1NIEA

The structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
333
structure length
333
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase (nitric oxide(a))
molecule keywords NITRITE REDUCTASE
publication title The structure of copper-nitrite reductase from Achromobacter cycloclastes at five pH values, with NO2- bound and with type II copper depleted.
pubmed doi rcsb
total genus 86
structure length 333
sequence length 333
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nieA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nieA02
7PAZA 3SBQA 2YAFA 1ETJA 1J9RA 1TEGA 2R7EA 1JZIA 1CC3A 2GBAA 1AAJA 2B3IA 4AKQA 1UATA 3UAEA 4HAKA 1W6WA 5PAZA 4DPCX 2EIKB 1N68A 1JVOA 2AFNA 1AQ8A 1KBWA 4A68A 4BXVA 2VM4A 1AZRA 1IBZA 3QQXA 3X1NA 4QKTA 1L9QA 1MZYA 3X1BA 5F7AA 2OCCB 1NIBA 2DV6A 4AKOA 1A4CA 1NIDA 5EHFA 4HCGA 3UADA 4GP8B 1YLBB 2JFCA 1BXVA 2N0MA 4DP4X 4GP4B 4KO7A 2I7OA 3TBBA 3NSYA 1PZBA 2GC7C 2J57A 3T6ZA 4FA7B 3PAVA 2BP0B 4FAAB 4G70B 3DTUB 2IAAC 2UXGA 1A4BA 1BQKA 4NB7A 2GC4C 4E9VA 1ILUA 1AZBA 1ET8A 2DYSB 3JTBA 5PCYA 3NP4A 4DPBX 4E9WA 1W6LA 1TKWA 2FT7A 2X87A 3FPYA 3PPSA 4YSTA 3T9WA 1EZLA 5B7EA 4HCFA 3H4HA 2MTAA 4E9YA 3WNIA 2BWDA 4MFHA 1X9RA 2VW7A 1AZUA 1OF0A 4AKPA 1A3ZA 3AZUA 1OCZB 1T5KA 4BWWA 3PLYA 1OCOB 5B1JC 5B1KA 1ASOA 1CURA 1NIFA 3V9EA 4M4RB 2PPFA 5I28A 4DP6X 3UACA 3WG7B 2DWSA 1J5DA 1GS7A 1GYCA 4TXVB 1E30A 3FT0A 1NIEA 2FT8A 3N55A 1BEXA 2YAOA 2BP8B 5I5JA 1DZ0A 2IH8A 3WNJA 1RCYA 2UX7A 1SNRA 2YAQA 3S3BB 2LLNA 1BAWA 4G72B 1OE3A 3X1FA 3JT2A 2GI0A 2XV2A 4PCYA 1PY0A 3T6WA 1NDTA 3D12B 2XYBA 4PAZA 2ZWNA 3FSZA 2QPEB 2FJSA 1BQ5A 1A4AA 3AG2B 2UXTA 2XXFA 2FT6A 2IDUA 3NJHA 1AZCA 3C75A 2WO2B 1BXAA 1JERA 2HZHA 1NINA 3TU6A 2J5WA 2CCWA 4BWTA 3FS9A 2QDVA 1GS6X 2HXAA 1SDDB 2DWTA 3EH4B 1RZPA 3NJGA 1X9UA 3CG8A 1AS8A 1V10A 1PAZA 4A2DA 4YSPA 3AG1B 3OD3A 4GY4A 3ABLB 2WO3B 1AS7A 1ZIBA 3KW7A 4E9QA 2XXGA 2YQBA 2VW4A 5I6NA 2AANA 2BZ7A 2Y69B 1JZHA 1PLAA 2H5UA 2X88A 2BZCA 2CUAA 1MG2C 1W8EA 2CALA 2VMJA 2IWEA 4N4YB 4AI7A 4WTQA 4HIPA 2CBPA 5I5IA 3AY2A 1N70A 4UF7C 4G7SB 2PP9A 1ADWA 2P80D 4Q89A 4DPAX 4DP9X 2BP0A 4KNSA 2PPEA 5B1AB 1KDIA 1V55B 5I6PA 3X2QB 4KO5A 2BO0A 1R1CA 1WA2X 2W88A 2I7SA 2Y1AA 1PNDA 1XB8A 4M3HA 2PCFA 2H3XC 1BYPA 2VM3A 3FQ2A 2XLLA 1XB6A 7PCYA 1A8ZA 1M56B 2EILB 1JXFA 1AANA 4RH4A 2PLTA 1ASQA 1PMYA 1PLBA 1WS7A 4JHVA 4KO6A 5B7MA 1BXUA 1OE1A 1ZIAA 2PP7A 4AX3A 2UXFA 2GSMB 3TASA 3FQ1A 2YAPA 1IC0A 1SFHA 1QLEB 2XX1A 4K9JA 3AG4B 4L0PB 1F56A 1NPJA 3OMAB 2IWFA 3FYEB 1KYAA 2YAEA 3FPXA 3IE9A 3QJTB 4BK5C 2HX7A 3NSCA 4KO9A 2BP8A 1HAWA 4HZ1A 4NAJA 3T6VA 2BWIA 4BXSV 3GDCA 3T6XA 3IN0A 4E9SA 4YSOA 1J5CA 4BDVB 1SJMA 4HHWA 4GP5B 5I6MA 5AZUA 5ANHA 1JZFA 4W1TA 5B7FA 1BYOA 3NJNA 5D4IA 3NSFA 1L9OA 3PXLA 1WA1X 3QJRB 1FA4A 3OMIB 2IDTA 1AACA 3FU7B 3PAZA 4ENZA 3MBWB 9PCYA 3ASNB 3N2JA 3U25A 3ZX1A 2PPCA 3S8FB 3NSDA 4UANA 1E65A 2GHZA 1ZDQA 1MG3C 2QT6A 3UGEA 1BQRA 5IY5B 4WKXA 2IDQA 1A65A 2NRDA 2PP8A 4YSDA 2J55A 3KW8A 4EF3A 1PZAA 1NIAA 2FTAA 4GYBA 3EH3B 3UABA 6PCYA 5FC9A 4YSQA 1KBVA 4YSAA 1OE2A 4UAHA 4KNUA 1JZJA 2TSBA 1KV7A 5I26A 3NT0A 1L9RA 1NZRA 3NJJA 2WSDA 2EIMB 2XV0A 3EF4A 3QJSB 1AR1B 2YAHA 2PCYA 4DP2X 4W9ZA 1GS8A 1QNIA 1ILSA 2RACA 5D4JA 3TA4D 3SQRA 3SBPA 4YSSA 1IUZA 3CDZB 5D4HA 2CAKA 4NERA 1L9PA 4F7KA 3V9CA 1J9SA 2FNWA 2HX9A 3QPKA 1ET5A 3TBCA 4YSEA 1MZZA 4DP8X 3NP3A 4A67A 1ZPUA 3FU8A 1GY1A 3WKPA 4X4KA 1CYWA 1OCCB 3IEAA 2JKWA 4DP7X 4E9TA 4N8UA 1HAUA 1JZGA 1PCSA 1J9QA 2YAMA 3G5WA 2XU9A 2ZONA 3GYRA 4KOCA 1MDAA 1I53A 4YSRA 3ABKB 3FU9A 2XUWA 2EINB 3EHBB 1M9WA 1ZDSA 2TSAA 1M57B 4F2EA 5I5MA 4G7RB 1GR7A 2B08A 3T71A 4CSZA 1RZQA 3ZIYA 2FWLB 2VW6A 2DY2A 3ZBMA 3CZUB 2ZXWB 2I85A 4G7QB 1V54B 2GB2A 5B3SB 1NWPA 2H47C 2IH9A 2JXMA 1XB3A 1B3IA 2VN3A 2E86A 1NWOA 2FQDA 3CVDA 4QLWA 4YSCA 4JHUA 3UAAA 1GW0A 1ET7A 2YARA 1E5ZA 1NICA 3FQYA 3ERXA 3MX0B 1EHKB 3HEIB 3PAUA 2Q9OA 2BHFA 3FSAA 4BDVA 1J9TA 5A7EA 2QPDB 3WKQA 4A2HA 1CYXA 1HFUA 3S8GB 1JVLA 2R7EB 3IBOA 1KGYE 4DP1X 2CJ3A 1XMEB 2IWKA 1KCWA 2VSMB 4YSUA 1WS8A 2XX0A 2DYRB 3FU7A 2AZUA 2XWZA 1JXGA 1AIZA 4A2GA 1PLCA 4P5RA 2YXVA 3NJMA 1AOZA 1KDJA 1KCBA 1E67A 3FSVA 4G71B 4DP0X 2BW4A 1PNCA 4DP5X 1JZEA 1RKRA 4KNTA 5LDUA 3HB3B 5TK2A 3X1GA 1FFTB 3ABGA 1AZNA 1GSKA 1ID2A 8PAZA 3S3CB 4HALA 2FQEA 3H56A 3GXUB 2PPDA 1NPNA 1AG0A 2VSKB 1URIA 3FYIB 5TK4A 1WAEA 4HHGA 3WI9A 3OM3B 4A2FA 2FQFA 1L9TA 4BWUA 1DYZA 3NJKA 1SFDA 1SDDA 4GXFA 3CVBA 4CSPA 1WA0X 3S3DB 2P80A 2UX6A 6PAZA 3CDZA 3ASOB 3PCYA 2BW5A 5B1BB 4A66A 1IBYA 5I6LA 3BVDB 3RYMA 2HLEB 3L45A 1SF3A 2IDFA 1FWXA 1SHXA 1TU2A 2OV0A 3EH5B 4Q8BA 3DKHA 1JOIA 4E9XA 1OCRB 1OV8A 2HX8A 2IDSA 2PPAA 3FSWA 4E9RA 2AVFA 2HRHA 3ZDWA 3IN2A 1TEFA 3X1EA 3H4FA 4P5SA 1E5YA 3QJQB 5B1JA 2A3TA 2UXVA 4F2FA 4A2EA 4JKNA 1SF5A 1SHWA 1PF3A 2Q5BA 2XV3A 4YVNA 2XVBA 3NJLA 1AG6A 5F7BA 3QJUB 2W8CA 5I6KA 3AW5A 2OJ1A 3SBRA 3NJFA 2ZOOA 5AKRA 1AS6A 3NYKA 5AFAA 2GIMA 1L9SA 3WIAA 2EIJB 4HCIA 2AZAA 1VLXA 1PZCA 2J56A 1ASPA 3BQVA 5E9NA 2QDWA 5I6OA 4YL4A 4ZK8A 1NTDA 2YXWA 4KOBA 2MRYA 3ABMB 1GY2A 3DIVA 3OMNB 3QJVB 1IKOP 3NJIA 1CUOA 2HRGA 1JXDA 4AZUA 3AG3B 3CVCA 1QHQA 1OOWA 4YVUA 2FQGA 3OQRA 1ZV2A
chains in the Genus database with same CATH superfamily
4KJWC 2VZTA 4ACTA 1I3GH 1P5UC 5EBLA 5KZCD 4GRWH 4GMTH 4IS6A 4WV1A 1FNEB 4Q9QL 3NFPB 3QQ9C 1L6PA 2GBAA 2Z1KA 5D4QA 3GDBA 3ROOA 3LEYL 2COQA 3WFCH 3UZVA 2B3IA 1K72A 2WYTA 1L9NA 2DKUA 1LK3H 3K0YA 4NWUH 3BSHA 3CMGA 3UOAB 4H8VA 5FK9A 1BPLB 2CKBL 3GLEA 1U9KA 3DK2A 2R83A 3QQXA 5D7JB 4BRJA 3FU0A 1KG0A 2R56L 2HFEB 3R1GH 5JXED 1NIBA 1UM5L 1E27B 4HT1L 3ISWA 2GJZB 2AHIA 1WGVA 5C07A 5I30H 3O3DB 4C58B 4DGVL 4L1LA 4XN4A 2VDQB 4PIBA 2X9XA 3DARA 4KO7A 1J0HA 5SX5H 1TTBA 3HS0C 5IB5B 5I74C 2LVEA 3RTQB 3L95A 4IHOA 3SE9L 1K3IA 2GC7C 2QKSA 3T3PB 5GGRA 4QCIA 4HGWA 3NPSC 3V6BR 4C54A 3IJ8A 3KPRE 1NBZB 4X5XB 1SXAA 4Y2OA 3U0PB 4PJ5D 1P4IH 2GEEA 2W5PA 3H54A 1NCWH 3B9KB 3J8F7 1QZNA 4MLSA 4PS4L 4Z3EA 2H0PA 5J3HD 2BPBA 2XOTA 1RZ8A 1CLVA 4UV4H 3VVWA 4P5TC 1S7UA 3PWPE 4DERA 3FPYA 2KQMA 3T04D 2CR0A 1U8IA 2L3BA 1ROCA 3NFSH 4UDUA 3ARBC 4PRDA 3UG4A 4CSSA 4HCFA 2ICES 4NUGL 1S8DB 2ADJB 2H1LM 3VXRD 3LXBA 3WFHA 4FXTA 2BWDA 2R4RH 3K1KC 5CLXA 4CU8A 3EO9L 5CCHE 5FYLL 2WIMA 2MMXA 1A3ZA 1GGTA 2F54D 2OULB 3SZ6A 3MNZA 5HHVL 3BESR 5HHNA 2C3VB 1NDGB 1U6AL 1JRHH 5FDWB 4ES9A 3ZZSA 1WT5C 4RMRA 1R17A 5GGVL 2OTPA 5BW7C 2PPFA 4XP9L 5IQ9B 4M93B 2Z7UA 1NJ9B 1OD9A 4K3GA 4L3CA 2CA4A 1NMAL 2C9VA 3L4VA 4K8RH 4RWHA 5FV2A 3RWGB 2BSDA 5I71C 3G6JA 4YXLH 1DO6A 1A7QH 4JG9A 2X6AA 5D8JL 3WTXA 1ZANH 4NC1C 3S3BB 2DQJL 5DS8A 3TOPA 4TV3A 3FO1B 2EZ0D 3ZUCA 4L29A 3VFOA 3FT9A 4UDTB 5E2TL 4NHCL 4QHMB 2W60B 5KBNC 3T4AC 2X4RB 1LJMA 4WLCA 3CIAA 1Z7JA 4FP8H 2DQTH 2IDUA 3UTTA 2P45B 3AXIA 2JIXA 1Q38A 1JERA 5DDHA 5F70A 4BWTA 5D6DA 1TYRA 3US1A 3NEXA 1U0QA 3J07A 3PNRB 4WI8A 3DOSB 2E56A 5F6HJ 5FYLD 4MJ4A 4UOZA 4FFZL 5F9JB 4LEEA 3FTWA 2WB1A 5FO9B 3CSYA 1J18A 3O9WD 3DVGB 3W3BA 4MHHG 4FG0A 4Z7OB 1WBZB 4J3OD 1SN5A 3SDAA 3RNQA 3GK8H 4B96A 5I0YA 1P69B 5I6NA 5ICYA 2YN5A 3HZ3A 1AHWA 3QUKA 4MNGA 4NNYA 4O02A 1OLLA 3R06A 2CUAA 2GJ6A 3Q8EA 3L1OL 3LEXB 2EJ1A 5IK3B 2HG0A 5D2LE 2F74A 4KK8C 1R5IB 4AJVA 2WYHA 3H1ZA 3QXDA 3EBIA 12E8H 1GKOA 2R0LH 4PWJA 1CXHA 3QUZD 3L3HA 5EIIB 1DUYB 3VFPA 4DGIH 4JGNA 2RJMA 4PJDE 3NA4A 5IVZA 2VLRD 2WLJA 1F58L 3WIFA 3HUJA 4HX1B 3S9DB 5K39A 3QEQB 1AHKA 3FHEA 4ZUVA 4GSDH 4ZQTA 4HK0B 1HZHH 4P46C 4MAYC 2XN0A 3O8XD 4N6RA 1FJ1B 4AQOA 2OMUB 4XMKH 3LV3B 5A6LA 3LDBB 4YWGH 3TA3D 5IB4B 1A66A 1U2CA 5E8DL 1QBBA 2DQUH 1XB6A 2XLLA 1SM3H 4C56D 5KYNA 1CIDA 1BM3L 5IM7A 3EJCA 1OARL 5C0IA 1TYEB 5B7MA 1F6AA 5I8OH 3O2DA 1HEZA 5KTEH 2YAPA 4X6DE 5GGTL 1U92B 3TN0A 5I1LA 1B0IA 1YEJH 4OZFA 4GRLA 6CGTA 3P77A 4DUWA 4PGBA 4JL1A 4ZQKB 3B5HA 1M7DB 5ECJE 5AAMC 5C7XL 3OC5A 2DB8A 1CFTB 1NAMH 2CHDA 5LQBH 2CHNA 5F71A 4XPTH 4JFVA 4NAJA 3VI3A 4DGYH 2B1HH 4FTVD 4P9ML 2ISDA 3RPIA 3LKSA 1YMMD 2FYVA 3ILDA 5AOJA 4U3SB 4KAQH 4HUMB 2F58L 3D9AH 1OAXL 1B0GA 1FZMA 2CO7A 3WD5H 3TC9A 2K8MA 43C9B 2V5MA 4FLRA 3B7TA 4TULL 5FXCH 5DD1L 4YR6B 5C0GA 1TNMA 3T0EA 1S5HB 2EDJA 4Q9RL 4M4PA 3T8VA 5AEAA 5IHZB 2F08A 5D4IA 4P2OD 4ZPTA 3KBHE 4OLYL 4FZEH 3KPRB 3MRKB 4X9GA 1RY7B 5C0DB 4Y2DD 4MAUL 4QOKA 4XT1C 5DZJA 4G8EA 2PWEA 1BD2A 1E65A 1KTLB 2UZPA 3PWPB 4IK6A 4P4KA 4QJ5B 1BFTA 1EZVY 1I4FB 1SLUA 1VRSA 4L5FL 3UAFA 1VPOH 2CLRA 2AJZA 4U6HB 1F3JA 1HHIB 3GMPA 4XPAH 2Q86B 1CF8H 1X3DA 4G3YH 3SYAA 3WS6C 3OGCB 3QBTB 2R0ZL 4MZIA 2E27H 3LKOB 4BSWA 4RAVB 3OLIA 2FJGA 3QC5X 3VB8A 5A2KH 4P2YA 5CCJA 2VDNB 2FCBA 4HJ0C 4KITB 3CUPB 2HP4A 1M71A 2DQGL 3M7OA 2BNRE 3C5ZA 3SGDH 1E9OA 4L3EE 5D4JA 5BQ7B 1E9PA 4UINL 4GKZB 2WVSA 1KLGA 3AUWB 1MNUL 2I07B 5AW9B 3EO9H 5L8JB 4J6RL 4ESKA 1PQZA 1JGIA 1JZ2A 4FNPA 5T33H 2YXMA 2Z1PA 3BKYL 4P2QA 1FRGH 4PWGA 4IBSA 4BCYA 4KZEL 1FNGA 4JRWA 1YCSA 3QI9D 5GRYA 2CCVA 5GGVH 1FYHB 4X4KA 5JQHC 1M6UA 3LZQA 1IC5H 1WCBA 4XP9H 5EOQL 1KYOJ 1IGJA 1FN4B 3ZTCC 5AENA 1OY3B 2XRAL 4I3SH 3UPRA 3O6LL 2FO4A 5K9KA 1AR1D 1QLFA 3APFA 4FGMA 3VM7A 4YHML 2P5EA 2BCKB 2KZKA 4Y4KD 3FU9A 2DICA 4EUPB 4JQXA 1UHVA 4PV1C 2RQEA 4FE9A 4FFWD 2YD1A 2ADIA 4JN2B 4QRQB 3EFDH 2YKKA 3HFMH 5DEZA 3WEAA 4HP5A 1E7UA 2TRHA 3I75B 4WNQA 1ACYL 2O5NA 4X42A 1BIIB 3GMRA 5A6MA 5K59F 4K9EH 4BKSC 1XD0A 1N4XH 2A6JB 3FK3A 4S11A 1E7VA 1OTUC 1ZHNA 4M1GH 1ZT1B 4HWUA 4YHNA 2J43A 4XMZA 2AEQH 2DMCA 5LCVA 4MA8H 1OT4A 4FDWA 4LDCA 4MA7H 4P5MB 5D2LB 3UROR 5JHDD 1A2YB 4OTXL 5FUZH 1HFUA 3H7LA 3CVHB 4F57L 3O2VL 5FYKL 2H9GA 1MEXL 1KJVA 3MFFA 4OCRL 2P8PA 4FNTA 2Z64C 1Z6JT 4PJDB 2X4UA 4XO3A 1KEGL 2YMTA 3S37H 3BPOC 2W9EH 4UUJA 2VR7A 2DYRB 4HIQA 5KSBE 2FEDC 1LK2B 4I89A 3ESUF 4WJKB 4MJ6A 5F3BB 5D1ZI 5C9JB 1KDJA 3Q43A 1QACA 1RIUH 3BXNA 5LNEA 5D7JD 3UC2A 2HKAA 4KNTA 4RFEA 4NKOA 4M62L 1UQSB 3K3QA 1QKZH 3LVTA 4RIRA 2OMXA 1KPUB 3V6ZB 5FOJA 1OT2A 3RTQD 3HG1A 3NRQA 1KCVL 4X6DB 1NCAH 4YBQD 2XN1A 4L3FA 2RFXB 1UCBL 1KLUB 4YAQB 4GKSB 4QTFA 5FA4B 2EYRB 4WHYG 4NN7B 2B8OT 3MRQA 4GJTB 4CSPA 1C08A 4MCYA 4Q52A 1INQA 1BM3H 3B9KD 3L3OA 2Z7WA 5AZEL 2A9BA 4OLUH 4A66A 2Y2TA 1AXTL 3L1FA 5HTSA 5KVDE 1FPTH 2HVBA 3GEFA 3L45A 3F6IA 4DGWC 3WTVA 1KCRH 3FHAA 2BH0A 1HHKB 2X89A 4YBHA 1JOIA 5B4MC 2ZOUA 5FYKD 3MV7E 3TFBA 2FSEB 2PPAA 3UFIA 3MBEA 1IVLA 3BVNA 4B9GA 5KS9A 3B37A 1RPKA 3BQUD 2ITCB 2RALA 3B2PA 3KLAB 4YHZH 1HTYA 5TQ2H 4A2EA 5E08H 2EDLA 3UDWA 2OA9A 4YN3A 5IROA 5BS0E 1N59A 1G6RH 4IEFA 4FHJA 2BOBA 3FH7A 4LCVA 4HIEA 1K6QL 2UWEE 5E2VL 3U48A 3T2NL 3NJFA 3KR3L 4YC2B 2HA1A 1EVUA 1TJXA 5D1ZA 4XC1L 4OF3A 1HOCB 1S3KH 4N0YH 5J13C 2XCMC 3TT1L 1TJHL 5CJXA 3K91A 5I76B 3AMKA 1J5IA 3RI5K 2ZICA 2WXHA 3F84A 4CJ0A 1U95B 2PCXA 4AMXA 1EXUB 3GKZA 3TV3H 3KJ6H 4FABH 2YPLD 1BZQK 4OBSA 4JX0A 1YMHB 1C5DA 3RDTB 1T04A 3D2UB 4X2UA 4EI6B 1OAYL 5BJTA 5DJXA 3VGFA 2CLVB 1S9WA 4PS3A 4UBDC 3KCWA 4M5TA 2BNRB 2F8VA 2BIHA 1QVOB 3C2AL 3IMWA 3BPCB 3EH1A 1VFAB 4FLSA 4L3EB 4LCCC 2A4ZA 3TT3H 3LPOA 3VRLE 3VRJA 1N10A 5BZDA 1OTSD 3KBPA 4AKQA 5IHHA 1OZUA 1GHFH 1MCCA 1PIFA 3LQMA 4N5EC 1EAQA 3FUMA 4D94A 1XCWA 3GJEB 5GRWA 3IETB 5AUMB 4FQ1L 3BWAB 4AIZB 5IW6B 1A7NL 3X1NA 5KEZA 3BMWA 1UH3A 4LCYB 3KYMA 2BSTB 3SYPA 1AJ7H 3CXHK 1NGXB 3OX8A 1BZDA 5DZ9A 3G08B 3WIHA 4B0MB 4LLWB 5C6TH 4ZUTB 3MJ7B 1EEYB 1MCBA 4F33A 3CBJB 3QJFB 3TYFA 2GBVA 4PD4J 3MLYH 3LD8C 1XH2A 1IZJA 1N0XL 3EOBB 2A83A 2NZ1A 4N2OA 3U4BH 2J57A 4I1NB 3P3YA 1E2VA 1JGEA 2MSPA 2B9BA 3L3GB 4QNPF 1TT6A 2CK0L 3D51A 2Q6WB 4Z7NF 2R8SL 1O5PA 4JFDE 2QQNH 1HX0A 2NDFA 2UUDK 5IB3A 1ND0A 3QEQD 3MGAA 5DD3H 5FEBA 5L2KE 1TKWA 1R3LB 4PWIA 4ZAKD 3L9RA 5F6IB 2NY1C 4C83A 1KUMA 2NNCA 1DUZB 4AY0A 4E9LA 4BD4A 4NQVB 3S3JA 4XMLL 3NIDF 5AW1B 4IRJC 1C7SA 4NUPA 4UNIA 3T0BA 3F2LA 4AL8L 2V33A 4MFHA 5I66B 5EUOA 1B4JH 4AKPA 2CNZA 1EV2E 1Q0YH 4AT6B 3W5NA 1OCZB 2IFFL 3DHMA 1CE1L 4LSPL 5IFAH 4WW1A 4WTZA 4AK1A 2VZSA 5DRWA 1SJEA 2K6ZA 5CBEA 1S9YB 1SY6A 5F1IB 3RPKA 1CURA 5DEGA 2A73B 2IANE 3QQ3B 3V9EA 3RWDA 4QXUL 1XCXA 3LKPB 3QUYA 3QJHB 4WU5A 1WBYA 3DHUA 2FT8A 2D2OA 1MCEA 2GY5A 1ADQA 2VDNL 3QZBA 4QTHA 5INCA 4BE6A 5BZXA 1U3HD 1DZ0A 3OGOE 2XTSA 4BJLA 1ETA1 1TQSA 2O5YL 1BJMA 2ROYA 5FHBH 4TKWA 1JBJA 3O2VH 4PUBH 2ZKMX 4G6KL 3VU2A 2JKNA 3P40A 5DC2A 2AJUH 3T1WA 3EXLA 1GZQA 1OE3A 1KEGH 4U1HA 3AXHA 4MJ2A 1F18A 3D12B 4M7KL 5JIIA 1T4KB 1JGLH 2NW3A 1RZIA 1Z9LA 3FFCA 4NQCE 3QPXL 2HWZH 3CDGA 2X44D 3Q0HA 1NLBH 3VG9B 1TZAA 1M2VA 2X9ZA 3L3JB 4KDTC 2IBZY 3KPRD 3RWIB 2UZXB 4CN6A 2ZX5A 3FJTA 4KRPB 1HWWA 3MRBA 3PL6A 2H2PD 2DWTA 3NA9H 2AXJA 2WQAA 3PWPD 5F93C 3UG5A 2ICEB 4AIEA 4HQQL 1UM6H 1AR2A 2EVFA 3VQLA 2VLLB 1IQDB 4TNFA 5DLLA 1ZIBA 2X38A 3TESA 5EF1A 1BV8A 4YXHH 3MV7B 3HPJB 2AANA 4QRRA 1QQDA 4NNYB 4XO8A 2Y69B 4DKDC 1X4XA 2H5UA 4LRNL 4K8RC 4DOHB 5EF0A 4NPJA 3TZVB 4F7TA 5E5MA 3WTSA 5CZXD 2IOIA 3MCLH 1D5BA 2IH3A 4U4BA 4CDHA 4EIGB 3IDGB 3LN4A 1E4KC 1ADWA 2R1WA 1T22A 4G7SB 5CGTA 3V8OA 4CGUB 5IG7A 3RQ3A 4L8DB 1DR9A 3PWUA 5JUEH 3I3EA 4MMZA 1QAWA 2OL3H 1UWGL 3EOTL 1KNOB 4OLWH 4M5SA 1D9KB 3ARQA 4O2CA 2W88A 4NKDB 2DS4A 4PJCE 3MOAL 1UOWA 2Q7YB 4AJ0A 4L9LB 1VGEL 3IDUA 1LWHA 2ODIA 1GW6A 2ZTBA 3HRZA 3QWNA 2AGJL 4H26B 4TSAH 5DLML 1BYPA 4KVCH 2ITFA 5C07E 3GXTA 4H1LB 5EO0A 4JVWA 1HESA 2JJWA 4HEPA 4KKNA 3QB7C 1JSYA 1JWMA 3UJIL 1GYAA 2ZQKA 3CX5K 1TQUA 1CL7H 4DZBB 1LO5B 1RFDL 2PW1B 4B50A 3J7HA 3IGFA 4JDEA 3WAKA 2JH2A 1TJHH 4I3GA 4K9JA 5TGBB 1EH9A 3QEHA 2E8ZA 2A1WH 1VCBC 1A6WL 4UT9A 1VZGA 3BP7B 1KYAA 3GZQA 5M95B 1MELA 4K23H 2YPKA 2E6PA 2G0KA 2NNRA 3ESMA 5KVFE 1UXMA 3C6LC 4ZJ9A 5EO1A 3UC0H 4BK5C 3H2QA 4NWTH 4KHXL 3DSFL 2VN7A 3NSCA 4KNQA 4NQSB 4NQEA 5ETUB 2JKLA 3C2AH 2QLYA 4ALAL 3GSNH 4OQTH 4CVXB 3KVQA 4FMKA 1Q1JH 5FUOL 1L0PA 4HZLB 5C71A 1DQJB 3WN5C 4F7PA 1J5OL 5LGJB 2NYYD 1AGFA 5KWYC 2F7PA 5C97A 3CWGA 3C09B 5B7FA 3QW9A 4NBYB 3VXUA 2X4TB 3GZOA 4LLMA 3GHBL 2HLAA 2IOMA 3CLFL 2JQMA 3W2DH 4AQ8C 1CD0A 1HSAB 1OB0A 1LEGA 1SOKA 4KQ4H 3AT8A 2QKIA 2VITA 1XIWA 3HAEB 1XCQA 4WHTA 5LDSA 3F12B 5LXGL 1W8OA 1V05A 5CIPA 3NSDA 4UANA 5FCSH 3RY5A 1A3LH 3S4SA 2H0JA 3PWVB 5BPPA 1N0XH 1EHAA 2NRDA 3B2VL 3VGEA 2XJKA 2A9CA 4FFYA 4YZWA 2NUPB 4YSAA 3NJVA 2KH2B 5HPOA 4XTRC 1HIMH 1YUKB 4NFDA 4QO1B 1YQVL 1AGBB 4IQHA 4LP8A 4XCEB 3UPCA 5F7HA 3H9SA 4FI8A 3HHSA 4TVPH 1V5JA 2VMCA 4QRPA 4ES8A 1HQRB 3GS4A 3GTNA 3IBEA 5CJQH 4YSSA 1HNGA 4DQOH 4PJ8C 4PSRA 2XQBL 1NCUA 1IUZA 5D4HA 1UUSA 4AL8H 3H3KA 5G4NA 5CN2A 2AQ3A 4QHKI 3V9CA 2FNWA 1LDPH 1NMBH 3DXAE 2UY7B 2WSKA 3DMMD 2IFFH 4LSPH 5ITBH 5CJBA 1OAJA 2BSSB 2V6HA 4ZO9A 2CBMA 2ZUWA 2R2HA 3RVWC 2A77L 3OJMB 3WKPA 2QV2A 4P49A 1EJ8A 4S0SD 5L9DH 3DHJA 2PXYB 4YMPA 3VYNA 5AKTA 4QXUH 2QZQA 4Z7QF 2PW2A 1S9VB 1R5WB 2Y5TB 1GMIA 2GJ6E 2GT9A 3BI9X 2D3NA 1RL1A 1J0ZA 4NQCB 1K8IB 4PWHA 2WQUA 1S9KC 5I23A 3UYPB 2ALWA 1I53A 1WWAX 3ZYZA 4DQAA 2OKMA 2VAJA 3QUXA 4ZFGL 1JMZA 1XGYL 4R96B 4DESA 2FL5A 4OM0H 2WWMC 2XWBA 4MRBA 4NDMB 3T71A 5HHQA 4F5CA 1YN7B 2BP3A 3K2UH 4LF3B 5KJRH 2I85A 5ACMA 3VSTA 4D3CH 1D5IL 1EDYA 2MCAA 4FCAA 1A6PA 3UBHA 1H3PH 3QG7L 1E9QA 3QIBB 2AP2A 2LQRA 2UVFA 2WMPA 3EBAA 1B4TA 2GPZA 5CD3B 4N6QA 3COOA 3MDJA 4MQXC 5TFSH 2VXUL 4MD0B 1ZA3A 2V2WB 3VWJA 3D2UD 3ZKQD 2E0PA 3OF6A 2JJVA 3CLEL 5EBLB 4DUXA 2NXZD 2BNRD 4QTIH 4WV1B 1AVAA 4NX0A 4L3ED 2FEJA 3ROOB 5EBGA 1HL5A 4O58L 7TAAA 3UZVB 3H85A 1DFBL 4NM8H 1I8UA 4FXGC 1WS8A 2FB4H 3HRPA 2JI3A 2MCMA 3RVTD 5DF0A 2AZUA 3DVNA 4XP6H 5FK9B 3SQOL 3Q6GL 1DQLL 1BWMA 3CFUA 2ZSVA 3IXTA 3OLEA 3VI3E 3MROA 4C47A 1KCBA 4PP2A 2JWYA 5DURB 1FZKB 5C07B 2RGSA 4FC3E 1SEQH 3HMXL 1GSKA 1ID2A 1UWGH 1FORH 3KJ4B 4JRLA 3B2DC 3H8NA 3NIFF 3T0EE 1J9CT 5AAWA 2VR6A 5DHVA 3L95B 5FPIA 2B59A 4IHOB 5JIMA 3TLRA 3FQ4A 5GGRB 4QCIB 4HGWB 4A2FA 3APNA 3TFKC 4FMVA 4KC3B 4K9EC 3WUWG 4KI5C 2YD9A 4Y2OB 2PMZA 5IREA 1CN4A 1FL3A 4H88H 2ICCA 1LO4L 3MLTA 4QOKE 4WEUD 3POHA 1XSJA 3ZGHA 4N2AA 2UUDH 3QZWA 4UT6A 1RZ8B 4GW5A 1S7UB 2JK5A 4O00A 1E4HA 5FOBA 4PJBF 1U8IB 1I7UA 1I9RL 2BVQB 4UDUB 5E9AA 5JPNA 3V2AR 2FRGP 4PRDB 3APDA 3FTGA 4JAMA 1BAGA 1SHXA 3W9EA 5C0RL 2BSEA 4EDWL 1OALA 4JRYA 3ZJAA 2V9UA 3WFHB 2JVUA 2Y7QA 5L4IA 2IDSA 2VLKA 3VWKD 1M05A 3APMA 3MNZB 5HD8D 4JPVL 3KPPA 1OTTC 1WH0A 5HHNB 1TEFA 4O5LL 4KVNL 5KVDL 3K1DA 3VXNA 1P9MC 5IEHA 4PR5A 3N40F 3HJEA 2VQTA 5TD4A 3F83A 1LDSA 4L3CB 1ZV5A 2WQ8A 3QJZA 4JFEE 2VN5A 3QJUB 3G6JB 2G3NA 3BAIA 2OJ1A 3K2MC 5JW5B 1J5OH 2WJ7A 2ZOOA 2ZCLH 1DQQA 5IQOA 1FO0H 3TNMA 5IBUG 1K8DA 5DS8B 1MREH 1N12A 2PYFA 3ARGD 4PJGF 1PZCA 2BZDA 3ECVA 4L29B 4P2RA 3VFOB 4AYBA 5KVMC 3WDHA 3GBNL 4PJ7F 4YHYC 1PKOA 4XZUA 4UNVA 4KOBA 4HC1H 3E9TA 2L4OA 5GZOC 2WTOA 3KLHD 5MEPA 2E6QA 4JPQA 4KJQC 3ABMB 3CH1A 1FVDA 4ZOBA 4IOFC 3UTTB 3EFFA 3LOWA 3U1QA 2JIXB 3HC4L 1OOWA 5DDHB 1ZSHA 4I5BA 3TEZA 4W9DC 2Z31A 4KRPD 4QHNA 5E8PA 1ECYA 1WFJA 3CU7A 2VN4A 1ESOA 4ZTOL 4G9FA 3S88L 3RAJH 2H8PA 3VXQA 4J6IA 4X8JA 3CSYB 3MACH 2RB8A 3M7FB 4YDKL 5JIQA 3SDAB 3RNQB 4ODSH 3RFRA 2R0WH 1YY9D 2R1XA 3BCFA 4LNRA 2EH8L 4NNPL 2WXRA 3U4AA 5ICYB 4XXCC 1AHWB 2ATKA 1QFOA 2DV6A 2VXQL 3MV7D 3QUKB 3R06B 4MNGB 2O26U 3MRMA 3MA9H 1QI3A 4IJ3C 2GJ6B 4AGLA 5HGBA 3IJHA 3NCBB 4H4NA 4ZUSA 2F74B 3R7QA 2FO1A 2BK8A 3QXDB 2GIXA 2I7OA 4BZ1L 3L3HB 1SPDA 2A77H 5TF1H 3VFPB 5BS0D 3T6ZA 5IVZB 5D1XC 4N9GA 4Q9BA 4WTWA 3HUJB 1MCOH 3WIFB 3ARSA 5BZZA 5K39B 3AY4A 4K94L 1BQKA 4OLZL 5DO2D 5AVUB 4ZUVB 3ULVF 1D2PA 4N6RB 4JZJC 1LNUA 3TP4A 4D8PA 5AL8A 4AQ1C 3RU8L 3CFMA 1RH8A 4OUOA 5B7EA 3BD5A 2AK1H 4KKLD 4BQ8A 5I0VA 2NY2C 2OS7A 4PGCA 5IM7B 3VYOA 2OMTA 4YHOH 5C0IB 3KWXA 5C08A 1F6AB 2JB6A 3P2BA 4Q9CA 2WIIA 1HEZB 4RLDA 1BZ9A 3QCTL 2YPVL 1D5IH 1T5KA 3TN0B 5I1LB 4OZFB 3QNYA 2G3ZA 3FOLA 3PNWA 4GRLB 1OAQH 4Y0GA 1OCOB 3R7RA 2A5UA 3P77B 5LN8A 5CJ5A 3SDDD 4TTGA 4PGBB 3WTWA 1OOAA 1GYCA 3W56A 5EF2A 1GPOL 2R69H 3X14A 2DWYA 4M3JA 7CGTA 1Q9WA 5CLWA 4OGZA 3VI3B 3RPIB 3LKSB 1A0QL 3ARPA 5ALCL 4XCFL 3WNJA 5HVGB 1AE6H 1SVCP 1B0GB 1FZMB 1PVHA 2CO7B 4O58H 3SDCC 2G9HA 2VDMB 3AC0A 3RX5A 5IF0A 3DHPA 4DVRH 4PJAF 2XV2A 2J71A 2WWOA 5C0GB 5E8EA 4KRMB 3T0EB 1T66D 4C55A 2AEPL 1U2HA 3ZHDA 4I7ZC 2JKJA 1G1YA 4ZPTB 2VDLL 4JGUA 2UXTA 1MFUA 1ZD6A 1AZCA 3L5XH 4R97C 4QOKB 4NOBA 3UX9B 4G8EB 2CCWA 2MNWA 2Y24A 4JFDD 1RIVL 1BD2B 3KPSA 5CHNA 5ADPL 3EIFA 1A1MA 3CK0L 4NC2B 2DQCL 4P4KB 2B2XL 2GCYA 5L2KD 4OD3H 2V9TA 3OD3A 1YNKL 3WJMA 4GY4A 2CLRB 2AJZB 5LBSA 1F3JB 3GMPB 4HPOH 5HGGS 3WNMA 4XC3L 1QWUA 3ZDYB 4X80L 4M5ZL 1QUNA 3MNMA 2P5WA 1A6VL 1JGVH 1GYVA 3BPLC 4X4XA 1HHHA 4KQ3H 2ERJB 2FJGB 4BSWB 1E4XI 4M8RA 3IM1A 4KTEH 4O02B 3N41B 4WEBL 2HTKC 1G7HA 3V0DA 2IWEA 3AT9A 1M71B 5AVYB 1Z9OA 3JZYA 3ZUNC 3C5ZB 2LV4A 1KPVA 1E9OB 2PABA 3T5WA 4F93B 4L8SC 1KLGB 2IAND 4U2YA 3FBKA 1PQZB 5TDPA 4OUUA 2A9DA 2VR3A 2GITA 1IKNC 2VAAA 5I6PA 4JPVH 1EX0A 1ZGLM 4O5LH 5KYUA 1DLFL 1L5GA 4P2QB 3C08H 5LB1A 1WA2X 2CUMA 1FNGB 2QQQA 3F85A 4S1RL 1A7OL 1KY7A 1J05A 4BV1A 4KMLB 1TF4A 1WCBB 2EXYC 3DETD 1IGJB 3C87A 4DTGL 2PXYD 1XAKA 3W39A 1B0RA 3UPRB 1I7TA 2FO4B 3KL3A 1MDTA 3SB3A 3WFEH 2MPAL 1ZLSL 1QLFB 5LBVA 1PTZA 2P5EB 4GKLA 1ASQA 2MCPL 2AQPA 4NQCD 1AFVH 2Q8BH 4LAJH 1ZIAA 3L8QA 1SMAA 4QWWC 4HAFA 3VGBA 5DGQA 3STBA 1X5XA 1SFHA 1QLEB 2GJJA 2ADIB 2F5AH 3A6OA 3DX0A 1EGJH 3IU4H 4WWPA 1F56A 4WNQB 3CXDL 4R6UA 2YAEA 2JNZA 2QGCA 4KK6D 3B8SA 3V79C 1CFMA 4MMYA 3MLXL 1FFQA 1YEEL 3MQIA 3HC4H 2CRIA 3S0PA 1L7IL 1UD3A 2IDCA 1JI2A 3FT2A 1XF2A 1ZHNB 5DMGD 2NXYB 3WKML 1JF6A 1RERA 2K9FB 3WHXA 1ZT4A 4BXSV 4WW2A 3LRSA 4B9ZA 1ZTXE 1KJ3L 3QIBD 1CR9L 5EUOE 5KVFL 1CWVA 3H7BA 2E4FA 2J4WH 1OP4A 4TMPA 5AZUA 3DRQA 1K5NA 3IPFA 3D0VA 1SDAB 2H9GB 3MFFB 1KJVB 2P8PB 4EO5A 5BRPA 2X4UB 3VFSA 4P48A 4ZMXA 1U30A 4UUJB 2IDTA 1D3CA 4OF6A 1CICC 2RQ8A 3ZVVA 1L6ZA 3ECQA 4QJ4B 4WFEE 4MJ6B 4PJ6A 4W9HC 2VABA 2DQHL 3BXNB 2F19L 5H2BA 1NFIB 2PR9A 1IGIL 5IFJA 4RFEB 1PD1A 2IG2L 3EOAA 5BVPL 3MLZL 5DURD 1R3IH 4NKOB 5C07D 3FUFA 4KX7A 6PCYA 2WXNA 2A4CA 3FDWA 4G43A 4RIRB 5TDOA 2A74C 3EG9A 2OMXB 4FXKC 3FFCE 1KV7A 3MR9A 4X7SH 1JYVA 3HG1B 3DBSA 4XNZC 3ZTEA 4U7MA 4H7VA 3MRQB 2F7IA 1C08B 4MCYB 1GS8A 5F0JB 1INQB 4HIIA 4L4VE 4A2MA 3L3OB 3LH2L 4XP5L 5A43C 1JGUH 4GBXC 1H8NA 3SSGA 2XY2A 1QTYT 1KMGA 4RMUA 1B90A 1WUZA 5J11C 4GRWF 5SWSA 5JYLA 3TF4A 5IQ7L 3IEAA 2FZ3A 3MUJA 5KS9B 3BVNB 4QRRE 4AEIH 5JHLA 3A22A 1B4LA 3P4OA 4LPXA 5I0DA 1BFVH 4XRCA 4G11A 4OM1L 2I9LA 4JDVA 1A9EA 1MQKL 5I1IL 1W72A 4P59L 1XL4A 5ELIA 4CAGA 4KY2A 4YSRA 1N59B 4X5QA 3JWDH 3KPLA 4IEFB 4NZ8A 4B41A 4HJ1A 2DJ4A 2BOBB 4RDQG 4O02L 4HIEB 1M57B 2ICWA 3TURA 4AOFA 2X4QA 4XWGH 3ROLA 1GR7A 1KXHA 1FG2A 3OAUL 3TIDA 1KCSL 5D1ZB 4TPRL 2VDLH 1JIBA 3OMZA 2AERT 4XNXH 2H7WA 1U3ZA 3WFBH 3NZUA 1RJYA 4GO9A 4R26L 4XWOD 5F89A 3DDFA 4EBQL 4CNIA 1URLA 4CVUA 4A7TA 1C5DB 4MA1C 1T04B 2BHFA 4XPBL 3RY6C 5BJTB 5DJXB 1S9WB 4H25A 5A1AA 1UUNA 1P5UA 3S8GB 4N0CC 3H3BC 1WD8A 3IBOA 1KGYE 3OZ9H 4JB9L 1ERNA 5E7BA 3H42H 5E6ZA 1DBBL 2IWKA 3VRJB 2C9RA 1H8OA 5BZDB 5DA4A 5CCKL 4HU8A 2CXGA 2K4AA 4BHUA 2DI9A 2VJ0A 1LVEA 3O2DL 1JXGA 2ADYA 3DXAD 1H8SA 1NCTA 5J6SA 2XT1B 4NQEE 1UJTA 2YA0A 1MAML 5K9QI 3KYMB 2CHWA 3OX8B 4Z3IA 1R24A 5FM5O 4KKBD 4OV5A 3GXPA 4OFDA 1F8TL 2GJ6D 4F33B 1W15A 1NSNL 3TYFB 1H3XA 1V3MA 3HS0A 3IFNH 5C2BL 3GXUB 2PPDA 4WSGA 3VXUE 2WZ0A 2A83B 4HLEA 4GT0A 1EAPA 4CMMA 5GRZA 1JGEB 4XX1E 2Y07H 2DLHA 5AB0A 4PY8J 1PG7L 2VDML 2K7QA 4XNQA 5IB3B 3LSOB 15C8L 1ND0B 3F7RA 1NQBA 4O9HH 4UT7L 2NX5A 2MCPH 4P5TA 2ZF9A 1TKWB 4TVSa 3L9RB 4NN6C 4C83B 1JN6A 2DM4A 4WO4C 2HLEB 4J28A 4N2FA 1HQ4A 5H4YA 3CGTA 3IRZA 2BHYA 1CLZL 2AVGA 5E2WL 5C3LD 5EUOB 1BXXA 2SEBA 4R8WH 1CF1A 1Q9LB 1UC6A 5D7IF 5IQLA 2DQIL 2HRHA 4HGKC 1VGKA 4FN0A 1H6EA 2WLMA 3MLXH 4WW1B 4P04A 1WT5A 4YZFF 5DRWB 1SJEB 3TN0D 1MW0A 5CBEB 4PP1D 5E9DA 3Q1EA 3TBYA 5BW7A 5DEGB 3UTSA 1SXSA 4GRLD 4JKNA 5HI3D 3RWDB 5LLIC 1NDMA 3FUHA 2P52A 4XN1A 3QUYB 4WU5B 1WBYB 3D06A 1MCPH 4HK3J 4M9OA 1XR8A 3VMPA 1SMOA 2NT0A 5INCB 2W8CA 4QTHB 3U0WH 1G9MH 3F3HA 4M1DH 3PRZA 3VE0A 1I1YA 2CXKA 2YQGA 4F27A 2OM5A 1JZ4A 5FLVA 1CIUA 4KTYA 3K81A 1GZQB 4U1HB 5E8OA 5I6OA 1OCWH 5F6HI 4N9OB 2IGLA 2YXWA 3T4AA 4BZ2A 4NQDE 4FRWA 2NW3B 4HWBH 1RZIB 1S7TA 2WQSA 3FFCB 2MRYA 3I84A 3O6KH 2Y9RT 1JFHA 4G8FA 1JTTA 3CDGB 3T0ED 3LQAH 3MX0A 1I85C 1XAUA 2EUWA 1IGIH 1M2VB 2DOCA 2HT4C 2R23A 4RGMB 4RZKA 2OTUA 5B38G 3FAWA 4Z7UF 1W8NA 1ZV2A 5AG8A 3C60A 4H20L 4QOKD 3MRBB 3PL6B 4WWID 4GQQA 1DQDH 2O5ZH 4XB7A 4F5CE 3BC9A 1NGQL 1FVEA 4HZAA 3UAEA 4P4KD 2GK0A 2B0SL 3ARTA 1HI6A 1DBAH 2CGZA 2EIKB 4ZMYA 3GLAA 4PJEA 5A16A 5GHWL 1R34A 1QLEL 4GS7C 1RUML 1U8CA 3MMEA 3D7PA 6TAAA 1L9QA 4QRRB 1QQDB 4TUKH 1TZGH 4XP5H 3F7VA 1SBBA 4HCGA 3UADA 1L6XA 2XXCB 4RISL 2YA1A 3HC3L 3ISYA 5AWNL 4F7TB 5E5MB 2FR4A 1D5BB 4PLKC 1HNYA 2IH3B 3RWEA 4EOWL 3C5ZD 3IMVA 1BQHG 4I48A 4QGYA 1B9KA 3LN4B 2R1WB 1T22B 4PJHF 5IG7B 5LCVL 3TJHD 1RZ7L 4BK4A 3PWUB 4MMZB 2ZPKH 1N6QL 3DTUB 4UQBA 2IAAC 4JFED 1COBA 4P46A 3Q44A 2KZ1B 4L2LA 4O2CB 3V5KA 3SHSA 1ILUA 4XI5C 3LNIA 4PJBA 4CDGC 3HRZB 3WEOA 1MCHA 2Z35A 4DETA 3ZTDC 4TQPA 2P1YA 1YECH 5E4EC 1MW1A 3OTTA 5EO0B 1U3NA 4AZ8A 4ZYKA 1QFWM 2Q7NA 3CAFA 5CKGA 3TTSA 4ZFOA 3SKJH 1JWMB 4GG6F 3P9LA 1SJHA 1I7ZA 3T65B 3IRCA 3CDFA 2ETWA 5MP6H 1SJXA 4FLOA 3AZUA 4IKKA 4JDEB 4NO3A 4UTBA 4BWWA 4GUOA 3QEHB 2VDKB 4K71B 1MFVA 5E94A 3DX6A 1NUFA 2YPKB 4K7PL 5AAMA 5C0EA 2DWSA 1CDGA 5EO1B 1KCUH 2B14A 3N1GC 1BVNT 3ILPA 4NQEB 4ENEC 2H0EA 1HJCA 1RMFH 1CLYL 1ZVSB 1CTMA 1K5WA 3D1MC 3ILQD 4JRYE 4F8TA 2NXYD 2G5RA 4LASL 5C3TA 2VLKE 2YRLA 2JJUA 4ZZFA 1JL8A 3C6EA 2XWJA 4TNGA 4F7PB 5E56A 1CGSH 1AGFB 4IU3A 1F3DJ 2EDHA 3VXUB 1X7TA 4LLMB 2HLAB 2VE6A 4Q2ZA 4EZLA 3HJ0A 1PD0A 1X5FA 3HE6B 3HMWH 3I2CH 1LEGB 3QXAA 3U0TA 2QKIB 2VITB 1XIWB 4WHTB 1XCQB 3V0HA 2HZHA 1IFHH 3FS9A 4OGXL 2OCJA 5CIPB 5FYJH 1SDDB 5C2BH 3S4SB 2W0FA 3FAXA 1A3RL 2HRLA 1JHKH 3PGCA 5K1NA 2AK4A 2YMXL 2ITEA 3AG1B 4OZHF 5K59E 1HDMA 1JWSA 1XGQA 2QTVA 1LYQA 4NZDA 3KPQA 5KAQG 4M6MH 2A0LD 1MHPH 3UIZA 5T5FL 1CVRA 3FN0H 1EQWA 2VDPB 1DFXA 3M86A 3OLDA 2G60L 3AU1A 1GGIL 2WVVA 3SKUD 4BQCA 3X3FL 3H9SB 5AW2B 2XQYA 4KI5F 2CALA 3HHSB 4JQIH 4LLVA 2C9SA 1JGDA 4U1IA 4DZ8A 2CGYA 3B2XA 4QRPB 5E6SB 3PF2A 1FV1A 2NNAA 2VDOB 3QARA 4OIIL 4OLVH 4OGYL 1F4WL 2W9LA 3GI9L 3GRWA 4PH8A 1DN0A 1KGJA 2BP0A 4G6AC 4B53A 2BO0A 2N7BA 4NCC1 3F64A 2EUXA 1JD7A 1C5CH 1F11A 2R2HB 4KMTH 3RX8A 4NNXA 1EO7A 2NDGA 4FJ6A 2HPOA 2X89D 4N24A 4Z7VA 5I18L 2PW2B 2VM3A 4DO6A 1IT9H 2YQ3A 4GG8A 3MBED 4C8XA 5FO8A 2GT9B 4DK5A 2NY4B 2XVGA 4QXVA 3F6LA 5GZNA 2ZCZA 1MY7A 2D9CA 1HKLL 4HBQA 4TUUA 4CBPA 2L7EA 3MU3A 5DJ8A 3NZSA 3QUXB 2PP7A 2HJFA 2E5EA 5L88H 2FL5B 4JPKH 5IROD 5DUML 1UA7A 3EYQD 3FQ1A 3Q13A 5I73C 5T3XH 1I82A 4G6MH 2XWBB 4PRHA 4ZRGA 2C5DC 1E2ZA 3GSXB 4XN7A 5HHQB 3MRCA 2F5BH 1MJUH 1O7DC 4WCYL 5GJSL 5DUPH 2XTJC 3WIIH 4OD1L 1P6WA 4W81A 1FAKT 3BAEL 2XQ0A 3FXIC 3Q8AA 2W38A 1EK3A 3M46A 2BP8A 5CILL 3X3GH 1CBVH 3LJ3A 4PW9A 4HMCA 1BF2A 5ESVA 1E9QB 4EZKA 2WMPB 3IN0A 2HMIC 4YSOA 5HDQH 2OK0H 1BAFL 3OKDA 3D85A 4PJAA 3GM0A 5C08E 1ZA3B 2GFBB 2LAAA 3VWJB 1XF1A 4PGDB 1UWFA 5DR5L 5DJ0A 1CFQA 2WHVA 4RCAA 1GYUA 4A7GF 3EHBC 1OP9A 4IRZH 1D5RA 1ZTXL 3OMIB 3RLSA 3T4YA 1C5BH 3DVNB 1SYSA 7FABH 1FYTA 2B20A 3U7WL 3UAJC 9PCYA 2QL1A 4Y16C 1OAZH 3OG6B 5FM5M 2ZSVB 3TO4C 3IXTB 4H0LC 4Y9CA 5I6XC 4J39A 2VXSL 1FFRA 2NY5C 2EEDA 2XZCL 3MROB 3II2A 4PP2B 3HI6L 1DVQA 2ZX8A 2CU9A 4JM0A 3TPUA 4KHTL 5KSAC 1UFGA 3OHXA 2Z4TA 5GISL 1NANI 4JFZL 3HI5H 3IDNA 2W94A 2OP4L 4TUJA 1ADQL 4HJUA 2IXQA 5CZKA 2C7UA 1QFWI 5DHVB 2B59B 4I88A 2YFNA 4Z3TA 4UOW0 2VLJA 2EXWC 2WLZA 4JFYA 3SN6N 4QRSA 1FL3B 3GBML 5FKPA 2WTPA 3CFEA 3MLTB 2SODB 4PN6A 2ADGA 4R7DA 3QZWB 3KPSE 5FV1L 1Z0NA 2NMSA 3PFUA 4GW5B 2JK5B 4BM7A 1PLGH 2JV6A 4NZTL 1MAJA 2XBZA 1I7UB 4U4IA 5FOBB 5CP3A 1VAHA 3NZHL 3STLA 1M7UA 4M7LT 5JPNB 1UZ8A 2ORBL 1F3RB 3FTGB 4JAMB 4JFQA 1J10A 4X83A 2DYPA 3EYSH 3W9EB 4JRYB 4N2MA 1IGCL 2NY7H 1MUJA 4FYSA 1M7IA 3NCYP 2Y7QB 5L7XH 4GQPH 5EZOH 1NEUA 1CYWA 2VLKB 1M05B 1HYSD 1IC4L 2P5WE 3KPPB 1MI5A 3VXNB 2GUOA 4E9TA 3SJVA 4JKLA 1ETZA 4HXAH 5HVHB 5IEHB 5FWRA 4PR5B 3EBHA 2A9AA 2X6UA 4HS6A 4DFHA 1BM7A 2JKRM 5HHPA 3K8MA 4K15A 4H8WH 2CHZA 2FJHA 2ZE0A 1BQUA 5L4MA 2QQKL 1P4LB 2VCOA 3E8UL 3D18A 5DCCA 2LVCA 1EFXA 2NTSP 5IBLD 3LKQA 4EN2A 3QUYD 1VHPA 2AJYL 1OAUL 2JI1A 1LO0L 2A9NL 1DQKA 4LSQH 4WFED 1DQQB 5I82A 2N7SA 3TNMB 1K8DB 3D39A 2OYKA 3IDXH 2PYFB 4JO2L 1RP8A 5DI8A 4P2RB 3EJZD 2H47C 3D4ZA 3HE7C 2DQEH 2BNQB 4XZUB 3PHOA 2R0KL 3HS8A 5DHMC 4QLWA 1UT9A 3UEZA 2P9RA 3EGXA 3NIDE 1I1AA 4S1SL 5MEPB 3SPHA 4HUVA 5F1SA 3KPTA 5T1MA 3CH1B 5GS0H 2B1AL 2ZCHH 4QLRA 1FVDB 3TEXA 4DH2A 5IFHL 3FFCD 1I8LC 3EFFB 3MKKA 4N28A 4DT2A 1CCZA 4HK3N 5A7EA 2EVGA 3JYBA 1EHLL 3H3PH 5F9WB 4I5BB 5ID0A 1QSZA 4LCCA 4JR9L 3OSVA 3ZQXA 2Z31B 1ZLVK 4HCRA 1H3WM 1XMEB 4QHNB 5E8PB 3PL6D 3MJ9H 2NYKA 5IR1B 1VENA 3LB6C 4G9FB 1AQKL 2D7MA 4XAWL 2WBJC 2H8PB 2AI0L 3VXQB 3RFZC 4X8JB 4BKLB 2XWZA 2VDQH 3S35H 4YK4C 1RUAL 4K5OA 1AH1A 4LNRB 2R1XB 1DCEA 4K4KA 4EEEA 4G71B 4UT9L 2CK2A 1J7VR 4QRAA 4QIRA 2ATKB 2BW4A 2VDKL 3JWDC 3LHPL 4DP5X 4E42A 1IGFL 1FNHA 3MRMB 3DTXA 4G6FB 4QRRD 5HGBB 3IJHB 4Z3GA 4ZUSB 4ORGA 1VSCA 5E7FA 2BIOA 2EIDA 3U6XS 8PAZA 3W0WA 5BO1L 3H56A 1S78C 4QRBA 2HKHH 3F8UB 5GGUA 2WK2A 4N9GB 5B3NA 3AREC 3DYMA 3UZQA 2UZIL 3NJKA 2V37A 1D5ZA 1X6LA 3A0OA 3DO3A 4GSXA 1NMCB 2NY0C 3TWCL 2YGQA 3CDZA 4D8PB 3ZQWA 2BW5A 1RZKL 3VM5A 4ZOCA 2VZOA 2ZNXA 4KKZA 4JFPA 2RHEA 1SF3A 2YXFA 3ABZA 4IRJA 1R47A 4XE0A 4BK8A 5CAYB 1XSKA 3FZUD 1GAFL 3CC1A 4PGCB 4Y19A 2OMTB 4FYRA 4PTTA 1F0LA 3HR5A 5TH2B 5C08B 2JB6B 2WIIB 3SDYL 1BZ9B 4RNRA 4FFYL 3QNYB 3FOLB 2Q8AL 1YYCA 4W70A 3TCLA 3PNWB 2DEWX 1MIEL 2MHAA 5GSVA 2EEXA 2ZYRA 2HFGH 1IBGH 2IALA 4Z0BH 3WDIA 3AWEA 2WYIA 2VDPL 3H0TA 2Q5BA 2XV3A 3RB5A 2Y7SA 4K3JH 3T6QC 4YVNA 1BAFH 3X14B 5JPMC 1N8OE 3LX9A 1NL0H 1Q9WB 5I6KA 5DZPA 2B4CC 2DQFB 5FO7A 2QADC 5CUSH 4F8QA 4NQED 1L9SA 5KYYA 2G9HB 1VLXA 4GIOA 1MVUA 3BGFB 2ZUXA 3FU6A 4W9FC 5IF0B 1FHNA 1WUNT 3QR0A 4LCWA 4Y2NA 5E8EB 1PS3A 1FFNA 1CDYA 3BUTA 1RPQA 4G8AC 1GY2A 2VXSH 2YSSA 4MTMA 2XZCH 3VXUD 5CD5D 3L5WA 4LPCA 2XPGA 4M8UA 4KDTA 2X1PA 4N2GA 4KHTH 4OSUL 5HI4D 3ULUE 3QNZA 3WEMA 1INEH 4FLHA 5CHNB 3KPSB 1A1MB 1R0AL 1UKSA 4LSRH 1WICA 2GCYB 4K73A 5FYKU 1X44A 3WJMB 3WXWH 2VXTL 4QAMB 2GBTA 4M03A 5HDOA 1SBSL 4P23A 4WUUA 3A24A 3QDHA 1QUNB 2NW2A 4OQ1A 4EMZA 2P5WB 4J7RA 3A6BL 4X4XB 5GGQL 3QXUA 1HHHB 1KULA 3L3DA 1G7HB 3KWVA 3TF7C 4I18C 4XB3A 1BQSA 4MS8D 1JCVA 2DTMH 4Y5VC 1G9MC 4Q6IC 3QFJA 4JPWH 1KPVB 5IIEA 3LKRA 3RWFB 4Y8DC 4AG4H 3EBGA 4PVMA 1PKQA 4R4ND 3OAYK 2KYIA 5TDPB 5IV2B 4OUUB 2GITB 4AJWA 2VAAB 5EUKA 5KYUB 1L5GB 1XFPA 1J11A 5AW5B 5HDBF 1MHHA 3GT6A 1KELH 4LCIL 4JFFE 1J05B 1BVKA 2QVFB 3LQAC 5DFVC 2A38A 3LKNA 5D1QC 3NDYE 3PPSA 4YSTA 4F1ZA 2IAMC 5L0QC 3W39B 1J8KA 1B0RB 1ZEAL 1I7TB 2RD0A 3P4MA 4YHPA 5EU6E 1WITA 3NIDB 2BC4A 3OR7A 3S35X 3OXRA 4NQDD 4WZ9A 3I50L 4X4ME 2DKMA 4OV6F 5AZ2L 3MRLA 2FHCA 3WXVL 4HKXA 2WWNA 1BG1A 4JO2H 1KY6A 1ZS2A 3QUXD 1RUKL 5HDLA 5DQ9A 3UO1L 1FFPA 3HG5A 3HZYA 4M5YH 4X8GA 4TRPH 2WXLA 5TTRA 5JHBA 3PV6A 5T8IA 1NIFA 1RZJL 3BUPA 1SN0A 1A5FH 2NX5E 1XTLA 2J5LB 1C7TA 2IVFC 4JKMA 4BK5A 2AAVA 4MMYB 2EH7H 3B9AA 4WAFA 4OFKA 5IQNA 2IJ0C 3FT2B 3ARVA 4UTCA 5D5MF 1XF2B 1G7QB 1N5YL 3KPNA 3KLKA 3WHXB 1ZT4B 1FI8C 4WW2B 4X6CA 4S0HA 3LRSB 1KXVC 4UT6L 2AAAA 3H7BB 3MRPA 3CFTA 1P84K 4XAWH 3S5YA 4GFTB 3LPWA 3WN5A 3FO2A 4XMTA 3DRQB 1K5NB 1UA6H 4GSQA 1ED3A 2MOGA 3VWJD 3D0VB 1AY1L 1SQ2N 3NCJH 3OF6D 3HNTL 4FL4C 4RFNC 1I9IH 2BX5A 3APCA 1RV6X 4AQ8A 3VFSB 4PQXA 3HBGA 1UB5A 2WO2B 1DEDA 3GBDA 1J1OL 1DEEA 1OM3L 1S2EA 2XG5A 4Z7WF 4M7ZB 4ANWA 4DSYA 3WY1A 2VABB 2K6WA 3EH4B 2B77A 3L6FA 4NC1E 1JK8A 5H2BB 5TQ0H 5IFJB 1EANA 2BIPA 2OI9B 3PHQA 4W9KC 3EOAB 1WZ1L 5KOVC 4WFHE 2WV3A 2XZAL 4O51A 5D7HA 1OSEA 5B8CC 3GTTA 1MVYA 1OPGH 3ILEA 4G43B 5TDOB 1MCWM 2IV8A 3EG9B 3P73A 3MR9B 3RZCD 5D70H 1B2WH 4FG6C 1OHQA 3TWCH 1QBML 1NAMA 1IM3A 1MG2C 3NABL 3DJTA 4X9FA 2X0UA 3P0YL 4AI7A 4WTQA 1QFHA 4HIIB 5AKVA 4BFKA 4PJ8A 1FZOA 1VFOA 2DKSA 2RMNA 3VGHA 3DO7A 2F54A 2OJZL 4AGNA 1OF2A 3FRUA 4U33A 3LRGA 4IBWA 5JIHA 4PJEE 5GXBB 4ZOAA 3LN9A 3ASWA 2CKBA 1AC6A 1HE7A 4JO1H 3VTTA 5ERWA 5SWSB 4JRYD 4EUPH 2AQ2A 2FZ3B 3BAKA 3S3SA 1Y1UA 2VLKD 3P4OB 3O6MH 3TCXA 2ZOWA 4WEEA 3KYKH 4XRCB 2I9LB 4JDVB 4N68A 1A9EB 4JY5L 4GNKB 4LSVL 4GG6A 3U1SL 1W72B 3NIFE 1T7ZA 4R83A 1ZWIA 3WMQA 5E51A 4KO6A 4A38A 3KPLB 4U3XA 3N1QC 1JPGA 1QI5A 2BY3A 3UBXG 2Y23A 2ICWB 4X5RA 4MXVF 5E1QA 5IGXH 5JTWA 2IV9A 2XX1A 3ROLB 2XV6B 3DV6A 3QWRA 3VMNA 3TIDB 3WL9A 2H2SD 2NTFA 1T1YA 2XKUA 4YNYB 1CFBA 4PJBE 1UXSA 1RAMA 2UVEA 3HN5A 3JBG7 1RJYB 4LVEA 3ZE1F 5F89B 3DLQR 1GGBL 4HGMA 4G1EA 4CNIB 2J1XA 1I3VA 1R46A 3CBRA 1UOVA 4LSSH 3QNXA 4R3SA 3T6XA 25C8L 4I3RL 4A7SA 4KDVA 1PZ5B 1W9XA 2ZNWA 2FX9H 2B5IB 43CAA 4YHIA 4H25B 3O9WA 4S1QL 2AS5M 1P5UB 2EDYA 3EJTA 3BFQG 3NJNA 4BEIA 3RGHA 3WFDH 4GAFB 1WK0A 3OKMA 4WENB 1ZLVH 2Z31D 1Q72H 5GGQH 4FXGA 1P7QA 2X1WL 4RX4A 2ARJQ 4N25A 3ZKXB 4KH9A 3SZKC 1NEZG 4QKXB 4BFRA 3PQYB 3UGEA 4AYFA 1WPCA 5DRNA 4OKDA 3W9DA 3ATEA 3IAGC 1PZAA 1R24B 4OV5B 4PJ7E 4KMQA 4G6FD 4LRIA 4QGTA 3HS0B 4AUJA 5I74B 3IDMA 5C86A 1CU4L 2OBGA 5EZLA 2QHLA 3O8XA 1HXYA 4CMMB 1EAPB 1T0OA 3WOVA 1ZA6A 3NPSB 1M7XA 3RB7A 1EVTC 1T03H 3VW3L 1CGWA 3I74A 4C56A 1CGUA 4JFXA 1VEMA 1HC1A 4XNQB 4DP2X 1RU9H 4MKTA 3CN1A 4O4YL 5I8KL 1IJNA 1IFRA 1WEJL 2NX5B 4P5TB 3I50H 4GIAA 2IWGA 3WHE1 4Y4FC 1L9PA 1ITBB 1JN6B 4S1DD 1JWUA 3F04A 1J9SA 2AK4E 2IQ9L 3ZDZB 1PSKH 4N20A 1HQ4B 5F0MB 5ILTL 1UACL 5E1AA 1A1OA 3QZMA 5JHAA 3FFDA 4UYQA 5C0AA 1RZJH 2EECA 5HHXH 1PY9A 2YUXA 4YEEA 5JMOC 3REVA 3D48R 1VGKB 4FJYA 5C08D 3VU1A 3VD1A 3JWOL 4R5TA 1PCSA 1BYNA 2V8LA 4HF5L 3EJQA 5LBSL 2XU9A 5JXAL 5E9DB 3TBYB 4UM8A 3LY6A 3UTSB 4U6VH 4LVNC 1NDMB 8FABA 2NR6A 4L37A 2FK9A 2X6CA 1XR8B 5DC4B 4PJXA 2J8UF 2AEOA 4AUYA 1MFEH 3D3VA 4X8CA 3RA7H 1RZQA 1I1YB 4P2OA 5EA0H 3VE0B 5DMYA 4ZNEA 2YGNA 1JF1A 5DVMA 2EYSA 4P5KA 1ZLUK 3KL0A 3PABA 2VN3A 4GAGH 4YO0A 5E8OB 3SDXA 4Z7VE 1JNLH 4B9CA 4UB0H 1T83C 2DM3A 4KKAD 4QJ3B 1DCLA 1RSYA 3T4AB 5GZOA 4JHUA 1S7TB 1F2QA 3K2KA 1ET7A 3FQYA 4MSWA 2AQRA 3MX0B 2CGRH 4I8DA 3FSAA 3P3TA 1E90A 5GS1C 2R23B 1T89C 1WZ1H 2OTUB 5IHLB 3C60B 1NCIA 4PRHE 2P24A 2NQ3A 5AVWB 3S5ZA 3KPSD 4FI7A 4GOSA 4GUCA 4N8VA 1FVEB 5D6CA 2GK0B 5DD5L 1HI6B 2BXYA 5A16B 3FTSA 5HI5C 4PJEB 4YQXH 1IO4C 2AJXL 2F8IA 4GT7A 3JXAA 4N2DA 4P5RA 4MAZA 4MNHA 3P0YH 1RJCA 2WP3O 3PWNA 1U8CB 3MMEB 5E00A 4R90H 3MA7A 4BFEA 1AOZA 4FERA 1DBKL 4FZ8H 4XXCA 1G6RA 4H8WC 4D2NA 4RSVA 3EYUH 4NP9A 1CGTA 3F7VB 2P5WD 3HB3B 3ETBF 3DX2A 2DH2A 5I1KH 2ZUVA 4HA1A 2EIEA 2BVPA 1DANU 4PJAE 5SWZA 3RDJA 1AZNA 4Y88A 1BMGA 1KTRL 4N5UA 2QZ5A 2FR4B 1WISA 2YGVA 3RWEB 3GJFK 3WBDA 2VZ1A 1N64L 4I48B 4MD5A 1P1VA 5D1XA 3OAYH 4JN1H 3MKGA 4IRSC 4PWEA 4GXFA 4ZUUA 4P46B 1FYTE 1ODUA 2OZNA 3UPAA 3V5KB 1FSKB 4MRCA 2RAMA 4JZJA 1EBPA 3RGVC 3ARDC 4I77L 4L1TA 1MLBA 1DN2A 3GIZL 3N04A 2Z35B 2B7DT 4GQ9H 5F7EL 3ZKSD 2ED8A 4F37F 4JEGB 4ZYKB 3JV4A 4AZ8B 5J0BA 1OLZA 4ZFOB 3BWSA 3EJYC 3N42F 3P9LB 1SJHB 1SOSA 1I7ZB 4D7PA 1QRKA 3Q9PA 2OSYA 2NYZA 4NO3B 4NJ9L 3ZDWA 3L4YA 2JQAA 5LG1A 5FECA 1NGPL 1S7WA 2QR0A 1CFVL 3SIKA 4JLRA 4P9HH 5E94B 3DX6B 1KN2L 5C0EB 2IADA 4I3RH 2XVBA 2JKTM 1L0YA 1WCQA 3ILPB 4JKPH 3GM8A 2R15A 3ZE2F 4HBCH 1BX2A 1G9EA 1QRNE 4XP1L 2BXZA 1CD8A 2QELA 4PJFA 4URTB 3RX7A 4JG1L 4BE5A 2XWJB 1TQVA 5DZLA 4AYSA 1PEZA 2KL6A 1PX4A 4LSDA 4IU3B 2JCCA 1F90L 1FDLL 3S8WA 4TQEL 4ONHA 2NT1A 2VE6B 4OJYA 4Q2ZB 1LO3L 5J1AB 5DEJA 4GLRH 5GJTH 3BD4A 3QXAB 2BINA 2GKIA 3VXOA 5JNYA 3U0TB 3C6SA 3VD9A 3ZYIA 3LAFA 1A6ZA 4RMVA 3PGDA 1SLVA 2ZP8A 3NZ8A 2EDNA 1F86A 5K9OA 4DKAA 1FNAA 3NAAL 2ITDB 3E2HC 4LSTH 2W0FB 4M93C 1WIUA 1ZV9A 1W72L 5MENA 3PGCB 3BH4A 5EU7C 2AK4B 4MDJA 2N01B 3SCMD 1W6WA 5SWQA 2GEQA 1HWHB 1HDMB 1JWSB 1XGQB 4IGBC 2MWCA 3ULUL 3KPQB 5EORL 2Z4QA 1AQ8A 1THAA 1DE4A 1BW8A 1FIGL 4PG2C 4TSBL 3VI4A 5CSBA 3AU1B 4FQCH 5F7AA 4O2FA 3C5JA 1A14H 2WVVB 3RUGF 1ICTA 1ZJAA 2VL5A 5MI0B 1DSFL 1QO3A 4PU2A 5FR3A 1MFDH 1XBDA 4G7YL 1JGDB 4LLVB 4U1IB 4DKEL 4DZ8B 3I6SA 3PJSA 1JPST 1F1GA 2RCSH 1UACH 1VEOA 3CN4A 2YRZA 1FV1B 2NNAB 3WLBA 4L0YA 6FABH 4FA7B 1VFBA 1DN0B 1PEWA 2BP0B 5I19L 4HD9A 1NLDL 4H5SA 2Y7MA 5I15L 3BQUA 2ZKHL 1A4BA 1X5IA 1F11B 2HH0L 2AMUA 4NNXB 3WSQL 4CSTA 2H32A 1EEQA 3S5LG 4E9WA 5BV7H 4G9DA 1MCFA 4RGOL 4Z7VB 3TS8A 4GG8B 5DU7A 2J1KA 2WKOF 5FO8B 4O2EA 1MXDA 3C5SA 4JO5A 4F9LC 5KN5A 2ZOKA 3W0WE 5AYUL 5DJ8B 4R2GB 1DLHA 2EDXA 2HJFB 1GZHA 2E6JA 3VQMA 4G7VH 4P3CH 4Q0XL 4PRHB 3ULUD 2OR9H 5JORB 5KSVA 3MRCB 1ASOA 5HY9A 2CBTA 2NY3B 2YPLA 4YFEA 1E5BA 3SGKC 4GI6A 1J5DA 4GI8A 2PR4L 3O0RL 3V9FA 5IVXA 3BSGA 2BP8B 3CSBA 4APQC 1JZ5A 4LU5L 4V2CB 2C7FA 5ESVB 3QO0A 1GJUA 4GRWE 3S3PA 3OWEA 1SNRA 1RULL 3O3BA 4Y19E 4AYID 4X6EA 1UD6A 1A4KA 2VZ3A 3OKDB 3D85B 4PJAB 3JT2A 5GRVL 3F62A 4GKOA 2OL3A 3MLWH 3PP3K 1KGIA 5AVRB 3ME0A 4X7DC 5DJ0B 1Z9NA 1CFQB 4FQLH 4KJWD 5KVGH 2QBWA 4HPYH 5DT1L 2XI9A 4FQ2L 3QQ9D 3BPOB 5CGYC 3ES6A 4ELMF 4MDIA 1G5GA 3T4YB 1MWOA 2HRPL 4YIQA 1SYSB 3PFQA 4OIAA 2YWYA 1UM4H 3AGWA 4ZW8A 3N43F 4JFFD 1VCAA 3THML 5I8CA 3TPUB 3O6FC 3OHXB 3V4LA 5KW9L 3MRDA 2WO3B 2JSFA 3IDNB 3GRGA 1D7DA 3LRLA 5EU6D 2IXQB 2CPCA 2A74A 3CN0A 3B2UC 4FXKA 4WK4B 3N3EA 3OBAA 4ETQA 2VLJB 1AHMA 2VRAA 4YDIL 3ZHKA 2VTFA 4L48A 4D8OA 4GEJA 4JFYB 3VX1A 4ISVA 1Q9KA 4QRSB 4F15B 2JB5L 2KUTA 2X3BA 5FKPB 5I1HL 3CFEB 3MZTA 3QR2A 4B3VA 4Z8FL 3GSNA 2ADGB 4R7DB 3VB9A 5EMYA 4OQTA 2CBPA 2YJQA 3HA0A 3WEBA 4BZ2L 5I5IA 4ODWA 5FHAL 4QYAA 4PLOB 4GBXA 2NX5D 4P5TD 2P26A 4ZS6C 4KNSA 3STLB 5E99L 1UZ8B 1OSPL 1KTDB 1MCQA 3B5GA 2ATPA 4JFQB 5GRJH 2DYPB 2CUIA 5KBDA 3ARBD 1PX3A 2LE9A 2XN9A 2APSA 1T6VN 1M7IB 1V3KA 4WUUE 3V0IA 4ANUA 4AIXA 4NPYA 4KKCC 2R9HC 5EU4A 3M8OL 3N85L 1UGNA 5JDSA 3U46A 4FEMA 3OKKA 3SD5A 1MI5B 2GUOB 1NC2A 3SJVB 2BVUA 3Q05A 4LEXH 1ETZB 1U3HA 2RH0A 4UTAL 1TJGH 3CQFA 4HS6B 1PZ3A 3P9MA 4MCNA 3QFJE 5HHPB 1PMYA 2VC2L 4TLKA 2H1PL 2FJHB 4JREC 4MXWH 4B0MM 2D31A 2IGTA 4HU2A 4XX5A 1PKQE 1LP9F 3HHMA 4JHWH 4EE2A 1EFXB 1G0DA 1RIHL 2OJEA 3LKQB 1X4YA 1NAKH 2PYEA 5B38A 3L7EA 5GRUL 1NPJA 4XN2A 3OMAB 5K69A 4PGJA 3D39B 2ATAA 3HI1A 1TJIH 2WPGA 5DI8B 1QR1A 4KXZI 1ODAA 1ZT7A 2BLFA 5DK0A 1ZLUH 3MOBH 4WFHD 4OVUA 4QHUA 3PHOB 3UH8A 5D5MA 2DLFH 2YEQA 3PAYA 2FATL 3EGXB 2J3SA 1I1AB 4HUVB 2V5YA 1UKQA 2EUZA 3MBXH 1QWHA 2BWIA 2P5PA 3BZ5A 5T1MB 2WAHA 3FB6A 5LGHH 3RE0A 1SJVA 4XZ4A 4BIKA 3ZDXB 3RY6A 1EXHA 1WFIA 5D7IE 2WCGA 1SLWA 2DZEA 4HHWA 5H35A 5I6MA 4NENA 2OTWA 5ID0B 3M07A 4LCCB 1FE8L 1BF5A 4YZFE 3UP1A 1NCCH 2EDFA 2WY3B 2XWTA 4ZFOL 1WA1X 1I1RA 1WD9A 3LS4H 4LGPB 1BQHA 2G9KA 3TNNA 2WANA 5E0QA 2BOLA 1DSFH 3ZN6A 3ZX1A 4UTBL 4DKEH 1P6AB 3RVUC 2D73A 5C1MB 4Y4HC 4N2BA 1BJ1J 4PY8I 3F7KA 1FGVH 1M1SA 4J2XA 5DMIH 4X6CE 4E42B 2IDQA 3CZFA 4JVUA 4XPFL 3R18A 3DTXB 5CSGA 2J55A 3LS5H 5I19H 4ORGB 4KK9C 3UABA 5EEVA 5I15H 2Z91A 3B7UX 4KK8D 1E4WL 4UNUA 2ZWYA 3LD8B 3MXWH 4W68A 4MVBC 2EDMA 2HH0H 1JZJA 2PKDA 3GJFH 4RRPM 3U9WA 1F4XH 4NCDA 4P2AA 2E46A 5GGUB 3ZQ9A 1HH9A 4RWYH 3RKDC 3GFUA 3I02A 3UG3A 4LEOA 4HJGA 1D5ZB 4Z7UE 3GUFA 4HWEH 4P46D 1GGCH 4MAYD 2DQDH 4X7FC 4XOBA 3IGAA 5AYUH 3SBPA 3CDZB 2NY1B 3FU3A 4OCXH 5A2LH 3S34H 3GHEL 4WO4A 2Z7YA 1M4KA 4G8IA 4JFPB 2L0DA 1YEKH 1CK0L 4IRJB 4GRWB 5IESL 3CVIL 2K45A 4UOQA 4Y19B 3KLLA 3M1CA 4PTTB 3HR5B 1OCCB 4ZMVA 4QUOA 2JKWA 3LTVA 4XCCH 2QSCL 1GC1C 4YBLB 5IVNA 2Q10A 1MFCH 2FHFA 2MKWA 1QABA 5IQMA 4RNRB 3EDDA 5D2NC 1J9QA 3ORJA 3TCLB 3MODH 3HIZA 2MHAB 5GSVB 4OF0A 3F6JA 2IALB 3ULAB 35C8H 1QBLH 3KHOA 1MRFL 3AUVA 4XVOA 3H0TB 3OPZL 4PJHE 1M9WA 1ZDSA 2X9WA 4LNVA 1QLRA 4NN7C 3RX9A 4DW2L 5I75B 2EEBA 2XDHA 4FJZA 5FO7B 1YO4A 4AEFA 2KZWA 3CFBA 3MLSH 3F5WA 5ENWA 3QCUH 2DY2A 3IKKA 3PHAA 1MVUB 2P4AB 2WXIA 3PXHA 4Z6AT 3RWJA 4LCWB 4FQHA 5EEXA 1DSWA 2VMDA 1FFNB 4NKIH 2YWZA 4HJJH 1EHXA 5FGCB 2YSSB 4GG6E 3ERXA 1I85A 3L5WB 3BLBA 3PAUA 2XPGB 4W9LC 2W65A 2X70A 3QNZB 4A2HA 2I60H 3B56A 2V8MA 3LNGA 5LG6A 3QXWA 2QHRL 4F8PA 2ZJSH 4YHLL 3QSKB 4GSUA 4DGUA 1WE5A 4ERSL 4JFTA 2OMYA 1XX9C 5I16A 4K3DL 2VUYA 2AK4D 3MBWA 4P23B 1AIZA 4YC2C 2BDNH 4XVUC 2VQ1A 2NW2B 1RJLA 1PNCA 4NQXA 2X53A 4QHLA 3WTUA 1LE5A 3L3DB 4Z23A 1F1AA 2YQ2A 1MIML 2EC9U 4WI7A 3FUJA 4HJ0D 1RP9A 3QFJB 4PRNA 4EUPG 1FO0A 2IPTL 3LKRB 4WI0A 1INDH 1PX8A 1S5IL 5IIEB 2IBGA 1IC1A 1PKQB 4FNLL 3RDTC 1EO5A 4JZOA 3MV8A 5FKAA 1Q0XL 3PJNA 3Q8CA 3QPQC 1XCTA 4K3EH 5EUKB 2GY7B 2EE0A 4HC1A 4XODA 4J5VA 2VN6A 1MHHB 4XP4H 1OL0A 2C8NA 4M00A 1IAIL 1BVKB 4YUEH 6PAZA 1IC7H 5DD0L 2V17H 2YMOA 3LKNB 3F58H 3V0WH 4OZHE 4J3OF 3VSQA 3B3IA 1F13A 3P4MB 4QT5A 2BC4B 1IL1A 1CG9A 1FWXA 3OR7B 2DI8A 4HUCA 1BMZA 4N8CL 4NZUL 3OXRB 5JW3L 4KWUA 2BNUA 5CZVH 2R2BA 4JGMA 3V4UH 3MRLB 4HKXB 2DBLH 1XGPA 1TFPA 5CS7A 1CS6A 5DQ9B 3GWJA 3MNVA 4KI5E 2O6PA 3IFLL 3SBWC 1FFPB 1BECA 2NNFA 2C34A 2WP3T 3HZYB 4HFWA 3G5XA 3PV6B 4PRHD 2CMRL 3QEGL 1RSFA 3I9GL 3UYRL 4GO6B 3MUHL 4XNUL 3AS3A 1HXKA 4OJFL 1H9VA 5E4AA 2MCG1 1GTFA 5CZRA 3KPNB 2ZXBA 4AGOA 1HVXA 2APFA 4XBMA 1OTUD 2M2DA 4X6CB 5DZAA 1Z9SA 4QD2E 3GD1C 4DEPB 5F6IC 4HCIA 2J56A 5C0AE 1ASPA 4HKJA 3BQVA 3MRPB 3WN5B 4KFZC 2HKFL 4CJ1A 3FO2B 3BAYA 3GLZA 1KXTB 1ED3B 3CFKA 2EICA 3PP3H 4ONOA 4G6JL 1K4DA 1X5YA 3QRGH 4EN3C 1WZLA 2W1NA 4B9FA 5A2JH 5CEYA 1C16A 3BSZL 3CV5A 1UB5B 5LJYH 4XPFH 1B88A 1CDIA 1DEEB 2XG5B 1NUGA 1MCRA 2HJKA 1FYTD 2VDRH 1QYGH 5T1DL 3ZE0B 4KZDH 2R7EA 3L6FB 5DVPA 3D3VE 1KSRA 5CJOL 1C1EL 1JK8B 1KB3A 2EKJA 4ZNEE 3PHQB 5DRXA 2C3HA 4ADIA 1EDHA 4KK5C 2WBXA 3SDXE 1D5XA 3SE4A 2HT2C 3O45A 4U1SA 1IBZA 3P73B 1Z66A 2ZUYA 3U7YL 1OIOA 4P9HC 1A7PH 1EMTH 4NXSA 2J44A 1LGVA 4L1BA 1NAMB 4FQPA 5IP4A 1IM3B 3BKJH 4LBEA 5L6YL 3J2PA 4WJ5A 1BEYL 1CZ8H 4AW4A 4Y5YC 4U0QB 1FHGA 3I6KA 1J8HA 4TF4A 1IAMA 3UTZA 4PJ8B 1FZOB 3BDYL 2FLBT 3VWKA 1AQDA 2BRRL 3VG9C 3DO7B 2F54B 2H26A 2BJML 5L8KB 5B39G 4Z95L 1BGXL 2QSCH 4ZD3L 1OF2B 3FRUB 1TSRA 4G70B 2CKBB 5DS1A 5ERWB 1MJ7H 3G04A 2XPYA 3G9AB 3KGTA 3P69A 4K5PA 5H37G 3I9AA 5PCYA 1IKFH 2VQUA 4HCRL 5AKSA 5B4MD 2ICEC 5IBUB 4CN1A 4ZMQA 1YNTF 2VKXA 1Q1PA 5KSBA 4TSCL 5I1EH 2QQLL 5SWZE 1DZBA 4GG6B 2BOCA 2XETA 2MTAA 3QP3A 1ZWIB 4ODVH 3WNIA 4M7JL 3ARGA 1JPGB 1G6VK 4X98A 4XMXA 1MW2A 5AVTB 4RAHA 5D1XE 5EU5A 5E1IA 2RR3A 4WHDA 3TZVC 3DV6B 3FONA 4FFVC 4ZNCD 1EFXD 5ABZA 4NIKB 1ZKAA 4Q74A 1GJWA 1HINL 3WL9B 4BFGA 3DUSA 3ULVH 1V7MH 2AJ3A 2NTFB 2YC1A 1T1YB 5GGSY 1F2XK 3WNNA 4DP6X 3TO2A 2VXVH 1UXSB 4Y5XC 1NIEA 3U79A 5I9QC 1BEXA 3AQXA 1D9KC 1T2XA 5CEXA 1Z9PA 4G1EB 1TDQA 3QNXB 3VTAA 4R3SB 1UYWL 3SQBA 2VMFA 3K6SA 3DIDA 4ERSH 5DC9B 2LLNA 43CAB 2E7LC 2X1XR 3LMJL 4YHIB 3O9WB 1ES0A 4UBDD 4PB9L 3K46A 1JD9A 1W80A 1I3GL 1L7TH 1A6UH 1DHKA 4GMTL 1BFOA 3AXLA 1A4AA 3NIGE 3OKMB 2XXFA 5BV7C 4X4YA 4FXGB 1PYWA 3WFCL 1LWRA 3DECA 1KJ2H 5IEKA 1LK3L 4NWUL 4N5ED 2J6EH 1UCTA 4Y16A 5JR1H 4HJEA 1LLAA 1NFDF 1A6AA 4N1EA 1IE4A 5CSZA 5IKCA 3O3UN 1T2JA 5IB2A 4GRMA 5C6PB 5I1GH 4AYFB 5DRNB 4FA8A 3W9DB 1AS8A 1B9ZA 5BS0A 3R1GL 3BH8A 4Q6KA 4PJFE 3Q5TA 1Q0XH 3ZR6A 1HS6A 4LOFA 5JQ6H 1XXFC 5F7LB 5I30L 3W1ZA 1EGJA 2WXGA 2UWEA 2DJSA 3FQRA 2YQBA 1XR9A 2MTPA 3A4FA 1EUTA 3IDMB 4XNMA 3O8XB 5EZLB 1HXYB 5GRXG 3W0WD 4AYGA 1J87A 1ZA6B 5BRZE 5D71H 1QSVA 2BY2A 4ZFZA 1W8EA 5IZ7A 5IJKC 4AW7A 3RJQB 4C56B 4JFXB 4TLSA 1Z0MA 1P4IL 3P11H 1NCWL 2CLZA 4L8CA 1CB4A 3IJSA 3LNDA 4R0LC 4UV4L 3SEPA 4HS8H 5MENE 5E6YA 2F15A 1CPUA 1JWUB 5FCUH 3NJXA 2NY1D 5MEQA 1IBBA 3NFSL 1MCLA 4JJ5A 4A7QA 1YC7A 3IFLH 3NQKA 2V7NA 5EZJA <