1NIEA

The structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
333
structure length
333
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of copper-nitrite reductase from Achromobacter cycloclastes at five pH values, with NO2- bound and with type II copper depleted.
pubmed doi rcsb
molecule tags Oxidoreductase (nitric oxide(a))
molecule keywords NITRITE REDUCTASE
total genus 86
structure length 333
sequence length 333
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nieA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nieA02
1V10A 3QJQB 4KOCA 2GI0A 4DP8X 1AG0A 1L9PA 1NIDA 1MG2C 1J9TA 4NAJA 1IBZA 3T9WA 3FPXA 3N55A 1HAUA 3WG7B 1TKWA 4PCYA 1X9UA 2XX0A 8PAZA 2XU9A 3T6WA 4HHGA 4W1TA 2PP7A 1W6LA 4F2FA 5IY5B 3NP3A 3FYEB 2RACA 3CVCA 2HXAA 3JT2A 1BXVA 2GSMB 1GY1A 3TBBA 4DPCX 3NJIA 1E30A 2DYRB 2W88A 4GXFA 4KO7A 2XLLA 7PCYA 3CVDA 5PAZA 1DYZA 4BXSV 3KW7A 1XB3A 4A67A 4DP5X 1J9QA 4N4YB 3QJSB 5I6NA 1AZUA 1RZQA 3FQYA 1NIAA 2EIKB 4FAAB 3CVBA 1ILUA 4HAKA 3ABLB 3EH3B 5I5MA 2IWKA 2OV0A 2HX8A 2YAQA 1J9RA 2QDVA 4UF7C 5EHFA 2N0MA 1TEFA 1QNIA 2YARA 3IN2A 3FU7A 4KO6A 2XXGA 1AANA 2X88A 1E5YA 2IAAC 3FU8A 3AY2A 1KYAA 4A2GA 1SDDA 3S3BB 1PMYA 1BXAA 2BWDA 1B3IA 3X2QB 2LLNA 2QDWA 3AG4B 3TU6A 1PZCA 2FQFA 5FC9A 2CUAA 1AR1B 1HAWA 3PAUA 2YXVA 1SHWA 1BQ5A 1AAJA 1OE3A 2IH8A 1KBWA 4YSCA 2YQBA 4RH4A 4F7KA 4DP7X 3IE9A 1ADWA 1M9WA 2FNWA 1SFDA 3IBOA 4BDVA 5I5IA 2HX9A 3WKQA 3IEAA 5TK4A 1AS6A 2BZ7A 3V9EA 2CAKA 2PPFA 1OOWA 4A66A 1AS7A 1CC3A 5B7EA 1A4BA 1BXUA 1MZZA 3BQVA 3ABGA 1PF3A 1PNDA 3SBPA 2JXMA 2HX7A 4DPBX 2PPEA 4L0PB 1TU2A 1L9RA 1L9OA 1JXFA 2GC7C 1R1CA 2I7SA 2VM4A 2XVBA 4KO5A 2QPDB 3UACA 3MX0B 2J57A 3S8FB 4KNUA 1ZDSA 2IWFA 3GDCA 4HIPA 1URIA 1ZV2A 2DYSB 1NTDA 2I85A 4K9JA 1M57B 3X1NA 1W8EA 3NP4A 3NJNA 1JZGA 1N70A 5I6PA 5D4JA 2B3IA 2OJ1A 2CJ3A 1L9SA 4YSQA 3SBRA 3H4HA 4KNSA 1NDTA 3T71A 3UABA 3UAEA 4BWWA 4ENZA 2XX1A 2XV0A 2JKWA 1JZHA 4W9ZA 1DZ0A 1F56A 2UXVA 2E86A 3PAVA 1CURA 5A7EA 3ABKB 3FSWA 3TA4D 4JHVA 3X1EA 3NJGA 5LDUA 5AKRA 1AIZA 4CSPA 2DV6A 3T6XA 3RYMA 4G72B 2FQGA 5B1JA 1PCSA 2AANA 2J55A 1BQKA 1GS8A 2YXWA 2GC4C 3AZUA 3UADA 5AFAA 1MZYA 2UX6A 1MDAA 3ABMB 4KO9A 2IDUA 2TSAA 3HB3B 2DWSA 2BP0A 2ZWNA 1ID2A 1CUOA 2CCWA 3NJJA 4AKPA 2IH9A 2FT7A 5PCYA 1JZFA 1WA0X 2AZUA 2GB2A 3PPSA 4DPAX 2BP8B 2BP8A 2VN3A 2FTAA 3OQRA 2ZOOA 4DP1X 2WSDA 1J5DA 3FU9A 1ET5A 1GY2A 4ZK8A 2YAHA 3SQRA 1T5KA 2BP0B 4YSUA 4E9SA 3JTBA 4GP5B 2GBAA 3UAAA 1ILSA 3UGEA 3HEIB 1SNRA 3S3CB 3FQ1A 3N2JA 1NINA 1PNCA 2BO0A 4YSTA 6PAZA 5F7AA 2UXFA 1GR7A 1A8ZA 2I7OA 2VSMB 2VMJA 1WS7A 2FJSA 3U25A 4YVUA 1BYOA 3ASNB 4BXVA 6PCYA 3WKPA 4AKQA 1ET8A 1XMEB 1ASOA 4NB7A 5I5JA 1OV8A 2P80A 4G70B 1KGYE 2W8CA 5AZUA 4E9XA 3PLYA 3S8GB 5D4IA 3EF4A 1PAZA 4JKNA 1A4CA 5B1BB 4BWUA 1SJMA 4GP8B 3WNIA 1AZNA 3NSYA 5ANHA 3SBQA 3MBWB 3IN0A 1V55B 1FA4A 3FSVA 1JXDA 4A2FA 3CG8A 1GYCA 4HCIA 1AG6A 1OCOB 1RZPA 4YVNA 3X1FA 1JERA 4YSSA 2FT8A 3OMAB 1NWOA 1JXGA 1N68A 1IUZA 2AZAA 4GP4B 4MFHA 2ZONA 4DP0X 3AG2B 2HRGA 4YL4A 5TK2A 3PCYA 1XB6A 4G7RB 3BVDB 1PY0A 3EH5B 3NJFA 3TASA 1NZRA 1NIFA 2VW6A 4WTQA 3NJKA 4HHWA 4Q8BA 1FWXA 3T6VA 3AG1B 3NJMA 1ASQA 4HZ1A 5F7BA 1JZJA 1XB8A 1TEGA 1GSKA 1QLEB 1WAEA 2OCCB 1GS6X 1W6WA 2PP9A 2EINB 3D12B 1OCRB 1VLXA 2VW7A 4G71B 2IDFA 4E9YA 1ET7A 2YAOA 3H56A 2BWIA 1OCZB 2PLTA 2GHZA 1KCBA 2UX7A 5B1AB 2J5WA 1ZPUA 3NSCA 3X1BA 3L45A 3NYKA 4A68A 1EHKB 1I53A 1CYXA 3FPYA 4UANA 2BZCA 2YAEA 1AACA 5I6KA 1IKOP 1A3ZA 1SDDB 2FQDA 4CSZA 2Y1AA 4DP9X 1E65A 5B1JC 1CYWA 3FU7B 4M4RB 3TBCA 2FQEA 4KOBA 4A2HA 2IWEA 2PP8A 3QJVB 4Q89A 4KNTA 4A2DA 2Q5BA 3ZIYA 4YSOA 2VW4A 1HFUA 3CDZA 2XWZA 3X1GA 4NERA 1RKRA 1V54B 2MTAA 4X4KA 4YSPA 2H47C 4AX3A 1BQRA 3ZX1A 3PXLA 3H4FA 1JZIA 2YAMA 4YSEA 4JHUA 2QT6A 3ERXA 2DY2A 2XUWA 2TSBA 2XYBA 4YSAA 2XXFA 1E5ZA 1NIEA 1SHXA 2BW4A 3WNJA 1NPJA 2PPDA 2R7EB 4E9VA 3ZDWA 1KV7A 1J5CA 1BEXA 3FYIB 4WKXA 3NJHA 3QJRB 2AFNA 3ASOB 2UXGA 5I26A 1NPNA 3FSZA 1J9SA 4DP4X 2DWTA 1AZCA 2X87A 3FQ2A 4E9QA 1RCYA 2A3TA 2MRYA 3OMNB 1IBYA 2H3XC 1QHQA 1GW0A 2Y69B 1SFHA 1AZRA 4P5RA 1WS8A 2PCYA 2CALA 1KDJA 3NJLA 4M3HA 5I6LA 2VSKB 2CBPA 4N8UA 1E67A 2IDTA 7PAZA 1PZBA 1KCWA 2PPAA 4E9RA 3PAZA 3T6ZA 3OD3A 1X9RA 1WA2X 4HALA 5B1KA 2WO3B 2FT6A 3KW8A 4DP2X 2R7EA 3QJTB 4AZUA 2BHFA 4A2EA 1ZDQA 1NIBA 1IC0A 3C75A 1OE1A 4BWTA 2HRHA 1PLAA 3ZBMA 5B7FA 1PLBA 2WO2B 3OM3B 3WIAA 1KDIA 1OCCB 2ZXWB 3NSDA 4GY4A 2HLEB 1FFTB 1JVOA 5I6OA 5B7MA 2PPCA 3FS9A 1ASPA 3QJUB 1A65A 3G5WA 4EF3A 3NT0A 4E9TA 2B08A 1OE2A 3WI9A 4UAHA 2H5UA 3EHBB 1AS8A 2P80D 3CDZB 2XV2A 1ETJA 4AI7A 1BAWA 1M56B 2XV3A 1GS7A 1WA1X 2AVFA 1NWPA 2PCFA 1AQ8A 2FWLB 1JVLA 3AG3B 3DIVA 1YLBB 2EILB 4BK5C 3AW5A 3GXUB 4GYBA 4P5SA 2EIMB 1A4AA 1JZEA 4HCFA 4G7QB 1SF5A 1L9TA 1NICA 2EIJB 4HCGA 2IDQA 4YSRA 1UATA 4QLWA 3QQXA 2YAFA 1ZIBA 2JFCA 2UXTA 1L9QA 2VM3A 1PZAA 1AZBA 2BW5A 2Q9OA 4FA7B 4F2EA 3NSFA 9PCYA 4YSDA 3QPKA 4PAZA 4DP6X 4E9WA 5B3SB 5I28A 1KBVA 1EZLA 1ZIAA 3DKHA 2NRDA 4BDVB 1AOZA 1OF0A 4AKOA 3FT0A 1MG3C 2GIMA 2YAPA 5E9NA 1BYPA 1PLCA 2HZHA 3V9CA 4TXVB 3CZUB 2IDSA 1JOIA 3GYRA 3DTUB 5I6MA 2QPEB 3OMIB 2J56A 1SF3A 3S3DB 3EH4B 4QKTA 5D4HA 4G7SB 3FSAA
chains in the Genus database with same CATH superfamily
3BSHA 1N0XL 4DP8X 1KB9J 4P5KB 4FXLA 2O61B 3FN0L 4S1QL 1UHVA 4HH8A 1I8LA 4OM0H 5EZJB 3K72A 1JIBA 1I9IH 2K4AA 3QQ9D 4FTVB 1Y18B 4YDJB 2ROXA 1KCKA 1T1XB 3FCBA 1IGTB 3L6FB 1M6UA 3LZQA 4Y2DC 4KNQA 1AI1H 1NOAA 4DOHE 4M43L 5C0JB 4QHNA 5I17B 4LOEA 4PR5B 3QEQA 3TNMA 5AVZB 1UH2A 3SE4C 1JGUL 3RHWK 5JIDA 2X4TA 1GGIL 3SDDC 4KTDL 3PWPB 3BSGA 4JVWA 5F21B 1USQA 5FUOL 4GIOA 2DQFB 4WWKC 3JT2A 5GS2D 4URKA 4Y4FC 1YN6A 4NT6A 2ZNWA 2EIDA 1EMTL 4M00A 3LQZB 3S4SG 3LSOA 4U33A 1LD9A 4PLNC 3GJFK 4Q6IA 1TETH 3BZ5A 4LBEB 4GXVL 3G6DH 3FQYA 4BIKA 3OAYK 2NXYC 4PGEB 2CRIA 4B9IA 2R0ZH 4M5SA 3V0DA 1HKLH 1NLBL 5LN8A 5JR1L 3RILA 2JH2A 3ARFC 2YRZA 4GNKB 5ECGA 3ZTNL 2E7DA 3HRZC 2OLDA 5IQNA 4LLVB 1R5VB 1JRHI 4NUQA 3Q8AA 3GTNA 1P6AB 2X4TB 4OCNC 1NC2D 2Z0BA 5FWQA 3M86A 1QNIA 3FAWA 1MQ8A 4KO6A 4QHNB 4G6JH 5GJTH 5SWZE 2O6CA 1AE6H 3MCLH 3AY2A 3TA3D 5IF0B 3T0EB 3WELA 4R4ND 1PMYA 3ECBA 3UL4A 4X2UA 4UQDA 5HVWA 4AXWB 4JKMA 1CFVL 4JN1L 4P5KA 5EIQA 5CBEB 4TTGA 4N68A 3AREB 1N5AB 4TPRH 3BUDA 4OIIL 5FLVA 1QMUA 3VXUE 3BUQA 5G5DB 2FX8H 5C86A 1QBAA 4MAYA 4MMXB 1EANA 4G9DA 3L13A 2FBOJ 1OW0C 4TUKH 4FKKA 4NLHA 3D06A 1ORSA 5BV7H 3F5WA 3T1FB 1T83A 1RIHH 4GAGH 1AMYA 3HTLX 5DD0H 1SBSH 4Z7OE 1UM6L 4M7LL 1RLWA 4NZDA 2C9QA 4PJHE 2VLLA 2BNQE 4R0LB 1WPCA 5F7YC 2C9VA 3VFVB 2NXYB 5SX5H 3TCLB 3GC3A 1ZJAA 4BFEA 4WGVB 4NQSA 3HRZB 2YPVA 4L0PB 3RKDD 4QXTB 1CXLA 1NCWL 2BVOA 3IKCA 3E8UH 1AHWC 4IBZA 1CB4A 2I7SA 3ROLA 1EFXA 2YBRB 2FJGB 1ZHKA 5J89A 4TUJA 3EYUL 5D1ZC 3GMMB 3RGVD 5E4OA 4Z5RB 3FO2A 1OM3H 1XZ0A 1IARB 2DYSB 3V9FA 1FLTX 1JV2B 3T3MF 1DANT 4U1SB 1JZ5A 4HWZB 4XNZC 3GMRB 1I9RL 1R34A 1XT5A 1IZJA 2P49B 1MCOL 3IVKB 2B3IA 5F89B 4KK6C 1KCUH 1L9SA 1TOXA 3LKSB 5KWYC 2ODIA 2Y07L 1SUHA 2EXWD 4N2AA 1OLLA 1UURA 3ZKMC 1QI5A 2RR3A 4P9HL 4KH2A 1CF8H 5SWZB 2OJEA 4TLSA 4WEBL 3TA4D 3U6RB 3JQOB 3B2PA 1BA9A 4LXFA 5EU6A 2IPTL 2NY1C 1AIZA 2NYKA 3EJRA 2DMHA 2EDRA 5GHWH 4KHTH 3E2HB 2ZWZA 1MN4A 1PY4A 2D7NA 3QRLA 3QEQD 4WAFA 1NKRA 4DQOL 2YD2A 4R0LC 1SY6L 4U1IA 1FFOA 3P40A 4N0YL 5D93C 4W9EC 4L5FL 4QKXB 3AZUA 2YUWA 4QEGA 1MZYA 2APSA 3HB3B 3W81A 1HZKA 3AU1B 3KJ4C 5EUKB 4U0RB 4J3TA 1FVDB 1IGIL 4Y5VC 1JD9A 3PPSA 4X9IA 2NXYD 2EDNA 4UQAA 5IOPA 3V6OA 3O2DA 4YQXH 4B9ZA 4Z8FH 2AHIA 2O5NA 2VLRE 2VR5A 3EYFA 4P2YA 3D69A 4POZC 2FNBA 5BXFA 4AIXA 2YFNA 5L4JA 3CH1A 1FO0A 1UKTA 1Y1UA 2H1XA 4FYSA 3GPSA 5JR1H 1S7XB 2AW2A 2G5RA 4PP2B 3X14B 1OALA 5EA0L 4YHYB 1TF4A 2ZOTA 1FPTL 4RDQF 1HNFA 3IGAA 3MA9H 3H7LA 1CDIA 2YLHA 1G1KA 1ZHLB 3VFTB 5DHEA 5ESVB 3F05A 2ORBL 4R7VA 4ZTPH 2D7PA 3CMGA 1RLBA 1C12A 1QBMH 4ODUB 4Z7VE 3RZCA 2XV6B 1IBDA 2NY1B 3DMMC 3OAWA 5DS2A 1EEZB 4G80A 1FNGA 3ARGA 4PJBF 5EIIA 3J27A 3QQ9C 1DQLH 2E6JA 4Y2DB 3UP1A 1JGVH 3BKCL 5EZIH 2FLMA 3FQ4A 1JYNA 3SPGA 2VO5A 3E3QC 4MJ6B 3GMRA 4AGQA 2HMID 3DV4A 4OUOA 4GP8B 3HFFA 2N3JA 3RURA 4Z5RA 3FSVA 3O0RH 3KVDD 4XMUA 3VFSA 4B60A 4LPWA 2G9HB 4UU9A 2LU7A 4LKCA 5FF6A 1TJIH 4F8OA 4J3OF 5EWIH 1H9VA 4KPHL 2AJSL 1PY0A 1NGXA 3G5ZA 4HC1A 1P84J 4RQQB 2V5RA 2MCMA 3TASA 3VFVA 4WTQA 1TQUA 3NJKA 3PQYB 1SOKA 2LU3A 1FGNH 1X9QA 3A5VA 5DZOA 2V17H 4D9QE 5HGGS 3SKUD 1JGEB 5D7SL 4AM0Q 4M7KH 4Z3TA 5I9QC 4WV1C 3NPZB 3TM6A 3Q01A 2ZXQA 3CU1A 4HK3N 1OAUL 2DQJL 5JYLA 4MMXA 2EINB 2QSTA 3H2PA 5JXEA 1C5DB 5AB2A 1NGXB 3G5ZB 4RQQA 4HETA 5JPMA 1ZWIB 2R1YB 2BJMH 1VEMA 3MV11 2ZOLB 3NYKA 1EHKB 3A6BL 3MQIA 4LKCB 5DO8A 3EYQC 5FF6B 4A2MA 5IWLA 4LHUB 5MHSE 2EADA 1MLCA 4ZUTB 1HE7A 1E65A 3L1OH 2GW5A 5LGYA 3HAEB 1TTUA 5EU6D 2J4WL 4H88L 4Z3JA 1QBLH 1MNUL 3DV4B 4EXPX 2GBTA 4LGPB 4L3CB 1OAZL 2R0LH 4MDJB 1EEYA 3O3EB 1XCTA 3DRQB 2M26A 3G9VA 4XN9A 1NMBL 3TH3T 5M95B 1EAQA 2XWZA 3W2DL 5KVMC 4MZIA 4YXHH 4NZUL 2Q87A 5I8EA 1NFDA 4TVUA 4X4KA 4YSPA 3HKZA 4G80B 1M71A 3U0WL 1FNHA 2VDPL 3ZDYB 4BGDA 1CZ8H 3B9KC 4EI5A 4GQRA 5JHLL 3ZE2F 2BVEA 1LO4L 1W9XA 4MA1C 5HI3C 3TEUA 2XIDA 1AZZC 3L3KA 2GY7B 3H42L 3FULA 1K72A 2EDWA 3F83A 3S97C 4JO2H 4QRPB 3W9EA 1QZNA 4IGBD 2F54A 4GAFB 2X4SB 3H9YA 3RL1A 2EVIA 2ESVE 4QT5B 1KTRL 3ZGIA 2NY3D 1MY5A 2P5ED 3MLRH 4X5WA 4LOVA 1S7XA 5FHBH 3GBML 4PR5A 3TNMB 2H3NB 2JK5B 3ET9F 1UM5H 3VG9C 2X10A 3SGEH 1QSEB 3BPLC 1FZMB 1Y18A 4X4YA 5I1LA 1U0QA 4JO4L 5GXBB 3I74A 5KN5B 5EMYA 2V33A 4CKVX 1XCXA 3GSOB 4YWGL 2Y69B 3TV3L 4DESA 3U2SA 2OR9H 5AOJA 1XGQA 4NRZB 1WS8A 4GRWF 4YHZL 3QCUH 4IOIA 2HWZL 4HPOH 3CN3A 3GK8L 4U6HB 5KSVA 4HK0A 1E5BA 2R1XA 2PCPB 3NFNB 3ULSB 2E7BA 5E00A 5BMFH 2WO3B 4F7MA 2NY7H 5EU6B 2MCAA 4HAGA 1NIBA 5IMMB 3KJ4B 2JJSA 2ZKXA 3TT3H 5I1GH 3GRBA 1IBGH 4DF9A 1HINL 1I4FA 1TFPA 3OM3B 1BW8A 4PJAB 3ME0A 1DSFH 3Q5TA 4FQXC 3SPVB 2NUTA 1YPZB 3V7MA 1NCDH 4YX2L 3TJEL 2GK2A 3KYMA 5E8DH 2H5UA 4JFXB 4EI5D 4LCYB 3CDZB 2XV2A 3RWCA 2AK4D 3R4RA 3B6SA 3EDFA 4PGJA 1ZLWH 4JKKA 3NPSB 2IBGA 2XV3A 4KVCL 4BFJA 1CI5A 4O9HL 3ZHDA 5CZVH 3MJ9A 5F1NB 5KYYB 1HZHL 4NHUA 2PCXA 4BK5C 2QHLA 1DQQA 4JN1H 4WTZA 2GK0A 3ROLB 2BDNH 5JXED 1UWGH 3O6FB 3UOAB 4MJIA 4D9LL 4OUUA 5EEZA 4NQSB 1YMMD 2IOOA 5IVXA 4TL4A 5IB1B 1OP3H 4D9LH 5HPOA 1TEYA 5TQ2L 4JPQA 5JPNC 2XG5A 1SXAA 5HJ3B 5D1XC 1IQWH 1LDPH 5TQ2H 2DJ4A 5EIIG 1M05A 1R0AL 3PG2A 8FABB 1WFOA 5D7HA 3SGKA 1AE6L 1MG3C 1HX0A 5F6HI 5KANI 1DL7L 2PYEB 2D9CA 5G5DA 4DUXA 2BIQA 3P9MB 5DURB 1JHLH 5F7UA 1BOGB 1EZUA 2J56A 1X5IA 3MRKA 4WO4B 5D4HA 2CO7A 2XIBA 4R5TA 1MCWM 5KG9B 2JELL 4Y16B 2Y9RT 1JDDA 1IBGL 2MH4A 2NOYA 4G9FE 3H1ZA 4ETYA 4PBXA 3DVFA 4AC4A 4RA0C 2G30A 2EC9T 4NAJA 4C83B 1RULL 2WQUA 4KI5C 1DEEA 5CCKL 4Q0XH 3VXNB 4HUWB 3EYUH 4W1TA 4L9LB 1PG7H 3F58L 1TZGL 3DX0A 4XGZB 5DO2D 4N2BA 3PWPD 4F2FA 4BA0A 5K9KA 1ZTMA 3VB8A 2OZ4L 2Z8WC 4QY8B 3S4SA 4MASA 4K94C 1FG2B 1A9BA 4MWFB 3TT1L 4I0CC 5C3TA 5E4AA 3WIHL 4NJAL 1S7SA 5C9JA 2WTPA 3D2TA 4HSQA 5KJ4A 4HUXA 3DOSA 1VFUA 4AEHL 5IG7A 1U95A 1LD9B 3LSOB 4BGLA 4JLRB 3V0GA 4H5SB 2R23A 5DYOA 3BVUA 4XO8A 2DPKA 3BPCA 2VT0A 2OAAA 3TF4A 4WUUE 3FB6B 4ODXA 1NIAA 3BSZH 5HGBB 5T1LA 3QH3B 4Z0XB 4NQCA 5IT2L 3FOLA 4P05A 3BC9A 5H4ZA 1ZLSL 3CQPA 2LTQC 2YWZA 4UMGA 4M6AA 5G2NA 4ZG1A 5KVEL 1A9EA 3KXFD 2H1PH 1JPGB 2YRBA 3BP7A 2Y4SA 2ZCZA 4M8QA 1SM3H 5F72S 5C0JA 4NZTL 2V8MA 3FU7A 3QXWA 1YQVL 4O5LH 4XO9A 2Y72A 3FT3A 5SWZD 5FB8B 3TS8A 3BZ4A 4HC1H 2JJVA 2G75B 4J6IA 5LDSA 4HBQA 1QRNB 4AXWA 5DYFA 4LASH 4LHUD 5KBLA 1LJMA 1G9NH 1B3IA 3N1GC 1IL1A 2XQYK 2F7QA 4FQ2H 3JV0A 3KPSE 4PGDB 4MA1B 3VW3H 4P49A 1BJ1J 3GO1H 4LVNB 5F44A 2HJFA 4KY1H 1HAWA 4BD4A 3VSQA 4M48L 3O2DH 4I77L 1AD0A 3RWJA 4ZFZA 4DP7X 3N1QC 3US1A 4PJ9C 5JDJA 2ALWA 1C08A 4XXCC 3KD4A 2E74C 4XCNB 1CQYA 1HJBC 5GRXG 1Z5HA 2VZUA 3UCRA 1YEIL 1QATA 3RFZB 4HKBA 5B7EA 3VWJB 4KZDH 3PQYD 2KLSA 5IP4A 3PDOA 1FZOA 2K45A 4MSWA 2H7WA 1J1OH 3WHXA 3ARDC 4Y0GA 2P5EE 3IDMA 4KTDH 4A38A 2WOYA 4RA3A 2I9LA 4F3FB 1FZKB 3JYCA 4U1KB 3C5SB 2Z8SA 2G4EA 4KO5A 4QRUA 2Z91A 3VXUD 4EO5A 2ZKYA 4KNUA 5KYUA 1DQDH 2JCCE 3QG7H 4WI0B 5A2CA 3GDCA 1CFSB 2VL4A 5JW5A 2V7HA 5BQ7A 3R06A 2Q20A 3QA3B 4HPYH 1SYVA 1B2YA 2UZYB 1MJUL 2OMNA 4LEXH 3PUUA 4X4XA 2Y7QA 3L3OB 4OVVA 4KRPC 4CC1A 1I7UA 5C0CB 4DGYH 1MHPL 1YMHB 1KPVB 4PRIE 1ZLVK 3ARED 2EXYC 3SBRA 1U3YA 4PRHE 3UAEA 4PJGA 3I9GL 2HVBA 1E50A 2UUDK 1HQRA 4JE0A 2ESVD 4N0FA 4WO0A 3FBQA 2UXVA 3FNKA 4GFTB 5A7EA 4MQ7A 4UBDD 4WTWA 4MCZB 5KVEH 1NAMH 3BLBA 4C4KT 1LO0H 3SQBA 3RB7A 2CHXA 4DEUA 4AE0A 2CIIA 5EN2B 4UB0H 1YJDL 1S9WB 3NSXA 2C3VB 4HQQH 2DZEA 3ARSA 4UOW1 3PWUA 2KZWA 1OTSC 3BWZA 5HHME 3HC3H 3Q2WA 2KLRA 1JWSA 3MJ7A 4GMSL 1EJ6A 1F4WH 2ZWNA 1C5CL 3F7LA 1E4XL 3L3GA 1MQKL 2QVKA 2AGJH 3OKNA 3SIKA 5FXCH 1MVYA 4LIQL 2CLRB 3Q8BA 1A6ZA 4F8LA 1NKGA 4CGTA 3DGDA 2FTAA 3O3BB 5L4IA 3STLB 4KK8C 3RJOA 4EEEA 1BG9A 5DMGC 1FGVH 2MTPA 4MCMA 3L1EA 3KLDA 2BP0B 3N44B 5GRJH 4YSUA 3DUSA 1ILSA 1HINH 4GKOA 1YMME 3EOTH 3N2JA 4L5FE 2EUWA 4ZTPL 2VDOH 3LVTA 5HGDA 4LLQB 2WZ6A 3DSFH 3UIYA 4GRWB 3QWOA 3EYVA 3HUJE 4JAMB 2A9NH 4MJHA 4PS4L 4O02L 4XMXA 5MENE 3BW9A 2UYLB 2HKFH 4HV8B 3ZQXA 1UA6H 3KCWA 3ASNB 1CI3M 3MLUL 4Y4HC 2QSCH 3MDJA 4BYHA 4JO1L 4G6AD 1DBBL 3UBGA 1DVTA 2XN9B 4E5XA 2VLKB 2FX9L 4YXLL 1UQSB 1MRFH 2A6DB 2D4FA 2APWA 1KYFA 4U3XA 1EDQA 3SKMB 5LGJA 4L9LC 5ITFB 1HOCA 4WTXA 5HBBA 3KBFA 2W0PA 4KAQH 4X99A 5F3HB 1KSRA 4JFDB 4DW2H 5ANHA 4H25A 5CU9A 4WEBH 3IN0A 1IBFA 3IDJA 1YNLL 3LXBA 4IOFC 5BZZA 4YBHA 4HEME 1F6AB 1PEZA 4PJ8C 4H1LG 1NWOA 5DFVC 5CIPB 1NEZG 3X3FH 3EGSA 3GGWB 2HLAB 5IW3A 25C8L 3MNVB 2R83A 3P2TA 1I1AB 4XVOA 2OSYA 3MV7A 1ETZA 2WAQA 1EGJH 3IMRA 3L7EA 1M2VB 4N0UE 2Z1PA 2ADJB 3OHXB 2YR3A 4IHOB 1QSFE 4J27A 3ZW3A 4ODTL 4GBXA 1T7WA 1XB8A 1TETL 4U6VL 1H15B 4N85A 2QQQA 3H3PL 3IDXL 3UTSA 5ALCL 3ZGHA 4P04A 5KSAA 2APBA 4KXBA 1KT2A 2MQCA 3A6BH 3A4AA 3HPLB 1HN1A 3BZEB 3DSFL 5FW6A 3US0A 4URTB 1S3KH 2BWIA 4N2CA 4QRRA 5CSZA 4XXWC 3HUJB 1TTGA 2KPWA 2R51A 3O3DA 4MDIB 3MGAA 4PWFA 3TJPA 1ZE3H 3GSNA 3LCYA 2WLYA 2COQA 4F33B 2DYPB 2P8MB 3MXVH 4ONHA 1NCWH 2YIHA 1ZAGA 4RGMC 4TULL 3BUYA 4JY4A 3DBXB 1XTMA 4ELME 2FQEA 1KFAH 1KPUA 4BKLA 3MRIA 3BT2L 2J1ZA 5AZEH 4A7SA 4LDEB 3REVB 2OMYB 3LZPA 5L2KA 1N59A 4A7QA 5IIEA 1XCQA 5LCVL 5I66A 1V54B 1UWEH 5IW1A 3N43B 3FFCB 4CMHC 4JFYB 4P4KB 3H4FA 1JZIA 1D6EA 2KZKA 5IUCA 2LT9A 3H0TB 4RDQG 4BFRA 5JHLA 5ICUA 1AP2B 4XCYA 1RHFA 2DY2A 1WZ1H 4PREB 3KPRE 1E9QB 4HIHA 4L8DB 2CPCA 4OLVH 3CC5A 1Q90A 4JFOB 1R6VA 2OJZL 5MEPA 4KKAC 4KKCD 3T2QA 1YRKA 4HGKC 3MXWH 1RURH 3GZKA 5KSUB 4PM1A 3QUKB 5AALA 4LVHC 2EDMA 3IFNL 5A2FA 1MFDH 1R3LB 2OYMA 3FQXB 4UQCA 4HP5A 4GFXA 2J7LA 4UDTB 4OI9A 1G9MH 2UY7A 4WDIA 3ILPA 3D2UA 1KCVH 1IAII 2ENYA 3IU3A 2A9DA 4RFNC 5CGTA 3DV6B 1QFWH 3ZTDC 1IBYA 4XNXL 5K9QG 4HCRL 3QG6A 4S0TD 5FUCE 2XYCA 3D39E 4K4KA 2G3NA 1WCQA 3RWFB 2IQ9H 1MCWW 3V0WH 3HC0B 4DAGH 5CF3A 1AZRA 4P5RA 4KKLD 4Q6YA 3WNPA 3OAZH 2WLLA 4JO3H 5E9DB 4B9GA 2V2WA 3LIZA 2BSSB 3KWVA 2ITDB 1U3HB 4KKBC 4NDMA 4J3OG 1U8OB 3HBZA 5J13B 3DWTA 2OR7A 2G2NA 3ARFB 5BO0D 1E7VA 3OJ2C 5E2WL 4NO2B 4XCCH 2QTEA 3MBEC 5EEVA 4IBVA 1DVZA 3RWDA 1P5UA 1HE8A 4PMEA 1E42A 1CG9B 4MRBA 1BVKB 1OSZB 1ML0A 2FH6A 2X4QA 4J4PC 5EU7C 5TDOB 1J8HD 5E94B 3CJJA 1MKFA 4PWEA 4AOFA 3CBKB 3DX8A 1BZOA 1CLYL 4ZX5A 5B7MA 2PPCA 4JQXC 3C9NA 1P6WA 2B08A 3QZWB 2ZF9A 1AS8A 1HHJA 1T5WA 4PRIB 4X6DF 3FN0H 3G9AB 5TF1L 5DD6B 4MA3B 4Y5XC 3MV8A 2V2TB 3Q8EA 4OLUL 2O4EA 5CEYB 1RU9L 4KDWA 5BOJA 4U6XB 4FYTA 4JFZL 4NWUL 1QA9B 3CZFA 3LQAC 2J6EL 4PG2C 3UZQB 4ORZC 4G9FB 4QCIA 3W39B 5J7CC 3CUPB 5B39G 4PJDE 3CZGA 3MACL 2H2PD 5DD1L 1KXVC 5F0PB 1JWMA 4R26H 2FECI 4PLJD 2P8LA 3DETC 4OZHE 3M1OA 5IT2H 2VM3A 2OA9A 4KMTL 4H8QA 3VFPA 2VQUA 1ZVSB 3WFCH 2BW5A 4S1DD 5BS0A 5IFHH 4Y19D 4KK5D 3HZVA 3SQOH 1ZKAA 1X7QA 4HF5L 1YO4A 3D51A 4ZTOH 5FDWB 1R19A 4ODVH 1U8NB 4JGNA 3P4NB 3SCMB 5CZXC 4I0PA 2DB8A 3KPTA 1NC4A 1YHPA 3NEEA 5A3ID 5F88B 3TWYA 1N6UA 4H0LC 1KXQA 4LFHG 3E8UL 3ZQWA 3CXDH 4HX1B 2LLLA 2ARJB 2C9RA 2IALA 4ZQKB 1LEIB 3FONB 2VIRB 2FB4L 3LZFH 1K2DB 2DQCL 2VR4A 4WJ5B 4F57L 1YNKL 1WT5A 4OU3A 3OF6D 3F58H 1YY9C 1H3PH 1K4CA 1ZT1A 2ATPB 2BMKA 1J12A 4Q0XL 3PWVA 4KI5D 4H2CA 1NKOA 2BH0A 3PGDA 1P9MC 3V5HA 4O2CB 3BAYA 3C60A 3CZSA 3O6LH 5L8JB 4PVNA 2O5ZH 4KTEH 2WY3B 4XVSL 4YHLH 5ETUA 2OTWB 1X9UA 5G4OA 1G9EA 5FX3A 3OZ9H 2X7LA 2BLFA 5DK2A 2FIKA 5D1ZI 2XFXA 1PZ5A 1WV7T 3NZ8B 2RTTA 3N91A 1RXLA 5IHZA 1HL8A 4F92B 3CFKB 2HKAA 4RMUA 2RGSA 2ZXDA 1NMCC 1IFHH 3LS5H 3CVCA 1NGPL 2CMRL 3JVGC 3PAYA 4I87A 4DPCX 1L7TH 1LQSR 1EO8H 3CHPA 5ID0B 3LKOB 3NCFB 3RVWC 2W88A 5DS8A 3UTPD 1DQTA 7PCYA 3H9SE 2AQ2A 5DJCB 3AQDA 3E8VA 2XPZA 3KPOB 4JQIH 4DEPC 2QHRL 3PU7A 2EO9A 1A6AB 3VXSE 2E9WA 5JXAL 3EOBA 1T4KA 4XAKD 2I5YL 4Q9RL 3CVBA 5I18H 3UJJH 1MF2H 1U8QB 3QCVH 1TCRA 5DEJA 3GXIA 4P2QD 3MMEA 2Z34A 5CJQL 5KTEH 4WEMB 3VWKB 2B5IB 1CLZH 1P1ZA 3GSWB 3FQTA 1J9RA 1FL3A 2BCKA 2DLFH 4MD5A 4APQC 2G0KA 1SOSA 2ZJSL 1HILA 4XX1E 3TVMD 1R46A 4BH8B 4OF0A 3WTYA 3VG0L 2BWQA 2EZ0D 1KYAA 1L6XA 4JPIB 5DMIH 3T3PF 1CL7H 4G8IB 5IQMA 1WF5A 2NY6D 3G04B 1NCAH 1J0ZA 3R7QA 4WJG3 5LBSH 1R3JB 4PP1C 3NG5A 1H5BA 4WUUA 2WXIA 4HQQL 2MOVA 3IGUA 1E43A 3MLYH 1G7LA 2D7TL 5H37A 5GSRB 4ODSH 4OZHF 4JM2D 4RWYH 3M45A 4LQFH 3ESVF 4QIRA 4N90D 4ANXA 3FUJA 1Y6KR 1E8XA 1YUHB 1SZNA 2WK2A 2YSTA 3FU3A 2ZJSH 3NIGE 4Y5YA 2WJ7A 3RUGB 1INEH 4JB9H 3KBEA 1CMOA 2HVJA 2JIXB 1RZ8B 2Y22A 4EBQL 5INDB 5LLIC 2CAKA 5IB2B 1OOWA 2AXGB 4HCRA 1U8LA 1BM3L 1QD0A 2FJHB 4NS0A 2O6PA 2XACC 4P4KD 4RRPA 4XN5A 4WF7A 1MFNA 4UINH 1BJ1H 4M1GH 3LIUA 3VXUB 2J1KA 5HHOE 2EXSA 4EDXB 3FW6A 4LOUD 4O02B 4WU5A 5AAMA 3WYRA 4WWKB 3BEWA 4UQ3A 2PWHA 4JQVA 1L9OA 4OM0L 3TN0C 3KPQA 4EIZC 1P5VA 3KS0J 4LOUC 4M7JH 3JBG7 3P77B 4WK0B 3CFTA 5CZKA 1MW2A 1ZV2A 2I85A 3KDPB 3P0YH 4PB0H 1OP3K 3SE6A 3CAFA 4HJ1A 3IMBA 2DWDB 3ULAB 3E0GA 1X4ZA 3QVAA 4H1LA 1JZGA 2BSEA 2VR8A 2WSKA 4WW2F 4F80A 3FUEA 2ICWB 3IFOA 4GI9A 4KNSA 5DT1H 4NXKA 4N5EC 5D2NA 3DTXB 1GGCH 1R3KB 3CIAA 1EJ8A 4R96B 4DERA 2NW2B 2V9UA 3EO1A 3PAVA 1F56A 1PLGL 3QC5X 3FTZA 5GGTL 2ZPKH 2IQ9L 3NIFF 1OB0A 3RDTD 4UTAH 1M7XA 4M48H 1WO2A 5BZXA 1ZGLM 2AEQL 2OZNA 4IRSC 4POUB 4IKKA 3NRQA 3RWIA 1N0LB 4KVNH 3RYMA 4GUPB 1PCSA 2J55A 5ERWA 4YZFE 1AQDB 3GXFA 3FRPA 3ULUD 3WS3B 4OIAA 4WW2B 2TSAA 1D5MA 4F1SA 2OSWA 1AY1H 1Q0YH 3WV0A 5ANMB 5DFWH 2CCWA 4PVMA 3RGVB 3Q0HA 1CE1H 3IDGB 4PJFE 5LAXA 2FD6H 1V5JA 2FECL 5D7KE 2VR7A 3GINA 3TP4A 4ABWA 2D7OA 2RQ8A 1AHKA 3LQMA 5G55A 1J5DA 3CSFA 3DYPA 1IV8A 2VOTA 5LAXB 3RGVA 2D2OA 1UWXH 1F4AA 1QR1B 2DS4A 3C8KB 3C6EA 2WNXA 3O6ML 3EGXB 1K9TA 2WCGA 4GP5B 2IAMB 3KYKL 4FKEA 4HJSA 5AVRB 3S2CA 3HEIB 4BUGA 4N9GB 1XR9B 4OTXH 3JV4A 2E4FA 1MFEL 3BP4A 4ALAC 3LNIA 3RWIB 3BKJL 4LE8A 4WRLA 4TQEH 4KPHH 4M1CD 3VGAB 2OSXA 3BUTA 4P3DB 4NJAH 2Q0ZX 3DROA 1GGBL 3PQYE 4JDZA 4NB7A 4QI3A 1LLAA 1QBBA 4NSKA 3KPSD 4OI8A 3FO1B 1VZIA 3GLEA 2CCLA 4NYLA 2Y0SA 3RL2B 3DTXA 4HGWA 5D7EA 2AERT 2Y7NA 3U4BH 3PLYA 4YDKL 3QDGA 2ICWA 4NP9A 3U7AA 3DJ9A 4HDIB 5KUMA 4X6DA 4JKWA 4H1LB 5B1BB 3C5JA 3GXPA 1DSWA 4KKAD 4NCC2 4P2AA 3MOBL 2EDDA 3MLXL 4QXVA 3B9KA 3SBQA 1BIHA 2ICCA 2ALAA 2X4UB 3ZJAA 4HAFA 4IQHA 4M5ZL 4A2FA 2DIAA 3G6JA 3OKDB 3GNMH 1OCOB 1A4JA 4ODTH 3QEHB 5IFJB 2FWOA 1UCTA 3D85A 4DP0X 5FO8A 4JE4B 1BM7A 4ELKA 1KPRB 1MW0A 2XZQH 5T8IA 3V0WL 1YZZA 1HHIB 2EVJA 3NCBB 1OZTG 2VXTL 1Q38A 1KY7A 2PR9A 5KYXA 4FJYA 2J12B 4X8GA 5EU7E 2UZXA 3BQUB 4WY7H 1RZ8A 2YN3A 4PD4J 2XXCB 1G7PA 2BIPA 1NANH 2AITA 4HZ1A 1NPUA 1ZTXH 3C8DA 4U1GC 4X5XB 3EH2A 3POHA 4AGOA 2ORBH 3NPSC 1WAEA 4GSDL 4U6TA 1F11B 2XTSA 1CDBA 1PG7X 5C0DB 1A21A 1MCJA 5D1ZA 3WIFA 1NBYB 3H3BC 4PJ9A 4WI7A 3KLAA 4UV4H 4KY2A 1HCYA 2BDNL 3K6OA 4QNPE 3FTGB 1F58L 4U1MB 4HG4J 5ABDE 2CA3A 1MXDA 2AXWA 4AC2A 4UANA 1CBVL 2WIMA 4X6EB 1MSPA 3BE1L 3ULVE 3KL5A 3MNWB 1A3ZA 3QO1A 5JIKA 5AZEL 2FQDA 4ZNCD 3AXLB 2NY2D 3VSVA 3MBWA 1QSFA 1G5GA 3GRWH 3ISRA 4PCSA 1ZT4B 3H53A 3WOVA 4DQOH 2A5UA 1XH3B 4WHCA 1K4DB 5CEZD 1ZGLP 1UA6L 4DUVA 2G2PA 2GAZA 2X1XR 3AM8A 4DN3L 5L4MA 2WPGA 4KQ3H 1PKQB 2W9DL 1G7MB 3HI6H 3QRBA 1WTLA 3ENEA 1B88A 4WU7B 1HFUA 4HS3B 2YMXH 2CH8A 3QZOA 4ORGB 5E0FA 3NJVA 2XVKA 1ZANH 3QUXC 3ZT7A 3O9WD 1AJ7L 1KN4L 2OQJA 2YRLA 2G3MA 4NC1C 4HLEA 4YSEA 2DL2A 5CJXA 2APFA 4PJHB 1L3WA 2QT6A 3ULVF 2WUBH 2XUWA 1B0RB 3UBXG 1J18A 2O5XL 2QSQA 3D0AA 4TUOB 4X7DC 1S7RA 1I9RH 4GSUA 1E5ZA 4E36A 4O51B 3ULVD 4ELMA 1OARL 1E9OA 4LIQH 3KWTA 2R7EB 4L0ZA 1O0VA 3U4EB 1EFXD 3VWKC 4TN9A 4ZTOL 1UYWH 5DHDA 1AGFB 3VD2A 2ZF8A 1KC5L 3QCUL 2WLIA 2OPCA 2ZP0T 4X7TB 2CG9X 2P5EA 1KTKE 4L8SB 2VNCA 3NZ8A 1LEKB 1MUJA 3ULUC 1NQBA 3FT4A 3I6LD 1RUAL 1TVBB 2Q1EA 4FNTA 4RAUB 4XODA 5BJTB 4XC1L 2OTWA 5I76A 5DMKB 5IM7B 1A7OH 4OCWL 5GGTA 1OM9A 1EXUA 3OMNB 1CR9H 4KQ4H 1CGXA 2VDOB 5EUOE 2J8UB 4OJFL 1C16A 4PJHF 3WLBB 2AMGA 4WFGE 2CALA 2VLRD 3KNBB 2A4CA 3SDXA 1WGOA 3B5GA 3ZHNA 3ZKQD 4NIYE 3QHFL 3DX7A 7PAZA 1KN2L 4F7TB 3ARFD 1N0XH 2OK0H 2Z7UA 1MCPH 3PAZA 3N41F 4LCWA 4U05A 3N44F 4F5CA 3T6ZA 1EJFA 2ZICA 5AUMB 2NY2B 43C9A 1U8IB 3ZTJG 2KERA 3OKLB 1M3JA 3P4NA 4WIQA 3ROOA 3SCMA 5FDWA 1PLAA 4WEEA 2F18A 2ADIA 1WHOA 4UM9B 1CTOA 3V8OA 1J8HE 3R7RA 3WIAA 3MVSA 4NIKB 2A0LD 1CF1A 2ETWA 3VCLB 4OIIH 5CD3A 2C1PB 3O0LA 4CC4C 3CZKA 3EJYD 1WUZA 2IANE 3MNDA 5IROC 2FEEI 1G1CA 5F1IA 3KLQA 3OB0H 5DJ0A 1PD1A 3MA7B 1CXIA 4FG2A 1XWVA 1HCFX 2VC2B 4KX8A 1QA9A 3IDYC 2JIXD 2MOQA 3RVUD 4BHUI 4N2MA 4GW1A 4OJCA 2ZX5A 3DIVA 2XG4A 1CE6B 2CNYA 3HHRB 3OSKA 4M6NH 4X5RA 4N0UB 3AW5A 3VDCA 4P46B 3AC0A 1JZEA 1GSMA 3MV8B 2BJML 2PABA 3RGHA 5CJBA 3RY5A 1FO0H 4Y4KC 4P9HC 3CSGA 3V10A 3UMNA 2NT1A 4MAZA 1SJEA 3F7PC 2Z4QB 3VSUA 1O6SA 2NY0B 2NSXA 2NUPA 2JE8A 4OCSH 4UZUA 3O2VL 4P2QE 3F6IA 3HG1E 3IFNH 2XVLA 3OC8A 1KXTA 1S7VA 5J12C 4FA7B 1UZGA 3BPLB 2VRKA 4K8RH 1WHPA 5D7LE 3T2LA 3DXAE 2AC0A 1CG9A 4XMLL 3RWDB 1IKNA 2L7UA 4AYDC 1KY6A 4NO2A 3UH8A 2WQRA 2NYYC 2IFFL 3DI2B 1PQZA 1A7NH 1JZ8A 1MWAL 4K3EL 1D6VL 5JDSA 4NDMB 5CINH 5I6MA 5J9PB 4PWKA 3AAZB 5EBGA 1SEQH 4YR6A 4X6BA 3ZYIA 4J12A 3BP5B 3TBVA 4L8CA 1A3QA 4TRPH 1CYGA 2VM9A 2WLLB 1RU9H 2Q3AA 3LPPA 4Z7IA 4Y2DD 1BGXH 4LF3B 2R2HA 4L3FA 1BLIA 3IMVA 2ZCKL 1TQVA 4FQQB 2F74B 4FFWC 4EN3B 1D9KC 3CC1A 4C4KO 4DVBB 1N6QH 1DN2A 2AF2A 4J2QA 3T6WA 1FYTE 1Q72L 2MJWA 3Q2NA 3NH7L 4YDVB 1H3WM 4GJTB 4TF4A 4QYAA 2Z9TA 1FQ9C 2QPFA 4MJ5A 2QQNL 3B7UX 2X9YA 3M7FB 3MLWL 1SEQL 3RIAK 4DZ8A 1KIQB 4WHDA 1M42A 2F5AH 3DUUB 5DJAA 1HNYA 4L29A 4PJCF 1OO2A 5DRZA 5ILTL 1VERA 5JW3H 3OB8A 4JFOA 2NCMA 3QWNA 1BQUA 3HZKA 3RZCD 4PREA 1WFUA 2A6IB 3PWNB 4BXSV 3C2AL 3W57A 2P7TB 2J44A 1P53A 1AHWA 4TTDC 4A67A 4LHJB 4YFLI 1YY8A 4JRXA 3FFCA 4HH9B 4QHMA 4A04A 3CBRA 2EIKB 1ILUA 2YD9A 4HCRH 4QTIL 2NZ9D 4FQIL 3E2HC 5DMIL 3MBXH 1KJ2A 5LB1A 1DUZA 3DVGB 4FNUA 5D9SB 5DRNA 3ULUF 2IXQB 4PJGF 4ANVA 1SGKA 4YE4H 2KZ1B 4HW6A 4N1CA 2W92A 3U1SL 3IN2A 1PZ3A 1X9LA 4H13C 1EQWA 1MCEA 3DBXA 1H8NA 1BEYH 3IWUA 4GG6A 1XO8A 2AK1H 2RH0A 4ZUWA 4NQVB 3E3QE 3CFUA 2XN9D 5DRWB 2P8MA 4ONHB 4JFUA 4F33A 3KPMA 2B0SH 4Y4FA 1U58A 4UNVA 3MUGA 3GSNB 4IMLB 2OULB 1HXMA 4N0YH 4GRWE 4ZW7A 1GZPB 4XPTL 4DGVL 5K1NA 4JFQB 3RPIB 4G2AA 3TYFB 2NY3B 3UXFA 2CUAA 3APCA 3QHZH 5L7XH 3IF1A 2WLJA 1SHWA 2BPBA 3U4AA 3MUY1 1UH4A 2IPTH 5T1KB 1BD2A 4BK4A 5KSAB 4OZIE 5LG1A 1M9WA 1SFDA 1MI5D 1ETB1 4NGHH 1TLMA 1OB1A 4LLYB 4PG9A 5C0IA 1ZVYA 1CGYA 1ZLUH 1N2RA 1WAAA 2GCYB 5BVJB 1TDQA 1Z9SB 1WBZA 5C0RL 4JY5H 4FJ6A 4Z77B 1P7KB 4AMWA 1WZLA 2V6HA 4NNXB 1I1AA 3U9PH 3R0NA 4QOKA 1YN7A 2BSRB 1UOKA 3U0TB 4HLJA 4KI5F 2Z31C 4UT6H 1TU2A 5DHXB 4MQSB 3WKML 4YHML 4ZTEA 2AEWA 2XVBA 2J2ZA 3I6KB 4K9EC 3ZE1F 3RWGA 2IPUG 4FL4B 4ZUUB 1GL4B 5DUJA 2B15A 4XVUD 2DM7A 4D0BB 1FGVL 2DH3A 4AUUA 4YNYB 1EVTC 4DTGL 3G5VB 1E9PA 4B3VA 3D52A 5TE7H 1F4YH 4F7EA 3N06B 4QHLB 1QHOA 5ITFA 5E4IA 4ZXBD 4BFKA 1UQSA 5FOJA 2WYHA 5GS1A 1PVHA 5HHOD 3ZDZB 3BZDA 2IOMA 2Y5EA 3UBXA 1PCXA 3LKPA 5K9JL 4QF1B 4PLKD 4O2EA 4X6CA 1I8LC 4OZGB 5CJ5A 1FVEA 4DSYA 4X8CA 3ZDXE 2XZZA 1UB5A 4XNYL 3OPUA 5GGQH 4PJEB 1LEGA 3HA0A 4MCNA 4N2HA 3WO4B 4P2CG 1UACL 2F54D 1Z9LA 1G6RA 2C1OB 2NW3B 1VCBC 3QPQC 4LLQA 3REWA 5ESQA 2QGDA 5DLMH 1GS8A 1THCA 2XKNB 4JFTA 4AQ8A 1RZGB 3AS2A 4GT0A 3QFJD 2AK4B 1ZTXE 1ZT7A 3DUSB 1T1YB 2YUXA 2BP0A 1XH2A 4K5MA 5D96C 4AWJC 5JNYB 3F12A 2VXQL 5C6TH 3L3DB 4M7ZB 3LS5L 4TVPE 1Z2KA 4N22A 4H8PA 1BAFL 3HHSA 1NDGA 1X5JA 2J3SA 2RJMA 2WXKA 3BE1H 2YAHA 1OTTC 4MVBC 3OR6A 3RP1A 4YZFF 3CSBA 5EC2A 2VC2H 4MKMA 4RDBA 4XP1H 3S3CB 5JHDE 4L3AA 1CL7I 4I18A 2BO0A 2DL9A 3S37X 1LO5A 4BUQA 1BXXA 4GXUM 4ZMWA 3OPZH 1RQ5A 1E8WA 1DDHB 2UXFA 5HHMD 1UTDA 4P07A 4M7LT 5ALBH 2ICEA 3S88H 3RTLA 3V0IA 1FHGA 1QLRA 2QGBA 4XXCA 1RZKL 3PJSB 1Q9WA 1CLVA 1PBYA 3FL7A 1NL0H 3DSNB 3S5LB 3WKPA 1FYTA 4FQJL 3RRQA 3PP4H 4L23A 4QGTA 2FGZA 2EYSA 1YY9D 2PO6A 1DQJA 1X5AA 3QDMD 4IU2B 5CGYD 1IAOB 3LPWA 3MOBH 4BUHA 2DQGH 1YMHA 3GS4A 3WKNA 4CDHA 3Q06A 1JI2A 2IBZX 1YG9A 3TT3L 1RD6A 1EV2E 2OP4H 3BH9A 5IK3B 4LIQE 4CC4A 5HI3D 2ZUWA 4QXGH 3S48A 4A6YB 1FA4A 4ZW3A 3IBEA 2BNQA 3ULVH 3DX1A 2B1HH 2Z4TA 2FCBA 3JTSA 2VDPB 4PY8J 4YVNA 5LGHH 2CO6A 1XEDA 1MHEA 1DSYA 2ZONA 4R2GB 3K2UH 3UO1L 3E38A 4ONFH 3SDAC 4I7ZC 4JFEE 3G5YB 1V3LA 3EH5B 1EAPA 2X0WA 3BKJH 3KBPA 4MKTA 5DHVH 4EI6B 5IMKA 1KBGH 3NJXA 5D2LA 1IE5A 4QAWA 3HS0C 1FWXA 4NNPH 1OKEA 3FB7B 4HKZB 3NJMA 3CPUA 3H9SA 2BSBA 5LN4A 5FYJL 1ITCA 4Z0BH 5FGCE 2QTVA 4GAYA 4MDRA 5HPMA 4H7VA 2ED9A 2V7NB 1P1VA 4JFPA 3VXOA 5J11C 1FIGL 1BMGA 5I8KL 3FTWA 5FA3A 1RH8A 4PGCB 3IDIB 3BN3B 3EYOA 1E7UA 1KENH 1AO7E 1BQLH 2Y7LA 2VDLH 3F3HA 5G4MA 4JO2L 1H8OA 4AL8L 1IL1B 4Y16D 4RMRA 5JO5B 4C55A 5TH2A 3G08B 3IAGC 3DK0A 1S7QB 2YAEA 3V7AG 2AJZB 5F2FA 2LFEA 5I23A 4DP9X 1DLHB 2JCCF 4NUGH 3FU7B 5FB8A 1CD0A 4KOBA 5D71L 3MCKA 1A14L 3IB4A 1S7UB 3B9AA 2XFGB 1IGYB 2F9BT 5I1JL 1HEZA 1D9KD 2OYKA 4DN4H 2NY4B 1WEJH 3F7QA 3MHZA 2D0GA 4NERA 3LPGA 2GFBA 3U6XA 4LAJH 5T1LB 2ZYRA 4PJBB 3FB6A 1F3DJ 5BZDB 1BQRA 4Z3GA 1Q94A 1LGVA 4GG8A 5CGMA 1QI4A 1HJCA 3LKQB 3BKYL 3B56A 1DE4B 4H0HB 4XNXH 2V8LA 4NO0A 3JTTB 3N85L 5TF0A 4WHYH 2HVKA 1GOGA 4U0QB 1TPXC 2CJTA 2VITB 1NDMA 1BEXA 2LAAA 3FYIB 4LKXB 5K9KB 1W8OA 3QQ4A 5AOMA 2BRQA 3MROB 3NDYE 1XSIA 2P24B 3FSZA 4L9LA 5E1IA 3PGFH 3FQRB 3MO1B 1QLEL 5IVZA 4DUWA 1TJHH 3VE0A 4AVHA 4FTVE 2F1EA 1TJIL 3OLIA 2Q7YB 4XPBL 1JF6A 1UWGL 5AKVA 2WAHA 2R69A 4C83A 1RVFL 4OZFB 1Q9KA 4P57B 3O2WH 5C08B 1KCLA 3BGFC 3VX1A 1S9XB 4LEEA 2CJSA 3EFOA 5DZJA 5EO9B 3EDEA 3CLFH 1KLFB 1XF5B 1GIGL 3QRGL 1E27A 3D08A 4ZI8A 2X1PA 2CKBH 4UNTA 5I1HL 3MRKB 1KDJA 1RK1A 3HNSH 2Z0UA 1BOGA 4WQOA 4PEEA 3BUPA 3GSRB 1EEUA 5CJOL 3FO9A 3OGCA 2NLJB 4PJXF 1WIUA 5KBMA 2ZKHH 3SDCD 2PYEA 3OD3A 3ZSTA 3IJSB 4RGMB 1Q9LA 1X9RA 1WA2X 4HALA 2I9TA 5GZOA 1XGUB 1IJ9A 2VDML 4JS7A 1SJXA 4QGYA 1KJVA 1OT4A 1AH1A 5B7FA 3B8SA 5H37H 3Q8FA 5CMAA 3MRFA 5DVNA 4X83A 2YKKA 2XKUA 3BDYL 1FFPB 4PYHA 1Z9OA 3MNZB 2BVPB 4JJ5B 2ARWA 5FKPB 4WFGD 1ZV5A 2MMXA 4F7PA 3A22A 5HVFB 2E6PA 4P8QA 1A2YA 2R0WH 1ICTA 2WB1A 4FL4C 3WI9A 4Z7NB 2KQNA 2Z6FA 1KYDA 3B7TA 2GEEA 1XR8A 1VFBA 1CL7L 1S3KL 3CHSA 1MCNA 3HE6D 4XNUL 1BMWA 4NO0D 1EBAA 4J8QA 3RWHB 4NRXB 2CSPA 4GS7C 5E8PB 4FI7A 2R2EA 3EJPA 4JRYD 2W0LA 3RU8L 4Y2OB 1V3JA 5I5RA 4JRYE 1WICA 4M6OH 3ZDYF 5DDHA 4XH2A 2XTJC 2A77H 3T8VA 3FCSB 5EF0A 3VXQB 4OLXH 5HGAA 4P4RA 3ZL4H 5AAWA 5CR1A 3KYMB 1YECL 1EXGA 3KYOB 2JFCA 3PJNA 1T1ZA 1G0XA 1T0MA 1CFQA 3GBMH 3PHQB 4ZAKA 5IBTL 1YPZA 2NUTB 3G7TA 3SPVA 3AVEA 2ADFL 2E27H 5IJVA 2BZDA 3UTZA 3V6BR 3I2CL 5DVOA 3FMGH 3SOTA 1BAFH 4BQCA 1JGLL 3HC2A 4G82A 4AQ1A 1LWRA 1MRDL 3KR3L 3SBWC 5KVDH 3IFPB 1OGTB 4A39A 1JRHL 1MH5B 5DZAA 1U3JA 2ZOWA 5E00B 2J88H 3LN4A 5T1DL 3T4AB 2BC4A 4Z7NE 5KSVB 4XVJL 2ICEC 1X5XA 2UY6A 3MYZA 1RUPL 4TVPH 4IOIB 2IQAB 1LO2L 3VXMB 3X1BA 1PEWA 1NGYA 5B39B 3CGTA 1Z66A 4Q58C 4UTBH 3LZOA 1G43A 3DECA 3F6LA 4JZJB 3MV8E 1KWKA 2RQEA 5D7LA 4GS7B 1FDLH 3MV9E 3VXPB 1FZMA 1QSEA 3NIFB 1NA8A 1QPKA 3QPXL 4N6RB 3ZYJA 2XX0A 4XCFH 1IEAA 1KJ3H 4EE2A 3NACL 3GSQB 2XTJB 5JZ7C 3QQDA 3J2PA 2JTDA 4QT5A 3K6DA 1U8KB 3DK2A 4XO5A 3FH8A 4WJKB 1I1FB 1M2OA 5C0AD 1P7QD 3H6JA 3NIDE 1DBJL 1E4JA 1L5GA 4P2RB 1MRCH 4GW5B 4N8VG 1GMIA 3GTTA 1IGCL 3O2WL 3MFFA 1NAKL 1MAML 3CVDA 3FUFA 4U6YA 3KGTA 5ACZB 4HIEB 4PRPB 3KW7A 4PUBL 2VLMD 5CUSH 3LRSB 4OLZH 1W0WA 3QRGH 4W93A 4ZBJA 4FX5A 2W9LA 3LN9A 2VQ1A 5AW0B 4YHNB 2J21A 2FAUA 4TOYL 3RX5A 4HFWB 3QULA 2ERJB 2WKOF 4OQTA 4P2QA 4JNXA 3NFSL 1GC1C 2AV1A 4LHQB 3APNA 4LSSL 4NUJB 5AW7B 2ZNXA 4LCCA 1VEPA 2M1KA 4K7PY 2VKWA 2N0MA 1IQDA 1U3HD 2VKXA 1RIVL 1G7QA 1SLVA 3FTXA 3FU8A 3JV5A 4HULB 3BWAB 1I7RB 3A47A 2OM5A 3S3BB 4LBAA 2H4EA 1IGJA 4G6JL 3I3EA 4XTRC 3MRPA 1A4KA 2MQ3A 1ZHNB 4NBZB 4CUCA 5B8CA 5CFAA 5IB4B 2OMVA 1Y0LB 3ISYA 3MV7D 4JPVH 4NI6A 1VESA 3BT0A 2ENPA 5EU5B 1FNEA 4NKIL 3WDHA 3AREC 5F1KC 1BQ5A 3V0FA 1DBMH 3GKWH 1KBWA 1MI5B 2YQGA 5D6DA 1A7PH 1DJHA 2WQ8A 1Z5LB 1M6OA 3BHBB 4ZUVA 1G9NC 5JUEL 4DAGL 3GI8L 4ZSOE 1QFOA 1CC3A 5E6IC 1BLNB 1TZGH 3GSUB 1XBDA 3MBXL 1VEOA 3PV6B 5DGRA 3MRHB 4HIJA 3ZMNA 1JYVA 1GJWA 4AQZA 4DCQB 3FB5A 4Z76B 1MW1A 1KCVL 3GJFA 1U92A 2DBLH 3QDJD 5BPPA 5IW6A 3LHPH 5ICZA 1UVQB 4NLAA 4EPSA 3T0WA 2D3JA 3CFIC 1YEFH 3CXHK 1SLWA 3MN8A 1JWUA 3ZYOA 4AYSA 1T22B 5FWRA 1P69B 3K4AA 3S8FB 1U8PA 3T3MB 4G8FA 4C47A 4TYUA 2XPGB 1DBML 2IH3A 2KHAA 2V17L 1AXSB 1Y6NR 2OTUA 1KIPB 4FQCL 3W0WB 3HBPA 5G4NA 5F7LB 4NN5C 4QTHA 2E59A 5IJKC 3NP4A 3MLSL 3QXAB 4M93B 5C0AE 5A6LA 1OAUH 2DQJH 4JR9L 2DLEA 5EIVA 3UTTA 4HS6A 2CJ3A 3NFPB 1CFNB 1SOQA 3P2BA 1DVXA 4KHXL 1UVQA 3ECWA 3GRWA 4BWWA 2HLFC 1S78C 1VACA 2MSPA 4MNGA 5AVSB 3FB5B 3QJXA 2JKWA 3ARGB 1INDH 2ZG1A 2E86A 5F3BB 5C07A 4OLVL 1LWJA 3D4ZA 4E41B 2WMPA 4N25A 3OHXC 3K6FA 2JI2A 6CGTA 3B1UA 5KVGE 3S3PA 4TRPL 2E0PA 2Z93B 1RK7A 3MC0A 1EHXA 2VLME 4MZ3A 2DQ6A 2BHYA 2E46A 2WUCL 2DIBA 3C60C 3GD1C 4MA8L 3VJ6B 1I3GH 2VJ0A 1YEEL 3RJQB 1KCSH 5IUSA 4RETB 1BVNT 2DWSA 3J8F7 3F65A 4JVUA 1ZLSH 1CUOA 3CH1B 3DGCR 2GPZA 2ARJQ 1VRSA 2FGWH 1S7WB 1TXKA 1JZFA 3WUZA 1VGEL 4M8VA 5I15L 4S0SD 1KLGB 1II4E 1JGIA 2W0FA 1L0XA 4OLZL 3EH1A 4UIKH 1WEJL 4TNGA 5GSVB 1DQLL 5BV7C 3TC9A 1EA9C 4W6XB 2VDNL 4OLYL 3AROA 1A7BA 3AUVA 2FSDA 3NZHL 5T5FL 4DEWA 1CK0L 2FO4B 4QXWA 4YPGA 1SNRA 4IS6A 1O5DT 1DBJH 2BP5M 4UDUB 2YPKA 3NBNA 4FHKA 1B4RA 4XMKL 3SDCB 5C0FA 4CGUB 3ULUE 4HFWA 3DHJA 4RGNC 3HI1A 1FHNA 5HGHA 5ALCH 4GW4B 3KPNA 2DQDH 4XBGA 4YJZL 2WXJA 5KVDE 2FRGP 1W91A 4FNSA 4AENA 4UCFA 4Z7UA 3LRSA 5EG6C 5GS0L 1YAIA 4LNRB 4JBSA 1N67A 4Y1TA 4NM4H 4HIEA 4PRNB 2WBJC 3TA3B 3RAJH 3PNRB 8CGTA 3UTSE 1UXWB 2HRPH 5ADOL 4OQTL 3HN5A 2FX7H 1U3NA 2P80A 3L08A 4L1LA 3QNXA 2FYVA 4IJTA 1NGWB 3DJTA 3LKSA 4LLUB 3K3QA 1TZAA 4WUUD 5BRZE 3EF4A 4NNYB 3E6FA 2CRMA 3NA9L 4JKNA 1LDPL 3JWOC 2OMXB 4HZLA 5AOKA 5C8JB 2VLJE 4FHBD 4ZFFA 3UIZA 1AZNA 5F7NC 5HDWA 2BOCB 3FO2B 5CLYA 3D18B 4OAWB 4FXGB 3QDAA 3DX6A 5FYLL 3PL6D 4HEMA 3MJWA 4J4PA 3VXPA 3UAJC 5TJWK 5ADPH 4NM4L 3WCYA 3OJVC 5BOPA 1WBXA 2NR6D 1YMMB 2J20A 1CICA 4WENB 4ADGA 2ZP8A 3BH8A 5KUKA 2IQAA 5HHVH 3VXMA 2XT1B 1JV5B 4R4FH 3CK0L 2WD0A 5ICXB 3WTSA 1NZRA 1NIFA 5GZNA 2LE9A 3D3VA 2VMFA 2C5DC 4K23H 1NC2A 1X5HA 1QKZH 2NY4D 4FN0A 4LLDA 4NQDA 1FBIH 3N0PB 4JRFA 2BNRE 2H2SC 1ZLWK 1C5BH 2NQ3A 3QIWC 5E03A 2N7SA 1TO5A 3LMJH 5JA9A 5DRXA 5EORH 3NZSA 1RZKC 2WQAA 1ET7A 3Q2LA 3WXVH 2NTFB 1N5AA 1S46A 4LSVL 2D31B 4QD2E 4CAGA 4LPTA 3RPBA 1FV1B 2F5BL 4FXKA 5DFTA 5CBEA 4GUQA 1K8DA 4HOMA 2NNAB 1T1ZB 1TNMA 3BIBX 2I27N 3K4DA 4Y7OC 1CYXA 1D3CA 3BJLA 3ECBB 5HGAB 3VFGL 4NP4L 1ULVA 5IF0A 5C7XH 4GI6A 2VDQB 4CNIA 5A16A 1EZVX 2PUQT 4TUKL 2M8XA 5KOMC 4Y2OA 1ZLUK 3PS6A 4A2HA 2CLVB 5ICYB 1HC1A 4X4ZA 3C8HA 4K3GA 1ZGLB 1GJUA 2ZUQC 3TZVC 1OGSA 3OXRA 1ZE3C 5C0ND 4ZNEE 3MREB 1TG8A 1H6FA 1QPPA 4FDWA 2UZIH 4LL9A 2MTAA 4OB5H 3MJ9H 3EBHA 4LBEA 4H26B 1XAKA 3IETA 2JJSC 2BVPA 4JJ5A 4G7YL 4GSRA 4J3BA 4FF9A 4Q6IB 4OV5A 3ERXA 1XVSA 5L7XL 1FFPA 5F9AC 3N6YA 5DVMA 4GQZA 4ZYKA 1JPSL 4E9LA 3WNJA 4KKQA 2QSVA 3NEOA 2DQFA 2B0SL 3EZJB 5T1MB 4JGUA 1ED3B 2X53A 1I85A 4IGBB 3QZPA 3NJHA 5IKCB 2XC8A 3D9AH 3FO9B 4UQ2B 3GSRA 3L1FA 5EN3A 4DGYL 2EDXA 2Q2EB 4FA6A 5TDPB 3Q9PA 4P3WA 1TZOA 5I17A 3AXHA 3E1F1 5HHPB 1IGTA 5GS0H 3L6FA 1G4RA 5IBLC 2HFGH 1DQKA 1KJ2H 2K3TA 2H3XC 4Q97A 2KLTA 4NZJA 1EHNA 2ZUQB 5TE4H 1PDKB 5DQJA 2QLYA 5D71H 3WUWG 5B3JF 2BFVL 4G5ZL 3NH7H 2AAVA 4G8GB 4AVKA 5A6IA 2VXUH 1RJZB 3L1OL 5D55A 3GBNL 1NDMB 4LKXA 2YA2A 4HISA 1LTXA 3MCG1 2HN7B 3CX2A 3V4VB 4FMKA 4LVOB 2R69L 5T3XL 4M29A 4BFIA 4A2LA 1ZDQA 3KPRD 2R0LL 2BSTA 2GI7A 5ACLA 2IPKB 2EH8H 1VGEH 3V4PL 5HYJA 5I15H 2JI1A 4KQ0A 5F6IC 2ZKWA 3O45A 1DVQA 4QLRA 3IWVA 1E3ZA 1TQBB 2YD5A 2BNRD 4Q74A 1WT5C 3L4CA 3LRKA 1S3RA 1BZ9A 1HQ4B 5A1AA 4P5TA 4D9RD 4E9TA 2F15A 3TZVA 3HE7A 1OE2A 5AVYB 3ECVA 2HTLC 2DBJA 3HMXA 4Y5VB 3IFLL 3DGGA 1A7NL 2PTVA 1EDYA 3FRUB 4G6FD 5I2IA 1BAWA 4QAMB 1CS6A 2XI9A 3C09B 2FWUA 5DEFB 2WNWA 2APXA 4K5NA 4MNQA 2VQ4A 2EDJA 3AG3B 3M17A 3DVNB 1C8PA 3K6SA 4R7DB 1O9VA 3RTQC 3HBGA 1SF5A 2G5BA 4FNRA 3IJYB 2EIJB 1NANI 3F7RA 1EUUA 1UT9A 4QLWA 3BAEH 3BVTA 3MRJB 4XN8A 5GHWL 4B97A 1XD1A 3OKMA 4M56A 2X2YA 1LE5B 2WGXA 5F71A 1DBAL 5K9OB 3CDGB 4HJJL 4J6RL 2H1LM 1CGSH 4CVXB 1KYOJ 5BW7C 1ZA3B 2VABB 1ZA6B 4FCAA 2DOCA 4WCYH 1F3JA 9PCYA 1MPAL 1P84K 4HMCA 2LVEA 2XWDA 2EYRB 5E8NB 3MRBB 1UADC 5I75B 1WJ3A 2B1AL 2IGLA 5AWNH 1ZSDB 3WXWH 1TJMA 1RJYB 4WFHE 2GIMA 5GZNC 1AGBA 1SXNA 4F9LA 4YGVB 1I8KA 3QXUA 3FB7A 3KGRA 1MCQA 5FGSA 2IDSA 3GMOB 5MP6H 4S0HA 2AS5M 3K6IA 4YXKL 2IO5A 5JOPD 3VI3B 1QNZL 3OMIB 3GSNL 3S96B 2BIOA 4UQEA 3W9DB 2FHBA 3G5YA 3TBCA 3VWJD 1W0VA 1V10A 4HJGA 1HYSC 4N90E 3W1ZA 3ZZ1A 3MGTB 2HYMA 2VRQA 3QAZC 4PTTA 1G6RH 2BFVH 5IHLB 4DH2A 1L9PA 2CO6B 3FCTB 2CRZA 1NIDA 2Y36L 3JTSB 3KXFE 5TE6H 1QZ1A 3FPXA 5BUAA 2AXFA 5TDNA 5IHWA 1KB5B 4Y1AA 3MPCA 4GO6B 4ALAL 4NQQA 5CEZE 5AEAA 1BP3B 5LNGA 1TMQA 3SJVB 2K8MA 3I6LE 2K3HA 3P30L 3ALXA 4G1EB 1OWRM 3QR0A 2X6UA 4OLWL 4KFMA 1GGUA 3FAXA 1QYGH 1IAOA 4IRJD 1GY1A 2HSIA 3D7PA 3GZQA 3IDYB 3VFWA 5CD5C 2Q76B 4KO7A 5E8OA 12E8L 1KN2H 3ARWA 1FYTB 1D5BA 1JTOA 4Z7QF 1F3DH 4N4YB 4BZ1H 2A6JB 3QJSB 3S34H 5LNDA 3HOGA 2G4GA 4TSCL 3UPRA 1SLUA 1E28B 3CSYB 2E56A 2W80C 3VRLF 3EH3B 4YMPA 3UO1H 2IOIA 3HB3C 4X7EC 1NGQL 1QSFD 1JNJA 1LO5B 4MXWH 4OZHA 4L1BA 5GJTL 4Q9QH 5H37G 3ABZA 4MQXC 2QDVA 4J7RA 2GUOA 3U46B 4BSWB 1W80A 3K4ZA 3L9BA 1R5WA 5EBLB 3VGBA 1ORQB 2ZUUA 3CVHH 2DD8H 4LCWD 2IDCA 2EO1A 1ACCA 1XF3A 4ZPVB 5F9DC 1R24B 1KZYA 1RZFH 5AW3B 2IAAC 1FORL 4ANWA 2COVD 3VA6A 3EXLA 3LXCA 1J8RA 3BUIA 5J56B 3NESA 2OS7A 3QZMA 3MYJA 2GTWA 4ADIA 5L6YH 2R15A 3X2QB 1M7DB 1MCSA 4RMBA 4K7FA 5JNYA 2WV3A 4LSDA 3QYNA 1ZHBA 5IMOA 5TGBA 3HE7D 2ZUTA 5EEWA 4LSRL 2W9DH 4XCEB 3VRLE 5A2AA 3WFZA 4ATTA 3OL2A 3PP4L 5BMFL 4I88A 3BEVA 4LVNC 3NACH 4ZMPA 4QRQA 5J3HC 2IH8A 3O11A 1QQDA 4U3HA 1KIUB 4F7KA 1R3HB 3HFML 1G6RB 2C1OA 2UUDH 3BGMB 3OAUL 3SE4A 4JGJA 5B38G 3SY0B 1P9MA 1TJGL 1UZ6F 2EDFA 4YHOL 4EQ3A 4A66A 1N3NB 3EADA 3N0AA 1MHHA 5D1ZD 1D5RA 4J3XA 3D09A 3TONA 2AI0H 1A0QH 4DPBX 3SODB 1QLEH 4R90H 5EC1B 4GRMB 1ADQA 5E6SB 1EJOH 1L9RA 3D0LB 3VYOA 1OWWA 2VM4A 4LSPL 4PJIA 2ISDA 4Z3FA 4XRCA 4LLMB 1BQHG 5I73C 4RMSA 5BUPA 1DJWA 1B90A 4ZPTA 4AW7A 5E5UB 2X28A 1URIA 3BPNC 2MIZA 3O4LA 4XB3A 3VFUB 4CA4A 2XY2A 1K5WA 1BVZA 2N59A 1TZHB 3NJNA 3II3A 4QR7A 3RWGB 4NRYB 2ITCA 2J8OA 3II1A 1GHFL 4KRPB 3Q9QA 3T65B 1NDTA 2VDPH 3FFDB 5DLML 2OMWB 1RZJH 1K85A 3ZL4L 2I60H 3U0TA 5HDQH 3HMXL 2HJLB 5IMLA 2C9PA 1J87A 2JCCA 1OTSD 4MNQE 1G5AA 2Y36H 4HZAA 4K07A 4ZW6A 3X12B 4JFSA 4Z77A 1UOVA 3B3IB 3X1EA 3MRLB 3T2OA 1N2RB 3DXAD 4HKJB 3MCLL 2W0KA 5EU6E 1JJUA 1T21A 4ZJ9A 4G72B 4Y1AD 5B1JA 5T5NF 4IKNA 1VADA 1YEKH 3GRGA 4X8XA 6FABH 5DK0A 3QFJA 1TQTA 1ZS8A 1NCJA 1MDAA 3P73B 3BESR 1TR7A 5D1QE 4Z9KB 3WUWA 5E9DE 4DN4L 5F7DA 5EFIB 1NGZA 4QTIH 3SYAA 1HXMB 4RFEA 1F8TH 3M8OH 1NJ9A 2GB2A 1U58B 1QTPA 2KH2B 2ZKMX 3R18A 2ZXEB 1CGTA 4I2XB 2QQLH 3FU9A 3U9UB 3ZY7A 3UJTH 3HG4A 2VLRA 3VMNA 1J1XL 1MLBB 2PW2B 4PJ5D 5ENWB 1DDTA 5BCAA 5J8OA 4WNSA 4H1LH 3GTVA 5JPNB 1NINA 4XE0A 4F15C 1FF5A 4KX7A 4PJCE 2D0HA 3UTQA 5AOLA 1PFCA 2DQIL 3EUUA 2D03L 5GGSY 3OQ3B 3G5XA 4KU1A 4Y9CA 2VMJA 1WS7A 1XMWA 1MFEH 4HUMB 5GJSH 1K8IA 1KYUA 4HIIB 4PU2A 4JY6B 1XIWB 4PD4K 3LY6A 3PWNA 5JHDD 2A6KA 4NNPL 4UYPA 1ASOA 1ZEAL 1U2CA 1UUSA 3ZZLA 4XPFH 3SE8L 2BIHA 4NQCE 3ZQ9A 3I6GB 2Q7AA 3GT6A 2LV4A 1E5UI 1MIML 2LABA 1OAJA 1BGXL 2W8CA 4PV9A 4ALAH 4Y16C 4ADJA 5C2UB 2XWXA 3E1ZA 1EZVY 3DUUA 5DJAB 5JQ6H 4FERA 5K39B 4QRPD 2WVVA 1KEML 3ZRFC 1PAZA 3A6OA 4BZ1A 3HE7C 3FHQA 1T80A 2VZTA 3EJZC 4UTAL 2DEYX 5AW4B 5CN3A 3HG3A 4XMTA 1VFAB 5E6IA 3WN5A 3C6LC 5L88L 1DN0B 1EWHA 4FQJH 4MQTB 2K7PA 2ZOKA 4IBUA 2QQKH 1JYWA 4GP4B 3H85A 4FOMA 3MOQA 2G5UA 4P9MH 3EDJA 2JXMB 4UWQB 2P44B 4JK0D 3NJFA 3L2MA 5FLUA 1I1AD 4QUOA 4M7ZC 4FZEH 5BRZA 2VE6A 1G0YR 4KJQC 4PB9L 3ESMA 3A3YB 4I1RA 2VUKA 1M1XA 4X7CC 1G9ML 2NY2C 1KTLB 2R59A 4Z7VF 1AQHA 3B2MA 1RMFL 3WLWD 4X7FC 5IGXL 5FO7B 4JFDD 1O7SA 3GSXB 3KH3A 4G6KH 3T2NH 4LAQL 5FCUH 1I7TB 2YJQA 2IDFA 2BOBA 3H56A 4K94H 1FYTD 5GRUL 2IJ0C 1KXTB 1S7VB 2ZXBA 4APXA 4QWWD 4DFHA 4PJCB 3VH8B 3X3GH 2YKLH 1REIA 2PO6D 2Z4QA 4A7UA 2CBMA 2GQHA 1DQML 1EK3A 1PZDA 3CFCL 1YCSA 5DR5H 1ZEAH 5JA8B 2MFNA 4DVRL 5D7JC 1F1DA 3M1CA 2VCOA 3T8XB 2CKBA 3SYOA 5JOFA 1NSNL 2C3XA 4EVNA 2DKMA 2HFEA 5HD8D 1UXSB 4XZUA 4PYGA 4EBQH 3K8MA 3OKOB 5F1IB 3S36L 2XN2A 3UPAA 2Z31B 4FNLH 3AABA 4AVJA 4MJ2A 1OAXH 3GXDA 4MXQC 2WHVA 3K81A 4NQEA 2BNRB 5AG8A 2C1PA 5T33H 1L7IH 3PXLA 5EBMB 4YZWA 3S35L 2O6DA 7FABH 2V0AA 2OL3A 2RB8A 1NCBH 3WLWC 2EZ0C 2TSBA 2ZD0A 3V0EA 5L2JA 1F4YL 1YEKL 2BW4A 3LKNA 4FS0A 4G5ZH 3DURB 3EYSH 3ARDB 4E9VA 3V6ZB 1J5CA 4IRZL 1RUML 2J1YA 3R8BB 4LLWB 2CDEB 2EQDA 3M1BB 4IRSA 4BSVA 4EZJA 4IRZH 3LD8B 1JZ4A 3NZUA 3BZFB 1OEZW 3PP3K 4XP4L 5INCA 4DP4X 5J1AB 1DCLA 4OJAA 1ZV9A 2KZBA 2F53E 5J4MA 4UILH 2NNFA 3QJHB 3S5ZA 3BCDA 1A64A 3CH8A 3NIGB 4FRWA 3C87A 1JDCA 2WUBL 5IB5B 2YUVA 5DA0B 4KZEL 4CC0A 5JQHC 5DWUH 1GVIA 5DXWA 2Q8AL 4LP8A 1HL9A 2FBJH 3LH8A 3HNVL 1WWBX 1BFVL 2Y06L 2PPAA 3KPLB 5J0BA 2WLIB 2WTOA 2NXZC 3VD9A 3B2XA 2ZYSA 4ZOCA 4PJ6A 1JNLL 1O9WA 3ZE2B 2XWJB 4RAHA 4JFHD 4DGIH 1UT1A 3APMA 3ILDA 2FJFB 4OB5L 4HJUA 5EO1B 5FAAA 2Y7OA 1SVZA 4DVRH 2MKWA 3WU1A 3SDDA 1RP9A 2Z31D 2HRPL 2Z92B 4XN1A 2FSEA 5ADOH 4ETQB 4ORGA 4XN7A 1QASA 3WEXA 2VQTA 2DH2A 1U4EA 3HE6A 1UC6A 1LK2A 2FEDC 7CGTA 3N42B 1AZVA 3DIDA 2PCFA 1NWPA 3NVQA 5A3IC 3QWRD 3VXRE 3QUZB 3BFWA 1SJHA 1T3FB 4O02H 4ODWA 3UROR 3W82A 4BFNA 2DWYA 5DUPH 1YLBB 1LYQA 5E99L 1J0IA 3TBSB 4WV1A 5E6YA 1ZT4A 2EIMB 2PTTA 1I8IA 2J1WA 1DR9A 5DCCA 4U3SB 2BM3A 4OD3H 3CZNA 4XZ4A 4AL8C 3QO1B 4HOWA 1X5LA 1DCEA 1FORH 1FH2A 5SWQA 3QFDA 4XXDB 5KSBB 1L9QA 3P0GB 4YBQD 3FTGA 1AZBA 1EVUA 1J05B 1VKXA 2GITB 3JV6A 4AGNA 2Q9OA 2V4LA 2ENJA 4HLZH 1U2YA 3PPEA 1NBYA 1TJXA 5AD0A 2D7QA 3DYMA 2G3ZA 3TXAA 3IDUA 1XGPB 3D48R 3WFCL 4DTGH 5C0DA 2ICWJ 32C2A 5KTEL 1A3RL 1G9MC 2AQ3A 1F11A 4TNVK 1YEJH 5LBSA 2NNRA 1MCFA 1RZFL 4UOJA 5F9JA 1JDAA 4X5XA 2GIXA 3MUZ1 4ZFOL 4WTZG 3CZUB 4FFYA 3C6LB 3CFJB 3JXAA 4YIQB 2ADGB 4G42A 4YC2C 1S9KC 1ETA1 4YEEA 2RCSH 4OCYL 2KPNA 2GT9B 4KBPA 3IPBA 1L9MA 3DRTB 3THMH 4S11A 3WY2A 1SMDA 5AKSA 4ELKB 1GZHA 1U6AL 3SO3C 3O8XA 3QUML 3W0WE 4YLQT 2BS9A 5FYLD 1F45A 2LAGB 3FUKA 2FWOB 5ID1B 3S35X 4BZ1L 4Z7OB 5IFJA 4E42B 2CQVA 4NKOA 1JXJA 3OKDA 3WMPA 4PCYA 4GBXD 3IJHA 3BIKB 3MBED 1F58H 1KB9K 3I75A 3HKFA 2VISB 3LEVH 1OPGL 2IG2H 4I48A 4N8CL 4BRVA 5L8LB 3AWFA 5EPMA 3NP3A 2R2BB 1D6VH 2RACA 3OAYH 3U1QA 3X3GL 3TFKC 3D2UD 3TBTB 2P4AB 5EZOH 3LZLA 5I1AA 2DTML 5AAWC 2DQEH 1CXKA 3QUHA 5GGSA 1IGFH 2HH0L 1P6FA 2YD4A 1GZHC 2EEFA 5I6NA 2ZUVA 1HDMA 1IMHC 1KGIA 1CK0H 4FAAB 3R1GH 3L9EA 2JSFA 2ATKA 3WXWL 1KB5L 3VWKD 4UIMA 3T5WA 2OV0A 4HF5H 3JV4B 1EHLH 2I25N 5FGBC 3GO1L 3GMNB 3R19A 2B5IC 6FABL 1ROCA 3QZLA 2ZZUT 3EG9A 2EVHA 3BIKA 4RGNB 2OI9C 1X44A 3V7AE 1S2EA 4A2GA 3K74B 3VXTB 3WHE1 4HS8L 1ERNA 3WFEL 5LQBH 3HN3A 3JWNE 2Q3XA 4ZO9A 1S9VA 4ACPA 2LLNA 4HT1H 4BRJA 3L81A 2PWFA 1AR1C 1BCIA 1WZMA 4L1SA 3FXIC 3KGSA 5HJBA 3FRPB 1BZDA 1AQDA 3N04A 4OLUH 5DQDH 1OE3A 1BQHA 2TRHA 4KUZL 4AYGA 3DPDA 3NGBC 1NOLA 5DUBB 5SWSD 4HEPG 3V5DA 5T1JA 1JGDA 1U8MA 2HX9A 3F2LA 5B8CC 4H0IA 1QLFB 3TO4A 2PPFA 5I0YA 3TBYB 1ESOA 2QKSA 1WGVA 3QIBB 4MNHB 4OM1L 3RI5K 4LP4A 1XGPA 4QJ3B 5C0GB 2OK0L 1MZZA 4W4NA 2CLZB 3HW7A 3RVXC 3MODL 3IXTB 3U83A 4BJLA 5FFOA 5T5NG 1J5HA 4ZOBA 3O6MH 2OZ4H 3I02A 5IROD 4MLIA 3F7VA 3W11C 5I1IL 5DZNA 4JMXA 3MUHL 3T0EE 1XHHA 3VB9A 5I30L 1NC4D 5I0ZA 3VGEA 1Q8MA 1UFUA 3TCTA 2DWDA 3UDWC 1JZ6A 1WAAF 3KJ6L 4M8RA 4D0CA 5A2LH 4BCYA 2K1MA 3ZMEA 2OJ1A 4O2FA 3MLTB 3KPQB 5MI0C 3LPFA 1KJ2L 4I3GA 1UWYA 2EEXA 3I02B 4GRLD 5KYWB 1KBBA 3MKKA 3MBEB 4WWKA 1BOYA 2XV0A 3D4CA 1JVKA 4ABQA 4C59B 1ODAA 1DZ0A 3DPBA 3HPJA 4JHZA 4NKDA 3RFRA 2ZWLT 1FNSH 4ECNA 3BI9X 2BY1A 3LZRA 4KROC 4JRYB 2K6YA 3JT0A 4DW2L 2XOTA 1KMGA 1QLFA 3B4NA 5AKRA 1D5IL 2HFGL 5F0JB 1R0AH 1IKFL 2B4CL 4F8PA 2WBXA 4I4WB 1D5XB 1BQHB 3NRFA 4NENA 2FYYB 1GW6A 3A23A 5J11B 4MJIE 1WFNA 4AQEA 5AFAA 1SY6A 3VXSB 5SWSA 5GPRA 3WFDH 1G7LB 5JZ7D 1OAYL 2Y7MA 3FOMA 1OPOA 5DJZB 4AKPA 2A74B 1H5BB 3NJJA 4FQHB 4JG1L 4Z95L 1RIVH 3T09A 3KR3H 4Q2ZB 4Q52A 5FW7A 5PCYA 5BS0D 5IB5A 1UB6B 3RTQD 4HOXA 3FQWB 2M2DA 2BP8A 4J39A 1PIGA 4JVPA 1HESA 3OX8B 5EUOF 4Y19E 4ZS7H 4BZ2L 4XO3A 2ITFA 4MBOA 1XGTA 4KVCH 4ENEC 3H55A 5A7BA 4W9DC 5DURD 2YMTA 1T7VA 5J1AA 5INCB 1TITA 4G1MB 3DO7A 2QKIA 3KH4A