1ZOXA

Clm-1 mouse myeloid receptor extracellular domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
110
structure length
110
Chain Sequence
b'EDPVTGPEEVSGQEQGSLTVQCRYTSGWKDYKKYWCQGVPQRSCKTLVETDASEQLVKKNRVSIRDNQRDFIFTVTMEDLRMSDAGIYWCGITKGGLDPMFKVTVNIGPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLM-1
publication title Crystal Structure of the Mouse CLM-1 Ectodomain
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 29
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zoxA00
4RAUA 1F3DJ 2DQUH 3OJMB 1BF8A 2E7LC 3BDBA 1V3LA 3WDJA 2ZCKH 3UYRL 1BJ1H 4JREC 3LSOB 5E7BA 1FVCA 1DQLH 1EJ6A 2WINB 3ZYOA 4DUVA 2R0ZH 1FV1A 3ROLA 2GY5A 4HKXA 4XVJH 4QXTB 3D85D 1ZGLB 4KXZH 2CSPA 2VIRA 3GSVA 3VU2A 3B3IB 2PTTB 5EU3B 3IXTB 1XGTA 1F58H 5J06A 2BVUA 2D31A 3NH7L 3IVKA 1I3GH 2CDFA 2XWJB 5MENA 2ADIA 3VCLA 1NCUA 3MCLL 2XV6B 2GTWA 4Z95L 5D7IE 1RK0A 2LQRA 3QDME 3KVQA 2HYMA 2WMPA 4LLAA 5SWSA 1KN2H 3RZCA 4N5ED 2JE8A 2E7MA 2V9TA 5I1AB 3LEXB 1WV7T 5EA0L 5DT1L 1U2CA 3GUTA 1TQCC 2GAZA 3N1QC 2Q8AH 2P47B 1N4XL 1TETL 5ABDE 3UTPD 1CDBA 3MLYH 1VFAB 1XEDA 3T0ED 4LLMB 4WEUD 1VCAA 1UKQA 3EFFA 4FQ2L 1SQ2N 2YXMA 3MOBL 2UZXB 4LCYB 1WICA 3KPNA 4MXWH 5SWZB 1MLBA 4AK1A 4FMKA 4XPAH 2AP2A 1ZV5A 3HE6B 1DLFL 3KPLB 4UBDD 2JCCA 2EDYA 5IR1A 5JORB 2FJFA 2J8UE 3P0YH 5DD1H 4D9LL 3CVIL 2GK0A 3BPOB 5E8DH 3TBTB 4JFFE 4JFED 4KZDH 1V3JA 4X4XB 3K4DA 5KVMC 3PGCB 2X05A 2GSGB 2CGRH 1G7JB 1C08A 1GGCL 2R56H 2HH0H 2W0KA 3MUGA 5JIIA 3IU4L 5L88L 5CEYA 3HKFA 5LG1A 4AIZB 5GISL 4S1QH 1I8MA 2R2HB 3VXRB 2R29H 3BVNB 4TVSa 1IQDB 4X5XA 1NFIB 1U8JA 5A3IC 5CJQL 3FQRA 1DQMH 3KPTA 2CD0A 2E7BA 3RWDB 5LAXB 1OARL 4OTXL 3B4NA 4ZFZB 4JZOA 4E5XA 4ALAL 1U8QA 1MFBH 5H37H 1JGUH 4YR6A 1IGYA 3FB7B 4LLWB 2IAMB 3QZWG 1KIUA 4WI2A 5GZNC 2VLRA 5HHOE 4FS0A 3LIZL 3VGDA 3GK8L 2I60L 2IBZX 1CGTA 2YC1B 4N1CA 1INEH 1EO5A 5LXGL 5IM7B 3Q5OA 2GTZA 3WFBL 3GBNL 1F4AA 4AQOA 5DQDL 4YHYB 3PWJB 3ET9F 5HD8C 4K71B 3V6FB 1DVFA 2A6DB 5DHXB 4M02A 3QCVL 2VDOL 4HLZH 3TP4A 4P2OA 3TJEL 2BHZA 2F15A 3EDDA 2YKLL 4P59L 4AEHL 3IFOB 5E4IA 1KPRA 4P99A 1IRAY 1PG7X 2JJVA 5DA0B 3EOAA 3GSUB 3BRDA 1G7HA 5EO0B 1T1YB 3I02B 3UZVB 4UIMB 1BQHA 4GSDL 3OZ9H 4N0UE 3N9GH 4D0DB 4PRHE 1URLA 3EJYD 5C07A 4NO0B 4UTAH 3DTXB 3KR3H 5CBAA 4NQDD 1FQ9C 1QYGL 5J6HA 2WIIB 1FYTA 2FBJH 3WNOA 1UM6L 3S4SB 3RIFF 1QLFA 1FN4A 3ILPA 4L5FL 4PRNA 4ERSH 3LB6C 1BFVL 1ITCA 1U8LA 3GKWH 4OCSL 4P5TA 5HYQA 4FFYL 4ZFFA 4DK6A 4GS7B 1XIWD 4D0CB 3HR5B 5A2LH 4Y4HB 4PJ8B 1RJYB 1DJSA 4ESKA 1FL6A 2AK1L 1UENA 2R0WL 5IEKA 1D6VH 3OKLA 5IROA 1R6VA 3TN0B 2XWTA 3R8QA 1PEZA 3SCMD 3W0WE 1JJUA 2P45B 4PJEA 4YWGH 1VADA 3VXSB 4ZFOL 3QIWD 4JPWL 5F3BA 5IJKC 1T0MB 4DN4H 3K2UH 3I3EA 3QDMD 4ZPVB 4MCYB 4P5KA 3F7RA 3EZJB 1AR2A 2DIJA 4LGRB 4ZFGH 1CDHA 4YXKH 1F8TL 1ZEAH 3P3YA 4RRPA 4J1UA 5K9JL 4OI9A 5I16A 1RZFH 4TULH 1VA9A 2CRIA 3SKMB 4UT9H 5E1AB 2H8PA 3P4NA 4XH2A 5M7QA 1P7KB 3ULVH 1T83A 1ZVSB 3QJFA 2CO6B 2EDQA 4HWNA 2FWOB 1MFDL 4XBGA 1LK3H 4G9FE 4HDIB 2JIXA 2CO7B 4LVNB 4WEBL 4HGMA 3BN3B 5B3NA 2IQ9L 5BS0B 2VZ3A 3GGWA 4FNLL 5DUPL 3C2SA 4X6DF 1H15B 4UINH 4JO1H 1IFHH 1CT8B 1I8LA 2R1YB 2VDPL 5F96L 3C08H 1JF6A 4JFFD 5KTEL 3QDGD 3GJEA 4YUEH 5FOBB 1K8DB 4XMKL 5DEFB 3CH1A 4KVNH 1QR4A 3EOTH 2HT3D 1S7VB 4L8SB 5KVFL 1D6EB 2XZAH 1OQOA 5L9DH 4OF7A 4MNQA 5FYJU 3CFKA 3ARDB 3C8KA 1P2CA 2AXHA 4WGWB 3TFKC 5JXED 5ICZA 4OZ4B 3E8UL 4MDIA 1RY7B 3UTZA 4G9DA 1I8IB 2HTLC 1QQDA 3V5KB 4HJGA 4BA8A 3TNMA 3ULUC 3T3PE 5HHOD 1I1AC 3HAEA 4WI6A 2EE3A 5D5MB 4N1HB 3WO3B 4RIRA 1UACH 2X1PA 4I0PB 5C08A 2NY5L 2VXSL 3E3QC 1RUKH 1XGRA 4X6DB 3TIDB 5JHDA 4EVNB 5KVGH 1BQSA 1C5DA 2HRPH 3OSKA 4NDMA 2WUCL 4Q58C 3PL6C 4H26A 2W59A 1WAAA 1YEEH 4OFPA 2ZUTA 3LSOA 4K94C 3EUUA 3P30H 4DQOH 1TZGH 3ETBF 4ONGL 4O2CB 3V0VA 1ZGLA 3TBYB 3E0GA 3B3IA 1EHNA 1MCCA 1S7RB 3QI9A 4U1NB 4NUJB 5DUBA 5J9PB 4EN3D 4WU5B 1RFDH 1YN7A 2XWJA 5F7YC 1QNZH 1MREL 1S9VB 1OTSC 5C0EB 4NO3B 2CMRH 3IJSB 4N8VG 5CWSB 4M6ML 4ZAKC 2UWEA 1J8HB 4I3GA 4YQXH 5BZDB 1RSFA 5EBLA 1BECA 4G8IB 1KG0B 3LEXA 1IGJA 2VDNL 5C0RH 4GAFB 1PEWA 2CUMA 5IMMB 5FGCE 4QXGL 4FZ8L 3UTTB 2GFBB 1CXKA 5DZNA 2C1PB 2KQMA 4OD2A 5J8OA 2BNUB 3BEWB 1GCFA 2VISB 4DEPC 2XTJB 2B1AH 3CX5K 4FQHA 5JOPE 2VLME 1KJ2H 2DYPD 3TWCL 3C6SB 4LCYA 2H26B 4ORZC 3W0WD 2P7TB 1EBAA 5D72L 3QIUC 1U36A 4WNQB 4ZTOH 4TYUA 4AENB 4IDLA 5H35B 5DJXA 4Z77A 2Q20A 2GJZB 5A16A 4MB5A 1V3MA 4K3DL 1MWAH 4WV1C 4X4XA 3HZKB 3DXAE 3FB5A 4PRHA 3PGCA 3NCFB 2WANA 1F45A 4JRWA 4DZ8A 3MREA 2ADJB 4BM7A 4G5ZH 3CFDB 3MBED 3UBXG 4AIZA 3VXRA 1UJ3B 5EZLB 1CFTB 4G8GB 3ZKND 1IQDA 1OAKH 2J5LC 4NN6B 1NL0L 4ZOAA 4GG6F 4LCCC 3TO4B 4HPYL 2BSRB 1WT5A 5D1QD 1IARB 4O4YH 4HFUL 3SDDA 5CSZB 4QCIB 4ZFZA 4G9FD 1BGXH 5F88B 5T1KD 2V5SA 3D0VA 3IFLH 4WI9A 4HF5L 4KTYA 1HNGA 1HQ4B 1FGNH 1HZHL 4PB9H 4LLWA 2IAMA 3H3PL 3IT8D 2XZQL 2GCYB 4OGAC 5FCUL 1Y18B 4IIQC 2QADB 4RBPH 4RFEB 2YC1A 4BJLA 1TIUA 1NDGB 1D5ZA 2WBJA 5D7KE 4K3EL 3QYCA 5IM7A 4EQ3A 4RGMC 4ONHA 4XPGH 5B39G 3U4EB 3QCUL 1I7RB 1P4BH 5DLML 4JFXA 3PWJA 2B5IC 4R26L 4WY7H 1QPXA 5LWYH 2A6DA 4HCRA 4M7KL 4Y4FB 3RY4A 4LIQH 3SGDH 5DVKA 4ELKB 3AREB 5I8OH 4MZ3A 3LS4H 5TDNB 5HHXH 1WQVT 4K7FB 4Y0GA 1TVHA 1UCBH 4X4ZA 3GSUA 4DWHA 3VW3L 5TE6L 3I02A 4UIMA 4POZC 2J7LA 1CN4A 4GG6B 1MJUH 4JFZH 3TZVB 1G6RB 4JPKL 4WDIA 1MFAL 3LQAH 4HV8B 1T03H 1EFXD 3E6HA 4RGNC 1UWXK 1CCZA 3O0RH 2MQ3A 2WIIA 2IPTH 4QXWA 5I76B 3S4SA 2J8OA 1J88A 1ZA3B 2O5XL 3OGCB 3G04A 3X3FH 1UB5A 1XF5B 5I73C 4EOWL 3E2HB 5JPNB 4X0KB 5DYOB 4P3WA 2DWEB 1D9KD 3PNWB 4D0CA 4X8XA 4HMCA 5DS8B 4Y4HA 3WS6A 4PJ8A 1P5UA 2O5YH 4YDJB 4JKMA 3BDXA 5DC4B 4YNYA 5JO5A 1PW3A 3HE7C 5D9SB 1KLUB 1UXWB 4O5LH 1SJEA 4NKIL 4MCZB 1X4ZA 4O2EB 3KJ6H 4G3YH 4YZFE 3DUUA 5IESL 1U8KA 2J88L 4F7CA 5I30L 2YD1A 2EIDA 1T0MA 2M26A 3L3OB 3MZTA 4RDQF 5JW5B 4ZPVA 3O6MH 3V5HB 4JM4L 1OM3H 5HXMA 5I1CL 2AI0H 5IBUG 1WVZA 1I3RA 4GMSH 1CDJA 3QBTB 3NPSC 1BIIA 4J2XA 3OG6B 4DKEH 3BN9D 4X6EB 4R7NA 5E4EB 3GMNA 4AH2B 5E1AA 1J7VR 1M1SA 1VFOA 3MNVB 5SV4A 3EDEA 4RDQG 3GEWB 2FWOA 3RX8A 5TQ2H 1OWWA 4PY8I 2ZUVA 2VLMD 1DVFC 5KSVA 1JPSH 5C7XH 3QA3B 3SGJC 4P2OC 1K4CB 4NJAH 3QH3B 1H15A 3CVHH 4QOKB 3ZL4L 3QUMB 3MCKB 4FQCL 3VXUE 4RMRA 3U0PB 2R1YA 3X13B 3DVFA 4JO3H 3T0VA 3SDXF 4E41B 4ACPA 1MIMH 3DXAD 3WXWL 1K8IB 1QO3A 5IV2A 3NABL 3C6LB 1S7VA 3MSPA 1KUMA 4NP4H 2FEDD 3VRJB 4XP1H 4HWEH 1VPOL 4NN5C 3IFPA 2VR9A 2DQCH 3OXSA 1B2WH 4KJWC 5AYUH 1MHEA 3H8NA 4P5TC 2Y7QB 4UILL 5GGVH 4BZ2L 1I8IA 1TENA 3P11H 4LFHD 5ISZA 5JXAH 3L5HA 1I9RH 2N56A 4OD1L 1INQB 2BFVL 5D5MA 3PHQA 4JZNA 4ZMAT 1JPFA 1NFKA 5HYEA 4EUPB 3FAWA 5IROC 3BGAA 3P73A 3SE4C 1LEKB 1NMAL 4XVSH 4Q0XH 1KOAA 1MEXH 5D7KD 4XP5L 3DVNB 3TIDA 4Y5XB 2VZUA 4ZQKB 1R3KB 2D7NA 2QQQA 4PUBL 2VXQL 5I19H 3KYMA 4B7IA 3BYYA 2DQTH 3K1KC 1CGSL 4JRXB 1ED3B 2JJWA 5DD5L 1RZGA 2NY0B 1A1NB 1A3LH 5IJVA 1EJOH 1MFNA 2JF1A 5BZWB 1A7QL 1PAMA 1YNLH 1CDIA 5DK2A 1S7RA 2EDXA 1HXMA 5C6TH 4U1NA 1CL7L 4NUJA 3TBVA 3R06B 1T5WB 2VOTA 5HYSB 4OZFH 3S37L 4TTGA 4Z8FL 1KB9K 5CWSA 2QSTA 5J3HC 4YHIA 4UT7L 3U36B 3DRTB 5EOCJ 1CK0H 3UBXI 3QHFH 5I1KH 4MD4B 5HHMB 1TVBB 3KDMB 4HX1B 3VDBA 1AIFB 4ONFL 3ARGD 3C5ZC 3J8F7 2P8PB 5IMMA 3UTTA 4XPBL 3KXFB 2GFBA 3RRQA 1MRFL 1TTUA 1UJTA 3ULUE 5GZND 2BNUA 3T08A 1AJ7L 3BEWA 2VISA 4I48B 3GMMB 4N0FB 4ZOBA 3RHWF 1ZHLB 1BVLB 5E5UB 1G6RL 3CPLB 1ZSDB 4Y2DD 5MEQB 3C2AH 4ZS7L 5T1LB 1NKOA 3GMRA 5EORH 1NGYB 2H2SD 3BIAX 1OCWH 4HIJA 3S97C 4WNQA 5HD8D 5H35A 1CS6A 5TPWL 1CFSA 2Z8VC 4P3DB 3MRQB 3TLRA 4MYWB 1EEUA 1XAUA 2AJ3A 4X6BA 3HZKA 3NGBC 3T3MF 1F13A 1X5XA 1LILA 1X5GA 4HUWA 2XXCB 1C7SA 1YPZE 5E99L 4I3SL 3UC0H 2ADJA 4KJPC 3WSQH 3CFDA 2X4SB 1UJ3A 1CFTA 4CDGC 4V2CB 4XP6H 5J1AA 3CDFA 1GHFL 3CJJA 4PR5B 4Z76B 3VFNB 3TO4A 4Z7UB 2BSRA 1AP2B 1NCBH 4MGXA 1W0VB 4XX1G 5AZEH 1GZPB 5EUOF 3DGGB 4MAYA 5H2BA 2YEZB 5EZJA 1KCVL 1V7NL 1CF8L 3D3VB 4CU7A 1LDPH 1UYWH 1MRDH 2NXZB 1HQ4A 4TNVK 5T3XE 3GI8L 3DETC 4MWFB 4PJXB 1S7SB 5HGHA 5E24E 4M7LL 4JY6B 3LB6D 4OT1H 5H94A 2VZOA 5EBWA 3VXUD 1NUGA 1Y18A 4C55A 2BSED 2XRAL 5FYKH 3SDYL 4NNYB 4RFEA 4RMUA 5DQJB 1KIPA 1CTOA 3IETB 1NDGA 5B38B 4BZ1H 3CFBB 3VI4F 3U4EA 4WHCA 1ZANH 1I7RA 4YHML 2QQNH 3I6KB 1YYML 4Y4FA 2FL5B 1L9MA 4M8QB 3PGFL 3ZMRA 5GRWA 3AM8A 4ELKA 3AREA 2Y6SC 4K7FA 3GIVB 4K7PX 4HXAL 3BP4B 1PJ9A 3TH3T 5CBEB 3FQUB 5FO7B 4I4WB 3A67L 3QUML 3BIKB 2DTML 5ADOL 4GG6A 4RGOL 4WTXA 2A9ML 35C8L 4YFLF 3MLSH 2BNRE 5F44A 1NANH 5GS0D 5JLZB 4L4TA 1NLDL 5EUOB 4OUUB 2ARJB 2F53E 4HIEB 1LO0H 4Z7VF 2MTPA 5DMJB 5I76A 4HW6A 5E7FA 3RWJA 4O9HH 1BIHA 3NCJL 1L7IL 1XF5A 3HE6C 3TC9A 3ZLQC 1ZHKA 5I15L 2W1NA 1SBSH 4HLJA 2X4NA 4X0KA 7CGTA 2FX8H 9CGTA 1TVDA 1XCQB 1G7QB 1XF3B 4OD3H 4MXVF 3BPOC 3MV9A 4OM1L 1F90H 3MXWH 4LARH 1OOAA 2EDDA 2YPKB 5GRVL 4YDJA 1MJ7H 4G6KL 4UIKH 4L3EA 2E27H 4OIIH 5GGQL 1E0OB 1JI1A 2HVJA 2NY5C 5GRJL 4XAWL 1YYLH 4NQCA 2C3HA 3VMOA 3ELAT 3VI3E 4DJMA 1XF4B 4WO4B 1JK8A 1MLCB 5EG6C 3QEHA 3GBMH 2BMKB 4BH7A 3LKOB 4HQQL 3L3OA 1REIA 5INDB 1DBKL 3DX7B 3V5HA 3WDHA 4P9HC 4G8FB 1OSZB 5I1JL 2IAMC 4AJ0A 3U6RB 2H3NB 2X4OB 2IANB 1FAKT 2R4RL 5F70A 5CCKH 4X6EA 3C5JB 4JM2F 2HTLD 3JVGA 4AH2A 3OQ3B 3MNVA 3CK0L 3ULUD 1ZGLP 4RGNE 3TNNB 3DHMA 4R90H 5FUCC 5A2IH 3ABZA 4YHYC 4DVRH 2EZ0C 5C6WH 1FH5H 4K71C 4IMLA 3RJDA 5CIPA 5L7XH 3QA3A 1FC2D 4LCIH 1AD9A 5GJTH 1MI5E 2VAAB 1X3DA 3O6LH 4LSUH 2PR4L 4PGJA 4PJ5D 1K4DA 1KIRB 1T1WA 2EDFA 2RFXB 3PDOB 5TH2B 4YHOH 3RUGE 3MCKA 5BMFL 3PL6D 2VTFA 4KQ3L 3BJ91 3X13A 2YZ8A 1V05A 3MLXL 1CFVH 2CK0H 3MX0A 3HZMB 1YUHA 2XOTA 4MAUL 3SE3C 4A2LA 1K8IA 3W11D 4LVHB 3C6LA 4BQ8A 1XGUA 5HY9A 1O5DT 3MFFA 5L6YL 3EYFA 1OGAB 1JGDA 3BMWA 2VDML 4ODHL 1CXHA 1QG3A 1MCWW 3TA3B 1OTSD 3ESUF 3SBWA 4I5BB 3TEUA 5ACZB 3CDYA 5I1HL 2XI9A 4JM2B 4RAVB 4FABH 5C0IA 1HEZB 1XR8B 4GS7C 3HLAB 5T3XD 4XXDA 3DO3A 1GL4B 4ZO8A 5CINL 3M07A 3H9SB 1S5IL 4G6ML 4Y4HC 4PJ8C 1L7TL 3OB8A 1INQA 2XXMB 5DURB 3QUKB 1ZLUH 3ARRA 2D03H 1RIUH 5D70H 4CW1B 4EUPA 2N4IA 4JB9L 4GAYB 3TN0C 4NNXA 4X8JA 3DVNA 1NCAH 4XMLH 4Y5XA 5HHQA 3DWTA 1H8OA 4ZQKA 3S35H 4Y19E 4Z0BH 1INDL 1MQKL 3G5XB 1VKXA 2DQJH 1MJ8L 1CGXA 3B9KB 4D9RE 5HVWA 4JRXA 1RIVL 4WWKB 3QIUD 4KDVA 1JNLH 4PJFF 3AFLA 4IDJL 3HG1E 4PG2C 3EFDL 2DQIH 4XHQA 4KK5C 1J12A 1RVFL 2OTWB 5ILTH 4N8CL 2RB8A 1H3TA 2YR3A 3WN5B 1A6TB 1DBAL 3VFVA 1J0IA 1DE4B 1T5WA 4HFWB 1U91A 5E2JA 2BNRD 4S1SL 1A3RL 1ETZA 5E2TH 1S7UA 1QSED 2D7PA 1GVIA 2BHYA 3AVEA 2F53D 3U82B 3KPMB 4R7DA 4WUKH 4LVNC 2BVEA 2ESVA 4XCCL 4GAGL 1OAZL 3LN9A 2F74B 1QHOA 3KDMA 3P4LA 4HX1A 1G7PA 2PTVA 1KACB 4GRLA 1UZ8A 3WUZA 1AIFA 3ARPA 3U1SH 1J10A 3SPVB 3HTLX 1E4WL 5JQ6L 1QFUL 2X4PA 1N5YL 5ID1B 1MIEL 3CSGA 1EUTA 5FM8A 4PV9B 2F8XC 4N0FA 4RFOH 1ZHLA 2XY2A 4OGAD 3ARFB 4OUOA 2BNQB 3CPLA 2A77H 1F6AA 1U6AL 4MJ4A 1ZSDA 4L8SC 4ELMF 2Q1EA 5DMKA 5FOJA 2VLJB 1HIML 3HPLB 5TFSH 1FNSL 3CXHJ 4HIHA 4GKZB 4XB8A 5T1MA 4PJFB 3ARDC 1EXUB 2EXYC 1E6OL 1XGYL 3HUJE 3BKYL 3T0BA 3QRGH 1AI1L 5KVDH 4LRNH 4P4RB 3ALWA 4UQ2A 3OAZK 3X3GL 3VG9B 3U9UA 1ND0B 3NVQA 5ETUA 1O7SA 5DDHB 5F9DC 2VKXA 3UXFA 2X4SA 4POZD 1IC4L 4JFDE 2ICCA 5DK0A 4I0PC 1FFRA 3VFNA 4Z7UA 1KJ3L 1AP2A 4AIOA 3D0LB 2JLLA 4RGND 4LAQL 5F89B 1A14H 3RI5F 4FFWC 5F1KC 1ZHBA 4L1DA 3DGGA 3WFDH 1ITBB 1KELH 3BZ4B 1KCKA 1LEGA 1IVLA 2NY1B 1MAMH 1MI5D 4MWFA 2UZIH 4PJXA 4JQIL 2GT9A 5CD5D 5TE4L 3UJTL 1ZK9A 3O9WB 2WBWB 3BP7B 4IBLT 4ELMB 4QGYA 3OAYK 1X7QB 1R3IL 2EDLA 4FXGB 4NO2A 4NNYA 4K94H 1IM9D 3V6ZB 5B38A 4PFEA 1CZ8L 1NC4D 1YEHH 5CJBA 3ZE0F 1S9KC 1S7WB 2APTA 3HE7D 4AL8H 4NSKB 4OGYH 4XCNB 4XNQB 4J4PA 4M00A 2IFFH 1ZWIB 3PWPE 4RISL 4F15B 5HYJA 3GIVA 1F4XL 3DOSA 5CBEA 5D2NB 2DL9A 3ZE2F 2B4CL 4BZYA 1Q1JL 1G0YR 3K80A 5EBMB 1JFQL 3VH8G 2Z35B 5D4QA 3DURA 3D39B 4O00A 5DRXB 1MQ8A 4UMGA 4PJAA 1AKJD 2XTJC 4HIEA 1IEHA 3OTTA 1DEDA 4KKLC 5JR1L 4OQ1A 3WIIH 1U8HB 2IPUK 1CBVL 1U8PB 3BAEL 1EAJA 4JR9H 5C0BB 3OWEA 1XCQA 1XF3A 2FLBT 4D9RD 4AM0B 3KYKL 4N68A 3CFJA 1VHPA 4XPTH 3ARWA 1VFUA 3HCVB 2XZCH 4OLEA 4GJTB 3HG1D 4LDOB 3VXNB 2MJWA 1J18A 2AJZB 5HVHB 1UJ3C 1IBGL 4KAQL 4M7LT 1KB5H 4NN6C 4HUUB 1MLCA 3TO4C 1AGFA 4X6FB 1S7QA 4PRPB 2BMKA 5DMGD 5C6PB 3QG6B 3F7PC 4M62L 4OZGF 5E6IA 3DX7A 2BVQB 4OFKA 4IRSA 2IGFH 1CLCA 1H5BB 3QUZB 3ZKXB 5EU6B 1A7OL 1B3JA 2AABH 4LEXH 4KJWD 4RWYH 2H3NA 2X4OA 3HC4L 1SEBB 4JKPL 3L5XL 4TVPL 2NMSA 3VGFA 4HK3J 2AV1A 2QADC 1UWXH 1MCHA 1T0NB 2W0FB 3QQ3B 4XNUH 3L5JA 4M1DL 1W72B 4OLWL 3TBWB 3BISA 3TNNA 1FFNB 3PE9A 3KG5A 1LEIA 3OX8A 4XZUA 4Y19A 4LCWB 1JWMB 3QEQE 1KCUL 5C0AB 3FRPG 4Y4FC 1N2RA 3SO3B 5SWZE 1CYGA 3JWDC 3AREC 3S96A 4L8DB 4IRJB 3PDOA 4JEGB 3WHXB 4DAGL 1KPUB 3U83A 4ZUSB 1CICD 2IMMA 1MHPL 1T1ZB 4BSVA 3BKJH 3UJIH 3HZMA 3O8XB 4Y1AE 3TZVC 4JZJB 4KI1A 3WFHA 1BEYH 4EIGB 4H5SB 4YC2B 5IGXH 1BP3B 3MA7B 1LO2H 3MGAA 3ZYIA 1PG7H 2DQDL 5E2WL 5I1IH 1KBGL 4OZGB 3K1DA 4OCYL 4LPTA 4JFDD 4KPHL 1P9MC 1UKTA 3TA3A 2NNAB 3U7AA 4FQJH 4I5BA 5ACZA 4WFFD 3E2HC 3DV6A 5J3HD 3FB8B 4DKFL 3F58L 4RCAA 3RKDC 2C9AA 4RAVA 3MJ7A 1XR8A 3WFEH 3AS3A 4B0MM 2CXKA 2R0LL 1OAUL 2IADA 1AXSA 1MCRA 5GS1A 3C5ZD 4U6XB 5EB9A 4NC1C 3PHSA 2X70B 5EC1B 3V7AG 5FF6B 4GW5A 3GJFA 3WYRA 4M9PA 4JG1L 3U79A 5DRNB 4WCYH 4P2QA 5KOMC 1QEWB 5DD6A 1Q0YL 2AXJA 2XYCA 2YPVH 3EOBB 3NIGF 5C09B 3JBG7 1PVHA 1HSBB 4JFOB 3VFMB 2ZSWB 3LQZB 2DF3A 3DBXB 3R0MA 5J1TC 1G1CA 2AJUL 4ZNEE 5SWQB 4R2GB 4LHUD 1CFBA 1HHHA 3T2QA 4CVZB 3P9MB 4MD5A 3SGKC 1F4YL 5FA4B 4NFBA 1OSPH 1S9YA 3OPZH 2OTWA 4M7ZB 5E4EC 3WN5A 5ESAB 2XN9B 3FJTA 1OPGL 3RWGA 3DX9A 1DE4A 4HFWA 1CE6A 1KLGA 3CXDH 1JRHH 4KJPD 1E4XH 3DX6A 3OHXB 4UB0L 4APQD 4LSRH 4Y5YB 4YE4H 1LNUA 2P42B 2VDKL 3ZHLA 5IW1A 5F7DB 5HBBA 2DQHL 2F74A 4G6JH 4G6FD 5F7WC 4TUOB 1C5CH 1R3HB 4PJ9B 2EH8L 4YPJA 5KN5B 3SPVA 4PJDF 3FB6A 4ODXB 5JUEH 3IDXH 4FQ1L 3DETD 5ID1A 2L4OA 3BGFB 3IYLW 4XP4H 1RQ5A 4PV9A 5BW7C 4O51B 1OD7A 2BNQA 4OF3A 5DRZA 5I1LB 3C6LC 4JGJA 1A6UL 4BH8B 4M1CC 1BQUA 3HPLA 4U1LB 3PWPA 4PG9B 1TJGH 4Z78B 4GKZA 1BJ1J 3B43A 4PJFA 2R69H 1EXUA 3VXSE 4NHCH 3NFNB 2BRRL 3QIBB 1EO8L 3SBWC 2B0SH 4V1DB 2FJHA 3IJHA 3RTQB 5DSCB 4P4KB 1RD6A 4P4RA 2Y6SD 5KAQG 3QXDB 5FFLA 1OP3K 2ID5A 4WHTB 2BX5A 5DHYB 2ICWJ 2YUZA 5B4MD 5DDHA 4YHZH 4YHLH 3MRGA 1GRWA 1V3KA 3NIFF 3EO0A 5I74B 4TSCH 5F8RC 3E1F1 4DK3A 2NX5A 1M7XA 4XT1C 3M8OL 3TPKA 2OZ4L 1NCWL 4K8RH 5DJCB 4LCUB 3ULVF 5F89A 4F7TB 1YEIH 3RY5A 4Y5XC 3UPRB 3JTTA 2ZCHH 2BOBB 3T09A 5CILH 3QEQD 3PUCA 4PJIF 2Y4SA 5SWZD 4W81A 1N8ZA 4D3CH 4OTXH 3HE6D 4JY4A 4JY5H 1RUPL 2NY0C 4FTVB 3O9WA 1T7WA 2DIAA 3IS0X 4KTDL 5DXWA 4QHNB 2BVYA 4FXGA 2I5YH 1NGQH 1GC1H 2VITB 2NZIA 3V6ZA 4DW2H 1S9XA 3GK8H 4QF1B 4Y1AD 1S7WA 2X10A 3EO1B 5I8CB 1W72L 1DFBH 4LNRB 3EJJX 4PV8A 5KSAA 4G8EA 3U2SA 3SGEI 1U8IA 4LASL 3GHEL 3QNXA 2DQUL 5EPMA 1R3JB 2ZCKL 4Z7WB 3G6JF 4U3XA 1DQLL 2CUIA 3D2UB 2UUDH 1JGEB 2R0ZL 4XVJL 5J0BA 2FZ3B 1FZOA 3LN4B 2D4DA 3DV4B 4QNPF 1IILE 1F58L 4WENB 1KFAH 3MGOB 1I3GL 4E9LA 2OXHA 4KXZI 5FHBH 4GAJH 1A9BB 3Q1SH 4PJIB 4QRPB 3K74B 2X9XA 4QHMA 4X6DE 1A6AA 2ICWI 2K7PA 1U8PA 1KN2L 5KZCB 4P23B 3RL2B 5T3ZH 4PLJC 1MCIA 3FO2B 1DBBH 2Q8AL 3PXHA 3FQNA 4JFQB 3RWEB 2P8LB 1WUNT 1P5VA 2ADFH 4M6OH 3MLYL 3VXNA 2OZ4A 2ATKB 3V8CA 2CLVA 3QCTH 4JLRA 4WRLA 4GT7A 3CIQA 3HNTH 1VDGA 3TCLB 3X11B 4HUUA 4MXWL 3JV6A 4NO0D 3HAEH 2EYTB 4XPAL 5CSGA 1PKOA 3G6JB 5E8PB 4PRPA 2RR3A 3WHE0 1P7QA 1GGIH 1RJCA 5EU7C 3RWIA 3RWFA 2VDQH 1LE5B 3BW9B 4GOSA 3P0YL 2NXZC 1H5BA 3QUZA 4XBEH 5DD1L 5EU6A 5A43C 1HWHB 2HKFH 5E8DL 5GGUB 1X44A 4F8QA 4KZDL 1AC0A 4HS3A 4UV4H 1SEBA 1W8OA 1NDMB 4EI5B 3EHBD 3PDDA 5FECB 2V7NB 3O11B 2CGRL 4RMQA 4U1HB 3WKNA 2R56L 5DVLA 2HH0L 4K9EH 4I2XB 3P77B 3I6GB 4PGBA 1IAMA 4S1QL 4X99A 5ESVA 4BELD 2R29L 2V17H 4DTGH 3HZVB 1TNNA 1HHIB 4J4PC 1DQML 2FGWH 2R2CA 3TN0D 2Q6WB 1VFBB 2N7BA 1YEFH 2EH7H 3F12A 1A8JH 1MFBL 2VJXA 3QWOB 3VXSD 1JGUL 4Z7QF 5K9OB 4LU5H 3DLQR 1X5KA 4OCWH 1EH9A 3QZWA 1KPUA 3IJYB 2BERA 2COQA 1T1ZA 2WV3A 5IHZB 1NBYA 4YFDB 4FA8A 5AZ2H 5IIEB 5IB2B 2Q76A 3O8XA 3K0WA 3ZDZF 1YN6B 4JZJA 4H5SA 2ICES 1INEL 1SMAA 1VB9A 3MA7A 1VACB 3X17A 4JPVH 3HFMH 1XF1A 4KK5D 4TNWK 4CU8A 1KEGH 3F7QA 3FQXB 4G8GE 4PJBE 5D1ZD 2ED7A 3V8OA 3P4OA 2NNAA 1WBYB 2W60B 4PJGF 5HDLA 1Q9WB 2BVPB 3L3KB 1FZMB 5D7LB 1VENA 3PP4H 4YDKH 2JTDA 3ZT5A 1MCDA 1XGQB 2FATH 5BS0D 3OZ9L 3N9GL 2ED9A 2Q87A 3O6KH 1BQLH 3CUPB 3V9FA 3VD9A 1KJ2B 4U6XA 4UTAL 3KR3L 1IGMH 2OJEA 3BQUA 3CSYB 1BZ9A 3S34H 1L9NA 2HJKA 5IF0B 2FBJL 3KYOB 5DRNA 1QEWA 4WO4C 1ADQA 3UO1H 5L8KB 4AT6B 5IFAH 1HSBA 2ZSWA 4YK4B 4ERSL 2LVCA 1T3FB 3GKWL 1MWAB 3ARDD 1E4KC 1TCRA 3KPQA 5K33A 4RZCB 5L2JA 2R1WB 4P9HH 1BFTA 3B5GA 1IQWH 1D6VL 3F62A 4PJGB 2C1OB 4FG6C 4LHJB 5GQBA 2PYEB 3LKNA 2Z93B 3JV5A 2Z31D 2OSLB 4XXCA 4LRIC 4X98B 3UPAA 3V2AR 2GUOB 4YWGL 5IG7B 4F7PA 4ZYKA 4I0PD 4Y5YA 1I4FA 2BDNH 4DN4L 4LDLB 4TSBH 3K2UL 4LPVA 2I25N 3VXME 1ZMYA 4OBRA 4HCRH 1OP5K 3QDJB 2B4CC 1R3HA 4PJ9A 1CE1H 2DBLH 3BZDA 4ZFGL 4YXKL 3O4LE 1HH6A 1ZEAL 3L5WB 1IM3B 1KB9J 4IOSD 1BD2B 5D1XB 4F33B 1WFNA 4QXGH 5IB4B 4JO2H 1RZFL 1ZVHA 4TULL 1LO5B 3RVVC 5T1DH 4UT9L 5IBTH 4YEFA 5I1LA 4LVHC 4X7TA 2DI8A 3ULVL 4CVUA 4U1LA 3C8HA 4Q2ZB 2HFTA 3IDMB 2V2WB 1LK3L 4Z78A 1HKFA 3EYVB 4KY1H 1XCTA 3NFNA 3TA3C 3Q6FA 3QIBA 4R3SB 1DL7H 1E4JA 4XC1H 3RTQA 5DSCA 4ZSOA 4P4KA 1J8HD 4UINL 4JO1L 3RVXD 1IFHL 4JM2C 3QXDA 3RL1B 4GLRH 2A73A 4JVUA 3C08L 3R1GH 4YUEL 3HI1A 4JAMA 4KVNL 1OHQA 1G7LA 3EOTL 2E6QA 1NEZA 1G0XA 2XZAL 2NR6C 5E94B 5L9DL 3MRMA 5DJCA 4LCUA 4F7TA 3RPIB 4G7YH 3KPSB 3UPRA 5B22A 5CP7B 1QLEH 3BO8A 3SE8H 3B9KC 2RGSA 4WWKC 4QOKE 3Q5TA 1TITA 1NCTA 4F7EA 5JNYA 3Q3GB 3FQWA 1T66D 1VSCA 2WM0A 1C16B 2DDQH 1JF5A 3WN5C 4J8RB 1UACL 1CFNB 3ARZA 5I8CA 4LNRA 4JRYB 3ULSB 1RUKL 4MXQC 5KG9B 5KVGL 1YC8A 2HRPL 4G8GD 3O3AB 1Z5LB 4ODWB 1BFOA 1YEEL 2QR0B 3FTGB 4Z7WA 4MJIA 3EJZC 3D2UA 3P30L 4JFHE 4U0QB 5DGQA 1ZGLM 4DQOL 1HYSD 1TZGL 2X7LB 5EU4B 3RA7H 5TF1H 1OB1A 3FFCB 3LN4A 5GS2D 1X5YA 4BFEA 4YJZL 5C0CB 4XHJC 3ARFC 5DMYA 1RFDL 2I24N 4LMQI 5SV3A 1A9BA 1QNZL 2QADD 2NZ9D 5SX4H 1DN2A 5I1GH 2CMRL 3FN0H 1L0XA 2I27N 4QRPA 3K2MC 1TZHB 1N59B 2I07A 3CVHB 1VGKA 4YQXL 3LZFH 3ZT6A 3RL2A 2MWCA 1S5HA 4YO0A 5C0RL 5CMAA 3SDXE 3TPUB 3WNMA 4AEIH 5EFIA 3VG9C 3TVMB 5I0ZA 2NY6B 4HKZB 4JFQA 3STZA 3FT2B 3MZGB 3NCEB 2P8LA 4UNTA 3IB4A 3SOBH 2ATKA 5JW4R 1LDSA 1M71B 2B1AL 1KJ2L 4G7VH 4PJBA 2CIKB 3TZVD 1JZ3A 3TCLA 3ECBB 1IC1A 2EIZB 3BKCH 2AK4B 4EZMA 2OR7A 3V0WH 5E8PA 1M7IB 4X4YB 2YK1H 4ZTOL 5AYQA 4KK9C 4YHNA 3IAGC 1LE5A 1JNJA 1UZ6F 4M48H 1CD1B 2NY1C 3BXNA 1ZE3C 5HHME 5JPMB 3VFPB 3VXMD 1MWAL 4EI5A 3O9WC 1RV6X 2VC2H 3CCHB 3RKDD 5FECA 3O11A 4XVUC 3KXFE 3O4LD 4U1HA 5J6GB 5B8CB 3DIFA 3P77A 4G5ZL 3WHE1 4OZFG 3QQ9C 4MNHB 5F1OB 4CN1A 1HHIA 1OAKL 1JGVH 2FX7H 1JZ5A 2FB4H 4O4YL 1K85A 3QUYB 1CDCA 1VFBA 1BGXL 4F15C 3IFLL 4YDIH 3Q48A 3QWOA 2AQ2A 5K9OA 1IZJA 1FGNL 4PB9L 3O3EA 4ZDHB 4ETQB 5D2NC 5DK3A 3DX8A 3UDWC 3NA4A 3M17B 4D8PA 2HMIC 1II4E 2EXWC 5CEXA 1MCWM 1A47A 3T2OA 4CBPA 4K7PH 5E2VH 3DMMD 4XPGL 1P4BL 4WY7L 3FQXA 4BFIB 5LWYL 2VQ1A 1H0DA 2RAMA 2PO6A 1PGRB 4LIQL 5F1SA 1WBYA 2W60A 4PJ7F 2F54B 4YX2H 4H20H 5I8OL 1CVSC 3LS4L 5HHXL 2BVPA 4M7JH 1FZMA 5D7LA 5HJ3B 1UCBL 4W70A 1N0XH 3QXAB 3G9VA 3D3VE 4NRXB 3MRRB 1T7VA 4WTZG 4GRWH 2ICEA 3DUSB 4CMMB 3QQ4A 1P1ZB 1AHWB 4QOKD 2DM3A 3CUPA 1MJUL 4JFZL 2WWKT 3RIAF 3JWNC 3V4VH 3LQAL 1T03L 4OLZH 3EDKA 5IKCA 3O0RL 3QO0B 4E41D 5HVHC 5ID0A 1OT2A 2IPTL 2LU3A 3KYOA 2FH6A 4ETYA 2FR4B 2D7TH 4HS8H 4M1CD 3X3FL 1ZA6A 1Y6MR 3FQTB 3RDTA 4K55A 3SHSA 4CJ1A 2H2PC 4XX1E 1RZIB 3HI6H 2WLZA 3JUZA 1CLZH 1IGFH 2G2RB 3B6SB 3W82A 1T3FA 4N0RA 1JZ6A 3BPCB 3T3ME 1MWAA 3D1MC 1XF2B 2BVOB 3ZKXC 1H5BC 3IDGB 3QUZC 4LPWA 4GKSA 2G9HB 1EV2E 4MQXD 1VGEH 2R1WA 2G60H 2O5YL 2X89D 4JFHD 5GRXG 5DRWA 4LLQA 1OW0A 2BRQA 4KQ4H 4ZUWB 3T65B 2FRGP 2WBKA 4O5LL 4G80B 4X9FA 4HBQA 5DTFB 1DP0A 5CLTA 1U8MA 4X98A 5CHNB 1WC7A 3KJ6L 4G3YL 3JSSA 5DJYA 3SO3C 3HMWH 1PBYA 3W9EB 3X14B 3O6ML 3MBXH 3PWVB 4BFBD 4IRJC 1F3JB 3ZDXF 1OM3L 2AI0L 1WZKA 1ZXQA 3VFSB 2QV2A 3JWDH 4GMSL 5HGGS 4H25B 1Z6JT 3L5WA 4TUJA 1HOCB 3DVIA 3FFDB 1IM3A 4F33A 1PSKH 3W5NA 3VI4E 4DKEL 2NY0D 3U9PH 3O8XC 3RWCA 1YMMB 4PP2B 4JZJC 4EKXA 4J6RH 2D3VA 1IKFH 5GHWH 4Q2ZA 3IDMA 5TQ2L 3IU3A 2VZTA 1JPSL 5ERWB 3EYVA 3T1FB 5IP4A 3WBDA 5C7XL 3KPOA 4TTDC 2E3VA 4NJAL 2VXVH 1A21A 3CVHL 4OFYD 1MUJB 3S6CA 3G5YB 4X6CE 4KJYB 2X1QA 3ARQA 4JO3L 5HHMD 3NIDE 2OBGA 2J4WH 4LBEB 2IANE 4KUZH 3WKMH 1MIML 43C9A 1A7BA 3TYFA 5CKAA 2M2DA 4Z7VE 5JOFB 2DKUA 3KXFD 4NP4L 3QPXH 1HN1A 1H9VA 3KAAA 4HUVA 4YH6A 4XP1L 5FUZH 5HHNA 3RPIA 4HWEL 3L7EB 4KRLB 4MS8C 3P0GB 1B2WL 5CP7A 5T1LD 2EKSA 3UTSB 4P5MB 5AYUL 4URTB 4R2GC 3QJHB 5GGVL 2YRLA 3GSXB 2EDHA 4MA7H 3P11L 4PJHF 1BVKA 5DVOA 1NC2A 2Z92B 5JXAL 1I9RL 3G6AA 1I7ZA 4M7ZC 4PLJD 2QQKH 4NQEA 2V7HB 3KS0J 4J8RA 2X1OA 5EU5A 2HFFA 4XVSL 4Q0XL 1MEXL 2XPGB 3MRNA 4UOW0 4XXCC 4K07A 1OGAE 5HVGB 3GSWB 4NWTH 3O3AA 1K2DA 1Q72H 1Z5LA 4GKNB 2Q7YB 3TYGH 1RUAH 5I19L 1BBJB 1WSST 4P2RB 4XGZA 2QR0A 1BM3H 2DQTL 5CIPH 1A3LL 1JHTB 4PJ9C 4H0HB 1EJOL 3O3DB 1XZ0B 3D3VD 3FFCA 4XNXH 5GSRA 2BSTA 5DO2C 5AWNH 1YNLL 3RVTD 1D5MB 3H9SE 1P6FA 5C6TL 5E5MB 3BGFC 43CAB 1QLRB 5C0CA 3B9DA 1HXYA 2YZ1A 1EHAA 4Y5VC 5BRZA 2O26U 1JV5A 1TZHA 1N59A 4WI8A 3H9HB 4Y4KB 3RIFK 5I6XB 3CVHA 1CK0L 4PJHB 3IAPA 1UCTA 1DN0A 3QIBC 3WXVH 3QHFL 3RNKA 5I1KL 1AO7E 1YY8B 3RTQC 3K4AA 4P4KC 3TPUA 4ODUB 3BFOA 5HHVH 1WTLA 2PETA 4HKZA 3FT2A 3NBNA 3LEVH 4U1KB 4PREB 1M71A 1XMWA 4TQEH 3MV8B 5I74C 3NCYS 1QSFE 2CIKA 3QRFM 3C2AL 3ECBA 2EIZA 4LSQH 5EORL 4FQXA 1M7IA 2NY3B 4EUPH 1OCWL 4GBXA 4X4YA 1YEGH 4QLRA 1JWUB 2C3VB 4PRIB 3VGEA 2VO5A 1GGBH 3W9DA 3VFPA 2CJUH 5IK3B 4A2MA 2VZSA 4MB3A 5E8NB 2A6KB 1UEYA 4EDXB 3OB0H 4PJCF 3UC0L 3WSQL 2VL5A 3WJJA 4L9DA 3GMLB 4XP6L 1EHLH 5GRYA 3KLHC 4R0LB 1F11A 1GOGA 3MLTB 1NCBL 3QUYA 5AZEL 3C60D 4M61A 2IBBA 4KK8C 6FABH 1DDHB 4WO4D 3OAUH 1LDPL 1UYWL 1MRDL 4JJHA 3U7WH 4ETQA 4DFIA 3P9WB 4OT1L 3JTSA 1BZQK 4ZUVA 4S1DC 1FYHB 4QWWC 1RK1B 2ERJB 5FYKL 5I75B 4QT5B 4OLXH 3W2DH 4WUUB 3FRUA 3ULVC 3MACH 2AEWA 2IAND 2CDGB 4BZ1L 4H1LG 1ZANL 1ES0B 1R5VB 3DYOA 2QQNL 4E0RB 3OGOE 4BFIA 3U0TB 5KANG 2FD6H 3GRWA 3CMOH 1M7DB 3IDJA 2NTFA 3OKOB 2JB6B 1U3JA 4XPFH 2QHRH 4HT1H 1NFDF 2V2XB 1UFUA 4P23C 2IH1B 3QXAA 1IC5H 2CKNA 1AQDB 5HHPB 4CMMA 3SDCB 5IOPB 1AHWA 5TDOA 4UDTB 4L29B 5FKPB 5HGAB 3PGDB 4GW4B 3MLSL 4OZHF 4MQSB 3LDBB 1JZ8A 1EZVY 3QO0A 3HC0B 2IALA 2CLZB 4AEEA 5CJXA 1FNEB 3MRLB 1LO0L 2E7CA 3BDYH 3GSQA 1J05A 4O9HL 3IDIA 1H3UA 4OGZA 5MERB 1J11A 3LKRB 1A22B 3FQTA 1OGAD 1SBSL 2G2RA 1INDH 1IAOB 4X6CA 2DQEH 1QFWH 4HJJH 2FX8L 1RZKC 4K3JH 5F7HA 1J8KA 3IDGA 1A7NH 2A6JB 4OD3L 1CVRA 2G9HA 1F90L 2BJMH 3MXWL 4LARL 3BPLB 5FB8B 2VQTA 1U9KA 1MJ7L 4UIKL 4EI5C 4XNMB 2E27L 3BGMA 2VB5A 3ALPA 4JM2D 3WE6A 3T65A 4OIIL 1Q8MA 5KSBB 5DHVB 3BP6A 1YYLL 3H9SD 3D39E 4G80A 3SDAD 3KPRE 5DTFA 1MCKA 5DURD 4OV5B 5CHNA 1NFDB 2HT2D 3NZHH 3GBML 4QKXB 5D7JA 2EEAA 3MV7E 3T4AB 3W9EA 5E0QA 3X14A 4DCQA 1FBIH 1HSAB 1N5AA 3NZ8B 3SKOB 1F3JA 4NGHH 2DWDB 2FEEI 1A1MB 4ORGA 3S5LB 5C0BE 4OZHB 1AO7D 2YD8A 4H25A 3B9KD 2RCSH 2NLJB 4NNPH 3ZE0E 4MNGE 3PWLA 3WLWC 4WWKD 5CCKL 4HJ0D 2AQ1A 4GQPH 4HGWB 4TVPD 1ACYH 4NZTH 3PJSA 5A40E 4XCYA 1KYOK 1Q9LB 1SYSB 4I0KA 1I75A 2DQFB 4R90L 4DVRL 4KRPB 4ZO7A 1FH5L 2E9JA 1FAIH 3IRPX 3Q5YA 4ISVA 5L7XL 1R0AH 3L9RB 4U33A 5DUMH 4LCIL 5GJTL 4HMEA 1FVDB 4MJ2A 4WJ5B 3O6LL 4LSUL 3ZE2E 4MXQD 4ODSH 2BZDA 2Z91A 1MUJA 4YHOL 3BP5B 3QUXA 4KJYA 3BE1H 5E9DB 1JPGB 3JV4B 3KYNB 1CFVL 2CK0L 4LBEA 1B0WA 3EJZD 3MNZA 4HWZA 3CLFH 1FFOA 4M6AA 3VD7A 1R24B 4HC1A 3MUY1 3TIEB 3WMSA 1NCDH 2P5EE 5MHSE 1JN6A 1C12B 5ANMB 4XHJD 5LVEA 4KROC 3ARFD 3L7EA 2H45A 1NGXA 4LCWE 1CQYA 4XPHH 2A2QT 2I9LB 2VLJD 4X9GA 1AXTH 1QVOB 25C8H 4U6YB 4YK4C 5BJTB 3B9VA 4P5MA 4FP8H 4FABL 2YPLB 4JN1H 3QJHA 3GSXA 4OZIA 3SE9H 1T6VN 2NY7H 3KNBB 4NO5B 2FJGA 4L3CB 3VWJA 4Y16B 5E08H 4HWUA 2D03L 1QSFA 1RIUL 5D70L 2V7HA 1KB5B 5D2LA 4LSSH 3UYOD 4M3KB 5JW4M 1NLBH 1MRCH 1NCAL 4XMLL 4OZGE 4CL7A 1CU4L 3S35L 5LGJB 2ARJQ 2CQVA 4Z0BL 4C4KO 4MLSA 3O6FA 2DQJL 5EO9A 3KHQA 1WEJH 3F6LA 4ZOCA 1JHTA 1JNLL 1UWEH 4KK9D 1U3ZA 4ZS6C 3O3DA 2DQIL 1XZ0A 3EOYG 3QXVA 2NY1D 1FVCB 1JPST 5D1XC 1D5MA 3ROLB 1QBMH 2JCCF 4HKXB 5ILTL 5E5MA 4QHKJ 3EGSA 2VIRB 4RMWA 1XGTB 1SEQH 2LV4A 2V5TA 4EXPX 3PWUA 3WL9B 3GMOA 3MRFB 3KGRA 2D31B 3DRQB 3T0XA 3IVKB 1ZHNB 3QQ9D 5E2TL 5EOTB 3LOWA 3H9HA 5MENB 5LCVH 4WUKL 5C09E 4PJHA 3QNYB 1Z0MA 4N9GA 5IVXB 4U6TA 1T89A 1YY8A 5SWSB 4KFZC 1A3QA 4OI7A 3RZCB 1O0VA 3U1SL 5KS9A 2GY7B 2UY6A 1M6OA 4QEGA 4YLQT 3LQAC 3HRZA 3F5WA 2GJ6E 5JW3H 1H3PH 4PREA 4TPRH 4RFOL 4K3HA 2HMID 2EXWD 4ZO6A 2A77L 2AW2A 2XN9E 3U46A 4WVRA 4JVWA 5TFSL 3V7AE 3D39D 3EFFB 4NZRH 1G1YA 3KPRD 3DYPA 1MLBB 5TE7H 4KDTC 1JWUA 3GJFH 4PRIA 3MV7D 3QRGL 5KVDL 1T7ZA 4LRNL 2AVGA 4AEFA 2FJFB 5KANI 4OKVB 5BOZG 1KXQE 2D0GA 4PRDA 4LK4A 2GK0B 5C0BD 4EDXA 1A6PA 1BX2A 2C26A 2NW2A 5JHLH 5GRVK 1C08B 5LJYH 3NIGE 4OKDA 1QFWM 2PF6A 5CEYB 1I1RA 2VERN 3DHJA 2ITDA 5FO8A 2MHAA 1I8MB 4U7SA 1A14L 2OYPA 1DQTA 3U7YH 3STLA 3ZE1F 2Z9TA 2ZG3A 4EXKA 4TOYH 5L8LB 3WFDL 1KELL 3FQRB 3T77B 4QHKI 4PRAA 4JVPA 3LPFA 1MAML 5ADPH 4JZOB 2UZIL 3AY4C 4E5XB 2WLYA 2XKSA 4ZD3H 5IB5B 4YR6B 1IGYB 2GYSA 1RK1A 2XQYK 1MHHB 2VLRB 3T0EB 3I85A 4K94L 1BQHG 4WUUA 4XCEA 2F5AH 1YEHL 5IVZA 1R5VA 1ZT7A 1IAII 4F8TA 2F8OA 4AL8L 1AD0A 2W9LA 4OGYL 5C86A 2GTZB 3U0TA 2IFFL 2P5ED 5MHSD 1QFPA 5GGRB 3O4OB 4LGSB 4MJ6A 3OKOA 4LCWD 4PJDE 5C0AD 5FA3A 2FGZA 15C8H 1AQDA 5GGSA 4MNGA 4PJEF 5HHPA 3SDCA 4FTVE 3EOAB 2X40A 4KHXH 4IRJD 4POUB 3TVMC 3OKMA 2NY6C 1U8NA 2P5WE 5FKPA 4GW4A 4QO1A 1BQHB 4LSDA 3DPBA 2W07A 3FZUD 4L4VA 2CLZA 4Q97A 5CBAB 1S9WA 4Q9QH 2R1XB 5MERA 3LKRA 1A1OA 3WIIL 5HI5C 3MNWA 1AGDB 1IAOA 4JR9L 5EC2A 1FN4B 3ILPB 5GJSH 1U3YA 5GSVB 3IGAB 5MEPB 2OQJA 4AMKH 5FB8A 5HYQB 3LRSA 4PPTA 3NIFE 4XPTL 4PGEB 4M4PA 4XNMA 2XNAA 2XZCL 3ZSTA 4FXKA 1CGWA 3NACH 4RRPG 4WW1A 5B8CC 5KSBA 5DHVA 5E56A 3HNSH 1FL6B 3IDYB 4YDVB 3ULVE 2EIBA 5CJ8A 1HYRC 4U1JB 4OV5A 1KB5L 2XWTB 3FO0H 4PJIE 4F80A 3H6JA 3QUYC 4CGTA 4PJEB 1VADB 3L3GA 4BKLB 3ISWA 1HSAA 1Z9OA 3NZ8A 3SKOA 5C09D 2IGFL 2Y23A 4TNVF 3HC3H 5D7IF 5BVJA 2AABL 4LEXL 5DC0A 4RWYL 4IOIA 1Z2KA 3CGTA 3HPJA 3TGXA 3UJJH 2CLRB 2Y72A 5EBGA 4KKBC 2ICWA 4RA0C 3AS0A 4XNUL 3DUHA 1K6QH 2YA1A 1MCOH 5D6CB 4Y88A 2GJ6D 1Q9LA 1SYSA 3RHWK 5I16B 2DQFA 1BOGA 4FMFA 3P4NB 1B0GA 3UROR 5E8EA 3QR2A 2XN9D 3FT3A 3FRPA 2FNBA 3MLPA 2VDRH 1BZ7A 1JTTA 1WIOA 4KKCC 1BAFH 5F9OH 3V4PH 1EAPA 4QNPE 3GGWB 1JPGA 4M5YH 1KT2B 3BKJL 3KYNA 3ZTNH 3BEVA 3UJIL 2D9QB 3PV6B 1AHWC 1WAAF 2B2XH 3P9LA 4F3FA 2IWGA 1BEYL 5IGXL 5DO2D 1LO2L 1H3WM 3HAEG 1PG7L 1DBMH 3CH1B 5I1IL 2SEBB 4IMKA 5CJXC 1C12A 3QIWB 3VFTA 2EO9A 2FECL 2HWZH 3L1OH 1F6LL 5D7IB 2FYYA 5FDWB 1RU9H 1R5IB 1DQDH 4FQJL 1IGIH 4MNQB 1A02N 4OLYH 4U6YA 3C8KB 1GOFA 5BJTA 4C56E 1P2CB 1GZQA 3VXQB 3WFEL 1GSMA 4V1DD 3UTZB 2UWEF 2LABA 4G9DB 1CR9H 4L3CA 1YZZA 4Y16A 5CGYD 1P6AB 3TNMB 2V5RA 4XAKE 3BD3A 1X5AA 4C57C 1OTTD 4WCYL 1TNMA 2YPVL 5LGJA 1OGTA 1XGRB 5SX5H 4MA3A 2VWEC 5JHDB 3CSPA 5EZOH 4KGLA 1F00I 1C5DB 3OF6A 4NDMB 4H26B 1FNHA 2HLAA 3CMGA 1OSPL 3C09B 1T0PB 3OPZL 1CIDA 4UUJA 4FTVD 3V0VB 2UVEA 4QY8B 3V7MA 2P5WD 1CFQA 3QI9B 3LHPH 3WL9A 2AQ3A 3VD3A 3MRFA 5I71B 5DUBB 3CXDL 1JRHL 3DRQA 1E4XL 1ZHNA 5EOTA 1YN7B 2HJLB 4LSRL 3FHQA 2JELH 3LV3B 4YE4L 1FIEA 3QNYA 5HPMB 2VRAA 5IVXA 2UWEB 1E4XI 2QHLA 1T7YA 4G6JL 4ZXBD 1C5CL 4KK8D 5EBLB 3ZDZE 1IGJB 2WUBH 5HHOB 5JUEL 3CXHK 5E95B 3IDXL 2BK8A 4PGZA 1NKRA 1MCBA 4XP4L 4JANA 4X5WA 4S1DD 4QWWD 4X80H 4NKOA 4OD2B 3K8MA 4QRRA 1IJ9A 3OKEA 3LH2H 4PJGE 3ULVD 4FQHB 1JI2A 1IC7H 1TJGL 1ZT1B 3GSNA 3E6FB 2R69L 3A6CH 1F2XK 4NHCL 1RURH 2B0SL 1U42A 1ADQH 1NGWA 3QFJE 3D85A 1N6UA 5DJXB 3SQBA 4Z77B 5IVOA 3QDJE 4OKVA 5A16B 4P23D 1RJZA 4M43H 4N0UB 3QDGE 3U4AA 1AH1A 4YHZL 3FB5B 1BD2E 3EW3B 4PRHB 4GKOA 4YHLL 3DSFH 4TSCL 4DZ8B 2CPCA 3MREB 4ZODA 1LP9E 3BT2H 1D5IH 4I3RH 3MR9A 4K8RL 1N7MH 1YEIL 2O5ZH 2ZCHL 5CILL 3OG4B 3T77A 5FXCH 3SDDB 5IQ7H 4P46D 3TF7C 4D3CL 4U4BA 3REWB 4X4MA 3D0VB 1LWRA 4EDWH 4JY5L 3V0AC 5IB5A 1UADC 1MHHA 2I5YL 3T0EA 1NGQL 1GC1L 1NMBH 3SEPA 4DW2L 2EE6A 4U3CA 4PRBB 3BI9X 1KV3A 3D25A 2AJSH 5C9JB 3W0WB 1DFBL 2XWBA 4D2NA 1D5ZB 2WBJB 3VRLF 1G7MA 1JVKA 4ONHB 5ALCH 2F19H 4N90E 5GGRA 4JFXB 4Y4KC 3S4SG 4NCC1 3KPSE 5I6XC 4F2MA 2L0DA 4JFEA 4N0CC 2UYLA 1OAYH 1T89C 2PW2A 2Z4QB 4KI5F 3U4BH 1DUYB 1TVHB 4C56D 1P4LA 4OCLC 3RGVD 4KTEH 3ZDYF 2W9EL 4MA8H 4R6UA 2Y36H 1KFAL 2R23A 2LAAA 3V6OA 4WDIB 4NQSA 1ZLVK 3WLWD 5FHBL 4GAJL 3Q1SL 1FO0A 5D1QB 3E6HB 3T3PF 1RHHB 2R1XA 4XAKD 3GSRB 3MC0A 2BXZA 1DBJH 1KCRH 3MJ6A 2J3SA 4G9FB 2YSSA 1KENH 2X4QB 2NY3C 1AGDA 2OM5A 2HVKB 3G04B 1UB5B 1EEZB 2APWA 4KMTH 5GGVY 2MNUA 2DJUA 2H6PB 3VMPA 5GSVA 3IGAA 5T3ZL 5MEPA 3T4YB 1OTUC 1UKSA 1DBBL 4XNYH 4PGEA 2K3TA 1VESA 5CP3A 3AMKA 4S1RH 1LK2B 2ADFL 4M6OL 8FABA 3QCTL 4YNYB 4YDVA 4OF6A 5JO5B 3VFRA 4RAHA 3HNTL 1JBJA 3L3IB 4U1JA 4WHDA 4R0LC 1SJEB 4PS4H 4JKWA 1GGIL 4M6NH 1Q94A 2VDQL 1W0WB 3DUUB 2KKQA 4BKLA 1U8KB 5ALBH 4F7CB 3PWNB 1QPPA 4KROD 1FDLH 4XBEL 2B39A 2VLKE 1KIQA 3ARBD 3QPQC 4YGVB 2HKFL 4UV4L 4UDUA 2CLRA 1I3RB 4NQDA 2ERJC 1H8NA 4OB5H 3RGHA 5I75C 1N26A 3NFSH 5BVPH 4K9EL 1BIIB 1IKNC 5D6CA 4R7NB 3GMNB 3QEGH 2V17L 4DTGL 4F9LA 1HNFA 4ZUTA 3NTCH 1TJIH 5AEAA 5I1EH 3AGVA 2FGWL 2AK4E 7FABH 5CAYB 1QTYT 2PYED 5D5MF 1YEFL 2EH7L 5KSVB 1XIWA 3SN6N 2HA1A 4LU5L 4OCWL 5HDOA 4XTRC 1U0QA 1Z9MA 3LMJH 4LP5A 4P3CL 4GW1B 1KT2A 3QFJD 4LQFH 1Z0NA 3SDCC 5AZ2L 3PV6A 3QDJD 2W9DH 1Y6KR 5ITBH 5FYJE 2VSCA 1YQ2A 3SCMA 3WIHH 5KVEH 1J1OH 2YRPA 1JMZA 4KRMB 1LE9A 3MTRA 2FSEB 3LDBC 3HFML 4JPVL 5D1XD 1BD2D 1QO3B 5IV2B 3HS0A 2SEBA 1KEGL 1KNOB 3QIWA 3V5DB 1JNNH 1IT9H 1U3HD 3QEUB 5D7IA 3QDMA 1J1XH 1R5IA 5FDWA 3FCTB 3RI5K 32C2B 3IFPB 5F93C 3A6BH 5DD0H 2VR5A 4BYHA 3OXSB 3VXQA 2B20A 2LAGB 3PP4L 4YDKL 3OR6A 4N1EA 1WFTA 2FATL 1MHEB 3C9NA 5FGCB 4XI5D 3BPLC 1N64H 1MF2H 3O6KL 1BQLL 1RZKH 1U93B 1MFEH 3Q6GH 3IKKA 2F9BT 2HFEB 2ED8A 1IGML 5ISZB 3NCYP 1MAKA 3PHQB 4JZNB 3S34L 1JPFB 3NFPA 3P73B 3UO1L 5EN2A 2YWZA 1UZ6E 4N0YH 3WJLA 3H2WA 5IFAL 1NPUA 2FHFA 2PXYD 4UU9B 3QDAA 4N90D 4YHPA 4KHTH 2F54E 3KPSD 3MA9H 2J8UA 1E6JH 3KYMB 2DS4A 4IJ3C 1RI8A 4JFFA 3QDGA 4MDJB 1RZGB 3DXAB 1I9JH 4P9HL 3I2CH 5DJ8B 5IJVB 1IQWL 2OMBA 4GRWF 5D96B 4OQTA 1IEAA 4QY8A 1LP9A 5DK2B 1HXMB 2YMXL 1AR1D 3PIQA 4LPXA 5F21B 4U1IA 4EIZC 3TBVB 3MRKB 4KRPC 1FSKB 2HJLA 5DWUH 5JXEA 3LV3A 1F97A 1EMTH 5EO1A 2BDNL 1FG2A 3OV6A 2DLFH 4BSWA 1KN4H 4JRYD 4TSBL 4YHIB 5HPMA 1PD6A 4HCRL 3LS5H 1JZ7A 4DGVH 4PLKC 1CE1L 2DBLL 2APXA 3MLRH 5HHOA 2ZG1A 3MRJA 4NM8H 4CDHA 2F8VA 3QO1B 4JO2L 4XWOC 5T1DL 1H8SA 2UV3A 5IBTL 1L4IA 1X4YA 1CXEA 4PJ7E 4BSJA 4IMKC 12E8H 1ZT1A 1UG9A 3I75A 3E6FA 1DLHB 2EEDA 4KY1L 5L0QB 4B5EA 1A64A 3GMRB 1YY9C 1DL7L 5F6IB 3MRCA 1TJHH 4XC1L 2K7QA 4HXBH 4GRWB 3O2DA 4HIJB 4U6HA 4W6WB 3NA9H 1CFSB 2VLKD 4UQ3A 2QLVB 3L95B 5EOCH 4N0UA 2BSSA 3R1GL 2AJ3B 3QAZB 4X6BB 4EN3A 3OKDB 4Y16C 5C0NC 4HUWB 3TVMD 2NY6D 3T0DA 1YMME 2FX9H 5MEOB 1DR9A 1DQQB 2MKWA 1OAQH 4OF8A 3L7FA 4NFCA 2ARWA 2NYYC 2P46B 4DUXA 4LEOB 5J1AB 4G7YL 5FYKU 5F7MC 1RUQH 3QXTA 1EX0A 2AK4D 4NKMA 1QLEL 4OFVA 3SE8L 3REWA 3ARGB 4JQVA 4MAYB 5H2BB 5EZJB 4QRUA 1FZJA 5DJ6B 2MKLC 2AEPH 1DZBA 5HGHB 5HTSA 5INCB 5H94B 3MLUH 3QB7C 2E8ZA 2FHBA 5EBWB 2VE6B 2DDQL 2DYPA 2Y06H 3C87A 4PRBA 4Y2DB 5AAMA 5C9JA 5FYJD 1KIPB 3W0WA 3D69A 4HAFA 3R8BB 4HG4K 3ZDXE 1HH9A 3B8SA 2DAVA 1YMHB 4UT6H 4LKCB 1LVEA 3UAJC 2VYRE 3SJVE 2Z4QA 3VWKD 5B21A 1DUYA 2DQGH 3RZCC 1I3UA 3RA7L 4R96A 5TF1L 4PY8J 3WD5H 1CG9B 3EIFA 3PXJA 3MBEA 1XH3A 3HNVH 1EEYA 3DARA 3N06B 5BXFB 4NBXB 4WFGE 5I1GL 5D1QA 4A6YH 3FN0L 5IHUH 2MPAH 5E6YA 4L4TB 5FGSA 1RHHA 3GSRA 3MV11 1GPOH 1R3LB 4G9FA 5T1KA 2X4QA 2OP4H 4MQ7A 3WNPA 3RWJB 3LZFL 5SX4I 2HVKA 3CDGA 1EEZA 4XCFH 2H6PA 1ZHKB 2Y5TB 4P2RE 2JJSA 2F54D 4AEIL 4KV5F 2X4NB 1CWVA 3T4YA 1GH7A 2R2BB 1LK2A 2P43B 3MV9B 3OKYA 3SOBL 4L3EB 4J3TA 2VKWA 4Q9BA 4G7VL 4AG4H 1HHGA 2HVJB 3L3IA 4NM4H 1EVUA 3BKCL 5DA4A 4NQCB 3HMXA 3V0WL 4PTUB 4CU6A 1W0WA 1JK8B 1QKZH 2YK1L 1YJDH 5HGBA 2IC2A 4HIXH 3PWNA 1FNAA 3QEHB 4BH7B 4M48L 4QXUH 4YGVA 5FAAA 3NOIA 1RAMA 2VC2L 4F9PA 1EFXA 1NBQA 2QL1A 4JFPA 3FT4A 3T0EC 4J3OC 2HTKC 1IE5A 4NN7B 1BLNB 3JV0A 3TCXA 1JGVL 3G6DH 3CFCH 2FX7L 3OJ2C 2FB4L 1WWCA 2JK5B 3O4OC 3C5SB 3PHOB 5DR5H 4AZ8A 5KSUA 4YDIL 4IMLB 5CIPB 2PW1B 1D9KA 1SY6A 2AV7B 1AD9B 3UTOA 2IPKA 1XR9B 4RMVA 1QBAA 1K4DB 4GW1A 1T1WB 1KSRA 1KYOJ 2D7OA 3LN5A 5J56B 5GZOC 4CVXB 1RZ7H 2DLIA 4NBZB 2BY2A 4XP9H 5FYKD 4K7PL 1YUHB 2YUXA 3RY6A 2FSEA 5E2VL 4J7RA 1XGUB 1KNOA 4EUPG 5HY9B 3GHBH 1YMMD 2DM2A 1JE6A 3V5DA 3MFFB 4YPGA 3EYFB 3QEUA 1JGDB 4LL9A 4FQIH 3FCTA 4YX2L 4H20L 1X5LA 4LHQB 32C2A 4M7JL 1CDUA 4HH8A 1N0XL 2XQYG 2LFGA 1CD0A 4JKKA 4WTZA 1QRNE 3QWQB 5C0IB 1CLOH 5FK9A 1U93A 3OL2A 4XXDB 2HFEA 4OCRH 3V4VL 4WIQA 4OLZL 3DECA 4K8RC 5F71A 3QHZH 3IDYC 2P24B 3F7YA 5J11B 4PYHA 1J0KA 5HYSG 2D7TL 4HS8L 4NNXB 4X8JB 4UU9A 5L2KE 3IKCA 2BOCB 4HIIB 5HHQB 4X9BA 2EIEA 5EH1A 3HI6L 1CLZL 3LRGA 4BK5A 1IGFL 1MVUB 3P4MA 2EYSB 1WITA 5BQ7A 1VKXB 5IQ9A 4GUPA 4PJCE 1A5FH 1VGEL 4MDJA 3SJVD 4NZUH 2G60L 3DXAA 3OJVC 3UTSD 1GC1C 5DJ8A 1KTKE 1S7XA 3U30B 4KQ4L 3MRHA 1YPZB 1MHCB 4R97B 2PNDA 4F9LC 4WFGD 2VL4A 3MRKA 3MROB 4JFYA 4Q6IB 3VFVB 4C83B 3KLSA 1U91B 1T83C 1P4IH 1WIPA 4HWBA 2QKIA 1ETZB 1CL7I 2WIMA 2CKBA 3TO2B 3ILQC 1S7UB 3HMWL 3MQIA 4R7DB 3MBXL 4JQXA 2ESVB 4N9OB 3DVGA 3GRWH 1D7FA 1PKQE 5A3ID 2DICA 4Z7UF 3JWDL 3MO1A 3S36H 1G7PB 4P2RD 1HKLH 4GRLB 1FFPB 1UZ8B 1PSKL 1I8LC 3QO1A 3M1BB 3U9PL 4KUCF 4O2FB 2X4PB 3I3BA 4J6RL 4YBHA 3AUVA 1L0YA 3IDNB 4PJXF 4LKXB 1IKFL 5GHWL 1QFHA 4RMSA 1WWBX 3GBLA 1F6AB 3QIWC 5DMKB 1DLHA 1VEMA 2EECA 3PQYE 3E3QE 4HIHB 4MD0A 1EBPA 5T1MB 4PJ5E 4X9IA 2VXVL 1N0LA 2ORBH 2ZUYA 4Y4KD 5TGBB 2XKNA 4GFTB 4YHKH 1GGYA 5DVMA 2C3XA 5LBSH 4OZHE 5CLWA 3L95A 4N0CD 2J4WL 4UQ2B 4KUZL 3WKML 1W8NA 4DFHA 3U9UB 3OKDA 4Y8DC 5ETUB 5I9QB 4QYOA 1HILA 5ITFB 5MEOA 3MJ8B 1DQQA 3QPXL 5B38G 2F53B 3CU1A 5FUZL 2Q86A 3WLBB 4LEOA 4OV6F 5DK0B 5T5NF 3MV8D 4FHBD 5CD3B 2WP3T 1X6NA 4P2CG 4ENEC 1U95B 4UV7H 1D3CA 3EYSH 4PJAF 3MODH 2NTSP 1ZHBB 3ARGA 5JW4N 4PIRF 2NY3D 1J1PH 4QHLA 3RFZC 1LEGB 4CAGA 4MA7L 4ZPTA 2WP3O 5DJ6A 2ILLA 1TQBB 2GT9B 5E9DE 2FDBP 4F7MA 4WTWA 5HYFA 4K9EC 5INCA 4DOHB 3C09C 2HT3C 3LKPA 2VE6A 2QQKL 5T5NG 1OTUD 4Y2DA 4NO2B 2EDNA 3QI9C 1UB6B 5I71C 3AS1A 5C1MB 5JMOC 4LOUC 2IBZY 2A83A 4W4NA 5ANME 4G6AC 4NWTL 3GDBA 5JIPA 1Q72L 3TYGL 1QUNA 1RUAL 1YMHA 4LKCA 1BM3L 5HYJB 3CX2A 5B3JF 2YD7A 5I1DA 2W92A 1MY5A 2YPLE 4PD4K 5FM4A 1KF9B 3ZTJG 4XNXL 1CG9A 2A6IA 5AWNL 3QPQD 1QRND 3H42H 1FZKA 3ZT7A 2OL3B 1RHFA 5BXFA 2OS7A 3NN8A 3DURB 3KLAB 4RGNB 1UVQA 5LKNA 4PJAB 3NAAH 1OL0A 4TSAH 4JCLA 1R3LA 1QSEE 1BVZA 4HC1H 1YEKH 4EBQH 4LLUA 3WXVL 3LPWA 1J0JA 5L2KD 4U31A 3MYZA 2Y5TA 3VXUA 2W65A 2GKIA 5FYLH 5HHVL 2VZVA 3AC0A 1T21A 1M05A 3W39A 5CEZH 2R2BA 3TH4T 3LEVL 1NC4B 1KTDA 4MA1B 3CFJB 5DD3H 4TQEL 5FDYA 3V79C 3CH8A 5CJOH 4JDZB 4HZLB 4X7EC 2ENSA 4LSQL 2L7UA 3K81A 2ZSVA 3EYUH 5DI8B 4BQ6A 4PTUA 5MENE 1YEGL 3S3SA 1AGFB 1WT5C 5IJKA 1S7QB 3SDDC 1LD9A 5EOQH 5F3HA 3CDCA 1GGBL 5E6IB 1LO4H 5IVNA 1HCFX 2CJUL 5SWSE 2X41A 4IRSB 1JTPA 3TFKD 4HUNB 4EQ2A 2D0FA 3QWRD 5A1AA 1NCCH 1YNKH 1DEEA 2KH2B 4G42A 3ESVF 3SY0B 3BYTA 2AV1B 2BCKB 2DD8H 1BLNA 2QJDA 2ZPKH 4NCDA 1EHLL 3A0OA 2AEIT 2WBJC 1I1AD 2EC9U 1LEIB 3OX8B 4JGMA 4XZUB 5GGRY 4FN0A 2JK5A 4J3XA 4Y19B 5D71H 3C5SA 4O58H 3PHOA 4KRNA 6FABL 1SVCP 1N2RB 2PW1A 3PQYD 1WZLA 2AV7A 2XICA 3BZFA 3OAUL 2VDLH 1NGPL 3U7WL 1HHJA 1XR9A 4WFEE 3S96B 2JCCE 2XZZA 3QDHA 4BQCA 1FC1A 1NAKH 4CVXA 2AJYH 4L4JA 4NHUB 4BSVB 4RX4D 4GXVH 1BPVA 4OLXL 3W2DL 3MACL 3QULA 5F7UA 3ZKNC 3INUH 3T0WA 5DC9B 3WFHB 4M4RA 5D1QC 5CGTA 1UXSA 1VERA 2FD6L 4DGIH 3CMOL 5DJ0A 2FHCA 1KXTB 1F5WA 1AXIB 4WI7A 4XPFL 2QHRL 4HT1L 1ROWA 4DN3H 2EEBA 1IC5L 4V2BA 1DANU 3DV6B 1G7IA 4ZAKD 3UCRA 3GO1H 1GJIA 2WQ8A 5M94B 1AQKH 1DCLA 3FONA 3AAZB 3MJ7B 1ZVYA 3V95A 4KWUA 4PLKD 4QRSB 3NPZB 2DIBA 2IADB 1AXSB 3S35X 5E9DD 3WS6C 1S3KH 4KK6C 2VLRE 4M8VA 3GMQB 1FCCA 3MLZH 1RPQA 5GS1B 3BHBB 2P24A 2D2OA 1QOKA 4XWOD 2ZOKB 3BDYL 4PBXA 1ZT4A 4GW5B 3GJFB 5DMIH 1A6ZA 4KI5C 4PJ5A 2BOCA 4HIIA 4P2QB 5GGTA 1CU4H 5DD6B 1MVUA 3O3BB 3PL6A 2GI7A 1T22A 2DQEL 1CICB 1QFWL 2EYSA 4HJJL 4K3JL 4NRYB 1A7NL 3MOAH 1YY9D 2R9HC 2YA2A 2Y07H 1NAMH 2BJML 5ICYB 1UQSA 3VRIB 3G5ZA 1QP1A 3VDCA 4XBPA 5DQ9B 3FOLB 4F9PC 1HHHB 2YPLD 3GIZH 1YPZA 4L1HA 4MD5B 3ARTA 2Z8SA 1MHCA 3AB0B 3UP1A 1S9YB 4JFDB 5CS7A 1UWGH 5C0ND 3NCMA 1TFHA 1SVZA 3RWGB 5C07E 3DX9B 4Q6IA 3MROA 4C83A 4GG8B 3NZHL 5KOVC 1CE6B 1I85A 1KLGB 3TO2A 3DX6B 5EIIA 2JB5H 1FYTE 3U0WH 5DJAB 1FBIL 5JA9A 1LNUB 1U92A 4NGHL 5EDXA 5IW1B 2Q7NA 4C59B 1EHXA 1T1XB 5JDSA 3VE0A 2RCSL 4NNPL 1FFPA 2NY4B 2Y25A 3C5ZB 3I9GH 1KJVB 1FNFA 1U41A 2OI9B 4DVBA 3M1BA 3FB6B 1I9IH 1ACYL 4O2FA 1QA9A 3KYAA 4NZTL 4QRQA 5IW6B 3IDNA 4LKXA 4WFHE 2XFXB 5DRZB 3MJ9A 5IW3A 1FAIL 3HR6A 3PWPB 4Y89A 3LD8B 5DUML 1R0AL 4XRCA 1E28A 3S9DB 3N1GC 4H8WH 3QIUA 4LHUB 4ODSL 4PJEE 3LKSA 3LVEA 5MEND 1JP5A 2C5DC 5TGBA 2AXGA 2FJHB 3BE1L 3IJHB 1HHKA 3RNQA 4WV1A 4YFEA 4P49A 5SWSD 5ICXA 3CLFL 3RZCD 4ZTPH 1YEJL 2X2YA 2BNRA 4C58B 5ITFA 2ZUWA 4CUCA 2M8XA 3MJ8A 3MRGB 1NCDL 3OJDB 1G0DA 1QSEA 3EO0B 2F53A 4APQB 2NX5B 3WLBA 2YBRA 4KKNA 5DHVH 5CD3A 4J12A 4M1GH 5AAWA 2I26N 4XPHL 2DJ4A 1AXTL 1U95A 25C8L 4WFFE 2OJZH 3JTTB 4FP8L 5MI0B 3RWHB 4JN1L 1N8ZB 4LNVA 3SE9L 4I13B 2NY7L 4WFED 4JY4B 5E08L 2ZCLH 4IIQA 5D96C 4YGAB 3CLEH 1T2QH 2FEDC 4RFNB 4U1MA 4LSSL 1UB6A 1NLBL 1MRCL 1S9XB 3D6GA 4HMDA 4YFLI 3M45A 1FSKC 5D93B 4PV8B 5KSAB 4G8EB 3U2SB 1EGJA 1U8IB 4LGPB 4MNQE 4HBCH 4JN2B 4JQXC 1WGOA 3QNXB 5T3ZE 1WEJL 3WUWA 5EPMB 1UWEL 4DGYH 4KZEH 3D18B 3ROOB 3REVA 2IG2H 1FL5A 3KWWA 5F1NA 3P0VH 1QBML 2C3GA 4PTTB 5TDPA 1FZOB 1PX4A 4GXUM 3EAKA 1B4JH 2NW3A 3RIAK 2OL3A 5IUSA 1SEQL 1ZKAA 1A2YA 4AY0A 1NH6A 3KLAA 2VLRD 1IGTB 2HTKD 1LO3H 4NKDA 2NXYB 1ZTXH 1LHZA 2OX5A 3QEQB 5LCVL 2ZJSH 5C08E 2OR8A 3VXPB 5L0QC 1BJMA 2EDOA 1J9CT 4UTBH 1MI5A 3S7GA 4QHMB 1A6AB 5F6IC 5JHDE 1MCSA 2DB8A 3KPPB 5I0DA 4HKBA 3RUGA 2B8OT 1DVFD 1WAAE 3OKKA 1DUZA 2EDKA 3K4ZA 3THMH 2P49B 3RBSA 3TH2T 3HA0A 2R8SH 3VG0H 1IM9A 4P2OD 1NC4A 4Z5RA 3QAZC 4Y1AB 5JW3L 1H3PL 5MP6H 3FQNB 4TPRL 3HE7A 4BK4A 5GZOD 2R15A 3O2WH 4JDZA 4HZLA 4KVCH 1A7RH 2CLVB 4JLRB 4U49A 4X5LA 5DI8A 1JF1A 4NZRL 1Y0LB 2RIKA 1FNGA 5I18H 3HB3C 3JV6B 1HQRA 5C07D 1I1FA 1A6VH 5TE7L 1BHGA 3H0TA 2DRUA 1P7QB 3HN3A 3RWFB 3RWIB 5IBLC 1FYTD 2UWEE 3MRIA 3ARGC 4MAYC 4HK0A 1AE6H 4OM0H 4S2SA 5FM5O 1UC6A 4R4NC 1NGZA 1AKJA 1WZ1H 1RUMH 2YXFA 4HS3B 1RZ8A 4P5TD 5I2IB 5JHLL 3SY0A 1YECH 2BCKA 4Y2DC 4M03A 1KGCE 2FO4A 1HINH 4PGBB 4RNRB 4X99B 4HPOH 5ESVB 1MAJA 4WFHD 2EDJA 4PBVC 2Q8BH 2QSVA 4K8RD 3BUYA 2H2SC 3U7YL 4TOYL 5FGBA 4PGCA 1MCLA 3TJHC 3WFCH 1X5HA 4WU7A 3SGJA 4HSQA 4NBYB 4RQQB 2MQCA 3AM8C 5ADPL 4ODVH 3F12B 4OAWA 4X7DC 4ZD3L 3HG1A 3QZWB 4NHUA 4NYLA 1NBYB 1RZJH 1BBDH 2F5AL 5F1IB 1MCEA 2Q76B 1L6XA 1CLYH 2WW8A 2VN4A 2V2TA 4HUXA 2YS4A 3VXRE 1NJ9B 2H1PH 3P4OB 5DF0A 3BESR 3CZFB 2VABB 4R9HA 3GSNH 4OLVH 3ILQD 4L3AA 15C8L 3GSOA 4O02H 2JIXD 3AAZA 4KHXL 3EYOA 1GOHA 5IB3A 4QRSA 3GMQA 4NT6B 3BHBA 2ATPB 2OJEB 4N8PA 3FN3A 2ZOKA 3RVWC 3SE4A 3BQUB 4Q9QL 2WSKA 1BZ9B 4XVTH 1PZ5B 2HJKB 5FUCE 2BC4A 4Q9CA 2GK2A 1VFMA 3O3BA 4UAOB 3HUJA 2HG5B 5H37G 2HJFA 1CICA 3VD5A 5GJSL 2X42A 4NRYA 5IMOA 3QNZB 5F9JB 4MNQD 4PLOB 4AMKL 5ICYA 3PABB 3VRIA 5T3ZD 1TCRB 2DI9A 3KPQB 5DQ9A 3FOLA 3QSKB 3NACL 5GS0C 3DROA 1S78C 5L2JB 3O41A 5IEHA 3HNSL 1RMFH 4JFDA 4NN7C 1AY1H 5D1ZB 3JVGC 3NMEA 4L8BA 1ZLUK 3FO0L 4GG8A 4TUKL 3CSBA 3LKNB 2BP3A 4HLZG 4NRZA 4U1SB 4WEMB 1U58B 4OJFH 4ZYKB 4F7PB 5DJAA 5C3LD 1X5FA 5C08D 1I4FB 1OD9A 5E00A 3HC3L 4ENED 1T1XA 5JHDD 2GW5A 3TT1H 4LVOB 3VGAB 3UJJL 4YAQB 3UZEA 3C5ZA 2X9YA 4WW2F 3EDFA 1KJVA 3DO7A 1JUFB 3RAJH 4OLUH 4HKJB 1HH6B 5IFJB 4ODTH 2IH3B 1NBZA 2DLGA 3VRLE 1K6QL 2BY3A 1FPTH 5IW6A 1MCOL 3OR7A 5J1SC 2XFXA 4NPYB 1NEZG 3G5VA 3HZYA 4X7TB 3VDAA 4JHAL 3QI9D 1KTLA 2VDRL 4KI5E 1FO0H 1BAFL 4LOUD 4LHUA 5F9OL 4G6AD 1XCTB 3LEYH 3Q6FB 3V4PL 3ZDYE 3MMEB 2EE9A 2G75A 3I3DA 1KEMH 2FCBA 4ZSOB 4M5YL 1JWSA 1OLLA 4F37F 3ZTNL 5IFHH 4XMPH 4D0BA 2H32A 2A73B 2B2XL 1LQSR 4QTIH 1GGTA 3EKCA 3HI1B 4Z7WF 2Z31B 4JAMB 1DBML 3OBAA 5C0GA 1G7LB 3OJDA 5CP3H 2V5YA 6CGTA 4APQA 4OCXH 5J11C 1A6WH 1NEZB 4ZFOA 1KGCD 1I8KB 3CFIC 2HWZL 3L1OL 4NC0B 5C3TA 1RU9L 3MRMB 1DQDL 3UPCA 3VFWB 1IGIL 3GZKA 4OLYL 2MOVA 4WW2B 5CZVH 4MB4A 3RWHA 3BO8B 2YN3A 5E70A 5BS0E 2WINA 4CN6A 1CR9L 2AERT 4QXTA 3U30C 3W11C 4F57H 1T2XA 4Z7NF 4F7EB 4HAGA 5JNYB 2PTTA 5EU3A 3IXTA 4H88H 3FQWB 4R97C 4PRHD 3RU8H 4Q6IC 1I85C 2ZUUA 4IOFC 5EZOL 3B2VH 1QHPA 3VXRD 4OGXH 4JN2A 4Q9RH 4PJBF 1BFOB 3D18A 3ROOA 5I1AA 1PX3A 3CFEB 2YD9A 3SDDD 2DMKA 1NUNB 4MJIB 1ZLSH 4GRLC 3LPGA 4K7PY 4HG4J 4PTTA 1OB1B 3S88L 5A2JH 2IAMD 2W9EH 1VFAA 3LHPL 5ISZE 5F7FA 1IGTA 1ACZA 4JHZA 4LLMA 5D5ME 1ZLWK 1JZ2A 5FV1L 3IDUA 3QEQA 2Z8WC 2FIKB 2JELL 5SWZA 3VXPA 4N8VB 2DJSA 2CRZA 3HE6A 1KC5H 2WBJD 3KPLA 4LLYB 2I07B 2RBLA 1H3GA 3KPPA 1VGKB 2EZ0D 2VQUA 5DJDB 5JORA 2RJMA 1S5HB 2WUBL 4YO0B 5CMAB 5CZXC 3T2NH 3TBTA 4CN4A 1F6FB 5EFIB 4GQ9H 3F7VB 4U1GB 4Y1AA 2J6EH 2GSGA 1V7MH 3STZB 1G7JA 1PFCA 1GXEA 4X80L 5I9QC 3LH2L 2R2HA 3BVNA 1DSFH 1IC7L 4HD9A 4PJBB 1Y0LA 1NFIA 3A6CL 4QGTA 3O2VH 1RURL 1G9NH 4OBSA 3RWDA 5LAXA 1B4RA 4XNZB