1NIEA

The structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
333
structure length
333
Chain Sequence
b'DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRITE REDUCTASE
publication title The structure of copper-nitrite reductase from Achromobacter cycloclastes at five pH values, with NO2- bound and with type II copper depleted.
pubmed doi rcsb
molecule tags Oxidoreductase (nitric oxide(a))
total genus 86
structure length 333
sequence length 333
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nieA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nieA02
1PMYA 2PLTA 3SBPA 3NJFA 3QJTB 4YSUA 2HRGA 3QJSB 1GW0A 3DTUB 4G71B 1WA2X 1ASQA 1HAUA 4QLWA 3ERXA 4A2HA 4UANA 3OMIB 5B1KA 1TU2A 4QKTA 1OE1A 4YSOA 3H56A 4BWTA 2UX7A 3NJNA 3EH5B 3NJIA 3PAVA 4DP7X 2WO2B 4A2FA 1BQRA 1SNRA 3UACA 2PPEA 4WKXA 1X9RA 3NYKA 2IDSA 4NAJA 5AKRA 1AZRA 1NPJA 3KW7A 4GP5B 4KOBA 4YSQA 4M4RB 3U25A 5D4JA 1ET5A 1A4CA 1NIDA 1OCRB 3IE9A 1J5CA 1T5KA 2JFCA 2WO3B 1AANA 1KGYE 5B3SB 1NWPA 4YVNA 5ANHA 3UAEA 2VSMB 2BWIA 4JKNA 1J9TA 2XXGA 1BAWA 3NJLA 2LLNA 2UXGA 1QNIA 1AZBA 3OMNB 3GXUB 4DPBX 2BP0B 1ILSA 1DYZA 1WS7A 2J5WA 5I28A 2BO0A 2R7EB 1JZGA 3FQYA 1MDAA 1N70A 2X87A 2XLLA 2VSKB 3NSYA 2BZ7A 2HRHA 4G72B 3FSAA 3HEIB 4RH4A 2ZWNA 1ZPUA 3KW8A 1RCYA 4E9RA 3PCYA 1NWOA 3T6XA 3V9EA 1N68A 4DP8X 4E9WA 2P80A 4GP8B 1JZIA 3QJRB 4PCYA 1SFHA 2GC4C 4AKQA 1W8EA 1A8ZA 4G7SB 2MRYA 2DWTA 5B1JC 1EZLA 4F7KA 2PPFA 3QJUB 3ZBMA 4GXFA 4UAHA 1JXFA 5I26A 2FT8A 2QDVA 3NSCA 4N4YB 1AR1B 2CALA 7PAZA 2IWEA 2B08A 3UGEA 1OE2A 2HXAA 5I6OA 4KO7A 3NJMA 1JVOA 2EIMB 2AZUA 3FSWA 3QJQB 2YAHA 2EIKB 1OF0A 3WIAA 2P80D 1PZCA 4HCFA 3WNJA 2PPDA 2EINB 5I6KA 5EHFA 3CVCA 4ZK8A 5A7EA 1NDTA 1JVLA 1PZBA 1UATA 5FC9A 2TSBA 5F7AA 4AKPA 1MG3C 1OV8A 1JZFA 2Y1AA 3S3BB 2XX1A 1EHKB 5D4HA 1RZQA 2H47C 3MX0B 4E9SA 5TK4A 3T9WA 3EF4A 3SQRA 4BXSV 2DY2A 2E86A 2XVBA 3EH3B 4KO9A 1IKOP 2VW7A 3AY2A 5LDUA 3S8GB 1PY0A 1PCSA 3AG3B 4CSZA 2GB2A 4HCIA 7PCYA 1F56A 2TSAA 5B1BB 1FFTB 1HFUA 3FT0A 3AG4B 2JKWA 3FU7B 3TASA 3CZUB 3CDZB 1ET8A 4E9XA 1WAEA 2IWKA 4HHGA 1MG2C 2BP0A 2FTAA 3V9CA 4YSRA 3FPYA 1AZNA 2CJ3A 2YXWA 1HAWA 1NICA 2XYBA 3JTBA 1I53A 2FQFA 2R7EA 2Q5BA 1OCZB 1JXDA 4K9JA 2BHFA 3TU6A 4FAAB 3IN2A 4AZUA 3WNIA 5I5MA 3ZX1A 1GY1A 2PP9A 1AS6A 3AZUA 3NP4A 2XV2A 1DZ0A 4E9VA 4KO5A 1GSKA 3SBQA 1L9PA 3WKPA 1BYOA 3ASNB 2AZAA 1KDJA 2ZXWB 4G7RB 3CVDA 2J57A 1GYCA 4DP5X 1ASPA 4P5SA 4A2EA 4DP1X 2XXFA 2JXMA 2VMJA 3D12B 1L9RA 1CC3A 2UXTA 3PAZA 1E5YA 3DKHA 4YL4A 4DPAX 9PCYA 3UAAA 2W8CA 2FNWA 3NP3A 3WI9A 4G7QB 1JXGA 4DPCX 4YSSA 1E67A 2H3XC 1AACA 3X1EA 2MTAA 1GS8A 3WG7B 2YAMA 2VW6A 2FWLB 1NINA 4GP4B 3UABA 3C75A 4KO6A 2IDQA 4YSPA 4E9YA 3CVBA 1E30A 1JZEA 2I7OA 4E9QA 2PPAA 5PAZA 1E65A 4PAZA 1ADWA 2DWSA 1BEXA 2DYRB 2IWFA 2HX8A 2GC7C 5I5IA 1PNCA 1X9UA 2Y69B 3GDCA 4HALA 1BXVA 1KV7A 3JT2A 1KYAA 1A65A 2UXFA 2CCWA 2GHZA 2PP8A 1JZJA 1VLXA 2IH8A 4DP9X 3OMAB 1CUOA 1SDDA 1OCCB 1ETJA 1B3IA 4L0PB 1PLAA 1AQ8A 2UX6A 1ZIAA 1TEFA 2YAFA 2PPCA 2HZHA 3N2JA 2YQBA 2CUAA 1ZDSA 2BZCA 3GYRA 2GBAA 4EF3A 5B7FA 1ZIBA 1L9SA 2ZONA 1SHXA 2WSDA 4TXVB 4BK5C 2XV3A 1R1CA 4FA7B 1PNDA 3AG2B 3ASOB 2HX9A 3ABKB 3FU7A 4P5RA 4A2DA 3BQVA 3CDZA 3FU8A 3PPSA 1PLCA 3HB3B 1PLBA 2W88A 3NT0A 2QDWA 2QT6A 1A4BA 1AZUA 3QPKA 4NB7A 1JERA 1KDIA 1XMEB 3PXLA 3X2QB 1JZHA 4KNUA 5I6MA 1A3ZA 1NZRA 2VW4A 4BWWA 2BP8B 1AIZA 1OOWA 2PP7A 2UXVA 1JOIA 3WKQA 2GI0A 1NIBA 1NIAA 2YAOA 1BQKA 1CYWA 2H5UA 1J9QA 2HLEB 4W9ZA 4BWUA 3ZIYA 2AFNA 2IDFA 2XV0A 3FQ1A 4Q89A 1L9QA 3IN0A 1WA1X 2YAQA 4CSPA 5I5JA 1AOZA 4N8UA 2CAKA 4AI7A 1ZV2A 2GSMB 2I7SA 1V10A 5TK2A 2YARA 4YVUA 4UF7C 2YXVA 1A4AA 1MZYA 5AFAA 1ET7A 1OCOB 4E9TA 3S3DB 4X4KA 8PAZA 3OQRA 3QJVB 4HAKA 4KNTA 4F2EA 1J9RA 1SJMA 5B1JA 5IY5B 4HZ1A 2FQGA 2DYSB 3NJGA 2N0MA 2BWDA 2RACA 1GS6X 2IDUA 5B1AB 1SF5A 4KNSA 4NERA 4AX3A 2XUWA 1YLBB 1URIA 1W6LA 6PAZA 3FU9A 1ASOA 2ZOOA 3PLYA 1IC0A 2DV6A 2IH9A 2NRDA 1AG6A 4A68A 2QPDB 5E9NA 2GIMA 3T6ZA 4A67A 4F2FA 4DP4X 4KOCA 4WTQA 3X1NA 4BDVB 1XB3A 3QQXA 2FT6A 2J55A 4BXVA 1QLEB 1ILUA 1L9TA 3NJHA 3IEAA 2YAEA 3H4FA 3UADA 3IBOA 1AS8A 4M3HA 1BYPA 1V55B 2IAAC 2FQEA 3H4HA 4JHVA 3ABMB 2HX7A 2EIJB 1AAJA 3T71A 1CYXA 3TA4D 1AZCA 1KBWA 3FPXA 3NJKA 4A2GA 3X1BA 4Q8BA 3S8FB 3BVDB 2PCFA 1SF3A 2EILB 1IBYA 1OE3A 4ENZA 2BW5A 3RYMA 1RZPA 2IDTA 2XU9A 2VN3A 3CG8A 1BXAA 3OD3A 5PCYA 3TBBA 3ZDWA 6PCYA 1PAZA 1TEGA 2OV0A 3T6WA 2Q9OA 4YSEA 1M9WA 1CURA 3S3CB 3MBWB 2BP8A 2XWZA 3SBRA 1NPNA 1FWXA 2A3TA 4HHWA 2VM4A 3FS9A 4GYBA 1FA4A 1SHWA 4HCGA 4DP0X 1IBZA 1ID2A 1RKRA 5B7EA 2AANA 3NJJA 1SFDA 3FSZA 4A66A 1KCBA 4HIPA 1M56B 5I6PA 1NIFA 2XX0A 4GY4A 4YSDA 1KBVA 1XB8A 3EH4B 3AW5A 3NSFA 1V54B 5D4IA 2YAPA 1J9SA 5B7MA 1BQ5A 2I85A 1NIEA 4DP6X 1PF3A 1BXUA 3X1GA 5I6NA 2FT7A 1WA0X 2FQDA 2CBPA 3FQ2A 2FJSA 4YSTA 1XB6A 1WS8A 1AG0A 3FSVA 3NSDA 1W6WA 1GS7A 4YSAA 2PCYA 1AS7A 2VM3A 4JHUA 1TKWA 5AZUA 1E5ZA 4DP2X 1L9OA 3TBCA 1NTDA 1GY2A 2X88A 2OCCB 3G5WA 2B3IA 4G70B 4W1TA 2J56A 3N55A 1M57B 3AG1B 4BDVA 5I6LA 1IUZA 3ABGA 1J5DA 1PZAA 4AKOA 3FYIB 4YSCA 1ZDQA 2BW4A 3EHBB 1SDDB 3DIVA 3FYEB 5F7BA 1MZZA 3OM3B 1GR7A 2AVFA 3L45A 2OJ1A 2QPEB 3ABLB 4MFHA 3T6VA 1QHQA 3X1FA 3PAUA 1KCWA
chains in the Genus database with same CATH superfamily
1KEGL 2FYVA 1DQJA 2CRZA 3FL7A 4EUPB 3Q3GA 4NHCH 4OZIB 2B2XL 1NMCC 1YN7B 4OGAC 4XN8A 5I16B 4RCAA 3LZNA 5FECB 4D3CH 3MRCB 2M83A 1Y0LB 3ZE2E 1RIHH 1FYTD 5BCAA 4LLVA 5EU6E 1EGJA 3V6FB 4OCRL 1LEKB 1MQKL 5F0LB 3OWRA 2NQDA 3QIWC 1G6RA 5DWUH 1X5ZA 4XVJL 4KZDL 5DQDL 4BEIA 1XFPA 3GO1H 4FI7A 1OKEA 2B77A 4WI8A 4L8BB 3ROLA 3O6LH 4G7VH 3RI5F 2OMZA 2ZWYA 1GMIA 3EYUL 1T21B 4NJ9L 1FFPA 3MLWH 2RFXA 4JO8A 2FAUA 3VI3F 5IQ7H 4GP5B 4HPOL 4FQ2L 4ZSOA 4ZMLA 4NUGH 5KBPA 3KH3A 35C8H 3FN3A 3D0LA 1HEJC 1KGYE 2GQHA 3H55A 3PIQB 5E9DD 3LNDA 1MUJA 2L4OA 2CGRH 2D3VA 1I3GH 4PP1D 3WFCL 2XWJA 5D1XB 4UQ3B 2V37A 1HKLL 1QNIA 4HIQA 5JIIA 1F4AA 5J3HC 4QCIB 1BFVL 1NBVH 2EH7L 4JRYB 5EEVA 1RJZA 2BSDA 2Q86B 4EOWL 3T8MA 2J44A 4OSUH 2OCFD 3UO1H 1JNNH 1NCHA 2ZP8A 4JHAL 4QF1B 1UZ6F 3US1A 5HGHB 3KCPA 5IJVB 1NMBL 2RB8A 5I0XA 4NWUH 1GPOH 1ZHKA 3ATBA 1YNLL 1MHEA 3S96B 3WNNA 4FYSA 5C07B 1ZPUA 1DLHA 4KKCD 4AOFA 4P0DA 2E9GA 5AW6B 3C8KB 4UMSA 3RWCA 3LAFA 3L3HB 4MJHA 4ACPA 2K3TA 2BXZA 1TMCB 5DTFB 3IU3B 4F7KA 1CE6B 3TONA 2NX5A 3NRFA 2R0LH 1F11A 5ACMA 2GIXA 2N56A 3E80A 3HI5L 1M05B 3O2DA 4NN7B 5J1AA 2X41A 3VSQA 1ZLSH 5C0DB 4FL4C 2IWEA 4PRID 1U0QA 2VDOH 1WEJL 3L3GB 1R5WA 1H3GA 2IG2H 1VACB 1LK2A 3V6ZB 5A6IA 1QW9A 3IMWA 5E2VL 1SN0A 3HC4L 5TE7L 1CDHA 1I3RA 4N5UA 3FQRB 1KXQA 1LMIA 5IHBA 2OX5B 4WWNA 1CD8A 1OT4A 2QEJA 2QGCA 3R0NA 3LHPL 4F57L 1UD5A 3N06B 4PLJC 3HAEB 2CLZB 3FFCA 2VZ1A 1WJ3A 4LEOB 1RP9A 2VXTL 4Z7WF 1USZA 1KBKA 5KUKA 2BJML 4Z7VE 1ZGLB 1J12A 1LE9A 3HZ3A 3KLAB 5IBTH 5KANI 3R1GH 4E9SA 1O6VA 1S9YB 2GSGB 4LSUH 3CZFB 3CDGB 4OZHF 1S7VB 1UHVA 2R2CA 3BLBA 3NFNA 4AEFA 4X6DE 1GGIH 2G75B 4ZW5A 1H3VA 3GK8L 4J3XA 3QVAA 3S8GB 1D5MA 4QHMA 1FCGA 1NL0L 3WXVL 5IVZB 2YEQA 4RFNB 2R83A 2WP3O 1RJYB 4DF9A 2EDLA 3SGKA 3OLDA 4C4BA 1JXJA 3C6LB 2ETWA 3MBXL 3KPTA 3FOLA 1H3XA 3HE6D 4FEMA 3E7JA 3C2AL 2I69A 3C5JB 1T7XA 2CNYA 2XICA 2XYBA 3E8UL 1KGIA 5DS8A 2ZCKH 5AEAA 2BC4A 2IH1B 2YUZA 4ZFZB 4E36A 4M02A 3NZHL 3B2VL 3IN2A 1WZKA 3TN0A 3SPCA 3HAEH 5F89A 4P4KC 2EO9A 1AY1L 4XC1L 3UX9B 1DZ0A 3MRLB 5C08D 2X4UB 4M1CC 2H26B 3VFSB 4ZNEE 4L2YA 2CJUH 2HTKC 5FFLA 4C58B 2HRPL 1P9MC 4UILH 5CN1A 5AZEH 1P6WA 1DSWA 1KCUH 2BOBA 1Q0XH 5FV2A 3MLTB 4P4RA 1T80A 4A2EA 4HF5L 2ED9A 4JFEB 4Z95L 3D12B 2NTFB 5D2LE 4FXKA 4HS8L 4PJEF 1IGIH 1F3JB 4X7TB 4F9PA 4X9HA 5T3ZE 1CICD 4HIJB 5DVLA 5AAWA 2AAAA 5CEZE 1EZVX 2NY5C 3TBVB 4NFCA 4P2AA 5D7IB 1NUDA 5EO9B 4YDJA 4RMRA 5HHVL 3CFMA 4I2XB 4QTFA 2YUXA 1T1WB 3F3HA 4Z78B 4HWBH 3MUZ1 3SOTA 4F2ME 2VM9A 3B8YA 4EI5D 2Y25A 3BPLC 1R47A 1RZJC 2G3ZA 2WWNA 2ESVA 5A2IH 2OBGA 2R27A 1XEUA 3JYCA 4H7VA 3ZLQC 3CHQA 4P8QA 3SGDH 3DX3A 3O9WC 3TP4A 2QTEA 1KTKE 3BH9B 5ANMA 3UZVA 1Q72L 3L5JA 3LVTA 4CRPA 1TMQA 3LIUA 1WIUA 5CFAA 3QORC 2H1PL 2JQMA 5H94B 3NCYP 1YJDC 1VLXA 1XSIA 1OGAA 4H0HB 3INUH 1SDDA 5DMGD 1HEZA 4RAUA 3VRJA 1IM9B 4DO5A 2WJ5A 3KLHD 3WFDL 1L0YA 2BRQA 2VDQL 5F1NB 3U1SL 4L4JA 3PABA 3K1DA 1SYSA 3GYRA 5IM7A 4ZMVA 3H9HA 3WDIA 1I7TB 4XMUA 12E8H 3MLZL 2CJTA 5DD3H 4A63A 3TNNA 1KCKA 3IJEA 1I85C 3C5XA 4GFXA 3LIZL 4CC1A 4BH7A 1BF8A 4O2EB 2DAVA 4A2DA 3FU7A 5ALCH 5IMOA 3RGVB 4NQXB 1RP8A 1M7IA 3ARDC 3MOBH 4IS6B 2XQYK 4ODVL 1IBFA 1PLBA 3K8MA 1CG9B 4I4WA 4XRCB 5C0CE 4ANUA 3H8NA 1WTGT 5FM5M 3SE6A 5KBMA 3N1PC 1XGUB 1JF1B 4KNUA 1T0PB 5E7FA 3VI4F 4FQQB 4FX5A 5GZNC 4ODTL 2YPKB 3O0RL 1QBBA 4G6KH 3L81A 1DDHA 2WZPD 3LEVL 2YRLA 3ZN6A 2QSTA 1ZTXE 1U95B 1UXWA 2E7HA 1VF5C 5AB1A 3E6HA 4O2CB 4YL9A 3HLKA 3RZWA 5E6UB 3M7FB 2P9RA 2XFXB 4MD0A 4TULH 1AJ7L 3T0AA 4HJJH 1AOHA 4MNGE 2X12A 4F58L 4HWEL 1VGKA 3L5HA 3DC0A 4RAVB 4UF7C 1NC2B 4W9EC 4Q9CA 2OR7A 1OL0A 4K7PL 3TCLB 1EUUA 5FA3B 2F53A 2R1XB 2MCPH 5I66B 3R19A 1MREL 5IY5B 1JF6A 1KGCE 1Q1JH 3DX1A 3QEQB 4PS7A 4PJ6A 5AYUH 4K9EC 3WY3A 2FQGA 3ECBA 4M7JH 1A7QL 1DP0A 1CFQB 4NYLB 3GSXA 3U30B 1EO8H 3T0EC 5ITFA 2HRLA 1H3WM 2R0KH 3NCBB 3BWUF 1CU4H 1YMMB 5FS5A 3ZMNA 3PWJB 4BK5A 4N2IA 3OHMB 3FJTA 3PLYA 5AZ2L 4Q97A 2HUEA 2DV6A 2IH9A 2P26A 1AHWA 4XMVA 1T7YA 2CBTA 4A7QA 3LVEA 4NKIL 3DSNA 2UZYB 1RH8A 3LKRA 3CSYB 3F6JA 5FO8B 3FMGH 1MJUH 4QTHB 2PXYD 2OL3A 3AITA 3EO0A 4LHJB 5EORH 1PQZB 4OLZL 1MCCA 1WHPA 4P3DA 4DKAA 4MJ6A 4PS4H 5DUBA 1YPZB 4LLMB 2FQEA 4MAZA 2J8HA 3VAEA 2V5SA 4HUMB 4I18B 4XNXH 4JREB 4K4KA 1ZLEA 2JCCE 4FFWC 4X5LA 3KPPA 3NCMA 4PY7A 4RSVA 2G5RA 4HLZH 2DI7A 3IWUA 3CIAA 1FI8C 4X5WA 4PJGE 5LGJB 3MV7E 3EDEA 3TO2A 5L9DL 1JRHL 3OBAA 2WVSA 3PWLA 1R3JA 1I9JH 2BW5A 4MD5A 5HHXL 1OPGH 1VZGA 2NSQA 3CMOH 5D71L 6PCYA 4PJ5A 4IOFC 5EDSA 5D2NA 3AREA 4R5VA 3ZY7A 3LRLA 3U36A 3IAPA 2YPLD 3SBRA 7TAAA 2PWDA 3P9MB 1AO7D 3QUMA 4D0CA 3OKKB 4JFTA 3CK0H 2VDMB 4AIEA 1LDPL 1L4IA 5KVGL 1RUPL 2IADB 5KSAB 4KH9A 1A1OB 2QMJA 4PI2A 5F9JA 2CKNA 3LB6C 4LFHG 4X9FA 1FN4A 5KVFL 5I18H 5E94A 4CW1B 2P52A 3ESMA 3CN4A 1OAZH 3QEUB 1NCOA 3QQNA 4K94H 1L6XA 1FCCA 4M29A 1CDCA 2E9IA 1SEBB 3G6JA 4ODHH 4PBXA 4XVSH 4UTAH 4PJIE 3D3VD 4BH8B 4JN2B 3A4AA 3DRTA 1GJUA 3QBTB 4F27A 5IV2B 5CO1A 3HMWL 3I3DA 4L4VD 5I6NA 3GQFA 4APQD 3GKZA 4H25B 5IQLA 4X6EB 4MTMA 2B1AH 2VR6A 3IWVA 1JSYA 1EAPB 1WDAA 4JPKH 4XP4L 3PNWB 4G6JL 5C92A 1X5JA 3WJLA 2ADJA 5IFAL 4O00A 3ISRA 1QRNB 5AW2B 4P5MB 3KYAA 5EOCH 3HRPA 4FLQA 2D7OA 5F70A 3T2PA 5J56B 1CD0A 1HZHL 2ODIA 1RUKH 3NCJH 3D39E 1CPUA 4KKBC 2X4NA 4X99A 1OP3H 1RK0A 2VDMH 4YUEH 3KPNA 2VLLB 1J8HE 2EEXA 3VFNB 4XXWA 3D48R 1TVDA 4AMWA 1K5WA 1LP9E 2HLAA 1MCPL 1MF2L 2B9AA 3BGFB 3CN2A 4NNYB 4JN1L 5DR5H 3VXQA 3CFBB 4FNRA 1VFAB 3M46A 3DXAD 4GKZB 4YBQD 4CKQA 5AVRB 1FO0B 1XT5A 3TC9A 3K80A 3RVTD 3UTQB 1LTXA 2EDFA 1JYNA 5BQ7A 2L0DA 4L1TA 1UASA 2BVQB 2NR6A 5CN3A 3MXWH 1B0IA 3RKPA 1K6QH 3BP5A 3DTUB 4JM2C 3T65B 1BZ9A 3VWJD 1IAII 32C2A 1S7XA 1QFOA 3ERXA 3BYTA 1HHHB 4JFXB 4TNWF 3GKWL 4GO6B 2E4FA 5AUMB 3A23A 3RKDC 4AY0A 1JZDC 2K7QA 1PLGH 1ZGLM 1KIUB 2GUOB 4L37B 1S5HA 2XNAB 1FFOA 5AKTA 4AT6A 3RX8A 5I1IH 5FM5O 2QR0A 4JLRA 3VRIB 2GW5A 2BSTA 2NZ9C 5FDWB 4BA8A 4L0YA 2WIIB 3KGUA 5DJ2B 3S4SG 1OGSA 1MFEL 3IU4L 5T1LA 3P30L 1BCIA 5EBLA 5A16A 5HHME 4M5TA 2Z91A 1E2ZA 4JO3H 3C5ZA 1ORQA 3WTUA 3GS0A 1S8DB 3GMRA 4G9FD 5ANHA 3MRKB 4K7PX 4I8DA 1B4TA 4YXHL 2XWTA 1HDMA 4JY5L 3N50A 1UT2A 1FH5L 1CFNA 1S7RA 2YZ8A 1X7SA 4QR7A 3BZEB 3KS0H 3UAJA 3C6SB 3O3DB 3ARZA 2UWEA 2OZ4L 3KJ4C 1ILSA 4CNIA 1YEHL 2KZBA 1ROCA 1Z0NA 4L9LB 1QSFB 5GGTH 2YC1A 5D5MB 3AS0A 4Q9RH 1P7QA 2VUYA 2HKHH 4XNZB 4GAGL 1K2DA 1U2YA 2AQNA 4X4XB 5FHAH 1NEZA 4ZUTB 1YEEL 1RIVL 3RJQB 5MERB 2PTTA 4LLDB 3EFFB 3RGVD 1UWFA 3TT3H 1FG2B 4OM0H 5H35B 2ATKB 1KXHA 2VN6A 3KW8A 3SJVE 4A6YL 5HD8C 5JQHC 3GSOA 5DI8B 5HPMA 2G5BB 1XSJA 2ZYIA 2EDWA 2BS8A 5E2UL 3QIWA 3P4OB 4XODA 5TQ2L 4L3EE 4UAHA 4IGBB 2V17L 3V8OA 4N4YB 4PJCA 3II2A 4XAKE 4ERSL 2GTWB 3FOMB 2EEBA 3ARBB 4DW2L 2HXAA 4F7EA 1SEQH 4JG1H 3G5VB 1KYDA 4XN9A 5J6SA 3SY6A 1A7PH 3N6YA 1S7SA 4U7KA 5E1GA 2DLFL 4KZEH 2HN7A 1A2YA 4Q58C 3CNKA 1E9PA 4IHOB 2ITDB 1A64A 1PZCA 5JHDA 1MI5B 1RFDL 5EOCJ 2PWHA 1FVEB 4ADJA 3QQ9D 3ZE2B 5E8EB 3Q2NA 2C1PB 4LP5A 3F8UB 1BPVA 1S46A 1UENA 3B56A 1CZ8L 2ZXDA 3HR5B 3BWAB 3EBIA 4HYTB 1MCEA 2VSDA 3FB7A 3SPGA 1SPDA 3BH8B 4FTVA 2P5WE 4M62L 1F58L 2DB8A 2XIIA 2WXLA 5C0JB 1MKFA 5I6XC 2DWEB 1DVFD 4XMKL 1ZT7A 3IK2A 1D2PA 4GUPA 2XQBH 4RWYL 4JY4A 5ITBH 4JO1L 3QSKB 2HVBA 3JWDH 4DK5A 4GUCA 1VDGA 3V5HA 5IJBC 5IMMB 3ULVE 1MNNA 2IOIA 5CP3A 2X7LB 1KTRL 4R4FH 1K8IA 3LPFA 1A7RH 5CEXB 4AGPA 1EO7A 1N26A 4AXWA 5T5NF 1URLA 5BUAA 5DEJA 4TUOB 3PS6A 1QVOA 3L5XL 4NRXB 5IHZA 1P53A 4JPVH 3FHQA 5K9QI 1P7KB 4JPWL 2IWKA 3PL6C 4OLXL 2DH2A 1EEZA 1MG2C 2GK2A 3FH7A 1DTUA 3UBGA 4PBWD 3WLBA 1TTUA 1DQDH 2JLLA 1OAKH 3NESA 2EDOA 5K9JL 4D8PB 1V5JA 4OUUA 3MJ9A 1R5IB 5ILTL 3SDAC 4NJAH 3ZT6A 4HX1B 4FAAB 4I87A 4DN3L 2G30A 3KYOA 2GT9A 3K1KC 4RBPH 4K3JL 5IFJB 3VGFA 4RIRA 3SBQA 1EK3A 1BZ7B 2OYKA 3QDGA 1A14H 3GSVA 3PHSA 3S2CA 1XGPB 2NY6C 2ZX5A 3U0WH 4I0PC 4G8IB 3SQBB 3TX4A 2ZG2A 3BCFA 4TMPA 3TPKA 2B1OA 1QG3A 3QUXA 1E8YA 4OCMC 4UQ9A 1KN2L 5FHBH 3ESNA 4YDLB 3DECA 1J87A 2WINB 3EUDA 4AVHA 3SDXB 1T0MA 4Y8AA 3DDGA 2FVNA 4OTXL 1E67A 1QABA 3BPOC 1M7DB 3ELQA 4B7IA 2UY7A 2UY6B 1UACH 3WMSA 4CDHA 4XZUA 2AXFA 4AYID 2V5MA 2AK4D 2IPKB 4AZ8B 4FQLH 4JE0A 5CHNB 3BSZL 5LVEA 1MCWW 3D18A 4R90L 4M61B 4TNVK 4P2RD 4UB0H 1CXKA 4ZXBB 4YPJA 1E65A 3E9UA 3IVKA 4U1NB 4LCWA 5LG6A 3UXFA 3PP3H 5C0ND 5I1CL 5T1KB 4ODSL 4NHUA 3MV8D 4OT1H 4XPTH 2OFQA 1A65A 3GSNA 2UXFA 3HKFA 4PTUA 3W0WE 2EACA 2NXYB 1UA6H 4KK6D 4NRZB 2B5IC 4DP9X 1DVTA 5SWZB 2YKKA 3EDDA 4PJXA 4O4YH 2DN7A 5D72H 4Z7VB 4GRLB 5FO7A 1E4KC 3PWUA 4OLVL 1FNHA 1SBSL 1QRND 1SOSA 4XP9L 3A6CH 1JGVL 4WUUB 3BAYA 1P69B 4Y5XC 5HYEA 5I0ZA 2A73B 2WGNB 2EKJA 1KIQB 2BZDA 3L5WA 3DJSA 4QNPF 2F54D 3WKNA 2F19H 5DXWA 1HXMB 1KTJA 1RSYA 2C34A 1P9MA 4DGYH 2GI7A 3UYPA 2Z35B 4GAFB 5IEHB 4N2KA 3FTUA 3PPSA 1IC5H 4WI0B 3RIAK 5JW4R 2HJLA 4ZQKB 4WUKH 1AZUA 5F7LB 3A47A 2D31A 1IC7H 1BBJB 5EIIB 2P7TB 3WIHH 4OZFB 4TUUA 2WVVA 1FSKC 4FFYH 2VMEA 5J8OA 2BP8B 1JVKA 3H7BA 3SYCA 1QD0A 2BNRA 4LO9A 4H8WH 3AB0B 1SY6H 2BNQE 2HLEB 2WXHA 2APTA 4I3RH 5JW5B 1KXVC 5GRYA 3D4YA 3FQ1A 3D0AA 4NOBA 1ZRUA 3RPKA 2Y36L 5ADOL 2F0CA 2ZYRA 4X4YA 5FV1L 4HA1A 3U9PH 1KGUA 1MRCL 5I5JA 5A3ID 2EVGA 6FABL 1I1AC 2JJTC 2KDYA 3ML8A 2CCLA 2GTQA 5IKCA 2JB5L 3SPVA 4YVUA 1JPSH 2YXVA 2JKXA 2O93L 4GRMA 5D2LB 5AFAA 5GZOD 3KPRA 3QORA 4KFZC 1J05B 4RRPM 5E99L 4ANKA 3SHSA 2ZCHL 5AW8B 5EUKA 2CIIB 3UERA 4W4OC 2EYTB 2NYZA 5CUSH 3M45A 2MCMA 4QRTA 5B1JA 3AFLA 4KK5D 3VXPA 3KXFE 3DPDA 3N43F 5FR3A 3VXSA 1OQXA 3BAJA 2C1OA 1FZMB 3NJGA 3PNRB 1XTMA 2Y5TB 2R4RH 3RDTC 1GS6X 2W0LA 4F2MB 1T2JA 2IDUA 1N2RA 3TV3L 3VCLA 2IV8A 1VRSA 3EW3B 4U1JA 2F8OA 5E8DH 2ZUXA 2GJ6B 3LPWA 1KBGH 1I85A 4OCYL 4OM1L 4K8RL 5E9NA 4A67A 1R9FA 2RCSL 5F3BB 3QI9D 4H2CA 2MKWA 4HW6A 4YC2C 2CDEA 3MRDA 4NM4H 4WTQA 1BF2A 4HKZB 4XVOA 3VXRB 4ZUSA 1YA5A 2Q7YA 3ARDA 3HVDA 4OGQC 4G6FD 4KZCA 4UOQA 4XPAH 2P24B 4G8GD 2FD6L 2YSTA 4XT1C 4TOYL 2FX8H 2X1PA 3WIIL 2WXNA 1F0LA 3IBOA 5I30L 3K72B 1NDGB 2ZKHL 2PCPB 1RMFH 5GZNA 3MODL 1AC0A 2VN7A 2JKRM 3PJSB 2CR0A 4MAUL 2RTTA 5HHPA 5D1QA 1QAWA 5DK3A 2Y06L 1IAIH 3QZOA 5T3ZH 5BOPA 5CEZH 3HE7D 1IL1B 2WKOF 4HIHB 3G6AA 4JDEA 5FOJA 1SDYA 1G5AA 5HGBA 2EILB 1FFRA 2NUTB 1CI3M 2JKLA 3ZMEA 2OMWA 3VI3E 4Y4KD 3ZZSA 2F7PA 5TFSH 5BMFH 5C0CB 3ARGA 4HUUA 5MP6L 5ABZA 3HNTL 2OV0A 5CJOH 4A7TA 3BEVA 3S4SA 3QDHA 2Z1PA 5IHWA 2XJKA 3IDYB 4DGVH 3QAZB 5I8OH 1GZQB 2YEZB 5ETUA 5B39G 1I7ZB 1TZHB 1FL5A 1U92A 3KBPA 2GJZB 5EOQH 5JO5A 1EHXA 2L7JA 1QSEA 3N0AA 1JPGB 5EU6D 1UB6B 4Y4FC 1QI4A 3FK3A 3SQOH 3SCMB 4AQZA 1LE5A 1D5ZA 4MAYB 5JQ6L 2HVJB 3AVEA 3G7TA 1A6TB 1V8HA 4MNGB 1G7JB 1OGTB 2WTRA 5HJGA 2XY2A 1KLUA 4S1RL 4LLWB 1CL7I 1FNLA 1AH1A 4QRUB 3VG0H 4KDWA 2CHXA 4HXBL 4FG2A 3VXTB 3OR6A 1UZ6E 4NOFA 4JPIA 4QXUH 3X1GA 1Y1DA 4NFBA 3ZQXA 4G6ML 3B37A 1CDGA 1KPRB 1U41A 1D9KB 4Q9BA 3RURA 4FZEH 4MQ7A 2GBTA 1E5BA 4JHWL 2P8LA 4JFPB 1CLVA 5A6MA 4I3SL 1TJGH 1WVZA 3QDAA 5IG7A 3O3BB 3AROA 4OD2A 2YSSB 2A4EA 1Z7JA 3KJ6H 3DX6A 3NSXA 4HJEA 1T1XA 3C6EA 3NK3A 3H0TA 4YDVA 1EHLL 1RULL 4Q6YA 3R8QA 4KQ3L 3UGXA 1NLBH 3O6FB 5TE6H 3VQMA 4GO8A 3NIFF 4RGOL 3VWKD 1ZDQA 2X40A 4DO6A 1FNGA 3D1MC 4I13B 4WJ5A 5ESVA 2AW2A 3D87B 2VO5A 4U1GC 2AVFA 1ADQA 1T04B 1ZTXH 3K6OA 2F1BA 2ARWA 2TAAA 1S2EA 3ES6B 3DJ9A 1I75A 5JZ7C 3MR9A 1DDTA 4LCUB 4XCFH 3U1QA 4DTGH 5FEBA 2A38A 1VJSA 3DO7A 4NGHH 4PH8A 5HY9A 2BCKA 5C0JA 2F5AL 1SJVA 4H0LC 5INCB 3O4LE 4UWQB 1T6WA 1BLIA 2JCCB 2EEAA 4OLYL 3QHFL 3W2DH 2FX9L 5L2JB 4J4PC 1QLFB 5JXEA 1IVTA 5C2UB 3LQZB 1IGTA 1PZ5A 3FCSB 4GPVA 4Z7WE 4G8EA 1CGVA 2X0VA 4PJGB 1RLBA 3MV7B 4U1LA 2NW2B 4MJIE 5FIEA 3ET9F 1KJ2B 3WS3B 2FGWL 4HPYH 4L29A 4OZGB 4OZHE 3WIFB 1IQWL 1IFHH 5EU7C 3EH5B 3EJPA 3P9LB 3T1FA 1ECZA 5K69A 1HT6A 1RU9L 4G3YL 2IBZY 3BGMA 3M07A 3Q7JA 5ES4B 2A74C 1M4KA 5SWSB 3SN6N 5KBLA 3FB6B 2V5RA 3QHZL 3BXNB 4GQRA 1S7TA 3U2SB 1GIGH 4WCYH 2YD9A 4M48L 1TT6A 4CSTA 2YRZA 2FBRA 4AVJA 3MV9E 2V2WB 2AHIA 1UG9A 4GQ9H 1TYEB 1F4XH 2ZXGA 5CJ5A 4PJDA 1JGDB 3TN0D 1TQWA 1IRAY 5J13B 1JWSA 2HG5A 2AAVA 3W81A 4IBTA 3P3UA 1BEYH 2VZSA 1H8SA 1X6LA 5TGBB 4UV4L 3DYPA 3R8BB 3REVB 3CFEA 4L05A 2YXMA 1KJ2H 2BZ7A 4GKSB 3FF8A 2HRHA 5IUCA 4NQCE 4PJEE 1KC5H 3FT3A 1AP2B 1FGVH 2BIHA 3GZQA 4M5ZH 3CX2A 5I19H 1OARH 3V4UH 1XXDC 3FCTB 3TJHD 2ADIA 4E9RA 1XGQB 5E8OB 1AFVL 3O8XB 4DP8X 5BS0A 4HT1H 5KSUB 3D39B 1W8EA 1ZJBA 5DD6A 4ZAKD 5C0RL 43C9B 1U8MB 2CXKA 4N28A 1J8HB 1XAUA 1UB5A 3NFPB 2VN5A 1MRDH 1XXFC 4GI8A 2VIRB 2ESVD 5GGUB 3WDJA 1BIHA 4JO5A 4XCYB 4F8NA 4Y2OA 5F71A 4FFVC 3QUKB 2FEJA 1E3FA 1ES0A 1P2CB 1N4XH 1ONQB 2C9QA 4XHJD 5F7YC 1FRGL 4Y19A 2EDMA 1ZJAA 3DX8A 5EZOL 2B4CH 2EUVA 4N68A 4XI5C 4MX7B 3BQUC 1P1VA 3VA2C 5C0BA 2JWYA 1PZBA 1UATA 25C8L 4JS7A 4R4ND 5CEZD 2W9EL 2BP3A 4HS3B 2YKLL 5ICXA 3KWUA 3T8XA 3GTTA 3CCHA 5T3XE 2BFVL 5FUCE 5B4MD 5TDOB 3QDJA 3WY1A 2ZWLT 5I17B 3CVHA 1F5WA 3ULAB 2H47C 2ZXCA 3QFDA 3KPSE 4MXWH 1TIUA 3P2BA 4Z18A 5TK4A 4BXSV 1M7UA 4XOBA 5JW4N 5KVDE 2VISA 3KPLA 4HGMA 3VYPA 4QRQA 5LLIC 1ESOA 2VW7A 1MCJA 2G0LA 4JFOA 1MCKA 3HJEA 1SZNA 3N0PB 4CSZA 2EVIA 2FEEL 4P2OD 3JVGC 2I60H 1QI3A 1PY9A 4NXKA 4GG6E 2AJ3B 4AYFB 3TJEH 1DLFH 3NVQA 5DHXB 1ICTA 5DHVH 2VQUA 4AMKL 3ATAA 1OWWA 2YK1H 1LO5B 4LF3B 4RMSA 4OB5H 3RNQB 4O9HL 3VI4E 4E9XA 1MFAH 1ID5I 4JRXA 3WJMB 4GT7A 5CD3A 5CEYA 1UM5H 3TS8A 4XVTL 1PTZA 2OMXA 2Y1YA 1BMZA 1A21A 5DJ8B 2X4RB 2BHFA 3TU6A 1UM6L 3CSPA 1TJIL 3F7YB 2W38A 1MELA 4B9ZA 4EBQL 1C16A 2PYFB 4C56A 1UJTA 2R4SL 4B7LA 4KJPD 2QQLL 5J6GB 4EVNA 2V2TA 2DEXX 1LD9A 2YBRB 4YAQA 1BYOA 5HGGS 3L3OC 1T5WB 1GYCA 4PJ9B 4IYKA 3SJVB 3MFFA 1RZFH 1UJ3C 4KGLA 5D7KD 1MFVA 4DKFH 3EO9H 3CHOA 1Z5LB 3L3DA 1IC4H 4LVOC 1R3HA 4WWOA 5EWIL 1J1PL 3CGTA 1TJHH 3D85D 9PCYA 4EZJA 4L3EB 5DURD 1JXGA 4PS3A 1FNSH 2FHFA 3EYVA 4MB1A 2NY0D 5T5FA 5B38G 5D7SL 4KMTH 2WBJB 1Y6MR 3MJWA 4LP4A 4G1MA 2R8SL 3FU5A 7FABL 5CM1A 3WG7B 4DJMA 4DOHE 3CZJA 1XGYH 3K2IA 3ROOA 3GI8L 5LGKA 4R2GB 1O5PA 3T0VA 2MCAA 2G2RA 1U9KA 1LO3L 1RUMH 3IDNB 3VGHA 2LVCA 4U3SB 4QXTA 4UM9B 5JHAA 4PYHA 3D4GA 4F37K 5SWQA 2FEDC 2NNCA 3P4MA 4J7RA 3JT2A 3FQXA 1IAOA 3H53A 5K33A 3BFOA 1H6EA 4ZUVA 2OQJA 1HL5A 4WO4B 5GGSA 4JG0H 4YGVB 5JDSA 4Y4HD 3PL6A 1EAJA 3DVFA 5HVHC 1F6AA 5F1IA 4HKJB 3W9EB 3N04A 4XO5A 2QADC 4NQEA 3UJIH 1DQIA 2OR8A 3MKGA 4LCYB 3LZOA 4KKLD 3SDAA 4YHYC 5DT1H 2EE3A 2OXGB 4FFZL 1OP3K 3EDJA 4PGDB 1OSPH 4TXVB 3A6OA 1J48A 3QO1A 5IQMA 5LN8A 3ASOB 4YHKL 2BRRH 2Q6WA 1D5IL 4PJHB 3M1BB 3MJ7B 5I8EB 2NXZC 3ARED 3F7VB 1KYFA 3ABKB 5LG1A 1DBML 1HSAA 4HKXA 4HU2A 4JKWA 1KCSH 4I0PA 4BIKA 3DBSA 1LO0L 1YEKL 2FIRT 1A4JA 3NN8A 5DZVA 1W72L 1W91A 2L3BA 4LP8A 4TVUA 4DGIL 4WW1B 4U1SA 1RJLB 5FUZH 1YSOA 3QPXH 5DLML 2ZOTA 4FQ1L 1ZVSB 4C83A 2EDKA 1PEWA 4O51A 1SLVA 5B39A 2VXVL 4DCQA 2NY1B 3HPJB 1AGFB 4BWWA 4M8VA 2W80C 4X98B 1FF5A 2YAOA 1J9QA 5KYXB 4KHTH 5BVPH 1BAFL 3SKJH 4Q89A 5CP7B 2Z9TA 2HLFD 2QQQA 2KLSA 4H1LB 2ZOKA 4N8CH 1WA1X 3VFRB 1R3LB 4JDTH 1NKOA 4Y1TA 1BQHG 3LDBB 4XNYH 4P2QA 3K2UL 1U8LA 4B9CA 3SOBH 1CL7H 1KFAL 1MZYA 4FJ6A 4PJBF 4K55A 2ATPB 1R75A 4K8RC 4P5TB 4JR9L 3Q1SL 1NFDF 2VDLH 4HXAH 4TV3A 2VAAB 3UMTA 3ULVH 2QQKL 2KLTA 4BK8A 1X4YA 4KNTA 5B22A 5KYUB 4F2EA 4ZW8A 1MLCA 4WLCA 2B20A 5EU5B 4JFFB 5IB5B 2IVFC 1E4WL 2IALA 3OV6A 1SXCA 4HZ1A 1E4KA 3QAQA 3TYGL 3OKNA 2CLRB 4DKDC 3POHA 5IW1B 4ZMZA 5D7JC 2EEFA 5H2BB 1CLCA 3GXNA 1TKWB 4S2SB 3DGDA 2WBKA 3RDJA 3I6KB 1ACYH 4H44C 1N7ML 5KYWA 1INDH 4HAFA 2AGJH 2NRDA 2QPDB 5F7EL 3NZUA 4F7PA 2PWEA 2IFFH 3DRQB 5CJQH 2NNAA 4EPSA 3VFVA 3ILQD 1CD9B 3G04A 2J55A 3OKMB 4ZFFA 1QLEB 4J23A 4PQXA 3ZTJG 1HKFA 1PY4A 4H1LH 3F12A 2FJHA 2VXQL 1MSPA 3MNVA 3BVVA 1V55B 3RZCA 2WXQA 1XHHA 4XBEL 1U8JA 3ABMB 3H7LA 2HX7A 3R06B 4ORZC 3SKOA 2HFGH 3UZQA 4PR5B 5I1EH 1GGBL 2X89D 3RWFA 2D2OA 1MWAL 3MACH 2YWYA 1KXVA 5LAPA 3MXVH 4A2GA 5F3HB 4AIOA 3FCBA 2ZAIA 2A6IB 4XB3A 1TCRA 3S8FB 3ZRCC 1WQVT 4QRPE 4YNYA 1I1AA 2JJTA 4M7KL 2BIMA 4ENZA 1KIRB 5BOZG 5DYOA 3CSTA 1EJOH 1XR9B 1EAOA 2UYLB 3GRWL 1FBIH 1C8QA 2BSED 3C12A 4JM4L 4JVWA 3CUPB 4TSCH 1XF5A 4WJKB 5T1LD 3KLSA 1RZGB 4OFVA 5DQ9B 2L8AA 4JFZH 5DD1L 1X4ZA 3T3MF 3IGAB 3GEWB 3HRZA 1A9EA 1JDDA 3DGGA 2NY2C 4FQJH 3RDTA 3FSZA 5HJ3A 1FAKT 3K0YA 1P0SE 1LWRA 1QLEH 2XX0A 4K5NA 4WTWA 1AE6L 1MEXL 1ZEAH 4TUKL 1J18A 3C87A 1CCZA 3DJRA 2LGNA 2O6EA 1NC4B 2H7WA 4L9LC 1NA8A 2DQGH 4MNQE 4QHLB 3WKML 1MQ8A 4Y1AB 1BP3B 1L7IH 5T33L 4TTGA 2K9FB 1YEDA 3RUGF 1MH5A 3HC3H 2AQRA 4J2QA 5DMJB 3KE0A 2H6PA 3T2NL 3ATEA 3KXFB 1SJHA 4PJDF 3VTMA 1TYRA 4AEIH 4YHNA 3DX2A 3TTSA 5HHMD 3D33A 3U0TB 1EFXA 1HC1A 5T1JA 1PKQB 3DSFL 5AZUA 3GXMA 5GGRA 1XF2A 5HDRA 2M1KA 1QFUL 4YDIL 4FQPA 1N6UA 5I74C 3GJFA 3G5WA 3HG1E 5CIPA 3MYZA 2WLNA 1A22B 5JOPE 2MOGA 5DMIH 3OKLB 1PZAA 4OD3H 5D1ZI 3ZZ1A 5DVOA 3UG5A 4RBPK 4PREA 3D4ZA 4AL8L 3GB7B 5HI4D 4JM2F 4MZRA 2XTJC 3OAWA 2H0FA 1MXGA 2FZ3B 2QPEB 3CLWA 5E00A 3LS5H 3P02A 3T6VA 3TBWA 2HH0L 1YRKA 5JHDD 5T1DH 5F8QC 1IGFH 4IMLA 1WIPA 4N8PA 5J7CC 1NFIA 2Q87A 3RTQD 3IF1A 2VUKA 3TBSA 2JJUA 2PO6A 1ITBB 2ZOLB 3DI2B 4KVNL 3CN3A 4AJVA 1VEOA 4UNTA 3KG5A 4XH2A 1AQKL 2K8QA 2AV7B 4Y4FA 4MHHI 1CLOH 1FAIL 2W95A 4A2HA 4P5KA 2F7IA 4M93B 1QYGH 1FIGL 4FHBD 5ACLA 3K71A 1TQCC 1EDQA 4R7NB 3UYRH 3KPMA 3VI3B 3K6SA 1W0WA 2CDGA 2FBJL 2J1KA 5DD5L 4CADA 3O45B 2XBZA 5I1GH 3BUYA 2ZUQC 4OCWL 4EJ1C 1CBVL 4I1PA 4PRHD 1BQRA 3KYKH 2DQJH 3PP3K 3E3QC 4YR6A 4A7UA 3PREA 3HCVB 4R96A 3WFEL 4Z8FL 5GJSH 4Q6IC 4AENB 3NPZB 3LQAC 1OCRB 4HH8A 4KAQL 3RWGB 2IPUG 4PWKA 2Y5EA 4KMQA 3MRRB 4HSAC 3RX5A 5B3SB 1NUGA 2GITB 3MJ8A 3PQYB 3O11A 3W1ZA 3SDYL 4PUBL 1BAWA 2Z8VC 1EH9A 1XL4A 2P5WD 5GS3A 3BESR 1FE8H 3BMVA 2GIYA 3ARVA 3GXUB 3HHMA 3H42L 3NACH 2JIXB 3E2HC 3FH5A 1JZ3A 5BPPA 1ACCA 3VXUE 3AXLB 5DJ0A 1YEJH 3D69B 4ADIA 2K78A 4WI7A 3ULVD 4A1RA 2PWFA 4NUJB 1PZDA 3MOQA 3OJDA 2R7EB 4ONGL 4HDIB 1YYCA 3SBWA 2O61A 5K39A 4IBSA 2Z31B 4W70A 3WV0A 3FB8A 1K4CB 4YHIA 2JK5A 5KVMC 1U4FA 3FO1B 4Y2DD 3QUXD 4JVUA 2C8NA 2O6CA 4OIBA 4X4MA 4J4PA 1YUHA 4F93B 4NKMB 3T6XA 1E5CA 3ARTA 1HEHC 1BFSA 4E9WA 1O7DE 4Z5RB 3GRBA 3GMPB 5MENA 4PRBB 1JWUA 2MRYA 1LQSR 2IH3A 1N64H 2CGYA 3J2PA 4F15C 4UU9B 3IJYB 4IEFA 4OVUA 2F53E 2B15A 3BD4A 5KS9B 1QBML 1QFWI 1OAYH 2I5YH 4YWGL 4ANXA 2DQCH 7PAZA 4G43B 5DVKA 3ECUA 4LCWD 2N1TE 3AMKA 4HZAA 3NJMA 1X5XA 2VMCA 4X8GA 2OZ4A 3ZKNC 2VLKE 3HMXL 5CBEA 5EU4A 1MAKA 2A74A 2ROXA 4RNRB 2EIKB 3PWNA 5FGBC 5JPMB 3ZK0A 4FOMA 2NXYC 3RWJB 3D52A 1JE6A 2VMFA 2XA3A 3B3IA 1CTMA 2ICWA 2PPDA 3V2AR 3V5KA 3MSPA 2ZF8A 5JOFA 1FV1B 1RUQH 4FLOA 4RVBA 2WHVA 5JORA 2TSBA 4LK4A 1A6ZB 5BZWA 1AR1C 1GZHC 2WXRA 4A6YA 1KIPB 1KLFA 1G1YA 2XX1A 4OZHB 2XG4A 1YY9C 3D2TA 2YHGA 1CO1A 2R2EB 3EO1B 1HOCA 1TITA 1VFBB 5F44A 5D8JH 4QNPE 3DPBB 1YAIA 3QZWA 2EXTA 5FYLE 3R7QA 3RL2A 5CMAA 3OAYH 5FOBA 5TE4H 1FZKA 5FCSH 3VFOA 2CK0L 1G7MB 1RIUH 1Y7VA 2WLMA 2BWQA 1FJ1B 4NO2B 4PGEA 1BOGA 2CO7A 2KPNA 1B0RA 3GHEL 1WLHA 1YEGH 3EG9B 1F56A 1Y6KR 3BW9B 3W0WD 1WBZA 2VDRB 3G5XA 1FORH 3P3RA 2GBUA 3QRLA 3RY6C 3TASA 1CFSA 4LFHD 3PY9A 2X9YA 3RWDA 4AM0B 4KNQA 2YXWA 5K59F 1T0NB 5DWUL 3UDWC 3OC5A 3QJXA 3S5LB 1E9QB 4X4ZA 1U93B 5IVNA 3V0AC 1Q94A 4BQ6A 3BP4B 4G7VL 5C8JB 4BK4A 5EO0B 5JDJA 2APBA 3CPLB 3MLWL 3P54A 2KPWA 4KUCD 2PP9A 1WYJA 5ALBH 1FP5A 5IQ7L 1KY7A 2BVYA 1GSKA 3LKOB 2O5XL 2XTLA 1C12B 3NQIA 4NQCB 4PJEB 1GC1L 3LRGA 3P9WB 3THMH 5EUOF 1CT8B 1AXSA 35C8L 2LHAA 3GXDA 4ZQTA 2AXWA 2HJFB 2OPCA 2WLLA 3BQUA 3HBQA 5JR1H 5CJ8A 4GRWF 1QFHA 4YL4A 4PVLA 5F9WB 5ISZA 4B9GA 1GXEA 4EN3A 3WFBL 4JVPA 5I76B 4FERA 1JI2A 2YMOA 1YUKB 2FSEB 1MJ7L 3HHSA 4BSJA 3H9SE 5FB8A 5AWNL 1BQSA 1MCLA 4Y1SA 1OGPA 3RIFK 2WD0A 3DTXA 3D30A 2LTQB 2BNQD 3VXNA 1V7NH 4OD1L 4Q52A 9CGTA 3HI1B 4XGZB 2W1NA 4I1NB 4ODWA 5JW3L 5FO9B 3CSFA 4OSUL 4QYOA 3MYJA 3S6CA 2OK0H 1YCSA 1JNNL 4KROB 5L88H 2IWFA 1E4JA 2JE8A 3JVGA 3LN4A 1CTNA 3GDCA 2Y69B 4HEME 4MS8D 3B9KC 4XNAA 3UH8A 3WFHA 4A7GF 4FG6C 2EEDA 3US0A 3MMEB 4MB3A 5KZCD 1CF8L 3OKEB 2F08A 4QHKJ 3FTGA 3EXLA 4AIZB 4Y9FA 5L4IA 1DEEB 4YX2H 1AQ8A 2QKSA 3DIDA 3LCYA 4LCCA 2WCSA 5D1QD 4UAOC 2R0LL 4ZPVB 2YQBA 4XWOD 1KJ3H 2Q2LA 3KPSB 3UTSA 5C70A 1HJCA 4EF3A 2XWDA 3ARSA 4L4TA 3F00A 2DJ4A 1S7QA 2EC9T 3P77A 1ULVA 3RPIB 4POZC 5DRZA 3FO2B 3L3KA 1J0KA 3ARGD 2X9WA 4MMXC 3U7YL 4O2FB 3L3OA 3GUTB 3BKML 3CDZA 3FRPB 4ELKB 3O2VL 4YHZL 1NBZB 1DFXA 4N3TA 3Q6GH 2ZX8A 1UJ3A 1IGJA 5BRZB 1VERA 2P1YA 1BD2E 2V7HA 2BHYA 5DJDA 3L7EA 1HE8A 3X2QB 4HPHA 1WUNT 1SJEA 2CO6B 2CQVA 4XPGH 3W38A 5FYKE 3JTSB 3WKQA 1NIBA 2X70A 3EOBA 4M5YL 4PSPA 1PCXA 2YOCA 4DN4L 3VU2A 4BUHA 4ZMPA 3CFQA 3SPHA 1X44A 1ZSDA 2C3VB 4QOKE 3TO4C 2APWA 2D3LA 3L95B 3L1OH 4XO4A 2H4EA 4UM8B 4N3UA 5T3XH 4HUXB 2O6PA 2J8UB 2P44B 2VNCA 4PVBA 1TVBA 3JV6A 4LHUG 2X9ZA 1QR4A 1D6VL 2HT3D 2VQ1B 3L4YA 4A2LA 4N87A 3QCUH 1EEYA 5LCVH 1E9OA 4N0UA 1S3KL 2ICCA 5J6HA 1HIMH 3JSSA 5KVDH 5L0QC 1QA9A 1R19A 3RL1A 5D6CA 3CC5B 4F7TA 1TQVA 4HAKA 2MPAL 1SJMA 2Y07H 1U3HB 3QEGL 3BLKA 2R29H 5F7DB 1VB9A 1XGTB 3LNFA 4PBDA 4ZG1A 2QELA 2BWDA 4DOHB 4FULA 1PDKA 3L4XA 4ODUA 4GUOA 4Z3GA 1U6AH 2AQTA 2XQ0A 4OZIF 3O6FC 1REIA 3H3KA 1SN5A 5ABDE 3NIFE 2J6EL 5AVYB 2VTFA 4L1BA 4BE6A 2LLLA 4WSKA 3M8OH 1YQVL 4HC1H 1KCUL 4NZUL 4YEEA 2HWZL 4PTTA 2H32B 3HPLA 1WBXB 4QWWD 3GMOA 4KOCA 4Y16B 4JZOA 1FZOB 1BZDA 4N9OB 3TCXA 3BUDA 3ZE0E 4EI0A 3QXDA 4ZZKA 5LDSA 3RFZB 5C6WH 2WSKA 1ILUA 1E27A 1M42A 1T3FB 3APNA 3N3EA 4NO0B 3V4PA 5C97A 4XAWL 5IOPA 3EUUA 5JXED 2RD0A 1BVKA 2WQXA 2DLTA 2X4QB 1DQJB 3NDZE 3UJJH 3Q3GB 1ODUA 4LARL 2TRHA 4LCIH 4LLVB 4RMVA 1RZIA 4KY1L 1ZY9A 5CR1A 1DVUA 3EYOB 3CG8A 3Q06A 4OBRA 1TEGA 4WFHE 3T6WA 2FRGP 1XIWD 3ROLB 2DOCA 4PGBA 4LRIA 4OIIH 1G7HA 2OMZB 2YN3A 1GAFH 5C0IA 1FFPB 4GYBA 3O4LD 4LBEA 2RFXB 1RHHB 4NQDA 2H32H 4CN4A 2AANA 2H0EA 4ZSOB 5HYJE 1MLBA 4OLWH 3UL4A 2DTSA 4X9BA 3HB3D 4HIPA 5D7LA 1AXIB 4TLSA 4MJID 2WUBH 3D0LB 1N6QL 1MUJB 4NXSA 1SXBA 2E27H 4PP1C 3OX8A 1E43A 1UZGA 4JDZB 5D4IA 5B7MA 2BS9A 4F8QA 4CVWA 2YGNA 4TPRL 2J25A 4TNFA 5DJ6B 5EZPA 3GEFA 4A37A 5AVWB 5J57B 1RHFA 3H9YA 5DA0B 2OS7A 4AL8C 2FJSA 3ZOAA 3IRCA 5B8CC 2XDHA 1RJZB 1AG0A 1WFMA 1J86A 3TA3D 4GH7B 1EGJH 2HT4D 3V0VA 1MNUH 2HA1A 5BS0D 1E42A 2UZXA 4PV9A 1A7OH 4MNHA 1NGZA 2MFNA 4G82A 2BS71 4OFYD 5KAQF 5KBDA 3TZVD 2X88A 3MV9D 4ZPTB 5GS0D 4J6RH 5KSBF 1CIDA 1MHEB 4PRAB 2DH3A 2VC2H 2YR3A 1DLHB 2HSIA 3AG1B 3ZVVA 4DHLA 4KKCC 4YXLL 3RNKA 3RWCB 1TZIA 5I6LA 3WUWA 4OCSH 4X42A 3T5WA 1PZUB 3EHBB 3F2LA 1YY8B 1YEIL 2XZCL 1QFWH 4GXUN 2NX5B 1ZWIA 3OM3B 1GR7A 4ONFL 2H1LM 3L17A 3IYLW 2XKUA 4MWFA 3HI6H 4Y19D 4J3TA 3DOSA 5J1AB 2KQMA 1A6UL 2MCPL 3IMRA 3FDWA 5KTEH 3TF7C 4P49A 5AYUL 3WY2A 3I9PA 1A7NH 3QG7L 3NJFA 4CU8A 1R5WB 4F24A 4KJQD 4FKKA 2HRGA 3NPSB 1A8JH 1LK2B 4M7JL 3CH1A 3QJSB 5ABAA 4PG9A 2AEQL 1EO8L 3BPCA 5GHWL 5L8LB 2FECL 5E1AA 1HAUA 3CDYA 2R0KL 3G08B 5CKGA 4E41A 3UTPE 4OQTL 2OYPA 1N0XL 4QKTA 3IGFA 2MIZA 4KTEL 1OT1A 1UOLA 1O9ZA 3FFCB 5GRJL 1NFKA 3X3GH 1LK3H 3ME0A 1JK9A 3D2UA 1MHHB 3LMJL 4DP7X 1KACB 1HHIA 2YQ3A 4RFEA 1LE9B 2EDNA 3D8MA 2R23B 1MCIA 4NAJA 5AKRA 4C8XA 2GFBA 2FO8A 4UQDA 3BO8A 3V4VH 3Q8EA 2EH8H 1CB4A 2R39A 3NFNB 4PS4L 1A4CA 4QRRD 1J5CA 1D5MB 4QHMB 3KLLA 1LXMA 2GVYA 4JRXD 2XWBA 4XNXL 3FT2A 3I6GA 1R24A 2EZ0D 4FLSA 3CFCL 5E0FA 5T3XD 4MSWB 3PP4H 1QSVA 4G8AC 2Q3ZA 4IBUA 3FOLB 1OO2A 1MPAH 5GRVK 3MRMA 5IBLD 4MNQB 5G4OA 4CC4C 4DVBB 3DVGA 2D7TL 4WEMB 3MLXL 3AUVA 3FUNA 2CNZA 4AE1A 3U83A 4J8QA 4ES8A 2VDRL 2QQNH 2J5WA 2BC4B 4B53A 5CINH 1KCRH 5DJYB 2BNRE 4JFYA 5AW0B 3NSYA 2O1AA 3DROA 5F89B 1I3VA 3CK0L 3VTTA 3HLAA 1WFUA 3CFKB 2Z3FA 1T22B 5HDQH 4E5XG 3HW7A 5I18L 4GW5B 4HETA 3Q1EA 1N68A 2WLJA 3RAJL 4K94L 3VXME 4P4RB 5KYNA 4QTIL 2RMNA 3EOYG 3LRSB 4JO2L 4JKPH 2WLIA 1X9QA 2DWTA 3DX7B 3KPRE 4FXKB 3V9FA 2VQ4A 4ODHL 2EADA 3I85A 3PHOA 5E6IC 1JXFA 5D1ZD 2FT8A 4XBGA 1CICC 3FU6A 3BKYH 5EMYA 1PG7H 4H8PA 1WITA 2EAEA 3OL2A 4YDJB 1ML0A 5JHLH 4N2OA 5H4ZA 5L2KE 5BOJA 2AZUA 2B1AL 3W9DB 2DDQL 4K71B 4Q6IA 4EI5C 2IDCA 4Z3TA 3WNJA 1R34A 3IPBA 1F18A 2AXJA 4M7ZB 4UIKH 5J1TC 4NQSA 3BLPX 5EOCL 3VW3L 2B59A 3FBKA 4H4NA 2AJXL 5ANMB 3UZVB 2IANE 3OVUB 3QDME 3ZDXF 4HBCH 4LRNH 3FUDA 4MA7H 2PYEA 3F6IA 3KVPA 4RESB 3V4LA 1OGAB 4YUEL 4Z23A 4BZ2L 4ZS7H 1HWHB 4NP4H 5IBUG 2PABA 3WSQL 4RGND 4CMMA 4PGJA 1HEZB 2Q3AA 2Y6SD 4RAUB 5DMGC 3VRJB 3B34A 1NAMH 1PEZA 3KLHC 3P73B 3RTLA 3PABB 3PDOA 5ESAB 1GRWA 4Q6KA 5IM7B 2ADFH 5LDUA 4RGMC 2EXYD 1FNAA 3AG3B 2GB2A 3IDIA 5BO1L 3MNWB 3TNNB 1A6VH 3K6FA 3IJEB 4BH7B 3HIZA 1Y18A 2F7QA 2J88H 4QYAA 3FU7B 1OHZA 1R3IL 2P5EE 2YA1A 5GGVL 5IMOB 4DH2A 1OCWH 2DF3A 2XKSA 1FNEA 1NCDH 2FTAA 3WNPA 3ZDZF 4I4WB 2EXWD 1BQLH 4DKEL 3GRGA 1OVZA 1RUAH 1DJXA 4GAYA 5DUML 4AUUA 3FQTA 2BX5A 5DO2D 1PLGL 1JXDA 1OZUA 4HCRA 1TSRA 3S34H 4YHML 1IKFL 5IWLC 1A5FH 3X1BA 1PJ9A 3Q8BA 4PJBE 1Q0EA 4G7RB 1KDJA 3BAEL 1EERB 4IDLA 2J2ZA 4LB8A 1NFDE 4P5TC 3E6HB 1M3IA 1LVEA 5FGBA 2D7MA 5C09E 2XQYA 3L7FA 1G9HA 4MD0B 3IMSA 1C5CL 1UD8A 4JO3L 4QXGL 5AW3B 4X7CC 1VGKB 2WWOA 2OW7A 4K23H 5ECGA 3WEAA 1GZHA 2FNWA 3QFJA 1HOEA 3QRBA 3QS2A 3B7YA 4NZJA 5L7XL 2F53B 3EJRA 1NCWH 2MTAA 3SO5A 1HXKA 1UWEH 5HDBB 2Z0BA 5BV7L 2WYIA 2PUQT 3C75A 2VDKB 1DBJH 4E9YA 4HGKC 3ECBB 5EG6C 1YPZF 4BSVB 1Q0YH 4F5CA 2R56H 2HKHL 3RJDA 3GSXB 3V8CA 3IMBA 1G9NL 3U6RA 5ITFB 1ADWA 4XO9A 1A3LL 2HFTA 3J8F7 1ZVYA 2J21A 3C09C 3LN5A 5I5IA 1E2WA 2ZKXA 3HS0C 3UBXA 3L6FA 1AHWB 3LYRA 5DJCA 2JKJA 3VB9A 4XWGH 3X14A 5E2TL 3WL9A 3DSNB 5CSGA 3K6NA 3RZCD 1CUOA 2D9CA 3LKRB 4PWJA 2GAZA 1OQOA 2XOTA 3MX0A 5EC2B 3ESOA 3WXWL 2YAFA 3V55A 2OL3B 3UDWA 2PXYC 2NZ1A 3EO0B 3PWPE 3QJOA 2CUAA 3QZNA 4BFRA 5GS1A 2HAZA 1VADA 2VLRA 3D51A 3JT0A 2IBGA 3ETSA 1FGNH 1JHKH 1H5BC 4P3DB 3LHAA 4MJ6B 1EBAA 2ZONA 5DUBB 3NRPA 5E24E 2WSDA 1SEQL 2HUHA 2UVEA 5FYJU 3SODB 4WAFA 1AGDA 5I15H 2XI9A 4JZJC 1NFAA 4G11A 1UZ8A 1JNLH 2HYMA 1A3RH 3U7WH 3UMNA 4QHNA 3TO2B 3GT6A 2VDKH 4KC3B 4WU5A 1MAMH 3PWLB 1R3JB 4I77L 4TQIA 2OSWA 3T3ME 1I8LC 3PGFH 2DBLH 3GHBH 4NPYA 4XX5A 1F45A 4PJ5B 4IRJD 3QP3A 4J3OF 4DZ8A 3U36B 1E4XI 1OK8A 1V27A 2PP7A 4ZO8A 4D0CB 1C5DA 3B3BA 3MBEC 3UBHA 1QFWM 2VDPH 2IDFA 4X6BA 1G6RL 3T09A 5F9JB 3JWDL 3NA9L 4P46A 1FN4B 4WQOA 1WT5C 4RDQG 4QRPD 1UQSA 1QNZH 5E94B 1JZ2A 4OKVB 4FFZA 3ZYZA 1JPTL 3ZL1A 1F8TL 5K1VA 3GMLA 2Z4QA 4PRPE 5DD0H 3RUGE 1A4AA 5E5UB 1T20A 3KL0A 3IFLH 4LIQL 4RZCA 3B9KA 4WKZA 2D03L 5FYLH 1U2CA 4MCMA 4PJDE 2WY3B 3DRTB 3N43B 1C7TA 5CGYD 5HYSB 2C4XA 5J12B 1PD6A 3DLQR 5DHEA 4IU2A 1V7MH 1EXUB 5KWYC 1A1MA 4IOIA 1W72A 1DQDL 5DK0A 1OAKL 3T4AC 1KB5B 4APQC 4NJAL 1TNMA 4M8QA 1HHKA 1IO4C 1MCOH 3QXWA 4NZRL 2ADJB 5IVXA 4EZMA 2O30A 2F8IA 2BVOA 4K15A 3VD5A 4Z7OB 1IC0A 4Y7MA 3BSHA 3I75A 2W0PA 4K5LA 4MMXA 1CTOA 3L4WA 4X7DC 4X99B 1RK0B 2Z0UA 1XV8A 4GW4A 2Q1EA 3KPNB 2NY7H 3WTVA 3RI5K 5AB2A 1MXDA 5EEWA 2DD8H 1KFGA 1R3KA 1S9VA 2AI0L 5FHBL 2PO6D 1K5NA 2COVD 2GK0A 4Z3FA 3AT0A 4NC1E 5E08L 1HTYA 1EWHA 4MKMA 2CO1A 3TT1L 3ARRA 5MI0C 3TVMD 5IJKA 5EZJA 3OGOE 3UGUA 4P9HL 4YBQC 4N6QA 2PW1B 3RVTC 3HG1D 2YD6A 3QC5X 4EXKA 1DBAH 1KBWA 3QIUD 1T2QH 4NNXB 4TRPL 5JOPD 3FF7A 4EUPG 3BP5B 4KRPB 1BZ9B 2OR9L 32C2B 4PJ8C 4E68A 3VWJC 1JZ4A 1KB5H 2XVLA 3HA0A 5AW9B 3S5ZA 4F8TA 1Z3GL 3OC8A 1HSBA 2F2HA 4U7MA 2WWMD 2XU9A 3GGWA 5FWRA 1L7TL 2HP4A 5HVWA 2E7BA 4JPSA 3BP6B 3H85A 1UA6L 4NC2B 1MVFA 1GA2A 2VE6B 1DQML 2Q9OA 3CZGA 4X6CF 2UVFA 1WG3A 1S5HB 2ICWJ 3ASWA 5HHQA 5I0YA 1FFOB 4AT6B 1Q9LA 2QR0B 5I9QB 5IT2L 5F97E 2BSTB 4MDJA 3M86A 3O0LA 4V1DE 1S7UA 4NDMA 4PV8A 2Y72A 5JA9A 5I1JL 1DSFH 1WO2A 2EDQA 2N7BA 1OANA 2IAMA 5EBLB 1NIFA 2Z91B 3QS3A 1U8KA 5E4EB 3C5ZB 1C7SA 3GMRB 4XB7A 5IESH 2BOLA 4XC3H 1MWAA 3T8VA 4N20A 5I1KH 3OAYK 1YAZA 3RB7A 1ZS8A 1IC5L 3FRUA 4NNPL 3ARFD 1CFNB 1S7RB 1BXUA 1G7PA 2MNUA 3LXCA 4YBHA 5DZJA 1IEHA 1IBBA 1QLRA 3VVVA 3DYMA 4CNIB 1IC7L 1IGYA 4XP5L 1K9TA 3EGSA 3GRWA 1YMHA 2CUHA 2IGLA 4FFYL 3APDA 1GS7A 1P7QB 2DRUA 3X17A 4LSQL 4LL9A 4J6IA 1NEZB 2P8MA 3EOAB 3F6LA 4H8WL 3RU8H 2PTTB 3TBCA 4UI2A 1JN6A 1T1ZA 3A4FA 1NMCB 1CFTB 3AAZA 3NIFB 3WHXA 4GKLA 1M57B 1WAPA 2GSIA 5LUMA 3U9PL 3GSOB 1C1EH 5HPMB 2VRQA 1FYTA 1JYWA 3VXUD 5FYKH 1QOKA 2WQVA 3QIWB 1WZ1H 3L45A 2VH5L 3BUIA 4CL7A 4FHKA 4OIFA 4WWKD 4KTDH 1CGSL 3PFQA 4K3DH 1BX2A 1L9MA 2AEPH 3HC2A 2W65A 1S7SB 5J4MA 4DWHA 1GW0A 2ED8A 4J3BA 2HN7B 1A2YB 1E9PB 4WFGE 3EAKA 3LN9A 2C9UA 2MH4A 1BJ1H 3TNMA 5LBSA 5KAQG 1VKXA 4JMXA 3MUHL 2BCMA 5B1KA 3QQ9C 4GMSH 4R7XA 4DZBA 1TU2A 1N3NA 3H56A 3ARWA 4H40A 5FKAA 5KW9H 5E9DA 1JL8A 1NM9A 4F20A 2VR5A 4BZYA 3UBFA 3FB7B 4S1QH 1EDYA 2F9BT 3HAEG 3ZYIA 1V3KA 3NJIA 2WLKA 4FTVB 3QPQC 3FB5A 1CGTA 1QUNA 4A7SA 2VLKD 2PPEA 2X38A 1ZT7B 1X9RA 3NYKA 1DVFC 2IDSA 1NCJA 1IM3D 1DN2A 5CSZA 1IIKA 2A6DA 5B8CA 5L6YH 2YJQA 2FO1A 1NOFA 4Q7DA 5C0EA 5E4OA 3V5HB 1FG9C 3MV11 4HEPG 3MCG1 4LEXH 5HYJB 4KI1A 3ZYOA 5E1HB 5ICUA 1K8IB 1XBDA 4FNQA 4GMTH 4CDGC 2X4TA 5K59E 3BP7A 3AQYA 1NEPA 1IAIL 2O5ZL 5CLXA 3DV6B 4AXWB 4D0BA 5CEZL 1G7LA 2DLIA 1CDIA 1QVOB 4GQPH 4XMXA 3MRPB 5IHZB 5K1NA 3IXAB 3ISYA 2A6JA 4JX0A 4M1DL 4K94C 1U21A 5AD0B 5DEFA 5GRWA 4ADGA 2LR4A 1EEZB 3IFNH 2ZUUA 4XNUH 4AQAA 5E5RB 2Q7AA 4YHPA 5FYLD 5JUEL 5TFSL 3SDXF 5DRNA 1QMUA 3JUZA 4WK2B 3SKUD 4X83A 5EUOE 4Q4IA 4FL4B 1MHPH 3KYOB 3PJLA 1QTSA 1WFOA 2GT9B 4PRIA 5I8OL 5E56A 3LD8C 5AOZA 5ICYA 4EQ2A 2WBXA 1J0YA 1UOWA 1MN4A 4RIRB 5J1SC 3VM7A 4FJYA 1KTLA 3QDGB 1NCAH 2QGDA 2WQAA 3U9UA 1RCYA 2VRKA 4P3CH 4BKSC 3IDMA 4LL4A 2NLJA 3B2PA 5GPRA 4CVXA 3MGTA 3V95A 4JRFA 5IB3A 3MN8A 4GXFA 4ENED 5C0AE 1DBBH 4FNLL 1GW6A 4CU7A 1T0MB 5SV3A 1RZ8A 3LH2L 3JXAA 4KO7A 2K7PA 4XZUB 3R4DA 5C6TL 4DEPC 5HI3D 3D18B 3WIAA 2P80D 2R1WA 5DYFA 4DETA 4O5LL 4UQIM 3QQ4A 2XRAL 5EULV 5MEOA 1BGXL 2X4SA 4TM9A 3ZJAA 1J1XL 3KJ6L 5IEKA 5F7AA 3SDCD 5C0NC 3NH7H 1AI1H 4XN5A 1MVYA 2VABA 4PTUB 2GJJA 5CGTA 2NY4D 5C9KA 3H9SD 1NSNH 2Y1AA 3Q48A 1NLBL 4KK6C 1U3ZA 2FX7H 5F1OB 5BZZA 2G4EA 3UTTE 2MHAA 4WI4A 3HE6A 3VMNA 4X5PA 3VB8A 3ZKQD 5FO7B 4Y9BA 1J1OL 1EEUA 1ZTXL 1UXSA 3PWUB 4ZUUB 5BRQA 3U4BH 4HH9A 2ENPA 3MLVH 3MGOB 2F6AA 5HHOE 1J0IA 1VAHA 3L5WB 3QO0A 4P4KB 4HCIA 4UYPA 5BVJA 1HQ4B 3HMXA 4WFEE 7PCYA 5I8KH 3W2DL 3NCCB 2OL3L 3GBNL 5C08A 3X11A 43CAA 3IGLA 3CU1A 1BJ1J 2J72A 3UYPB 2CKBL 4HFUH 5EEUA 4QY8A 4KKQA 1Z0MA 3EOTL 1UM4H 1AD0A 3MRQA 2WYZA 4YSRA 2HJLB 3K4DA 2GCYA 3F83A 5I8CA 3CZSA 4HPYL 4L8CA 1ZXQA 1BXXA 2D31B 3X13A 4KJYA 3VDCA 1TLMA 1CICA 1KXTA 2WVVB 3QYCA 2IJ0C 3NZ8A 4PJ7A 1IJ9A 4WI5A 5DEGA 3DX9B 4JFDD 3H7BB 4GSDL 3VYOA 2BNRB 3NP4A 3UIYA 4YPGA 5BV7C 4KO5A 4PJAA 3WKPA 3HNVL 2ICEA 1S9WA 3BPLB 5MHSE 1D7BA 3DARA 2QVIA 4X4YB 3JTTA 1G9NC 1ASPA 2ARJQ 3K4AA 3O3EA 5A3IC 1GIGL 5BZDB 3HBGA 4Q0XH 5FGRA 5IKCB 3QUML 3D07A 3IJ8A 2AQPA 5IB1A 2APVA 2EO1A 1BD2D 4GRMB 3TEXA 3KPRB 3QORB 5GZOC 3H3PL 4HIXL 5EUKB 2CSPA 5FYKD 2XWEA 4OZIE 1AACA 4I5BA 5FM4A 4HLZG 3VXPB 4KK5C 4PD4J 3HUJA 2VW6A 3L9YA 4QOKD 5BW7A 2VDNB 3L9RA 3VXSB 1HWWA 2X53A 2C1OB 1BEYL 3NIGF 4KVCL 5E9AA 5L2KB 3CVBA 4AC2A 1NCCH 3MUY1 1N2RB 1HNYA 5KVGE 3HBZA 3VFTA 3VCLB 5F8RC 4FZ8L 1Z9LA 4H20H 4JFSA 5KVFE 2GTZA 4ZD3L 3OLEA 4M5ZL 3IMTA 2NY5H 5I19L 4NRYA 2NT0A 4LL1A 4LHQB 3QI9C 1MFBH 2CDEB 1YVLA 3MRDB 4N8VB 3QDMB 3DOIA 3ARDB 4ZUSB 5T1MA 5ESQA 5EA0H 5F88A 2UX6A 1ZIAA 2G2NA 1NKGA 2HB0A 3Q05A 2HZHA 3N2JA 3DBXA 3Q8CA 1ZDSA 1MRDL 3VD0A 4LT7A 1B2YA 3WE6A 2EE9A 1BM3L 3ZHLA 3HFFA 5I16A 5IWLA 3AADB 4M7LH 1LDSA 3PG2A 1M1SA 4NLHA 1WRFA 1TYJA 4ZO6A 4BFFA 3B9DA 3QULA 4P06A 1PZ2A 3O41A 4XPHH 3JWDC 3V6FA 1LEKA 3DA0A 1UKSA 3HE7C 3G6AB 5D96C 2FBOJ 4D0DA 4JDEB 5HVFB 4XNMB 5E2WL 3CVIL 5HGBB 2Z7YA 1T66D 1J0JA 4UZGA 1XZWA 1IE4A 2OMWB 2FJUB 4Y4KC 4HUUB 4UBDD 4ZTOH 3MZTA 3BEVB 3S4SB 4GQZA 1EV2E 3MOAH 1XH2A 3ZZQA 2Q8AH 2PTVA 2R0WL 2GI0A 3MCYA 2NQ3A 4UT6H 3P2DA 3LOWA 4W4NA 4PWGA 5ETUB 1C9SA 2DYPD 4GKNB 3LS4L 1FL5B 1U92B 4X0KA 5JO5B 1L9QA 1EZSA 3S37L 1S78D 5KUMA 1QSEB 1GKOA 4PJBB 2XWRA 4X7SH 1AGBA 1M7XA 1Z3RA 3T0EB 5IROD 3PIQA 3RX9A 4AI7A 1D5ZB 1A25A 1N12A 5C09B 3PYCA 5DDHA 3BX7C 2D7NA 2WTRB 1KLUB 1N8ZA 3HS0A 3MLSL 4WFHD 1WICA 3P3SA 4LKCB 5FW6A 4OB5L 2EIEA 1MFAL 1KEMH 4U2YA 4XXCC 2FATH 3OR6B 4JPIB 2YMXH 1BBDH 4RRPG 5ENWA 1U3YA 1UM5L 1HL9A 4J3OG 4HD9A 2DYSB 5HYJD 2A9NL 3SE4C 1DCLA 5KSBE 2LFGA 4QF1A 2CRMA 5E6ZA 1ND0B 1H5BA 4MQ7B 3L2MA 5HGHA 2F1EA 2DM2A 4TQPA 4P9HC 3FU9A 4WNJA 1ASOA 1JZ8A 2OP4H 4RMQA 5IG7B 4OD2B 4TNWK 4JZJA 3CPUA 5GS2H 3C8KA 3T6ZA 1T1XB 3L3HA 2BINA 3H0TB 4YZFE 4YDVB 1CBJA 2I32A 4YHLH 3IU3A 5C3LD 1QWUA 2EKSB 4LVEA 4DKFL 4K9EH 3EO9L 3HZYB 1IIIA 1FNGB 2X3AA 2X6AA 4WJ5B 5ESVB 3VWKC 1RAMA 1P4BL 1I8LA 5EU7E 1TJHL 1X5LA 3RVXD 2DQIH 1AS8A 5L4MA 3OHXC 4NSKA 3NAAL 3MR9B 1KPUB 4H5SA 5F96L 1PFOA 4E41D 2YPLA 3DO7B 1VACA 5HY9B 2YGQA 3V6ZA 5AVQB 1AO7A 3G6DH 4I1RA 3AABA 1ZANL 1I8IA 3ETTA 2LU4A 3BYYA 2K70A 1WT5A 3BVDB 4N5ED 3MO1A 4EXPX 1IGTB 1GJWA 1QTYT 2NNRA 1NGPL 3GBML 3HAEA 1F3RB 4G8EB 1Z5YD 4L5FL 4U1LB 3LPOA 3UZEC 3M1CA 3OD3A 3LEYL 3EYFA 4ECNA 1ZT4A 2ROYA 3BKJL 1OAUL 3D3VA 3T3MB 3ULUD 1ZGLA 5AAPA 1NMAL 5DC4B 2HKFH 4KKPA 3T1FB 3APFA 4HFWA 1I82A 5IIEB 2XTSA 3CDGA 4QKXB 4NFDA 5LKNA 3BGMB 3PUCA 4HCGA 3T4AA 1LJMA 4APQA 1YECH 4N86A 3QRGH 2Q10A 1KCBA 1F02I 3A4EA 4JFEE 1T5XA 2Y7OA 3UTPD 4L23A 1S7TB 3JWOL 4MVBD 3QWOA 2OAAA 4H8WC 3ZT5A 2XYCA 4XP6L 4OF7A 4HWBA 2BRRL 1FDLH 3M6DA 3RUGB 4PRPB 2HPTA 3I9GH 2VJXA 3NSFA 1KCSL 4R3SA 3C5JA 4IJTA 4QXVA 4FKHA 4I2XE 3KPOA 4PJDB 3BZ4A 3TN0C 1JWSB 3K8KA 4OF8A 4KITB 3OZ9H 1U8OA 2HG5B 1R6VA 5FUZL 3TBYA 3V0WH 3Q2CA 1UCBL 1N0LA 3V7MA 2J4WL 3ZDYF 4BQ9A 3K5RA 3VFWA 5JMRA 3FHAA 1EMTH 1SN2A 3ALPA 4IDJL 5GRUH 3UEQA 3CFEB 4KQ0A 3DXAA 3WYRA 4OZ4A 5EDXA 4AK1A 3FT3B 4G80A 3H6JA 4F9PC 5G4NA 3D25A 1LEGB 3GI9H 4R97C 4R7LA 1G9ML 3D0VA 4JDTL 4BDVA 3WY4A 4JM2B 3TJHC 2CHNA 2X2UA 2YD3A 3GIZL 4X7TA 3KWXA 5DD6B 1CL7L 1DVYA 2DQDL 3FYEB 4ZAKC 1I8UA 8FABB 3TIEA 1UB5B 4FF9A 2VDLL 4D9QE 2OJ1A 4JB9H 5GISH 5TQ0H 1KEGH 1KTCA 4M6OL 5CLYA 1T1WA 2AV1B 2B2XH 3S7GA 1IU1A 2XIDA 4Y2OB 4DKTA 2XN9D 3WMPA 1SUHA 2J1WA 1TZAA 4Y2NA 1ES0B 1EDHA 1EVUA 4XHJC 1MQKH 3O9WD 3NGBC 1BM7A 3VXMD 3ZDXE 1WA2X 3BH9A 2NY3D 2E8YA 3VH8G 4XVJH 4KK9D 2BOCA 2BSSB 5C0BB 4KZDH 4H0GA 5H94A 3STLA 3IRZA 4R4NC 5IMLA 3CE1A 5ICXB 3T8XB 2WAHA 5CLZA 4Y9GA 3EYUH 3IE4A 2QLYA 3QDJB 5B4MC 4Z9KB 4CMHC 4W9KC 1BIIA 4FQ2H 3QFDB 3KJ4B 2DLEA 5I23A 2VISB 2VLJE 4WDIA 3GSNL 5DJAA 4QRQB 4KZ0A 3J27A 1HVXA 5KEZA 4JFOB 2QLVB 2Q20A 4P9MH 4C4KT 2AJUH 2IAND 4P2OC 2HFGL 3WOVA 3UAEA 5GIRA 1JGEA 3RGVA 1BJ8A 4HOZA 5EV7A 4GJTB 4IS6A 1CGUA 2DL9A 4OJFL 4C4KO 3QEQE 2EH7H 4KRLB 3A0OA 4DAGH 4YDKH 4J1UA 4OQTA 4LHUD 1WS7A 5CD3B 1JZ7A 3D9AH 3U79A 5CEYB 2B3RA 3QJFA 3R4RA 5LGHH 3WS6A 1FBIL 4EOWH 5C2BH 2OMXB 4TSCL 2K6ZA 3WEOA 1UH3A 3FQYA 4NZDA 1MDAA 2XLLA 1NMBH 2HVKA 2VSKB 4JFZL 4WFFE 4URKA 1C16B 4C56B 2V2TB 1U95A 1YNLH 4EVNB 4KJPC 1FUNA 1LD9B 1KGWA 1GOGA 2WVUA 4FQJL 4YAQB 4JJHA 1ZSHA 2P5ED 2Q8BL 4P23D 3II1A 4LOUD 1H19A 1LO4L 1QP1A 4HJTA 2FO4A 1E40A 4W9IC 4X9IA 4RAVA 2WB1A 1KLGA 1NC2A 3MFFB 1AYOA 4K7PY 5CCKL 3FT4A 3HI5H 4POYA 1N5YL 3WGUB 1R3HB 1P7HL 1YPZE 1A9BA 5B3JF 1RZJL 1F1DA 1SOKA 1WEJH 3EYVB 5F6HI 2NY0C 3EH1A 4G1MB 5I6XB 1EO5A 2XN1A 4IRSD 2WXIA 1DVFA 2NUPB 3KHQA 5J11C 5E2VH 3T0ED 1KJMB 3COOA 4NO3A 4B60A 1NBQA 3ROOB 3CTTA 1ETZB 1X9LA 1YMMA 2G2RB 2Z92B 4LDOB 4F57H 1GOHA 3LHPH 5JIDA 4L9DA 4QXTB 1JGUL 5SWQB 2R59A 1JVLA 3P4MB 5FUOH 3U7AA 5JLZA 2XVGA 3CLEL 1NCBL 2VDNL 3CSBA 3FQXB 1IAOB 2UZYA 3E8VA 2VLRD 2VXTH 1PIGA 2V0AA 1F4WL 4ZUVB 2XZQL 1ZK9A 2OQJB 3KBFA 2O5NA 2A9BA 2WXMA 5GGSB 4OD3L 4CGUB 5JDSB 3PL6B 3U1PA 3MCLL 4Y4HC 4MMYA 2IBZX 1F6AB 4CUCA 5F1IB 4B96A 4UTAA 1F4HA 1KOAA 4NQEB 2D4FA 2DY2A 3GK8H 2XPYA 4LLMA 1P6AB 3N1MC 5CZXD 4FXTA 3LS5L 3BRDA 4I18A 3SDAB 3WXVH 1HESA 4KKLC 1VGEH 5T1DL 1W2KT 4MCNA 4LSTH 2V33A 1B4JL 1Y07A 3CV5A 1GGCL 3QO1B 2CO3A 3MBXH 3EGXA 5LGJA 5EF1A 1MCDA 3JWNG 5D2NC 2PWGA 2NY6B 1NEUA 3AREC 1KT2A 3C2AH 1N6VA 3MRFB 1HSAB 4HKXB 2EYRB 2J12B 5M94B 4I0PB 5IFHH 4RSYA 3I6SA 3E8UH 3NN8B 4H2AA 4X8JA 3PWPD 1NICA 3LKPA 4U1SB 1I53A 5DUPH 5DGQA 2MNWA 3S48A 4JZNA 1THAA 2QGBA 3UYRL 3QUHA 3NZHH 1U8CA 3B2VH 5B39B 4Y5YC 3VYNA 5I1GL 2F74B 4U1IA 4GSXA 1AY1H 5EIIG 3WNIA 3BPOB 4XC1H 4BZ2A 3B5TA 4OZFG 1O9VA 3BEWB 4ELMA 4E9VA 3SZKC 2H3NA 2VDQB 4CW1A 1OAXL 2AK4A 4FQXD 3QEUA 4X6FB 3SPIA 1CGYA 4GRWB