1NIEA

The structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
333
structure length
333
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRITE REDUCTASE
publication title The structure of copper-nitrite reductase from Achromobacter cycloclastes at five pH values, with NO2- bound and with type II copper depleted.
pubmed doi rcsb
molecule tags Oxidoreductase (nitric oxide(a))
total genus 86
structure length 333
sequence length 333
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nieA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nieA02
2IAAC 3NJHA 4JHVA 4YSCA 3FU7A 2BWIA 1AACA 2YARA 2MRYA 1NTDA 1AZUA 5F7AA 1CUOA 3AG3B 3SBPA 3H56A 3S3CB 3X1NA 3DKHA 3DTUB 4KO6A 3UAEA 4NERA 2WO2B 3X1FA 4E9WA 4BDVA 2I85A 1GS6X 3NP4A 3T9WA 2DY2A 4A2GA 2IDQA 4YSSA 3FSVA 4A2EA 1PLAA 2EIJB 2FQGA 2X88A 2YAQA 2YXWA 4QLWA 2YAHA 3PCYA 1ZV2A 4AKQA 1RZQA 4HHGA 1MDAA 3CVCA 1NDTA 4YL4A 1L9OA 2IDTA 1OE1A 4KNTA 1T5KA 4HAKA 4ZK8A 3V9EA 3WNJA 1ZPUA 2HRHA 1AZNA 2CJ3A 3RYMA 4RH4A 2YXVA 3TASA 1URIA 1FFTB 1ID2A 4YSUA 5AZUA 2XUWA 1ILUA 2EIMB 1MG3C 2VSKB 1W8EA 5B1JA 1OE2A 1XMEB 4A68A 6PCYA 3C75A 3FYEB 3MX0B 4MFHA 4A2HA 4CSZA 5E9NA 4GYBA 3UACA 1GSKA 1BYPA 2BW5A 3CVBA 5PCYA 1F56A 1CURA 4HCGA 4YSPA 1L9RA 1SJMA 4E9SA 2J57A 2GHZA 4E9QA 2IWEA 4M3HA 1MG2C 2WO3B 1XB6A 2OCCB 1RKRA 3CZUB 4CSPA 2PPDA 2EILB 5I6OA 1A8ZA 2VMJA 4GP8B 1JZIA 2PPCA 2BZCA 2XVBA 1KV7A 3UABA 2CALA 2UXFA 1ZDQA 1NIFA 4W9ZA 1AG0A 3WKPA 1PMYA 2Q9OA 1NIBA 1DYZA 1X9RA 1YLBB 3AG2B 2BWDA 3CDZA 3D12B 3FPYA 5B3SB 4UAHA 1QHQA 1SFHA 5B1BB 3EH4B 4TXVB 1ZDSA 1FA4A 3KW8A 1JOIA 4G72B 1NICA 2PPEA 5TK4A 7PAZA 2PPFA 1GY2A 2XXGA 1ET5A 4JHUA 4GP5B 1MZYA 3QJRB 2FQDA 4G70B 4PAZA 5FC9A 2X87A 1KDJA 4DP0X 1GW0A 3G5WA 5I5IA 2R7EB 1TU2A 1NWPA 3PLYA 2DWSA 5D4IA 2DYRB 2FT7A 3JT2A 4HZ1A 5B7MA 2FWLB 4KNSA 3CVDA 2XLLA 2QDVA 3WKQA 5LDUA 4BWTA 1BQKA 4KOBA 1JZGA 1R1CA 3ZIYA 5I5JA 3AY2A 2QT6A 1KCWA 1AS8A 2QDWA 3T71A 1WAEA 1WA2X 4HHWA 1L9TA 1NWOA 3PAVA 1SF5A 4KNUA 3H4HA 1M9WA 3IE9A 1AG6A 1AANA 3L45A 3PAZA 4P5SA 4DP2X 2LLNA 4E9XA 4F2FA 3ASOB 3EH5B 1GS8A 4X4KA 3NT0A 3SBQA 2E86A 4AKOA 3SBRA 2ZWNA 1ETJA 5EHFA 3TA4D 3IBOA 1L9QA 4E9VA 1J9TA 1W6WA 1NIAA 2J56A 3V9CA 4E9TA 1A3ZA 2P80A 1ILSA 4NB7A 5A7EA 5D4HA 3T6VA 3WIAA 3QJVB 4A66A 3NJIA 3AG4B 1V55B 4DP8X 2FNWA 1NZRA 1KGYE 4DP4X 3FSZA 2DWTA 3HB3B 4Q89A 4K9JA 3DIVA 5B7EA 3IEAA 4AI7A 2H3XC 1IBYA 1SDDB 1NPJA 2A3TA 3NSFA 2IDFA 1PZBA 5I6PA 2EIKB 2N0MA 1ASPA 2CCWA 1M56B 3QJUB 2BO0A 8PAZA 2HZHA 4YSOA 3AW5A 1HAUA 2VW4A 1CC3A 4GXFA 2YAMA 1PNDA 2R7EA 1BQ5A 3EH3B 2VM3A 2WSDA 4DPAX 2JXMA 2MTAA 2XYBA 2GC4C 3QPKA 1KBWA 3NJJA 2ZXWB 4E9RA 2FTAA 1E5YA 3OMNB 4DP9X 2HX7A 5PAZA 2EINB 4KO5A 3ZDWA 1QLEB 1W6LA 3EF4A 2PP7A 1PZAA 2HX8A 1E5ZA 2XU9A 5B1JC 4DP5X 4UF7C 3NJLA 2BP8B 3NJMA 3NJGA 3QJTB 4KO7A 4FAAB 4DPBX 4Q8BA 3KW7A 1IBZA 2FT8A 1AZBA 3ABGA 4YSEA 4G7RB 3TBBA 4WKXA 5B1KA 1V10A 1GY1A 3UGEA 1OF0A 4BXVA 3NSYA 5I6NA 3ABMB 3GDCA 4A67A 2AZUA 1SF3A 3WNIA 2VN3A 1IKOP 1RZPA 2DV6A 1BYOA 2GIMA 1SFDA 1N68A 3WI9A 4YSAA 1N70A 3FPXA 5AFAA 2IDSA 3H4FA 4HALA 1BQRA 3FSWA 3TU6A 2JFCA 4YVUA 4G71B 2BZ7A 2UX7A 2Y1AA 3FQ1A 3X2QB 4AX3A 2GSMB 1J5DA 3UADA 2W8CA 1SHWA 1WA0X 4NAJA 1JZFA 1ZIAA 2IH8A 1I53A 1SDDA 3EHBB 1TKWA 3T6ZA 1TEGA 5I6KA 1JXFA 2IH9A 1L9SA 1SHXA 3PAUA 5I26A 3FQ2A 1SNRA 1OCOB 1NINA 4YSTA 2XX0A 2PLTA 3OQRA 5AKRA 3ZBMA 1NPNA 3OMAB 4DPCX 2PPAA 4JKNA 1JZJA 5I6MA 1NIDA 3NJNA 4A2FA 1A4CA 4N4YB 2FT6A 2BW4A 1E67A 1J9SA 2PCFA 2PCYA 2ZOOA 3NSCA 5B1AB 1JERA 1XB8A 3PXLA 1CYXA 1JXGA 3T6XA 1EZLA 2P80D 1MZZA 2QPDB 3UAAA 2BP8A 2UXGA 4N8UA 3FYIB 3ABKB 1AOZA 3QQXA 4AKPA 2YAOA 2BP0B 1BXVA 1WA1X 1A65A 1DZ0A 2RACA 5ANHA 4DP1X 2FQEA 4HCFA 1HFUA 1PY0A 3BQVA 1WS7A 2VW6A 1J9QA 2HRGA 1BXUA 1NIEA 3X1BA 1PCSA 3NP3A 2YAEA 3MBWB 5TK2A 3S8GB 3WG7B 5I28A 3S8FB 2UXVA 3ABLB 3FU8A 1L9PA 5D4JA 4P5RA 7PCYA 2QPEB 1AZCA 1TEFA 1KBVA 2PP8A 2YAPA 3ASNB 1KDIA 5I6LA 1JXDA 2HXAA 4GP4B 3HEIB 1PLBA 2PP9A 3CDZB 1FWXA 4G7SB 1AIZA 2NRDA 3NJFA 4W1TA 3T6WA 2CAKA 3QJSB 3ZX1A 1M57B 1J9RA 3OM3B 2XV3A 4FA7B 6PAZA 1HAWA 2AZAA 2TSAA 3QJQB 3NYKA 4F2EA 2B08A 1ASQA 2XV2A 4F7KA 2ZONA 2VSMB 5B7FA 9PCYA 1OCZB 1ZIBA 5F7BA 3OD3A 1E65A 2J5WA 1PZCA 3S3BB 2IWKA 3SQRA 1AS7A 1B3IA 3ERXA 5I5MA 2Y69B 3GYRA 3X1EA 4ENZA 4YSRA 1OCRB 2Q5BA 4YSDA 4L0PB 4YVNA 2XWZA 1ASOA 2H47C 1JVLA 2YAFA 2BHFA 1AAJA 2XXFA 4KO9A 2DYSB 3PPSA 1BAWA 1BEXA 2CBPA 4BWUA 4UANA 2J55A 1GS7A 3NSDA 1GYCA 1QNIA 1ET8A 3FT0A 4YSQA 1IC0A 2BP0A 1GR7A 2HX9A 3AZUA 2TSBA 2AANA 5IY5B 3FU7B 2UX6A 1E30A 4WTQA 1ADWA 3IN0A 4DP7X 1AZRA 1RCYA 3X1GA 3GXUB 2FJSA 1PNCA 2I7OA 2GB2A 3N2JA 1A4BA 1JZEA 2GBAA 2OJ1A 1A4AA 4PCYA 4BK5C 1IUZA 1XB3A 2JKWA 4G7QB 1KYAA 3N55A 2OV0A 3FSAA 2GC7C 4BDVB 4EF3A 4QKTA 2XV0A 1AR1B 2GI0A 1ET7A 1UATA 1OOWA 2XX1A 3AG1B 1WS8A 4E9YA 1OE3A 2H5UA 1PLCA 2VM4A 2CUAA 1KCBA 3NJKA 2UXTA 2VW7A 1AQ8A 3IN2A 4A2DA 1PAZA 2AVFA 1PF3A 1VLXA 2FQFA 4GY4A 4BWWA 3U25A 1V54B 3OMIB 4BXSV 4AZUA 1AS6A 2IDUA 1BXAA 1JZHA 3FU9A 3FQYA 1X9UA 1J5CA 1JVOA 3FS9A 2YQBA 3CG8A 1CYWA 1OCCB 2HLEB 3JTBA 2B3IA 3S3DB 4DP6X 4HIPA 2W88A 4KOCA 2IWFA 1OV8A 2AFNA 3BVDB 2I7SA 3TBCA 1EHKB 4M4RB 4HCIA
chains in the Genus database with same CATH superfamily
5GS1A 4TNVF 5CJOL 4AVHA 3KDMB 5AYTA 2OMWA 1UTDA 3WE6B 3MPCA 4LFHG 5A16B 5T1LD 4ILDA 5DRXA 3AREC 3BPLB 1YYLL 1OGAA 1YEJH 3AABA 3A0OA 3OXRA 3X1NA 4ZZKA 4LOUC 2RHEA 3E0GA 4Z7QB 4EKXA 2I9TB 2WO2B 3P3YA 3ULVD 1Y6MR 2I85A 4BK4A 5H4YA 5GS0L 4JKKA 4WAFA 3IJYB 2QGDA 1Z32X 4HIHB 2APSA 2ZAIA 2ZXCA 1ZS2A 3VGDA 1S7TA 4O5LH 1F3JB 1KEMH 3D39A 4UT6A 2A6JA 1A7PH 1MEXL 3P4MA 4I48A 4EN2A 3U36B 3MA7B 3QHFH 4XP5L 1ZV2A 1ML0A 4I0PD 2Z7WA 4HIJA 4JQXA 3VFGL 1IM9D 3HC0B 3SN6N 5C6TL 1MDAA 4BZ1A 2VISA 4Q56A 5SWZB 3KGUA 3WFEL 4AMKL 1A66A 1T1ZB 3C6LB 4I9XA 1P7BA 1MHHB 3SDYH 4GH7B 1FL3A 2Q2LA 4L4VD 4JX0A 2CRIA 3HNVL 4RH4A 4PWFA 2NY2C 4TLKA 1GRWA 4LCIL 5JIDA 4P2QB 2EH7L 4AWJC 2DQFA 1ILUA 3LS4H 4I9WE 1L9MA 1L7IL 2VXUL 3FT3B 4JQXC 4OFIA 5ETUA 3TIDB 1GA2A 4WI3A 4Y2DD 2VDRL 1CE1H 3H7BB 2DQDL 2OTPA 4MFHA 2IG2H 2XPGA 2ZOLA 5I1IL 2W38A 2B2XH 4Z7QE 2B1HH 5M95B 4RIRA 2EZ0D 3LQAL 4QWWD 1Y07A 4S1RL 3UC0L 5ABZA 3CDGA 3LX9A 4RRPM 2YQ3A 2ZX7A 3MI6A 1QSZA 4OD1H 1SGKA 1Z5YD 2WCGA 3BDBA 1XSOA 3FU6A 4TNFA 1B2WL 1XB6A 1XGRA 4NCDA 2ZUQC 4XBPB 4JQIL 5BPPA 4QEGA 5FHBH 4IBYA 4C56A 5LXGH 1XAKA 3IU4H 1KV7A 3H3PH 4PGEB 5SWZE 3UIZA 2ODHA 3A24A 4XGZB 1THAA 3CVHL 5BMFL 1I31A 4TKWA 3FDWA 3D3VA 2AJSL 3L3DB 4ZX3A 3BH9B 3TZVC 1ZXQA 3CSGA 2E9IA 5HYJD 1YLBB 3AG2B 3LEYL 4F91B 3UO1L 3EYUL 1FPTL 4MNGB 3DXAA 4P2QE 1ZLSL 3G5YA 4OD3H 4RRPA 4P8QA 1DQKA 1ZDSA 1A6TA 2EUZA 3TCTA 1BMGA 4ENED 4YIQA 2K7PA 5B38A 7PAZA 3HN8A 2AQ1A 4YDLC 3POHA 2FQDA 4QHNB 3ZW3A 1YEIH 4F15B 1AGDA 3MRDA 1FH5H 4Y1TA 4A7TA 5IJBC 3FO2B 4EAEA 4IRJD 4NDMB 2V2XA 5DYOB 4W4NA 1GW0A 1T1WB 5IZ7A 2IO5A 2NYKA 3QQ4A 2DYRB 3NIGF 1UVQA 1A6AA 4NN7B 4PRBB 5AWNH 3V4VB 3Q3GB 4LGRB 5TFSL 5JW4M 2O5YL 2X4SA 1Q9WA 4KKAD 4Y9CA 4PRIA 3TVMC 2CGRL 1FE8L 3AMLA 1M3JA 3EO9L 2QT6A 5LAPA 5JORB 1KCWA 4GXVH 2AW2A 2ZP0T 4LLWA 4QJ5B 4J8QA 4UB0L 1TZAA 3BKMH 3KYMA 4BZ2L 5LB1A 4HJUA 3I9AA 1DEEA 4MNGE 4NEHB 4F2FA 1JZ8A 3EH5B 4E41D 3Q05A 1F8TL 5E8EB 5D1QB 3T0EB 3GSWA 5AAMA 1UT1A 5D7JA 2X40A 4HU2A 3VU2A 5I8OH 4ZW7A 4J3OF 1S7RA 2FLBT 1A21A 1TSRA 3TH4T 3F7VA 4DH2A 4K7FB 4RGNB 1NIAA 4YDKL 3SCMD 3M7FB 5HHNB 5B39G 3V9CA 3VO0A 1KIUB 3O3EB 2GCYB 5C3IA 4OM0L 3CUPB 2WD0A 3T6VA 3DX9B 1OIOA 3MRJA 1QNZL 4AQZA 2W9DH 2APVA 5DXWA 2VL4A 3NCEB 2VSCA 2R69A 3SOBH 3BDXA 4J4PD 1RMFL 3ZKNC 3UBXG 3W9EB 2A3TA 1ZE3C 4OSUL 1A9BB 4MQ7A 3RIFK 4X4XB 4UUJA 3GK8L 3J7HA 5F3BB 3M86A 5ESQB 3RVTD 2WB7A 3AGVA 4NZRL 4YGVA 3W2DH 3VD0A 2WM0A 1PZSA 5I1DB 3L3IA 3HW7A 2HH0L 5IEKB 1SZNA 3PPEA 1LE5A 3FQXB 1CC3A 3V6ZB 1BX2B 3GJFK 3NOIA 1L7TH 3VGGA 3LAFA 2YKLH 2P47B 1X5IA 4K5NA 5C09D 5D1QE 2H26B 3OAYH 4P5MA 3T0EE 5GGSB 3EGDA 5CWSB 2EIEA 2XYBA 1VHPA 5EZJA 3VWKC 2ZXWB 4HPYH 3EH1A 4N26A 4RGNE 2Q8AH 5J13C 2VDPB 2VC2H 3PJSB 1W6LA 1M7DB 3MGAA 2HTKD 5EB9A 1BREA 3W9DB 5KBLA 5D7EA 3N85H 4DP5X 3OXSA 1EX0A 2AK4D 3JV4B 3M6DA 3QJTB 4JG0H 4HEPA 1IBZA 2WLHA 4G8FB 3P9WB 4LRIA 4XMTA 2GITA 3BUQA 3FF8A 3GRWA 1XCWA 2PXYA 3MR9B 2OS7A 1ZT7A 1B0RA 2CMRL 1GZHC 1LQBC 4QDGA 1HYSC 2AZUA 3FH5A 3MREB 1F97A 1RZPA 5CCKH 4ZS6D 3DX4A 2J1KA 4Y2LA 4ZS7H 4HKJA 5DK2A 4BSJA 2CLVA 5EBWB 4DKFL 5FKAA 1BSIA 1MKFA 1Q9OB 1WZ1H 3FSWA 2J88L 4RZCA 5IEHA 5CN2A 4Q2ZB 3FQ1A 5F0PB 3CIQA 1VKXB 4QF1B 5L0QC 1G6VK 1HXKA 4Q9BA 1XH2A 2ZCLL 2E7CA 2H1LM 3ARDA 3ZL1A 5FGCB 4LCYB 5I1EH 1TKWA 1Q0XH 3U83A 2PR4H 1CDIA 3J8F7 2C9RA 3L9EA 4Z7NB 1EV2E 2CDGA 4XNMA 2QEJA 1TZHB 1AQKL 1SNRA 4OR1A 3HZVB 4OLEA 1YO4A 3WUZA 2VSDA 2B59B 1H6UA 1HCZA 1HL5A 3WY2A 1HS6A 3OMAB 1BOYA 1D6EB 2VDNL 1G7MA 1L5GA 1NMAL 3S34L 2BNRA 2MQ0A 4KX7A 2PCFA 3BQUB 4WUKL 1QSFA 2GJ6D 3ZIMA 4Y7MA 2PCYA 1CQKA 1CLZL 3WMPA 4S1SL 2OP4L 5TPWL 2Z4QB 4F7PA 2MCAA 5EF2A 2XWTB 5HGAA 4N2MA 2QPDB 1MZZA 1DUZB 3GIZL 4OU3A 5F7KC 3FO1A 4LFHD 4M6MH 3FYIB 4TSCL 3KBEA 3VG0L 2OR8A 2PTTB 3QG6B 4P99A 5E99H 5ICYB 2FNBA 1N6UA 4GS7B 3T77A 5FGCE 5E8PA 3QJFB 4L29B 3ZTJH 2CHDA 5D70L 5I8EB 2ZKWA 4G9FA 3VCLA 4Z7NE 2CQVA 1ROWA 2VTFA 2XG4B 3RI5K 2IFGA 4G42A 2QVTA 2BVQB 4CBPA 3MVSA 2OXGB 5ERWB 4F58H 4Z7IA 4FI7A 1KWGA 3CFBB 4PJIB 4DGYL 1BVNT 3HLAA 5D2LA 2A4EA 3I75B 1AGBA 1AZCA 3WTSA 2HJFB 1LP9B 5KSVB 1IILE 2J2ZB 2MKLC 5EN3A 2CLRA 2UYLA 2W9EH 5DR5L 3QS3A 4DGVL 3RIAK 3M8OH 3RPBA 5AOZA 2AEQL 2Q6WB 1I7RB 3OLDA 1JYNA 1EJ8A 1OSZA 4IOIB 4X6FB 5IT2L 1P4IL 3OLIA 2IFFL 4LP4A 4QHMB 4OCRH 4NNPL 2UY7B 2W95A 4KJPD 1P7KA 5AVSB 3VFMB 1CBVH 4HZLB 3MRFB 3AITA 5ECGA 3BRFA 2CUIA 3NQKA 1FV1B 4NQXA 1PZCA 2VRQA 2YPVL 2X42A 3K4DA 4IGBC 4KVPA 3ULAB 3UTTE 3W39A 5I5MA 3EADA 3B3IA 4XX1G 2ADIB 4XVUD 4B3EA 5K5YA 4UIKL 4YNYB 1AJ7L 4UZGA 3S35H 4PJIE 4TN9A 4CVUA 1BQLH 4XCCH 2YEZB 4JJ5A 2NY5C 5HPMA 2VN7A 1MFAL 3ZOAA 1LP9E 4ZZFA 1GS7A 3I02A 1BFOA 3UTPE 3VD9A 1OO2A 4R0LB 2H8PA 5DMIH 4U0QB 5I8KH 3PWLB 4OLYH 4R2GD 5D72L 4UOQA 5AVZB 4YAQB 1J1OH 1CXEA 3HS9A 5E1QA 4K15A 1LO2H 1FAIH 3KNBB 4QRFA 5HPOA 2JV6A 5IR1A 4NO5B 5GIRB 1XL4A 1BJMA 4D7PA 4F1SA 4YFLI 1HXYA 5E03A 2FZ3A 1RZIA 4RRPG 4GMSL 5JLZA 4TNEA 3OKNA 1MW2A 4AYID 3NSXA 4JRLA 5FM5O 1OQXA 2YOAA 1JJUA 2J8UB 3CFKB 4WNSA 5B38G 4QKXB 3LPOA 1IGTB 3QQ3B 1U92A 2EDQA 3F7YA 4TVPD 3D0LA 1OOWA 3D2UB 4NUGH 4DW2H 1S9WA 4MXWL 3WFCL 3WLBB 4HJEA 2AXWA 3NJKA 3H55A 2P8LA 3PGFH 3NPZB 4OCWL 1Z1WA 4B5ZA 1DFBL 5JHLH 4ZOBA 2AVFA 3CDYA 4XAKE 2HYMA 4UMSA 1SMAA 3UG3A 2C9PA 4AEHH 3P0VH 2RH0A 1E4XL 1RIUL 4HKBA 1AQHA 3MODL 5IQ9B 3FN0H 1WZKA 4U1IB 4KKCD 4PVBA 1U30A 4PRPD 4GG6B 3K8KA 2ZCHH 1TMCB 3DJSA 4ALAL 4TM9A 3RDTA 2M2DA 3ETSA 3DVGB 3CZSA 3MQIA 3ATDA 2YLHA 1FP5A 5KS9E 3D4ZA 4XNBA 4PJ9D 2IADB 5LJYH 2Y5TA 1X4YA 3HG1A 4R97B 1HTYA 3VQMA 5HVFB 1XH0A 4P46D 2Z7YA 5J3HD 1RD6A 1X9QA 4UINH 2J8UE 3IJSA 5DHYA 5HHQA 3V4LA 2HVKB 3VU1A 4MAYC 4KRPD 1K8DA 3N5AA 2ZKHH 5LGJA 3RA7H 4M4RB 3CSPA 4F8NA 1YEFH 1P5UB 3D25B 3BPOC 4L5FE 1QEXA 4N0FB 2L0DA 1O7VA 3LZFH 2YARA 1SJXA 2JTYA 4Q14A 5F7AA 5KN5A 4IM8A 1LILA 4OUUA 2L4OA 4Y5XB 3SBPA 4ZFFA 3ESUF 1BIIA 4AITA 4H1LH 4YBLB 4JLRB 1IGJA 1KTDB 4X5WA 1F18A 4ORGA 3UBGA 4HJGA 2FX9L 4GG6E 5F7EL 3DX8A 3CAFA 2EACA 5ADOL 1OM9A 4QUOA 3RNQA 5KVFE 3FO9A 4HSAC 1A7QH 1RZKC 1T21A 4WO4D 5ELIA 4BHUA 3X11A 2X88A 1XSKA 5DMJB 1U8KA 1VZHA 5EEWA 4ZMNA 1F41A 2BJML 2PTVA 4QRQA 3AC0A 2HMID 2OR9L 1TQCB 3B3BA 4BH7A 1S78C 1S8DA 4Q6IC 1KCSL 3EH2A 2V5SA 1OHZA 5H8DA 3VXRD 5CF3A 1OE1A 1G9NH 4GLRH 4N0YL 4N20A 4XP9H 3VGBA 3WEAA 1ZPUA 5JZ7C 3LPGA 5LCVH 4AEIL 3TO4C 1ID2A 3S8WA 4NZ8A 5GHWH 1FI8C 1G9HA 4BFFA 1WBYB 1Z0NA 2P46B 2G75A 3Q43A 4DUXA 2GYSA 3I6KB 5FF6B 1YMMB 2PO6C 3QW9A 4AMXA 3Q6GL 4LVEA 4HEPG 4P4RA 2GSGB 2VLMD 1UXLA 3BAKA 4PR5B 3WN6A 2B16A 1I3GL 3BAYA 5F8QC 1SOSA 2P24B 4WF7A 4C59B 4KZEL 2EKJA 4HCGA 3GHBL 2EDTA 4OQTA 3LRMA 1XGTB 3ARGA 3ILEA 1NLBL 3NH7L 4HUVB 5E6IA 2VR8A 3ESPA 3FRUA 4AZ8A 1TDQA 4NQCD 2ZKMX 2M1KA 3IE4A 4M1CC 2QKIA 1YC8A 1KYFA 1JWSA 1KCVH 1VSCA 4WHYH 5E8DH 1UXMA 1A8ZA 3S35X 1KXHA 3ARGC 2Y36L 3GUTA 4EDXA 3K81A 1RZFL 1BGXH 3QNZB 5LXVA 5IJKA 1HH9B 4NOFA 3GMOB 4NN6B 3U7WH 2H45A 1T0OA 3V6OC 2DPKA 4IJ3B 3MLUL 4RQQB 3F12B 4YPGB 3KCWA 5BJTB 2ZG1A 3CZKA 2G30A 3CBKB 3VM5A 2ADGB 1CXLA 1RLWA 25C8H 1XD1A 2V2TA 5I8CB 1C12A 3WD5H 1YMME 5GGQH 4ZX4A 4FQXB 1HIML 5IJKC 3QDJD 4ZFOA 3D9AL 2J6EL 4FQLH 4AIZB 3MCKB 4ZDHA 1V8HA 2CR0A 2QQKL 3N44B 2ZIDA 2XVGA 1S3RA 2E7BA 3MDJA 1MFEH 4QHKI 3WYRA 2CO2A 2N7SA 1QATA 2XC8A 2O5NA 3L5IA 1XSJA 3QH3A 1HINL 2CNYA 1W0WA 4MJ5B 4M7LT 5EDSA 5TQ2H 2D7QA 3BCFA 4WHTA 4XN7A 1FDLH 4O02B 4K9EL 2HFTA 1INQB 3KL3A 4KU1A 4MNQD 3GSRB 4KC3B 3ELQA 2P48B 3S6CA 5LDSA 5KYXB 3K80A 2R29H 1JZGA 3ZO9A 4NAMA 3U9PH 3CFCH 2F54E 3KLKA 4G80A 1WAEA 3LB6C 3UH8A 1L9TA 1WD9A 3HBPA 2XWJB 4OZGF 5BQ7B 2VN4A 3LXAA 4RAUB 3GTNA 3OHXB 4FNQA 5C0CA 1N3NB 3H0TB 3LCYA 5ITFA 3T0BA 4MMXA 4UTBA 1JWUA 2J5LC 1OGAD 2ZNXA 5FGBA 3BN9C 3FFOA 5HI3C 3OLEA 3VRLF 1QAWA 5BO1H 4PJ7A 3WTXA 4U1NB 3NGBB 1EGJH 3NT0A 2AQRA 5BS0A 4J7RA 3LQAC 3TO2B 3UTOA 3MLYH 5C2BL 1KCKA 4JDZB 1LTXA 1U6AH 2NY2D 4FG0A 4FXKA 5FGBC 5C07A 5DSCB 1TJGL 4E9TA 2AQTA 5BV7B 5AB0A 4ZPTA 3TYGH 2IQ9H 1FFOA 4Q97A 3BH8A 5LAXB 2FO4B 1JD7A 5GGSY 1WICA 3V6FA 3WIAA 4FFYL 4J3VA 1FC1A 3P3UA 5LBVA 3VYPA 4DP8X 5I5RA 1OAQH 3QEQB 1P1VA 2JKNA 1KGYE 4KUZL 4JO2L 2G2PA 3AUVA 3EBAA 1XXFC 3OC8A 4X98B 4OIAA 1OP3K 1EHNA 5FUCC 4LDLB 1NFDB 3FT4A 4TPRH 3SPGA 3TNNA 2FGWH 4YZFE 8PAZA 9CGTA 5I76A 5T1MA 3P4OA 4M5ZL 3P3SA 2A2QT 2ZUUA 1F6LL 4YHNB 5FO7B 4DAGL 5EA0L 2YAMA 4U6YA 4NM4L 4UNUA 4X9YA 4YHLH 5I9QB 4FG6C 4FXGA 4OH2A 4UV4H 1NSNL 3BUYA 4FJYA 6CGTA 3MGOA 3NTCH 2MTAA 2BINA 1IBHA 4WTXA 3AU1A 3TZVD 4XAWH 2HJLB 1MCLA 4PRAA 3TBVB 4NYLA 1PZAA 4C56D 1KGIA 2HX8A 3KS0J 1R5IA 4K7PY 1QR4A 4FFTA 3SY0A 3JV0A 3NJLA 5EWIL 1NBZB 1PW3A 1C5CL 2HT3C 2X09A 4JPSA 4HPHA 1UD5A 2WJ5A 3LXUX 4XBGA 3QEQE 4OZ4B 4ZUSA 1NCNA 1H5BB 3RTQB 2H0PA 3IDIA 2BIOA 4KTDH 1DSFH 2EDFA 1DVFA 1TZOA 3DXAD 3SO3C 1YYML 4Z8FL 2H0EA 3NFSH 1NFDE 5F8RC 5DC0A 3OKOA 4L23A 1XX9C 2ROXA 1O7DC 3EFDH 1MWAB 4LSSL 2GIMA 4NZUH 1JV2A 3HAEA 4POYA 3IYLW 3WI9A 3TVMD 2QGCA 1NC4D 1O9ZA 1ZTXE 2UZIL 3KPPB 3LQMA 4JS7A 4MD5A 4L9LC 1THCA 2Y1AA 1HOCB 3TGXA 3NPSB 5SV3A 2ZX9A 4PWHA 3GMPB 2VXVL 1SHWA 2YA0A 3BYYA 4HKZB 2BMKA 3GMNA 2QJDA 2YXMA 3KWUA 1KXVC 5DLML 3ES6A 1SY6H 1QFOA 1INEL 1V7NL 4KK6C 4FNSA 2AV7B 4MCYA 2A99A 1X5YA 3FNKA 1NDGA 1P6FA 4OQ1A 4UOW1 1H6TA 2PLTA 4YXKL 3CD4A 4YE4L 3ZBMA 3LZQA 1ACZA 1SJEA 1E9QB 3B9EA 4JO4H 5I15H 2NNAB 3EYOA 5MEQA 5CHNB 4NRZB 5D2NC 4D2NA 4JK0D 1IM3A 3CQQA 3HUJA 1FIGH 4R83A 4XB8A 3ZE1B 5HY9B 2HN7A 4K3DL 4N2FA 3ECBA 1ZKAA 5D7JD 4RMVA 5IBLD 4PN6A 1ECYA 1A6ZA 4XC3H 4N0UE 3TN0B 4A63A 3V0DA 4Y4HC 3VQ2C 1OWRM 3IU3A 2D03L 2AXGA 3CZNA 5F88B 1MFBL 3PXLA 4LPYA 5C8JA 2CD0A 2NQ3A 3TYFB 5ALBL 4WW2F 5D96B 1M2OA 1J8RA 3G6JF 4QHLB 5MP6H 1AOZA 4ODTL 3L54A 4ZXBA 2QLVB 5C0JB 1MNNA 3DO7B 5FYLE 5AW0B 2BWQA 3HIZA 3PHAA 1UH3A 4XT1C 5DQ9A 1PX4A 3BWUF 3MGTA 1CU4L 5IFHH 4UDTA 1KGXA 3O9WC 5EO9A 3HPJA 5D7IA 3IB4A 2HRGA 4TQEH 3UZVA 5D5MB 4BFBD 3D85D 2AJVL 3OKEB 4NKOA 4NGHH 5B1CA 3SE8H 3V4UH 3VWKD 1A4KA 3SQOH 1UCBH 4IBQA 5E0QA 2JJUA 4G5AA 2J43A 4PCKA 4Z78B 1CLYH 4CMHB 1EZVY 1KYOK 3K6NA 3MV7B 3A23A 1MJ8H 3V0JA 3ZE1E 1G1CA 4ABQA 5E70A 4LMQI 5J4MA 5AW7B 4N28A 4P2RB 1IV8A 3CDZB 3L1GA 2VN5A 1A2YA 5BRZD 4IDJH 4DZBA 2BOBB 2EDLA 3WDIA 4AUUA 3CCHB 3OM3B 4ZUWB 3QE5A 4Z7VF 4PRNA 2ICWJ 2WMPA 3KEDA 1B90A 4YBQC 5IOPB 5EBMA 1H3PL 1HYSD 4KPHL 4G3YL 2Z8WC 4KKQA 2BZDA 2EVJA 2CKBL 5BRPA 3C5JB 2Q10A 2DQJH 1ASQA 3KLLA 3FQNA 1PLGL 1HL9A 9PCYA 2R4RL 1HHHB 4V11A 1H8OA 4CMMB 4NBZB 5IJDC 3WTUA 5F6IB 2V17H 4W9IC 3VXSB 4Y19A 1U3JA 5FO8B 1OQOA 3MUUA 3HS8A 5J56B 4P23A 5D5ME 1BECA 5FUZL 3LV3A 3I6LE 4HIIB 3GD1C 3CH1B 4PY7B 4PW9A 4JUTA 3I3DA 2X6UA 1SLXA 3E6FA 3MV7E 3MNMA 3GZQA 5CEYA 4UANA 1EMTL 1N64H 3SQBB 3ZRFC 4BYHA 4JDEB 4Z95H 4P2RE 4X0KB 3NEXA 2O5ZH 4YDZA 5HGHB 1ZOXA 4GSRA 1UWEL 5E4EC 1MQ8A 2AANA 3QRBA 4GXUN 1ZS8A 1G6RA 1E30A 5D6CA 4PJCF 1BFSA 5E4OA 1KCRL 1M53A 1UXSB 2WSKA 2ATPB 4K94L 5TH2B 4W9GC 3EGXB 3K4ZA 1SDYA 1UB5A 2JLPA 2O1AA 3MBWA 4BM7A 5KYWB 3BD5A 3MRIB 1IAIH 4JZJA 1QD0A 5E1IA 5FB8A 2EC9T 4LKCB 3FCSA 1RVFL 2PYFA 4Z7VB 5B8CC 2X4PA 1C08A 1WFIA 3VXSE 3ARBA 3QP3A 4HF5H 2BNRD 3VE0A 4MSWB 1QRKA 2Q7YB 3IM1A 4HK0B 1KCBA 1UUSA 2G9HA 1QSFD 1J10A 3FOMA 5L9DH 1QPXA 1HH6A 3D08A 4D0BB 2RIKA 3FTWA 5ISZA 5I75C 5FX3A 1AFVL 1NL0L 5DJCB 2D7PA 3R8QA 3KHOA 1HHKB 5DJXB 1EAPB 2VAAA 2VDLL 3VD7A 4Z7UB 3MRMB 1GOHA 2C34A 1LK3H 2Q3ZA 2PN5A 2BHUA 1MCIA 3DPBA 3KPSD 2EIDA 4HFWA 1A8JH 1CYGA 1G0DA 3GBLA 3ZRSA 2P42B 4KQ4L 4NO2A 1DBKH 2ZT9C 2E7DA 1KLGA 5EUKB 3WV0A 4R90H 4G9FD 1CT8A 1NFAA 2B8OT 3PV6A 2ITDB 4DQOL 4I89A 2A9DA 3S3DB 3BSZL 3BKCL 5ID0A 4FN0A 5F0LB 4ZBJA 3A6CH 5CJOH 1CXHA 1M7IB 3BEWB 1S9VA 3DGGA 1BJ8A 2KZ1B 4HKXB 4R4BB 4TOYL 4Z7VE 5L4MA 1YMHA 3B9KA 4WY7H 1E6OL 1EH9A 2D2CC 3O4LA 4JFHD 3FQRA 3HA0A 1EHKB 4MTMA 3ZGHA 1D9KA 3Q01A 3JWNE 3MACL 1AKJB 4JHVA 3TF4A 4N1EA 2FATL 4X42A 3UJIL 5GS0H 1NC2A 4XN8A 4TUOA 3WXWL 2PMZA 3H56A 3IPBA 3L4CA 3B9KC 4IGBD 1MEXH 4XH2B 3CX5K 1CWVA 4XP5H 3P4NA 5K1VA 5C6TH 4Z7UE 2AJ3B 2DJSA 1FJ1B 3VFGH 5CFHA 3CC1A 2D7TH 3T9WA 3VFUA 1MCDA 4XMKL 2DY2A 4AMKH 4BRJA 5GRZA 4HLJA 2IDQA 2RFXA 1NGZB 5DUBA 1AHMA 2EH7H 2PABA 3S4SB 4KI5F 2VXUH 1L7IH 3D4GA 3CLEL 1U2HA 3DIFB 3HE7A 2VDRH 2IDTA 3NIDB 5AQ0A 4FF9A 2DQDH 4LLAA 3ARUA 2CJ3A 2ZWKA 3QUGA 5I1IH 2GKIA 4BINA 1H3XA 3WS3A 3NZ8B 5EU3B 4S1RH 3LQAH 2OYKA 1CXKA 1KGUA 1U4FA 3QQDA 4L8BB 1P0SE 4B9PA 2Y2TA 1FZOB 3KVDD 1C5DB 3BIKA 3SDXB 2P5WB 1B2WH 2V9QA 4W9FC 1ZPLA 3QWOA 1LO0H 4ALAC 1G9MH 1U2CA 4JQIH 3CVBA 4JY4B 2IC2A 4YN3A 4GOSA 4UNTA 5IW6A 1CXFA 2WQVA 4YDIH 2CA4A 5BMFH 1U3HA 5AUMB 3EOAB 3KBHE 3MRNB 3OKLA 3QXWA 4JREC 4WW1B 4X9GA 2AJSH 1CFVL 5DCCA 1GGTA 1NCDL 4GUQA 4K07A 3WIHL 2QV2A 3P2DA 4Q0XH 2XQYK 5I6OA 3UO1H 3K5SA 4YC2B 4GP8B 4AJ0A 5C0IA 3QUXC 3G7TA 4LCUB 4GEJA 1DO6A 5BOJA 2AQNA 4F7TA 2CU9A 1ZDQA 3NIDE 4M8UA 2J4WH 2EDBA 2MOVA 2V7HB 2BNQD 4LEOB 4MAZA 3PNRB 2EO1A 4PCTA 2I9TA 4LGSB 1LMKA 5EU4B 2CO7B 4P5TB 3U4EA 1ES0A 1S6NA 1JZ7A 4RMRA 5DWUH 4XOEA 3QFJD 1N18A 1E28B 3IJYA 4FQ2L 4U3HA 4JHAH 2TAAA 3SDXE 2YMXH 1XIWC 2P5WE 3DVIA 1F3JA 1QG3A 4MAYD 3RDTD 5JQ6H 2O5YH 1NJ9B 3DURB 3MA7A 5KVEE 3LVTA 1A1OB 1FE8H 3L3OA 2F8OA 3HC0A 1FQ9C 3EO9H 4GPVA 3IRCA 4L4TD 5FHAL 4N2DA 3G5WA 4X6BA 2QHLA 1T1ZA 3C6LA 5CD5C 2GG1A 4UB0H 4OGZA 4EUPG 4BZ2H 5FXCH 2ITCB 4HS6B 1Z0MA 4P2QA 2MCPL 3L3OC 3RU8H 1R1CA 3VSVA 4G6FB 3SKMB 3TIDA 3TEYA 1I8KA 1U8MB 2NY1C 1QR1B 1NKOA 2PWDA 3H7BA 3QWQB 2X1XR 4M7ZC 2Y7SA 4TTDD 3APMA 3G04B 5EZOL 1DJXA 3CPUA 2WINB 4KVCL 1P53A 4P3CL 2MOGA 4PPTA 4OM0H 4M1GL 3QEGH 1S78D 2KKQA 3SBQA 1QMUA 4H88L 3DJTA 4NO0B 1LEGA 4XO5A 4N2CA 2BVEA 5CLXA 5DVMA 5I2IA 1I7TB 1PZDA 3V5DA 1L9QA 5JZ7D 3R19A 4XZUB 4S0SD 3TO4D 1EHLH 1IEHA 5KZCB 2UZXB 1N10A 1NBYB 3AT9A 4C83B 1L4IA 4OSUH 4PGEA 3FUMA 1RZGB 1LDSA 3GK8H 2DH3A 2M8XA 3BX7C 3L3DA 3NJIA 1BF2A 3J07A 4NZRH 1V55B 2YN3A 3BH9A 4QY8B 2HH0H 4Z3HA 4DP4X 4MNGA 2DYPB 3SDCB 4FTVB 1MHEB 4A39A 3IK2A 1Y0LB 1NPJA 1Z5LB 4U1JB 1I1AC 2R9HC 3JWDC 3TPUA 4YX2L 3LIZL 2O6PA 1HWWA 1M56B 5AENA 1YEEL 4M1CD 4QHNA 3L5HA 4PYGA 2NZ9C 5JHBA 2P5EB 4C4UA 3P54A 1N5AB 3LN5B 5FOBB 4I18C 1T1WA 3VJ6B 2YBRA 3CSFA 1VGKB 3ARGD 3D69B 2WSDA 3IPFA 1E5UI 4J1UA 4PRBA 3T2NH 2BSEA 3N3EA 4NJAL 3V4VA 3Q3GA 3R7QA 4LMQE 3WN5B 1KBWA 2NY7L 3GGWB 4HWBL 1WT5C 1IL1B 5JORA 4U3SA 1CVRA 5J8OA 2CMRH 4I3RL 4DO4A 5AZ2H 1KCUH 4YDVB 5EH1A 2YUXA 3O2VL 3VAEA 1MFMA 3CV5A 4E36A 1WAAF 5GGTL 4EIZC 4DEPB 2DM3A 4FTVE 2FWSA 1BLIA 2XIIA 2XZQL 3WFDL 1MNUL 2J88H 4JFVA 4LP8A 4LLUB 5D1QA 3UGEA 3T0EA 4U1KB 3D4CA 5IV2B 1ZK9A 2BIQA 4A67A 2FJFB 4A6YL 3LRSB 5DD6B 2ZCLH 1JZ5A 4PREB 1ACXA 1XGPB 4K7FA 1F58H 2P5EE 2IPTL 1M2VB 3FPXA 5HHNA 1X5GA 1KIUA 1MPAL 2GCYA 2HLFC 3FMGL 3GEFA 1UJ3C 3DGDA 3ZTEA 2GUOB 4EZKA 2R39A 3LB6D 4M6NL 3DI3B 3DX9A 3X2QB 2XQYG 1VFOA 5MENB 3L9RA 5DK0B 3MNZB 4YHZL 3SE3A 4ELMB 2LLLA 3BZDA 3CN0A 1GTFA 4TUJA 5EZPA 3W9EA 2CRZA 3A5VA 4PRHA 1O5PA 4XMZA 3F62A 4W9KC 4CJ0A 3I9IA 4X4XA 3TWCH 4Y4KB 5F3BA 5CM1A 1IX2A 1KIRB 5AW5B 3QCTL 5I1DA 4WUKH 4HUMB 2AV1B 2DTML 5IEKA 5C0CD 3FQXA 5CIPH 3E2HC 1KB5B 5LHDA 1DVTA 2Z8RA 5DD1H 1V05A 2VDKL 3ZZLA 2R56H 1CLZH 1WHOA 2E74C 4S1SH 4TRPL 4ODXB 4TNVK 4AV0A 5E6RB 5KVDE 4GQQA 2H26A 2GIXA 3MUGA 5GGSA 4R7NB 1GH7A 2EEXA 3GIZH 5CWSA 3T3PB 2J8HA 3KPNA 1CLCA 2JCCF 1BXXA 5I18L 1HQRB 1OAZH 1F4XL 3LXBA 2BLFA 1M7DA 5D70H 3TBTB 3W9DA 4ZOEA 2PR9A 5C07D 5KEZA 2FGZA 2L7QA 4ZPVB 2XJLA 5JO5A 1GW6A 5KJ7E 3MV9A 1UASA 5MENE 5DC9B 4ELME 1UOKA 4J6IA 4XCEB 5A6MA 3QQXA 2WGXA 5DFAA 3NN8B 3DX3A 1I7UB 4DGYH 4EMZA 3MR9A 1XGZA 5I71C 4KHXL 4FG6D 4BKSC 5ESAA 4LAJH 3BQVA 4J3OC 3LMJL 1IAOB 1H3TA 4DGVH 1U8LA 4H26B 4KJYA 2CDFB 5EBWA 1ZLVK 3S8GB 1WTLA 3KPQB 1Q9OA 4X6CF 4X8GA 4GQ9H 3T1WA 3UEQA 4RX4A 2YAPA 1P4IH 4QF1A 4X5QA 4X2UA 3T3PE 3ZSTA 1VKXA 2JB6B 2IFFH 1IEAB 4XPFL 4I88A 2HT3D 4I3SL 4RMSA 4TULH 4OAWB 3KCPA 1NMCB 4Q6YA 4LCYA 5C0RL 4XVJH 4DK3A 1G7QA 5ADPH 2A6IB 2DICA 2XZAL 1TZHA 1SQ2N 1UXWB 2YPVH 1AKPA 5T1DL 3HZVA 1QACA 4HW6A 4NKQB 4P05A 2TSAA 2O4EA 4S2SB 4UIKH 1JNNL 3QIBC 4EDWL 2B59A 3HZKB 4F7KA 2KDYA 2VQTA 3KZ8A 4JN2B 2J5WA 1KWKA 2IWKA 1MFAH 1KJMB 1S7QA 3X1EA 1H9VA 1OCRB 3BQUA 1Q94B 4UQCA 4FQHB 3FB6A 4GW1A 2FVNA 5I0WA 3ELAT 1U58A 3VGFA 2Z4QA 1ANUA 1BQSA 2PETA 3MJ7A 5T5FL 1DUZA 1HESA 2ZUWA 4IRZA 4KK6D 2X28A 2VDQH 2J55A 1MIMH 4M1DH 1SXSA 2PTTA 2IXQB 4ELDA 3V9FA 2JSFA 1RP9A 3O2DA 4IHBA 1YEDB 1DANU 4L29A 5T1KD 1YEWA 5KAQF 3DPDA 2XG4A 4PH8A 5SWSB 2I7OA 1KTLB 3BISA 2BVQA 4AQEA 3RL2A 1NCJA 1CF1A 4X9FA 3KMDA 5CEXB 1P9MC 3L8QA 2OXGA 5ERWA 3V0FA 3WFCH 3HZ3A 3CMOH 1S5HB 1KYDA 3CFBA 3N55A 4JRYA 1FBIL 4PJIA 5EN2B 4F20A 5IBTL 1DFBH 2HJFA 4JRFA 4HOZA 5KSVA 2J2ZA 1YNKH 4LEEA 3DV4A 1U8QB 3MODH 4XI5C 4F2MB 1GGYA 5A2KH 3BVWA 2HB0A 4RFEB 4BFKA 1SN5A 2C9UA 3PFUA 5BVJB 2H7WA 2Q6WA 5KUKA 3W5MA 4IOIA 3MUHL 4X6FA 2F53E 4QHMA 4WO0A 2UY7A 5HXMA 3VFMA 3QYCA 4HZLA 4ZXBD 3T4YB 2W0FB 1AP2B 2H4EA 5SWSE 2HKAA 1RZJL 1M9SA 5EBLB 2A83B 5I16B 1PL3A 1XO8A 3HTLX 2PF6A 4DP6X 3K6SB 3FW6A 1SOQA 3ARFA 2OSLB 3ZDXF 2MHAB 2YEZA 3TIEB 4ATWA 3OJDB 3GKWH 1CL7I 2AEIT 5JA9A 1VPOL 3ZDZB 1J8HB 1R75A 4BEIA 1GC1H 2CK0L 3GHEL 2ZSVB 4F2ME 4R0LA 4L1TA 5KSAB 4Y16C 1KJ2B 4GRLB 4EIBA 4ZI8A 4QHKJ 2FX9H 3PWLA 1I8LA 2QBWA 4HH9A 4AQ1B 3ARFC 4YAQA 2OK0L 1BZ9B 3TJEH 1K72A 3KNBA 1WLHA 4LLDA 2VXQA 4ZTPH 3BPNC 5GIRA 2D7OA 4QRRD 2R2BB 1LEKA 1E0OB 3LKSB 5MERB 3UAEA 3DROB 3C09B 3T09A 5I74B 4K94C 1ITBB 3CFKA 4JN1L 1KCSH 1CQYA 4A04A 4GSUA 1HI6B 4YXHL 1IGTA 2WBWB 1BLNB 1KFAH 3QQ3A 3TP4A 3UJJL 4N0YH 3QDMB 4JQVC 3D2UA 5BUGA 5T3ZL 2FAUA 2H6PB 1PZ5B 2YAQA 3NCBB 2UVEA 4FQCL 3VYOA 2YAHA 4Y19D 3BGAA 4B9KC 1A3RL 3MOBL 4IKNA 4IMKA 3Q2LA 3WLBA 5CJ5A 4P23D 2YZ1A 3U0TA 1GHFL 3FTZA 4BE5A 1NDTA 4HWEH 2DWEB 4LPUA 3EHBC 1NAML 4ZUUB 3I9GL 3CFEB 3S5LB 5IB5B 1PZ3A 1Q8MA 3Q6GH 3MLVL 1A3LH 2OR7A 4NQVB 2LOEA 1J8HE 3RGVB 1KPUB 3ZDZE 4CVZB 3D87B 3EDJA 3HI5H 3RB7A 4Y2NA 4KZEH 4YFDB 1AC6A 5IQ9A 5I1AA 5D1XB 3GHBH 3RZCB 4U1SA 3F2LA 1KN2L 4GG6A 1S2EA 4MASA 5B1JA 3OZLA 3IDJB 4Z0XB 2QSCL 2Z91B 3WNOA 2FO8A 2N1TE 3MX0B 3DVGA 4ZMWA 1EAQA 3R7RA 3BHBA 5KJRH 1K3ZA 4TLSA 1SJMA 2Y36H 3C08H 4FP8L 1TEYA 1S4IA 2J57A 4EI5C 1IIKA 1RZFH 2GHZA 2HVKA 4A55A 4JPIB 3QDME 5GGRY 1P2CB 2I26N 4XO8A 3MLUH 3HMXA 4M4RA 1J0ZA 3ARBD 5KBDA 3D25A 2VMJA 4N0FA 1FORL 2YBGA 2Z1KA 3KXFD 5E1GA 2OLDA 2C3HA 1QI4A 1UZGA 1QBBA 4Y5XA 5ITBL 4W9ZA 3D9AH 2J6EH 5AW4B 1FIEA 4JLRA 2APBA 2QQKH 1KTDA 2B4CL 3MLZH 2JB5L 2BWDA 2NCEA 5D1XE 5AKVA 1V3MA 4UAHA 3VFRA 5FFLA 3CDCA 4DTGL 3M1BB 1HINH 1IFHL 4W81A 1NFKA 2IH1A 4XNYH 4A38A 4BA8A 4K9EH 2J44A 4AV5A 4JHUA 4YWGL 4GP5B 2XZCL 4WUUD 3KH4A 1A0QL 1XSIA 1RIVL 1C8QA 4JM4L 4MDJB 3IJ9A 3QAZB 2WZPA 5J11B 4UT7L 1X7QB 5T1LB 1DBBL 1NWPA 3EO1B 1EJOL 4DN3L 2G5BB 5H37G 2FT7A 1XBRA 4BV1A 3O0LA 4ZMXA 3B9KD 2XLLA 3U6RB 1NFIB 3NK3A 4MQSB 3K46A 1DN2A 5B4MC 4JFFD 1QLRA 1WBYA 2F8XC 4TSBL 2XT1B 3RWGB 5FF6A 4HCRL 1YMMA 2ZYRA 5DHVB 2GEEA 4J3OG 1NWOA 4X4YB 4I0PB 4IKJA 2JI1A 4PR5A 2EVIA 4JO1H 1IM9B 2P24A 2IBZY 3BE1H 3WU1A 5AOKA 5IB3B 1WRFA 4DCQB 1XGTA 4HUVA 1ZHBB 3FZUC 3BGMA 5FECB 3B6SA 1J5OL 4HWNA 2NXYC 5AVQB 3IGLA 4FFYH 4I4WB 2FBJH 2SODB 1BPLB 4G8AC 3EXJA 5AYUL 1H3GA 4IMLA 1E4JA 3AWEA 4JO2H 3OG4B 4CDGC 1JS4A 3Q7JA 5C0DB 1R34A 3QNZA 1BJ1J 4AH2B 4FZ8L 5FM4A 4ES8A 1HH9A 3MLPA 1MHPL 2OMZB 2XWEA 4K4KA 4ODVL 4YUEL 1K4DB 3GMOA 1TO5A 4IIZA 4Z1PA 5IFJB 1IKNA 3VXNB 1MSPA 4RQQA 5HVHB 3ULVE 3K6OA 4YPGA 3BZ4B 4M5ZH 3WJLC 5BJTA 1B9KA 1T0PB 2ADGA 5CN1A 3QVAA 4DAGH 5EA0H 4NM4H 2VDML 6FABL 5I8CA 2J1WA 2IPKB 4OLUL 3MCKA 1AR1C 2NYYC 3JWOL 1PDKB 1MCWW 3PP4L 4H5SB 1N4XH 2E7MA 4NNYB 1DUYB 3QUXD 4HFUL 4KGJA 4L4VE 4LVNC 3D2TA 1U3HD 4X9IA 1INQA 1C5CH 4U6VL 4PJGB 3GSRA 1P84J 2XTJB 3B7SA 5KYXA 4WU7A 1Z3RA 3IWUA 3SPJA 2UY6B 3SKOB 2HKFL 4J3OH 4Z3GA 2BIMA 1YYMH 1EO5A 2XWJA 4J3UA 3FCUB 2CHZA 5FYKU 4QRPA 3N43F 3B2MA 3QO1B 2BP8B 4PLKC 4J23A 1N3NA 1CJYA 2X4OA 3Q6FB 4IRJB 1S7SB 4LSSH 4BCZA 1FG9C 2IBBA 4RMQA 3WTWA 4G7RB 4WKXA 5B1KA 2GY7B 5GS2H 1G0YR 4U1NA 3V0WH 3TESA 1J1XL 2GAZA 1HNYA 5IESL 1PX8A 4NKDB 3ABMB 5CD5D 4UT6H 4JDZA 3N6YA 3F5WB 3SPIA 3UL4A 2VXVH 3JVFC 2KZKA 4XBEL 3MRQB 2R2CA 4GO9A 5DSCA 1BM3L 1N70A 4BZ1H 1JRHI 3SBWA 1J5HA 3QZLA 4OBSA 1G94A 1VGEL 1I75A 5DLMH 2NY1D 1AZVA 2FO4A 5LAXA 3D4YA 3CN4A 1INEH 1V7NH 2CUHA 1D5IH 2WLYA 5HYJE 4PJGE 4FEIA 4YXKH 2WHVA 3UMNA 4M7LL 2X70B 1D6VL 4D7BA 4R4FH 1JYVA 1SVBA 4YE4H 3SKNB 1ZIAA 5I1HL 3PP3H 1RUMH 4LASL 4L3AA 4WEUD 1QEWB 4X98A 4Y2OA 1XF4B 5GJSH 3VI3F 5HYEA 4ZOAA 1PFOA 5I26A 4JY5L 3D5OF 1YNTB 4K3DH 4YSTA 3HC3L 3SCMB 3FB5B 2QVMA 4DETA 1FNLA 2DEYX 1NBVH 2D03H 2OL3L 1ZAGA 3FQWB 1OSYA 3MC0A 4GFXA 1I9IH 1AE6H 1E67A 3EZJB 3FONB 1A14L 3BFQG 4ODTH 4XTRC 3DHJA 3BWSA 1FO0L 3NAAH 2YEQA 5DS2A 4X83A 3OF6D 3UBXI 3TBVA 5C0NC 2ZAHA 3SGJA 2CHNA 2WKOA 4QTFA 2YGPA 1JXGA 3F7PC 2R9HD 4Y5VC 5E24E 3B2UD 2Z92B 4U1HB 4HGWB 4OZ4A 1H5BA 2AJVH 2WXNA 4E41E 4O2EB 2NZ9D 1NDMA 2Z64C 4B3VA 1I8IB 4JRWA 4G11A 4NZTL 5C09B 5T8IA 2CIIA 2RACA 1QFUH 2FQEA 2WTRB 3DIDA 1JXJA 2WUCL 3D06A 1QHOA 1MWAA 2JQMA 3CLFL 4HULB 2IEPA 3VI4B 5EU6D 4LU5L 3F6LA 1NM4A 5TK2A 3KPPA 3RWDB 4H8WC 1IFRA 3PQYA 5AVUB 5IVNA 3OAUL 2AK4B 3KHQA 1BVKA 3ULUH 2ZWSA 5MI0B 4IOFC 3HJ0A 5D4JA 1HOCA 1CDCA 1BP3B 3B1UA 4AEFA 4KPHH 5ILTL 3GMPA 2CKBH 3B56A 4WGKA 1QPPA 4W1TA 4KKBC 5EU5B 4LCWD 1CGWA 5GRXG 2V8LA 1PLGH 5GRJL 3V10A 3QDAA 1PD6A 3EJSA 5EFIB 1J87A 1KLFB 2N7AA 4EZLA 2AV7A 5FYJL 1Y18B 3DVNA 1WCBB 3QZNA 4X5LA 4U1GC 4ZQKA 4BFRA 1H8NA 3SYAA 5JXEA 1FAKT 5C09E 2NNAA 5EO0A 4HLZH 5CHNA 2F58H 3QUHA 3K0WA 4ACTA 1B3IA 4X7EC 2V4LA 2Y69B 3GSOB 4QPEA 1NGPH 5D9SB 3VI4E 2WAHA 3TN0A 5CD3B 4KNQA 1QLEL 2Y2YA 2EECA 1UWEH 1T7YA 3E9TA 5JW4Q 5CEZD 3ZDYF 3IJ7A 2AK4E 5F88A 2A0LD 1L6ZA 4PBWD 4K73A 3TYFA 1KCRH 5IHBA 2G3XA 4K94H 5E94A 4QHLA 4JPWH 1ET8A 1H15A 3ZHKA 3T0VA 2WVVA 5C0JA 5A3IC 4Z7OB 3DO7A 4NC1E 4RISL 2HG0A 2GABA 3OSKA 1OAYH 4OF3A 1GJWA 4PRHD 1NCBH 3JXAA 4OI8A 1PNCA 1DQIA 4KY2A 4MYPA 2V9UA 1CVSC 2GJ6B 5D5MA 1RHFA 1UEMA 3OKEA 2BIPA 5JUEL 1N59B 4Z78A 5ICZA 5A1AA 1EZSA 5L8JB 2GC7C 3VFOB 4EO5A 4ZX5A 3MV7A 1NBCA 1J18A 1AFVH 1NL0H 3RVXC 2GI0A 2IOOA 1IAMA 2BVOB 4PJXF 1DEDA 1GXEA 4P2RA 4KMTL 2VDLH 2F15A 3OSVA 4KDWA 5F9AC 5CBAB 1V3JA 3C5SB 1YJDL 3CCHA 4ZUWA 1XMWA 2OFQA 5DJ6B 4Z18A 4P9ML 4XE0A 5IOPA 5CJBA 4BGDA 4MMZC 3H9HB 2LTQC 4DQOH 3BSZH 1TTBA 3BKCH 3C5JA 1WO2A 3MV9D 3PXHA 4Z7OE 1JF5A 3HMWL 5ACZA 1M05B 2P5PA 3LVEA 4XCNA 1QTYT 1HHHA 4ZJ9A 5D7SH 4OVUA 3UZQB 4WW2A 5KANI 3VXSA 5FO8A 2GJ6E 3G6JA 5K9JL 3VFVB 3B7UX 2EVGA 3T04D 3VFWB 4D9QD 2B3IA 3MACH 4UT9A 5HDOA 3DK0A 2G0KA 4HIIA 4KOCA 1MCEA 1FGNH 3CH1A 3F58H 4HH8A 3WO4B 3IDYB 2EDJA 2FATH 4PY7A 4AIXA 3ZKXB 5JHAA 4M93B 4GIPD 4UQAA 3GIVB 3QUML 2B14A 5F9DC 3WXWH 4MD4B 5IVZB 4P57B 4JDEA 4WW2C 4ICXA 1VB9A 1HQ4B 2ERJB 1I85A 4JCMA 2VLKA 2VZOA 1F3DH 5JPMC 4AXWB 3LNIA 5FYKH 5HGHA 3RUGB 1NOAA 5D71L 4KQ0A 4PBVC 4HS3B 3QIBD 1OXYA 2X89D 2DQMA 4O9HH 4XMKH 1AZUA 3C8DA 3BWUC 5F71A 3ZHNA 1SYVB 3L16A 1TLMA 5K9KB 5TH2A 2ZTBA 2ATPA 4JDVB 5KYWA 1K4CB 4LB8A 4XN9A 1QLFB 3CLEH 3U30B 2XHNA 4LKCA 5E4AA 4MVBC 4RGMB 1IC5H 1LNUB 3T0WA 4Z7VA 4M43L 4GKNB 2FX7L 4YSSA 1MN4A 3O4OB 4BFGA 3IKCA 4MSWA 4R2GB 2Z31C 4HK0A 4QIRA 4LKXB 1RUKL 4MS8C 5DJDB 3ILQC 4NIYE 1OT1A 2H2SC 3QWNA 2AVGA 1S7UB 4PJ5D 1EEYB 5DJCA 1J11A 4C4BA 5LGYA 4UILL 5DJXA 1WUNT 4HOMA 2F0CA 5D93C 5MEOB 1KTKE 4MMYB 3MRMA 3Q48A 4JO5A 4LRNH 3CBJB 3MV11 2XUWA 4RZKA 5IM7B 3RUGE 1XBDA 4ODUB 5EUKA 2XETA 4FFVD 1CFVH 2WVSA 2ITDA 3WIIL 5ENWA 4UIMB 1RZJC 3GXIA 3MRHA 2ZF8A 4XI5D 2F68X 3BEWA 1M7IA 2Z65C 3KJ4B 4JB9L 4DGIL 4WCYL 4FQJL 2A9NH 1E4KA 2O5XL 1K3IA 5KVMC 4JRYD 4EIUA 4HKXA 5DUML 4B9CA 3QZOA 3KLAB 1A22B 4MX7A 3QNXB 5F93C 4C55A 4E9QA 3MV01 3MKKA 2FR4B 1Y1DA 4PRPB 1KC5L 4QNPF 1P1ZB 3G9VA 1AKJA 2BRQA 1IU1A 4GKOA 3B43A 4FYQA 2I5YL 3VX0A 5DO8A 3OPZL 2R0LH 2OW7A 1KENL 4XH2A 2WLJA 4PJ9B 3BD3A 2K8QA 2QVIA 2VLLB 4RWYH 5F9JB 3RHWF 1X9RA 4P46B 3X12B 2AJ3A 1FJ1A 3DHUA 4PYHA 2HRPH 4PJBF 1TOXA 3MBXH 4TXVB 5B39B 4KRPB 4HOWA 4XN4A 2NY4C 4CVWA 4PS8A 1G0XA 1NGZA 3QPXL 4J3SA 1E5AA 4OCXL 4UQIM 5E6SB 1HZHL 4XRCB 4N24A 2MCPH 1FC2D 1PAMA 3N9GL 2CJUL 1OEZW 4GAJL 4GI9A 1XGYL 4Y16D 3S4SA 3IGFA 3DIFA 3UBXB 3WJMB 5L88L 1DQJA 4HUCA 4EZMA 2E46A 3U2IA 2K6ZA 4KJWC 2G4EA 2J73A 3ARFD 3J27A 4HBCL 3L2MA 4W6YB 2XWBB 4CN1A 1O75A 3ZU8A 2JXMB 3F85A 4PRPE 3DRTB 2EXWC 3NZ8A 1CF8L 3RVWD 1KGCD 3B83A 3M88A 2R4SL 5KBMA 3ZKSD 4L8BA 3G5XA 4JAMB 4WO4B 4M1GH 3GSNB 1C5DA 4H88H 2WIIA 4HEME 3SDXA 4PTUB 2P5WA 3IDXL 3QARA 3FTUA 3EJCA 3ZK0A 1FHGA 4CC0A 1AANA 4DP2X 1T5WB 4QTIL 4BGLA 3K91A 4NZJA 5DTFB 3EOAA 5AAWC 3MRNA 3AROA 4PTTB 3X13B 1MCHA 4GSDL 4LSDA 1CR9H 2BCMA 2Z8VC 3LRGA 3HNTL 4OGYL 4AC2A 4QRUB 3BVTA 4Z6AT 2C4FU 1IBGH 1ZA6B 5E56A 4LCUA 1A3ZA 1UKQA 2DQGL 2ZXQA 2YKKA 5JDJA 3QDGD 3L6FB 1NUDA 1YQ2A 3UCRA 3L1OH 2V7HA 3NA9L 4LEOA 1OM3L 2R1YB 2ITFA 4F92B 4HXBH 4MA1B 1UZ6F 2B20A 3H2PA 3O3DB 4P5TA 4NQCB 1SDDB 5JOFB 2B4CC 1E28A 2PCPB 2YEVB 2V7NB 3ARWA 5KOMC 3T4AB 4WK4B 5JW4R 2CCWA 4NJAH 5DO2C 2QGBA 1NJ9A 3HFML 1IVLA 1OW0A 1A1OA 2V5MA 3CXDH 4HWBH 3MRGB 1E7UA 4KI5C 4AL8L 3VXRE 1KG0B 3F04A 1UD8A 4I3RH 3NESA 3MTRA 4NKMA 4GT0A 1SXBA 4XMUA 1MXGA 4HS6A 2FTAA 1ZA3B 5GGTH 3V0VA 1PVHA 3L08A 1U3YA 2DLTA 3UFIA 1CE6B 1UUNA 1QR1A 4OJAA 3QDJB 3QHTC 2NY3C 2VLME 2AABL 3VRJB 2KH2B 4KO7A 3BN3B 3H54A 2WINA 4DUWA 4YSEA 4JMXA 1S46A 1MPAH 3BW9B 4NQCE 4P2OA 2WXPA 3TX4A 4POUB 3NSYA 2OZ4L 4M6NH 3AREB 4NO0A 3AGWA 1BF8A 2E0PA 3GDCA 4MHHG 1I7TA 4M56A 3DSNB 1HILB 1AI1L 4HQQH 4NP4H 4XZUA 3BOVA 1KLUA 2L04A 4K8RL 1WBZB 2UZXA 4R26L 3V2AR 1NBYA 4LDEB 5B4MD 2OMWB 1RZGA 4P2OC 1MFUA 4YVUA 2WZPD 4NQEB 1Z66A 2BZ7A 1BZ8A 3ATAA 3MXWH 4U4BA 5JW3L 5GRUH 3V4PB 3RFZA 5DJZB 4QY8A 1OGAB 2ZUYA 3QCTH 1N2RB 3KJ6L 2W8CA 4PBXA 4Q9CA 4MJ2A 4L5FL 2DYPA 5E23A 5TE6L 1JZFA 1MHEA 2VDKH 4FTVA 1Y0LA 4TRPH 4JGJA 5I6KA 3FZUD 3WHE1 1Z5LA 4U1JA 3QDJE 2QL1A 1AIFA 1TMQA 1QASA 1S7TB 2NXYD 3RFZC 2A6JB 4I48B 2NY2B 3P4MB 4N1HB 2WTOA 2ENQA 4FL4C 3W11D 1L0XA 4XXWA 3REVB 4MB1A 4XWGL 5I18H 3K1KC 1D5RA 2ZCKL 3QR0A 1O5DT 5C70A 3VJ6A 4AK1A 1VGKA 5F2FA 1GGBH 5KVFL 4MNQE 1BZQK 5C08B 4N2NA 3G08B 5GJTH 3WN5A 1QBLH 1BCIA 5IHUL 3GGWA 5F72S 4MA3A 5EOQL 5C0EB 2DQFB 3FH8A 2YPLD 3DOSB 4WZ9A 1IL1A 3IGKA 5JW5A 2B3RA 4MLIA 4YH6A 4KHXH 1YEGH 4NQEE 3RLSA 3GKZA 4JVPA 1EZLA 4YDVA 2ENYA 5L6YH 1OGAE 2ZUQB 3K72B 3MUZ1 3LMJH 2CA3A 1AR1D 2EDMA 2I25N 2LAAA 2NYYD 2KT6A 1U8NB 3GJFB 3IKKA 5KSBB 2CR3A 1Z9OA 2BP0B 3DO3A 3ZMEA 5AG9A 1T2QL 1OK0A 4DEWA 4U1KA 4JKPL 2JJTA 1P7HL 3KPMB 4Z3FA 5FIEA 4ODHH 43CAA 2B15A 4HCFA 1HFUA 3MNWA 1F6FB 4XPFH 3TZVB 2FJFA 3LRSA 4GBXC 5DD6A 3PL6C 4I3SH 4K71C 2ICEC 4PREA 4PUBL 1XGPA 2JJWA 1T4WA 1VZIA 1EAJA 1M2VA 4MCZB 4C56B 5IHHA 2X6VA 5LWYH 2N56A 3FFDB 4JG1H 1R3HA 2A4ZA 1OAKL 1H3VA 4P5RA 4YDLB 5LNGA 2QPEB 3LRKA 2LU7A 5C08E 2ZOKB 5ALCL 3QWRA 5DK0A 3MNZA 4GP4B 4ELMA 4PLKD 2DD8L 4Z3TA 1FWXA 4UI2A 4N86A 5JMRA 4G7SB 1JNNH 1N8OE 3DXAB 1U36A 2GJJA 4EDWH 3WJJC 4HYTB 1TZIB 5CJXA 3VW3L 3Q2NA 1A6TB 3MYZA 1OLZA 2ADFL 3N42F 1ED3B 4Y4KA 4YIQB 5GS3A 2C3WA 3HVDA 5B38B 5IB4B 1CGYA 1F3RB 4XVSL 1BFVH 1TPXC 2AXHA 3OG6B 4QRPD 4XX1E 2VT0A 4UTBH 1NC4B 2C9VA 3TVMB 2Q8BL 5KSBE 1BVLA 5JOPD 2APFA 3D33A 5F7FA 4CNIB 2J12B 3QQ4B 5L4IA 4R7NA 5ANMA 5F7BA 5T5FH 4O5LL 1KTJA 2YPKB 1KEML 3I3EA 2IV8A 3O2WL 4APXA 5C2UB 2OPCA 3QHFL 4DVBB 1Q9WB 5BW7A 1XR8B 1HQRA 1W9XA 1ZHNB 2QPFA 4N68A 4C56E 4G83A 1T89C 3TBTA 4EPSA 2WB1A 1TJXA 3SDYL 3IDNB 3UYPB 2OZNA 2Y0SA 1CICC 4XCEA 1IC0A 2JK5A 1EEZB 3DXAE 3GBML 3SJVD 2WO4A 3H3KA 2NXZC 1RJZB 5HHOA 1MUJB 2NTFB 4J6RH 4OJDH 2P26A 5IBTH 4LIQE 2QLYA 3O41B 2GBUA 3IGAB 1W15A 2EDWA 4M9OA 1JZEA 3WEOA 1LK2B 1IAOA 2B2XL 5GGUB 1FLTX 2B1HL 3FUHA 1FFRA 4XTRD 5C92A 1KJ3H 3ESOA 3BPLC 4B96A 3KPQA 3BIAX 3GLDA 4N87A 5FW7A 3MSPA 5ABDE 1WFUA 5C0ND 2Y06H 4YDMA 2BH0A 4GKZB 3MRJB 2JB6A 3LHPH 1IEAA 2BHYA 5E8OB 4OAWA 5B3JF 1NANI 5FHBL 5LXGL 5EIIG 1FF5A 1YQVH 4CU7A 2A6IA 1AQ8A 4UUJB 3D1MC 1RZJH 3OGOE 4O02L 3D85B 5LUMA 4PJ8C 3VWKB 4QXWA 2HJKB 2ZP9A 3MXVH 4BXSV 2VZUA 3EUDA 4UM9A 5J13B 1BXAA 1HKLL 1M7XA 2GY5A 4WI7A 1V3LA 1G1YA 4P5MB 3BUIA 4JN2A 1ZANH 4IOFD 4XNUL 4KXZI 1VPOH 3NZSA 1KJMA 5BRZB 1KPVB 1YY9D 4XE5B 2CK0H 1FH5L 1HEHC 2EEFA 1GYUA 3JTBA 4FQHA 1I8AA 3US9A 1XFPA 3PIQB 3DHPA 4HIPA 2ZICA 5EUOF 4PD4J 3PABB 1W0VB 4KKBD 1QRNA 2QQNH 1AD0B 2OK0H 4XO9A 3PQYD 1SLWA 3AAZB 2W9LA 3BVDB 5DFTA 5AWNL 4BUGA 2EJ1A 5HHXH 2YGVA 1REIA 2IXQA 5T3XD 1FL5A 5C0FB 5E7BA 1CFNB 4FXLA 2WN2A 1YEDA 4HCIA 1W72B 4X6CA 5BV7L 4RMUA 2PWHA 5GRWA 1AACA 3UJJH 1ZT7B 5SWSA 1B0RB 3O6FC 3WS6C 4WNQA 4YXHH 3O6LL 5L0QB 1KTLA 1DJGA 5T3ZH 4LHJB 3DKHA 3ZE0F 1A3RH 3HI6L 3UDWA 2CLVB 2YWYA 1S5HA 3GRBA 1GHFH 5JXED 4LARH 4RZCB 2LW3A 1NAMH 2DRUA 4LSPL 5A2IH 2YMOA 3AM8A 1A9EA 5JW4N 3UIYA 5I8OL 1E2VA 1OP4A 2FQGA 3HS0C 5BRZE 4H0HB 4QLWA 4LK4A 4LPCA 1U8QA 4F2MA 2DW5A 4F8LA 3CPLB 2HWZH 1QKZL 4RFEA 4ZMZA 5A3ID 1RZQA 4ZMQA 5BVJA 3IF1A 3NK4A 2QSCH 2WQSA 1N8ZB 1EK3A 3MROB 4F37F 3GNMH 1EHAA 4KNTA 3PF2A 4HAKA 1GGCH 2W9DL 1YJDC 4PJDF 4UNIA 1E90A 1CXIA 1QFWH 1Q0EA 5E2WL 3BSGA 1JGDA 4JUSA 1AP2A 4FFZA 4WIQA 2RGSA 3FHAA 1L5GB 2BK8A 4HG4J 3RVXD 2OTUB 2BNRB 2F18A 5EBLA 3W2DL 4CRPA 5I16A 4RAVB 3MKGA 1SLUA 3RWCA 1JP5A 2BW5A 5HVWA 4KZCA 1FORH 1UCTA 1L7TL 2YD4A 2OSLA 2EE0A 1HL4A 3ISYA 4F7PB 2MHAA 1Q1JL 3TIEA 1C5BH 3A67H 5J5EA 4WFED 3RGBA 1J8HA 3H42L 1LYQA 4PW3A 3FO1B 2B4CH 4HPYL 2ZSVA 3KPSB 5KSAA 1KJ2A 2Q8AL 4L0ZA 3EJUA 5JIMA 5E8PB 2WXQA 2VC2L 1DJWA 4DTGH 1IFHH 3ROLA 4AQ1A 2AQSA 4G9FB 3VCLB 1BZ9A 3C5ZC 5IK3B 3WHXB 3E80A 4W4OA 2FYVA 4YWGH 5CJ8A 2E9WA 4CUCA 2Q3XA 2XZCH 2R2BA 2O30A 1A0QH 5MERA 1RIVH 3DROA 4JM4H 1WE5A 1JCKA 2NX5B 4ZD3L 1DBBH 2WQRA 3WAJA 1HI6A 1X5ZA 3KW8A 4DN3H 1BLNA 1EJOH 2NQDA 2EDXA 2IIJA 3QDMA 4N2BA 4ZMVA 1ACYL 2BNRE 2H6PA 1PZ5A 4W9LC 3VXSD 4X4ZA 1XCTB 2QPSA 4ZS7L 1QSFE 2UYLB 3PWNA 3GPSA 2PUQT 1MXDA 5AZEL 1M3IA 1LXMA 2DWEA 2EDEA 4N8VA 4OY9A 2X12A 4ZUUA 3RNKB 3ABZA 3CFEA 4IGBB 3R0NA 3S5LA 2ZX5A 3TWYA 1OSZB 5IB5A 1CDYA 1EERB 4NQVA 3I50H 1KPUA 3INUH 4NKIH 2FWLB 4TMPA 3UAJA 4DVRH 3KPSE 4NXSA 5D1XA 2MWCA 3TC9A 4ERSH 1BQKA 2VLKD 1P7KB 3RZCA 1BA9A 1Q0XL 3CFDB 3IDJA 4Z0XA 4G9FE 1SVZA 3QAQA 2Z91A 4MVBD 3QUYA 1IBFA 4ONFL 4NQXB 4AVKA 2KMWA 3W39B 3F6JA 4P9HH 2VLRD 3H4HA 4CA4A 3PAZA 2Z31D 2CIKA 3S37X 5JIPA 1EVTC 4MS8D 4JPIA 2J1ZA 3ILQD 2H2SD 4JFHE 4HUWA 3QUYC 3PWUB 3HBQA 2EC8A 4ODVH 1ACCA 1P2CA 5K9QG 2DLIA 2P49B 1FRGH 3IBOA 4E9VA 2A9AA 2YD1A 4OD2A 5EEXA 1J48A 2YD2A 3R18A 4U6TA 4ZUTB 1U8OA 4A7GA 6FABH 4XP4H 4ZAKC 2VRAA 4OLUH 3VXQB 2X2IA 2AQ3A 4M6ML 4Y0GA 3JWOH 5E99L 1ADQA 4EQ3A 1H0DB 2FECI 3BCDA 4U05A 1MCOH 4Q89A 4X9BA 5D6DA 3M1BA 1PBYA 5AW6B 3S5YA 4EXKA 3Q9QA 4PVNA 1RAMA 4S1DC 3MMEB 3BT0A 5LGHL 2X1OA 5CCHE 1FN4B 3WNKA 4XB7A 4U6VH 3Q2CA 3LZRA 4N5ED 4YSOA 3AW5A 1RERA 4HK3N 4KK5C 3AT0A 2X5PA 4GXFA 1X7QA 5D6DC 2P8LB 1JWMB 1F2QA 3EO1A 2IVFC 2ATKB 2G5BA 1IJ9A 2VM3A 1MAKA 2BNQB 4MXVF 3QISA 4OLZL 3U6RA 4AUYA 3UAFA 3LPFA 2AK1H 3QFJB 2JH2A 3UERA 1JF1A 2HX7A 3OLGA 1OB0A 3RWGA 4MAYB 3UBFA 5IBUG 2G4GA 5CKAA 5IESH 2XU9A 5LBSA 5C7XL 3WTVA 4X4YA 4I0PA 2NY4D 2CJTA 3PREA 4OCRL 1MFNA 1IM9A 4XMXA 3TJHC 1UGKA 1FSKC 1M71B 5IB3A 3BPOB 3N1MC 4L4TB 4XBEH 1D2OA 4DCQA 2C1PB 2ZG3A 1BM3H 1ZHBA 3O11B 5HHQB 5HDBB 2AF2A 3OQ3B 1VGEH 2VR5A 3K6DA 3DJRA 1X7TA 3ATEA 4ODWB 1K8DB 2YD6A 4KJWD 4I4WA 3K2IA 1MAJA 1IKOP 1ZT1A 1UHVA 5EV7A 1BYOA 1D6VH 1GSMA 3L4YA 2EXWD 3S35L 5I1HH 2F19H 2JI3A 1BQLL 4AH2A 1PPIA 4QYAA 4XCCL 5C0BA 1R0AL 4OUUB 2BNQE 1KZYA 1K4DA 2A74C 5IVXF 3HC3H 5IFJA 5AVWB 3VXNA 1IGJB 1J5DA 2YFNA 4F27A 3BZ4A 1DJYA 1HHJB 1VERA 5I8KL 3QFJE 4HJGB 4KKNA 4Q6IB 4A2LA 3D7PA 5CKGA 3ALWA 4IIQA 1T7XA 2OL3H 2ZWZA 2GIYA 4FJ6A 2IPKA 5HHMD 4UQEA 4KMQA 2DQUH 4V1DA 4NUJA 3TO4B 4F9PC 2DJMA 1DVXA 3CNKA 1PDKA 1TZGL 2I9LA 5F3FA 2VH5H 2VO5A 3O3AB 1FO0H 3MCG1 1WWBX 4H5SA 4L4TE 5EC2A 2EIZB 1ZHKB 4N2LA 2FBRA 4NNYA 12E8L 1JGEA 1DUYA 4BH7B 1S8DB 3LSOA 4AYFA 2W80C 2PO6B 5HDBE 1JE6A 4JKNA 3I2CH 4ZUVB 4YHML 5BZWB 4AL8C 4B9FA 3H2QA 4B9JA 2BW4A 4NUGL 3HFFA 3D05A 4NZTH 4UV7L 3SYQA 3EYVB 2UY6A 4PJAB 3SKOA 2J3SA 4Q74A 5JDSB 1JERA 2DAVA 3KYOA 2WUCH 3QO1A 3PDGA 2BP8A 2UXGA 4P4RB 4Y5YA 4AEHL 3P0VL 3Q6FA 1S7SA 1QSVA 3CLFH 3D6GA 1QZ1A 2YAOA 3ARGB 4RNRB 4OZFG 3LYRA 3OAUH 4KI5D 3FRUB 3GLAA 2DLFL 4CC4C 3BRGC 4I3GA 2AJZB 3KGTA 4NKDA 1U3ZA 1X9LA 2WZ0A 3F5WA 2D9QB 3BVUA 4Y5YC 1TTUA 1AGCA 1B0GB 3O8XA 2BSDA 3VRIA 4OV5B 3SPCA 3B7YA 3NCWA 3VD4A 2COVD 4NZDA 4UINL 5H4ZA 2XIDA 1L9PA 1ICTA 4K8RC 2JIXA 2KHAA 5IQ7L 4QTHA 2NY3D 4BFIB 5FYJH 3PDOB 2NT0A 2ZKHL 4R5TA 4ZMLA 3RA7L 3ZE2B 4X7SH 1N5YH 5IMOB 2X70A 2ORBH 3O8XC 3SKNA 2ADJB 1RJLB 1AIZA 4K2UH 5EMYA 2CAKA 3LZFL 1QEWA 1SPDA 4PJAE 1XF4A 2V2TB 5DD3H 1J9RA 1WDAA 2X4UA 4RFOH 3M17B 1YNTA 1ZMYA 4ZFOB 1Z9LA 4PJEB 3FB5A 2R0WL 1QLEH 3N0PB 5IROA 4ZMOA 1WD8A 1OP5H 5AVRB 2XWXA 3FQWA 1NEZG 3SGDH 4P2OD 4K0OA 4WHTB 1TZ8A 1QX1A 4J4PA 2VR3A 3V6OE 3FONA 2VDRB 2J5LB 2Q5BA 4UTAA 1DANT 3SKJH 4M8RA 2WKGA 3FUIA 5KAQG 2QSTA 3HHSB 2JQZA 2VQUA 5IROC 4ODSH 5KZCD 1KT2B 4LO9A 3EDFA 1G9NL 3QORA 1DQQB 3BVNB 2HT4C 2XV6B 2Z92A 4U1HA 4HGWA 4NCC2 5C0CB 3ZE2E 5LCVL 4WQOA 4MMXB 4OZFH 1OD7A 4X5XB 4OZHF 5GHWL 1J1PH 4G7YH 2YLKA 2UZYB 4XX5A 5IY5B 4XO3A 3FU7B 4RDQF 2UWEB 4U1LB 3IN0A 43C9A 2H6UA 2WTRA 1AZRA 3GXUB 4GO6B 5DUJA 3QORC 4TSAH 2WOBA 3CVHB 3VXUA 4PJEE 3VI4A 1AMXA 4KMTH 3LEXB 3GMLB 1RK1A 3TA3C 5C07B 4MRBA 2AK4A 5LGKA 4BDVB 4GRWB 3BH8B 5F70A 5DYFA 1AXTL 3D09A 3V4VH 4F5CE 2E8ZA 4U33A 1BAGA 1WS8A 5E8DL 1ZV9A 3HBZA 4WEEA 3QFDB 2JLLA 4N8VG 3IAGC 4XNZC 2EYSB 3IN2A 5EFIA 1KLFA 2EUWA 2HSIA 2R27A 2VIRB 3VFSB 4KV5F 1Y18A 5F7MC 3VG9C 4AUJA 5C0CE 1WCBA 1V54B 3DTXA 5T1MB 4HJ1A 5C0GB 1UD6A 4KZ0A 3GS4A 25C8L 4U6YB 5EU7C 3BSHA 2UWEE 3KS0H 3QUMH 3WD5L 5GGQL 5IMKB 1JVOA 5CAYB 4PCSA 3MGOB 1ZV5A 4FQLL 2HLEB 1DO5A 3RKDC 1TXKA 1JGLL 4PY8I 5CD3A 1IRAY 4MZRA 5C07E 3SO3B 3CZEA 5LQBH 3QC5X 1E4XI 1T0NA 4PRAB 5FUCE 2DQCH 2AFNA 4NUPA 4HIEB 4GRWE 1R5IB 3DUSA 5TQ2L 4LLYB 3WNNA 2OAAA 3MBEC 1FDLL 4HV8B 4MJIA 1KULA 3KAAA 4XBGB 1DJZA 3CFUA 3QWRD 4X99B 3OB0K 5F0MB 2R29L 3FXIC 3K74B 5HGGS 3U9PL 3CFCL 4L9LB 2BWIA 1HCFX 4RGOL 2NLJB 1IZJA 3GLEA 4M43H 5H2BB 2FX7H 4PI2A 4OT1H 1PSKH 2A6DB 4Y4KD 4HMCA 3S3CB 3RWJB 4KRNA 2GJPA 2CO6B 4P3WA 3REWB 4L8SC 2WWMD 5DJYB 1AO7D 1N59A 5BO1L 1RUKH 4L3ED 1EGJL 4MD5B 5HJ3A 1JBJA 3OKMB 3MLYL 2BVOA 1KPRB 3QCUL 3FSVA 2CXGA 4A2EA 2CPCA 2Y1YA 2GK2A 2FJUB 4M6OL 5T1KB 4FNRA 3GMNB 4QXTB 2VDPH 5DZJA 5CBAA 1VEMA 5D2NB 3TYGL 2G5UA 2NXZD 1NOFA 4MZ3A 5E8NB 2C26A 5DJ6A 3ZZ1A 2OMVB 2Y7OA 4Z0BH 1NDGB 1OAQL 1DBJH 2LGNA 2OYMA 5F1IB 4M5TA 4ONGL 1CS6A 2RCSH 4QCIA 4JB9H 1M05A 1Y6KR 3C8HA 2X2HA 4R9HA 1J12A 4WCYH 4ZNCD 5MEQB 2O5XH 5CU5A 3E6HB 2YSTA 4XZ4A 5HHOD 3UZQA 5TQ0L 1F90H 2IANA 4Y9GA 4Z76B 2DB8A 2HN7B 2R23B 3VFVA 4Z7WF 3T3MB 3INOA 4EUPB 4GAYB 3VFWA 3TCXA 1CURA 3OZKA 4Y88A 4C57C 4IBVA 3Q8CA 4E9SA 1TIUA 1JTTA 1IMHC 1WIPA 3GIVA 2ZOUA 5C8JB 3M1CA 3O9WB 3RPIA 2YD5A 4JGUA 5I1JL 1KENH 4P57A 2VR7A 1HQ4A 1QP1A 4H8QA 3AQYA 4PJ8D 5ID1B 5A2FA 4H8PA 2WNWA 4JHZA 3ESMA 4M02A 4XAWL 3RUGA 5T33L 4JCLA 4CL7A 5KG9B 1JZIA 1QPKA 5D2NE 1UM4L 5FYJD 5DQ9B 5FA3A 2QPUA 3AXLB 1SYVA 2NUTA 5EO9B 3HPJB 4PJXA 3QPXH 5K9KA 1AG0A 3WFHB 3J2PA 3OKKB 3A4AA 4OCXH 1HZHH 4ZMTA 2Q9OA 1K5WA 5I1CH 2X3CA 3CN3A 1QLFA 3EUUA 4J28A 5F7UA 4GAJH 2ZSWA 1XGYH 1QHQA 4UM9D 3DETC 1E2WA 3UO8B 5DS1A 5AG8A 3NFSL 1H8SA 5AOLA 4HBCH 5GSRB 3TFKC 2XKNB 2I07B 2XXGA 1ROCA 3T3ME 1I3VA 4NZUL 4G70B 1EUUA 3UC2A 1A2YB 1CF8H 1KB5L 1MAMH 5FC9A 2MQGA 4X0NA 4XXCA 1E7VA 3VB9A 4PG2A 1I9RL 5DJDA 4DP0X 5BZDB 1S7UA 3IRPX 3NCMA 1EEYA 1QRND 3IDXH 4IRZH 4QRRB 5D4IA 1ZSDB 4BZYA 2COQA 2YOCA 3BDYL 3QEUB 3GRGA 5F89B 3SGKA 2VDNB 1HWHB 3MLXH 3JBG7 3WKQA 3O2DH 4AYEC 4QTIH 1BW8A 5MEPA 4J3WA 3KL0A 3FQNB 4ODUA 4XXCC 2ZXAA 1HNFA 2DM2A 1T66C 3JTSB 3T71A 1SY6L 2Y5EA 3MTXA 3QHZL 2KL6A 3SGKC 3DMMC 3H9YA 1M9WA 4OGYH 4KJQD 2ZOTA 2ZUTA 4UIMA 1JCVA 5E4EB 1EXUA 4JO4L 4G5ZH 4JM2F 1RPQA 2DQGH 4DN4H 3AMKA 1JV5B 5CEYB 3QNXA 1LO5B 2VWEC 5H35A 3NA9H 2ZWNA 4JKLA 1ETJA 4K5OA 2XFXB 3FB8B 4PRPA 1OM3H 4KGLA 5IGXH