1ZOXA

Clm-1 mouse myeloid receptor extracellular domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
110
structure length
110
Chain Sequence
EDPVTGPEEVSGQEQGSLTVQCRYTSGWKDYKKYWCQGVPQRSCKTLVETDASEQLVKKNRVSIRDNQRDFIFTVTMEDLRMSDAGIYWCGITKGGLDPMFKVTVNIGPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords CLM-1
publication title Crystal Structure of the Mouse CLM-1 Ectodomain
rcsb
source organism Mus musculus
total genus 29
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zoxA00
4JG1L 1RUML 4HG4K 4PGCB 4NCC1 2XTLA 3VMPA 1S9WA 2BFVL 4R26L 5EA0H 3KG5A 4OCYH 4PGBA 3RJDA 2ZUVA 1U8LA 3IDNA 3MRCA 5DURD 3V8CA 1YZZA 1IKNA 1LP9F 4L1DA 4WW2B 3EYSH 1DQJA 3BUYA 4WV1C 1OGTA 4FFWD 4PYGA 3PL6B 1K5NA 5SWZB 4JFYA 4XBEL 1CL7H 3GJEA 3MUZ1 4QTHA 3QUKA 4XWOD 5HGHA 1MHEB 1V7ML 4WUUE 4HUKB 4PY8J 3VMNA 4ZOEA 5GGRY 4BSWB 2JIXB 3GSWA 4QRQB 3RGVB 5J7CC 3CFBB 1A4JB 1DLFH 2YD5A 4KDWA 1DQLH 3RWGA 4PV9A 1E4KC 5KOVC 5DK0B 2Z8WC 3GZKA 5KVMC 4NUGH 5F9WB 1RZGA 3GHBL 3UTOA 5DYOA 1CU4L 5ACZB 2F53D 1J87A 4GLRH 3GSVB 4J23A 5DRXB 2Q8BH 3UTTE 4PGDB 4NQUA 1DUZB 2AV1B 4UDUB 5IB5A 4YFLF 4XCEB 4MMXC 3WD5H 5DD5L 4MYWB 4EUPB 4YDKH 2QKIB 5DJCA 1UENA 5EZJA 4BSVB 4M6NH 4PBVC 4FQ2L 4N0FA 4Q58C 1UCBH 4RGMB 3CDYA 5D1QC 4F9PC 5HBBA 1VFBA 3UXFA 3A67L 1U8OB 1IGCH 5DK3A 3OPZL 2DIBA 1D5XB 2VL5B 3WXWH 1LO4H 4KZDH 1I7RB 1WTGT 1ZSDB 3WV0A 2F53A 4S1DD 3CLEH 3L6FA 5HHOB 2O5XL 2IGFL 3U9UA 5KVEL 2GK2A 3EAKA 5DQJA 1TXKA 4Z95H 3ZYZA 3BZ4B 5DD0H 4XBGB 1FDLH 1OAQL 5HYIA 1XGRA 1HYRC 5E7FA 3GRWL 1ZEAL 4WI2A 3HNSL 4LVEA 5IR1A 4HS6A 4MJ5A 4GAJH 3N1MC 2D2OA 1DL7H 1TLKA 5L2KB 1IM9D 3SE9L 2CMRL 1UG9A 2VISB 5C3TA 4KHXH 2Z4QA 3LKOA 4K3EL 4FTVA 1XCQB 1BOGB 4XH2B 3KHOA 3W39B 1MCEA 4D9RD 1FZJB 3MGTA 1AE6L 3P4MB 1NGZA 1IVLA 5F21B 3GI9L 3DNKA 1ZVYA 3MOQA 1MREH 1D7FA 3LEXA 4HWBL 4KHTL 1MPAH 4XNYL 5FKPA 3ZHDA 1YQ2A 4N9GA 1IM9A 1X5YA 1LQSR 2BSSB 1IC5L 1K2DB 1MFDL 3ESVF 3ARGA 4XMKL 4Y2DD 5HHNB 3RA7H 2H2PD 4WU5B 1OQXA 2X4SB 5DJXB 4XXDB 2B8OT 3P4NB 4HFWB 3HE7B 3VJ6B 2J1KA 1R0AH 3L7FB 5AZEL 5IMMB 5FF6B 3TA3D 3NN8B 5EO9A 4JM2F 4QNPE 5I71C 5F8QC 1I7ZB 4O02L 4OCSL 1OCWH 3PNWA 4F7CA 4UT6L 5DD1H 4K2UH 5JR1L 2HYMA 9CGTA 3V4VH 5F7FA 2AGJL 3LQAL 3MRRB 2A9ML 3REWA 5IHZB 3JTSB 5GIRA 3ORJA 4GXVH 1DTUA 4D8PB 1R3LB 3QH3A 4Y16D 3BKYL 3QXDA 4KUZL 5EPMB 1NFIB 3GBLA 1M7DB 3CH1B 3KJ4B 4M1GL 5FO8B 3HRPA 4YWGL 1FIGH 2YS4A 3WFDL 4XCNB 1VEOA 1UA6L 1N2RA 2L7JA 1T22B 4NN6B 2Y36H 3T09A 3A0OA 5AUMB 1PYWB 5HYJB 15C8H 3UDWA 1X5AA 2XKNB 5I1HH 3B9EA 1FL5A 4KPHH 3ZTJG 1BFOA 4Y16A 2D3VA 4OZFA 1NJ9B 3ULSA 4GW5B 3EUUA 4ONFH 2W9DL 4ZPVB 1CFBA 4EI5A 2XFXA 4M7LH 1A7PH 4CJ0A 4I0CC 4GRMB 2Q20A 1DUYA 1INDH 1TCRB 3MLZL 3QZWA 4G7VH 4PJGA 5BRZE 1R24A 4XCFH 1DQQA 5K93A 2Q8AH 4HIIB 3BAEH 3CC5A 5I0ZA 3TN0C 4YK4B 2N56A 5F7HA 3AM8A 5KTEH 1X7QA 3DROB 2A83B 2OL3B 3U0PB 4HLZG 1EXUB 1P5UA 2DQFA 3GNML 4B5EA 5EDXA 4PJAF 3PDOB 3FB6A 1MJ7H 1C1EH 4PJXA 1DN0B 4G8FA 4Z7NF 1RZJL 2R23A 4XNMA 1T3FB 4H88H 5TE4L 5MERB 2Z91B 4L3EE 4LGPB 4OF5A 5L9DH 3NA4A 5ID1B 3QWQB 2AJ3A 2O5ZH 2AJSH 5C71A 2IAMD 4M61B 5B38A 5DEGB 3KYKH 1UB6A 3V79C 1T6VN 3RVVD 3QQ4A 1RMFH 3V6ZB 4O58L 4HK3N 4HGWA 4LLDA 5HGBB 5KAQF 3MCLH 2YA2A 1QBLL 5CIPB 1CYGA 3VA6A 3NCFB 4JY6B 2DICA 4X9IA 4GKNB 1AQKH 2NW2B 2FBJL 4H1LB 3B2VL 2EYSA 2X44D 4LEXL 1OT2A 4YGAB 2DQGH 1YMMD 2RFXA 4FXKA 4JVPA 1RZKL 2BVUA 4I4WB 4U33A 1S5IL 4NJAL 4NUJA 3K4DA 1FL3A 2M2DA 1AGCB 1AY1H 4HDIA 1EUTA 1JGLH 1FG2A 1HCVA 3DVIA 3INUL 1U92B 4JANB 3MLTB 3TBTA 3BP7A 1A7NH 1EMTH 3OKDB 4UIMA 1BF8A 3ARFB 3TT1L 1MFAH 4OQTH 2Q3AA 1ZT7B 3HC0B 4OLUH 4X6BA 3T04D 4MAYC 1KPUA 3H7BB 1ZV5A 2DYPB 1YEFL 1RIUH 2O93L 3UJJL 1RUPL 6FABL 2CD0A 4MJID 1AXIB 5GHWH 4Z76A 2VIRB 4WEUD 1OTUC 1S9YB 4JZJB 1WBXB 3FN3A 5EIIB 3BMVA 2IMNA 1SJHA 1EEYA 1WV7T 2XY2A 4M43L 3S96A 1AP2A 3OJDB 5F7UA 1J0HA 2JJVA 5GJTH 3K2MC 5FYJE 4H5SA 1CLYL 4GG6E 4QRUB 3G5XA 4P5TD 3WNKA 3JWOH 1CDUA 3Q3GA 5I6XC 3T0XA 4TVSa 3TNMB 1ZLWK 3JVGC 4MJIA 5ESVA 1YEEH 3UTPD 3OHXB 2HA1A 1AO7A 1R3HA 2QHRH 4WUUD 5FGCB 5ESQA 1U8KA 4WW2F 3L3DA 2BVOA 3VWJD 1MCQA 1LD9A 4GAGL 2XNAA 1IGIL 1CCZA 4KQ3L 2Z31B 5T1LA 4L8DB 5I8EA 3KPOA 3FOLA 4JLRB 3B2UD 4KDTC 3CVHB 3H0TA 3OKNA 4OZHB 5EB9A 2HWZH 4IRJD 3NA9H 4ODUB 1G7PA 1TITA 4MD5A 4KJWD 4WUUA 4XCCH 5JMRA 4MA8H 1VACB 2VZUA 3VWJA 5J06A 5A2JH 3HNTH 3P4OA 3QUXC 4MAUH 4D0BA 3RVUC 4XP9H 3HS0A 5IJKC 1PX3A 1W72H 1BVKA 2IG2H 1WQVT 2YD6A 3H6JA 2VL4A 3A6BL 3CAFA 3PHOA 1T21B 5HI5C 5T1DH 5IW1A 4NO0B 1MEXL 1F4WL 1KLUB 1C7SA 1X4YA 1UQSA 1EV2E 2P8MB 2YD3A 1KCSL 4UNTA 3DBXB 3DX7A 1OLZA 4XNQA 3MNZB 3WUWB 1SJEB 1EK3A 7FABL 2UUDH 3DMMD 1FIEA 1UADC 5JLZA 2NR6C 4Q9QL 4Y4FD 3ZKMD 4D3CL 2HKFL 1DBJL 2XWBB 4CAGA 3WDJA 1N7ML 3S37H 5EC1A 1UM6L 3KR3H 2XN9E 4NFDA 2DMKA 1ZA3B 3EKCA 1OY3B 4JHBA 5D8JL 3DARA 3EFDH 3WIFB 1C16A 1PX4A 2ZUUA 2ERJB 1YQVL 3S6CA 5E2JA 5JW3L 2X5PA 2FX7H 2MOVA 4GKSA 4ONGL 3TWCH 2CDGA 2WANA 5LVEA 5GS0D 5I18H 2QADD 4Y4FA 1PW3A 3UJIL 3IRPX 5L88H 2X6MA 3U83A 4RDQF 3WS3A 3OKLA 2NXYB 3U4EA 5ISZB 3CCHA 5IBLC 1RJLA 2WWMD 2OCFD 5E8OA 2HH0L 2FEDC 3LQZB 3O4LE 3C60D 1H15A 4LLYB 3QA3A 1Z9SA 1A9EA 3DXAD 4NKMA 4D0CA 4LPTA 4WW1B 4PUBH 4F8QA 2AEQH 4KROB 4Y4KA 1EFXD 2CKBH 5ADPH 3PWNB 1NUNB 2OK0L 4OLXL 4YAQA 4XNZB 2PXYA 5E03A 4XAWL 4Z8FH 2VNCA 1G0DA 5D1XA 1KENL 1EEUA 4J6RH 5FB8B 5CP3A 3UJTL 3MCKB 1YY8B 1FJ1A 3P0VH 2Y23A 2DRUA 5EULV 3SDAB 4UQ3A 3VRJB 1N59A 3SKNB 1I8MB 4R90H 1F6FB 4LKXB 4PGZA 4Y19E 3V6FA 2WQRA 3IU4L 3SE3A 2NMSA 4HPOH 1EFXA 5GRUH 1MFCL 2R0KH 4U3CA 3TFKD 2GT9A 1U0QA 4NJ9L 5T3XH 3H9SE 5HY9B 2JJSC 3ET9F 5JHDE 3AU1B 1IC4L 2N4IA 1MHHA 3GBNL 4X80L 1CT8B 2QBWA 3OBAA 4X4MA 3SKJL 4K3JH 4MXWL 3PWUA 4U1KA 3BVNB 1KYOJ 5D7JA 4UV7L 3CNKA 3V5DB 4HH9B 3TPKA 2IPKA 2IQ9H 1X4ZA 1ED3A 4KK8C 5B8CC 3TBSA 1MCFA 1KB9K 3T8XB 2ADFL 4R3SA 4U1LA 3IJSB 5TFSL 4KRNA 1GAFH 4QRRD 2A6JB 4MXVE 2HT4D 2J7LA 1S3KL 1RAMA 4J3WA 4NRXA 1D9KD 1ZMYA 5F3BA 1SM3L 1ULVA 1X5HA 2QSCH 3ARED 3J8F7 4P5KA 3RDTD 1FN4B 3NIFE 2D0FA 2ZCHL 3VXSB 1LO3H 1KEGL 1BQHG 3VXPB 1QBBA 4HS3B 4OFYD 1U8IB 4U1HB 3MRQA 3PV7A 4PV8A 4C4KO 2D0HA 1YNKL 1T2QH 1EPFA 1JZ7A 1BJ1J 4Z78A 5HVHB 4HBCL 3SKUD 1CGSL 5J9PB 3G6AB 1IGFH 5FYLL 2R9HD 1D9KA 1E6OH 4K94L 2OL3L 4ZXBA 1N4XL 3VXUD 1YJDC 4YZFF 4ZDHA 3ARBC 3HZVB 5J4MA 4I2XB 3RDTA 5EIQA 1Y6NR 2H45A 3PABA 3MFGB 1ZLVK 2FNBA 5F88B 3TVMD 3VXMB 1TTGA 1MCDA 4YHIB 4JVWA 5E4EC 4O2CB 4IDJH 5AAMA 2JELH 4ZUUA 2ITCA 4YHLH 5CEZE 3D3VB 4LQFL 3WDHA 2VLKB 3N06B 3K7UA 3HLAA 3GIZH 2PR4H 4KJPC 1J05A 2NZ9D 3VXUA 2X1WL 5GGTL 1IGMH 1MI5E 3VW3H 4GOSA 3GBML 2DQCH 4PJCF 4R0LA 5C08D 3TVMA 2R2BA 5E94B 2B1HL 1VFOA 4JG0L 4P9MH 5TDNA 4X7TB 1P7HL 1G9NH 2APXA 5EC2B 4JQIL 3TO4D 5IOPB 1E4KA 2B4CC 1BZ7A 1V5JA 4ZO7A 5TF0A 4DTGL 3VRIB 4O2EA 5TPWL 3VFMB 4MDIA 5CEYA 3ZDXF 1AD9B 4HJGB 4ZS6C 1MCOH 4X4XB 3QDMB 3OJ2C 2DQJL 2J5LC 3VGDA 1F3RB 3DRTA 4S0TD 3V2AR 4OLEA 2WUBL 5BQ7B 3CFKB 4Z7WB 2COQA 3D9AL 3SDYH 3TO4A 3K0WA 1W2KT 1NEZA 1YEKH 2R69L 3AMKA 2F8OA 3WXVL 3E3QC 5J6GA 1BOYA 3P0YH 5IBUB 4MXQD 4KVNL 1PG7W 3VH8G 5IK3A 3AC0A 3MLRL 5LJYH 3CXHJ 4YGVB 4RMSA 3LN4B 5DMKA 3X11B 1CLZL 4JZNA 3NGBC 1X6NA 3WIHA 1Z6JT 4Z7VE 4PLNC 5IVXE 4XT1C 1NMAH 5JW4Q 1KC5L 4F58L 1P9MC 4KK9D 3BXNB 2ZG1A 3AS0A 3BP6B 1OGAE 4GBXD 5EU5B 3H42L 3D0VA 4LDOB 3TNNB 3U4BL 1J1PH 8FABB 1P6FA 4FFYL 4M1DH 4ZAKC 4MVBD 5IVZB 5DRNA 3O45A 3CSYA 3VFVA 5DSCB 4PB9L 5F1SA 3H9YA 3EO0B 4XMPH 4LAQL 4ACPA 1I1FB 4H20H 1Q9WB 2EEAA 5DJYA 4TNVF 1ZLSL 2AKRA 1HCFX 3CVHL 4E5XB 4H0GA 1J8HB 4L4VD 4PS4L 4GBXA 1I85C 1AR1C 3MOAH 4JFFD 4PP2B 2ILLA 4OZHF 2XICA 4P57B 4KTEL 1FNAA 4JVUA 5I19H 4Y5YA 4ZFOA 4C83B 4S1RH 1SBBA 4HWEL 4LSTL 4PJEF 2G9HA 5CGYC 5BMFH 2X4RB 1SY6H 1VKXA 3DI3B 4QWWD 2W60A 1EZVX 4ZTPH 4L4VA 4IJ3C 4ZO9A 1P1ZA 3IVKB 2A77H 5DLMH 4K3GA 4JFFA 1NGQH 3GSRB 4NQEB 4JGUA 4HCRL 4JPKL 2A9NL 3QULA 3DWTA 3ESUF 3WL9A 2KDGA 4G8GB 4EOWH 3U0TA 3WCYA 2EC9T 4OCRH 1A02N 4WRLA 1ONQB 5DEFB 3ME0A 3B9AA 3C08H 3MNWA 2YZ8A 5CSBA 2BVPA 5LWYH 5AWNH 1JV5A 3ZZ1A 5GRJH 3LZFL 3LKNA 4DJMA 1S8DA 1WSST 3MSPA 3H7LA 4XB7A 1I1YB 1JGUH 1A1NA 3EO9H 3MV8D 3GMMA 3L5WB 1KBGL 4OLYH 3WE6B 2AXGB 5JXED 1OP5H 5MHSD 1G9ML 2BVEA 4GS7B 4DKEH 3C6LB 1D5ZA 2XN9A 5M94B 4QKXB 2YA0A 3QEUB 5F9JA 4X99A 3GDBA 5BCAA 3QNZA 3QUMH 4PJ5B 1C5CL 3P73B 4BH7B 4YBLC 2VLJE 3F7VB 1H8OA 3FL7A 4RGND 4P3DA 1HILA 4LHQB 4FQXB 4RA0C 1NGPL 4LF3A 3VGHA 4WJ5A 1U2CA 1S7SA 5JIKA 4LHUB 2EDKA 4FQIL 4WNQB 3RWHB 1MY7A 3W82A 1UJTA 3UBXA 1LK3L 2WIIA 5JXEA 3IJHA 1UKSA 4NZRL 2RJMA 1LK2B 5EA0L 4HFUH 5I8KH 3THML 1OB1A 3MRBB 4OUOA 4KKBC 2AQ1A 3QFDA 1U41A 4WTZA 1XGPB 1Q94A 3GMPA 1WWCA 1CL7L 4KKLC 4I3SH 4QHMB 1NCCL 4JFEB 1D3CA 4Q6IC 1L6ZA 2I60H 4FFVC 4MZ3A 1XZ0B 1G7JB 4QOKB 5SWQA 5D96B 2R56H 4JRXE 5B39B 4PRNA 2G75B 3WFZA 4XRCA 1FLRH 5F6IB 3N0PB 5DC0A 5IMKB 2ARJA 3IGAA 5CGTA 5HD8D 5SWSD 4K8RH 5KS9B 3MLYH 5I1JL 1MCWM 5IBTH 2X4QA 3OR6A 3ALXA 4JRYE 2GAZA 3C2AH 4X8JA 3ARTA 1KB5A 4YHKH 5F1IB 1P2CA 3LV3A 4LVOB 5I66B 4ODTH 3JWDC 3MJ7A 3W0WB 5L8JB 2V5TA 1A8JH 4YDKL 1KJ2H 3BP4A 4JO1H 2NY1B 4QHLB 4XHJD 1U8HB 1FNGA 5FYKL 1FVEA 2YPVH 4GRLD 4ODHH 3N9GH 3RIFF 4U6YA 3IKCA 2HKHH 5BOZG 4CADA 4DZBA 1ZKAA 3KPSB 2FATH 3MLVH 3EJYC 4WY7H 4NYLA 4TPRH 2ZUQB 5HDQH 3WXWL 1CFSB 2WBJC 3CLEL 3UTSD 4KZEL 2MSPA 3K81A 4KMLB 2LFGA 1E28A 3HI6H 1ZANH 3QCTH 2I24N 4H8WL 3OJVC 4TVPE 1FDLL 2R2EA 3LHPH 4JFPB 1TQCC 3WJJC 4HKZB 1IC7H 2FWOA 4MAYA 4G8IA 1E27B 4GRLA 3L3GA 3VFSB 5FV1L 1OWRM 1K8DB 2H26A 3FB8B 1XGTA 3ROLB 3BRGC 1DL7L 2VLRE 1RK0B 1GPOL 5DTFB 3UPAA 3HMXH 2X4UB 4KHXL 1N0LA 3QPXH 3C5ZB 5DJ8B 2UY7A 2JF1A 4BKLB 5C6WH 4LLVA 3NFPA 4OCNC 4U1NA 4OFKA 4EN3B 3V9FA 1J12A 3KPMB 1S7VB 1UGNA 3OJMB 3ZKNC 5AEAA 4YX2H 3HRZA 1IQWL 2EDNA 4MA3B 4Z77A 3QHZH 4YDIH 2F5AL 3LB6C 2H41A 3DUHA 4OIIH 5MEQA 2Z93B 3JVGA 5C9JA 5D72L 1CDYA 2VABB 3L9RA 5DQDH 1CDGA 5B3JF 4ONOA 2ESVD 2LTQB 1YN6A 5DVMA 3HC3H 1R3JA 5I73C 3RA7L 1Q9OA 3B8SA 1S7WB 5HYSB 1FNEB 4UQ2A 5EWIH 3RVUD 3QXTA 1F58H 5GGSA 5I1AA 3QEQB 3BWAA 1HHIB 2NW3B 2GCYA 2R0WL 2X9WA 4RZCA 3HI5H 5MP6H 3NZ8A 2P7TA 2YC1A 3OAYH 1YN7B 1NC2D 2WNGA 1KN4H 3P4LA 5DS8A 2DKUA 3CXDH 1IAIH 1GVIA 3LMJH 1QTYT 5C09E 2V2WA 3T65B 1KPVB 2Z92A 1PKQA 2VRAA 5SX4H 4Z7UE 3I2CL 2NZIA 5BO1H 5TE7L 5KSAB 1T0PB 3ILPB 4PJAA 4HHAB 3W9DA 1NC2A 1C5DB 1LHZA 3PUCA 1MJUL 1FGVH 1YDPA 1ETZA 3G9VA 4JY4A 5FO7A 1CBVL 2YPKA 3LEVH 3AB0C 3I6GB 1YPZA 1JWMA 5KVFH 1ZOXA 2Y36L 4MDJA 1RJZA 2BJML 1CLOH 1J0KA 2LAAA 4JDTL 3T3ME 2X4NB 4YLQT 4WTXA 2DWEA 4X4ZA 3RY5A 3TIEB 3IU3A 5CJBA 2CUMA 1R3KA 5FGBC 3KLAB 5IMLB 4EDXB 2BNUA 4PGEB 3M8OH 1UKTA 3C8HA 3GJFB 2FEDD 1KTRL 4G7VL 3IF1B 3Q48A 3T3PE 4Z7VA 3TCXA 1HHHB 3DO3A 3RX7A 1EAPA 1JNHB 1MCNA 1OGAA 3QUZC 4LCUA 2VAAA 3BMWA 1QRNB 5HHXH 1TZGH 1U8PA 3M1BA 1CZ8L 3BH9B 4EBQH 4O4YL 1V3LA 2CIIB 2ZG2A 3L3KA 2KZWA 1N5YL 5E2TH 5C0CD 3R1GH 2VDLH 1WT5C 4PJHB 5EU7C 3ZTNH 4X7DC 1QSEB 1PSKH 2E7BA 3HUJB 1GXEA 2G5RA 1DANT 2CLVA 3O3BB 1G0YR 4RFOH 2P47B 1WAAF 1Q38A 3ARDD 5CKGA 4UB0L 5I30H 1BQLH 3V0VB 3GSQA 1GGIH 2JJWA 4HLJA 4QGYA 4L8BB 3KYNA 3A6OA 2DJUA 2XA8H 2XWTB 5IB2B 1I1AC 2OXGA 1AXSB 3ZKSD 2R29H 5E8PA 3E1F1 4JFZL 3O6MH 3ARDA 5A16B 4NNYA 3P9LB 3G08A 2WBWB 4JDVA 3NACL 4B50A 4OFPA 1E4XI 2JJSA 1WICA 3HE6B 4PRIB 1PBYA 4TSAL 3BW9B 2YD8A 1UM5H 1T7ZA 2AERT 2Q1EA 4HUUB 3KPNB 1UXSA 1KIRB 5DJ6A 2Y07H 4GJTB 1JI1A 4OGZA 3QEHB 3CJJA 1EMTL 1OAYL 1ZHKA 4TOYH 1EGJA 1MFAL 4AIOA 3MJ8A 5E95B 1BJ1H 5B8CA 5D2NC 4NKIL 2Y9RT 2X7LA 3ULVD 1FZKB 2Y25A 4NQXB 3ECBB 3O9WC 3LS4L 3QUYC 5DMJB 4AEHL 5GHWL 5E8NB 4YDVB 1MCHA 3VRLE 4ELKA 4DKFH 2YD9A 5HHME 4QXGH 1DZBA 1SJXA 3BGAA 4AM0A 4G42A 1CFNB 3BD3A 32C2A 1FSKB 4YHOH 1RHHB 2KBGA 4I77L 5E6YA 1II4E 4X5XB 5FA4A 3EW3B 3JWOL 1I1RA 1FLTX 4QRSB 4WHTA 5E5MB 1JGVH 4UOJA 3O8XC 1T0MB 4E9LA 2JB5L 3ULUL 4M1CD 1A6WL 1SJVA 2OI9B 4CNIA 4ZS7H 4M4RA 3FO9A 2CO6B 1SVZA 2VXSH 4P46C 1UWGH 2A0LD 2BMKB 3C5JB 2QHRL 4U1GB 3TYGH 1MFEL 1HSBB 3ULUF 4XPAL 4P4KD 5EBWA 2GW5A 3NVQA 5HYQA 5KN5A 1A0QL 5JORB 1H0DB 3WYRA 4P2QE 2GJJA 1LEKA 5ILTH 3TZVC 2AJZA 3FO1A 3FZUC 1MOEA 3CU7A 3NTCH 3BIKA 1QHPA 2JB6A 1MHCB 3IXTB 4A6YB 5GSVB 2HTKC 5IB4A 1ORQB 4R7DA 1BQSA 2HWZL 4UINH 1A6UL 1I3GL 1HQRA 4DVBA 2OJEA 4N0CD 1H5BB 2YPLD 3U30C 1MCLA 4XCCL 1FVCA 1T1YB 4MA8L 2XZAH 4V1DE 5J13B 5D7IB 1O7SA 1CXLA 5C7XH 1T7WA 2AK4D 4AT6B 2GSIB 5KS9F 2D4FA 2YWYA 5IWLC 4MAUL 3ZHLA 3PHQB 4JRXA 2IG2L 3LIZL 3BQUC 3GSNL 4LU5L 4ZUWB 3HR5B 3WEXA 1XIWC 2ADJB 4HKXB 5MI0C 3IJYA 4QY8A 1MLCB 1FRGH 3SCMC 2MFNA 5K9OB 4I3GA 3WIIH 2W0PA 2OTWB 3SE8H 4AK1A 1A9BB 3U7WL 1MCJA 4W70A 3OGOE 2AK4A 3F8UB 1OTTD 1TVDA 1QFWI 4NM8H 3TJEH 1ZHLA 3DIFA 3RNKA 4L3CA 1L0QA 5HHVL 5GRVK 4MJ4A 5DHVA 2EDYA 3V4UH 4TTDD 3P30L 5ELIA 5F7EH 3S37L 2V7NA 3G5ZB 3UTZB 2UVEA 3PXHA 3OL2A 1DBKH 5FUZH 4G9FD 5AYUL 4YHPA 4OV5A 3EFDL 1BFSA 3FB7A 4WIQA 5LQBL 2VDPH 2CUHA 4GSDL 3BH8A 3G5YA 2P8LB 2X4TA 4LL9A 2P8PA 1C7TA 5I18L 2QJDA 3FQWA 5GSRA 2J8UB 4LPWA 3SDDC 5JPMA 2VXUH 2ZWLT 3SDXE 2NY6B 1X5IA 1P9MA 3QUMB 1I7TB 1QVOB 2XTJC 1RVFH 1D6VH 1JRHH 2D7OA 1FL6A 2VDKH 4G9FA 3D18B 3PP4H 3GKWH 3PGDB 2C1OA 3SQBA 4DGVH 1LDPL 1WC7A 4Q74A 1CS6A 1K3IA 1RIHL 1TVHB 2V17H 1YNTB 4C56B 5GS1A 4ZFGL 5EU7E 4MNQE 4JFQA 3E6HB 3O3AA 3L7EB 3TBYA 2PNDA 1RJYA 4OB5L 4N0UA 2Z8RA 4EIGB 2UWEB 2F19H 1I85A 3P0VL 5DGQA 5ID0A 2MMXA 3RPIA 5T1MA 4X4YB 1U3HB 4OZFH 4PJ7E 2X4OA 1SYVB 3NCMA 1VESA 1R6VA 4OBSA 3RVTC 1KJMA 4XMLH 3X3FH 4QXUL 2R0KL 3CDGB 1DBBH 1GZQB 1KF9B 3MLSL 2GUOA 1KTDB 4E41E 3KDMA 2F15A 3TT3L 3MRIA 1BD2D 5T3XL 3CFCL 4RFEA 3VXRB 2E27H 4P48A 5DFVD 2GJ6E 4MSWB 4PJ9B 3KYOB 1Q9KA 2FO4B 2QL1A 2CRIA 4FZ8L 1KCUL 2VXTH 4RISH 4CDHA 2H3NB 5C07E 1I7UA 5I9QC 5KSBF 4MCZA 2C3WA 4Z7UA 4ALAH 4WO4D 1UB5A 3OAUL 3O3DB 1TVBA 3VG0H 2APVA 3QNXB 5IF0B 1HSAB 3MRPB 5BJTA 1IC1A 2ZSWA 1BD2A 1GAFL 3DUSA 4X6DA 3ELAT 3OKOA 1G7HA 1K6QL 5D2NE 3GSUA 1FVDA 3CVIH 4E0RB 2R2HA 4JKLA 1FG9C 3O2DL 3ZE0F 4TUKH 3BT2L 1HH6B 5F89B 4JM2C 1OARL 4GW1B 5KBNC 4WO4A 4G6MH 3U36B 5CBAB 4X6CF 3QIBC 5EU6D 5A2LH 1AC0A 4XVTH 4LIQH 5HHQA 2DQTH 1T2QL 5I75B 2YUXA 1XF3A 2XQBH 3F58H 3GK8H 1UXWA 1WGOA 4U6HB 4KKBD 4UILH 1E6OL 4OZGF 5K9JH 2WP3O 3C09B 2EE2A 2HT2D 3LQAC 4X83A 4ZNEE 4DQOH 3S9DB 2NY4C 1KCLA 1LMKA 2N7BA 5ENWA 1TNMA 1FCGA 3K8LA 4P49A 3LEYH 5EU6A 3REVA 1M1SA 1QFWH 2BHYA 1EVUA 2A6KA 4PJIB 2YUWA 1MELA 5F9OL 4PJHF 2XZZA 5C0DA 1G7LA 3HUJF 2V7HA 4OLVH 1AGFA 5JHLL 3E2HB 1MCIA 1AJ7L 2PR4L 4IRSB 1G0XA 5IGXL 4ODVL 3SE4C 5JZ7C 1XFPA 4PJDE 5D7KE 1EZVY 5CLTA 4O00A 1X5LA 1JGEB 1WBYB 1R5VB 4J3VA 4Q6IA 1RZ8A 3L3IA 1MWAB 4K23H 5ABDE 3D2UB 43C9A 4OIBA 3ARSA 2RAMA 2FJFB 1JNNL 3BPLB 1G9NL 3K1DA 1CFTA 3LKRA 1JWUB 4M7KH 1VB9A 1IGJA 1P7QB 2VMFA 4HMCA 4JKPH 3FB5A 4LSQH 5BOPA 4LCWD 1JN6B 1HQ4B 3S88H 2HLAB 3BIAX 3GIVA 4JO4L 2B7DT 4ENEC 4LSSH 1UC6A 1YEDA 4BM7A 1ORSA 4WUKL 1OAZH 1JPFA 4Q9RH 3JSSA 3FRUA 4PYHA 1I8LA 3MJ9A 5FA3B 4CU6A 3UTQA 4Y5XB 3LRGA 5KVDH 2ZCLL 4PTTA 1UWEH 2EH7H 4H0IA 4U0RB 1FYTB 5DJDB 5GISH 1RZJC 5F7DA 2DF3A 3RWCA 3DGCR 5FO9A 1QBMH 4I8DA 1A4KA 2HVJB 4Q2ZA 4LCCA 3FQRB 4M7ZC 5T3ZL 1YEJL 4XPGH 5I76B 4LRNH 2WBJA 5FUOH 2PTTA 4KKAC 4PJEA 1NCUA 1CR9L 3SKMB 5EBMA 4F7PA 1XGQB 5HHPB 4L9LA 1KGCD 3ILQD 2XZQH 4L3AA 5GGRA 4CVZB 1MY5A 4K9EH 1G6VK 2IFFL 5EUKA 1KXQE 5FOBA 2ITDA 5EU4A 2X4PA 3JUYA 5TDOA 5E1AA 5DJ2B 3GSXB 3GMNB 1UJ3C 5CILL 3TBVB 2XTJE 5IHUH 2Q7YB 2EIZA 1IEHA 1EDQA 1AHWA 3VG9C 2X09A 3FT3B 1RZKC 3R4DA 4KTDH 2B2XH 2ARWA 4WEBH 3OMZA 4J8RB 5GS2H 2VZ3A 3UMTA 1G1CA 1QLRA 4A6YL 1HIMH 5GGUA 5ICYB 4JKMA 3QDGD 5TE6L 2FSEA 5BV7B 4KI5F 4YHNA 1KNOB 3MOAL 5D7LE 4PJFF 2F58L 4P2RE 3VWKD 4F9LC 4P2QA 3O11A 1CD1A 4M00A 1Q0YL 2IANB 5I19L 2ICEB 5F6HJ 4U1MB 5E8EA 2P5WE 3X14A 5D7IF 3GEWB 4ZTPL 4EVNB 4X5WA 1NCAH 4OAWA 4JPWH 1A3LH 4WHDA 1YEGL 4X0KB 4LNRB 4YXLH 2IQAA 3VWKA 2YKLH 3PGCB 4MCYA 2OR8A 1OP9A 4IRZL 1Y6MR 4U7SA 5DHYB 4WEMB 5DUML 4JQVC 2P5EB 2XRAH 4YXKL 5EU3A 1RZFL 3T1FB 1AKJB 3SO5A 2VDMH 3PL6C 3LPWA 5GS0H 1JZ8A 1WIUA 1S9WB 5D5MF 4PGBB 2J4WH 4PRDA 3MRCB 2C1PA 5INCA 5JOEA 1G7IA 1DQJB 4S1SH 4PD4K 3BUYB 4R8WL 1OGTB 2PYED 5CP3H 5C0AB 1K5NB 3RGVC 3MV7E 3PV6A 1UZ6E 1AIFA 3QPQD 1ZHBB 2CK0L 3WS6C 4QTHB 1TFHA 3QUKB 5IT2H 2E7MA 2I27N 5IFJA 5E2UH 1MIEL 2AI0L 3PP3K 2Z8VC 3BJ91 5F9WC 4Q9BA 2V2XA 3QUZD 3P2TA 4UV4H 4FQJH 3GSWB 5FGBA 3QUML 4NQDE 4DGYH 5H37G 1BECA 5DURB 4PV9B 1P4BL 1CGUA 1N8ZA 3MLUH 2PYEA 3LRSB 1U8JA 1EJOL 1RZGB 2YK1H 2IH3A 2CKNA 4K7PL 4RGMC 2B1AH 4HFUL 3GM0A 5IB5B 5C2UB 2P1YA 3ZYJA 1VCAA 5DGRA 5DJCB 3WFCL 2JE8A 3QUZA 5J12B 5EZJB 4HIXH 3TBWA 4NZTL 1V3KA 1BGXL 4OZIA 2GQHA 4I3SL 4L8CA 3G6JF 4C57C 1XF2B 4YBHA 2QSQA 1WT5A 1U2HA 1NGXA 3WO4B 3G6DH 4MNQA 2VO5A 3GMLB 3EJJX 4RAHA 2F53B 5SX5H 3L6FB 1MAML 3U9UB 3CUPA 4W68A 4XZUA 1YECL 4NRYA 5B21A 4B0MM 1H3PH 3VFTA 1JI2A 2GJ6D 4BQ6A 1FLRL 3B9KD 4L8SB 3WSQL 5I17A 3L5XH 1JYNA 1Z0MA 1XGRB 3MLYL 5IBTL 4PJ7A 1H8NA 5FHBH 2ENYA 4HS6B 4M7LT 3RIAK 2X1PA 5FKAB 1KEML 3GMOA 4DZ8A 5ALBH 4IS6A 3OGCA 4X9FA 2BRRH 2X1QA 2DIAA 4F57H 5TDPA 3SDCD 3RZCD 3MA7B 3ZDYE 5BXFB 3QFJE 1EO8L 3EYQC 2Z4QB 2YPVL 1SEBA 3MFFA 3O4OB 4Z7NE 2GJ6A 3B9KA 5GS3A 2VH5H 1JYWA 2PUQT 4ODHL 2MKWA 3MGTB 4MMZC 3MRHA 4WFED 2YN5A 4OIAA 2BY3A 4HWZA 2C26A 4WY7L 2H8PA 5HDQL 2J8OA 3LEXB 4EKXA 4B7LA 1RPQA 3HE7C 5IP4A 5FKPB 3O2WL 2WWKO 4N9GB 1ZANL 1IM9B 5EUOF 3BEWA 4P5MB 1ND0B 1QFUH 3KXFD 3SDCA 3RZCA 1D5IH 4IOIB 2B39A 5I1CH 5D2NA 4YPJA 3O8XD 1JMXA 2WK2A 5JIHA 3O9WA 1RUQH 1CFVL 2G2RA 3PWPE 1IT9L 1GIGL 4HJJL 4FA8A 1QSFD 3MRLA 4PG2A 1MAKA 4FG6D 5EO9B 3F12B 4OD2A 4XPHH 5CS7A 1GCFA 4OSUH 4YFLI 3PNWB 4ELME 3KXFA 3UBXI 4UNVA 1F2XK 4HIEB 4Y2DB 2O5YL 4ZSOE 5DWUH 2D7PA 3KPQB 3KJ4C 3O8XA 1ZWIA 4OIIL 3TV3H 3C6SA 4LSDA 1INEL 3REWB 4FFZH 4CBPA 4QRTA 5L6YH 3E6FB 4ZNEA 5GIRB 3MGAA 1CDIA 4PJIF 2AW2A 3R0MA 4P46A 3QH3B 3GSOA 1RUAH 2VQ1A 3TA3B 2BHZA 35C8L 4EQ2A 1RULH 2FECI 2HJFA 3QXDB 2BNQD 2Y7QB 2PW2A 3HC3L 1NBZA 2IWGA 1JMZA 4FABL 1MWAL 3EYUH 1T0NA 3UZQA 5EWIL 4QRPE 5EZOL 1KTLB 3TZVA 1EVTC 3GJFK 4QEGA 5EZLA 5MP6L 3BO8B 3IS0X 2H1PH 1IKFH 1IM3A 2UYLA 2Y5TB 3WIHH 5MEOA 4KUCF 2DM2A 1HK6A 1F5WA 1FL5B 2AEPL 3OAZH 1BFOB 4FXGA 3CXDL 4Y16B 1FQ9C 3S36X 2C3VA 4ZUVA 1FYHB 4PREA 4MQ7A 2EH8H 2BNQA 5KANI 3I50L 4YK4C 1FE8L 1H3VA 4U1IA 1Z9OA 5FYJH 5IWLA 2DD8H 1BJMA 4K94C 4RQQA 3QZWB 4LSPL 3BQUA 4PJGB 3Q2CA 2VLLA 1XIWA 2CXKA 4D0DA 4HBQA 2PYFA 3CC5B 2DLFH 2ZUYA 1A6VH 5F1OB 5SWZE 1K4DA 1J5OH 1JWSB 3RQ3A 1FGVL 3NABH 5D93C 3DX8B 1X7QB 3S35L 1F3JA 3T0AA 5KVFL 2FX9H 3FB6B 2DQEL 4MNHB 2LABA 2WBKA 1BQHA 5I8OH 1FORH 2R23B 4XNMB 4LLQA 5D2LF 3T08A 1JGDA 1F11A 1A7BA 1MQKH 4N9OB 4GT7A 3W2DL 1A1MB 4LSRH 5DJZA 1A3RH 4LPXA 2AJ3B 3T2QA 3S3JA 1FO0H 3LKQA 2XTJD 3QHFL 5B38B 1UB6B 3T2OA 4YHML 1YA5A 4LEOA 1SEQH 1BREA 4PR5B 1WFOA 5CJ5A 2CDFB 3FT4B 1JPTL 2VDQH 4CRPA 2PO6D 1I8KA 2A1WH 3IAGC 5EOTA 3S7GA 5LAXA 3WKML 5CINH 4U2ZA 3I6KA 4WDIA 5D7LD 1J1OL 3NH7H 5JDSB 4AZ8A 2EYSB 2HFEA 3TIDB 4EBQL 5BV7L 2IAMB 3RVWD 3FN0H 2EDOA 3MPCA 3R1GL 3ARFC 4GUPB 5HHOE 4NUJB 3RWIA 3QB7C 1FL3B 1J88A 2I9LB 5EBLA 5F70A 3I6LD 2HVKA 3UC0H 4J3UA 1KN2L 1FG2B 4DAGL 1MCWW 3UYRH 1OAUH 1VGEH 1A14L 4WU7A 1D5MA 3BP7B 4I48B 4JZJC 3WO3B 4UIMB 5JDJA 3H9HA 5D7LA 5HYFA 4X6BB 4P2RA 2AK1L 3D0LA 3SJVD 1F6AB 1KPUB 1CGVA 1EA9C 5GZOC 1YMMB 5L2KE 4HUVB 3OXRA 4Z76B 43CAA 1IEBA 1IBGH 3I9GH 4NGHH 2P5WA 1SJHB 1EEYB 3GRWA 3IDYB 3MUGB 1AP2B 3DVFA 4HIJA 3SOBH 4F33A 2E7HA 4H5SB 5HGDA 5IKCA 4ZQKA 3C8KA 1RUKH 3KPRD 3WUZA 2Z8SA 1BAFH 3G5XB 1U6AH 2EDDA 3SJVA 3HR6A 3G04A 5ACMA 2EDHA 1UM5L 4LPCA 4YR6A 5H94A 5IFHL 1K4CA 4MJIB 5ESVB 5JUEL 2Z31C 1LNUA 1KPRA 5A3ID 4OM1H 5FK9A 2Y07L 1OM3H 3VH8A 5JO5A 1R3HB 1CXIA 4XWGL 3OKKB 5ESQB 4OZ4A 3L3DB 3QIBD 3UAJC 1LD9B 2XNAB 4HWBA 4PRAB 1KCVL 5ACLA 5I8CA 4NQDD 4XI5D 5F96H 3VD5A 4CW1B 4WFHD 4WFFD 4F7TA 4P5TB 3KPOB 3FOLB 5MEND 3OAZK 3H0TB 3L5HA 3OKNB 4QXGL 1MH5A 3SY0A 4UTAH 1TJGL 5IQ7H 2Z0BA 1XGYL 4MD5B 5C3LD 3MLPA 4WUUB 5J11B 5DR5L 4WCYH 4Z0XB 2C3HA 2KUTA 3QIBA 3VWJB 1KB5H 3P4OB 4NQDA 2J12B 4KQ4L 4ZS7L 1QNZH 5MENA 2VXSL 2VDNL 5CCKH 3PHOB 1UWGL 3QP3A 4OD3L 5CJXA 5IW1B 1W0WB 4PJBA 4IRJB 4F2MB 3WFHB 2H32B 1UYWL 3WN5A 3DX7B 5IM7A 1JHTA 4TSBH 1P7KB 4HGMA 4XNQB 4UT9H 5HYJE 1Z5LB 4EXKA 1F2QA 4L29A 1AXTL 1T20A 5JLZB 2R1WB 3RL2A 4NWUL 2YUVA 4Z5RA 4JFOA 2ENSA 3SE4A 4R7NA 1PZ5A 2KH2B 2YN3A 3B43A 3O6FD 4QHKJ 2ZPKL 4MX7A 4FQLH 1G9MC 4UOW1 4LVNC 5LGKA 3DVNA 2QLVB 4JREB 2IMMA 2FB4H 5HGAA 1NFDB 3IDGA 4OCXH 4RCAA 1ZHNA 4O5LL 2NXYC 1C16B 4G43A 2NNAA 4FQHB 4O2FA 3DMMB 2CDGB 1L7TH 1RIVL 1BM3H 2MPAH 4XP6H 4Y4FB 5CHNA 5FYLE 5CSZA 1FRGL 1NDMA 1WWWX 3WS3B 4AEFA 5KVGL 3U4EB 2QR0B 5CSGA 2ADGA 3CCHB 4XCYA 4JPIA 4KROC 1RJLB 4ZUTA 3O6FA 5FM5O 3F7YB 4CVXA 4DWHA 4Z7OF 1PG7X 4OGAD 4IOFD 4WI8A 5E8OB 3LPGA 4XNZC 4N8CL 2FYYA 1H15B 3QA3B 1A9EB 2FGWL 4RFNB 3P11H 4NKMB 4D0CB 1J8KA 4J3TA 4A2LA 1QQDA 2QADB 2VITB 1GH7A 3RWDA 2FZ3A 3RX8A 2HLFD 3B5HA 3UYPA 2K7QA 3U46A 1JF1A 1T5XA 1V8HA 4KV5F 3B3IB 1T89C 4NNPL 1EUUA 3SBWA 1CQKA 4PRHD 5JQ6L 1FJ1B 1B2WL 4RMTA 1DSFL 4JN2A 4NNXA 2XWJA 3C60B 1OAXH 4HV8A 1F4AA 3MMEA 3DXAB 2H9GB 3V6FB 1HXYA 1VFMA 1EFXB 4P2OD 3BPCB 2V9RA 1UCTA 2GT9B 2YRPA 4LLMA 5EN2A 1RURH 2VDKL 1F90H 1DFBL 1E4XL 1NBYA 3GKWL 3LKPA 1UJ3A 2I25N 4PRHA 1VFUA 4ELMA 2DS4A 3K74B 4UDTA 2OTUB 4M6OL 1TIUA 1MHHB 4KJQC 2AJUH 1LO5A 4BFIA 3PWUB 4U1KB 2PTVA 1QLEL 2OR7A 1NCTA 4KVCL 3VD4A 3VFUA 1VGKA 1DQDH 1D6EA 1FZOA 4R3SB 5CD5C 4TUJA 1XT5A 3DPBA 1SMAA 4S1QH 4H8WC 2CRMA 5CZKA 4F9LA 3ES6A 1JHKH 3BZEB 4XPBH 2HMID 3EDFA 3EGSA 1VA9A 4BA8A 2AXHA 4P5KB 5HVHC 1ZS8A 1DBBL 2AVGA 3B6SA 1CQYA 5GGVL 2IBGA 2OBGA 4OZGA 4O51A 1CICC 2XQYK 5KW9H 4PV8B 1DVFD 2YXMA 3RUGA 4HEME 3FQNA 3PGFH 3T0WA 2O61A 3SGJC 2VXTL 4PJGF 4YBQC 4QRRB 5FGCE 4Z78B 3RAJL 2GKIA 4NHCL 3MBED 4J7RA 1D9KB 3BN9C 4PGCA 1GJIA 2F54E 4JQVA 3BEVA 3AREB 3DX6A 3RDTB 1L7IL 4QXTB 1C08A 5GJSL 3VG0L 1HEZA 3PABB 1QFWM 5CUSH 4OZHE 1CDCA 3MXVH 3QIWC 3VI3F 4W4NA 2DM3A 4PJXF 4YQXH 1FFPA 4XVUD 3AS1A 4ZUUB 4YJZL 5EG6C 1DDHA 1MHEA 1QO3B 3NFSH 3RX5A 3HLAB 4FRWA 4TUKL 3F62A 4Y2OA 2EYTA 3MBEA 3BZFA 5GZND 1J05B 1MRDH 5DVNA 3VXUB 2E7LC 1G7QB 4RX4D 1UZ8B 2R8SL 3SGKC 3BD5A 3CFBA 4R4NC 4KRLB 4XVTL 4R0LB 2Y06H 3TVMB 2X42A 1A3QA 1NAKL 4JKWA 1MQ8A 5I2IA 3F58L 5TDNB 5ACZA 4CL7A 1LE5A 2EXWC 4RIRA 1U3ZA 4I5BA 4ZMAT 4J4PC 1N26A 1Z3GL 4PGDA 2AV1A 1N0XL 4XGZA 1MCKA 1BZ7B 1YY9D 4L5FH 2VN4A 2NY5L 4XTRD 4RX4A 4FQPA 4O2EB 1DE4B 3CFJB 3LEYL 4NSKA 2NX5D 1QFWL 2NYYD 4I9WE 4MDIB 5CEYB 1A5FL 3U79A 4G7YL 5C08B 1NCWH 1EGJH 4TULH 4ERSH 1PKOA 3CDFA 4FQQA 3HPLA 3IFLH 1I1CA 4GO6B 4BK4A 3TO4B 3BJLA 5H35B 1NEZB 1BVLA 2AV7A 3I3EA 2QSTA 4K23L 4M48H 5IK3B 3VXNA 1B3JA 3P77A 1F4XL 4G9DA 3WNNA 1H3TA 3QI9D 4KI5D 5DMKB 5ISZE 4M7KL 4G3YH 3PJSA 3JBG7 4NC0B 1QHOA 4LSQL 1DBMH 2VB5A 3TJHD 1H3GA 3NZHH 5LXGH 3S88L 5B4MD 3W39A 5A2IH 3D0VB 1TZHA 4LSSL 3CIQA 3N85H 3QRGH 5IQ9A 2C4XA 3S5LG 4DK6A 1UEMA 5DRNB 3O45B 3CSYB 4XC1H 3VFVB 1QSVA 1W0YT 3QI9A 2HT3C 4PJFA 2XQYG 5DJYB 4AL8L 5T33H 2BSSA 3HZMB 4KJYB 1VHPA 5DT1H 5J6HA 1URLA 1K2DA 1QOKA 4GBXB 4WU5A 1MFBH 2X4SA 4UTBL 5DJXA 4WENB 4XXDA 5BVPL 2XZCH 5IIEA 5T5NF 1NL0H 3L7FA 4EDWL 2CR3A 4GRWB 5FF6A 4Y5YB 1W8OA 2VDOH 5E0QA 4ZFOB 1NFKA 2ICES 2G9HB 1PFCA 4LSUL 3BUTA 4DN4H 1KJ3H 5ANMA 2NQCA 3VFNA 4J3XA 2W60B 2BNRD 2LV4A 3S34H 4L4VB 4DK3A 1P1ZB 4JFFB 1G6RA 1F4HA 4BK5A 2B2XL 4TNWF 3QULB 4M03A 2DQDH 3LD8B 4NHUA 5FYKE 3RIAF 1JZ5A 1BEYH 5EPMA 1LP9B 3U0TB 3FAWA 4C4KT 4UZGA 3NOIA 4YEFA 5DA4A 1BQUA 2E8ZA 3O0RL 5DHVH 3VFRA 4RGOH 3KLHC 1J86A 4G6JL 4QYOA 2BNRA 5TQ0H 1IQDA 1OTSC 2E6QA 4GS7C 5AUMA 3MNWB 2BVPB 3VXSE 1ACYL 1JUFB 3C6LC 4KGJA 1CDJA 2XKNA 3VCLA 1MIMH 1QSZA 4L4TD 2Y6SC 3LKNB 1S8DB 4NFCA 3S36H 4RWYH 1NJ9A 4GW5A 3GMMB 2DJSA 2YEZA 3BPNB 4TVPH 3DYOA 4U3HA 4YE4H 4FQXC 5BZDA 2BOCA 2J88H 1D5ZB 1ZGLA 4Y5VB 4GRMA 3EYFB 3RWEB 1AD0A 3GFUA 3I85A 4I2XE 5F9JB 4X99B 2AQ3A 3RJQB 4C54A 1JZ4A 1T2XA 3QNZB 5JOPD 3JWOC 5KSVA 5LGHH 4WI3A 1MJ8H 2E3VA 4P3DB 1HILB 4OCWH 3VXME 3ULUC 5HI4C 4LF3B 4L4TA 4WJ5B 3CSPA 1I9RL 3MV8B 4LMQE 3DROA 5B3JE 3UBXB 3NPSB 3D3VE 2OL3A 1EXUA 2VLKE 4JO2H 5GS0L 3IJHB 4FMKA 4QHKI 4HD9A 2LAGB 1OB1B 1KLGA 2MQ3A 1N64H 1YC7A 2R39A 4OD1H 3MOBL 3BE1L 3QFDB 2YRZA 5CP7A 5D96C 1Q94B 4NKOB 3RP1A 3GMPB 5ID1A 4RGNB 2BZDA 4NCDA 4WVRA 2GTZA 3T0ED 1BIIB 2BXZA 5F6IC 5HJ3A 4JN1H 3FFCD 5E2UL 2DDQL 5CEXB 3VE0B 1JHLH 3WLBB 2EXYD 2VXVH 2JLLA 4RA3A 1TTUA 3STLB 5GGTA 5HGBA 1V7NH 4LVOC 4PRNB 3JV4B 4JHWL 2ZZUT 3L1OL 4JY6A 1TJHH 4DCQA 5E2VH 1LEGA 2ARJB 1TZIA 3IGAB 2NW2A 1A21A 4U6XB 2X4QB 4X8XA 2GAZB 3T0EA 3QDME 2B1AL 4UUJB 1KB5B 4QNPF 4WI6A 3MYJA 5DUBA 4KRMB 4Z7WE 4Z0BH 3MJ7B 3BP4B 4ZFFB 2ZUQC 2ZNWA 1FNGB 4QTIH 1FVEB 4DW2H 1R5IA 1A6TB 3MLTA 4NT6A 2ZJSH 1ZLUK 5SWSB 4U6YB 5EUOA 3OKDA 3IKCB 5DDHB 3OSKA 4NWTH 4XVJL 4CADB 1ZT7A 4NYLB 4PRPD 1S9VA 3L95B 4UI2A 3VFGH 4NQVB 3I3DA 4FQCH 2ATPA 1E28B 1Q9LA 4M62H 1GGCH 1HHGB 5K9QI 5D70H 5ITBH 3BYYA 5EIIA 1I3VA 4Y89A 4GFTB 3L5XL 2R2EB 2JJTC 2IADA 2FWOB 4WWKD 3C5ZC 4G8IB 5KJRH 4GRLB 1RD6A 4EN3C 4QRUA 2F54D 2FR4B 3KLSA 3V5KA 1XGTB 3EJZC 4ZYKA 2FEEI 5F7KC 1VEPA 3W11C 3UTSB 4F15C 3TNMA 3OHXA 4KUCD 4LLVB 3NFPB 4U1NB 4X7CC 5ALCL 4D2NA 2VDRL 2VH5L 2ZG3A 1J8HE 3OV6A 2HJKB 3V5HA 1CVRA 4GG8A 2LTQC 4FXLA 1OWWA 3X3GH 4WWKA 4Z77B 1YEIL 3T0DA 5HXMA 4TUOB 4UBDD 4YUEL 5MEQB 1HXMA 2F54A 5C9JB 2VUYA 1U58B 2A6IB 2R1XA 2Z31A 2QQKL 4L8DA 5F7LB 5JXAH 5D6DA 4MQSB 3QQ3A 3L9RB 4F37K 2R4RL 1KLFA 2NY7H 3MRNA 4G5ZH 4FP8H 5F7MC 3UO1H 1YN6B 3IRZA 1Q9OB 2M26A 4KMTH 1ODAA 3WBDA 5HVGB 5GGSB 5C0IA 3MLWL 4JFHE 5JW4N 1RUQL 2W0KA 1VACA 2GCYB 4ISVA 4NQEE 5C0RL 4RZCB 3NZ8B 5E1HB 2P7TB 2YC1B 4NQCD 5DS8B 4TRPH 5IB3B 4HF5L 5KSAC 2ESVB 4GLRI 4OUUB 4NO0A 1KLUA 2H2SD 2V2WB 3KNBA 2YBRA 5CZVL 2Z92B 2P8MA 3TV3L 1PKQB 1NCDH 1HINH 4FFZL 4FZEH 4HCRA 5L6YL 3MJ9H 5C0FB 1DLHA 3MNZA 4RAUA 2A73A 1SJEA 1P4IH 5DI8A 4PJAB 2Q86A 1RULL 1NC2B 2DBLL 2EICA 4OGXL 5I1KL 3ZTJH 4NQCA 2CLZA 3ZDZF 1EHLH 2F5BL 1CWVA 1YDPB 1ETZB 4M5ZL 1NAMB 1QR1A 4OFIA 3BSZH 1YPZB 3QHTC 3UX9B 1JWMB 4MNGA 2J8HA 4MDJB 1RJZB 3LKSA 5K59F 3PIQA 3MXWL 5K33A 3RTQD 3WIHL 4PJ5E 1MSPA 5D1ZD 4YPGB 3IU3B 1R3KB 3B5TA 5DF0A 2CGRH 2EH8L 1ZT1A 2BNUB 1T66C 2W65A 1Y18A 3DSFH 4HLZH 5IHBA 1HHKA 2DTMH 2GJZB 5ISZA 1PG7H 3LDBB 5IEKA 4UAOC 2DQIL 3EHBC 3ULUE 2OP4L 4DGIH 3DTXA 1LVEA 3WNPA 3RTQA 4HULB 2FH8A 3D25B 2EZ0D 1EAPB 5D1ZA 1BZQK 5IESH 4LCUB 2VAAB 2CRYA 4WW1A 1U8PB 4CMMA 4JFEE 5DJ0A 3X13A 5IJVA 1A7QH 4XNXH 3L3KB 3BPOB 4DOHB 4QOKE 3TEUA 1S7RB 5DD3H 2QEJA 2ZUSA 4J3SA 5I8OL 3UROR 1Q1JH 2DMCA 2CLVB 1YY8A 4OT1H 3NCJH 3VRJA 4HMEA 1TJIL 3GMRA 5C9KA 4AMKH 3AAZB 3OB0K 5DEZA 2IH1B 3MGOB 3FO0H 4YHZH 5ADOL 2P24A 4NRZA 4OM0H 5BW7A 1GGBH 2BK8A 3KYNB 2FJHB 4KKCC 2GFBA 1PQZA 2VZ1A 5C6TL 1G9NC 1BX2A 3QAZB 5C0CB 3W0WE 4XNUL 4GMSL 5C2BH 3NIDE 2X1OA 2ZKHH 5CINL 5C0NC 1VFAA 1NBVH 5HY9A 4G6FD 3CSGA 1J9CT 1IAOA 1A7OH 3AU1A 1PGRB 2JCCA 4YC2B 5E2WL 3Q5YA 1YNLL 3ARDB 4WGWB 4NNYB 3G08B 3I75A 4BUHA 3PQYD 3KPSE 2BCKA 4KY1H 2PN5A 3BVNA 3V5DA 4OKVA 2ZSVA 4HH9A 4X6FA 1H3UA 4M6AA 4EXPX 2UZIH 5DJ6B 4OBRA 5C92A 4OI7A 3HG1D 4MQXD 4L4JA 1G7MA 4ODSL 1P53A 1TQBB 3MJ8B 3RWFA 2VE6A 5GRZA 1CICD 3PQYA 5A43C 3RHWK 1FSKC 2X7LB 1JTOA 1KG0B 2YMXL 2EE9A 4GW4A 2VQTA 5HPOA 1IBGL 2FIKA 1XCTB 4NGHL 2EDFA 4U1HA 4ETQA 1RFDH 4G42B 1CG9A 3HG1A 5HSFA 1IFHH 2OI9C 4IIQC 32C2B 3JV5A 5J9PA 5H8DA 1S7XA 1OL0A 5E99H 4NKDA 1RUKL 4FNLH 4U1GC 1M7IA 2AJVL 2HRPH 5FA4B 2AQ2A 5FHAH 3QIWD 4I2XA 1CICA 4WHTB 3EOYG 3S8WA 1NCBL 4KK6C 3SGJA 2AJXH 3T4AA 2V6HA 4CNIB 1QKZH 1OM3L 5I74B 2FECL 3OZ9L 4P23C 3S97C 4YHIA 1KXVC 4O2CA 4LCIL 1S78D 3HTLX 3D3VA 5EBWB 3SO3B 3QEQE 4POZD 5HYQB 5KN5B 4Z6AT 3KJ6H 3QQ9C 1VSCA 1LEKB 3FO1B 4XVSL 2D7TH 4FTVD 3BIKB 5TGBB 2E8YA 5J13C 4OI9A 3VD7A 2MTPA 3QIWA 2ZCKL 1P84K 3FKUS 3LQMA 4R7DB 2I9TA 1NDGB 1HQRB 1MJJB 4Y88A 4DVBB 3D39D 3TYFB 2E7LA 2FD6H 1RHFA 3CLFL 1FVCB 4U6VH 1G1YA 1JPSH 1KIUA 3CH8A 4P4KB 3SGKA 1KB5L 5DRWA 5IOPA 1UFUA 4XP4H 5T3XE 5BS0D 3Q1SH 3VRIA 2AAVA 3ARGD 1IL1A 3ZSSA 1REIA 1A6PA 3WEXB 5CCKL 3CX5K 1TTFA 3IJYB 4J4PA 4QY8B 4X6EA 4AENA 3D39A 1TETH 3FMGH 2YPLB 5BQ7A 5E7BA 4GQ9H 4Z7WA 1XF1A 3GKZA 2FCBA 4BZ1H 2AK4B 2Y4SA 4K3DH 5CJQH 4ZPTA 3O6KH 3ZE0E 5BS0A 1Y6KR 1ZHLB 3RNKB 4XXCC 5E6ID 4RMWA 4N8VG 1RQ5A 5DHVB 1JNJA 4XAKE 2RBLA 1MRFH 4YGVA 5F97E 5L7XH 2BOBA 2V7NB 5EZIH 3LN4A 1RZ7H 2OJZH 3X11A 5D6CA 4YHPB 4OV5B 2L4OA 1LO2H 5GGQL 3CK0H 2NY6C 3FB7B 3QXVA 1CI5A 3U0WH 4OV6F 3BXNA 3IT8D 3JV6B 1BBDH 3FTGB 2X4TB 5E9DD 2XIDA 5EU5A 1BM3L 2MPAL 2P8PB 5I1DB 2FJGA 3TNNA 1JFQH 5E6IA 3DETC 1UM4H 4M3KB 5TQ2H 3ZSTA 5T5FH 1NSNL 5IVZA 4HC1A 2NY3D 3GHEH 4JQXA 3I02A 1SYSB 2OR9H 3EO0A 5GPRA 4ZO8A 4PJHE 5LCVH 5FEBA 1ZLWH 1QSEE 3HUJE 4G6AC 1J7VR 4G9FB 1FL6B 1CE6B 2NPLX 4EI5D 1WC7B 2Q76A 3P11L 4E5XA 1CXKA 2V2TA 1CE1L 1J8HA 1IEAA 1RU9L 5D71H 5E9DA 5HI3D 5GS1B 1MRCH 1B6DA 3BKMH 4QT5B 1CK0H 4JFQB 3O3AB 4PP2A 2MHAA 4OLZL 1FPTL 3TBYB 1GZPA 5CJOL 2VLMD 3MV9D 4N0UB 1LO0H 4P57A 2VXQL 4BZ2H 3QCVL 5DRZB 1EHAA 4JAMA 3D69A 5ID0B 4MA7H 1U8QB 3QDJD 3RPIB 1OAXL 5T1MB 4GAYA 4P9HL 1W8NA 2X4RA 2X4OB 4EJ1C 4PJ9C 1Q0XH 4HIHA 4NQEA 3DV6A 1OAKL 1RSFA 4PRIE 4F3FA 2GUOB 4EZMA 1RURL 3MV9A 3MRIB 1QRKA 1WEJL 4BFBD 1WZMA 4Y4HD 3KLHD 4ZTOH 3QG6B 2BDNL 1Q9KB 1AFVH 1FH5L 1U3YA 4CVUA 3QDJA 1MCPL 4JG1H 2BRQA 1NAML 1I7UB 1RUMH 5DEFA 2BVQA 4PLJC 2D7QA 2BFVH 4LNVA 2X9YA 4Y8DC 4YDLC 4XPFL 3LAFA 1S9KC 3JWNC 3V52L 5E8DH 3QO0A 1XAUA 1FAIL 5BJTB 4HKBA 3WFBL 4EI6A 2ZSWB 1BD2B 5E56A 5T3ZE 1YPZF 3N1GC 3L5WA 4X6DB 5FIEA 4Y4HA 4XBEH 3AY4A 1G7HB 2MNUA 2ZP0T 1INQA 1FVDB 1OPGL 2R2HB 3LRHA 4Q6YA 2JJUA 5I75C 1V3MA 5L2JB 1A47A 4PJCB 3ABZA 3T0VA 1N6QL 1OD9A 3QCUH 3DVGA 1AR2A 4RBPK 5I15L 4LASL 1D5BA 4WO4B 1CF8H 3C09C 4P4RA 3DGGB 4BH7A 3MUJA 5GRXG 2NY2D 5HHQB 1MHPL 4GMTL 4WNQA 3WMSA 4Z7VF 4O9HL 5C0BE 3GHBH 1UXWB 1E4WL 3HCVB 3O41A 3V4PL 4M5YL 1LK2A 4DEPB 4LOUD 3Q6FA 3IDJA 1IGYB 4ORGB 4N90D 5DD5H 3E2HC 5AZ2L 3U9PH 1OF2A 1VDGA 4IRSC 4OJFL 3QG7L 4L9DA 2BERA 4FQ2H 5EU6B 4U7KA 3A6CH 2A6KB 3SQOL 3A67H 2ICWA 4QHMA 3OX8A 4JFEA 3M07A 3TO2B 3VI4E 5C0DB 2ADIA 1G7LB 3OPZH 2V7HB 4ZD3L 3NFSL 3RKPA 5DZOA 4WFGE 1KJVA 5D7IE 1CTOA 3HC4H 2O5XH 2IGFH 3BPLC 3HB3D 4POUB 5KVEH 3C2SA 4U05A 2G75A 1AO7D 4I0PD 4NC1C 4Q6IB 3L3IB 4XC3L 3GRWH 2LVEA 1C5BL 3HNSH 2Q6WA 3K3QA 1UWXK 5T1LD 5FDWB 3OR7A 5F1IA 5J0BA 4LQ1A 5I66A 1IGJB 5GRWA 4HZLA 4L5FL 3SE9H 4D9LL 4QHLA 1T2JA 4Y5XC 5EOQL 3GSNA 1HKLL 4CDGC 1CFQA 3FFDA 2XOTA 4K3EH 4A2MA 2ZUXA 4V2CB 1F3DJ 3GIVB 4I0PA 4XPTL 2APWA 1YEDB 1AE6H 3E8UH 3VXTB 1JPFB 3F65A 4TULL 3GI9H 4G6KL 3UTQB 1CFSA 4HWBH 4MS8D 2HTLD 4XNYH 2XKUA 4ONHB 4ZG1A 2ED7A 1DJSA 5F7DB 1S7QB 4LCWB 5FO9B 1FNSH 1A4KB 4Q2ZB 1MFDH 4HKZA 4LCCB 5FAAA 1WFTA 3IXAA 3WLWC 1E27A 4LPVA 1FC2D 2J8UE 2PTTB 3PG2A 3UTTD 4AJ0A 4PJEB 1OVZA 1PLGH 3ROLA 3ARZA 4G3YL 5GS2D 2D0GA 4L9LB 4R97C 5E5UB 2JJTA 1TQCB 3NZHL 5GGRB 4YEEA 2IBZX 3ULVL 4BKLA 4JHAL 1F13A 4EN3A 4OCSH 4O02H 3B9DA 5CBEA 3S4SG 4X9GA 1QPPA 1HYSD 1S7VA 5FOBB 2ITDB 5JR1H 5EU4B 3N85L 4HQQH 3N50A 5TDOB 4C56E 5E1AB 4JFXA 2AGJH 3ULVF 4PY8I 1NANH 2DLHA 2A9MH 2E6JA 3UTTA 2EIZB 5BV7C 1AHWB 3BOVA 4YIQB 2IJ0C 2HJLA 2UWEE 2VABA 3FJTA 1ZLVH 3RZWA 3STBA 3BKYH 1J1XL 2CPCA 1QLRB 5DT1L 4KUZH 1QYGL 5EOCL 1PD6A 4M1GH 5BZWA 2FSEB 1CD0A 1S7WA 4YWGH 1HOCB 2D03H 3WFDH 1FNEA 4YHNB 5FM5M 3AMLA 5E00B 1UA6H 3QEQA 2ZUTA 2ZNXA 3O11B 1CD1B 4CVWA 2VDOL 1YN7A 4U31A 2EDQA 3DHJA 2V5YA 1XF5A 3VXRE 5E8EB 3X14B 3SGDH 3FQUA 4GKZA 4Y4KD 2Q7NA 1KJ3L 4K7FA 2W9DH 4LSVH 3VFWB 3QQNA 5CD3B 3IDMB 1RJCA 1XR8A 3QDGB 1KPVA 2PXYD 1U95A 4X5WB 1NUFA 2CLRA 5D1XD 4X7SH 1DQTA 2EEDA 2GITA 4AH2A 3VWKB 2IQAB 2XI9A 4ZOCA 4ESKA 4PJ8C 2R4SL 3KS0J 4KK5D 5EU3B 1IKNC 4GAFB 5E08H 1C12A 3QIUD 2FX8H 1A1OB 3NCYS 3CZJA 2E6PA 3GNMH 4AIZA 5TQ0L 3DECA 4PRDB 1ZT4B 2WP3T 1RZJH 5INCB 1F4YL 1T66D 12E8H 5TE4H 1G7IB 4HT1L 4S10A 1OD7A 3FQXB 3GJFA 3MLXL 4BZYA 2NTSP 5IFJB 5D7JD 3O2DA 2JKXA 2EKSB 3QIUA 1EHNA 4FFWC 4URTB 2FLRT 2V2XB 4XWOC 2Q87A 4CMHC 2ED9A 4P3CH 1TPXB 1JNHA 4ODBD 5DUPL 4PJIE 2PYEB 2FBJH 4MB4A 5J12C 1JK8A 2R0ZL 1VEMA 3BH9A 3B2VH 4JM4L 4LEXH 1I9JL 1E6JL 3GO1H 5EO1A 2NY0D 3NCEB 1RZKH 1S5IH 4NJAH 5L0QC 3WO4C 2OM5A 2G60L 1NLDL 3QUZB 5DO2D 5AD0B 3TBWB 1FZMA 2CDEA 1CIDA 3INUH 1H9VA 4OZIB 4KKCD 2APTA 4ZXBD 3RU8L 4L8SC 4JN1L 3R06A 3TT1H 4KRPD 1GL4B 3V0VA 5BRZD 2B0SL 2VXVL 1YEFH 1RUPH 4NC1E 6FABH 3LSOA 3H9ZA 3DUUB 3VFTB 3QWRD 4HS8L 4S1DC 2YWZA 5I17B 4M43H 3DX9B 1T7VA 3X17A 1CLYH 3O4OC 1N5AA 3VGBA 2DWDA 3GMOB 3ZMRA 4IS6B 5BRZA 1U9KA 3OGCB 4Z0BL 5I0DA 1FYTE 2CJUL 4L3ED 1Z0NA 5CMAA 2B20A 3HMWL 4R96B 4OF7A 1KCRH 3KPNA 5C6PB 2CQVA 5IB1A 3MFFB 1MVUA 2GJ6B 2FLBT 3QWRA 3B9KB 4Z7UF 3MBXH 3QEHA 4XP5L 3AXLA 3MRHB 4LBEA 1L4IA 1ROWA 1WBZA 2WZPD 4GAGH 2HN7A 2H8PB 1IGIH 4WV1A 2XYCA 4KQ3H 4X6DF 1KSRA 1ZK9A 4F7EB 3FCTA 4L3EA 1B0RA 3SDCB 3RZCB 1MAJA 2VR9A 4RAVA 4HKJB 2LU3A 1CFNA 1HWGB 5C0BD 4YNYB 4OLWH 1RHHA 3VFOB 1ZXQA 4NN7B 4X5XA 5D1QD 1EAJA 3GGWA 2ORBL 4Y2DC 2FRGP 3MRLB 2H2PC 4R2GC 4P23D 1T0MA 2XXCB 3FOMA 2W9EL 4NP4L 4OD2B 4X9HA 4EUPH 2EDXA 4IIQA 4KGLA 5D7SL 3VFPA 4MLIA 3TA3C 3KXFB 3T3PF 1MEXH 1MLBA 3K2UL 3X3GL 4BQ9A 5C0BA 5LBSL 3O8XB 1KCSH 3C6SB 1ES0B 3BD4A 5JXAL 2IANE 5D1QA 2DLTA 4F9PA 1QSFB 1YYML 7FABH 3GSOB 1UT9A 3CSBA 2JK5A 3IXTA 4P23A 3KYAA 1DR9A 2HJFB 5GSVA 3LS5L 5FYJD 2PW2B 4D3CH 1NBZB 1DN2A 1HZHH 4Y16C 1GYAA 2PW1A 1K8IA 3DOSA 1N7MH 1T1YA 1UM6H 2X70B 5D9SB 1KIPA 5EZLB 3BGFB 3T0BA 5D8JH 3O3EB 4OF3A 1ADQA 2UYLB 5MEOB 1V05A 3H2WA 1YQVH 4TRPL 2P5EE 4LKCB 3BRFA 4ONGH 4FXGB 4YFDB 4ZUWA 3U30B 3M45A 1FBIH 4ZUVB 2ADJA 4HKXA 1S7UB 4MQ7B 2BNQB 1CD8A 1QEWA 3D6GA 4JJ5B 4GG6A 4U2YA 3UJIH 4U1IB 3AM8C 4TSCL 1NCDL 2OTWA 3CMGA 2OZ4L 3KHQA 4RQQB 1YMHA 2VLLB 3OQ3B 2HH0H 4D0DB 5MI0B 4GKOA 4Q7DA 4ZO6A 5C0AE 5JTWA 5ERWA 1K4DB 4HUXB 1F8TH 2MCPL 2K1MA 2R15A 4DUXA 2VKXA 1XR9A 4M93B 3BSZL 3EZJB 3UTZA 2OK0H 4OLXH 2J3SA 3WFEL 5FFLA 4XAWH 3IAQA 1BQHB 2M1KA 3QXAA 1KENH 1YEHH 3DV4A 1QLFA 3TF7C 2Z35A 4LLQB 5IFAL 4R4BA 3EYOB 3T2NH 1FO0A 2P8LA 5DJZB 2CGRL 5C0JA 2CIKA 1L6XA 2J8UA 2CO7B 2GEEA 4CN6A 2DTML 3IU4H 4LEOB 3VRLF 1U8NA 1MFCH 2AABH 3ZT5A 3OF6D 2IAMC 2V5MA 1G6RH 5FM8A 1WZLA 5A2KH 5LAXB 4NJ9H 3RVVC 4QCIB 2NY5C 4QO1A 5IESL 2I5YH 5ETUA 4WDIB 1IC4H 3VXOA 1CXFA 2XN9D 4MA1B 3GBNH 3Q6GL 4X80H 4OCMC 2XTJB 2YRLA 3SKJH 5IV2A 4AQOA 5I1IL 4MXWH 1A2YB 1U42A 2F53E 3L7EA 4UV7H 4ODWA 3RY4A 3HAEG 4U0QB 2UWEA 3RWIB 3EDJA 4NZUL 5EBLB 1BWMA 1Q1JL 3MRGA 2PO6B 3HFML 3OF6A 2DKMA 4QHNA 1SBSL 1CDHA 4WU7B 1D5MB 5J1AA 1ZTXL 3Q5OA 5D7LB 3IDYC 5C0GA 4JGMA 3T4YA 3D0LB 3TN0D 5ITFA 3CX2A 3CDGA 3O4LD 4LARH 2ZCHH 3CZFA 1IAII 1KTDA 4BFEA 1KEGH 2CH8A 43CAB 1NGYA 2FEEL 2NLJA 2WWKT 3VGAB 4Z7OE 2E5EA 1MNUL 1YNKH 4MSWA 4PLJD 3WDIA 4JY5L 4KFZC 5KAQG 4HIJB 4F33B 5SX4I 1NPUA 4M02A 5HGDB 4ZQKB 5FYLH 1UH2A 3C8KB 3FN9A 2OL3H 1N4XH 4OCYL 2OQJA 3TN0A 3SJVB 2EDWA 3G04B 1MF2H 3EYSL 3O4LA 4YR6B 5H94B 1I3UA 2WW8A 1HSAA 5IF0A 1KPRB 5ESAA 3DHMA 4P5TC 5I9QB 4Y19D 5JO5B 4U7MA 2XY1A 4LQFH 4OZ4B 3BFOA 2PETA 5JA8B 1HH6A 5I8CB 2WIMA 3KPRB 4KU1A 5J11C 1DLFL 3H9SD 1DQLL 1KT2B 3U36A 1RZIA 5GGTH 5JHDD 4F8TA 3MR9B 3HZKB 2W9LA 1MH5B 3GBMH 2ICWJ 2Y5EA 4NUGL 5HDLA 2NTFB 2B1HH 4H1LH 4HUWA 4Y19A 3B2UC 2PCPB 3IFPB 3S5LA 4U6HA 1FFOB 4FNLL 2UZYB 2Q8BL 2GTWA 4PD4J 3D1MC 4IRJC 4JQIH 1JCKA 3QIBB 3WD5L 1W72B 2BVYA 4KJWC 4NQDB 4DTGH 1L0XA 5JW4M 1WCQA 3H9SA 4M6NL 1ITCA 4MAYD 4M9OA 5TPWH 1UCBL 1MUJB 5JHDA 5MENB 1IGCL 4PJBB 1A22B 1OTUD 1BLNA 2DQJH 1LO4L 4KZDL 4I18B 3WN5B 5IM7B 2WUBH 1JHTB 4OZIF 3D9AH 4X9BA 2D7TL 4Z95L 2F8XC 5DD0L 4L29B 4JREC 2R69H 1T20B 3WXVH 2LVCA 4MJ6A 4G8EA 4LP4A 2QQNH 4KVNH 4Z5RB 3D2UA 3MLRH 3DMMC 1F3DH 3LVEA 4R7NB 2FD6L 2FJFA 4GAJL 3S37X 4LFHG 3ZKMC 4XBPA 1LILA 1CLZH 2DQHH 1Q8MA 4PJGE 4NO2B 1P7QA 3IDGB 1ZHNB 4PJ7F 4YXHH 3S3PA 3Q1SL 1KC5H 4WGVB 4G43B 1QP1A 4O2FB 4JKKA 5CEZD 3G9AB 3H42H 4R4FH 3WHXA 3U4BH 3BHBA 4HEPG 4FFYH 5CSZB 2G5BA 4RFNC 3H3PH 1X6LA 2ATKA 3FMGL 1MREL 4Y5XA 2ADGB 4XCYB 3VI3E 4CVXB 4ZUTB 3O6FB 1MPAL 3FO2A 2X1XR 5GS0C 2IALB 4PB9H 4LAQH 1FYTA 1MI5D 4EUPG 2WUCH 4YHYB 1ZLSH 2WWMC 4S2SA 2CKBB 3QUXD 3OKMA 3K1KC 3C60C 1R0AL 3RWDB 2FZ3B 3C9NB 2OJZL 3SKMA 1WIPA 4KDTA 1XGQA 1JF1B 1WISA 5HI5D 4U1SA 1HI6A 1T5XB 2BHUA 4I13B 5JOFA 3SE3C 1OT1A 1U93B 4M7ZB 1MI5A 4CVZA 4PRBA 5I1GH 4U1JA 1OCWL 4LSTH 4JN2B 5DD1L 4NNXB 2XWJB 4K2UL 4P2YA 1LE9A 4HV8B 4OKDA 3V4VL 1KULA 1UM4L 3QUXA 1HXYB 2NR6D 3ZT7A 2F74A 3GHEL 5IJKA 5HDBF 5F1KC 4GXVL 2OR9L 4HCRH 4TQEH 4UU9A 4RSVA 3CFEA 4JPKH 4LLMB 2A9NH 5TF1H 3HI1B 5KSBB 4RDQG 4AEIH 4W81A 2A6DA 1UACH 4PRHB 5ICYA 4UDTB 1FIGL 1MRCL 3BKCH 3VG9B 2C4FU 1LO5B 4BFIB 1CK0L 3OKEA 1G9EA 1QFHA 15C8L 1YMME 2IANA 4RMRA 4P2OB 5I1HL 3C5SA 3VFUB 4KPHL 3MRJB 1OGAD 3LZFH 1D6EB 1FZOB 1WCBA 3D85A 4TUJB 4ONFL 5IBLD 4DUWA 2A74A 3KS0H 1KBGH 4X98A 4X6CB 4RMUA 4M7LL 2P46B 1A7PL 4PJ8D 5DQ9B 5FECA 1G9MH 1JPGA 3ZE1F 4Z7QE 1INDL 1ZS8B 2HT4C 4XCFL 4X0KA 4G80B 4LNRA 5IVXA 5JMOC 3NAAH 2Q8AL 3PGCA 4OZGB 4O51B 4D94A 1C5CH 1CXHA 3BAEL 5DHYA 4MJIE 4BH8B 3EFFA 2P5EA 4F7MA 3AREC 2EKJA 1KTKE 4ZTOL 3OG4B 3RDTC 3L3JA 1NGPH 1YUHA 3RUGB 3FQNB 3BGMB 2O61B 5KTEL 1FV1A 3LN9A 3T1FA 1T4KA 1AKJA 1XGUA 3N1FC 5TH2A 1LK3H 3TLRA 4PJ8A 1MJ7L 2XA3A 4NZRH 1C1EL 1J11A 2VUOA 3BEVB 3THMH 2AXJA 3DX6B 4H88L 1C08B 5E8DL 5HVWA 1T1ZB 2FIRT 2R9HC 1HEZB 2NXZC 5L9DL 5F7NC 4JFDE 5C0AA 1JE6A 2O5ZL 2AJSL 3UTPE 1ZHBA 1DVFB 1FFPB 3KYKL 2OS7A 1IAKB 1NCCH 1DDHB 2IBZY 1RMFL 3BI9X 4R0LC 2YHGA 1R5WA 3TVMC 5I1LA 2EYTB 3MBEB 3BZFB 1S9XA 4ZFZB 3QCUL 1AQDA 3MCLL 1CF8L 3IDIB 1AQKL 2NZ9C 4L1HA 5IMOB 3AGVA 3OXSB 1M05B 3LRSA 1BF2A 5I1JH 4IHOB 4HXBH 3VDAA 3PDGA 3AFLA 4KK8D 5I2IB 2DQGL 3UCRA 3RNQA 3CFDA 1LE5B 4ODXB 4RIRB 4I5BB 4TNVK 1JRHI 4XGZB 1CVSC 1AY1L 1U8MA 1JGLL 3C8DA 3U9PL 1SVCP 5JPNA 1RK1B 1ITBB 5FYKH 5AYQA 5DHXB 1GHFH 4NSKB 1OP3K 2OTPA 3TO4C 3A6CL 1A7NL 4OQTL 1XF2A 4OLUL 5JW5B 3GMLA 1QBAA 1RIUL 5DD6B 4FQQB 1UH4A 3ARUA 3HC4L 3HPLB 1NFDE 2VLJD 4KZEH 2K7PA 2IPTH 3PWJA 1BVLB 5JNYA 2AV7B 5DVKA 1CGYA 2MQ0A 4KMQA 4FN0A 4H8WH 4L8SA 5GJTL 1NUDA 3ARBD 5JIIA 3VXNB 3P77B 2NX5B 3IFOB 2YA1A 3IS1X 4G9DB 1U3JA 3ZT6A 5FCUH 5FKAA 4MXQC 4N68A 4X5LA 3PJSB 3SGEI 2YR3A 4NBZB 1GPOH 3U2SB 3L5JA 3PHSA 2VLJA 4AY0A 1YEEL 3MA7A 5BXFA 4K71C 5F9AC 3ARYA 4KJPD 4H1LG 1TZHB 3E8UL 3ARBA 4ETYA 1KXTB 5IQ9B 1IQWH 5E5RB 4KK9C 4NN5B 4NZJA 4YDJA 2F5AH 4GBXC 3TH2T 4JRXD 3QI9B 3DJ9A 5D72H 1NGWA 3P0GB 4PJFB 1WVZA 4OF8A 1X9QA 1N3NA 5DMYA 4MVBC 1ZVSA 4P5MA 1ND0A 4RRPG 1FNSL 4Y5YC 3NA9L 5J6HB 4JRYD 4CU7A 4JZOA 4CUCA 4IOIA 4WHYG 4MD4B 3DXAE 1XH3B 4R2GD 1L9MA 5I16B 5IIEB 1PLGL 1XF4A 3HNTL 2R0WH 1IE5A 4XP9L 1UZ6F 3RL1A 1W72L 3BYTA 3F12A 4ZS6D 1BHGA 4XP1H 5T1DL 3LD8C 4RWHA 5INDA 5ANMB 5ICXA 3BP5B 4HQQL 3VFNB 4JRYA 4HIEA 4Y2DA 1B0GA 4X4ME 1AI1H 3KPQA 4Q0XH 5CGMA 3I2CH 1G6RB 3E6FA 5TE7H 3QO1A 4QWWC 4TVPD 4NZDA 4PJBF 4NHUB 3TA3A 5D5MB 4M8QA 4NDMA 2Y7QA 1Y0LA 1MJUH 2ICWI 3QXUA 3PWLB 2D03L 1QUNA 1CBVH 1KTLA 3KR3L 3VFRB 3R8QA 2VLRD 3BPNC 2BSRA 4OI8A 4QYOB 2BNRB 3LY6A 1IQDB 3GUTA 2BJMH 3ZL4H 1JZ6A 3BO8A 4JDTH 1T7YA 4W4OC 5EFIB 3U1SH 4P3WA 2Y5TA 3VCLB 2FX7L 1HHJA 4Y5VC 4ZAKD 3HHRB 2A2QT 3TWCL 5JA9A 2HFFA 3NFNA 1NMCB 3GMQA 5IHLB 2IC2A 3MA9H 2YEZB 1UH3A 4LSVL 4QRRE 5L88L 1VADA 1L0YA 2KL6A 2OMNA 5BZDB 2BOCB 1ZGLB 4X7SL 1A6ZA 4HC1H 1AD0B 2VLRA 3NPSC 2DLEA 5JXEC 1GC1H 1MCSA 1AR1D 5KSVB 1HDMA 3RIFK 1BPVA 5IW3A 2X10A 4ZAKA 4L4TB 1HNGA 5EH1A 5E08L 4PUBL 1JWSA 3MNVB 2AEQL 3DX8A 2FX8L 4B41A 4EQ3A 5F72S 2CKBL 1EBPA 1CZ8H 1U91B 5ADPL 4K7PX 4RGNC 4IM8A 3MRDB 1JF5A 4O4YH 3ZDYF 1OSZA 1N5YH 5CGYD 4Z8FL 3G6JB 4MNHA 3RWJB 3AVEA 3VXUE 1KLGB 4J6RL 3N1QC 3WUWG 4LDEB 12E8L 1YC8A 5CP7B 5D93B 3PF2A 5FYJU 5H37H 4JB9H 5JW4R 2C7UA 5C09D 4R90L 3GB7A 1A1MA 3VXQB 4B53A 3UPRB 2GTZB 4UB0H 5HJ3B 4HPOL 3ZE2E 5GRUL 4PR5A 4BUGA 2CDFA 3FT4A 3F5WA 1RY7B 3LOWA 3MODH 4LK4A 3SGEH 4PP1C 4P3CL 1EJ6A 2XG5A 4DCQB 1LEGB 5K9QG 1TZIB 4DFIA 5L8LB 4GH7B 3MACH 4JFZH 2A38A 5C09A 3B9VA 4Y1AE 1NKOA 1BBJA 5JDSA 5C08E 3TIDA 3T0EB 2IAMA 4K3JL 4JCMA 3GO1L 3ZDZE 1VPOH 3FFCB 5F3HB 5HD8C 3MYJB 1FFNB 1KJ2B 2J6EA 5DUBB 4GUPA 2W0FB 2IQ9L 3CPLA 1CLCA 3NACH 4QXWA 2E9WA 4ELMF 4APQC 2I9LA 3FHAA 4E42A 4PLKC 4TSAH 1EHXA 5K59E 2GY5A 1R5IB 4RNRB 4NT6B 3F7QA 4I48A 5EUOB 1OAYH 4XHJC 2QSCL 1B88A 4PPTA 1I9IH 2DJ4A 2GK0A 1F6AA 5IUSA 4NKIH 1S9VB 4GRLC 1YMMA 1LO3L 4HUVA 1G84A 3LS4H 4AEHH 1M6OA 2ATPB 4WI9A 1Q9LB 4ZUSA 1S5HB 2GIYA 3I84A 3MUGA 4S11A 4MD0B 4LCYB 2IADB 2I07A 2X41A 1P4LB 3QNYA 4NIKB 1IGFL 1T1XB 4HK0A 4I77H 1BZ9B 3V5KB 1I3RA 3PDDA 3RUGF 4KKLD 4ZYKB 4PRPB 2JB5H 2X9XA 3ULUH 4JFDD 1KCRL 4FFVD 1Z2KA 1A6WH 3MRFB 4R6UA 2P45B 3DLQR 2BC4A 3MBXL 4IDJL 4N8VA 2JELL 3V5HB 4GG8B 4YHLL 1MFEH 3V6OC 3OKKA 4XPAH 4WWKB 5BVJA 1T83C 3GIZL 4JRWA 1KOAA 1A0QH 4UOW0 4PRAA 1HXMB 3KLDA 5DC9B 2F54B 2R1XB 4NO5A 4CW1A 4GRWE 3QQ3B 3MO1A 4P5TA 1IGML 3VW3L 3MRNB 5KG9A 2HFTA 4LDLB 2DQCL 4FS0A 4JFDA 1V3JA 3STZB 1A6UH 1I3GH 5IVOA 4MB5A 1KELH 4P9ML 1ZA6A 8CGTA 3PP3H 4P9HC 4L4VE 5C0IB 4OLWL 5DMIH 4Z0XA 4JFFE 3W9EA 4ISVB 4YFEA 5IW6A 3WNOA 4NBXB 3LIZH 1J0JA 3GSNH 3EJYD 4LU5H 4BELD 2WBJD 1NUGA 1T04A 1EH9A 1LP9E 1W0WA 1W0VB 4IRJA 1MCOL 3KNBB 4F2MA 3WFHA 1QPXA 2YBRB 2H32A 3ZHKA 1WF5A 1CXEA 1P7KA 3SDYL 3U7WH 1Z5LA 1DLHB 4RAUB 5HHMD 1YEKL 2A73B 2ZUWA 4PY7B 1O0VA 5DI8B 2Q86B 1Q72H 3P0YL 4X7FC 4NQCB 2CLZB