ZA 1E6OH 4JJ5B 3FPYA 4NQVA 4FG0A 3L1EA 5B4MC 4BFIA 4PJXA 3WU1A 2PW2B 1OANA 1U58A 1P5VB 3BAYA 1Z5HA 1EZLA 1CGXA 1RJLA 3JV0A 3QPXH 4ZXBC 3WKPA 2J20A 2LVEA 2ZF9A 3FB6B 4RIRB 1XB8A 4JQVA 4QKTA 5HDBF 4UF7C 2Y07H 4QRAA 1EDYA 5AOZA 4TRPL 1JHLH 4KPHL 1C12A 3QHZL 4OVUA 1R4XA 5E00B 4ZAKA 2DMCA 3CFDB 5KVDE 1TZOA 4IKJA 3NT0A 1I1AA 5SX5K 1NFIB 3BO8A 2JQAA 3FTUA 1MH5A 5TGBB 3SPVA 3U0WL 2P26A 5E8EA 4KOBA 2EXYD 2EYSA 3H2WA 2MQGA 4PJXF 5FYLH 4NO5A 4OSUL 4I8DA 1ND0B 2ENSA 2LAGB 5HYEA 4UNTA 1WF5A 1NDMB 3IGAB 3A23A 4PSRA 5JOFB 1NIDA 1TENA 2Q2LA 3N9GH 4Y8AA 1MQKH 4POZD 3GEWB 3G5WA 1F4XH 2MKWA 4N1CA 3TVMA 4H2CA 5CBAA 1UEYA 2FD6H 2GY7B 4WW1A 2EEBA 1YJDL 3SDCB 1IBBA 4MRBA 2V5RA 4YLCA 2ZUUA 3GS0A 1MF2H 4RGNE 4YXKL 3FUNA 1ZY9A 3JWNG 4MQ7B 1ZEAL 4ODBD 3HB3B 1IAOB 1GGYA 2DLIA 4Z76B 3GKWL 1H15B 2FGWH 2IANB 1SDAB 4PV9A 4XPGL 3UBFA 3W0WB 1BF8A 2NW2A 3S3BB 3FBKA 5F1NB 1DZBA 3IRZA 3FTGB 1EO8H 4POUB 3UPAA 1HCZA 3UIZA 3DIVA 2GC7C 5C0BA 3WMSA 1JUFB 2H8PB 2NNRA 4PJFE 2BXYA 1OTUC 1P7KB 3O2DL 4FYSA 5ICXA 1THCA 3MRGB 1QBBA 4XP5H 2WJ7A 1O75A 3N44B 2L7JA 4ICWA 4Y1AE 3O2WL 1LP9E 1UD2A 5T1KA 2NY4C 3C6LC 4OCSH 4XPTH 4Y2DD 5GS0C 3CFJA 3BUPA 3QDGA 3TN0C 5JYMA 1CLCA 1THAA 1W0YT 4UTAA 4WCYL 4HXBL 4CDHA 2H1XA 4K0OA 1ZCRA 5JNYB 4NNPL 2VSKB 2NYYC 1BXUA 1MRCH 1ZHBB 2UX7A 3PAZA 4M6NH 5DZLA 3CUPB 2UVFA 1DN2A 4Y1SA 5AVVB 3P2BA 3JV6B 5DJDB 1AOHA 5D9SA 1JHKH 3IETB 2JKWA 3X12A 2MHAA 4M8RA 3ABMB 4URTB 5ERWB 2OZ4A 3AGVA 3TZVD 5AB0A 1COBA 2XIDA 3LNHA 2VUOA 2LU7A 4YHPA 1NCHA 2DYSB 5CEYA 1PQZA 5HBBA 3PGFH 2IFFL 2FRGP 1RI8A 3MLRL 4PB9H 2DYPA 1KULA 3J27A 3G7TA 3BH8A 3FN0H 1PAMA 4V1DA 3KMDA 2X4OA 4PV8A 3T3PF 5L9DL 5ADOH 5EO9A 1JVOA 2AXHA 2X1WL 1KGWA 1HXMA 2E47A 1WCBB 3GTVA 2VN7A 4LCIH 4M5ZL 4F9PC 1CTNA 2NDGA 1FNGA 4X8JA 3FUMA 3PWPA 5C0EA 2RTTA 1XFPA 2YGQA 3VWKB 3SZKC 5L2KE 4F15B 1BEYL 2YKLH 2DM2A 1NGWA 1OGAD 3SJVD 2YXMA 3UJTH 1OWRM 3HKFA 4X99B 4OD2B 5KSBF 5JA8B 2FBRA 2DEXX 5C2BH 1FNLA 1CURA 4H8PA 4WO4C 5C6WH 2UUDK 3S0PA 3M17A 5LBSA 3T0AA 5F97E 4HH9A 3SPJA 1M42A 4K71B 3ZKMC 3BZEA 2O93L 2EH8H 4ZDHA 5DWUH 2P9RA 4ZBJA 5IW1A 2GJZB 1FZKB 4NO2B 3KLDA 1S7SA 4P2QB 1JVKA 2C3WA 5C0RH 1Z9MA 5AYTA 4U1HA 1MCPH 3ABLB 4MCMA 4F2EA 4XXCC 1W9XA 2D7PA 1B3IA 5CLXA 3CNKA 5JIHA 4N20A 2NY2C 3MRCA 1GCFA 4JM2C 1XBRA 4HCFA 2Q3ZA 2B5IC 2SEBA 1H19A 5GGSA 3VXUD 1ZTMA 4DK5A 3OAUL 4L8DB 1T1YA 2XZCH 3F3HA 4MCNA 4OJCA 3H3PL 3U7AA 4MDIB 1KLGB 3BPLC 1J1XH 2YRPA 5JPNC 1R33A 3H9SB 3ZU8A 3MUGA 4L9LC 4QHUB 1ZT4B 3MRIB 1AGBB 5JIQA 3CVBA 2X53A 4X4ZA 5G2NA 1XXDC 2A9AA 3VGGA 2MCPH 5EBMA 1G43A 3S4SG 4YOKA 4F3FA 4M8QA 1JZGA 1XCWA 3QEQD 1IRAY 4JL2A 4P0DA 3L95A 2CHXA 4GLRI 3EFDL 1A5FL 2E7LA 3KYAA 4HK3J 2Z92B 2CDEA 3RZCC 4P04A 1A7BA 3W39A 1IGCL 4AJYV 2QTVA 3STZA 4ZO6A 4PWKA 1UA6L 4M1CD 4HJIA 4MD5B 4WUUB 4L1DA 4NI6A 3HC3H 3LRSA 2VYRE 2WQSA 3DOSB 2PNDA 2VLRD 4HDIB 5IB3A 1Q72L 4YBHA 4OIIL 3TWYA 4PWEA 1HINH 1RUPL 1CDJA 3T3PE 5E2WL 1F3DH 4FL4B 4ZQKB 4G6JL 4F93B 1F42A 4H8QA 4JFFE 1YNKL 4AZUA 4LKCA 5J4MA 5IWLA 1KYUA 1GAFL 2HRLA 1J8SA 3Q05A 1HEJC 2Z31B 5ALBL 1MG2C 1SHMA 1KXVC 1W72A 2HFEB 4FZ8H 7CGTA 2W94A 1H3PH 3KL3A 5GRJH 4IOIB 3ZJAA 1AGCA 3QG6A 1WV7T 4Z3HA 1J5OL 1E4XI 1CDHA 5KSBE 3DX6B 3V7AG 2Y06L 4JB9H 3LXUX 4P46C 3I6LE 2OR7A 4P3WA 5EBLB 1NANI 2ZUSA 1BZQK 3VUAA 1K6QL 1ZWIA 1CE6A 2A9DA 2NY0B 1E9QB 4HPYH 4PN6A 1KTDA 1UM6H 1OHQA 3C6LA 1IC0A 4JFXB 3WIHH 1RZPA 2ZD0A 2A74C 4P2CG 2VXSH 2P5PA 1FNEA 5FV2A 1OOAA 2XKSA 3BHBA 5FF6B 1QFPA 4O51B 5D5MF 5GS3A 1J86A 1F1AA 4W68A 4KO6A 1HKLH 5BOPA 2VIRA 3I74A 1SLXA 3IDXL 3PQYE 1UJ3A 2H1PL 1R9FA 1GGBL 2XN0A 4EOWH 3CVCA 4RISL 1DJHA 3DHMA 4E5XB 3I75A 4L8SB 4LL9A 4M29A 1CXLA 3UTTD 3NIFF 3JWDH 5F21B 2F74B 2F18A 3A6CL 5J56B 4J3VA 1A6ZA 2OMXA 2Y7QA 1JHTB 4XZUB 4G8FA 1H3TA 4AKOA 3EJUA 4BUQA 2OS7A 3CZFB 1XH1A 1OEZW 1TXKA 4KXZH 5C0AB 5CS7A 5AW6B 4PGEA 1U0QA 4Q6KA 3WEMA 3MGTB 1WS8A 3DX8A 2DIBA 5ENWA 3SO3B 4DAGL 3FU7A 4PJ5D 2GC4C 4HU8A 2P5WA 2AJ3A 3K8LA 3HG0A 3P9WB 4LDOB 5D2NC 4UTAL 4BFEA 5AKTA 3QRGL 1URIA 1MIEL 2HKFL 4LVOC 2HFTA 3VFWA 4BRVA 3RVXC 1CFTA 3J7HA 4W4OC 4TRPH 4KPHH 1NH6A 3QHZH 1PBYA 3ZDXE 2X0WA 4MJIA 2F9BT 4O5LL 2XXFA 3WJLA 4UZUA 1G94A 3WS3B 3R06B 1GW0A 3N2JA 2A83B 4JPKL 2PMZA 4GRLD 2APWA 3WDHA 2OZ4L 3N40P 5EHFA 3UERA 3SYCA 4B3VA 5TE7L 3FT4B 4OSUH 5JXEC 3QUXC 1WBXA 2R69A 3D25A 3VRJB 2NDFA 3NCYP 4PBDA 1NCIA 4PJ7B 2YUWA 1ZJAA 1N3NA