1ZOXA

Clm-1 mouse myeloid receptor extracellular domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
110
structure length
110
Chain Sequence
EDPVTGPEEVSGQEQGSLTVQCRYTSGWKDYKKYWCQGVPQRSCKTLVETDASEQLVKKNRVSIRDNQRDFIFTVTMEDLRMSDAGIYWCGITKGGLDPMFKVTVNIGPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Mouse CLM-1 Ectodomain
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords CLM-1
total genus 29
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zoxA00
3MBEA 4NIKB 3EYOB 2BOBB 3CDGB 4EDWL 5HBBA 1QFUH 3V4UH 3ZT7A 3U9UA 1T20A 1B4RA 1BQHG 3LQAH 3O6KH 5I8CA 2CDEB 4AENA 2DLHA 1Y0LB 3CDCA 1EHLH 1MHEA 1YJDC 15C8L 4WUUA 4EDXB 2DQDL 4MQ7B 4PJ7F 2H41A 3EYVB 5FXCH 3IF1A 5GSVB 5LKNA 2WP3O 5LCVH 3KR3H 1Q8MA 3BMWA 4MQSB 3UEZA 1AY1H 5B4MD 2Z9TA 4UT7L 5CP7B 2ARJA 5DJ2A 1KCRH 5C09D 2KQMA 1Z9MA 1YYML 1MHPL 3BYYA 4X9FA 5HYJA 3KXFA 4PRHA 3N85H 3BD4A 3VXUE 3Q1SL 4WTZG 1LEGB 3EJYD 5E2TH 4MDIA 1XF3A 3RL1A 2XACC 4XX1G 3ET9F 1NMBL 4YR6A 5C08E 1UH4A 4WO4A 1AD0A 4EI6A 3NFSH 1FFOA 2ATPB 4OSUL 1DQLL 5JUEH 4HUXB 5DJ8B 3LKQA 5DVOA 2LAAA 4BKLB 4DOHB 3GSNA 3EGSA 4I3SH 4G9FD 5MENB 1UA6L 3ZSSA 1CD0A 5C8JA 4R4BA 2Y4SA 4XNXL 1X44A 5IWLC 2ITDA 4PRNB 4FXGB 3RBGA 3BN9C 1N6QL 2X1PA 3QG6B 5GGRA 4O58H 5KVFL 4GKZA 4S10A 3EYQD 5I73C 4BQBA 3UO1H 2Q8BH 4JCMA 5JMRA 3GSQB 1TENA 2VKXA 4Y4KD 1A1OA 5D1ZA 4WUKH 5H35B 5SWQA 3GMMB 3DX6B 2CO6B 1Q9OA 2R8SL 5BV7L 1KJ2B 5J13C 1QHPA 1BJ1J 4ODTH 4APQD 3GBMH 1MSPA 5IP4A 5JORA 1N8ZA 4XNQB 3BZEA 1HQRB 4D2NA 1S9YB 3L3OA 2HKFL 1F2XK 4PREA 2YPVL 3O6ML 3PGFH 4DUWA 4XPBH 3SBWA 1S7TA 2OP4L 2VMFA 5E8DH 1MFCL 2FD6L 3ULVE 4TTGA 1EEUA 2ITCA 4KV5E 4PJ8D 4L8SA 2PW2B 1OQXA 1QR1A 2WAHA 4DGYL 1KJ2H 3TA3A 4PJIA 4KH2A 4IRJC 5ANMA 2CJUL 3JVGC 3TH4T 1IGJB 2PUQT 4X98A 1IBGL 2BFVL 1JPGA 1T1XA 2W65B 5EUKB 4KVCL 5FM5M 3QFJB 5J89A 4WFHD 3CUPB 1S7XA 4JDVA 1HYSC 2A73B 2Q87A 2LVEA 1A6PA 1XGUB 2GIYA 2RR3A 4ORGB 1E4XH 3JXAA 1E4KA 2Z91A 4XCCL 3VFRA 4UILL 3ZE0E 2IAMC 5A2IH 5I18H 4YK4B 3DIFB 3WD5H 2DTSA 5IROA 2A77L 4QHMB 1KXVC 3BDXA 1NGPH 3Q48A 2D7QA 4JZJA 3AMLA 3WHE0 1OGTB 4KKLD 5F3BA 5DEGA 1VEOA 2R4RH 5IFAH 1XFPA 1QFHA 1DE4A 2HTKC 3C60A 4G80A 3TA3D 2X42A 5LGHH 1MJJA 4XC3H 3EIFA 2G2RA 4HIXH 3MJ8A 4KXZI 4PRPA 4TNVF 3SDXE 3RWIA 3DV4B 2B4CH 3SKJL 3RWCB 1CGSL 3F62A 4LPVA 5C0EA 1DQMH 5D4QA 3ULVL 1RZ7H 2IBZX 4FXLA 4QXWA 1G7MA 3RIFK 4B41A 5I1GL 3HCVB 5D7KD 3LPFA 3AS1A 4L8BA 2PW2A 3REVA 2P8PB 4XZUA 1IBGH 2BFVH 4NRXA 3F7PC 1IE5A 5GISH 4BZ2H 1HILB 4JANB 4RMWA 1FIGH 1NFDA 5DQJB 4WFGD 1R5VB 3MLSH 1LP9A 2P44B 3OKEB 1MUJB 2YKLL 5D1ZD 1LGVA 2YPKA 2NXYD 1TQCB 4PJCA 3ZHLA 5I2IA 5C9KA 5IR1A 3OXRA 3QO0B 2ESVE 5HGHB 5DJ0B 5JIPA 4JKMA 1X4XA 3MGTA 1MHCB 1R24B 5FYLD 2XV6B 3LEXB 1ORSB 3QPQD 3ARDB 3BPOC 4JG0H 1MFNA 1U8HB 2BSTB 3GSQA 4K3EH 1A64A 4ONHB 1X3DA 2A83B 3UTSB 4HMEA 2BJML 4UU9B 4FQJH 3NAAL 2VXTL 4OLWH 4XT1C 1LEKB 2VDRL 1IKNA 5JXAL 1DP0A 2ITDB 1S7QA 3DRQA 4LP5A 2EE3A 3TC9A 1PYWB 4FQ1L 4U3HA 1R3JB 1D6EA 4PGCA 3QISA 1PEZA 4LMQE 3TP4A 2XWBB 1LEIA 4N0CC 3KXFD 5FK9A 3D0VA 5KN5B 4TSAH 2D7TH 1XR9A 4IS6B 2E27H 1BP3B 4FQXD 1P84J 2XG5A 4F57H 4FQ2L 4LCUB 1OD7A 2YMXL 4PRHB 3OG4B 1GC1C 2UWEF 2PO6D 5SWSB 3VGGA 3UTTB 1UACL 4TVPL 1BM3H 4WUUD 2XZCL 4U2YA 3O3DB 4JHZA 1NC4B 4OCYH 3GMNA 5BV7B 3TVMA 1EHNA 4ZXBC 3DX7A 4K9EL 4PP1C 2IBBA 3BP5A 4NHCL 4U6VH 4ALAL 5DK3A 3F7YB 4ZTOL 1U8IB 4UAOC 3DETD 1FFNA 1ONQA 4FFZH 1HK6A 2X4PB 3W11D 1AGBA 4GG8B 4X4ME 3U7YH 4G8GE 4POZD 5LAXA 2FATL 5EPMA 1NAKL 1GGIH 4ETQA 1RUAH 3O45B 1KG0B 3GRWA 4GW4B 5DF0A 4Q9CA 2JELL 5C7XL 4BZ2L 5H2BA 3VD3A 4AQ1B 4PJIF 1BOGB 3QNYA 3WN5B 4BSVB 3BDYL 3V0WH 5IB1A 4I18C 1T7XA 1P4BL 5FOJA 3KYOB 3TJHD 4GXVL 2YRLA 3VJ6A 4F37F 4X8JA 4K2UL 5CD5D 4G5ZH 1BJ1H 2Y36H 3WJLC 4KTEL 2YEZA 1RZGA 4JLRB 2O5ZL 5IB3A 4PV9A 2V5SA 1NC4A 3L6FB 5JPMB 1QLRA 5DJZA 5HHMB 4LK4A 4XCYB 1IC1A 5E56A 5ESVB 1FNEA 2OTUB 1JV5B 3B4NA 2C3VA 1I1AA 2X4QB 2MQ3A 1U3HA 5F1IB 4R90H 5F1NA 3PQYD 5HPMB 4MJ6B 1UEYA 1JNJA 4WV1B 4BA8A 3RI5K 1NQBA 1OTSD 3QCVL 4HUMB 5L6YH 3MV9D 4NKQB 2NR6D 5F9JA 2PO6C 3CMGA 3GSOA 5IHBA 4OZFG 5HGBA 1QBBA 2DLEA 3NAAH 3VFWB 4PV8A 2DIBA 1ZOXA 4FQXC 3E8UH 4OZHB 3UJIL 2OZ4H 4P3CH 4E41D 1IT9H 1A0QH 4NO0B 5FUCC 4JY4A 2IEPA 3T2QA 5C0CD 4Q9BA 4DAGL 4YHIB 1HDMB 5GGQL 3WS6C 5HDOA 1FNSL 1V7ML 1UCBH 1U8QB 1UB5B 1QFPA 1LDSA 4UINH 5JNYB 4Y4HB 1G9MC 1QTYT 3DOSA 4HSQA 1B0GB 4JGMA 3MRNB 2ICCA 5ETUB 5CSBA 1YN6A 2NTFB 3BT2H 5DJAA 3MUGB 3B9KC 2HMIC 1IC4H 5B8CB 4FTVD 4XNZB 3RNKA 3EO0A 3LEXA 1HZHL 4CVWA 3G6AA 2OP4H 3S88L 4QOKA 1NFIB 1WWAX 1ZHNB 1TZIB 2QL1A 3HKFA 2ZOKB 3OXRB 5DRZA 2F54A 5B8CC 3DETC 2WBJB 5JQ6L 5DJXB 2UZIH 1RV6X 4BFGA 1MUJA 2FB4H 4CN6A 5DS8A 4XCNA 3WFCH 3H9ZA 2H6PA 3HMXL 2CRYA 1R5VA 1U2CA 2VLMD 3WS3A 1RD6A 3BHBB 4KJPC 3V6OE 5GGUA 1F8TH 4J4PC 3VFNA 2I24N 1I8LA 5FYLH 1LQSR 4CVXB 2UZIL 3I3DA 5CLTA 1GZPA 4MJID 5F88A 3ZDYE 3WSQL 3LKSB 1FDLH 1K2DA 4L4VD 4NN6B 2P5EA 1CDCA 2ILLA 5BXFA 3QQ4A 1KPVB 5GRUH 1KEGH 4UOW0 5DEFB 2VXUH 4Y4FC 1HH9B 2V2TB 1FORL 1FZJB 2K3TA 4PY8I 1G0XA 3VFMA 4K9EH 1A6VL 1MJJB 2JB5L 4FZ8L 1OP5H 4UV7H 1INQA 1CI5A 1CXKA 1HEZA 4GG6A 4IJ3B 2AJVH 2IFGA 2V7NB 4LLUA 4X6CA 4HWBL 4NC1E 4Y2DD 4JFEE 5ICZB 1D5IH 3U4BL 5EZJB 3SKMB 2UWEB 3HPJA 4ORGA 1B90A 5HDBE 4Z7VF 2H2PC 2VLRE 4J3TA 3BEVB 2DLTA 4ZFOL 3VFUB 4XBEL 3ARFA 1SYVA 4LOUD 1MRFH 3OXSA 2V2WA 3VMPA 5KVDH 1ZXQA 3MR9A 3TN0C 5D7IF 3SOBH 5LCVL 3NFPB 4PP2B 4X98B 3UCRA 2VIRB 1NCBH 2VC2L 1NH6A 4X5WB 3QDAA 2CDGA 3VD9A 1QR1B 3Q6GH 3KLAA 4OZGA 4TVSa 4C54A 2P5WE 2JF1A 3LOWA 2ITCB 4RDQG 1JRHI 3DVGA 1TETL 1MEXH 2HVKB 4H8WL 3JWDC 4LFHD 3L3OB 3O0RH 1Q0XL 1IAII 1N4XH 4PREB 4ELME 1S9YA 2VDKH 3QPXL 3VG0L 4YAQB 3VXRA 2D7PA 1N8ZB 1FLTX 2VKWA 5J6GA 1IC7L 2EIZA 5IT2L 3TA3C 3WUWG 1I7UA 3BEWA 3LMJH 1P1ZB 1YPZA 1S5HA 5BOZG 2DIJA 5F89B 4U1IB 3T3MF 1LMKA 2G9HB 1A6ZA 1E4JA 1H3PH 4XBEH 2ZNWA 3BIAX 3BKJL 5HYIA 1I85A 3FHQA 4L1DA 5DVLA 1H0DA 5J1AB 4GBXB 2NY0C 3P9WB 1MHHB 5INDA 5A16B 4N1HB 4HBCL 1O5DT 1EO8L 3VE0B 1JZ6A 5KSBF 4PRIE 3GI8L 4XTRD 5F6IB 2VAAB 1HYSD 4F57L 1F4WL 1W72L 4J3XA 1GVIA 1UZ8B 4JGUA 2JJSA 5HGAA 4POZC 3Q3GA 2XZAL 1NGWA 5EC2A 4KI1A 5E9DD 1SBBA 4QCIA 1UM4H 3ZT5A 1J05A 4FZ8H 5T3XD 2YA0A 3INUL 3P40A 1CQYA 4DKFH 4MLSA 1KSRA 2YZ8A 2IPUK 5ITBL 3O2WL 3T0EC 1MCWW 1TQCC 3KR3L 3KJ6H 5HYJB 3C8HA 4K94L 3HZYB 5E2UH 1K4CB 3R0MA 2VDPH 3NABL 3NZ8A 4LP4A 2DI9A 3MLUL 5F89A 2J8UF 1JFQL 1S5HB 5MP6L 3H9YA 3RWJA 1AI1L 1R6VA 2PR4H 4KVCH 1I7UB 2OTPA 3BEWB 3QDME 4YE4L 3MJ7A 5CAYB 1RHHB 3D0LB 5ISZA 3WLWD 2HG5A 5CHNA 5GGSA 3OKYA 4B5EA 1FZMA 1VGEL 2EDOA 3C6LB 4LEXH 5B4MC 4OV6F 2W59A 1S9WA 4KGLA 4GS7B 2E8ZA 5IVNA 1DUYB 2E9WA 3KPSB 1Z5LB 2EIDA 2XRAH 2CXGA 4P2RB 1OAZL 1TFHA 5T1LA 2UV3A 1JGDA 3SJVD 5DWUL 4FG6D 5BRZB 1J05B 3PIQA 2EXYD 3SDCB 4F9PC 3NTCL 2C3HA 5I74C 4JRYA 3Q3GB 5I17A 2O5XL 2DQJH 2IGFL 3MRMB 1FQ9C 3BZFA 1T03H 4P3CL 3C5ZD 4OM0H 4HIHA 2CR3A 1IKNC 1HHIA 3RWDA 5HSFA 4AY0A 5DC4B 1OAQH 3MR9B 1ZHKA 5EZLB 4HC1H 4DCQA 5IWLA 3IFNL 3T08A 4D8PA 4QXTA 3O41B 5HDBF 3ARFB 4KU1A 3T0BA 4TVPD 4I8DA 2L7UA 5E4IA 1YNKL 2VABB 3VCLA 5CEXB 5EOCJ 3MRJB 5CEZE 1ED3B 1I9EA 1A6ZB 2NY3B 3D3VE 4QT5A 2VLME 4DJMA 2CIIB 3O8XD 1B3JA 5CZKA 1VADB 1UYWH 1DBJH 2FECL 4URTB 4RA3A 3UTPE 2R1WB 3HRPA 2ZJSL 2HWZL 5DK0B 1INQB 4MHHI 2X4RA 5D93C 5E8OA 1F4WH 1W72H 1EIBA 4OSUH 4C58B 3HE6D 3JTTB 3WXVL 2FX8L 4RAVA 4EOWL 4WHYG 2IMMA 1JTOA 4ZXBA 2KPNA 3PP4H 3LKRB 1EZVY 3TNMB 2HRLA 1H8SA 3PGDB 4HWNA 4XPHH 1IGFH 2F9BT 1QLEH 1Y18B 2HTKD 4KPHH 1NGXA 2GJ6D 3G5XA 3SDAB 4X5WA 4LBEB 4L8SC 4G6AD 1G7JB 5D2LA 1MCCA 5GGUB 4HJJL 5IFJA 5IHUL 1HSBA 3NFPA 1J1OL 1U8NA 3JVGA 1ULVA 3EYFA 5DS8B 1CFSA 3EOBB 3UROR 5IEHA 3UPAA 5AUMA 3TZVB 3TIDA 2XIDA 1LK2B 2NW3B 3GMPA 3OKNB 1LP9F 3NFNA 2F54B 4LGRB 5HYSA 1Q0XH 3GHBH 2BSSB 3FFCB 4QHLB 5EO9A 2VH5H 3VGFA 1P6AB 3E1F1 4P23D 5D1QB 4KZDH 5DDHB 2EO9A 5JOPE 5FA4A 3ZKQD 1XGTB 4B0MM 3HUJB 2R4SH 2M8XA 2YA1A 2VZUA 5E6IB 5BQ7B 1PKQA 3U0WH 4RZCA 1QP1A 3KWWB 1E4WH 5TE4H 4MXVF 4R96A 1I7ZA 3AFLA 1YZZA 3MUJA 2DWDA 2EE9A 1X5KA 4R97B 4PV8B 1JWSB 2WUBL 1CDYA 3QUYC 3ZTNL 3B5HA 1KPVA 3W0WE 4OV5B 5JDJA 5FM8A 5GGTA 4DTGL 5F9JB 4N8PA 5KVFH 2UWEE 2GFBA 1CE1H 2SEBA 3SGJA 1E6OH 4JFEB 5JLZA 3GI9L 4RGOL 3GRWL 3O2DH 4XNXH 1MJ8H 4YJZL 5C86A 2EE2A 4CL7A 3VXQB 2N56A 1B6UA 3QUZA 1PG7L 4ODVL 5CINL 3R1GH 1CLOL 1TJHL 5FGRA 5IW3A 5KSAD 1HN1A 4NQEE 3VRIB 4HJJH 1J12A 2AJVL 3WO4C 1KPUB 3O6FD 1B88A 4JM2C 3PL6B 1FNHA 2F74A 5T5NG 4U7MA 2X70A 4PV9B 2DBLH 1TVHB 4MYWB 3EYQC 3D48R 3FJTA 1TZIA 5FCUL 2VDLL 3DSFL 3HB3C 4HAFA 4YQXH 2JCCB 1IJ9A 4ZOBA 3FCTB 3MRKA 2VZ1A 3QDMA 1WZLA 2NY6B 3BDBA 5EOCH 1JP5A 2WMPA 3C5ZA 2APXA 3C9NB 4Z5RA 4TUJB 2XA8L 1BFVH 3X13B 2R15A 1G6VK 2VDMH 5LBSL 2A2QT 1N59A 5IQ7H 4JG1H 5DRWA 1X7QB 4K3JH 3U4AA 1TNMA 4C56E 2CKBH 3STZA 3IXTB 5ADPL 4ZD3H 4Y5XC 2Q76B 5FYJU 3ZMRA 2OI9B 1B0WA 1NCCH 1GOHA 4HS6A 2Z92B 5I1KL 2N7BA 1A3LH 1A1NA 3DLQR 3TH3T 4U2ZA 2ZZUT 5KS9F 1C12B 3VDAA 1FV1B 4OZFA 5DD0L 4C4KO 1A9EA 2D4FA 5TGBA 4KHTH 1U3HB 1KB5B 3SE3C 2VXQH 3MV7A 4DKEL 2EEBA 1H3TA 1NGPL 4Q97A 3GJFA 4RFNC 5F7LB 2G75A 1KCVH 3DGGB 4I0PC 3RVWD 3BPNC 5FYLE 3VXMD 4WO4C 3GBNH 3I6LD 4PYHA 3OHXA 1I1YA 3O3EB 4NUJA 4IS6A 3NTCH 2NYYC 2EDBA 3CC5A 4MS8D 5HHOE 3V5KB 5H94A 4J2XA 1X6NA 1T1ZA 1Z9OA 4WCYH 4MA3B 2Z92A 1OAZH 3BPCA 1TZHA 4PLNC 2CDFB 3V5HA 4MQXD 1QVOB 4B50A 2Q76A 5F93C 4G42B 3VWJB 4ZUVA 3RHWF 6CGTA 4ODXB 3PF2A 1BOGA 2HTLD 4AIZA 1KUMA 4U6YB 4TN9A 1G9MH 4DZBA 3PDOA 2FX7H 5CKGA 4DQOL 3NIFE 1QD0A 3IXAA 4LCWA 5DVKA 1NGZA 1LILA 1LO3H 1CXFA 1JHTB 1AGBB 4K3JL 4JFFB 3SHSA 1A6WH 3MRKB 3B8YA 2FD6H 1DQTA 1JMZA 2VDPL 1E0OB 3WFHB 1UM6H 3NIFF 3JV4A 3FQXA 5I8OL 4EI5B 3VRLE 4GLRI 2C7UA 4IOIA 1NGYA 5C07B 1T0PB 2YPKB 3OKLA 2XICA 3CH8A 1G7IA 3G6DH 3MRCA 1DBKH 5JOPD 4G6FD 3CXHJ 3DX9A 3EDJA 2JJWA 1YC8A 2IG2H 1MCIA 3NCYP 4E5XB 4UIKH 1ZTXH 3RP1A 3QUZB 1FL6A 2J5LC 2AK4B 4HUUA 2EYTA 1JWUA 5FK9B 1YC7A 2P8PA 4XZUB 1B0RA 4J23A 5F6HI 3T3ME 1JCKA 1T21A 1BQHB 3WE6A 5JW5A 1TJHH 5C92A 2VYRE 5F7UA 1F3DH 4Z78A 2ZP0T 1GGTA 4P59L 2I27N 2QQLL 1KCSH 4UT6L 4HXAL 3OPZL 4I77H 4H8WC 4DKAA 2CMRH 4FQLL 2GJ6E 1QA9A 1VENA 5BQ7A 1AO7B 1YA5A 5KSBB 1OAXH 2IJ0C 5D6CB 5K59F 4EZMA 4ONHA 1WEJL 4XNYL 1I8IB 1XGRA 3UYPA 3LY6A 1D3CA 5CMAA 3UZEA 3VFRB 2DI7A 5D1XC 1T6WA 1BVKA 2XTJB 3L3DB 3QPXH 5DJ0A 1BBDL 4HUKB 5ISZE 3SO5A 3KYNA 3QI9C 4PBWD 1A7NL 5IMOB 2GJZB 3SKUD 1G0YR 2Z8SA 5CJOH 3AREA 1MEXL 5IGXL 3CAFA 4MS8C 3D3VD 5CEZD 5IFJB 1DL7L 3B83A 2M26A 2NY4D 4YHNA 1HILA 4JANA 3U36A 3MUHL 1FH5H 4WI8A 1CDJA 4Y5YC 4Y89A 3K2UH 1JF1B 3NCMA 4KV5F 1NL0L 1LO3L 4JJHA 3HCVA 1BAFL 3BP4B 1C8PA 3NCYS 2HFEA 1DN2A 4KROC 4S1SH 2BSED 2CQVA 4LLMB 1HNGA 2YUWA 1AC0A 5GS0D 4YHPA 3MRQB 4R6UA 1CF8H 5HI3C 3NVQA 3ZKNC 1J8HE 3KPLB 5JORB 3C60B 4G80B 4L29A 3SJVE 1I3GH 6FABL 1F4YL 1EPFA 2B5IB 1SJXA 4BUGA 2IMNA 1SJEA 1H15B 3DX8A 1ZA6B 4OD3L 1BQLH 1EVTC 4YZFF 1QSEA 1OAXL 1VADA 3MRFA 1CTOA 3GMMA 3RIAF 4YUEH 1WZKA 3RVTD 3ULVF 3P9MA 4FRWA 3MO1B 5I1LB 2CMRL 4FQLH 5D2NC 4PTTA 4MA7L 1J8KA 1NCWH 3MUZ1 4J12A 1XH3A 4MB4A 3BAEH 4FTVA 1U42A 4P59H 2A73A 1DJSA 1ZHKB 5EZLA 4DCQB 1UWXH 3VI3F 3MRHA 5KOMC 3QA3A 5E7BA 4EBQH 4R4BB 3QNZB 3LHPL 3IDGB 1B6DA 4XMPL 3MBXH 1IEAA 1JBJA 3UBXG 4JRYB 3CFBB 4OQ1A 3BP7B 5BRZA 4OZ4B 5FGBC 3RTQB 3W5NA 2X4TA 1TMCB 2DOCA 4OM0L 5CLWA 4G6JL 4WO4B 2HRPL 4LQFH 4UNUA 1FNAA 1JWUB 1A7PH 5DJCA 1JGLH 5F71A 4ZAKB 2LE9A 1YEKH 2O61A 5LBSH 5T3XE 2JB6B 1X5ZA 3P4OB 3QEHB 4MVBD 3WFEL 5D7LB 3S35H 5EU5B 4ZFFB 3BE1H 3DO7B 3OR7A 4XNQA 3QNXB 4HT1L 4U6HB 2N4IA 5I75C 4YBLB 3MLVL 4JPKL 3OKOA 4QF1B 4XP6L 1RHHA 2DJUA 4PGJA 4YC2C 2NW2A 2Z31B 4GKSB 3SGKA 5FCUH 2LVCA 3QHFL 1Q9OB 3DXAD 3ARBB 4EVNB 4NKIH 1FBIH 1YNLL 2EIEA 2P8MB 2E6PA 1AFVH 4S1DD 4LKCA 3MFGB 1SEQL 1WCBA 5DJ6B 5HI4C 4UOJA 1NCTA 4OUOA 3GJFH 4ACPA 2FGWL 3K2UL 3HPLB 2H8PB 3GBLA 4DZBB 4GKZB 1DLHA 4IMLA 3GMQA 1N3NB 2AEPL 2FNBA 1KCLA 4AIZB 3BE1L 2AK1L 4QRPA 4I1NB 3ZYIA 3CLFL 3U7AA 1KLUA 1KTDB 1HOCA 3BD5A 3EYSH 1VA9A 5L8JB 4JO1L 4NOFA 4U05A 4DGVH 3FRUB 3IDUA 1JPFA 5C9JA 5A40E 5BV7H 1WCQA 4YR6B 2PTVA 1P2CA 4D3CH 5GRXG 3DVFA 1SJVA 5CD3B 1DSFL 1I1YB 2QHRH 4TSCH 2VZSA 2PW1B 3LRGA 4RWHA 4PRDA 5EFIA 1S9XB 1S9KC 1TXKA 1T04B 4EBQL 4CVZB 1X5JA 1YN7A 2IALA 3OJDB 3HN3A 1NDGB 4ZTPL 3CFCH 1AQKL 2G9HA 1PLGL 2VH5L 4JAMA 5FYJL 3B5GA 1MIEH 4X9GA 5SX5H 2PO6A 4NGHL 3QIUC 5C71A 1L7TL 2EIZB 4R97C 1VFOA 4RFEA 1RK0B 4KKCD 3G08B 4PJ7E 3HNVH 5LGKA 4YAQA 1WITA 4J3UA 1MREL 3RZCD 4MCYA 5C0BD 2MCPH 3CDFA 4XBPB 3LZFL 1JGVL 4I0CC 5DRWB 1WFOA 2J88H 4BJLA 4G8GB 3NCJL 3E0GA 3TYFA 4X7SL 4O00A 3ECBB 1J0IA 1KIRA 3BZ4A 1NCDH 3ARUA 3W9DB 2WUCH 1YMMB 1GIGL 3HNSL 5D7JC 1I1FB 4PY7A 4M43L 1TETH 3WJJC 5L9DL 5C0AE 3MV11 4F9PA 1VERA 1D5ZA 5DD3L 1CLOH 4YHZH 1KULA 4L4VE 2EXYC 2BMKA 3QZWA 4M48L 5DUML 5CS7A 1WBYB 4OUUA 3T4AA 1RMFH 2HYMA 4M8QA 1PZUB 3D87B 2VC2H 1OTUC 1ZHLB 2A6DB 3RJQB 3SY0B 5FYKL 1F5WA 4L3CB 5DJYB 4WI4A 1OQOA 4K8RC 3LDBB 4RQQA 5SWZB 2VQTA 1EXUA 5BMFH 5J7CC 4Y19A 4MNHB 5ABDE 1PZ5B 2D0FA 5JIKA 5I1GH 1U3JA 4OKDA 3MMEB 5J9PB 4HFWB 4X6CB 1ZT4B 4HJ0C 1E4WL 3GHEL 1KENL 1R3IL 2XWJB 5EOQL 4F7CA 4XNYH 3QEUB 4LLDA 2BNRA 1F45A 1XCTA 3FQUB 1H5BC 4FTVE 3FQUA 1FZJA 1I7ZB 4P57B 4F7MB 4GOSA 1HH9A 2EC8A 2J8UA 3FB6B 1U6AH 4JFZH 4R2GB 4NWUH 3QQ4B 3K8MA 3WFDL 4KI5D 5E24E 3N9GL 3QEQB 3G5VA 1KC5H 1CGUA 4Z7WB 1V3MA 2BVUA 3RUGA 5DWUH 2OK0L 1YEJH 3P4NA 5D9SA 2XN9B 4M3KB 5DDHA 5HHNA 3U9PL 1PZ5A 9CGTA 2ESVB 5MI0C 3LDBC 1YMHA 4OGXH 1C08B 2CSPA 3K74B 5ID0B 4QHNB 3QP3A 4P46A 1NCNA 4LEXL 3ARFC 5SWZA 4W4OC 5IVOA 5HHXH 1HHHA 2VZOA 2F53E 1IZJA 4Z0XB 3ULUL 1L7IH 2B2XH 4LSTH 2X7LA 4N0FB 3PWPB 3EJZC 4DGIL 1TPXC 4OF8A 3PWPA 1L0QA 3MRBB 4HGWA 1BEYL 1AC6A 2VLJD 4UQ2A 4M1DH 2PXYC 4XPAL 4JDTL 5ADPH 1S5IH 1D5ZB 2FBJH 1HSBB 3UTSD 1KNOB 3VA2C 1KB5L 2PN5A 3IDXL 3P11H 5F7WC 3S7GA 3CXDL 2MKLC 3KS0J 5DMYA 5I1AB 3QI9B 3RVVC 4TOYH 3MUGA 1MRCH 5FEBA 4L3EB 1I3UA 3L95A 3SKJH 5D1XB 1NSNH 4NKMA 3V0VB 2W0FA 4NN5C 1MCQA 1VHPA 3MUY1 1G6RB 4PD4K 2BRQA 3A67L 1QKZL 4QTHB 3EJJX 3TNMA 3UAJC 2X4NA 1INEH 1UCTA 1J5OL 4HC1A 4BK4A 4OLZL 1DBMH 5I1EL 1JN6B 4PJ8A 1CGTA 5E8OB 2H2SD 4DQOH 2AABH 3S36X 3RIFF 2VXVH 2KZWA 4LVHC 3VRLF 1RPQA 1ZANL 1A6TB 2AXGB 3V6ZB 4OFPA 3C8KA 5E08L 2BDNL 3FB8A 3RKDC 5INCA 2GTZA 4NYLB 4X7FC 43C9A 4WW2C 1IGIH 4APQA 5E5RB 3JUYA 1JPTL 3MRJA 4LLVA 2OYPA 4CAGA 2BVPA 4LAJH 3WLBB 2Y06H 2FZ3A 1FO0H 1J8HB 3O4LE 1FPTH 3TWCL 3SY0A 3ZE1F 4QXTB 1K8DA 4Y4KA 5DZNA 5CGYD 5IVZA 5CJQH 1N7MH 1WF5A 3GB7A 4OUUB 3NACH 1KCVL 3QZWB 2BMKB 2EDXA 4CJ0A 1A7OL 2FO4A 1ZEAH 3MXVL 3CX2A 2J6EH 3I3BA 2Y9RT 2DKMA 3CFEA 3RDTC 5BS0B 3L3JA 4JZNA 1FZKB 5E8EB 3WDJA 3A6BH 1KACB 4PJ9A 3H42H 5I19H 3H6JA 4M5YH 3LH2L 4U31A 5IFHL 1KIRB 3HI5L 5T1LB 4KZDL 2QADC 4H8WH 4FN0A 1M71B 3KXFE 2G60H 3TEUA 4M6ML 5HYQA 4IOFC 4PJ5E 4U3XA 2X1OA 4W4NA 4MAYB 2VL5B 3S98A 3QUXB 4PJAF 4MCYB 5KVGL 1AI1H 2X9XA 4KJQD 1WCBB 5DJ6A 2ZG1A 3G08A 4BFBD 4PJFA 4H0GA 2QSVA 5F9OL 5AWNL 4YC2B 3V4VL 2WWMC 3QHZL 5E2UL 3O9WD 3HR5B 1DCLA 3KLHD 3PE9A 3KJ6L 1JL8A 4UDTB 5E8NB 5I75B 2MOVA 3TVMB 3MC0A 3U46B 1I7TB 3O6LH 5C09A 1MWAB 4FQHB 1BD2B 3WNOA 4ZNEA 2BNUB 2DDQH 1I9IH 1NDGA 1HXMA 5KSBE 1WLHA 2VDLH 4ZO8A 2DYPB 1T04A 4N0YH 4J4PD 5IK3B 1UZ6F 3BPNB 4KJPD 3OJMB 2JB6A 4OT1H 4RFNB 3HI6L 3R0NA 4GRMB 2XZZA 1PFCA 4Z7VB 4Y5VC 3OR6B 1A5FL 3QR2A 4NO0D 2MPAL 1P4IL 2XN9E 4HKXA 3DV6B 1WISA 1IEAB 2V5YA 1UZ8A 3QEQE 4WFGE 4Z7WE 1F4XH 1IAKB 3MBED 1IQWL 1EZVX 2Y5EA 3I75B 3F58L 4TRPL 3GI9H 1MRDH 1E6OL 2OI9C 1MHPH 2I5YL 3B9KD 4S1QH 2AVGA 5IESH 4GMSL 3MGOA 1H3PL 1N3NA 3GMQB 3IFPA 4LLAA 3NCBB 1T0MB 5DTFB 1IM9D 3IFLH 3MLTB 3DYOA 2A83A 4PJAB 2NY7L 4UDUA 1TQBB 1N64L 2R69L 1LO2H 1I8KA 3MROB 4GAGL 2DQDH 4ZMAT 3T4YA 5D70H 3IFNH 2VN4A 5FYLL 3BQUD 1WWCA 4OCSH 2OZ4A 3O2DA 4EVNA 4PJIE 5HYEA 2H32H 32C2B 3ARDC 3VW3H 2NR6C 2NW2B 3HRZA 4X6BB 3HMXH 1DVFA 3RWGB 5J6GB 3VWKD 3SCMA 2C4FT 2IH1A 4RGNC 5KAQG 5HVFB 4OF5A 4JFHD 3HG1B 3QULA 3T0XA 5IFHH 4YBLC 2EH8L 3REWB 4HWBA 3SGKC 1QG3A 3QQ9C 8CGTA 3VFPA 2DMKA 2FCBA 5IHZB 2HP4A 2LU4A 3TO4D 2R69H 1AGEA 3R4DA 3C8DA 4ZUSB 1QFWM 2E7MA 5JIHA 2UVEA 3CFBA 1T7VA 3MJ9H 5ITFB 2XFXA 2BVYA 3OTTA 4Z95H 2VTFA 1OSZA 4I3RH 1PBYA 4DVRL 3JV6B 4P2OA 4TRPH 5GRVK 3MJ8B 1U91B 2X89D 3KPRD 5I1JH 1CLCA 1FSKC 4OCWL 1HCVA 4OCRL 3ULVD 5IMKA 3OJVC 1SY6A 4JPVH 4O2FB 4P99A 5I1LA 1MFEH 2XZQH 3BH9A 4M6NL 5ICZA 1MOEA 4UV7L 4ELMF 4OT1L 1BGXH 1L9MA 4Y1AD 2HKHH 2J7LA 1K4DB 5C2BH 1ADQL 1NKRA 1M6OA 5FFLA 1G7HA 5BCAA 1UG9A 4JFXA 1H15A 2IAMB 1HHKB 2VDNL 1DBJL 5DURB 5I1EH 3HZKA 3FHAA 3X3FL 2A77H 1ND0B 3GSVA 3P0YL 3ARGA 1AO7A 4PP1D 5B21A 4U1KA 5TH2A 1CIDA 2VQ1A 4C56B 1QA9B 5F9WC 3MCLL 3WUWB 3QUYA 4NUGL 3MRQA 3S36L 1CK0H 1YJDL 3QDGA 4BSWA 4HIIB 2FRGP 4PJGA 3JV6A 1EA9C 4TQEH 1CT8A 1CVRA 1OSZB 1T22B 4K2UH 5EORH 2YPLD 1QSFB 4U7KA 1BZ9B 5EIIB 5F3HB 4ZSOB 3RVUD 4NFBA 1W0WB 5A2FA 4LSVH 2Z35B 1BZQK 4M6OH 2EYTB 3NPSC 5HPOA 2CJUH 2W92A 1KIPB 1FYTD 2WWKT 2G5BB 5AYUL 1OSPL 1VESA 4JFOB 3ARYA 3T1FB 5EUOF 3BHBA 1MI5E 3UP1A 1D7FA 2X4SA 4PGDB 3AS3A 2FDBP 3BFOA 1A6UL 4IDJL 3DX9B 2H6PB 4OBSA 4FFWD 2RCSH 5HTSA 4BZ1H 4OGXL 2VLKD 3F7QA 2F8VA 5C08D 5F9WB 5DJXA 2WWMD 1LD9A 1RFDL 3LQZB 4MNGA 5D7JB 4QOKB 1VFBA 3ZLQC 3AM8C 4AM0A 4BFEA 4UINL 3VXUD 3G5ZA 4OLXL 1IGTB 1U36A 2ICWJ 4OCXH 4PB9H 5IF0A 2D3VA 1NBQA 5DD1H 1YN6B 1I8IA 1A0QL 1BFTA 2FLBT 4GQ9L 2NZ9C 4WW2F 1NGZB 4Y2DC 3FZUC 5KSBA 4OCNC 1P53A 1U0QA 3MLUH 4CMHB 4N0UE 3IDNB 1YECL 4XVJL 2YD3A 2F19H 3MLRH 4QXGL 4N90D 3TPUA 2UUDK 1OW0A 2HJFB 3NZHH 4RRPG 5ERWA 2IQ9H 1H8NA 3MCLH 2X4OB 3GSNB 1JVKA 2MQCA 2AABL 1MRFL 4F7TA 4PIRF 1T21B 5JW5B 1DEEA 3BISA 4C57C 3L1OL 2GK2A 3MYJB 5H94B 2VDQH 4WHTB 1MF2H 5T33H 1FC1A 3S97C 3JZ7A 2NLJA 1JZ2A 5IKCB 5D71H 1DBBL 1JGEA 4I0PA 4JPWH 1YY8A 3LS4L 1I1AB 4E5XA 3BSZH 4MD4A 3AXLB 4KWUA 4CW1A 4H20L 1N0XL 1WGOA 1B4JH 3T2NL 4M43H 4R0LB 4Z77B 1QLRB 3C6SB 4XPFL 4JZOA 2JB5H 4PJXE 1OTTC 3CFJB 1VFAA 1YYMH 3ALXA 3HR5A 2IBGA 2YK1L 1VACB 4Y7MA 4M61A 1U9KA 1XIWD 1A14H 5I1CL 3ARZA 5EUOA 1U3YA 4IRJA 1W72B 3IXAB 1NBZB 3GKWH 2W60A 3WSQH 5GGVH 3SDCD 5HYQB 4YBQC 5BZWA 3MYZA 3LEVL 3KYKH 3L3HA 4XP9H 3F7VB 4X6DE 3X13A 2VJXA 2Q86B 3OAUL 3MV8B 5L2KE 5C0JB 1KC5L 2Y7QB 5EU6D 5JDSA 3RGVC 1HSAB 2ZOLB 2R0ZL 4MAUL 5DK2B 3N9GH 4MA8L 3F6IA 4PJBB 4JO3H 3SDDB 2PXYD 1Z9SA 2B4CC 2JCCA 1FFNB 4X83A 4AEIL 3HI5H 3IVKB 1CN4A 4NQCD 1RZFL 4LSQL 3EJZD 3K1DA 4P4RB 3CX5J 2CO7B 3MNVA 4NM8L 2OMBA 4ZUTB 4PBVC 3PDDA 4JZOB 3H42L 5F6IC 4JVPA 2F74B 4Y5VB 3OF6A 5T33L 4YWGL 4NQCE 4JPIA 5L0QC 3DGGA 2EYSB 1OWRM 2ZPKH 3O11A 2NY0B 2AEQL 3IETA 4XI5C 3BIKA 3IFOA 4UILH 3ILQD 2HFFA 3ARRA 1P9MC 1FFQA 2R0KH 4RFOL 5K9OA 2DQHH 1I3RA 1ODAA 1CXIA 3VWKC 4Z7UA 4L4TE 2GCYA 1D6EB 1WT5A 5TF0A 2SEBB 3CK0H 1A1MB 3U0PA 1YPZF 3AROA 4R8WL 2BHZA 1JK8B 4OQTH 1AO7E 4RGND 1E27A 5JO5A 4YHYC 5TDPB 2FECI 2YD4A 4P9ML 1ZS8B 4X7EC 1DQJB 4OCXL 3N1QC 1FRGH 1MFBL 2XWTA 4HS8H 3RDTA 4KJWD 2PYED 4F9LA 5AG9A 3C9NA 1ROWA 1IAIM 2HT3D 3QHFH 3I84A 4K3DH 1ETZA 1U8JA 5FOBB 2QADB 3JTSA 4PG2A 3QDMB 4CVUA 4UZGA 5GS2H 1XF4A 3RWHB 4LLWA 1BX2B 4R3SA 3TZVD 5I1AA 1GPOH 1Q0YL 3LN4A 4XMLH 2VN7A 3GM0A 3SE9L 4DKDC 5EZIH 3VGDA 4MXQC 2X7LB 2LFGA 3CXDH 1C16A 1HKLL 5D1QD 1AKJA 5D7SH 2YN5A 4AH2B 1CG9A 2DBJA 4KAQH 1RUPH 1YMHB 4EN3C 1PLGH 4DGIH 2JCCF 2KL6A 1NANH 3SDAA 2XN9A 4RAHA 4Z76A 2Z35A 4DEPB 4G7VH 1AIFA 2Q6WB 2V5MA 1F02I 3S88H 4HIXL 1D5MB 4XMLL 1JTPA 3L5XL 4JFFE 4E42B 4NJAL 1AP2B 2WW8A 4JQVA 3LKRA 1W0VB 5C0EB 2J8UB 3FB6A 2I25N 3QDGB 2OK0H 5D93B 1ACYH 1NCAH 1ZAGA 4PRPB 4BH8B 4O9HL 3QUYB 2NZIA 4DGVL 4JHBA 2HKHL 4RZCB 3QIUD 4N8CL 1E6JL 1RJYA 1UA6H 3VH8B 5IVXB 1RIHL 2LV4A 2EO1A 5HYSG 3RWEA 2IWGA 4JPVL 3MMEA 1JGUH 1P4LA 3OAYH 5I9QC 3NFSL 2VLKE 3X12B 5J9PA 1M6OB 3FO9B 4CN1A 4DUVA 4L4TB 4X6EB 4ZFZA 3ELAT 4NN5B 1S9VB 2E27L 1MI5D 3TBSA 3W39B 1CFQA 3DROA 5IBTL 1L6XA 2ZSVB 5I73B 3QCVH 5C0RL 4O2FA 2DQHL 5HYSB 2BDNH 2R56L 4NQDD 1QHOA 3KPOB 3M1BB 1YUHA 4I3RL 5HDLA 3C87A 1KCRL 4FQ1H 5IEHB 2A9NL 3FO2B 4LU5L 5BMFL 4JDVB 1PGRB 1AY1L 1WBYA 2XG4A 2ZUXA 2ID5A 2YPLE 1JPGB 4M00A 3H8NA 2PYEA 1RZ8B 3L5JA 4JPKH 2YBRA 2NX5E 3CH1B 1YY9D 2X6MA 2FYYB 2PTTB 2FWOB 3T0VA 1U93B 4L8SB 3WFEH 3LRSA 3S3SA 3GSWB 3TYFB 3C6LC 4BQ8A 3VFPB 1M7IA 4JG0L 5F8QC 1MQKL 4EDWH 2DF3A 1A7PL 4Y4HC 1I4FB 4QHUA 5EBMB 5IJKC 3FO0H 1JI2A 1DBAH 2VERN 8FABA 2E6QA 4LPCA 4PRIA 2ADIB 3BH8B 4FQXB 3KVQA 3MBXL 1RUAL 5BVJB 3HRZB 4OZHF 3MJ9A 3QWOA 2XYCA 3O81A 4HKZB 5T1KA 2H2SC 4A2LA 3KPRE 3HI1B 4JAMB 3TPKA 1TQBC 4KDWA 5TDNB 2QSTA 5CUSH 2ICES 3IAPA 4O58L 4KFZC 3IYLW 2YK1H 1YEJL 3MA7A 1ZGLB 1DR9A 1NLBH 3U30B 4LRIA 4JB9H 4OCYL 4PRDB 5EFIB 5GS1C 5JMOC 3O41A 5K9JH 1U8PB 1B4JL 3T2NH 4B7IA 1P2CB 4PJHF 4LHUD 3UBXB 2P7TB 5TE7L 3T0WA 3ZTJH 3SQOL 3I75A 3LS4H 3L3GA 1DBBH 4UB0L 2H32A 1URLA 2GI7A 1YYLL 1KTDA 2NXZC 5DC0A 3FONA 2CK0H 3QRGL 2H1PL 3L1OH 4JFHE 5AZ2H 4IRJD 1MWAH 1VSCA 4PD4J 5FA3A 1LHZA 4XGZA 3PHQB 1REIA 3W9EB 4RDQF 3EYSL 4NCC1 3ARPA 4WI6A 3WFBH 2HN7B 4Y8AA 3DMMD 3HZVB 1FLRH 1FL5B 1ZLWH 1UM6L 1IAOA 2QBWA 2XPGA 1P7KB 3CGTA 4WHDA 4NHUB 2MQ0A 3D0LA 3HA0A 3N06B 4U1IA 5CP7A 2FGZA 3HI1A 5C09B 1I7TA 1DFBL 5GGTL 2XQYG 5GSVA 3RPKA 3ZYOA 1Q72H 1KGCE 4K3EL 3D39D 5BVJA 1RULL 4NT6B 3QUXC 4YLQT 2ADIA 1K4CA 2ZCKL 3EFFA 1FL5A 1YNTB 2DQFA 4Y16A 2VL5A 3KDMB 2I60H 4C83A 1EGJA 4P49A 3UDWC 1M71A 5E95B 1SY6H 3AM8A 1KJMB 5DJCB 2VZ3A 3EYOA 1JGVH 3PWNB 2GUOA 3F65A 1OTUD 3BIBX 1EEZA 1YEIH 4JQIL 1NC2D 1AGCB 3BN9D 3CU7A 4QCIB 4I2XE 4N5EC 4YGVB 5EU3B 3K4ZA 1RZ8A 5CEYB 5D72L 1OLLA 5B38B 1VPOH 2YD8A 4HIJB 4HHAB 5BZDA 3LPWA 3UBXA 3PL6C 4YFLI 4WFEE 3VE0A 5CIPA 1KGCD 3GB7B 3SGEI 1XT5A 5IVZB 3EYUL 4PRAB 4G6MH 1L6ZA 3VXUA 2B4CL 1MCWM 2H3NA 1ZGLA 2Q8BL 2EKSA 4PJDF 2A0LC 2BVOA 4NPYB 3D85B 4TSCL 2VLKA 4PS4L 4YNYB 3LS5L 3WIHL 4LCYB 1YPZB 4HZAA 1V8HA 4PJ5D 5DZOA 3ZDZF 3P9LA 4YX2L 4Z18A 4D0BA 1HEZB 3U4EA 3PWVB 4BM7A 4M9PA 1SEBB 2HLAA 4M6NH 7FABH 4UTBL 5KANI 4YDIL 3PWJB 1D5XA 5E00B 4PJ8B 2HLFC 4OD3H 2V2TA 4HLZG 5ID1A 4P4KB 5J3HC 1C5CH 1E4XI 3LPGA 3QIBD 4EQ3A 5J1TC 2I60L 3ULUF 2FBJL 3L7FA 3MRIB 1JNNH 4L9LB 2CDGB 4NQSB 4UTAL 4ONFH 3ARGD 4L8DA 4N0RA 3IJYA 4DN4H 4PP2A 2ORBL 2DJSA 5BJTB 1TPXB 5GS0H 4WI3A 1AKJB 1AXTL 2NY2C 1FVEA 1WBXA 4Y1AA 3B9AA 2XY1A 2H26A 3OXSB 4NKOA 3MRGA 4N0FA 1SHMA 5E8DL 2WK2A 5ALCL 1YUHB 2EYRB 3TN0B 4WCYL 3IJHB 1U58A 5J0BA 4HG4J 4XNZC 4RFOH 5GRJL 2UWEA 1X5FA 3HPJB 3L3IB 2FR4B 3L3DA 4JCLA 3SKMA 1M05A 3G6AB 3O3UN 4QHNA 3LN4B 5CIPH 4ZOAA 4CADA 3S35X 1JI1A 4L4TA 4X6EA 1PDKA 4YDLB 5F7MC 2OR8A 3JTSB 1CD9B 2JJSC 2FHCA 5DRNA 3PP3H 1FG2A 5ANME 2ATKB 2FJGA 5B3NA 1WZ1H 2NY2D 1JYVA 1MCEA 1ZLVH 4CMMB 1T7ZA 3BVNA 3OX8A 1HDMA 4XMPH 5TDPA 2YD9A 2D7OA 5L8LB 2R29H 1J1XH 1JK8A 2BNRB 4HZLB 3I50H 4NNXB 1I8MB 5DEFA 1K8IB 2AKRA 1W0VA 5HGBB 1V5JA 3MRRA 5HVHB 2VE6B 4MVBC 1QBMH 4Z78B 4LLYB 4K7PL 5JW4M 4KGJA 3LKSA 5T3ZE 5HPMA 3UJTH 4NQDE 4H1LA 4XP4H 2ARJQ 2F53D 4Y19B 4QWWD 3SCMD 5GPRA 3ZHKA 5JR1L 1CG9B 4PFEA 4P2QB 4WU5A 3LV3B 1NMBH 3ARBD 1ZHLA 2A6DA 5JHDA 1WBZA 5KSVB 1GIGH 2DIAA 1JNNL 2BHUA 3L5WB 5DJDA 4PJ9C 2Z8VC 2Y5TA 1DN0B 2AXHA 3D5OF 2CLZB 3GIZL 2CKNA 2FLRT 3BKCH 3RL2B 2I07A 2W0LA 3V52H 1S7VB 4PJBA 1XF4B 5H8DA 2Z4QB 2YD5A 4NZUH 5IOPA 3UZQA 1JTTA 1U8JB 4IOSD 5HJ3A 1QBAA 1U8MA 2A6KA 3MV7E 4QRQB 3ECBA 4M1CC 3WNNA 1T3FA 7FABL 4TTDC 4UNTA 2X40A 5BZWB 4Q9QL 1ZVSA 3EZJB 4IRZL 2XOTA 3MLZL 5EPMB 1R3LA 3VWJA 4GMTL 4XCFH 3VFWA 2BVQB 4PJCE 2B1AH 2X4PA 4LU5H 5E8PA 3U0PB 1F58L 1QQDB 4JKWA 3H3PL 2GCYB 1Q9LB 4ESKA 2YSSB 5T3ZH 2EEDA 2NX5B 2VOTA 1WK0A 5SWSD 1ZK9A 4OFYA 4ODWB 4X7TA 4ERSH 4HUVA 4MXWL 4WW1B 5C0FB 3OHXB 4AYFA 3O2VL 2WP3T 4LCIH 5C0AD 5GS0C 3HNTH 4D3CL 2C3VB 4KMTH 4LSRH 2G75B 1MNUL 1FNEB 1RU9H 4P5TD 2IALB 1EFXA 4J8RB 2MNUA 4RWYH 3QG7L 1HHGA 3O9WA 4JFQA 1JGEB 2PW1A 3ARQA 1EMTH 3ZT6A 5AAMA 4Y5VA 4JRXB 3VFVB 1FC2D 4L8CB 1C12A 3DBXA 4OKVA 5D96C 3OPZH 4I77L 2XWBA 3KNBB 4ZYKB 5C0BE 3SKOB 2GY5A 5ALBH 1VB9A 1VEPA 3VJ6B 4IDJH 4H1LH 3S37H 3L5IA 3STZB 4BELD 5FM5O 4BSVA 3IDMA 2OJEB 5IVXE 4Z7OE 1YEEH 4FFVD 4HK0B 4IMLB 4PJ9D 2DD8H 2VXVL 1I3VA 2DM7A 4MGXA 1FBIL 1YNLH 1KG0A 1J87A 4M6OL 4GAJH 2A6IB 1ZT7B 2CLRB 4ONOA 1HINL 1MFDL 1JNHB 3AVEA 3DTXA 4LKCB 2P8MA 5IQ7L 5EO1B 1UGNA 3RL2A 2P48B 2BC4B 4MSWA 5IEKB 4AM0B 3F7YA 2CUIA 5ILTL 2QLVB 2WQ8A 1VFAB 3QO0A 2Y23A 3BI9X 3ZL4H 3GMNB 4JEGB 1PKOA 1WBZB 2IADB 3V52L 5C0GB 5T1DH 5TE6H 1W0YT 1KEML 4P2QA 4WU5B 3TNNA 4OGAC 2YXFA 1T0NB 1UYWL 1DQQB 4I0PB 2NLJB 5IKCA 4KQ3L 4ZAKA 2EDJA 4OI8A 4XB8A 3CCHB 2YXMA 5KN5A 3V5DB 3MYJA 4NRXB 1ZWIB 3QIBC 1IKFL 5DEZA 4HW6A 5E2WH 4MNQE 3MCG1 2GFBB 2W07A 1G9NC 2W9LA 2HLFD 2EDFA 3BAEL 1SM3H 3V6FB 5C0ND 5GS1A 4PJGB 1WT5C 4Y4HD 2IANA 2VO5A 3D25B 2DWDB 4GRWB 3TPUB 3OB0K 1TCRB 3HMWH 1MLCB 2IGFH 4LFHG 5KZCD 4QNPE 1DE4B 4YUEL 1CU4H 4P48A 2IPKB 4XXDB 1YY9C 4YK4C 4K07A 4WRLA 5DRNB 2R29L 4U1SA 4JFXB 1MNUH 2ZNXA 5FA4B 3MO1A 4PRBB 3KG5A 3S3PA 3U0WL 3RZWA 3PWPD 5FKPB 3WNKA 2P43B 25C8L 3SE8L 2EH8H 2EDNA 1UJTA 3GNMH 3C08H 5F97E 1D9KD 1SQ2N 1X5GA 3FO0L 1ZA6A 4YPGB 1A2YB 3C60C 1SJEB 4EIGB 4S11A 1Z6JT 5I2IB 4GJTB 4G8FB 4P46D 1K5NA 2W91A 3PV6A 3TIDB 4MXVE 4PLKD 4OB5H 5KVEL 4P23B 1MLBA 5AD0A 5HHME 1CFVL 2XNAA 4MQXC 3P4MA 3TCXA 3IKKA 1WQVT 5I1DA 1Y6KR 4KROB 1M1SA 3WO4B 2HT4C 4HLZH 4QRUA 2GEEA 4MNGE 3CFDB 3KYKL 4NQSA 4XP9L 1KIPA 4N90E 3QXDA 1UKSA 3QDJB 5K33A 2AEWA 2AJSL 5K9QG 4O02H 5LXGH 4LVNC 2YC1A 4PJBE 4AL8H 3HC4L 4Q6IA 2OR7A 5DRXA 3WNMA 1AGEB 3PGDA 4XVTH 4F7PB 3QDJA 4HMDA 1OGAD 4JFPB 1OGAA 5DO2D 4Y16C 2DS4A 1UENA 5F7EL 5ID1B 2E7HA 3LEYH 4BSWB 4N68A 4JQVC 4O4YL 5I1HL 3QRGH 2RGSA 5AD0B 1W2KT 3QAZB 4JDZB 4P3DB 2XKNA 4HDIB 4PB0H 1NAMH 4YHKH 3GSVB 2NY1B 4LPYA 4LNRB 1WEJH 4NQVB 2V2XB 3R1GL 4KKBC 5KANG 1J8HD 4ODVH 4LCYA 4H0HB 5EOTA 1QRND 1JRHH 5FHAH 5GIRA 3UJTL 3ZDYF 1A7RH 2EKSB 4GSDL 4JB9L 2KDGA 1MAJA 1FYTE 1FORH 4NDMB 1G7PA 4J6RH 5KBNC 3CFKA 5EBWB 2ZUYA 3UTTE 3RVXC 3DUHA 5JIIA 2DMBA 1UC6A 5I0ZA 2IPUG 2K7PA 1J1XL 5A43C 4Z7WF 4OAWB 1PAMA 4F33A 3GSUA 4XVJH 4KDVA 1XGPB 1YDPA 2XFXB 4HIEA 2HT3C 3DV6A 4WV1C 1HXYA 5I16A 4LCCC 3I9GL 1L0XA 2IAND 3QAZC 3V0AC 4P2RA 3KPQB 3RL1B 2VR4A 2DQJL 4UI2A 2AAVA 5EU7E 1DUYA 4XPGL 5F96H 4CRPA 4Z0BH 1JIBA 1IL1B 4ODSL 2X2YA 4Y1AE 3WUZA 3C6LA 1PSKL 2DYPA 1YEIL 5ECJE 3OSKA 3HZMA 1G7IB 3MRCB 1GHFL 2ARJB 3B9VA 1Y6NR 3KPPB 3CFIC 2P24B 2C7UB 5C6PB 1A4KA 3IF1B 1BQUA 2AJUL 3NN8A 3S4SB 2BRRH 4PLJC 5J13B 2A9NH 3U1SH 1WIOA 4WUUB 4EDXA 5H35A 1I8KB 1CE6A 4NKIL 2VNCA 1M4KA 3VI4E 4G43B 1JHTA 4JRXE 1NMCB 4NNYA 5FM4A 2CDEA 4AENB 4M6AA 5I8CB 4UT9L 4TNVK 4U49A 4OF6A 3MLVH 2OXHA 5FA3B 4RX4D 1J0ZA 3FONB 1P7HL 3MOQA 1OF2B 3LKQB 3CVHA 2GT9A 1KJVB 3R8BB 3TLRA 1AD0B 4EI6B 4LOUC 5IQ9B 3DBXB 4RA0C 4GRMA 1KB9K 4Y4KB 4Y2OA 5A16A 4X6DF 5CBAA 4FA8A 1H0DB 4K7PY 1U3HC 4J8RA 1G1CA 4S2SB 4G6AC 3GJFB 2YRPA 5IG7A 3K4AA 3EDKA 3P77A 3T0EA 3MV7B 3BW9B 5ICYB 1F3DJ 1IGMH 1X5YA 5DJ2B 1AGFB 2HJKA 5C0FA 4JO3L 4HKBA 5DMIH 4ZFOB 3S96A 4MA8H 1G7LA 4GXVH 1EFXD 3QWOB 3V0WL 4XNMB 1LNUB 4DUXA 3OAUH 1BEYH 3N0PB 1BVZA 3FB5A 1MQ8A 4RMQA 5GHWH 43CAA 1BFVL 3GKWL 5L0QB 1F00I 3LMJL 3NA9L 2HFGL 2Q1EA 3IXTA 5JW4N 5FO9A 5EBMA 4MAYA 4X5XB 5BRZD 6FABH 1GXEA 1HZHH 4TSBH 1RIVH 1OP3K 1AE6L 1T3FB 4YQXL 5L88L 3FFDB 2W9EH 5HHOD 2DLGA 3ZKXB 3BPOB 4C59B 4JE4B 2A1WH 3D1MC 3TFKC 3ZKXC 1BMGA 2I07B 4X9IA 4TVPH 1KTKE 1UXWA 4DAGH 2OL3A 1HNFA 4XVUD 2OZ4L 5ACZA 5DJDB 3E6HA 5FB8A 3GJEA 2EEAA 3VFGH 4HGWB 3MRBA 1RURH 3ZKMD 5H37H 4M9OA 2CKBA 5JHDB 1MCPL 3TBYA 3ARXA 3PL6A 3VFUA 1KPUA 2M1KA 4K94H 1RUKH 3BEVA 1IM3A 1QSED 3UYRL 1HHHB 4S1RL 3H9SB 4NWTH 4MJ5A 3O2WH 3ZZ1A 2GJJA 4FG6C 2ESVA 3WHE1 4C56D 4YDJA 2DM4A 3FB8B 2EDHA 5HI5C 1A7NH 3NZHL 3WLWC 3RUGB 1DQDH 3I02A 1F4XL 3H9SE 1UM4L 5FO7B 4NC1C 1GCFA 3V8OA 2APWA 1RMFL 1S7RB 1RJYB 2AKRB 1ITCA 3IRPX 5AG8A 5IVXA 2MWCA 4XNUL 3TBVB 5HD8D 3MNZA 1BIIB 1NGQH 1OTSC 4L4VB 3D69A 2E3VA 3GIVA 5JW4Q 5D1QC 1VKXA 2WUCL 2ATKA 2FJGB 3GHBL 5F1OB 1NCAL 1WIPA 4TULH 5D2LF 1JMXA 2FJFB 3QXAA 4WJ5A 4CKVX 5ALCH 4NQED 1KEGL 4OFDA 4QRTB 1OAUH 4CADB 3S9DB 4GRLD 3FT3B 4QHLA 4H1LG 4J3SA 1M05B 1N2RB 3GEWB 2ICWB 2AK4E 3GZKA 4XMKH 2HFGH 3TZVC 2I9TA 5GS2D 4F3FB 3FQTA 3IJHA 5IHUH 1C16B 2B1HL 4JREB 4XC1H 2YZ1A 5T3XH 4M8QB 4M62H 1FVEB 1WBXB 4KJWC 3MRLB 2Z8WC 3FQNB 3H3BC 1YEFH 1ZHNA 1J11A 3W0WD 2BXZA 1A4JB 4LRNL 4KK9C 3EKCA 4HCRL 4WU7A 5D2LB 2Y6SD 3G6DL 3EO0B 1RZ7L 1N5AB 5DMIL 2G60L 1BM3L 1BX2A 4R3SB 1N0LA 4JFYA 3MODH 5LGJA 1NGXB 1YJDH 1A6AB 2GY7B 4XBGB 1Q1JH 3MRIA 4QXUH 2YMXH 4M4PA 4HS3A 3IS0X 3W81A 2R1YA 3WCYA 4N8VG 4CJ1A 1TTGA 4GRLC 4L5FH 4HUNB 2BY3A 4TNWK 4UBDC 1D5XB 3LS5H 4HWZB 4HEPG 3QIBA 1A1MA 3WIIL 3CDYA 4XCCH 1NJ9A 1LE9A 4QTIL 4FQQB 4WWKB 3ULUC 1KLGA 4KC3B 1IT9L 4HFWA 1KXQE 4X9BA 3E6FB 3BWUC 5IM7B 5KSAB 4CGTA 5CZXC 1I85C 5F1IA 1PEWA 1PKQE 4PJ5A 1KYOJ 2EYSA 2H3NB 3DXAB 3O4LB 3MLXH 3ROLB 5JQHC 4R90L 5CBEA 3JWOH 2D03H 1NUGA 1KJ2L 3VXNA 3M45A 2YEZB 4EXKA 4HHAA 4YBQD 3SDCC 2QQQA 1R5IB 5D7IA 4N5UA 4YGVA 4X8JB 2JIXD 4OD2B 5BOPA 4BZ1L 5IBLC 2D9QB 4YFEA 3PIQB 2QSCH 2ZOLA 1RZKH 1L9NA 3MV8D 2YPVH 3PGFL 3ZKMC 2Q86A 3UTPD 3PWNA 4PTUA 1KJMA 2A6JA 4UQ3A 3KPSA 5GISL 4L3AA 3O45A 4GW4A 3QJFB 1NBZA 4YE4H 4LRNH 4LSVL 1CD8A 1GH7A 4OLYH 5TDOA 3AY4A 3QCTH 3QPQC 4YXKH 1T80A 1MCNA 3V95A 3WFCL 3EFFB 3UPRA 1HHJB 1U8LB 3CSGA 3J7HA 4NT6A 3NABH 3GSNH 4TQEL 3V4PH 2GAZB 2XXCB 3VXMA 1M7DA 3FQRA 3CFJA 5EOCL 2PO6B 2JK5A 3DWTA 1CLYH 3LVEA 4MDJB 3K46A 2UYLB 3QNXA 3BT2L 4Y4FD 3DO7A 3T0EB 4AZ8A 1YN7B 3PXHA 3KYAA 5CBAB 1HH6A 1SYSB 3FN9A 4I3SL 4FNLH 3JWOL 1A7BA 4MB5A 1UACH 3B9DA 2WZPD 2FIKB 2QQNL 4XGZB 1DEEB 3SQOH 3N1MC 3D6GA 5J56B 4OGYL 3FRUA 4AT6A 5K9JL 3IDYC 5EC2B 4GKNB 2H32B 1IAMA 3PJSA 3L3GB 3SJVB 4IOFD 1DANT 3DRQB 2R0KL 2R2CA 1RJZB 3CSYA 5KSUA 3GUTA 1FZOA 3QDMD 2JKXA 3WL9B 5MEND 5DUBA 4M4RA 4K8RL 5J1AA 3WDHA 4P5MA 2CLVA 3DARA 3MLRL 3HE7C 1CE6B 1SMAA 3QHZH 1FH5L 4X6CE 4Y88A 1MVUA 3HC3L 3WXWL 3VG0H 4YHZL 5CGYC 5EDXA 5F7NC 2EC9U 4YH6A 5TJWK 4MNGB 1U3ZA 4PJCB 2R2HA 3QUZD 4ODHL 4OIBA 3A6OA 4V1DD 12E8L 1HI6A 2VQUA 5D7LA 5E9DE 4JFDD 5FYKD 5HGDB 2R8SH 3T0DA 1HWGB 4Q2ZA 4BYHA 2W38A 3CVIL 2XTJE 4PRID 3BP4A 4A2MA 3REVB 3NA9H 3BMVA 4AJ0A 4ZSOA 2X4TB 4PR5B 5LJYH 2V7HB 1HXYB 1A22B 1EBPA 3U36B 1QSFA 4XAWL 2R39A 2NNAA 4GMSH 1S78C 4NHCH 3B9EA 5GGRY 2Q8AH 4UT6H 3OAZH 5KS9E 1GZQB 1OP3H 3TH2T 4PG9B 3ULVH 4D9RE 3QDGE 2GJZA 3ULVC 2UZYB 1P4IH 4PJGE 1ND0A 4EOWH 2BNQB 3S36H 3G04B 3SO3C 3SGEH 2FX8H 3BSZL 4Y4KC 3QFJD 1RY7B 2ZSVA 1OPGH 4JPWL 4MNQB 4E0RB 3W39A 4FNLL 1T5XB 5EOTB 2Z91B 4GW1A 1S8DB 4DN3H 3QCUH 1YPZE 4PPTA 4KRPC 2K7QA 4NQXA 1DQDL 4Y0GA 3ARSA 5JW3L 4QYOB 4HAGA 2V2XA 4M7JL 2D7NA 5GRUL 5J8OA 2NY4B 2EXWC 2GJ6A 3LSOB 2AS5M 1MFEL 1E4XL 1TZGL 5F1SA 1BQSA 2IH3B 3H7BB 4PJEB 1ZVHA 1NSNL 4QXGH 5MHSE 5EN2B 1Z3GL 1LK3L 5HD8C 4D94A 4TOYL 5ANMB 5BXFB 2EDEA 1XGQA 4OF3A 4ZXBD 3QIUA 1EHLL 1AP2A 1Z0NA 1FE8L 1HKFA 4NNPL 3GMOA 1AIFB 4XPAH 2Q6WA 3HE6A 5D7SL 3WE6B 1NUNB 1FG9C 3M17B 5IHZA 4N0CD 2OR9L 5FKAA 5CKAA 2WANA 2EZ0C 3VFNB 1AR1D 2ZCLL 3REWA 5DHVB 2HT2C 5I1DB 4JFED 3KPSE 1X4ZA 3I2CH 4XH2A 3HE7D 2G5RA 1LE5B 1Q0YH 4EQ2A 1OB1A 1E28B 2Z93A 4DFIA 1G9EA 4LIQH 2JJUA 3GMRB 1ZEAL 2Y07L 3MXVH 4EI5A 4HGKC 1A7OH 3I6KB 2AI0L 3EOTH 5A3ID 1MCFA 5FKPA 1UCBL 4QGTA 1MVUB 3EBAA 3T4YB 1W8NA 4LCCB 5IUSA 4ELKB 5FF6A 1JZ3A 1F6AB 4UDUB 1ETZB 2PR4L 1EFQA 4O5LL 5MP6H 3BRDA 2XWTB 3GO1H 5KJRL 3O2VH 3PWUB 3IFPB 4JY6B 4JRYD 3CK0L 1FZOB 4FABH 4HG4K 4JY4B 4NBZB 4MJIE 4YEEA 5MI0B 3MPCA 3SJVA 3CPLA 3RDTD 5M95B 5T1LD 4IDLA 4S0SD 4IRSC 3B2UC 3MZTA 5DJ8A 4WWKC 2APVA 1YEGH 4X9HA 3UYRH 1FFOB 3INUH 4WV1A 1NFDF 5HGGS 1BGXL 5D5MB 3DRTA 4K3HA 3DGCR 5ISZD 1X5XA 1OPGL 5DD3H 5I6XB 5ESVA 2J6EA 4X6DA 1I3GL 3U82B 1BD2D 5CSZA 2IADA 1J18A 3QXWA 2DQEL 2JJVA 1JUFA 1BF8A 4EN3B 1ZMYA 2GAZA 5C0CE 3VXMB 5IEKA 1P7QB 4KKLC 2DBLL 5SV4A 3JWNC 4J1UB 4E41E 2DDQL 1OT2A 4G8IA 4LSTL 3ETBF 3DTXB 1Y0LA 4PJHB 1CFTB 1UVQB 2WINA 3TJEH 4O02L 5LXGL 5TDOB 1I9RL 5DUPL 2W0KA 5I1CH 3OKKA 3RHWK 3F7VA 1NEZA 2OM5A 2PXYA 5E9DA 5F21B 3WNLA 5DFVD 4ALAH 5I66A 2BHYA 3T8XB 3EOAB 2O26U 5ENWA 3FCTA 4HK3N 1FNGB 3GBML 4ODHH 1HIMH 1KIQB 5ESQA 4JZNB 1VACA 5ICXB 4P2YA 1N0XH 3CFEB 2Y72A 4DFHA 1ZGLP 3V6BR 3BP5B 1F11B 5DGRA 3I9GH 2FO4B 5I8KH 5CZXD 3I6GA 1FVCB 4LLQB 5SV3A 3VXNB 2H9GB 5EOQH 1XIWA 4JO4H 1MF2L 4R0LA 1KPRA 2UVFA 4PJ8C 5KS9A 4WFFD 4M7LH 1QUNA 1N64H 1PY4A 2FJHA 5C07D 3NACL 1UM5H 3CZFA 4KTDH 5HXMA 1MH5B 4WNQB 3PV7A 1VFMA 4PUBL 4WW2A 3E6FA 2CIKA 2J1KA 4HS6B 2V17L 4F7TB 1QQDA 2DTML 3MTRA 3V7MA 5EIVA 1RJLA 4OV5A 4G8GD 2X4OA 3T65B 1FO0A 1DANU 3V9FA 2FGWH 1A5FH 2C5DC 3PWLA 3RVVD 1IKFH 1R3LB 1RI8A 1K3ZA 1MCHA 4HJ0D 5CSGA 1II4E 4WTXA 4KQ3H 3HNSH 1EEYA 4G9FB 4BH7B 7CGTA 4TUJA 1RZIA 4JHWH 1KTRL 1U8MB 2A6KB 2W0FB 3I6LE 4RIRA 1IGFL 2DM2A 5D1XA 5C0CB 3VXME 5LGJB 3D9AL 5JXEA 5HY9A 5IF0B 1WSST 3ARFD 3DSNA 4L1HA 1RZJH 3ZL4L 1MY5A 5D7JA 1RUML 5IVXF 3MRLA 5FUCE 4WEBH 3FFCD 1IVLA 1P6FA 2X70B 4KKBD 4RAUA 4PJEE 5IW1A 5FDWB 1QNZL 1LO4L 2HFTA 3OKEA 3O8XB 4U4BA 4Y2DA 1A9BB 1LP9B 1L7TH 1UJ3A 3EAKA 1T7YA 4MMXC 2I9TB 2WBJD 4OF7A 2PCPA 5ID0A 1J0KA 5FYJH 1QFUL 3BKML 4LBEA 3H9HA 5HHNB 1F3JB 2FJFA 3PHOB 4YFLF 5GZNC 1YNKH 2AW2A 2UUDH 2F58H 2NY5H 3RJDA 3FOMA 4NUGH 2ZWLT 1RJCA 3S5LB 1FYTA 3FRPA 1JYWA 4HC1L 1CLZH 5IFAL 1J7VR 1BIIA 1T22A 1K8IA 4L4VA 5HI5D 4RAVB 4R96B 4LLDB 2BY2A 1J1PH 2FO1A 1RQ5A 4U1KB 4CMMA 5E1HB 2R1WA 1ZT4A 4RCAA 2B0SH 4WEUD 5DR5H 1PQZA 5F7KC 5F3BB 2XQBH 4I2XB 2AJXL 2HT4D 3S8WA 3H9HB 4PJDE 4MNHA 1AD9B 2RJMA 1GJIA 4PB0L 4XVUC 1EXUB 3FFCA 2PCPB 4QO1A 1ERNA 4JHAH 2VABA 3VCLB 4Q9RH 3KYMB 3U2SA 4F7EB 3WO3B 2BCKB 1UJ3B 1UKTA 3HS0B 5GRZA 3MRGB 1F58H 3PXJA 4LKXB 4S1SL 1H3VA 3EYFB 4ZFGL 2D9CA 5FB8B 3FKUS 3GK8H 1AGDA 1BOYA 1HHIB 3OAYK 1GAFL 1HQ4A 3RGHA 3DURB 1IGJA 3L3KB 4B53A 4L8DB 3MRMA 4YIQA 3UTZA 5GJTH 5HY9B 4KUZL 4OTXL 5BO1H 4WI5A 5J11B 3N50A 3KPRA 2X89A 2IQAB 3S35L 5F6HJ 1F6FB 1FLRL 5M7QA 4ZUSA 1X5IA 4G5ZL 4ZODA 4P2OD 5D2LE 1AJ7H 4NZUL 1N6UA 4X4MA 1KCUL 1EEYB 1NCUA 4G8GA 1RK1A 3BKCL 5L2KB 3C2AL 3HAEG 3P30H 3MV9A 3QO1B 1S9WB 4XBPA 1P4BH 1QACA 1BBDH 4UOW1 4ZPVA 3TO4A 3QBTB 4OCSL 1Z0MA 2QR0B 3MCKB 4RFEB 3FB5B 2XZAH 3PWVA 3DUSB 3WKML 3TT3H 1I1AD 2X41A 2XKUA 2NY7H 3P9LB 1KJ2A 4H88L 5M94B 3HNVL 3FL7A 4WFHE 1P9MA 3S96B 1ZE3C 2VXSH 2HJKB 4LDOB 4BZYA 3F12A 3VWKA 1A1OB 1CICD 1WTGT 1NC4D 3B2VH 3RWFA 1EV2E 1XGYH 4OZIA 1DVFD 1XF2A 5B39G 3P77B 4K55A 5EULV 1XAUA 4RGOH 5TQ2H 2QKIA 3JWDL 1QOKA 3EHBD 4F15C 4LIQE 1CZ8L 3GGWB 1JRHL 1C7TA 1NMAL 3T0EE 1CVSC 1GGBH 2ADGB 3DVNA 3MNWB 3I6GB 1E4KC 4JM4H 4QHKJ 2NY6D 3G6JA 3KPMA 1RU9L 2YD7A 1IM9A 5B38A 2ZCHH 4MD5A 3TT3L 4OZGF 4OFIA 5EU3A 1T1WA 1HOCB 1NGWB 4L4JA 5E2JA 1AGCA 4KKNA 4YDLC 2R4SL 4XPTH 3OR6A 4O4YH 2FEEL 1NFDE 3ARVA 3H3PH 2NTSP 4M7LT 3VH8G 1Z5LA 5DYOB 4NQTA 3LKNA 1CFBA 4C83B 1J0YA 3NOIA 3VXSD 1AJ7L 4KK8D 4Y16B 4AEHH 4N0UB 2HVJA 1R5WB 4Q0XH 4N8VB 1FZMB 4U6XA 3EW3B 1A7QH 2AP2A 4Z6AT 5JXAH 1BBJA 1B9ZA 3KS0H 1ZLVK 1BD2A 4YXHH 4TVPE 1DL7H 4J4PA 4ZDHB 1D6VH 3PP3K 4QNPF 5GSRB 4RISL 1DZBA 4PJCF 1XF5A 4M6MH 3NZ8B 1MJ7H 2F54E 4U6HA 1QR4A 4X6DB 2XPGB 1LVEA 1R0AH 4U6XB 3H7LA 4KRNA 4N8VA 4YXLL 1CL7L 4M5YL 4QRRD 3GNML 4P4KC 1T20B 2O61B 4PJFF 4EI5C 4ZUWB 3W9EA 2HVKA 2ICEA 3MRPA 4M1GH 3QUKA 2J6EL 3MLSL 5KOVC 3H2WA 3BP6B 3KLAB 1G84A 1EJOL 1GGBL 4NZRL 4HIEB 1T1WB 5EB9A 5E8EA 5TPWH 4LVOB 4OAWA 4F33B 5LWYH 4YX2H 1EAPB 4GT7A 3MRHB 4W6YB 3HNTL 3DECA 1U8PA 3CLEL 2P49B 4JO2H 1K8DB 5GJSH 4ZTPH 1G7PB 3V7AE 2QKIB 4OLUL 3DO3A 3UMTA 3HB3D 2DN7A 5EZJA 4OQTA 3VWKB 4APQB 1TVDA 4K7FA 3J8F7 3CLEH 1A47A 2B1AL 3ES6B 3HE7A 4GUPA 4HKZA 5T1KB 4PJDA 2K9UA 4GKOA 4ZD3L 2MKWA 3DX8B 5DO2C 2CKBL 2V7NA 1J5OH 4IRZH 4K7PX 2QR0A 3MCKA 3PQYB 1ES0A 5I8EB 4ZPVB 5HHPA 2A38A 3MLWL 3VFMB 2H45A 5DHVA 1JHLH 1RZJL 2EDQA 4LNVA 3QO1A 4JGJA 3TVMC 3ILPA 5FGSA 5IJKA 1M7IB 1QSZA 2VITB 3PNWB 3M17A 1BFSA 2O93L 5EU4B 4OM1H 1NBVH 4F7PA 1KB5H 3IDXH 2LTQB 3P11L 3LRSB 2XA3A 1U93A 2R2BA 3GMOB 3EO9H 3LIZL 2RHEA 3GSRB 4NJ9L 4CVXA 3C60D 1D9KC 4U0RB 4OCLC 4XAKD 1YQ2A 1D6VL 4FQPA 5IMMA 1U95B 2V2WB 4WTWA 5F9AC 1Q9WA 1QRNB 2NY6C 1IFHH 1Z3GH 1F3RB 1H3UA 3LKPB 2AJXH 3PUCA 3KYNB 5DRZB 4XVSH 3WBDA 1KV3A 3EHBC 2EH7L 5F96L 1C08A 2FEDC 3TBSB 1Q9KA 5D96B 4D9LL 1ZGLM 1XGRB 1OCWH 3ULUE 1A3RL 1QYGH 5ETUA 1OAKH 5DT1H 2I9LA 1YEDA 2E8YA 1TVBA 3D2UD 1PQZB 4LLUB 5LG1A 5JNYA 2P5WD 2GSIB 4X6FB 1QSFD 4U1HA 2WM0A 5DLMH 4L3ED 3AUVA 4UIMB 4KTEH 3LQMA 5I8KL 5JHDE 4OLUH 3U83A 3E2HB 1XCTB 4G7YH 5GS1B 1C5DA 1T7WA 5E6ID 3UC0H 2DI8A 3T3PF 3GMLA 4QRPE 2P5EB 4JO2L 2F5BL 2KKQA 3KLDA 1K2DB 3WHXA 4Z76B 1QLFB 4HUUB 1KCSL 2VLRD 1OY3B 2ZG2A 4LPWA 3HMXA 2WLZA 3ZKSD 4KKAC 3NIGE 2R9HD 2R1XA 5C08B 2XA8H 4RQQB 2CUHA 5TFSL 3TJEL 2ORBH 1OLZA 4KDTC 4XCNB 1OD9A 5L9DH 4ONFL 5DJZB 3WIHA 3KLSA 1FFPA 3L6FA 4ZTOH 3V6OA 3Q1SH 4W6WB 5EH1A 5JXEC 2ADFH 2HJLB 12E8H 1M7XA 4MJ4A 4I5BA 3QDHA 3P30L 2MMXA 4KK6D 3K0WA 4HXBL 3PP4L 4U33A 3RA7L 4Z7QE 2ADJB 1JNHA 5DHXB 4KQ4H 4XVTL 3LCYA 4G6KH 4M5ZH 3WDIA 1IRAY 4N5ED 4LHUB 3PDGA 2P5EE 3G6JF 3W9DA 5JHLH 1DFBH 3QNYB 2BY0A 3WN5A 4G9FA 4U6YA 4YHIA 4HK0A 4LGSB 4ETQB 1UB6A 4ODXA 1HWHB 1H8OA 4MJ2A 2VSCA 1T1YA 4WO4D 4K8RH 3SDAC 3RVWC 1QBML 5F7HA 2FX7L 4DZ8A 1RJLB 5ADOL 4HX1A 1OW0C 1ONQB 2ED7A 4DWHA 3SKOA 4AT6B 4MA3A 3QUXD 1MAML 2EDYA 3T77A 3RZCA 4NZDA 5K9OB 2OJZL 2GSGA 3KGRA 5H37G 5DMJB 5HYJD 5C0DA 4A6YL 2EC9T 4Y4FA 1ZA3A 2E5EA 3VFVA 3TF7C 2AQ2A 1GYAA 5I9QB 3OQ3B 1SYSA 2BJMH 4MA1B 1CDHA 5D8JL 3H0TB 5ESAB 4N1EA 4O51A 1WFUA 3IT8D 5D72H 1V3JA 2DB8A 1CU4L 3BZDA 3LKOB 5FECB 5JPMA 4HH9A 4KK8C 2EH7H 5IB3B 4HUVB 1VGKB 5C0DB 1UADC 4XVSL 1OAYH 2GSGB 4KRMB 1A1NB 3PABB 3FQRB 5CEZL 1CFNA 4AG4L 4PGCB 4RBPK 3SKNA 1WV7T 4OZGE 1KIQA 2WLYA 4LVNB 4FP8H 5ESQB 1FNFA 1ACZA 1RHFA 1FGVH 2CGRL 3DMMC 3UPRB 5DK2A 5DD0H 3I2CL 1T1YB 2KBGA 4NCC2 3MV8A 5EU6B 4LF3B 5ELIA 1FSKB 3MV9E 1UB6B 1YMMD 4OF0A 1LWRA 1ZVSB 1LEKA 5EO0B 3L7EA 4LEOB 1OVZA 3PQYE 4P23C 1JPSL 2OTWA 1KT2A 4YXKL 1CQKA 2NXZD 4QRPD 5E2VL 5GS3A 5HJ3B 4OLYL 5GGTH 3QYCA 2HH0H 2Z4QA 2BSTA 1U8HA 1ZV5A 5EC1B 1KFAH 3SPVA 4HT1H 4XRCB 1MHCA 1R24A 3CMOH 4L3EE 1DN0A 4QWWC 1RUMH 4WDIB 1QSFE 3SCMC 2LU3A 3DX7B 3K7UA 2BERA 4LSDA 3KJ4C 4OZIE 2PKDA 5KSVA 5KTEL 3OKOB 4QF1A 3OGCA 4HKJB 1QRKA 1QO3A 2R4RL 1K85A 2L0DA 1T66C 4W6XB 3DXAA 4R9HA 5EU5A 4ZFFA 4PJ5B 4YHLH 4ZPTA 2QEJA 3WD5L 3C09B 5DQJA 4OI9A 3BWAA 4ZFGH 3G6JE 2L7JA 1G9ML 4H1LB 1XR9B 3JBG7 3QSKB 1NFKA 4ZOEA 5FYJD 2X10A 4Q9RL 3WYRA 1MFAL 1AHWB 4OQTL 5E1AB 1F4AA 5C0RH 5F7FA 4ENED 3BP7A 4P2OC 2GQHA 2D2OA 2VE6A 4BQCA 2OQJA 4IMKA 3IDGA 4XAKE 1X5AA 3GJFK 2HJFA 3DV4A 5ERWB 4ZOCA 5LWYL 4HWUA 3BN3B 1UT9A 3OG6B 4U1HB 4DVBA 5K59E 1PKQB 4FTVB 4N8CH 1QFWL 2WWKO 5DD6A 2X09A 4JM2A 1J1PL 3O8XC 4WUUE 2P45B 2BZDA 4XBGA 2E9JA 4F9LC 1XF1A 5JZ7C 4NM8H 4Q7DA 1ORQA 3I6KA 3QDJE 3ARGC 5E94B 1Q1JL 4QXUL 4YXLH 5IR1B 1RZFH 2GTWA 4LSQH 3TBTB 2ERJC 1LD9B 1MQKH 3GMPB 2NW3A 4D0CB 2NZ9D 4L29B 5ADOH 2X05A 4NKDB 4NQEA 4PGEA 2DQIH 3CSPA 3OGOE 5DURD 1KCKA 2ICWA 3T1FA 3FRPG 4GG6F 1JFQH 1G7JA 3G9VA 4Q9QH 3WV0A 1QBLH 2R0LH 4Y5XA 3GSRA 4JN1H 5DGQA 2IFFL 4CNIB 3RFZC 4X7CC 3WHXB 4A6YA 3SE9H 3CVHH 1VKXB 1WZMA 3OBAA 3U7YL 5IGXH 1AXSB 3QWQB 1XGQB 5KVDL 5A2LH 4G8EB 4JKPH 1CT8B 1AR1C 4P4KA 4JQXC 4WWKD 3RWCA 1S7TB 4D0DB 3B2UD 2R56H 3ROOB 1MWAL 2YUZA 1MCJA 5AZ2L 2G2RB 4JHWL 3H3KA 1OWWA 1T2JA 3QCUL 4C56A 4HS8L 3SDXF 2ESVD 3ZYJA 3AREB 4IIQB 4YZFE 3U4EB 4XP1H 1DQLH 5JUEL 1TTFA 4W81A 3D3VA 4HWBH 2D0HA 4XHJD 4HPYH 4YDJB 1BVKB 4QRRE 2CIIA 3BGMB 5IMLB 3D85A 1L4IA 2HWZH 4E0RA 5D1ZB 1ED3A 1ZVYA 2NXYB 5EIQA 3T09A 1A6VH 4N0YL 3JWDH 4MMZC 4NO5B 1ACYL 5IMKB 1UXSB 3MRDA 5E6YA 2BNQA 1XGUA 5A3IC 5E5MA 4PYGA 4E9LA 5AEAA 5D7KE 4NJAH 1FJ1B 1S7XB 3AS0A 1SBSL 3GJEB 4ETYA 1IAIH 1B2WL 4LASL 3B3IA 2DLFL 3EDFA 2ZUQC 5C8JB 2DJ4A 3FT2B 3V4VH 3JWOC 2VDRH 5I17B 1NAMB 3IU3B 3RUGE 1KJ3L 5ITFA 1LO5A 4HUXA 2V7HA 4UIKL 1I75A 5KVGH 1EEZB 1C5BL 1JGDB 2ZG3A 5FV2A 3FFDA 1C1EL 3ARWA 5EG6C 2VSDA 4ZUWA 3PNWA 4ORZC 3ILPB 4MDIB 4Z7UF 4RMVA 1RZKC 5FO9B 5EZIL 5DI8B 3F7RA 2DQFB 3KXFB 43CAB 1XF5B 1BHGA 1K6QH 2EXWD 1LNUA 1AXTH 1MCSA 3T0ED 2R23B 5GRYA 3Q5YA 4XI5D 4DN4L 3SQBA 3X17A 3DX6A 4NSKB 3EYVA 5SWQB 2C9AA 1AGFA 2F15A 4RMTA 5GGQH 3MX0A 1WICA 1DLFH 1R5WA 4IRSB 3FMGL 4S2SA 5HVHC 4ISVA 1BZ7B 2HN7A 5EBGA 3SDXA 3WL9A 4WY7H 2RQ8A 5GGRB 4UV4H 3NIDE 5L6YL 3BQUC 1JHLL 4HQQH 4FXGA 4X5LA 3T2PA 4ZUVB 5JOFB 4FZEL 1D5BB 3BO8B 4LCWD 5DSCA 3RAJH 1RVFH 4XC3L 1G7QA 2GT9B 1QVOA 3LN5B 2GYSA 2WIIA 4CU7A 3N1PC 3MQIA 5F8RC 4NO3B 3RU8L 1S78D 3TCLB 4X80H 2UY6A 4M7JH 1RAMA 1A21A 2ATPA 5DSCB 4DKFL 2YUXA 5IB4B 1YEGL 3G6JB 3QUKB 2Q3ZA 5I18L 1CLZL 4HUWB 1Z9LA 2R0WH 1LP9E 2XZQL 2FX9L 2Z8RA 4G43A 5SX5K 5CJXC 1WAAA 3MODL 4AEIH 4HBCH 1MCBA 5FGCB 5I1JL 1CXEA 4MAUH 3U46A 4YDVA 1A4KB 2Q8AL 2PNDA 2J5LB 4MZ3A 5IHLB 4JFDB 2P24A 3C6LD 3BKJH 3QUZC 4LHQB 2JJTA 3V8CA 3GFUA 2CXKA 4L9LC 2BSRA 3SGDI 2VZVA 4XAWH 3BXNB 2J3SA 3U1SL 5GGVL 1XR8A 2Q7NA 3OAZK 3TO4B 2FATH 4G9FE 4GRWF 4M7KL 3QUXA 3L5HA 1EHXA 4CU8A 3MV9B 1X7QA 3M8OL 4M3JA 4KVNL 1ZLSL 4FFZL 1IC4L 1RK1B 2FSEB 3MBEB 3LD8C 1O0VA 1EVUA 4RGNB 4GW5A 1J86A 5C0BB 1AH1A 1MCDA 4OZGB 1BJ8A 2DQTL 1P69B 1OSPH 5DQ9A 4U1GC 3CH1A 5AYUH 3IU3A 5DFTA 3HHRB 5I71C 1C1EH 3LAFA 4P9MH 5JW4R 1IM9B 5C09E 1EBAA 3BYTA 4ZNEE 2P4AB 3D18B 4HF5L 4XCEA 5L2JB 4XWOC