1DBJH

Molecular basis of cross-reactivity and the limits of antibody-antigen complementarity
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
219
structure length
219
Chain Sequence
b'QIQLVQSGPELKKPGETVKISCKASGYAFTNYGVNWVKEAPGKELKWMGWINIYTGEPTYVDDFKGRFAFSLETSASTAYLEINNLKNEDTATYFCTRGDYVNWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA DB3 FAB (LIGHT CHAIN)
publication title Molecular basis of crossreactivity and the limits of antibody-antigen complementarity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 34
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1993-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbjH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbjH02
3H7BB 5L7XH 4B50A 3GMRB 3MXWL 4X80L 4B0MM 4KRPC 2RB8A 4JJHA 5ISZA 2NY0D 4OLVL 3H3KA 5FKAB 3MJ7A 4RFEA 4LMQE 5F7DB 1P7QD 4LFHG 1CQKA 5IVNA 3BQUA 5E8DH 4X6EB 3HN3A 1QSEA 1LILA 4FS0A 3JTTA 3MV7E 3CSBA 4WFEE 3SDCA 3ORJA 5CGYD 3VWKA 1A6TB 3LS5L 3RWJB 1CLYL 2GK0B 3AC0A 3DRQB 3GBNH 3M17A 4ORGA 4M1CD 5EU3B 5FOJA 1XF1A 2AXFA 5F8RC 2D7NA 5MEPB 1A5FH 2J8HA 5TH2B 4LASL 2XZCL 4LNVA 3VFRB 1ONQA 2DMBA 4HK3N 4MNQD 1OHQA 3SDXA 4ZTPL 1S7QB 2HVKA 1CE1H 3IKCA 4PJAE 5FYJH 5I17B 5LKNA 3LSOA 1JTTA 5BO1H 2BNRA 4NN5C 2BSSB 4P99A 4LPYA 2PTUA 1ZVHA 2HKHH 4FP8L 3MOQA 2ITDA 4TUJB 4GRWB 1DTUA 3KPMB 3WUWB 4BQBA 1QLEH 1QLRB 4JQIL 4RX4D 1YPZB 5HHPB 4JHWL 4OF5A 1H0DB 2YBRA 4P4KD 4JB9H 4H25A 1YNKH 3DXAA 3KLAB 3GGWA 4JANB 3V6OC 3RU8L 5IGXL 1OGTB 2OXHA 3U9UB 1WWAX 4NKOA 3O9WB 4EBQL 2H26A 1FZOA 3BPLB 3VXMD 4NQTA 3O4OB 1OP5K 3CFIC 1YC7A 2FECL 4OZFH 5TF0A 4M7KH 4XRCA 3RWFA 1N4XH 2ZUWA 1XT5A 3WDHA 4CNIA 3W39A 5DUMH 5L2KD 1JPGA 5FYKE 3GMMB 4HS8H 4QTIL 5L88H 1ULVA 2NYYD 2HLAB 4NCC1 3U2SA 1LVEA 4PJCE 2IANB 3V5HA 4G8IB 1LEGB 5DMGC 3HC0B 4Y89A 4TNWK 4MXWL 1S7RA 3ZKXC 1SYSA 3BO8A 1UCBL 3D5OF 3BRGC 3GMLA 1NBQA 1BFOB 5IBUB 1F4YH 1Z0MA 3IU3A 1UZ6F 4XT1C 2DQUH 3OR7B 5C0RH 5KJRH 1NCTA 3FQUB 12E8H 3F7RA 3GFUA 1UGNA 5CJQL 2VLJA 2H9GB 3O8XB 5HI3C 1X4ZA 4BSWB 3MUGB 1DQDL 1RZJH 4JJ5A 4Y5XB 4JFXB 3V95A 2DWEB 3MOBL 2D2OA 4IOFD 4BFIB 5I74B 1NGQL 5DEFA 4G42B 5I66A 3FB8B 3KLSA 5HY9B 5LAXA 1A6PA 1LHZA 4JFPA 3MA7A 5KS9B 4WGWB 3LQAL 4RWYH 3Q2CA 4LLWB 4EXPX 3BVNB 4AJ0A 1I3VA 5H8DA 4WWKC 3TBSB 3DBXA 1PYWA 4U6YA 2HJFA 4HQQH 3EJYD 1ZLUK 3BH8B 5LGHH 2M1KA 4ZAKB 4KTDL 3NZ8A 1IM9A 1KNOB 1M6OA 3P40A 3RP1A 3C60C 4NKIH 4C58B 4AM0A 2V2TB 4PJFB 3C60A 3SDAB 5CCKL 3QIWB 1BJ8A 4X4MA 1H3GA 4W70A 1K3IA 1X5ZA 4J2XA 4L5FH 4Z0XA 3BEVB 4PRPE 1QBAA 3DIFA 1X3DA 5D6CA 2WBJC 1S9WB 2BNQA 3OAZH 4FTVD 2WBJA 5D70L 1UQSA 3QQ3B 4OF0A 1AO7E 5IBTH 1JGDA 1WBZA 3MBED 1FNLA 1Q8MA 5DRZA 1CDBA 3BKCH 3SKUD 4PV8B 4C56E 4I48B 1XGQB 2VLME 3BKJH 4LDOB 1DZBA 4JZJB 1ZGLP 5TDPB 3HMWL 3B43A 5E95B 1NCUA 1SVZA 1GHFL 1VGKB 3CFDB 4JDZA 3GIZL 4YJZL 2YRLA 3HTLX 4NCDA 4U1MB 1Y0LA 1IGIL 3TBTB 1PG7X 3VFWA 3V4UH 3BDBA 1EEQA 5IB1B 5EBWB 1ACYH 1MFEH 1G1CA 1MHPL 1RJLB 4OAWA 5B4MC 4H1LB 1QR1A 1A4KB 5SWSE 3I6GB 1G6RH 4XX1G 1T0MA 4WHCA 1BWWA 4K3EH 2R69L 3KYOA 5BVPL 5I16B 2ZPKH 5C6WH 4P59H 4PB0L 3CFBA 5SWZE 3DX7A 2DD8H 5CSBA 3NABL 3UTPE 1T1YA 1NSNL 5JDJA 3QIUC 2AK1H 5IEKB 3NIGE 4UT9L 4JRXB 3QIUA 3ARYA 3OGCB 4HC1A 4NN7C 4YC2C 3I6LD 2O5ZH 2GKIA 3FB5B 4PLKC 4O2EB 2BY0A 2DKUA 3OV6A 4PJHE 3NACL 1W72B 4MXVE 4NNXB 3OKKA 1QKZL 4DUVA 4RQQB 1INQB 5E0QA 5GS1C 1HDMB 4B5EA 1SJEB 3HUJB 5GS1A 1YEJL 2NY2D 2JTDA 5CUSL 4M5ZH 3D3VB 1JBJA 1ZE3C 3MLVH 4KJQC 5L6YL 2JKXA 3IB4A 3HZKA 3B9KC 3UTZB 3B9KA 2QQKH 4YHNB 1FAIH 3R06B 2C1PB 3HC3L 3T2OA 5IB2B 4FQ1L 4K9EC 3V4PH 4YNYA 3V52L 5T33H 4PRNB 2XT1B 1F4WH 1EDQA 1LO3L 5JW5B 3MRIB 1A7NL 3Q5YA 1FL5B 3IAPA 1ZHNA 4Y16C 3DVIA 2C3VA 4WV1C 4PLJC 3OJMB 5K59E 1MCFA 5ACLA 1TETL 3MV8B 2EH8H 1V7NL 3V0VA 4X4YA 2ICWJ 4I4WB 4MQXC 3KPNA 2R9HC 4N8VG 2RFXA 1WQVT 4WHYH 2XQBH 3U4BH 1QNZH 3GSXB 4LCWE 1FNGA 3GSRA 4N1HB 3HE7A 3QHZL 4U1NB 1JJUA 3RX5A 4LKXB 4HUNB 5INCA 1TJGL 3JXAA 4KZEL 3RY6C 4POZD 3EO9H 3LB6C 1NC4B 5D5MF 1BJMA 5DO2D 3S96B 3G9AB 4F7EA 1MQKH 3FO9A 1JK8B 5ICYA 3C9NB 4OZHA 1HI6A 4LSTL 1K2DB 2DQGH 2EDYA 3AVEA 5DJ0B 4XMKL 5D8JH 5GISH 4PP2B 2CLVB 4WY7H 1S7XB 4P5TD 1A6WL 3A6OA 1NCBL 5IV2A 5GGRA 3QWOB 2A73B 3LDBB 5DUBA 2BXYA 2XN9B 4QF1B 3PXHA 4LVNC 1J1PH 4ODUB 4IRZL 1WZ1H 1ZHLA 4JHBA 5FHAH 1MJ7H 2W65B 4NO5A 1B3JA 2BVOB 1CFQA 2ED9A 1H9VA 5JOPE 5ECJE 2UY7A 1EJ6A 2A6JA 2AJSH 3VXUA 1KELH 4Z7UB 3DVGB 2CK0L 2WZPD 4LP5A 2V9RA 5DK0A 2VE6B 4JN2A 4L29B 3K2MC 1NJ9B 2VR4A 5B38B 2OR9H 3KPSA 2VNCA 3TO2B 4LRIC 3REVB 5TE7H 1P1ZA 4YXLL 1MCPH 2VR5A 4TVPL 4JAMA 3OB8A 3GB7A 1P5UA 4JPKH 4LVHB 1VFBA 2Z4QB 2ZCLL 3AREC 5ANME 5LXGH 5C0EB 4MNGB 5TQ0L 2GCYA 4KV5E 1CL7H 2AK4E 4X9IA 5GGQH 3RVUC 3BP5B 4F37K 5C3LD 5DJ6A 2FH8A 5DS8B 1A0QL 4UDTB 1CFSA 5E8OA 3EYSH 3WJLA 1WV7T 1QHPA 3U7WH 2NY5H 2QHLA 2EYSA 4GXVL 1GGBH 5E9DB 2X89A 2FBJH 4XBGB 3FRPG 4LPTA 3K2UL 2EIZA 1INEL 4V1DB 2Z8WC 1TZGH 3H42L 1X5HA 4TULL 1JWMA 1O7SA 5ERWA 2ADFL 1FPTH 2XG5A 1CDCA 3O6KL 2DF3A 3CVHB 3RAJL 3T4YB 4CDGC 2IEPA 4BKLA 1ZKAA 4OJFL 5EZJB 3DVNA 4PJDE 5D93B 3O9WD 4RSVA 3HAEG 5A16A 3HZYA 2QLVB 3SO3C 2YZ1A 4LSRL 4FFYL 5EN2B 5EORH 3L1OL 1R3KB 3L3OB 2FJGA 1MCLA 3CAFA 5DD1H 5CLTA 2VWEC 3OSKA 2EE2A 5IFJB 2EECA 3QFDA 1I4FB 5CD3B 1U93B 4RGMC 5KVDH 2F58H 2OSLB 1ZSDA 3VFMB 1R5WB 1DQJB 1U3ZA 3J7HA 4XVTL 4DN3L 4K8RH 2IAND 3U36B 1OD9A 1UC6A 1N5AA 4POYA 4P3CH 4LNRA 4EDXB 3BWUC 3MREA 3CFEA 4ZSOB 2HKFH 3O6LL 3UZEA 1F58H 2P43B 5LGJA 3UTSB 4JN1L 1JNHB 1CIUA 1F4HA 5L7XL 3S7GA 3U4EA 3MRHB 3O8XD 3NPSC 3I6KB 3GBMH 4BZ1H 3BZ4B 4HXBH 2Q87A 4IRJB 3VXRB 5FB8A 3QG6B 1ES0B 5E8DL 3L3GB 4QYOB 1MH5A 3FO2A 5EOTB 2CRZA 5DZLA 1FYTA 4UQ2A 2LAGB 1YNLH 4HUUA 3EDEA 2X4OB 4E41A 3MJ9H 5F9WB 3MRKB 3AUVA 5IEHB 3WFHA 1DUZB 3VD4A 4ZAKD 1BJ1H 3CMOH 5I73B 2EE3A 3RTQC 3BZEA 3C5SB 3GBNL 3RTQA 4Q97A 2H3NA 3QNXA 4KI5E 1G7HB 1A5FL 3LN4A 5A3IC 1S9VA 3FB6A 4KH2A 1PX3A 2FSEA 3LEXB 1N26A 4RFNB 1GSMA 2C3WA 4WW2C 5C9KA 1FFPB 3QUYB 4MD0B 4HSQA 4ONGH 2HT4C 2ZUQB 1CE1L 3T0DA 5FYJL 2NY3C 3RVTC 3RL1B 3MLZH 4ZTOH 2D9QB 1GCFA 3CFKB 4RGNC 2OS7A 2A0LC 5EOCJ 3RVWD 3MRLA 5BO1L 4ZPVA 3OKEA 5EBMB 1LP9F 5EO0A 3F65A 4YPJA 2VZSA 3JV6B 3OAUH 2HKHL 5E8NB 1KN2H 4KKAD 1TZIB 5EU6E 3VA2C 3WLWC 2APXA 1QLEL 3LQAC 1U3HC 4Z5RA 1NGPH 4S10A 5IM7B 3L3IB 4KQ4H 4ZUVA 1CQYA 2J6EH 4JB9L 2G2RB 4L9LA 1JNJA 1I3RA 4GBXC 4Q58C 5LGKA 1YNKL 4PJ5B 5BXFA 2XQYG 1VA9A 3C8KA 3MRGA 1ETZB 2CXGA 2YWYA 4KMQA 3KPQA 1T2QH 1G1YA 3OJDB 5TDNA 4M7KL 4MX7A 1FV1B 1N4XL 5DUML 4P5KA 3PGDB 2IH1A 3V9FA 4TSCH 2NPLX 5GJTH 4HS8L 3TLRA 5L88L 4LVEA 2DN7A 3L3HB 3MODH 1FLTX 2CH8A 2I9LB 2X1XR 5ITFB 4MAUH 3OKYA 3UDWA 4S2SA 1DP0A 1QD0A 5CBAB 4JRXD 5I8EB 1S78C 4J6RH 1LO0H 1M7DA 4NQSB 2X4TB 1MI5B 4GAGH 1F4YL 5C0RL 2DQUL 5KJRL 12E8L 4L3EE 5HGBA 3NVQA 5J12B 3AXLA 2NZ9C 3C09B 1JF1B 4R9HA 4Y5YC 3GNMH 3LKSB 4W81A 1RZJL 4FQPA 3SDDC 3J8F7 4X6CF 5ID0A 2H32B 3SDDA 1KPRA 2LTQC 4WEBH 2VSDA 4HHAB 3D3VD 1CXKA 3X3GH 4DEPC 3DYPA 1E4KC 4XPFH 1ED3B 4ERSH 1AI1H 5GGUA 4TSBH 4PJ7B 4FFWC 4P46D 1LE5B 1YEEH 1U8NB 4ELMA 4RWYL 3LN5A 1TLKA 2XZQH 4A2LA 5IFAH 1RD6A 2IPUK 4HQQL 4LCYA 5H37H 5CJOH 5LGHL 4NQDB 2DWDB 5KAQF 4KKLD 4NKIL 1DUYB 2GJ6A 3LAFA 4L5FL 5DFVC 3V6OE 1JNNH 5T3XH 3NFNB 2LAAA 3TYFA 15C8H 2NY7H 3LOWA 3VD7A 3D0LB 3AU1A 2KQNA 3MV8D 3WIHH 4XGZB 5BS0B 1YMMA 4XP4H 2APTA 4WHTA 4P2CG 1EFXB 3X14A 4GRWF 4JO2H 4QGTA 5IBTL 2CO7B 4P2QE 1T89C 3VGDA 5SV4A 3BKCL 2Y1VA 4KK8D 1DANT 4G7YH 5KN5A 3ZDZE 1O5DT 1RIUH 3BKJL 5GRVK 1P9MC 4WTWA 1P9MA 4M4PA 1NC4D 3WNOA 4ONHA 4XVUD 5IW1B 5F8QC 4H88H 2XFXA 1EHLH 2VQUA 1YEDA 3MUJA 1F11B 2YD8A 3WFBH 5AYQA 3IFOA 1UWGH 2VXTH 1ZT1B 1IZKA 5JORA 3V4UL 1GZQA 3ARDC 4LSQH 3GDBA 1ACYL 1MFEL 2SEBA 3C6LC 4IM8A 4PGJA 2R1XB 5FCUH 1WT5A 1G6RL 4ZDHB 1CDGA 1HEZB 1SJVA 4C55A 4XWOC 3KS0J 3CNKA 4K3EL 2ZPKL 1FL6B 4P59L 2VABA 4GG8B 3OKLB 3R1GH 2PXYD 5DURB 1YYLH 2DD8L 4EIZC 3K0WA 2ZUSA 5FKPA 1X5FA 5DHVH 3CSPA 5F9DC 2W38A 1EAPA 2AK1L 3MRQA 3UXFA 2NCMA 3GIVA 2XWJB 3W9EA 3WXWH 2O5ZL 1F4XH 3MA9H 3QUZB 4KXZI 4X7TA 1ZT7B 1BOGA 1WEJH 1WZMA 3S9DB 2H2SC 4U1HB 1CE6B 2ERJC 5C0ND 2EDXA 3TNNA 3DX9A 4M5ZL 3GSOA 4P23B 1ACZA 5DI8B 3MLVL 4WI4A 3L3KB 4G8EB 1U58B 2Y36H 1G7IA 4NO2A 4KVNH 4EUPA 4PJFF 4Y4HC 4JKWA 5E9DD 2QQKL 4Y4HA 1FAIL 3IAQA 1B90A 1TENA 4KUZH 5JW3H 5JOEA 2NY6B 3RI5F 5I2IB 2ATPB 4AENA 4J8RB 5J11C 1P4BH 3V4PL 4V1DD 4D8PB 5T33L 3H2WA 3VJ6A 1F4WL 3EOAB 3WEXA 5D7IA 2VAJA 3D48R 3TVMA 4YPGA 1LEIB 1MCCA 2BHYA 5ESQA 4ZNEE 2R0LH 4RZCB 3QQ9C 5E6IA 2EH8L 4EZMA 1AR1C 2JJSA 3QUXB 2NTSP 5I9QC 5DRWB 3FQWB 5DJXA 1JIBA 2XQBL 3U4BL 1IAKB 3MO1B 1QNZL 1HSBA 1I9JH 2NX5A 3F7QA 1TNNA 4KPHH 2OTWA 3MV9E 2K3TA 3IETB 3EO9L 5GGSY 4ZYKB 5I1LA 2F8VA 4EVNB 2HFEA 4FMFA 5DD6A 1RZ8B 4M8VA 1MQKL 1ND0B 4UTBH 1XGPA 3CFJB 4ZFFB 2UWEE 3VD5A 2DQGL 5D8JL 5GISL 3P4LA 4M61A 3JZ7A 1CICC 3UTSD 3AMKA 1KB5H 2HJKA 5IMLB 3HR5B 3HG1B 2D7PA 1CICA 4AL8H 5MEQA 4WY7L 1MIEH 1N3NA 1BIIA 4ZO6A 2M2DA 2P46B 5CMAA 1K5NB 5I8KH 1YZZA 3UJIH 3GMNB 1J1PL 2GEEA 4I1NB 4IRJD 3VXRD 1WZ1L 1NCAH 3RHWK 3CC5A 1HILB 5FHAL 3TJHD 1M71B 1MJ7L 5E8EA 1CVRA 2AJSL 4O51A 1KELL 5F7MC 1UEYA 2E6JA 1T21B 2IBGA 3EDDA 3VH8A 5CIPB 4UNVA 3P4NB 5IJKA 5AYUH 5I0ZA 4BQ6A 4HKZB 2G9HB 1SEQH 2R0WH 2NY4C 5J9PA 2OR9L 1NBZA 2ARJQ 3IDYC 2AEIT 5TE7L 3PDOB 4KK5C 1MCPL 3SGKA 5D9SA 1FG2A 3UPCA 1FIEA 2HH0H 2R1WB 3QHTC 5JMOC 4JPKL 3CD4A 4Y5VC 5LXGL 4PJ8C 2V17H 3ZKSD 1MVUA 4ZOCA 3VFNA 3MRCA 1O0VA 4Y5VA 5CEZH 2NXYB 2NQCA 1CL7L 5GGQL 3QUYD 4U7SA 2EYRA 3MV01 1UH2A 3ULSB 4MDJA 4MVBD 3EYSL 3C5JA 3SGDH 3TYGH 1T66D 1UWEH 1G7PB 3U7WL 2NY5L 1KYOJ 1GGBL 3NCMA 4JO1H 3T0AA 1II4E 2V2WB 3UEZA 5KVEH 3KR3H 2FBJL 3I02A 5EU5B 4PJIB 1MREH 2FEEI 1L0YA 4YHKH 1DLHA 2V7NA 5F1NA 4JDVB 1FZKA 1WC7A 5IB4A 4CU8A 1TZGL 4X6BB 3ME0A 4F8TA 3KLHD 2A2QT 5DA4A 1FPTL 2MQ0A 4CBPA 3HI5H 1ERNA 3W0WB 1LGVA 1S9XB 2DM4A 4OFYA 4PGCB 4JFOA 2CDFB 1PBYA 2H8PB 4R7DB 5EORL 3PGCA 2OZ4H 4NHUB 1A6AA 5DD1L 3VGFA 2GTZB 1T5XB 3ESVF 1JGLH 1IL1B 1IKFL 1D5BB 4MWFA 4Z76B 5KVDL 2F58L 5FGRA 1X7QA 1PVHA 4DVBA 1Z5LB 4YBHA 1HHIA 4P3DA 4QRUA 1MFAH 4K8RL 1PQZB 3RUGB 1OAUH 2XTLA 3MRPB 4DKEH 4P3CL 3WN5B 5B3JE 3MRBB 3ARFA 4N0UA 5HVGB 1FLRH 3W81A 2CIKA 4KDVA 3WL9B 2YMXH 4ZUSA 2CIIB 5DJ2B 5GS0H 5HGDA 2HKFL 5I18H 4GG6B 1KSRA 1HH6B 1F58L 5HYSA 4D9QE 3FN9A 3PDDA 1IGJA 2Z8RA 5DQJB 1EVTC 2ATKB 5DRNB 3W2DH 2PR4H 4HKJA 5JLZA 5T3ZH 5F9AC 1NGZB 1G7JA 3B9AA 1MF2L 2FD6H 3ZE0E 5DT1H 1HYRC 1GOHA 3GBML 4BZ1L 2CDEA 4HXBL 1F3DJ 4OLUH 1X5LA 2CK2A 4OZFA 3SY0B 5FO8A 3TT1H 1CK0H 2X70A 4ZFGH 1JWSB 1F3RB 1T0PB 1YNLL 4JFFA 3P30H 3UTQA 4XVSH 5I6XC 4XP1H 3MJ9L 1HHGA 1Q0YH 1KF9B 2EDKA 1UZ8A 3GZKA 4NQDD 4WFFE 5J7CC 1C16A 1AD0A 1UM5H 3MJ8B 3QUKA 4YXHH 4YZFF 3ES6A 2Y06H 1LNUB 4K7FA 5F88A 2YSSA 1FZJA 2V5MA 2AQ3A 5KVGH 4Z7WB 2V7HA 2VC2H 2VDLH 3OMZA 2P8MA 2EIEA 4ONGL 1RK0B 4YIQA 5AUMB 2Y25A 4NT6A 2FNBA 5FA3B 3VGEA 5BS0D 1G84A 4OD2A 1R5VA 4QRQA 3MLZL 4ZTOL 1RZJC 2VWEE 4Y4KA 1EFXD 4QCIB 3L7FA 3PWVA 3BWAA 4MCYB 2BHUA 1Z9OA 3WKMH 1A3LH 2BOBB 1J0IA 3MMEB 3IVKB 2D31A 3X13B 5FF6A 3OAUL 5DJDB 2ESVA 5EO9B 5CZKA 4EI5C 1KN2L 3QDJB 3SCMB 5CFHA 4PRDB 2Q6WB 5CJ5A 3RZCC 1RZIA 1WWCA 2L7JA 4OZ4B 3JSSA 1NGPL 4CUCA 2ZJSH 3GSVB 4KQ4L 2J6EL 2N56A 1JP5A 5E2WH 1RAMA 1RK1A 2Y6SC 4WUUB 4TQEH 5JR1H 1OGAB 3EJZD 4HS3A 4OGAC 4YHPB 3P9MA 1T2QL 2CQVA 1KB9K 2BP3A 3DUUB 4DKFH 1FN4A 1A7RH 3WS3B 4GRLB 4LK4A 4JFDB 1MAMH 4TSCL 4L4TE 1OOAA 5GJTL 3B2UD 3TN0D 1FVCA 5GRJH 1FP5A 4Z77B 3MODL 4C54A 2C3GA 1J10A 4XPBH 5DURD 4MAUL 5EBGA 2VLRA 2J8UA 3MNWB 1R3HA 2E9JA 2M8XA 5EUOA 5D7LA 5EFIA 2V2XB 4JFYA 4J6RL 3C8HA 1LO0L 3RGVC 5BCAA 2WBKA 4GAGL 2JK5A 4P48A 3MV7B 2Y7QA 5KBNC 3QUZD 4D0BB 5F9JB 2FGZA 4LCCC 2AJ3A 3QPXH 2AV1B 3GNML 3WJJC 2OX5A 1HNGA 3NCCB 3QCVH 4J1UB 1UZ6E 1AXSA 4WEBL 4P23D 2EC9T 3X3GL 3M07A 2WK2A 3KPRE 1J7VR 2L7UA 3G5ZB 1IM3B 4KJWD 4ERSL 1AI1L 4NHCH 4RGNE 4U1KA 4TSBL 5JA9A 4S1QH 1WF5A 3IDUA 1YEEL 5T1MB 5IFAL 2XZQL 4PJAB 3MGTA 4I5BA 4CN1A 2UY6A 4JEGB 2NY6D 1V5JA 2VZOA 4PREA 5CJOL 4XNMB 1B2WH 2OM5A 3GHBH 3CXHJ 4MJ2A 2Z8SA 2X41A 1DCLA 1HHJB 4HLZG 1R0AH 3BN9D 4HW6A 1WFUA 1JNNL 5T3XL 2GSIA 2R0KH 1ZA3B 15C8L 2NY7L 3LKOB 1Y18A 5JIPA 3GMQB 1RFDH 5JDSA 1D9KA 1KGCE 1HQRA 3WIHL 3WKNA 3GMOA 3QEQA 2AV7A 4PGBA 4XP4L 2QQLH 1PZ5B 5I71C 2FLBT 3QUXD 5CGMA 4JO2L 1AXTL 1T5WB 3M45A 1P7KA 3V6BR 3MGOB 3QO0A 3QSKB 4M6NH 2ED7A 4G7YL 1RIUL 5MENA 1FZMB 5IKCA 5GRWA 3AB0C 1JGEB 4PP1D 2X1PA 5HI5C 1TQCC 2VZUA 1D6EA 3LKQB 5F7EH 4H88L 1QG3A 1EHLL 1BBJA 4NM4H 3ZTNH 3SKJH 5IOPA 5GGSB 3F7YB 4MJ6A 1T1XA 3QG7H 2NW2B 3WFBL 5ALBH 4PJCB 5IBLC 1UWGL 4HIEA 2VXTL 3FCTA 3HG1D 4LSQL 4LHUA 4TUOA 1H3UA 1GZPB 5FDWB 4LMQI 5FCUL 1BP3B 4WO4C 4V2BA 3QB7C 1QBLH 4JREC 4WO4A 4MD4A 1NGWA 5CAYB 4PRIA 3EW3B 4DVRH 4IOIA 4XPAH 1KTKE 3R1GL 5KSBA 5I1KH 1YYLL 2FYYA 1VADA 3BGFC 4KKBC 2E7CA 4FQHA 3TA3B 1QQDA 5KG9A 4UBDC 4HEPG 4D9LH 5EULV 2CDGA 3WXWL 2EKSA 1S7WA 3KPPA 4OQ1A 1F4XL 4MGXA 3VE0B 4N5UA 3MA9L 4W6XB 4QTHB 4Y4FA 2C26A 1WEJL 3DGCR 1PSKH 4PJ7F 4IMLA 3O45A 3VG9B 2ADIA 2LE9A 4P2OB 1SHMA 1AGEA 2NXYD 4XNUH 4FQIH 1QVOB 5SWQA 3D1MC 2OI9C 4PRPB 3QUMH 3G6JF 2Y36L 4XNYH 4HJGA 2IAMB 4KVNL 5A1AA 2XTJC 1S7SA 43C9B 3Q6FB 4PB9H 3HAEB 5JHDA 1JZ2A 2A6KA 4HUWA 1JMZA 4KUZL 5JW3L 3T65B 2BJMH 1AO7B 5DDHB 4GUPA 1NKRA 2FO4A 1P4BL 3INUH 1KTDA 4HKBA 4C56B 5DQDH 3ROLB 4JFHD 4PY7B 1T7WA 4PRAA 4WEMB 1MCRA 2DIJA 3AY4A 3DMMB 3REWB 5EOQH 4NNYA 2VISA 1XCQB 3MNVB 3W0WD 3CFCH 1DQLH 2R0LL 2QTEA 3V5KA 4DGYH 4MNQE 4ZXBB 5HVHC 3MUZ1 1KEMH 1SM3H 2BVYA 3RPIA 1D5MB 1XH3A 1KIPB 1K4DA 3G6DH 2MKWA 2X1OA 1F02I 4AT6B 3QULA 4WU7B 3F5WA 4UUJA 5DJYA 5JIHA 4ZD3H 2C7UA 4ODTH 2I60H 3T04D 4X98B 4Q7DA 4UDUB 5L2JB 1I9JL 1I1YB 1MRCH 3K4ZA 4MSWA 5SWSB 4KPHL 1DBKH 4PJBA 1W2KT 1NMCC 3QZWB 2O26U 2NY5C 4GW4B 4K3GA 4DCQB 4GKSA 1E27B 3G6AA 2A1WH 2R56H 3IFNH 4UTBL 2XWBB 1XF2A 4M6AA 3GI8H 2VKXA 5SWZB 2NNAB 4RGOH 1T04A 1JMXA 2P24A 1KPVA 3BJLA 5DRXA 5KSAD 2Z92B 2ICEB 1KB5L 4NC2B 4AL8L 2JB5H 5B21A 3VXOA 3PDGA 1MIEL 1K9TA 2PYFB 4Y1AA 3IGAB 3PNWA 5L2KE 4WI3A 4JFEA 3UJIL 5F71A 5E5MA 2F5BH 4XC1H 4PJHB 4D9RE 4DZBB 4N0CC 5IVXF 4OCXH 1U8HB 2QADC 2Q7YA 2WLZA 2G5BA 3OPZH 5DMKB 1NCAL 1RJYA 2AXGB 3VD9A 4YHIA 3BPOC 1A64A 3T3MF 4K55A 5SV3A 3IKKA 4LQ1A 3I75A 2EXYC 1NH6A 2P49B 5AYUL 3ARTA 3RWIA 5JA8B 3U79A 4K8RC 4RIRB 2J4WH 1SEQL 5DK2B 2R0WL 1ZLVK 5IR1B 2DQCH 4LLVB 4N1EA 3V7AE 1LO5B 3BIKB 2ZCKH 5GXBB 2WIIA 2HH0L 5IIEB 1OSPH 4EDWH 4I2XA 2ZOLA 2VLLB 3CMGA 4XP5H 2V17L 2O61A 1KLUA 3RKDD 5CEZL 3K80A 3QJHB 4IIQB 4PJGA 3UAJC 4NQCA 1G7LA 1QFWI 4KY1H 3EFDH 1JUFA 3TYGL 1UWEL 4F7CB 4JO1L 1N8ZA 5FYLD 4RFOH 5KVEL 3KR3L 4U1SB 2NLJA 3JVGC 5C70A 1MREL 4N90E 4YHKL 1ZLVH 2CRYA 3JVGA 1YA5A 2W9EH 3QDJD 3SCMD 5JOFA 5GSVA 5IROA 4DK3A 3TF7C 5I30H 3P4MA 1C12A 4PGEA 3MJ9A 5T5NG 4QRRE 4WI8A 3HC4H 3RWEB 4WUUD 1OGAD 4P0DA 2HP4A 1B0RA 4KJYA 3HI5L 4H0IA 2RHEA 1TITA 4XP9L 5C9JB 3VFVA 1KXVC 3AMLA 1T0NB 3F7VA 5H94A 1LK3H 4MS8C 5C0AE 1FORH 1KIQB 2APBA 1AGFB 1IAOB 3FONA 2OZ4L 2XXCB 1OTUD 4GRLD 3GJEB 1IAMA 1JGLL 2HT3D 4AEHH 2HTLD 4XBEH 3MLPA 2DS4A 4F57H 4IBLT 3FT3A 5EO1B 3PWJA 1MAKA 3IDIB 2DLHA 1MFAL 4L8SA 4JQVC 1OAUL 4YHYB 3IJYA 4JQVA 4DKEL 5JPMB 3NBNA 1JHKH 5E00A 3EZ8A 1FLRL 2YMXL 3P9WB 1EEZB 3CSGA 5GS0L 1IC1A 1W8OA 5I18L 4P5MB 4P2RE 4GS7B 5GZOD 3MV7D 2J6EA 2E9IA 2BCKA 2PR4L 3MR9B 3W2DL 5BRZA 1UEMA 4QOKA 5CZXC 1BF8A 3ARVA 5T3ZL 4PTTA 3FT4A 3SE3C 4IRSB 2YD6A 2FD6L 4AEEA 5DT1L 1D6VH 2OTUB 2BVQA 4APQA 1OAQH 1ODAA 3HLAB 3NTCH 2F53E 3CIQA 4OLUL 4LLDB 4ISVB 3TT1L 1CK0L 1LE9A 1FSKB 1QZ1A 5ANMB 4ZFGL 4WDIB 3LY6A 4L4JA 4UNTA 1IEAA 3H8NA 3VFUB 4HBCH 1BREA 2AK4B 3IJSB 3P30L 4XVSL 4XP1L 1Q0YL 4M7LT 3I6LE 4TTDC 4IJ3B 2FWOA 3KWWA 1UM5L 4KKNA 4YXHL 3BPCA 3IT8D 4GLRI 4CAGA 4A6YB 3TM6A 2Y06L 1AGCA 5B8CB 3CDFA 3C2AH 3NN8A 4Y2DB 4ZG1A 1JE6A 3T8XA 1G9NH 5KVGL 2VC2L 3KNBA 2VDLL 3PWPA 4O58H 4EN3C 3JV5A 4PR5B 1QUNA 1SQ2N 2BY3A 1DE4B 4MDIA 3U48A 2OCFD 1ORQA 1KJMA 3MNZA 3MTRA 4GAYA 1HXYB 1ZLSH 3VWJC 4NPYB 2BC4B 3HE6D 2XXMB 2QR0A 4RAUB 3EFFA 1NC2A 4PJDB 3WKML 1A3LL 4U1IA 3EHBD 1XR9A 5IVZA 5IQ9A 2OJZH 2HG5A 4M6OH 5FYKD 1JFQH 3L5WB 1YEHH 1DDHB 3G5VA 4BFEA 3QDAA 4KKCC 2ZJSL 1DEEB 4LLMB 3ZE1E 4ETYA 5E2WL 2I9TA 4PTUA 4G8FA 1OTTC 4TQEL 1A1OA 5JR1L 5J1AB 3QEUA 4MA3A 3JWNC 4M8QB 3PJSB 1M7IB 4NQXB 1AQDA 3KXFE 4OLXH 2EYTB 4ODBD 4DKFL 3VA6A 1NGXB 3EAKA 1A7RL 1HNFA 3X3FH 2GTWA 3QO1A 3RUGF 1MAML 3ZKQD 3CH1A 4HUVA 3OX8B 3RNQA 1D5XB 5GRJL 5E7BA 4HWBH 2EDRA 1PDKA 4OGYH 1Q9LB 1CDIA 4XPBL 2X4SA 3LKRB 4PS4H 1S8DB 1F6LL 4MMZC 3ALPA 5TE6H 4WW1A 3ULUH 3BIBX 1OY3B 4LLYB 1QEWA 4X9BA 2CXKA 4O2FA 3GSUB 2JLLA 2VXQH 5HHOA 3BPNC 3DTXB 1C5DB 4LLAA 1QYGH 5CJBA 5T1LD 3QPXL 3K3QA 3HB3C 1MCKA 2GAZB 1A1NA 4HZAA 4P2OD 3TZVB 3QCVL 1FFOB 3T1FB 5D2NA 2VH5H 4EUPG 3PGFH 2W9LA 3RX8A 4NHCL 5DHYB 1RV6X 4S1QL 2IAMD 5IMOA 2C4XA 4X6CE 3JTSA 4HPOH 4NCC2 5DJ8A 1I1AC 4Y19A 4M93C 1AC0A 1B0GA 5D1ZC 2R8SH 5E4EB 1EEUA 1AO7D 5DMYA 5F72S 2GSGB 5EIVA 1B2WL 3DRTA 3GHBL 3OF6D 1DQTA 3RIAK 1DBJH 4D3CH 1R0AL 1UACH 4JRYA 2VLMD 5EU6B 2R0KL 3DMMD 4JFQB 43CAB 1KTRL 1RFDL 1ZWIB 1QO3B 1NFDA 3G08A 1NAKH 1TCMA 2QQLL 3AROA 3FOLB 4GFTB 3JV4A 3V4VH 3QH3A 4BSVA 3WO4C 1BZ9A 4M6NL 1S9YA 3BUTA 3ILQC 4YUEH 3WIFA 1FDLH 35C8H 3ARGA 4KRPB 1SMAA 1UT9A 1QACA 1AHWB 1LDSA 4G9FA 4FFVC 1LO2H 1HXMB 1J18A 5ESAA 5F7EL 4NM4L 3ZTNL 3BZFA 3SKJL 3LPWA 3QG7L 4PJ9C 3WHE0 5DFTA 1RZGA 5ALBL 5D7JB 5SWZD 4PJ9A 3CZJA 1W0VA 2EEDA 1MHEB 5JW4R 2FGWH 3SJVA 3UTPD 1HK6A 4H26A 1Q94A 4U1LA 1ZTXH 1UFUA 2OQJA 3NCEB 5TF1H 1CTOA 4NGHH 5ADPH 5EZOH 5EU4B 1TDQA 4GT7A 1QBLL 5FAAA 2R2BA 2VITA 4OFVA 1KJ2H 2AXFB 1UJ3B 1DVFC 4ZFOB 3SKOB 1U8MB 4DVRL 4GXUM 4XPAL 2CLRB 1ONQB 4XXDA 3VH8G 4J4PC 3QDME 5I1KL 3FHQA 3RDTA 1BLNA 1GGCL 5FYJU 3FAWA 3HFMH 2IADB 4F58H 3GK8H 3VXNA 4D9LL 5HHME 4YK4C 5I0DA 1FNFA 3HRPA 1OARH 3PWLA 1VKXA 3QAZC 2A6IB 4JE4B 4NWUH 1P7QA 4NJ9H 4ACPA 4PJEF 5C0GA 5I1AA 3TGXA 1YEIH 4G8GA 4JDTH 4B7IA 1PSKL 5ICXA 3QNZB 1ZHBA 3ALXA 4HAGA 4FQQA 1RY7B 1KB5A 3OR6B 2PNDA 4GSDH 4XNUL 3GGWB 4FQIL 4PJAF 1KTLA 5CKGA 1KLGB 4BH7A 5IJVB 4NKOB 3QUML 4F7TB 1CD0A 2HMID 4XTRD 4HLJA 4H5SB 4XNYL 2O5YH 3T4AA 3RWFB 4PB9L 5E99H 3DLQR 1YN7B 5C0BE 1GGYA 4JGUA 4UOJA 2H45A 5I1DB 5HHQB 4NOFA 4NDMA 2HVJA 1J05A 3QXTA 2ZSVA 5FHBH 1JHTB 3INUL 1UXSA 4NO3A 4GRMA 4HS6B 5DQDL 5JZ7C 1TVBB 2IQAA 1J0KA 2WINA 1NCDH 5BZDB 5EOQL 2XKUA 1XGYH 1FCGA 2DYPB 3VXPA 5A43C 3CFCL 1DQLL 3BD4A 4DGYL 2BK8A 2X4NB 3BO8B 1FL3A 3ZKXB 5EC1B 3BKYH 4HDIA 1KEML 1QFWM 1JPFA 1SM3L 4U0RB 2PTTB 1PX4A 4G6AC 3G6DL 3BISA 4ZD3L 1HSAA 4ODTL 2I60L 4RX4A 3O2DA 1MRCL 1QR4A 4P4KA 1I7RB 3TPKA 4OCSH 3DX6A 1DBKL 3DARA 1PG7H 3ZYIA 4R26H 1U92B 4C83A 5DSCB 1U0QA 1OB1B 1MRDH 5D5MA 5AD0A 4R90H 3DX8A 1H3TA 3VXMA 4Z8FH 5HYSG 2A1WL 4XI5C 2R56L 1IGTB 2PN5A 3IFNL 2DICA 4JFPB 3GI8L 5H35B 1MCEA 5JOPD 4RGOL 2ZKHH 3G5XB 4YFLI 4CMHC 1CTNA 4WWKB 2JB5L 3BHBA 1BJ1J 5E2UH 1NUFA 3RVVC 4HKXA 3FO1A 4KGLA 3C60B 4IRSD 4OZFG 2F5BL 4XC1L 4LEOB 1AGDB 5D71H 4OCXL 3F6LA 4X6DF 1FC1A 1IAII 3OPZL 5IF0B 3WFEH 1NANI 2BNQB 2XTJE 3A67H 3MV11 2XWTB 4NRZB 5ETUB 3HZMA 2Z0BA 1T2JA 2AK4D 5GIRB 4LF3B 1WBZB 3O81A 4L4VD 2J4WL 4PJXE 1IGYA 4X6FA 4PG9B 2DQCL 1CGXA 3BESR 4NM8H 2BSED 1CGYA 1PJ9A 1TTFA 2ZCKL 3TBVA 5GS0C 4QT5B 1A7QH 5IK3B 5B39A 2YD2A 4Y2DD 1OSPL 4YEFA 2ZUUA 4EDWL 2YA0A 4XP5L 1RHHA 1JF6A 3WDJA 3ARWA 5FO7A 3DV6B 1HCVA 3P77B 1QRNA 1CBVH 3RA7H 3VMNA 5I75C 3RWGA 4KY1L 1A4JB 3EFDL 3QXAB 4Q9RH 1JPST 2FIKB 3K81A 5FECA 1OTSC 4RFOL 4JM2C 2V5SA 3IXAA 3WV0A 5K9OB 4JM2A 3A6CH 5C8JA 1J8HE 3FOMA 3RWCA 3S4SA 3UTOA 1H15B 2IPKB 2W9EL 2VTFA 2XPGB 4CVXA 2GITA 2LU7A 4NQUA 5I1CH 4D2NA 4UQ3B 5I30L 3O11A 4FTVA 3DX7B 1MJ8H 5C07A 2YC1A 1CF8H 2DQFA 3MV9B 1T1YB 3IU4H 1I7ZA 3LKNB 1A3RH 2R29H 3QIUB 1AIFB 3MV8E 3FQNB 4UIMB 3P9LB 4XCEA 5AAWA 5CBEB 5DJCB 4E5XB 1LK3L 1FORL 4NN7B 5LG1A 4OF3A 3UJJH 5J1SC 5EIIA 3CUPA 4AEHL 3O6FB 5IUSA 4XBEL 2CKBA 4KRNA 3U6RA 4F57L 1VDGA 4Y0GA 2IF7A 5EOCH 1KLFA 3ZKMD 4HWNA 5GS1B 2BMKB 2X42A 3T0EC 3U9PH 2EDBA 5HGAA 3RNKB 2G60H 1EXUB 2OK0H 4Q2ZB 3IJHA 1JHKL 3NIGF 4UT7H 5DFWH 5E94A 5MHSE 3TC9A 4OGXH 2YRZA 1M05A 4OZGA 1MCWW 3QJFB 2A9NH 3WLBA 2WSKA 2E9WA 3O3AB 1GRWA 3EYUH 5C0DA 3KPLA 2PO6C 5IHBA 3ULVH 2NR6C 3GSNA 2D03H 1ZXQA 1D6VL 2X4QB 2ZG1A 3AFLA 1WTLA 1IEBA 1OAQL 1F6AA 2YPVH 2BERA 2Y5TA 3MUHL 3NTCL 1JYWA 3GSWA 3MLXH 5BVJA 4Y16B 4WV1B 5IB5A 2FZ3B 3SE9H 5E2JA 1NLDH 2OR8A 2X9WA 4HBCL 4HWZB 5FOBA 5EBLB 5C0CE 5HHNA 3DETC 2FB4H 1W0WB 5HDBF 4LLUB 2Z91B 5I76A 1FNEB 4MCZB 1MLCB 1WCBB 3GSRB 2GY5A 5DJZA 1X5XA 3DO7B 3G04A 1Q9KA 2J5LC 2P5WE 3VFOA 3C2AL 2AAVA 1G9NL 4G9DB 5EU6D 3BGAA 4O58L 5K59F 3MRRB 1JZ7A 2DOCA 4YZFE 1J0HA 1QLFB 4URTB 5MERA 1JVKA 1WAAE 2H2PD 5HPMA 1D5ZB 1ZLSL 4GMSH 4EQ2A 4BZ2H 2Q86B 5E9DE 3C8DA 5FM5M 1BQUA 1WZLA 3TCLB 1KOAA 2V6HA 3H9HB 1AXIB 4KRPD 1LP9A 3H6JA 4QRPE 4JPVH 1CU4H 2I26N 2OJZL 4LVNB 4M6OL 4V1DE 3ZLQC 4KRLB 4R7NB 1JFQL 1ZHLB 4M43H 1NLBH 1YEHL 4HFWA 1CFQB 5DHXB 1BVKA 4HC1H 2BZDA 5ACZB 1PKQA 1P84J 4KK9C 4ODXB 4OLXL 5DVMA 4HWUA 4E9LA 3ARXA 1BZ7A 4MNHA 4HJ0C 4U4BA 3QPQC 3X3FL 5FK9A 4S1DC 4J23A 6FABH 3RX7A 5DWUH 3CLEH 4HWBL 5E03A 4WHYG 4OGYL 4I18C 1Z9LA 3AREB 4I18A 4YDJB 1QA9B 4PS4L 2PW1A 4JKKA 5E8OB 3KDMA 5TE6L 5MI0C 5JW4M 3ULUL 4P5TA 3H7BA 3GMRA 4NJAH 3RIFK 4NSKB 4ONFH 1T1WB 3UTSE 5C07D 5GQBA 5DMIH 5FKAA 2VXQL 5F7DA 3WFCH 1NKOA 3ECBB 4JR9H 4N68A 4AY0A 1JTOA 4HLZH 3VRIB 1QYGL 4X6EA 3F6IA 4LPWA 5FGBC 4NYLA 2PCPB 25C8H 2DI7A 4BKLB 3E8UH 2UYLA 2VH5L 3PGFL 4H0GA 4W4OA 3IDGB 2JF1A 1Y6NR 1WBYB 2X10A 2HWZH 1A6TA 3RWJA 4ZO9A 2GK0A 3PQYE 4HPOL 3SO3B 5CWSB 3B8SA 3DRQA 1IQWH 5C08A 2LVEA 5EU3A 1T1ZB 2R8SL 1PW3A 2R2HB 2V5YA 5MEPA 5TH2A 3BJ91 3MXVH 3MRDB 5SX4I 3VFRA 2CGRH 4S0TD 3P11H 1DBJL 2ZUYA 4D3CL 1UACL 3MBXH 1S7QA 1YQ2A 1WIUA 3PL6C 4P3WA 3GHEH 2LFGA 4FQCH 5DMGD 2DYPD 2I5YH 4FQ2H 1SJHB 5F3HB 5JQ6H 5JO5B 1EHNA 2G5RA 4E42B 3SO5A 2HFFB 1NAKL 2BSSA 5GHWH 4CADB 3GBLA 2KKQA 3V4VL 2D4DA 4K3DH 4TUJA 3KPMA 3WUWA 4PY8J 4J3SA 4YUEL 1FDLL 35C8L 1QLRA 5J4MA 4U31A 4HIHB 4TSAH 5A2LH 1YPZA 4FQXC 1NFIB 2EE9A 5D1QC 5D6DC 5HI3D 5D6DA 3KLAA 3DYMA 4JANA 1VFOA 1I9IH 3DHMA 4HJJH 4N8VA 1LO2L 3M1BA 4L4TB 5FB8B 3T09A 3W11C 4UNUA 3U9UA 1M7XA 3O9WA 1QFUH 1K8IB 2ARWA 3P73B 5C7XH 5HI4C 1T7YA 1FO0B 1RMFH 2FGWL 4AQOA 3CLFH 4R0LC 4WWKD 1ZTXL 4I0PC 3WFHB 3FFCE 1PY9A 2QKIB 5TF1L 4NGHL 5ADPL 5EZOL 2HLAA 1VACA 1I7TB 5INDB 3ARBC 3C60D 2IANA 1OLZA 2Y5EA 3FKUS 4FQLH 3GSQB 1KJ2L 4G8IA 1LEGA 3HC0A 1GXEA 4JGJA 5HXMA 1HN1A 4WW2B 2BNQD 1YUHB 1BFOA 4JPIB 4PBWD 2RJMA 3HFML 2NY3B 3OR7A 4FNLH 4M4RA 3S3PA 4M9OA 3KPRB 4F58L 3FQUA 4YXKH 3GK8L 3T77B 1U6AH 1G0DA 3MRLB 4RGNB 4LGRB 3UCRA 2H9GA 3RBSA 1I1CA 3O8XA 4Y5XC 1OARL 4BSWA 3PWUB 1OPGH 5J6HB 3MUGA 4Y5XA 1MNUH 4NWUL 2VZVA 5F70A 4JFXA 4NJ9L 5TJWK 1YEIL 4BFIA 3F58H 4JDTL 1X4YA 4G42A 5C0JB 3FB8A 3JBG7 1U3HB 2AEQH 5HY9A 3ZZ1A 3S5LB 1CI5A 5GRXG 1T22B 1IAIM 5KS9A 4GSDL 5DVOA 4O2CA 4LLWA 3QFJE 4FXKB 4GBXB 3BVNA 3NA4A 3TBSA 1UH3A 1WGOA 1FYHB 3BH8A 4Z95H 3OWEA 4LIQE 3UTTE 2O5YL 5J6GB 3D39E 5GRYA 3SDAC 4MX7B 3QIWC 4E0RB 2V2TA 5B4MD 5E99L 3SDAA 4R4FH 3QIWA 4O5LH 4G9FE 2IH1B 1IC4H 3BEVA 4PV9B 3G6JE 3MRMB 5HHXH 1CXHA 4ZUWA 4OV5B 3EYFB 5FHBL 5F89B 2GJJA 1S9WA 2IBZY 3KYKH 2I24N 3QQ3A 4RRPA 1NCDL 1Q9OB 3MV9D 1XGYL 2DM3A 1G6VK 3QIUD 1F45A 3BKYL 5BS0E 3QXDB 2FECI 2A83B 3KPOA 4PV8A 3D85A 1MEXH 2BFVH 4I48A 1RULH 1RIHH 3K7UA 4JZJC 1HYSC 4PLKD 1KENH 4JZJA 2F54E 4K7PX 3BXNB 3ZTJG 4NOBA 2YHGA 3AXLB 5TDPA 3IDXH 4Y5YB 4MYWB 4OCSL 3CFDA 4JVUA 1PG7L 4R26L 4U1MA 3U7AA 2LTQB 1KPUB 1JI1A 3TBTA 1MRDL 3OHXB 4DEPB 4R90L 5ALCH 1HKFA 5DVKA 5GGUB 4Z8FL 5IB1A 4KJQD 5EBWA 1RJLA 1HZHH 4QY8A 3VDCA 1IRAY 5GS3A 2YK1H 1A4KA 3B9KD 2ZKHL 4LCIH 3I6GA 4CW1B 4LEXH 3AM8A 5K33A 3QIBC 2YN3A 2WANA 5E2UL 4X5WB 1WWWX 5I16A 5DYOB 5D2LE 2GJ6B 1EMTH 3D2UB 3Q3GB 3SDXF 4K7PY 1A8JH 2VAAB 5D71L 4NBZB 3VRJB 5F6IB 4JRXA 3WFEL 1QPXA 4Y16D 4OV6F 4PLJD 1BAFH 4AH2B 5DD5H 2EDWA 3A67L 2ZG3A 1RJZB 3FB5A 4O2EA 5IVXE 5DEZA 4MQXD 1W72A 2R9HD 4NNXA 2XACC 1UB6B 1INQA 4H0HB 4RQQA 1HDMA 1SJEA 2X6MA 3HUJA 4NM8L 5CEYA 1J9CT 3E6FB 3GRWA 1FBIH 2Z31C 3PF2A 1A7QL 3D3VA 4AIXA 3OKNB 5KOMC 4ZQKB 2FHCA 3LB6D 4OSUH 3S88H 3UTZA 2LV4A 1CBVL 4YHNA 3RA7L 3V79C 3R06A 2C1PA 5JORB 5IB2A 3MUY1 3EGSB 4G80B 3WNKA 3WHE1 4Q9RL 3ARDB 4MNQB 2DKMA 4PRNA 3C6LB 2BSTB 4FXGB 5JW5A 3MRIA 3C6SB 3ZDZF 1FL5A 1XR8B 3A6CL 4NQEE 1CXLA 4YR6B 2BRRH 1XGTB 4ZNCD 1REIA 5K9KB 5I1CL 5H37G 4QXWA 4M6MH 1VSCA 1MJ8L 4OCNC 3VXUD 1CF8L 4J3OC 4I4WA 2AKRA 3IU4L 5E1HB 4HH8A 4IOSD 1A3RL 2R29L 2BDNH 1YNTB 3GSXA 3QI9C 4U1NA 1KB9J 4LKXA 3UJJL 3DV4B 4X7TB 4D9QD 2XOTA 5EC2B 4RWHA 5IMMB 1CIDA 4PLOB 1FVDB 4KJPC 2YPKB 1NC4A 3S96A 3PP3K 4F33B 5FO9B 5EOCL 1JK8A 5AEAA 3C9NA 4NRXA 3ARED 5L2KB 3U9PL 2Q8AH 4S1RH 2G60L 5AAMA 4LDLB 2IPUG 2ERJB 5DJ0A 5M95B 3NOIA 4DGIH 2OK0L 4PP2A 2BOCB 3B5GA 3RVUD 2CLVA 3P2TA 3MGAA 1VB9A 4UT7L 5D72H 1G7IB 1CGSH 3QWOA 2A73A 2XN9A 1WLHA 2X89D 4OGXL 1I7UB 1UM6H 2A9NL 4CVZA 4ODUA 1RSFA 2WUCH 2VIRB 3S35H 3EYUL 5J11B 3ULVL 2W65A 4A2MA 5CEXB 2VUOA 5C2UB 2BVOA 2D03L 4WFFD 2IWGA 4OI8A 4Z7UA 4DW2L 3PP3H 3DVGA 2YPVL 3O6MH 4KRMB 5T3ZE 1L0XA 1QFWH 4I77H 3O41B 3MLXL 1TJIH 8FABB 5GRZA 4L29A 1R5IB 4U3HA 2W91A 3SE9L 1NJ9A 1NLDL 4F8QA 4HGWB 3H0TB 1H3PH 3TO2A 2FB4L 3REVA 1NBYB 3DURB 3NFPA 4GW1B 3MACH 3L9RB 3GMPB 1BD2A 3DSNA 4AMKH 3HZVB 1XMWA 2OTPA 3TO4C 1HSBB 2Z4QA 5D1XC 4DK6A 4MNGA 5C0EA 4KQ3H 4NUGH 4KU1A 3ULUC 2XNAB 3BRDA 3BP5A 4X9HA 4EEEA 5DS8A 1KFAH 4UDTA 2C1OB 3L6FB 4LPCA 4DKDC 2OL3B 1XGPB 3ARQA 3QXWA 3ARZA 2A77H 2WQ8A 4QRRB 4XBGA 3NPZB 4GMSL 4P4RB 2HJKB 1MCDA 1CICB 4BZ2L 2R4SH 1N3NB 4MLIA 4NZJA 4MAYC 3KYAA 5EPMB 4KHTH 5C0AB 2DJSA 1A2YB 2GFBB 2QSTA 3T0EE 2FEDC 5A2KH 3KHOA 4JPVL 1CU4L 4ZO7A 3CVHA 3BD3A 2GY7B 5EZJA 4L4TD 4M43L 5D93C 1NLBL 3WHXA 4M02A 5E8EB 4HC1L 4ZPTB 1I8LC 1GC1H 3L3OA 1P2CB 5DVLA 1FYTD 4RAVA 1XFPA 2MQ3A 1Q1JH 5IFJA 2EO1A 5K9QG 5KW9H 1I4FA 2ED8A 1MRFH 1U93A 5CD3A 1EUTA 1F97A 3VFMA 1R5WA 1DQJA 2NY4B 3BP6B 4P2RB 3IDYB 4WI5A 1BMGA 6FABL 3U36A 2RGSA 5DWUL 3E3QC 3CLEL 4J3VA 2IH3A 1U8LA 5J13B 4EDXA 5A3ID 2BVUA 4PJ8B 4ZSOA 4HUMB 3RUGE 1MCQA 1XIWC 4LPVA 2HT4D 3EYOA 2F53B 2NY3D 1RURH 3KPRD 3RVTD 4NJAL 4JZNB 4ONFL 4RGND 1UADC 2A0LD 4GLRH 1MY7A 3MRHA 5E08H 5DMIL 3I6KA 3Q6GH 2AJVH 4K71C 3BZ4A 4U49A 3WFCL 3VXRA 4JR9L 3QG6A 1SBSH 1ES0A 2CO6B 3L3GA 2IALB 3WLWD 4QYOA 2F15A 4XZUA 1U3HD 3SE4C 4OD3H 3FFDB 3UZQA 5EOTA 4QKXB 3IDMB 2ADJB 25C8L 4TYUA 3E8UL 4GBXD 2X4OA 5HYJE 2OLDA 3MRKA 5F1SA 4NZUH 1XGRB 3ALWA 2DBJA 2HWZL 1HINH 1EO5A 1KGCD 3C5SA 1G7MB 1IGMH 1SYVB 1IQWL 3VXSE 5DD0H 2YPLA 3O4LE 2PYEE 1G7HA 3MXVL 3OXSB 1X7QB 2AQ2A 2CGRL 1GVIA 2HJLB 5FM5O 3P11L 4KI1A 3LEXA 1R24B 1FFPA 3QUYA 4MD0A 3MBXL 2P44B 3GHEL 3RL1A 1CFNB 4FQCL 3CFKA 2I5YL 4FQ2L 5JQ6L 2IFGA 1BFTA 4OI7A 4KZDH 1CZ8H 1ZVYA 2W0PA 1BQSA 5EBMA 1S78D 3N1FC 5GHWL 2FJHB 3JV6A 3T2QA 2ILLA 5SX5K 2WP3O 4K3DL 4PRHA 5E24E 1TZIA 2VDKH 3KXFB 2EXWC 5IM7A 4TSAL 3L3IA 2NZ9D 2IFFH 3UBXB 3C08H 2G2RA 4OF6A 1YYMH 2X1WL 4PJ5A 5GRUL 4XX1E 3SDDD 1I9IL 4HJJL 4XH2B 4OZFB 1YEGH 5M7QA 5FO8B 1F00I 1ETZA 1BECA 5LVEA 1QFUL 2FX7H 2P1YA 3LQZB 3OJDA 4WUUE 1FV1A 5C7XL 5I1EH 4FFWD 3UTQB 1RMFL 3CLFL 3PGDA 2DIBA 5F1KC 4TOYH 2BNUB 1F42A 1NMBH 3L3HA 5SX5H 1RZ7H 2EDDA 2ZOKB 3ZE0F 2NTFB 2GJ6D 2I9LA 3D2UD 5ITFA 4FQLL 3SGEI 2YSSB 4EQ3A 5A40E 5DFVD 2R39A 2P8PB 5CBAA 4D0DB 1LD9B 3H3PH 2E27H 5I8EA 4WU5B 4YIQB 2HT2C 3GI9H 1TVDA 4NQSA 1MI5A 1YMMD 3BQUC 4FNLL 1NCNA 4YXKL 3G5YA 3C09C 3QWQB 1U6AL 4Z7QE 1JF1A 5FV2A 4X6CB 1OPGL 4ODWA 1OT1A 1UKTA 1MNUL 5B39G 1S7VB 3TH2T 2ESVB 3SDCC 2H32A 3VWKC 4XVJH 1UH4A 4EI5B 3F58L 4HHAA 2I07B 4HGMA 4MD5B 5H2BA 3RZCB 1ED3A 1FG9C 4LU5H 4M7ZC 2AEQL 3S34H 1KIRA 4PJ7A 2D7QA 1LE5A 1LO4H 1U8NA 1AFVH 4PJEE 1D7FA 1N2RA 3I3DA 1A6UH 4R2GC 3H9SE 4Z95L 3T0VA 4NQDA 2DWDA 3TFKC 3ARDD 3TEUA 1A47A 4O00A 1DUYA 3S4SG 3C6LD 1VEPA 4R4FL 4O5LL 4J3WA 4X7FC 3CXDH 3FQRB 4OBSA 1HE7A 1IC4L 3FN3A 2NXZC 5HHXL 5DGRA 3NFNA 1I1FB 3I3BA 3CDGB 4XWOD 4EKXA 2A74B 3D0LA 3ZL4H 3IRZA 5I15H 1OAYH 3KYKL 4XGZA 1NCWH 3LZFH 2APFA 1OF2B 4ELKB 3UBXI 4EIGB 4Y88A 5BJTB 5EFIB 5CS7A 3PWNB 1WUNT 2EDEA 4I0KA 2R1YB 3RGVB 1OW0A 2HLFC 3PHOB 1MEXL 2KZ1B 2BFVL 4N9OB 1RULL 1RIHL 2JCCE 2Y7QB 1G9MH 5MEOB 1KENL 2Z35B 5E1AB 3TBYB 3IDXL 4LCCB 3ZHDA 2WIMA 1F11A 2H2SD 3UPRB 2D7OA 4D9RD 1ZT1A 3ZDYE 5ALCL 1G6RB 1I8KB 4DFIA 2PETA 4XCNA 1HZHL 2R1XA 3QDMB 2YK1L 4LCIL 4LEXL 4Y4HD 2B1AH 5KANI 1HEZA 4BQ9A 1YMHB 3Q5TA 5BZWB 4ODSH 5HHMB 1FL6A 4GG8A 3OKLA 1M1SA 1EMTL 5FEBA 4WW2F 5FIEA 1D3CA 1OP5H 1MQ8A 3U30C 5AG8A 2XA8H 4IHOB 4LOUC 4ZO8A 1BAFL 1Y18B 5DD5L 2E7HA 4UTAH 2XWJA 2IMNA 2MMXA 3QQ9D 5CSZA 2AV7B 4TVPD 5J89A 4X9FA 3ISWA 5I19H 3QUZA 1AR1D 2W92A 4X6DE 5I71B 1KCRH 3O2WH 3GJFK 1I75A 4U1HA 1CE6A 3MROB 5F96H 3GKWH 2NX5D 3E2HC 3MLYH 1IGCH 3QEGH 4N0FB 1FBIL 5C0BB 5T5NF 1TVHA 3WCYA 3RPKA 1IQDB 4P23A 4DAGH 2W07A 5DI8A 4N90D 3AB0B 1HQ4B 4OSUL 1D6EB 3L3KA 3S88L 4G8EA 1U58A 4QHNB 2VDNH 4OCRH 4OM1H 1XZ0B 4QRRD 3ULVC 4QHMB 3U82B 5I2IA 2ATPA 1CICD 4J8RA 1L9NA 4LHUB 5F7UA 4D8PA 3TIDB 1RVFH 5C0AD 3EOAA 5GS2D 3GJFH 4WO4B 4UT6H 5C09E 4JREB 2BRRL 1CDJA 2FH6A 1LEIA 2VSCA 1KCSH 4YHOH 4RAHA 1ZLUH 5L0QC 4M6ML 3UP1A 3W5NA 3HPLB 4EI6B 1J87A 3QA3B 3BGFB 3QUXA 4FQHB 3WE6B 5DRWA 3FQWA 3MCLH 3VFPB 2BDNL 2J12B 4X0KB 3S6CA 1IAKA 3MO1A 1BQHB 4JVWA 2CDGB 3GEWB 1X4XA 2YS4A 3KPPB 3ZHLA 1U42A 4DQOH 2NY4D 1TNMA 4P2RD 1QFHA 3MJGX 3IETA 4ZYKA 2GT9B 4EVNA 5E4IA 4KK5D 1IAIH 1ZS8B 1RZ8A 2CRIA 2FX8H 2IMMA 4LPUA 3CPLB 4LARH 1G0XA 1ND0A 4IMLB 5JW4Q 1NANH 3RRQA 3CFJA 2Q8AL 4PJ8D 4S1RL 4ZFFA 1H8SA 4X4ZA 2HTKC 4YFDB 3BP7A 4DGIL 4MJIE 3S37H 3HG1A 2F53D 2OI9B 3P0YH 5D72L 3D69B 1ZEAH 1WFTA 4HJGB 5KANG 5IHLB 4POUB 1EUUA 1CGSL 1PKOA 4NKDB 1K5NA 2XTJB 5JHDB 1ORSB 1UM6L 1A21A 2WUCL 4IS6A 1HOCA 3S35L 1HILA 4PJXB 4HBQA 1MCBA 1HHHB 3KYMB 3C5ZC 3LV3B 1T21A 3O6ML 3C5ZA 5CIPA 1QFWL 3P4NA 4I77L 2FJFB 1TJIL 4L8DB 3AAZA 4HKZA 2G9HA 1XEDA 5FUCC 4OFYD 5HVHB 1J1XH 1H3PL 1MWAB 1U8IB 3PDOA 3MACL 4ZUUB 2WWKO 5KAQG 4AMKL 2R1WA 4P46B 5CILH 4KQ3L 3L7EB 5FYJD 2AS5M 4NUGL 3VXTB 5HDBE 1WFNA 4KTEH 1QTYT 1IZJA 1Z9SA 3RVXC 4CU7A 1J8HB 1KFAL 1LMKA 3ULSA 3IDNB 2DBLH 5HD8C 1G7PA 3ARSA 2A77L 2E7LA 4Z7VE 2V2WA 2EZ0C 4D0CB 3WUWG 5EU5A 1BFSA 1C08A 2EIBA 3B9VA 4PJIA 4U1JB 3SGJA 4JDVA 1S7TB 2R4SL 2NW3B 3KXFD 4DUWA 4HK0B 4X6BA 4KHTL 4Q0XH 4JKLA 4XMLH 1R3LB 4JFEB 4XHJC 1VFAB 3W0WA 2QADB 3HE7C 1S9XA 4PGCA 2CDFA 5GJSH 8CGTA 2N4IA 3BPOB 1NDMB 4R7DA 5TGBB 1GC1L 4CN4A 1UXWB 3FTGB 2GTZA 1T5XA 1Q1JL 1EZVY 2P5EA 1IL1A 5KW9L 1D5BA 1A9EB 4Z76A 1MRFL 3STZB 1Z5LA 5C6PB 2Q1EA 5CHNB 4HH9B 1PQZA 2VQ1A 5ENWA 3WN5C 4UOW1 1ZGLB 3MRPA 4BH8B 3WN5A 5D7SH 3MRBA 3BIAX 3WL9A 1NEZB 1KACB 2VXUH 2G75B 3C87A 2CIIA 3FO0H 5DJ2A 5IBUG 3STBA 4YDLB 1NUNB 2D7TH 4ONOA 4GG6A 1HH6A 3QDGE 4XPTH 3MRNB 1XF3B 5DQJA 5J06A 2ATKA 1RURL 1V3LA 4HWEH 1JUFB 2PXYB 2YXMA 4JGMA 2MHAA 3LD8C 2JB6B 3A0OA 1A1MB 5DEGB 4LHQB 1NGZA 1N8ZB 3WFDH 1RIVH 5E08L 3V6ZB 3EDKA 5C0CB 5DQ9A 2XY1A 3Q6GL 1OP9A 2R2EB 3LS4H 2ESVD 2AJVL 4R3SB 4EI5D 1SBSL 4X4XB 3SY0A 3RZCD 3DVFA 4OD3L 4JZOA 2WLYA 4WI2A 1JWSA 1HIMH 2E5EA 2P5WB 2Y6SD 4KJYB 1EO7A 4QXTB 3FT2A 4NZUL 4OGAD 1GL4B 1I8IB 5H94B 1HINL 4HIIB 1U3YA 4YX2H 4HZLB 3FONB 1IGML 3OBAA 1QP1A 1LNUA 4L4VE 4DN4H 2Z93B 3CZFB 5DD0L 2DB8A 3QQ4B 3WJLC 4Z7WA 1EFQA 4KK6C 2VXVH 4MHHI 4RRPG 1RK0A 5AUMA 4KFZC 4QRPB 1H3XA 2BRQA 1TFHA 1P7HL 4QCIA 1HCFX 4KZDL 1CZ8L 5D7LD 4GKNA 3KJ4C 1ROWA 1YC8A 4QRSB 1PAMA 4OB5H 3MYJB 3MMEA 3IVKA 3X13A 3RGVD 2OJEA 5DJDA 5EO9A 3QDJA 3SCMA 1JV5A 3HPJB 1QSFE 2ZNXA 2Q6WA 2VDKL 3E3QE 4GMTH 2BX5A 4OZ4A 1B6UA 4KGJA 4OD1H 1EIBA 1MCOH 3GSVA 4QRTA 4QHUB 2IFFL 3C08L 3OB0K 1YYML 1OGAA 4TNVF 1EEYB 3OXRA 1WSST 2BHZA 1EBPA 1YEGL 4YHPA 1DN0B 4H1LG 1FAKT 3HI1B 1E6OH 2FX7L 4LAQH 3T2NH 3DUUA 1TXKA 1JYXA 4Y8DC 5I1EL 3QDMD 1IFHH 4OZIE 4JFDA 2P47B 4TOYL 4Z78A 1B4RA 2FWOB 3SPVB 1NMBL 5HHMD 4F9PA 4Z77A 1BQLH 1RZ7L 2B2XH 3EDJA 1AGBB 3MNWA 3X11B 32C2B 3OB0H 3EYQC 3H3PL 4EN3B 2E27L 2VDRH 3VFTB 1EA9C 3GI9L 5CJXC 1WFOA 4JHAH 3MV7A 5CJXA 3VWJB 4D0BA 1IT9H 5F9JA 2ADGB 3EFFB 3FQTB 4W4NA 3PHQB 5SX4H 1ZA6B 3MFFB 2AV1A 3PQYB 2LU4A 3DUSB 5DMJB 4J1UA 5EUKA 1RZKH 5C0BD 4XVJL 2DLEA 4GW5B 1V8HA 3G5VB 3G5ZA 1IM3A 4LU5L 3MSPA 3VI4F 1S3KH 5E70A 5HI5D 3S34L 2DAVA 1KULA 3I2CH 3TPUB 1LO4L 5T1MA 1Y6MR 1AFVL 3UYOD 4PJAA 1WISA 4M1DH 1A6UL 4G7VH 4XAKE 3RBGA 5IBLD 1A7PH 5ID1B 3K1DA 4XNMA 3F8UB 4XCYB 5E2VH 5EH1A 4NIKB 4LHUD 1C5BH 1SY6A 1HHJA 3ZTJH 3CXDL 2GTWB 4RMVA 3X12A 1YEFH 3OAYK 4TRPH 2VLKE 4WO4D 3K74B 4PRID 4YGAB 1ZA3A 4RISH 3LKOA 3ZE1F 3ZL4L 3GMQA 5I15L 3CCHB 3RL2B 1OAYL 4RMQA 2WNGA 1NCWL 1PZ5A 3LZFL 1LK2B 1AY1H 4KKBD 5F6HI 1T5WA 4U2ZA 3MGOA 5F7NC 4L9LC 3CSYB 4UBDD 3MC0A 3BN3B 3FN0H 2F74A 1FZMA 1G9ML 4ENEC 4MJ5B 2EDQA 1SJXA 2W9DH 3SQOH 2AGJH 2V9QA 5JQHC 4KUCD 3FFCB 4QHKI 1IBGH 4LCUB 4LSDA 5ISZE 3OAYH 2X4RB 3D0VB 3F7YA 5GGSA 2NW2A 3R4DA 3EDFA 3HNVH 4PJCA 1U8KB 4DOHE 1F13A 1X44A 1H3WM 1QSEE 2PW2A 3FZUC 3D18A 2ARJB 5L8JB 4UU9B 2GQHA 1GZPA 5FDWA 2BVEA 3UDWC 2XTJD 1I1AB 5JHDD 2B1AL 4QWWC 4M93B 2UZYB 5D1ZB 4NUJB 4ODSL 1E4XH 5DHVB 3L95B 3TA3C 4YGVB 2XA8L 3TA3A 4X99B 4JO3H 5KZCB 4FXLA 4X7SH 3SDXE 4UTAL 4YH6A 1PD6A 1T7ZA 2X7LB 3VE0A 1YQVH 4F7PB 3QFJB 4W6YB 5I19L 2Q76B 4I3GA 4BSVB 4QTHA 1KCRL 2DJUA 2F8OA 3O2WL 3WO4B 2BNRE 3UTTB 4TNWF 4JQIH 5F96L 3B3IB 3GKWL 3D39B 3MLYL 1IGCL 3QEGL 4YBLC 4Z7NF 1KG0A 2AW2A 4BQCA 4G9FB 1TCRB 2CD0A 3W9DB 2VL5B 4DAGL 1QVOA 1JZ8A 4ZOAA 4K3HA 2YD4A 1J8HD 1CT8B 4PRPA 3G6JB 1F90H 3F62A 3IXTB 2B7DT 4CJ0A 2VDNL 2IAMA 3ARRA 3WNPA 4OCRL 4OM1L 3DXAE 5TDOB 4Z9KB 2QQQA 43C9A 3Q6FA 1IMHC 1PG7W 1V7MH 3MLUH 1MCSA 3T65A 4HX1B 1AO7A 5DDHA 3BEWB 2JELH 2XI9A 2DM2A 1AJ7H 4O02H 1FO0H 1RVFL 1XF4B 1MHHA 2GK2A 3MFGB 1WICA 4C56A 4JFED 3ROLA 4UT6L 2J8UF 4PY7A 1JZ5A 4YBQC 3REWA 2GJZB 3DMMA 2F54B 4N0CD 1DVFB 1XCQA 4NQVB 1KCSL 2H1PH 3MNVA 4YHOL 4RNRB 4OLYH 2QADD 4ZXBC 4ZXBA 2OMNA 4JM4H 3RWHB 2X40A 3G9VA 1YDPB 3ILPB 1D5MA 4WIQA 5CGTA 1KIPA 2VZ3A 2VDOH 4AT6A 3MCLL 4WU7A 2EXYD 2QSVA 3VXNB 3L5JA 4UDUA 4YK4B 5L2JA 1I1YA 1MAJA 4K8RD 4QHLB 4S1SH 4DQOL 5SWSA 5MHSD 5I1AB 3R0MA 3OG6B 4GW4A 1CDYA 2VLJE 2KDGA 4DCQA 4CVWA 2FX8L 1I9RH 4MQ7A 1ZHBB 1WT5C 4LARL 1E27A 1WBXA 5D2LB 2XWBA 1KB5B 3CX2A 2I27N 4YO0B 5SWZA 3TJEH 2NNAA 1TJHH 3TN0B 1BX2B 2Z92A 5HYQB 2ICEA 4NQCD 5EIQA 3S37L 2C4FT 3UAJD 4OIIH 3P0YL 2E3VA 1ZEAL 1T4KB 2PYFA 1X6NA 2XY2A 3IGAA 1OT2A 2AEPH 2ZSWB 1EK3A 4N0YH 4BFGA 5IVXB 5C0CD 4BZYA 4PJHA 4DZBA 4G6FB 3W5MA 1U8HA 1DL7H 5DMKA 1GC1C 3S36X 1UJTA 3MRFB 5D96C 1ZV5A 1ZMYA 3IRPX 4X4ME 1GOFA 4UI2A 2X44D 2IQAB 5B22A 1FH5H 2IGFH 4L1HA 2VXSH 3O0RH 3PABB 2YEZB 2XV6B 2P5WD 3MCKB 3VXPB 2J88H 1T3FA 3CDCA 2BNQE 5DK2A 2E6QA 1J1XL 1X9QA 2Z8VC 3U0TB 4LLVA 4MS8D 4UV4H 2VJXA 1LO5A 3S3SA 1OLLA 2XICA 2B5IC 5IIEA 2YUXA 1U95B 2C5DC 2VLLA 3LRSB 5CILL 3QJHA 3DX6B 4IIQA 5JNYB 4KTEL 1F3JB 1Q0XH 3HS0A 2HN7B 4NQEB 2MPAH 4QRPD 3FQXB 1J5OH 2DBLL 5AD0B 4HFUH 1NUDA 2DJ4A 1MSPA 5IHZB 4F7CA 3TVMC 5F1IB 1R3JB 4RBPK 4JCMA 5ADOH 1T7XA 1OD7A 4YFEA 4U1SA 4YAQB 4CMHB 3NIFE 5E6IC 4JG0H 3BD5A 5BV7H 1N59B 5KSBF 2JJSC 4LCWA 5CZXD 4Q0XL 4XMLL 1F8TH 2DL2A 3RWEA 4YHLH 4GJTB 5C86A 5C9JA 4J7RA 4WFGE 1FNSH 4GQ9H 2CPCA 1YY8B 1T0NA 2QJDA 4UAOC 5GJSL 1KIQA 1ZVSA 1AGFA 4JY4B 1IAOA 3GJEA 4KUCF 1IKNA 3RWDB 5EO1A 4AYFA 3IDIA 4TTDD 5IQ7H 2RR3A 4JY6B 4LVOB 2Q3AA 4F15C 2EEBA 5JPMA 4XC3H 5D7SL 3HCVB 1RHHB 1T7VA 4WFHE 1P6FA 2VXUL 1RUMH 5ESVB 3FO0L 3NZHH 5MP6H 4EN3D 2D7TL 5F97E 3ELAT 4P5MA 4XPTL 1AE6H 4R96B 3RWGB 4BA8A 5J0BA 5I75B 3VWJD 4HWEL 3MR9A 4PJXF 3S35X 1I3UA 3ARUA 3WFDL 4IRSA 1RIVL 5IMKB 5IJKC 2Y23A 3PQYD 4XPHH 2OTUA 5T1DH 3LS4L 3FOMB 2WWMC 4HV8B 3RWCB 3HLAA 2EIDA 1PY4A 4LLDA 4ISVA 4TTGA 5ANMA 4WDIA 3SGKC 4KKCD 1Q38A 3QNYB 1HIML 2AK4A 3IJSA 2LVCA 1OTTD 4HIXH 4LPXA 1KT2B 4JQXC 3SGDI 1UWXK 3DWTA 4JQXA 5JXEC 3LMJH 4YX2L 1J0JA 3O2DH 1GGIH 4PJBF 4A6YA 5JXEA 5T3XD 5B8CA 4DN4L 4YQXH 2DLIA 1UA6H 4Y2DA 2MOVA 4PR5A 2K7QA 2VXVL 3CH8A 3P0VH 4L8CA 3FJTA 4U6HB 3T0EB 1DN2A 4XMKH 1HXYA 4B41A 2GHWB 2BC4A 2XRAH 2ENYA 3VGBA 4BQ8A 4OZHE 4RAUA 4R4BB 4PJDA 1HWGB 5I8CA 2EDHA 4QGYA 1JPTH 3DECA 4OB5L 3HRZB 3WLBB 4X7DC 1E28B 3ZYJA 4F37F 1FCCA 1UWXH 2DQJH 4GMTL 5C0DB 3D25B 3L5WA 1DDHA 1E6JH 4OD1L 3FFCD 2J1KA 1MCOL 1DEEA 2PO6B 1QBMH 1CWVA 4LLMA 5CP3H 3S98A 4CMMB 3HB3D 5T1KB 4M8QA 3PJSA 1M7IA 3TT3H 5F3BA 1FJ1B 4U2YA 4NQXA 2EYTA 1E6OL 1A7OH 4LAQL 4H8WH 3T2NL 3VXUE 1H3VA 1NGXA 1WIOA 1IFHL 3ARFC 2X9XA 1I1AD 1GGUA 4OCLC 4YXLH 5I76B 2FO1A 5TQ2H 3OX8A 5D1ZD 1D5XA 1U8JB 3N1MC 3KPSE 4AQ1B 3IAGC 1BQLL 2VB5A 5KSAB 1IVLA 4XNQB 3LKRA 3P0GB 1KJVB 1MCJA 3VFOB 1JRHI 4FZEH 1S8DA 2B2XL 2J5LB 4F7MB 4JRYD 2GW5A 1YECH 1CYGA 4HIJB 5KZCD 2XKNA 3BW9B 3MCG1 3NGBC 2VDRL 4NRYB 4LLYA 2X4PB 4JHAL 3EO0B 4OFIA 4R8WH 3BX7C 3DPBA 2OL3H 1JWUA 3GSUA 1UM4H 1P4IH 4BUGA 3QFJD 1IT9L 5HYJB 1F5WA 3DTXA 2VKWA 1C5DA 1LQSR 4U1GC 3UTTD 3ILQD 2GAZA 3MZGB 3TZVC 1I3GH 3D39D 3THMH 5JIKA 3TZVA 1RZKL 1FFOA 2CR6A 3PE9A 3DYOA 5DJAB 3VXSB 3T1FA 4KI5C 3O4LB 4G9FD 2PYEB 3CMOL 5HHVH 1S3KL 2CMRH 3I2CL 1FGVH 5CP7B 3U83A 3SN6N 1WAAF 3EOBB 1VPOH 1PKQB 4PJ9D 3FRUB 4M1DL 5E4EC 4G7VL 1W8NA 3VRLF 5E2VL 2GSGA 2CKBH 1C5BL 4MQTB 4HPYH 1U2CA 4MNHB 3LEVH 5KSVB 3I50H 4Y4KC 2R15A 4PUBH 1YEFL 4TRPL 5C0FB 3TIEB 5EU6A 2F54D 4RISL 1DVFD 4JFQA 1XCTB 4I13B 43CAA 4I18B 1ZWIA 1QO3A 2YD5A 1FFNB 3BOVA 4J4PD 3FOLA 1AY1L 1GIGH 5MI0B 5L9DH 2ZUXA 1BBDH 2EICA 2XYCA 1B4JH 1RUPH 3OKMA 1AHWC 1S7UB 3GSNH 3FN0L 1AHWA 3SGEH 3LEYH 2K9UA 3TWCH 4L1DA 1Z3GH 2W9DL 1YN6B 5ACMA 2AGJL 4G8GD 1HXMA 2GUOA 3SQOL 1IBGL 3GUTA 5D7JC 4NYLB 3HNVL 5D7JA 1MHEA 2UYLB 3QWRA 1MPAH 1SEBB 2UV3A 3GJFA 1FYTE 3TH3T 2ZWLT 5EU4A 5J3HC 4FN0A 4ZFZB 4E41E 5C08B 2DM7A 1UJ3C 5EWIH 4NKMB 1DSFH 4L3CB 1UJ3A 3SKOA 4ZFOA 1U8MA 2EE6A 4G6FD 4L3EA 5I8OH 1ADQA 1E4XL 1ZOXA 5ICZB 2CLRA 1JCKA 2IPTH 1NGYB 2DMKA 5BQ7A 1TMCB 5JZ7D 3U46B 3PL6B 2IADA 4JO3L 2YD3A 2EDFA 4X7SL 1OWRM 2DQHH 4FRWA 2A6IA 1NL0H 1YQVL 4PJEB 4XPFL 4G6AD 4DGVH 5EA0H 3H9SB 5CEZD 2EDJA 1XGUB 3QNZA 2EC9U 3R8BB 1QHOA 4ZUTB 3VGGA 2YRPA 2R23B 2KZWA 1I8MB 3QUMB 3OR6A 4FQXB 5D1QB 4F2MB 3DROB 1QBBA 4N8VB 3M1BB 4NQED 1T2XA 1KLGA 1UB5B 5CZVH 1F90L 3V6OA 5IJVA 4F7TA 1TTUA 3SQBA 3OKDB 5F7HA 5JPNB 1EERB 4H5SA 1L9MA 3VW3H 1TQBC 1Q72H 3DO3A 4XI5D 1U8PB 3JUYA 1YN7A 1V7ML 3MLUL 2W60B 5I1DA 4NBXB 3K4DA 5HHQA 2JELL 3O3EB 4R0LB 1D9KC 1AJ7L 4I0PB 1EBAA 1FO0L 4O02L 4P2QA 3W82A 1JHTA 3RVVD 1VACB 3LRHA 3PV6A 4HS6A 1T20B 3HE6B 5DD3H 1TVBA 2C9AA 3ARBB 2JCCB 1FNHA 5BZDA 1T83C 5DGQA 2DYPA 2H1PL 1DQMH 1T83A 5F7LB 4OLYL 4K23H 4JM4L 2I25N 2X4NA 4MA1C 3BMVA 4U0RC 5EC1A 1K4CB 3BP4B 1J12A 2PTTA 3U7YH 4WTZA 5C0IB 4WUKH 3ZE2F 4K7PH 2VDOL 4Q6IB 3IS0X 3KYNB 3QQNA 4ZMAT 4LFHD 1FVEB 4N1CA 4S1SL 1I7RA 4Z18A 3WYRA 1RZFH 1AKJB 1KN4H 1U92A 3L5XH 5DSCA 3OAZK 5GS0D 1OB1A 1I9RL 3BGMB 4W68A 3SKMB 3MLTA 4P9HH 4PPTA 1IGTA 1N6QH 4GAJH 4MXQC 3TJEL 5H35A 5T5FH 1MOEA 1TJHL 4O2CB 5HVFB 1QRND 3G5XA 1KEGH 4M00A 4WWKA 2C3XA 5T3ZD 4OIIL 1AD9B 5GRVL 2A38A 4ELME 4TPRH 4WVRA 2BY1A 4BM7A 2AEPL 4WI6A 1J1OH 4AIZB 4N0YL 1OTSD 2D9CA 4JM2D 4LEOA 4X6DB 5KSUB 1AGDA 3VFSB 2O93L 1DL7L 4ZUWB 2N1KA 4XB7A 4LKCB 2FHFA 4NN6C 5IF0A 2GJ6E 4L3AA 1NFDF 5L8KB 3N1QC 3MX0A 3MRJB 1U8QB 4Y4FC 2XWTA 1FH5L 2IGFL 1KCVH 2N7BA 2YA1A 4NRZA 2VXSL 5ETUA 4AZ8A 3O0RL 1AQKH 5T1LB 1CFVH 2J88L 4DJMA 5GIRA 4LF3A 1MLBB 1JYNA 4XWGH 4GRWH 1QSVA 1U91A 4PG9A 3STLB 1YMME 1ZT4B 3KPOB 5IESH 2EO9A 3D85B 4UV4L 4S11A 1OSZB 2V9TA 3KHQA 2W0FB 1P6AB 2R4RH 3ESUF 4QT5A 4M03A 5IK3A 2WV3A 2L0DA 4Q9BA 5F9OH 3DV6A 3P77A 1TIUA 1Q0XL 5C09B 3IFPB 3T0ED 2MPAL 4OFDA 1J5OL 2Y9RT 1H8OA 4HFUL 2YKLH 1A4JA 4ZNEA 3QXAA 2FIKA 4QY8B 1U9KA 3AY4C 5ADOL 4QNPE 1U8OA 2FATH 5D4QA 5K9OA 2WBWB 1H15A 2IPKA 4JG0L 3QIBB 2XPGA 5BV7L 2VN7A 1IGFH 1E4JA 4P57B 4UQ3A 3SEPA 3V6FB 5GGVY 2PO6D 1F8TL 1U2HA 2NR6D 4B53A 4ETQB 4YHLL 5T1KD 4LL9A 3MV9A 3LKNA 1BWMA 5FGSA 3S97C 1FNSL 4GQ9L 1AIFA 3FQNA 1A9BA 4UIMA 3P9LA 1YY9C 5CBEA 5DJCA 4E5XA 5J56B 5A2JH 3IDJB 2H6PB 2UWEA 3RI5K 1KXTB 4MJIB 3O6FC 3DETD 1K6QH 2NY1C 4AEIH 2HRLA 4TN9A 3O6FA 1K8DA 2ITCB 4RMWA 1S5HB 3ZKNC 4PFEA 5D2LF 2J2ZA 3O2VH 5FA4B 2DTSA 2BMKA 5IQ7L 5CEYB 1L6XA 3P4OA 3RNKA 2BSRB 1EXUA 4LLQB 1UVQB 2HFGH 2Z31B 4Q2ZA 1LEKB 4XC3L 1XF5B 4NFBA 3S37X 4KVCH 5I8KL 1RUML 5FYKU 3NZHL 5MP6L 1X6LA 3SKNB 1AE6L 3O3BB 3QJFA 1S9KC 3O3AA 4OBRA 4QO1A 1EGJA 4G43B 1Q9WB 2XZZA 3QCUH 2CUHA 3OL2A 5HYJD 1HHKB 4X5XA 2GYSA 4XPHL 2X4QA 3PUCA 4M5YH 5T1DL 4LGSB 3VXSD 1PGRB 3O4LD 3V0WH 4O4YH 3ZMRA 4Y16A 5GSRB 2PYED 4WV1A 2FZ3A 2FRGP 3S3JA 5D7IE 2CLZB 1N5YH 1MHCB 1CLOH 4HWZA 5IW3A 5EBLA 3RGHA 2AKRB 1IE5A 1W0WA 4LLUA 2Z91A 4HIXL 1FNEA 5BOPA 4MCZA 4WJ5A 3RHWF 1MLCA 4PIRF 4TVPE 1WCBA 4KK9D 2HRPH 3LMJL 3VCLB 1JF5A 3O2DL 3QI9B 7FABH 1GGIL 4Z7VB 3DO7A 4X8JB 2P7TB 4HJ0D 4YQXL 3PHSA 1UA6L 3QPQD 3RY6A 3OJ2C 4S1DD 2NX5E 4G9DA 4U6VH 1O7VA 3MRRA 2QV2A 4NRXB 3P0VL 3WDIA 3CX5K 1QLFA 4JLRB 4H1LH 4UMGA 3RFZC 2X4UA 5IROC 1D5ZA 5HGHB 2XRAL 3PIQB 5HDOA 2Q86A 1RZKC 4U6XB 3TCLA 1JPTL 3H9HA 4WNQB 4CVZB 3OG4B 4S0SD 2DQJL 2A9MH 4R7NA 3DHJA 1E6JL 1ZAGA 4PD4K 1NDGB 3K8KA 1QBML 4KHXH 5ACZA 5DTFB 4MA7H 1RHFA 3TT3L 1W72H 4ODXA 1A7OL 4L8SC 2X09A 3PG2A 4H8WL 3VGAC 5I1GH 3QDGB 3NFPB 4LRIA 5C08D 3GRWH 1BD2B 1MWAH 5TQ2L 1RI8A 3TO4B 3AREA 5D1XB 3EKCA 1I85C 4YDJA 2AJZB 2O5XH 1QA9A 1I85A 1KCUH 3ZT7A 5IW6B 4R4NC 2BVPB 3I85A 4FZEL 2EDOA 3FMGH