1DBJH

Molecular basis of cross-reactivity and the limits of antibody-antigen complementarity
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
219
structure length
219
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYAFTNYGVNWVKEAPGKELKWMGWINIYTGEPTYVDDFKGRFAFSLETSASTAYLEINNLKNEDTATYFCTRGDYVNWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG1-KAPPA DB3 FAB (LIGHT CHAIN)
publication title Molecular basis of crossreactivity and the limits of antibody-antigen complementarity.
pubmed doi rcsb
source organism Mus musculus
total genus 34
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1993-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbjH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbjH02
2I24N 3DUSA 4WW1B 1ITBB 1OSZA 1S78C 1CVRA 2XKUA 4N8CH 3P0GB 1F90H 2YSSA 5I1AB 1S5HA 3EJYD 1CFTA 3EYOB 3GI8H 4XRCB 1TVBA 3IFLH 3DPBA 4U1GB 5I76A 5DUPH 5I0DA 3F12A 4HKZB 2Y06L 4FRWA 3C8DA 4I5BA 2YPLE 1KGCE 1GGYA 4QRRE 5JR1H 1OP9A 4DZ8B 4QCIA 4TULL 5H2BA 3RNQB 4I2XB 1I1FB 1PY9A 2NR6D 4U6HA 3GHEH 1KXVC 1ZT1A 1ZHBA 5BW7A 1IAOA 1RZJH 2HKFL 2C3HA 3K8KA 4NO0A 5J9PB 5J1TC 2J8OA 4IEFB 3C60A 2Z8RA 4L3CB 4LU5H 2XY2A 3AROA 5KVEL 4NNXB 3QDJA 3ULUH 1CG9B 2DQGH 4N9OB 3MR9B 2B0SH 4K3JH 3NCEB 1OAKH 3IFNL 1F42A 5ESVA 4KKAC 1BIIA 3PDDA 1JNNL 3KXFA 4XPAH 1DQTA 4XTRC 2EDHA 2W0FA 4KHXL 3UJJL 3L3HA 4YHML 4GW1B 2F5BL 4LLVA 3QUXA 2FX8H 1KTDB 2V9TA 4GBXC 2VNCA 5BJTA 4MZ2A 4ZUTB 1HILA 1NFDA 5ITBH 4NZUL 1EUUA 2BC4A 5CEZE 1KXTB 2PN5A 3SE4C 5KVDL 5CP7B 4LHUA 2CRYA 3SPVA 1UM4H 5D7JD 2QQKH 2R23B 5F89A 1JTTA 2A83B 2Y5TA 1FL5B 5L88H 4DFHA 1C16B 1CF8H 1K9TA 2GYSA 3TZVB 2B5IC 3FQTA 5E6IB 4Z7NE 4BELD 5CZVL 4NQVB 1FGNH 3PWUB 4U1MB 3BRFA 1T1YB 5J8OA 5DJ2B 5I6XB 1NANH 5EPMB 4GLRH 1J87A 3FOLB 3PDOB 3HZVA 1RURL 4J8RB 2UVFA 4POUB 1YN6A 4HK3N 3JVGA 1F58H 4YE4H 4FFZL 1A22B 5EBGA 2X4QA 3WS3B 4LSPL 4U1SB 4HUWA 3I6LE 4NO2B 4BH7A 2KKQA 4WTXA 3VFPB 2HKFH 4G6MH 3EO1B 4Z0BH 1T04B 1OGTA 4GKSB 1FNSH 5HHVL 5GSRB 3QIBA 2VIRB 2RCSL 3O6MH 1OB1B 3ZYIA 1XIWB 2VXVL 1EAJA 3UJTH 3EOBB 3RWEA 2OMBA 1I3GH 1AHWC 3E6FA 3RWIB 3LKSA 1QHPA 4QKXB 3SDYL 1JNNH 1BBDH 3KLSA 4UU9B 4TNWF 2XNAA 2XG4A 4P2RB 3UJJH 4UNVA 4JFHE 4YHMH 4CL7A 1I8LA 4V1DB 1CGUA 1UZ8A 1MHEB 3AU1B 3NZHH 4PTUB 3K3QA 4XX1G 4NNYA 5GS2D 5HVFB 2YD6A 3IDGB 1E6JH 4NIKB 4HMDA 3TN0C 4EKXA 4NZUH 4H26A 5ICZA 4W6YB 4J3OC 4XPBL 4QGYA 4KAQL 1D5MB 5DS8B 1N5YH 3WMSA 4Y2OA 5FUCE 3QXAA 4F57H 1SHMA 3DVFA 3PHQA 3O2DH 5CJQL 5GGVL 5AZ2L 3TNNB 2GEEA 5JHDB 3U7YL 5HI5D 3GGWB 2YHGA 1U8HB 3S35X 5SV4A 1ORSA 3EO0A 4XPHL 1KYOJ 4UDUA 4DGYL 2XQBL 2YR3A 3CNKA 2E5EA 3Q1SL 3X11A 4JKKA 4LVOB 5TGBA 5FOBB 5IFJA 1FNHA 5BOPA 3P77B 4OCNC 3SJVB 3BKML 1KCVL 2FIKB 4GRWF 1J1XL 4WW1A 4Q0XL 3D0VB 1RURH 4A6YH 2AJZB 3EYOA 3AS2A 1CD1B 4LASL 4LNVA 3CH1B 3TYGL 4HKZA 5L6YL 3BRGC 4PY7A 4N90D 5FB8B 5F7YC 2ID5A 1GGCL 1LK2A 3C9NB 4DZ8A 4HF5L 3U36B 5AUMB 1QA9B 4KI5F 1A1MB 1WLHA 2F15A 3UTTD 1Q9LA 4Z77B 4G9FE 4MJID 4HAGA 5J9PA 4LIQH 2CKBL 1YPZB 3H7BA 1ZKAA 1G0DA 5FYKD 4EIZC 4IBLT 2DRUA 1N6VA 3RNKA 3C8KB 1KG0B 1CG9A 4D2NA 2VERN 3U9PH 2XQYG 1NBVL 3MR9A 3OSKA 1M7IB 1TTFA 3ARGB 2VLRA 1LO0L 2XICA 5LGHL 4QXTB 1ZHKB 3VRLE 4X98B 3BYTA 2CR6A 3SGEI 5EOCL 4L29B 5C9KA 2PF6A 3KR3H 1TENA 3TA3D 4GW1A 5IW6B 1Z0NA 3MREB 1NCTA 2P8MB 1H5BC 4JFDD 4PB9H 5C0EB 1IQDA 1VFAB 4FS0A 4KAQH 2BNUB 1XGTB 4AIOA 3G9VA 3MSPA 3O9WC 5CJQH 3TIDA 2P47B 3EJYC 2EO1A 4QHKJ 2EDOA 4PJXB 3MJGX 5CGMA 1VPOL 5CP7A 3BSZL 4TNWK 3O11B 4UT7L 5F1NB 1KCUL 2OMNA 1FL5A 1S8DB 1C16A 1RFDL 3TZVA 2NR6C 1QR1A 4UIMB 1SJXA 1WT5A 4NQVA 2EC9U 1DL7L 3CFJB 3PWUA 3DJ9A 4U1MA 3MX0A 1J1XH 3BGFC 1CE1L 1T1YA 5C0CE 4Q0XH 1Q9KB 5EPMA 4NHUB 3MRNB 4J4PA 2YPLD 3QFJE 1KGCD 5MEPB 4LASH 3UTTB 4IDLA 1TJHH 3PDOA 4QRRD 3OWEA 4GMTL 3TYGH 4MJIB 5L6YH 4J8RA 2L0DA 1J05B 2WWKO 4WO4D 3GSWB 1GGCH 3VFNA 1LP9F 4N8VG 3WS3A 5TDNB 4GG6E 1C7SA 3BFOA 4U1SA 1KB5L 3WN5B 3NCFB 3W81A 3ZE0F 4EI5D 4NO2A 4Z5RB 4WFFE 5AG8A 1FNEA 2HLAB 4LF3B 3EO1A 4K9EL 3LMJL 4WUKH 1T04A 3HRZA 3BH8B 5EUOB 5A3ID 4GKSA 2CR3A 2VIRA 1OB1A 1XIWA 5FYJU 4F33B 2ZG2A 5TH2B 1NBVH 3EOBA 1A2YB 3RWIA 4HIHB 2AQ3A 4LCCC 3GBMH 5F7UA 5KANG 2D9CA 1YDPB 5D7JC 4XCYA 3HR6A 4P2RA 1NLBL 1RI8A 2D0HA 3SGKA 4L9LB 4V1DA 3AU1A 1MHEA 4UZGA 4PTUA 3RVUD 1OW0A 1QKZH 3EHBD 3IDGA 4KGLA 2BVTA 2YXFA 1S9KC 3NCYP 4MLSA 3ET9F 5D7LE 4KZDL 3S36L 2XRAL 2H26B 3EFDL 5D2LA 5DS8A 1IILE 4M93C 3DO3A 4RFEB 1NH6A 1VPOH 4UT7H 5JHDA 3X13B 3GGWA 1U8HA 2G5RA 2R69L 3B3IB 3DYPA 3P4NB 5BQ7B 1RFDH 5CJOL 3N85H 3QB7C 4G8GB 2YPLB 4Z7WF 3HMWL 4M6NL 2DQCH 4WU7B 2GSGA 5HJ3B 1WF5A 1DL7H 2ILLA 1PZUB 5FOBA 5D1ZB 4Q7DA 1IAIL 3GJEB 4G43B 1AJ7H 1MFCH 2NZ9D 3P77A 4KK5D 1XGQA 3IS0X 1KJ2L 1XF2B 4IIQA 2NY6B 1WFNA 5DRXB 3H9HB 4L1DA 1SJVA 3I75A 3PQYB 4LNRB 4EI5B 4EIGB 1A8JH 3D0VA 4GMTH 1I9EA 5B38G 5D7SL 5C0RH 2DQFB 3I6LD 1CD1A 3CH1A 3TBYB 1PG7H 4HWZB 4WI4A 4EDXB 4URTB 4KUZL 1NEZB 4D3CL 2D0FA 3BHBB 4F7MB 4PRHA 1ZS8B 1RZIA 4NM4L 3C9NA 3I9GL 1I7UA 1JWMA 3HB3D 4L3AA 4P99A 3KPSD 4M00A 5AUMA 1QA9A 1A1MA 1BECA 2A38A 1MLCB 2W07A 5D6DA 3WKNA 4RMRA 4Z77A 2IH1B 1F5WA 2GITB 3WFZA 4MD4B 5DURD 4WHTB 1YPZA 1YY9D 1DDHA 2XKNB 2H2PD 2B1AH 2D03H 4XPTH 4ZOEA 1XCQB 1DSFL 1WVZA 1WBZA 2VDQL 3C8KA 4IRJB 3LN9A 2R0WL 4HIIA 3HMXL 3DGCR 1M7IA 4JFHD 4AEIH 4L9DA 1CU4H 3UTOA 5HI5C 4Z0XA 1ZHKA 8CGTA 1MI5D 3NCJH 3FO1B 3BUTA 4L29A 5C2UB 1D9KB 5DI8B 5HDQL 4EUPA 4Y5VC 4TRPH 5C86A 5IW6A 5CLTA 1AGCB 3H9YA 1EFXA 3DVGB 5I1CL 1TNMA 5A43C 4W4OA 5H35B 1VESA 4JRYB 4WWKD 5JW5B 2WWKT 1T20A 4Y16A 1XGTA 2QSCL 4N1EA 4ETQB 2YUXA 1BQHA 4NZTL 4Z7VE 1UYWL 1WTGT 2DM2A 3SE3C 3JWOH 4NJ9H 3IKCB 5GJSH 1CE6B 4Z6AT 2AJXH 2FATL 1XCTB 3CDCA 3VXOB 3VXSB 4OLVH 5F1NA 4M6NH 4JZJB 4N0YL 2QADB 1S8DA 5E7FA 3SKMB 4AK1A 2OK0H 5L8KB 2VH5L 4UIMA 4AEHL 3BAEL 1EEUA 3HNVH 2APVA 2J6EL 4HWUA 3B5HA 4HULB 5FO7B 3S5LB 3BJLA 1Q9KA 3ULUE 5D7SH 4GAYA 4IOSD 4UQ3B 3IXAB 1M7DB 1VDGA 5LBSL 3MMEB 4D3CH 2GY5A 2FX9L 3BE1L 3GSWA 3EIFA 3OPZL 3H7LA 4G9FD 4NM4H 3I9GH 1CDGA 3T1FB 3WN5A 1DVFD 1UADC 1YEFH 1RIVL 2AXGA 3P4LA 1OP3H 3FZUC 2HLAA 3TA3C 4LF3A 4BQ9A 4YHLL 1PBYA 3MNVB 4GUPA 4Q9QL 1KTLB 5HHXH 5CP3A 2VDQH 1E4XH 5IK3B 4F33A 4U7KA 1DANT 5TH2A 2R0WH 1BEYL 1A9BA 4I0CC 3RPIA 4B0MM 1A2YA 3KPQB 4HIHA 2APFA 2V5RA 1E27B 1K6QH 2BCKB 3OAUH 2J88L 1YDPA 1LEKA 2LVEA 3BQUB 5F9JA 4LPYA 3MLVL 3HE7A 1EIBA 5HDQH 4ZOCA 1JPST 3QSKB 4L9LA 3CCHB 1OLZA 5D1QB 5I1CH 5B3NA 4ODTL 1B90A 2QTEA 1LEIB 1D5IL 5AWNL 4MS8D 3KPLB 4ZO6A 4OF8A 5ICYB 4NZTH 4OD2A 3O3AA 4JO2H 5IUSA 2H26A 3DX8B 5C0BB 2EIZB 2PW1B 3UMTA 3ALXA 3LAFA 3FL7A 1AD0A 1T89A 3X13A 2IAMD 4WO4C 5IB4B 3B6SB 4N0YH 1BPVA 2VH5H 3MRIA 3JV6B 4G8GA 4EI5C 2XA8L 4WU7A 5C0CD 5HJ3A 1XR9B 1MF2L 4HIEA 3D5OF 5D1ZA 2J6EH 1NCDL 5EU5A 1XF2A 3QFJD 1IARB 3FFCD 5A3IC 1EHLL 4HIJB 5DRXA 3H9HA 3FN0L 5HVHC 4FTVA 1DVFB 4LNRA 3PQYA 4MLIA 2C7UB 4MNHB 1GZQB 5LBSH 4WFHE 2ZSVA 4LPVA 2FX9H 2Z35B 5F9WC 3MLYL 1T7VA 3TBYA 1NUDA 1DBJH 1BGXL 3BHBA 4OF3A 1ZS8A 3FAXA 5L7XH 5FDYA 5F1KC 3S3JA 3C2AL 1MLCA 4HSQA 3RVUC 4Q9QH 4OZ4A 1MFBL 3EHBC 2GITA 5H94B 5BV7L 4MD4A 4WHTA 2ZWLT 4TOYL 1BEYH 3QT2A 1DP0A 1QBML 2BOCB 4P46D 5TE6L 2XZCL 1CXKA 3F7VA 2J88H 1FE8H 3IU4H 2M26A 1GGBL 3MLVH 5IJVB 1XZ0A 2WBKA 4LLAA 4DKEL 4NHCH 2ESVE 3BD3A 5DI8A 1BZ7B 5D7LD 1ZHLB 4PGBB 2DDQH 3ZYOA 4BSVA 3KLDA 1CL7L 4Y19E 4X8XA 3M1BA 4H25A 2FEEI 3DVGA 2NZ9C 4KK5C 1I4FB 4M48H 3PJSB 4IOIB 5H35A 4JRYA 3I84A 5JW5A 1I1AB 2P42B 4XC3L 1R3IL 3B9KB 4ETQA 1QQDB 2VUYA 4PJIF 4RWYH 2QHLA 5C0CB 4DVRH 5DDHB 1JP5A 2HJKB 4S1QL 1YEKH 1CE6A 1I3VA 3L1OH 3QXDB 1HINH 4XBPA 3VXOA 2ZG1A 3VXSA 3TGXA 5KJRL 4JZJA 4WTZG 3A67H 3LV3A 3HB3C 3SKMA 1HQ4A 4GG6B 3WFHB 3HAEG 1NCDH 4OFKA 1JYVA 3QG6B 3B9DA 4LIQE 3FN0H 1H3PH 1IBGL 1BAFH 1YY9C 1WQVT 2E7LA 2H2PC 5FO7A 3S5LA 2J8UE 1HSBB 3CXDH 2APTA 1GGTA 1B9ZA 3B8YA 3GBLA 4UQ3A 3WFEL 4OFYA 3IXAA 1M7DA 4FFYL 1KIQA 4F58H 3KS0H 3KYOB 4LOUD 3LH2L 4A2MA 3MMEA 3WFCL 5IM7B 5L0QB 3VXMB 3D87B 5T5NG 3C2AH 2DI7A 4HWEL 1RK0B 2H8PB 4ZDHA 3C5SA 1MFBH 3F65A 3LPFA 4X0KB 3NMEA 1INEL 4D9LH 2YWZA 4WJ5B 2VSCA 1QBMH 4GQ9H 4FQ1H 4WW2C 5FUCC 4WWKC 5IK3A 5TE6H 4M9OA 1I7ZB 1B0WA 4LPWA 3V79C 2YRZA 5A16B 4YHYC 4UILH 1GGBH 4LLUB 1E27A 3ESUF 2BCKA 2ERJB 1A6UL 3D25B 3BQUA 3EFFB 5ITFA 1YQVL 1RJZB 1NGYB 2DS4A 3CCHA 3O2WH 3VFMB 2YPVH 4YGVA 5D1QA 4F8TA 2BVQA 5IP4A 4P2QB 4PJDB 4NYLB 1QLFB 1LEIA 4JN1L 3KPLA 4P4KD 4F7CB 3DTXB 4KMLB 1EZVY 2D31A 4TN9A 4Q97A 4UT9H 4XP6H 3SDDD 3DX8A 5C0BA 2EIZA 2O5ZL 3QG7H 3U0TA 4O58L 2IPUK 4GLRI 1MJ7L 1HDMB 4L3EB 5DJDB 1AI1H 2R2EB 1JZ7A 1RJLA 1BF2A 3UO1L 1IZJA 5KJRH 5IB4A 3B6SA 3HS0B 1RSFA 1D5ZB 3UC0L 5D7KE 2ATPB 2VQTA 3OB0K 1GZPB 1DVFC 4HUUA 4RGOL 4JJ5A 2A74B 3ULUD 3ARFD 3ZSSA 4LSSL 5JDSA 3ARDC 1FCCA 1HWHB 5I8EA 4JRXD 4DTGL 1CXHA 4N68A 4ZFZA 5F71A 3GSUA 2Q8AL 4NO3B 4ODWB 5D1XD 4FFYH 3ZT7A 1IGFH 3L3OB 1GZQA 2EDEA 3LH2H 1VSCA 1BD2E 3WFCH 1CLOH 3LEYL 2H32H 4H0IA 1FO0H 5A2KH 4JDTH 4OD1L 1KJVB 4LCIL 1RK1B 2P5EE 1G7JB 1IGTB 4NO5B 3HUJE 2FX7L 4KI5E 4M62L 3ZDXF 1INEH 3UPCA 1TQCC 4X9HA 5CJ5A 1SQ2N 2X70A 5H94A 4OUUB 4KKCD 3FB8B 3BWAA 4D0DB 4MS8C 4RZCB 3HZMA 1P5VA 1MCQA 5F3BB 3MROB 1VFMA 5EZLA 2DQIH 4MJ5B 1I1RA 3VGEA 2YD9A 4QTIL 3OAZH 3V5HB 2IAMC 1L7IH 4R96B 5IJVA 5CLWA 3E1F1 2ARJA 3KWWA 3V6FB 4OLWL 4XWOD 1ZT4B 2BVUA 4PGBA 4E42A 4JN1H 1D3CA 3U79A 4P4RB 1I4FA 2DWEA 3PJSA 4IOIA 4G7VL 3P9MB 1I1AA 1H8SA 2I60L 3C5JB 3REVA 1G9MC 1KJ3L 3B9KA 4JZOB 4O58H 1CDUA 4M61A 1MJ7H 2UWEE 4JR9L 5SWZE 5DDHA 1UGNA 2HJKA 4G8IB 4GXUN 5IHLB 1PY4A 4OAWB 2Y25A 1OPGH 2HH0L 2V5SA 5JQHC 5INDB 4R97C 1LE5A 5KN5A 2QBWA 4FXGB 4PJHB 3VXTB 1A3RL 2VL5B 3ULSA 1A9EB 4LSSH 1NUGA 1TZGL 2EDLA 2MKWA 3QG6A 4DTGH 4MXVF 4XCFL 3T0VA 1YY8B 3VG0L 4ONGL 4WFHD 1Z5LA 3LS4H 1G0YR 2Q8AH 4ZFOB 2E9BA 3V4PH 1P5UA 3AS0A 4S1DD 2NY2B 5DVKA 2DIAA 3G04B 1OTTD 2EEDA 5DZNA 4P46C 3L7EB 5IV2B 3HG1B 3LEYH 2FECL 3GSNB 2JLLA 3MBEB 2I25N 4OLUL 4P2CG 4LCIH 4QRTB 5IM7A 3BVNB 1MFEH 3VXMA 1T7WA 3M17B 2IEPA 3ZE0E 4JM4L 4M62H 1RIHH 4NPYB 1Q72L 1RK0A 2H8PA 4ODXB 3BP5B 2R8SH 3MJ9L 2GY7B 2UUDH 2X4SB 2F53B 3P4OB 4F2MB 2OR7A 5DVMA 1MIEL 4WJ5A 1WZKA 2ZUWA 4PREA 2JTDA 3QFDB 3ZT5A 2WSKA 2BXYA 2LQRA 1FC1A 4U4BA 2N7BA 4CU7A 4LLUA 1IL1B 3H9SB 4AH2B 4Y19D 4LEOB 3D25A 5GGVY 1KFAL 1AC0A 1HXMA 1QFWL 5EU6E 3UX9B 4JY5L 3EFFA 4UIKL 1NGYA 1FFOB 1ND0B 4HBCH 5TJWK 1YYLH 3VFMA 4WI6A 4U6YB 4P2QA 4PJDA 1S7TA 2OZ4A 1QLFA 4G7VH 2DJUA 2I60H 3T0EE 1XF3A 3VD7A 1FL3B 4U1HA 3DTXA 1NC4B 4YFEA 3EYFB 1FJ1B 1WGOA 4ALAL 3WLWD 3S34H 1E4WL 2DQHH 2HH0H 1HDMA 4L3EA 5DJDA 2R2EA 1BVKA 4LOUC 5F88B 4OV6F 1Y18A 2HN7B 4UUJB 4P9MH 2ATPA 1A3RH 2IFFL 4HLJA 4OD3L 1WBYB 1Z9MA 2A74A 4KTEL 4R3SB 4K3DL 5EC2A 4YEEA 3VWKA 3VFSB 3K4ZA 1KIRB 1P1ZB 2VZTA 5T1DL 1YNKL 4X99B 2J1KA 4HLZG 4M8QB 1BOGA 3L3OA 3K4AA 1N7ML 2X7LB 4OLUH 1LEGB 5DMYA 1I7TB 4RBPK 3WV0A 5ILTH 5CEXB 1KJVA 3D85B 5IR1B 1Q72H 3BZFB 2JIXD 5FKAB 3KJ6H 1GIGH 1IGTA 5HY9A 4YO0B 4P2OB 3SY0B 4NQSB 5MEQA 3UCRA 5JOPE 2ESVB 3WJJA 3IJSB 1JPFB 1JHTB 2Y4SA 2VZ3A 1Q9OB 5FUZH 4LAQL 4GAGH 3MV8B 4KY1H 4Y19B 3FB8A 4P4KC 1FLTX 4H8WL 4RRPA 5F3BA 2OYPA 4QHLA 4YPGB 3WFBH 3SDDC 5J06A 3KG5A 3AY4A 2VZSA 1CN4A 1QSFE 3MRLB 4XNUH 4A6YB 1KFAH 1QFWH 5IIEB 4JY5H 1AGDB 1HH9B 4R96A 3X12A 1RZJC 1U8PA 3V6FA 4P57A 2X4PB 3MV7D 2GJ6E 1UEMA 1ZT4A 4GSDL 4JFZH 5IB2A 1WTLA 1HN1A 2B4CH 3GI9H 3ULUC 3ARFC 1JTPA 1PQZB 2BRRL 4KV5F 2A9NL 1CFVL 3PWJB 2OXGA 3P9MA 3TO2A 3PG2A 5DGRA 4ALAH 5KVFH 2FHFA 4JZOA 2AEWA 5D1XC 2GQHA 4NQDE 3OKOB 4B50A 4Q9CA 4HWBH 4Z7OF 4G8IA 2DM4A 3MLSL 4OAWA 5LXGL 3WHXB 1OF2A 4GAJH 5FYJL 3QULA 3O4LD 5INDA 3JWDH 1SY6L 2YRPA 4XP4L 1LDPH 2IFFH 2UZIH 4PBVC 4OD3H 4PJHA 1YMMA 4K3DH 5IQ7L 2VL5A 5K9KA 4CU6A 2E9WA 2W0LA 3QAZC 4PRIA 4K7PH 3ZHDA 4PGEA 2ICWJ 4PGCA 3R8QA 1YY8A 4ZOAA 3X14B 2XFXB 1BD2D 5GGRY 4KKCC 2AXFB 4JN2B 1JNJA 3G04A 4IOFD 1TXKA 5DK0B 4WNQA 3HG1A 3GSNA 3MBEA 5LWYL 4PTTA 3OGCA 4KI5D 2FHCA 2PXYB 1RUQH 4POYA 3SE8L 4QRTA 3BVNA 1IM3B 3M17A 4NPYA 4I4WB 1FH5L 2B39A 5DJ8A 2WWMD 2NXZD 3BOVA 4XWOC 2DJ4A 3BP5A 3ISWA 1I9RL 4RMSA 2UY6A 1AFVH 2X4SA 2F53A 3VGDA 4APQD 4J2XA 5T5NF 3QPXL 2IG2L 5DJAA 4FQXD 3QJHA 3VH8B 2AJYH 3VFWA 4NC1C 4U1JA 3Q0HA 3QFDA 2GK0B 2NY0D 3EYVB 4F3FA 3IGAB 3FMGH 1WIPA 4X7DC 1IL1A 3H9SA 4G42A 3QUYD 1U3HD 5D70H 1Q0YL 4LEOA 2FD6L 3O45A 4O2EB 2OI9C 4GSDH 2NTFB 2DTML 1FFOA 1ND0A 2CPCA 3MRFB 3QDMD 4U6YA 3LIZL 1CFVH 5SWZD 1FL3A 3H0TB 5B8CB 1NC4A 4S1DC 1T1XB 5EUKB 1OD9A 4ZTOL 2NCMA 1OTTC 5E2VL 4GRWB 2ATKB 1NCBL 3MLSH 2BNRB 3G6JE 5FYLL 5F88A 1J0HA 3VI4F 1WWBX 2OTUB 1QFPA 2OJZL 1SY6H 2X4UB 2JK5B 2HN7A 2CIIB 4S11A 1QP1A 4HKJB 3INUL 2LFGA 2X1WL 1XGRA 3N06B 4JQXA 2P5EB 4MX7B 4OTXH 3SE9L 3TJEL 1H15B 1ZVHA 3V52L 1OQOA 4XP5L 3WNKA 3TC9A 1RD6A 4IS6B 3RL2B 2WIMA 4OQTL 1AIFB 1P1ZA 2EH8L 4X99A 5GRYA 4YJZL 3NCCB 4M8QA 2X4RB 4NNPH 2PO6D 1E4XI 3RY4A 5LWYH 2X7LA 1LEGA 1YJDL 3SE8H 1DLHA 1I7TA 5C92A 3LEXB 5LKNA 3OG4B 5DD5L 3SGJC 2J5LC 3D85A 3REWB 5C08B 3CZFB 4ZPTA 3HC3H 4MZ3A 4YO0A 3SY0A 2O93L 1XF5A 2IGFL 2XZZA 5B3JE 4UDTA 2VR9A 1JPFA 1U92B 4NWTL 1JHTA 3QPXH 2IG2H 1Q9OA 3CLEH 3MV8A 4YDIL 5CIPH 5DK2B 4LCYB 4AT6B 5DVNA 5CZXD 3CFCH 3DV4B 5IT2L 3HAEH 5FYKU 4YPGA 5EU6D 5DJYB 2DM3A 2Z92A 3MXVL 3MGAA 1DQQB 3WLWC 3RA7H 3TBSB 1WAAF 2E3VA 2ORBL 2VTFA 1FSKB 4DJMA 3W39B 1CWVA 1NC2B 4DKFL 1AGDA 2AS5M 3G08B 5EBLB 3T0ED 4KDVA 4TUKH 1AKJB 3OKMB 3U46A 5JHLL 2W9EH 2VLME 5C0AD 1M1SA 3PWJA 3MCKA 4ZTOH 3ZKXB 5E2VH 1MY7A 4KMTL 3IDMB 4PJCF 4PJIE 1NCBH 2I9TA 4NQTA 4K8RL 3BP7B 5FYLH 2AW2A 1LNUB 3OKOA 4HK0B 3OF6D 1B6UA 3WD5H 2R9HD 3QRFM 5T1MB 3MRJB 3MYJB 4O2FB 3L9RB 1LP9B 2VXQL 1I8KA 3QIUB 4XP5H 2X89D 1F11B 4TSBL 1ADQH 2EH8H 5DMGD 5IMKB 3X14A 2KQMA 4CMHB 4MJ6A 2FBJL 4XMKH 4G6KL 4JN2A 1DQMH 5I8OL 3ZKMD 1C5CH 5JXED 1H5BA 2R4RH 5DK0A 5HHNB 5I18H 3BT2L 1RUMH 4NFDA 3WNOA 3RX7A 3C08L 3FOMB 3LD8C 5BRZE 3SKJH 5F3HB 4RX4D 3O9WA 4KDWA 3LPWA 4O9HH 4PY8J 2XWTB 1IM3A 5JOPD 4QRPE 2BFVH 3PL6B 5E8OB 2D4FA 1V8HA 4MMZC 2ZUUA 1N2RB 3SDCB 4OB5H 5GGSY 2DIJA 4KRNA 4NWTH 5ETUA 5DD3L 4LL9A 2HJLB 4YDIH 3MNWB 4NKDA 4OZGF 2FBOJ 3G5VB 4M7ZC 4HC1A 1QSFD 1P69B 3VH8A 5I1JH 3BGAA 1J86A 2VKXA 3CMOH 4LDLB 1KLFA 3FT2A 3EYVA 5HGBB 5J7CC 2IBZX 1SEBB 2BY1A 3IFOB 3IGAA 1X5IA 2XACC 2GJ6D 3BPCB 4OLXH 5I73C 3OKEB 3BH9B 3RVVD 3EO9L 1RMFL 4F9PC 5HPMB 4LVHB 3BESR 3CX2A 4JO3L 2NTFA 5I1IH 3D39B 4GKNB 1J8KA 5GRUL 5E24E 4ZUWB 4PJ8C 5JHLH 4Z7WB 4NRXB 1PW3A 2DQUL 3QRGH 4HDIB 3RY6C 4NQDD 2EIBA 5F9OH 5KVMC 1JF6A 1NAMB 3H0TA 5B8CA 4K8RH 4AG4H 5EUKA 3C09C 4IOFC 1NSNL 2BNRA 4NFBA 2HRPL 1QLRB 1U8NB 4KI5C 1JIBA 2OTUA 5IG7B 2EDWA 2DQDH 2JK5A 4LCCA 4Y89A 2CIIA 2DQEH 4HKJA 1PYWB 2RQ8A 1GGIH 1REIA 4Q6IB 2WWMC 4MX7A 2NXZC 2OJEB 1CIUA 4TSBH 1H15A 2DYPB 3V9FA 3RL2A 4APQC 1ZT7A 4JPKL 1X5JA 5I8OH 1AIFA 3CH8A 4FQXC 2X4RA 5FHBH 4XXDA 2NY0C 5IBUG 2VE6B 2FYYB 3GHBL 2ICWA 4LCUA 3I85A 2QV2A 2FO1A 3CU7A 1QSFB 5MENA 3QUYC 1U3HC 5C08A 3STLB 4HPOL 2ZUVA 4ZPVB 4OCWH 5DD3H 3T2QA 4YBLC 4QXUH 5C1MB 1UWXK 3RL1B 1K4CB 1DFBL 3O2VH 3OBAA 4I8DA 5IKCB 5IJKC 2YBRB 3L6FB 5DK2A 1JK8B 4RWHA 4LCYA 4ZAKD 4JZNA 2NQCA 3IDIB 1S7QA 5GGUB 3JUYA 4JDZB 4JCLA 4LVNC 4ZUVB 3ARZA 2Z31D 5DJYA 1J9CT 4PLOB 3GSOB 3UAJD 1DQQA 1QBLL 3TBSA 3EO9H 3ZLQC 4L4JA 3FQRA 2P7TB 3BYYA 4PJBF 4WEMB 2F8XC 5EA0H 5EBLA 1DR9A 5GRUH 32C2B 3BP6B 2PYED 3CLFL 3QUML 3T2PA 1NMBL 3NZ8B 4UOJA 3PV6A 5I1GL 4YUEL 3I3BA 1WZ1H 3AMLA 2ICCA 2LTQB 3IDMA 4E41E 3BKCL 1IJ9A 2PO6C 1V3JA 1LNUA 4MD0A 2EEBA 2HRPH 2CSPA 4HK0A 5KSAB 3L3IB 4EUPG 4LLDB 3W82A 5HI4D 2Y6SC 2P1YA 3TBVB 5T1MA 2A2QT 3MYJA 1FPTL 4O2FA 3RU8L 4G5ZL 3DYOA 1VKXB 5KW9L 5JXAL 1S7VA 4I0PD 3TVMB 1LP9A 3GBNL 1BQHG 3QIUA 1IGIL 1S9XA 1IKNC 3ROOA 4MXVE 5JZ7D 1KEGL 3HC4H 1F11A 3FRPA 3GMPA 1HZHH 4JB9L 4JPKH 4HGWB 5IMKA 3JWOC 3DSFL 4MSWA 1X5YA 1NFDF 4K3EH 1YECL 4N5UA 4ZO9A 2IF7A 5CZXC 1IQWH 4Y1AE 3GHBH 3W9DB 3HNTH 1TPXB 2I9LB 3MO1B 1RU9L 5E70A 5DJ6B 5F3HA 4W4NA 3LRSB 2K9UA 2VR4A 3K7UA 3PL6A 4O2CA 3WIIH 1HHIB 3EUUA 1MCEA 5D2NB 1N2RA 3SDCA 1TTUA 3T0EC 1A7PL 4P3CH 1DFBH 3VXRD 1FLRL 2HJLA 3MNWA 3GSRA 5JTWA 3VD4A 2OL3L 5GGQL 3VW3H 1C8PA 4ZODA 1N3NB 2DLEA 4YH6A 3SDAB 5HHPB 1BOYA 1JPGB 5HGBA 4PJ5E 4JHWL 5E2WL 4FP8H 2HFGL 3BP4B 4H5SB 2R9HC 4ZMAT 4PJEA 3OKEA 3BH9A 3I6KB 3T0WA 3WBDA 5IVZB 5D4QA 4MA7L 2Q7YA 2IC2A 2VLMD 1AO7E 5FHAL 3TH4T 4WV1C 1J7VR 1UKQA 2A9MH 3CLFH 2X5PA 1BJ1H 3D39A 4GKNA 4RIRB 3S4SA 4TPRL 1NMBH 4ZUWA 2KH2B 1MCOL 4Z7WA 4BZ2H 5I1GH 5I8KL 5DMGC 5CD3A 1NAMA 5KANI 1VENA 1XGUB 3GMMA 4KTDH 3ARXA 3RRQA 3L5WB 4MB3A 1X6LA 4OIBA 3ZKMC 5JXEC 1KUMA 2E6QA 3NCBB 2ICES 3S97C 3QCUL 5FF6B 2JJUA 1FPTH 3RU8H 3KPRE 1QLRA 1J5OH 1FNLA 4ZOBA 5IG7A 4FQQA 5KW9H 5F96L 4UTAL 1IGIH 4MNQD 4MAYD 4Q6IA 3W0WB 1KCLA 2CJUH 5D9SB 5J13C 4DN4H 3P73A 3B83A 2DYPA 3DSFH 5L8LB 1CGSL 3TF7C 2G60L 1G7IB 3W9EB 5BRZD 1NGWB 3CVIL 4M7LT 2ZCKL 2COQA 1G9EA 4F15C 4OFIA 3BEVA 2Z9TA 4QRPD 2O61B 4NT6A 4QGTA 4FN0A 2FYYA 2CDFB 4EZMA 2BNQB 1RZ8A 1UWEL 3MA7B 3SDXA 3ABZA 3RVVC 4CN4A 3STLA 1AE6H 4YIQB 2P46B 5T1LD 3ZMRA 4ZPVA 4HZLB 2KQNA 1FLRH 4WO4A 4WI3A 1IMHC 4Z7QE 1Y6NR 4NOBA 1FRGH 4JG0L 2VXSL 3RL1A 4XBGA 2C1PA 3WO4B 3ZL4L 2C4FU 2YBRA 1JK8A 1RZ7L 3QNXB 1DEDA 5GGUA 4JDZA 4ZUVA 4JHWH 5E2WH 3QH3B 1XFPA 3NOIA 3ULVF 1LDSA 4MAUH 3WS6C 3EJZD 5AZEH 4YC2B 3RDTD 5JLZA 3LQAL 3V5KA 4MA7H 4ZQKB 1YA5A 2P7TA 4HXBL 5FHAH 5LQBH 5IROA 1XGPA 3HTLX 3BIAX 3LZFL 32C2A 3BP6A 2DBLL 2MNUA 5ESQB 1J0YA 4QEGA 3IDYC 2CK0H 1G84A 2AKRB 3NZ8A 4KV5E 5I1HL 5EO9B 3T08A 3LRGA 3QI9C 1JFQH 4YDVA 4ZUSB 4AM0A 2CO7B 5I17B 5JORB 6FABL 1R3JA 5IB1A 4HKXB 5CEYA 5A40E 2E7MA 5A2LH 1CDJA 1CLYH 1GL4B 3EOYG 1WUNT 2VDPL 2Q6WA 3I50L 3L3IA 5KSAA 4NJAL 4M3KB 4WY7H 5F96H 2I26N 5JDJA 4UTAH 4QHMB 2B8OT 1VKXA 1UA6L 3TH3T 4ESKA 3TVMA 3ZTJG 2CMRH 5JIKA 1G7MA 2EDJA 1AR1D 1TPXC 3HE6D 4OLYL 1SJEB 5EBWB 2G60H 3MODL 2CGRL 4M6ML 5E95B 1W8OA 1V05A 4NRYA 4N8VB 1QNZL 4ZAKC 5GRJH 3S8WA 2LU3A 2Y7QA 3W9DA 2Z31C 2I9LA 4G9DA 1F3JA 1UWEH 3MO1A 1EEZA 4FOMA 4YAQA 1CZ8L 3UAJC 5INCB 5DJ6A 1FNGB 3RY5A 1K8DB 3LRSA 4OCSL 1EO7A 3WHE0 3MJ7A 4C56B 5D2NA 3S5LG 2VXSH 3ARYA 4GKZB 1YEDB 3OAYH 3ZYJA 2P44B 5EZIL 3SGDH 2MJWA 3U6RB 3DETD 2F74B 2W9LA 3KPSA 4JPIB 1RZ7H 1YEIH 1RHHA 2HLFD 4BKLB 5ERWB 1U0QA 3VFUB 1QD0A 3SDAA 5HHPA 5FYLE 1JPGA 5DT1L 4Y4FD 1Y6KR 4XC1H 3LQAH 1OP5K 1KLGA 5HI4C 4LRIC 1W0WB 5DMIL 4HXBH 3I6KA 5I30L 4I3RL 3T0AA 3A6CL 3RHWF 5IVZA 1PGRB 5C9JB 3LZFH 4R0LC 3DXAA 3MUGB 2GT9A 4I0PC 1D5BA 4UB0L 4X6CB 4YHIB 1MH5B 1TITA 2NLJB 5I1HH 4E41D 4NGHL 5JZ7C 4Q74A 5BZWA 5BMFH 2VITA 5E00B 3WNPA 3J7HA 3NPSB 1XGUA 1XEDA 4DEPB 4JANA 2VDPH 1CDCA 3TBWA 5DTFB 3D0LB 4MA8L 4RCAA 1H3XA 3BKYH 3VI4E 1PDKA 4LPCA 2YRLA 5KBNC 4EXKA 1AP2B 3RIFF 4FXLA 2NY7H 4KKBD 2ZKHL 4JQIH 5EWIL 3W0WA 3GSXB 3MODH 2Y36H 5B38B 4HFWB 1E0OB 4M6MH 4Y1AD 5F44A 2AGJL 5C0GB 1LO4L 3WIHA 4ELMA 3NVQA 3QO1A 4IHOB 4I77L 1G7IA 3W9EA 1WK0A 2RFXA 3D3VE 5D2LF 4PJAA 5MHSD 3I2CH 1TJGL 1CD9B 3BISA 1HQRA 2BSRB 3R0NA 2IQAB 1F3DJ 4KDTA 2BNQA 4OCSH 4X7FC 2HRLA 3MA7A 3MBXL 1Z3GL 3WO4C 5CINH 2UY7A 3PXJA 3UTZB 4NZRH 4G7YH 1PEWA 1QSEA 5DEGA 4HZLA 1E4KC 1MCCA 4YBQD 4Y4FB 1HIML 3CVHL 2EDYA 2NZIA 1MHPH 4LBEB 2AABH 3RWFB 2IBBA 5JQ6L 4PJ5D 1UH4A 4P5KB 3MFFA 4QWWD 3D6GA 3RGVB 3QNXA 3ARDA 5DT1H 5KS9F 4J6RL 4PUBH 1ZVSB 4X5WB 5HDOA 1FL6B 1AO7D 3IDXH 1WAAE 1YUHB 5IMLB 2W91A 5FUOL 5ACZB 2X1XR 3SO3B 4K94L 2J7LA 2CUIA 2Q86B 1P7QB 2FR4B 4JJHA 1VGKA 4LLYB 5ESQA 4MAYC 3UXFA 4BQ6A 4NGHH 4F37K 3HPJB 1GH7A 2NXYD 3RIAF 2AKRA 5EO9A 3H6JA 4FQHB 4HS3B 3P9LB 5L9DL 1TQBB 3H3BC 1JNHB 4HKXA 4HH9A 4BUGA 4TTGA 3L5IA 3FB7B 3QUZD 3S98A 4JE4B 4JO4H 1NQBA 3FB5B 2C4XA 4Z8FL 1C08B 3U0WH 4CUCA 3X3GL 4NQCB 2E8YA 1PSKL 3VDCA 2IAMA 4M7KH 1LO4H 5FKPB 1SJEA 5EBWA 1BM3L 3BW9A 1FG9C 4L8DB 5ADOL 1TJGH 4N8VA 1NMCB 4NCC2 3FFCA 1JPSL 4D0BB 3VE0B 1U8OB 4OZIB 3IRPX 2AJUL 3MBXH 4ONHA 1Z3GH 5INCA 2EDTA 3EJZC 1MJJA 1GJIA 4JY6A 5EU7E 3RDTC 4PJ5B 1U8IA 2A1WL 3OJVC 1GOHA 4G6JH 3JV0A 1MAMH 3KLHD 5CAYB 5DJCB 4NKIL 4R2GB 4C56A 2NX5E 5F70A 4P23D 4PGDB 5ESAA 4X6FB 1YEDA 5FECB 2N7AA 4OZGE 3MRGA 5EOQL 2EYSB 2F74A 4X7CC 5MI0B 2L7JA 1ZOXA 5ACLA 3TIEB 5HYJB 4K2UL 4BKLA 4H1LG 5FCUH 5ERWA 5FYJD 5E4EB 3VFUA 1MCDA 5IHZB 4F9LC 2VQUA 1P84K 2AQ2A 5SWQB 1DLFL 3GSQB 5C07B 5FUOH 3RWDB 5IOPB 4K94H 1W0WA 5E08L 5DEFB 5E7BA 2Q3AA 4PYHA 3KPRB 2IALA 3HA0A 2V6HA 1T7XA 3BKJL 4S2SA 2DLTA 3KLAB 4X4XB 5IVOA 3L7FB 1GAFL 1I8IB 1BF8A 4NQXB 4X6CA 1MH5A 1FCGA 2NLJA 4LVEA 5F8RC 4Z18A 3WKMH 1AR1C 1QFHA 3HE6C 5J89A 3IU3A 5E00A 2X2YA 5CJXA 5IF0B 1ZA6B 2NYYD 4S1RH 4XVUD 2FJHB 5HSFA 4E9LA 4PP1D 4FFWD 3VWJB 3E3QE 2X4NB 4U6XB 1FORL 2E9IA 3WNNA 5D72H 5DTFA 3D0LA 3X3GH 1MNUL 3S96B 1AP2A 3ZE2F 3SKUD 2CDGB 3OB8A 2W38A 4MNGE 4W6XB 4X6BB 5IMOA 4LGPB 2WBJD 5DZOA 5FYKL 4J3TA 1WFOA 3QA3B 1CQKA 4PD4K 1JPTH 4UTBH 4NSKB 4K55A 5FGCE 2OP4L 3GSXA 3WE6A 5FV1L 5F72S 4KFZC 4BFEA 4DKDC 4RQQB 3MRPB 4ERSL 3DETC 2Y1VA 4NM8H 2QSQA 4P5TA 2HLFC 1JPSH 1NGQH 4TSAL 1N5AB 3GM0A 5C0JB 4Y2DB 2AJUH 3GIVB 4EN3B 1FG2A 4KK9D 2BSRA 1FAIL 4Y4FC 4X6DB 5F6IC 1U3YA 5KSBA 1JHKL 2A1WH 2W60B 1FYTB 3PWLA 2P8LA 2ZOLB 3RZCB 3MGTB 4TQEH 4ZD3H 1IGYB 3UTZA 2VYRE 3DMMD 4EUPH 3S35L 1UXSB 1W8NA 5TF1H 3N1MC 1J1OL 1EH9A 4LBEA 4XVSL 5FYLD 1T1ZB 3RWFA 4AIXA 2ITDB 2P5WD 1ODAA 3PWPB 4YFLF 1J8HB 4P5KA 3N0PB 3FAWA 2XWBB 1HCVA 3QDGB 1C5BL 4BSJA 2VLKD 3NH7L 2FB4L 3WLBB 4JFQB 4X5WA 3C6LB 3LHPL 2BSSB 1YUHA 5IMLA 5E08H 2X4TB 2BHUA 1IC7L 1N8ZB 2Q86A 2VXTL 4KKBC 5F6HJ 2XT1B 2FR4A 1C7TA 1TZIB 4LLYA 4M9PA 1OGAB 1KENL 2BSED 3B2UD 3V4UH 3HPJA 5HYQB 3O0RL 1MUJB 4V2BA 1EJ6A 1BQSA 4FQHA 4HS3A 1A7NL 3P9LA 3QDJE 2H6PB 1JNHA 1A47A 2X1OA 4DUXA 3FB7A 1MNUH 3HAEB 5EC1A 1INDL 3B4NA 1F6FB 4K71B 3SDDA 3KXFE 5BVPH 1BQUA 5HHQB 1C08A 3B5GA 3MRCB 1M71B 4UAOC 4PP2B 4QYOB 2H3NB 4NQCA 4LAJH 1BQLH 1F4YL 4LLMB 1T0NB 4UT6L 4YBQC 5L8JB 4HHAB 5CSGA 5FKPA 2E7BA 1EJOL 1EO8L 5EOCJ 5CP3H 5C0FB 2BY3A 1NFDE 1T83A 4XAKE 3T65A 1YEJL 1ZLUK 4QWWC 1XF4A 3BPLC 1FAIH 1OCWL 4D0BA 1WJ3A 1U8OA 1X5LA 2V2XA 4OZIA 1JHKH 4LFHG 4TUOA 2QQNL 1U8LB 4DGVL 5D1XA 3O3BA 2IADB 5T33H 5CEZL 2EDRA 2NTSP 3NFPA 4HPYL 4N0FB 4E5XB 1T66D 1T7ZA 2I27N 3ELAT 3OZ9L 3S35H 4DWHA 1OWRM 3ARBA 1XGYL 4K8RD 4DQOL 1U91A 4I9WE 1RUKH 4Z9KB 2NXYC 1ACYL 5HYJA 1UCTA 4HMEA 2HP4A 3AREB 4Y5XC 1UM5H 3HI6L 3QHFL 5E9DE 2DB8A 4P3DB 5K9JL 4PS4L 5SWQA 3GSQA 3QUZC 5C07A 1KSRA 3QWRD 1F4XL 2YMXL 1S3KL 4XGZB 8FABA 3Q2CA 4LSDA 5DEFA 3S37L 1KNOA 4KZEL 4JFFD 3QIWA 1KENH 3KLAA 4X4XA 4H8WC 3BZ4B 1FQ9C 5ID1B 1EAPB 3L7FA 3TO4B 3S36X 5EORH 4U0RB 2ZUQB 1BFTA 1I8IA 1T2QL 4NQXA 4UNTA 3B2VL 4U1NA 5T1KB 4FG6D 2RR3A 1U36A 5TF0A 1DBBH 5IF0A 1EBPA 5IESH 2R0KL 1RZFL 3L95B 3VWJA 4EBQL 4X4MA 4U6XA 2EECA 1QRNB 3D3VB 1INDH 2ADIB 2EYTA 4JM2D 1MY5A 4CGTA 2DKSA 15C8L 4Z95L 4CVZB 2CDGA 1XF1A 4X6BA 2BOBA 3MV9A 1KPVB 3KLHC 1F4YH 4DK6A 1CFNB 3PXHA 4TUJB 4P23C 2CKBB 1JWUB 1ORQB 3UYPA 3BO8B 4HJGB 4J3UA 4NUGL 2CRIA 3NABH 5GGTL 3MRPA 2YKLL 2N1KA 3ARRA 3UJIH 1YEJH 4Y4KD 1OT1A 1V7NL 5ADPH 1OCWH 1ZLWH 4B41A 1FFPB 4NN5B 3TT3L 3WDJA 1N5AA 5LGJB 4Y2DA 3GIVA 4DGVH 3QHZL 2Y07L 4XNMA 2NX5D 1FAKT 4X6DA 2CUMA 2W60A 1FYTA 2F58L 2ZOLA 4NN7C 3OZ9H 4U1LA 3QO0B 1MEXL 1VEOA 2OBGA 2CLZA 3MLXH 1EGJL 1UXSA 4R8WL 3PP3K 3ES6A 4GS7B 1T1ZA 5KOMC 1MRCL 2ITDA 2JJVA 1SEQH 3H3PH 1FNFA 3PWPA 4MA1B 5ICXB 4LQFL 1J8HA 3HI6H 3I6GA 3QHFH 2NYYC 4L5FL 2JB6A 4XVUC 3ZTJH 2XWBA 4JG1L 4PP1C 4FFWC 3QDGA 1XR8B 4KVCH 2PTVA 2QHRL 4PJCB 3WLBA 1F4XH 2YPKB 4LKCB 1MJ8L 1QRKA 3LN4A 4BZ1L 1ZGLM 2YMXH 1JF1B 3C6LA 2BSSA 1OSPL 1PEZA 4NBXB 2X4TA 3E2HC 4M6OL 4KZEH 1OAXH 3F58L 1JZ5A 4NP4H 1N8ZA 2ARWA 1GOFA 4HUVB 2WBJC 4ZXBD 1T2QH 4UQ2A 3B2VH 1LHZA 1TZIA 1OGAA 5F1IB 5HYQA 3P40A 1MUJA 1L0QA 1PKOA 4K71C 3NIGF 3PWVB 1RZFH 5F1SA 1EO5A 5D96C 5TQ0L 2OTPA 43CAB 4EBQH 4KHTL 1PG7W 2ENYA 2F54D 1MREH 3BMVA 1YEEH 2EXWD 3AB0B 5IWLC 2VLRE 4KK9C 5F7NC 4YHZH 1LE9B 3RX8A 4KK6D 5I15L 2PNDA 1IGCL 3MRCA 3WXVH 5HHQA 1M71A 4HFUH 3RUGF 1J10A 3HZKA 2H3NA 5M7QA 4XT1C 4U7MA 1J11A 3WSQH 2C26A 1T0NA 3DMMC 4R7DB 4HHAA 5DD1L 3HZYA 1NUFA 2PW2B 4YWGL 5C0FA 4OZGB 1DTUA 2QQLL 2C3VB 3BIKB 1IT9L 3E6HA 3UTPE 4OGAD 3PGDB 2Y07H 4PG9B 2EDDA 1U8LA 2F58H 5HGHB 2IADA 1N6QL 2DI8A 5EO0B 2A6DB 4N0FA 3EDDA 4G6FB 4JFXA 4DZBB 1L9MA 1PJ9A 3FQUB 1Q9WA 1MWAL 3UZQA 2JIXA 3B2UC 5BS0B 1D5XB 1MRCH 2LV4A 4LQFH 1BFVL 1YJDC 3QEQD 5JMOC 4L5FH 1ZMYA 2H1PL 3C6SB 5AD0B 1R6VA 1IEHA 3AREA 2QHRH 2IH3B 1RULH 1UJ3C 1MJ8H 4P3DA 4BZ1H 1S7RB 3SKOB 1X6NA 1VACB 1NPUA 3EYSH 4U0RC 4XCEB 4LMQE 3F58H 3I3EA 2XG5A 1HSAB 4XGZA 5EU4B 4NO0D 3V6OE 1KT2B 5IQ9B 1G9ML 2VLLB 1IC4H 4NZJA 3BZ4A 1T22B 3WHE1 1EAPA 4NQED 5ID1A 3TO4A 3SKNB 1YZZA 1L7TL 4PRAA 3UZEA 3FQNA 5T1KA 3RFZC 4MHHG 1FDLL 5FGCB 5TQ0H 4JFPB 2DLFL 5TQ2L 1NBZB 3KHQA 3L95A 2AEQL 3KXFD 5DJXB 5I71B 3RWHA 1OL0A 1U8MB 4BH8B 2BHZA 4I18C 1QRNA 2VDKL 2ADIA 2X05A 1JWSA 3RBGA 5I15H 4R7NB 2MPAH 1IGCH 1DEEB 4U2ZA 5TDOB 4P2RE 2W1NA 2EKJA 4OCLC 4CVZA 2ZCLL 4YQXH 3TBTB 1KPVA 3QUXD 1CXEA 1T66C 1CFNA 4V1DE 3DOSA 1WIUA 4NN5C 3N1QC 4TUJA 2CKBA 3O4LA 4WUUB 1ORQA 5DD1H 2JJTC 4K8RC 4HJGA 4PJDF 2VN4A 4YDLC 3DBXB 4OQ1A 4YWGH 4U1KB 1HEZB 1CFQB 4Y5YC 2UYLA 4PJ8A 3SGDI 1HXYB 1IT9H 3ZE1E 4LHUD 3RY6A 5D2LE 4RGMB 3SCMD 5BZDA 1FFPA 5DD6A 5LGJA 1BJMA 5JHDE 2PTUA 2YSSB 1S5HB 1ZA3B 4KQ4L 4KMQA 5DR5L 5I76B 3IJYA 5GISL 3F12B 1T2JA 4I9WD 4N9GA 1NUNB 1EEYB 2FIRT 3FTGA 3BZEA 4PJBB 2UZXB 2R1YA 3Q6FA 4L8SB 4QCIB 4KRPD 1LO3L 1YNTB 4B7IA 4U6HB 5IVXB 2H1PH 1ZHBB 4G3YH 3U7WH 4FG6C 2OZ4L 2J4WL 4GJTB 2O5YL 2EIDA 3C60B 3CAFA 4APQA 2YWYA 5JPNA 1EV2E 3QDJB 2Q8BH 4PJCA 4LKCA 1SVZA 4JM2C 1JF1A 2L7UA 1Y0LB 4PRHE 2GHWB 1BIIB 4TVSa 1CIDA 1HKLL 3O3UN 4IRSB 1JGUH 3QIBD 4HUVA 4J1UB 3V6BR 3HC0B 5IMMA 4JREB 4XVTH 3Q6GL 1M4KA 4QNPF 3L3HB 5TQ2H 1R5IB 4WHYG 5D7IF 1YPZE 3ILPA 4MVBD 3QDMA 4Y4KC 2AEQH 4LLVB 1JV5B 5BJTB 5EU7C 2VDKH 1G7LB 4OIIL 3TV3L 3HNSL 3NTCL 1G7PA 5C0DA 1LE9A 1KB5A 2WAHA 4FQJH 5MERB 1NJ9A 4PG2A 2KPNA 1U42A 5GIRB 4OKDA 1HYRC 2NY1B 5F89B 2VZOA 2LVCA 1JUFB 2Y5TB 3QXUA 3TEUA 4FNLL 5J56B 5I74B 3TH2T 5K9OA 4MMXC 4R7DA 4PRPD 1WITA 3S88L 1KJMA 1MPAL 2FEEL 3PHSA 2PW2A 2YS4A 3IRZA 2ZZUT 3CSPA 5DD0L 3PGDA 4R90H 1P4BH 3HLAB 3BDYL 4S0TD 4PG9A 1CDBA 5E9DB 5KSVB 3QWQB 4N8CL 3P3YA 1I85C 3DYMA 1F90L 1Z9LA 3FRPG 1DN0B 5HGHA 5JW4N 3GI8L 5C2BL 5EO0A 5L2KD 2A6DA 1B2WH 5DUPL 2X4QB 4ZXBC 5J12B 1ONQB 3NN8B 1X5XA 1LO3H 2CUHA 1H3GA 4DZBA 5IHBA 3FQUA 5CILL 3AM8C 5BS0A 2OZ4H 5J1AB 5JR1L 3I02B 2J4WH 5D8JL 4JKPH 4W70A 4D9RE 3PHOB 5HHME 1IKNA 3GHEL 4XB7A 4XXCC 2B7DT 2IH3A 4XNYL 3JV4B 4WFEE 1S7RA 4C54A 2EXWC 3E6FB 3GMLA 4XCEA 5AYUH 3ULUL 4YPJA 4KK6C 1HSAA 4GMSH 2B0SL 4HV8B 1OAKL 4LMQI 1KT2A 1Y6MR 3F8UB 2XNAB 1EMTL 5D5MA 4DKAA 1T22A 1KJ2A 3K2UL 4XPAL 3V8CA 4CRPA 1UZ8B 3OXRB 3K4DA 3MRDA 4JFPA 5KVGH 2YA2A 4LCWB 5JW4R 4NOFA 2B2XH 4KC3B 1ZLSH 1OARH 5K9QG 4ZFOL 4OIIH 2ICEB 4K23L 3HNSH 5ICZB 5DJXA 3NTCH 1FFQA 4U1IA 4OGAC 4BH8A 5C0AA 3S4SG 4AJ0A 5ITBL 3GSNL 4NN6B 3QXAB 1TFHA 4ZNCD 2AEIT 3ZE2E 2Z91B 5E5UB 2N56A 1AC6A 1ORSB 4EI6A 2EDXA 2QQKL 4PLKD 5CGYD 4UDUB 5LCVH 5BV7B 1QFUL 4WUUA 3S88H 3X11B 2ZPKH 3UTPD 3KGRA 5L88L 4WV1A 1B4JL 4U1KA 4GXVH 1CFQA 3LS5H 1HHGA 3G6DH 2G2RA 4L4VA 2X89A 3HMXA 1NKOA 3MXWL 3BDYH 5FCSH 1A1OA 3KAAA 3CFKA 1ZK9A 1ZA3A 2NY5H 3TZVD 5C2BH 1J0KA 1VERA 5E6ID 4M4RA 4YX2L 5BW7C 4MB4A 4PY7B 1EEYA 4G8GE 4PJBA 1JF5A 5CILH 1F58L 4PJ9B 4YE4L 1LK2B 4J3XA 4L8SA 4OM0L 5D8JH 5ABDE 2APXA 1YNTA 2YN5A 1Q9LB 5IVXA 4LDOB 4R4BB 1CDHA 4G6ML 1YYML 4FTVE 3HFMH 1ZANH 4XNYH 3PQYE 4Z0BL 3H7BB 1FNSL 5DRZA 5JIPA 2NY3B 3BPOB 3RNKB 3THMH 3O6ML 4X9BA 2QEJA 4YHKH 3UJTL 3T0BA 1QSZA 1I3GL 2VLRB 5A1AA 1Y0LA 1EMTH 3GIZH 4IRSA 3QUXC 1NEUA 1BBDL 3K2UH 4J1UA 2YD3A 4QHUB 1XIWD 3DROB 3HC0A 2SEBB 2C3XA 1WICA 5I1EH 1R5IA 1MRFL 3NZHL 3QQ9D 1P84J 2DQTL 4K23H 3IAQA 1E6JL 1IQDB 1JV5A 4YHOH 1E6OL 3SCMC 4P2RD 2NMSA 1CICB 1G7LA 3U30C 3RJQB 3GSNH 3VA6A 2UVEA 3TIDB 5I74C 3U82B 4V1DD 4KK8D 1N5YL 5MERA 2J8HA 5GIRA 5ACMA 4F57L 3VXQA 3O2DL 3WS6A 4XB8A 2DTSA 5KOVC 5DVLA 1QFUH 1SJHA 1JUFA 1B4JH 2EXYD 4KRPC 4CVUA 3NBNA 2XOTA 1QR1B 4JRYE 5JHDD 3MXWH 1N4XH 3NGBB 2V7NB 4M1DL 1T1WA 4BZYA 1TTGA 5DJ0B 5EO1B 3QI9A 2PETA 3HLAA 4I0KA 5E9DA 5KSVA 1VFOA 3JZ7A 4YX2H 4PD4J 1DN0A 4A6YL 3VXSE 4P59H 1JGEB 3VGAC 1T7YA 5CCKH 5ALBH 3VFNB 3SJVD 4OM0H 3QIBC 3MRKA 1ONQA 3NN8A 2OCFD 3RVXD 5J1AA 1FNEB 3I02A 4HCRA 1YYMH 3EGSA 3T2NL 3PHOA 3HRZB 4MVBC 3WYRA 1Z2KA 4EOWL 1KB9K 2R1XA 2YA1A 4LIQL 4PRHD 3JV4A 1GPOL 2WINB 2VDRL 1A3QA 3DVNB 1I8LC 4X8JB 3U9PL 3KYAA 1QYGH 4HV8A 1UH3A 1OD7A 5F7LB 4XCYB 3T4YB 2ZP0T 3RTQB 4S1SH 5FGSA 2D7TH 1MRFH 2DQTH 4H88H 3OXRA 3KR3L 3ARGD 4XNQA 2PYEA 4LCWA 3ZZ1A 2AV7B 1E6OH 3LQAC 1A21A 3G6AB 5E03A 1QLEL 2ICEA 1NL0L 4BFBD 1DUYB 4P9HL 4PB9L 4K7FB 5D2LB 5EIIA 2Z91A 3WCYA 2R4SL 2Y23A 3FCTA 3LQZA 3QHTC 1F45A 5ECJE 5IBUB 2GSGB 2VZ1A 3GK8H 3NFNB 4M1DH 1P4IL 1XGQB 4U1GC 4IIQB 1X44A 5C0BE 2I07B 4DOHE 3I75B 2WM0A 5KS9B 3N9GH 2DL2A 4MCYB 4M7JL 1TJHL 5F9AC 1LO5B 1K4DA 4D9RD 5BO1L 4PRHB 3IYLW 1RZIB 4PJ9A 1FIEA 2EIEA 1I7UB 1JWMB 4MDJB 3T2NH 4QHKI 2VLJB 3F7RA 3D2UB 4R4BA 1R5VB 4EOWH 3VXRA 3FQWB 3S7GA 2IPUG 2D0GA 2EDNA 4WUKL 1DDHB 4YFLI 1OAUH 1V3MA 1GPOH 3DX6B 2VDRH 1WBZB 4G8EA 4J12A 4U33A 4EQ2A 4HK3J 3GMOA 5D71L 4C55A 4XNXH 4HIIB 3CIQA 5B22A 2QL1A 4Z0XB 3GBML 4QHUA 3DROA 1F00I 4PLKC 5CGYC 2SEBA 2V2WA 5J0BA 1P2CB 3FJTA 4KUCD 3UTSA 1D6VL 4XMLH 1P53A 3RKDD 4M5ZH 4EUPB 3FO0L 3NIGE 2GUOA 1EFXB 1QLEH 5E2TH 2RBLA 1I3RB 1NL0H 1MCKA 5FK9B 2J3SA 4P9HH 1QKZL 5C09B 1INQB 5DWUL 1T20B 4HXAL 1CICA 4Y16B 4IMLB 1F8TL 1BQHB 4HZAA 2VAJA 3D9AL 4Y0GA 3SQBA 3TZVC 5FIEA 5E6IC 2R4SH 4JRWA 3SOBL 1WT5C 3H8NA 4ODHH 1UJTA 1EHNA 2WZPD 1IC5H 5I6XC 2K7QA 3VGHA 1P4IH 1T6VN 3N85L 3EOTL 4MNQA 2DQCL 1HH6B 4HC1H 3MRQA 2V7NA 1AJ7L 1MFCL 1ZSDA 5DJ0A 5HHMB 5EO1A 3VFTB 3VFVB 1LQSR 4EEEA 2HA1A 3F6IA 4GAYB 4M7JH 4G8GD 1K5NA 5D1ZD 5C0RL 1A6VH 1JGEA 5BO1H 4M43L 2NY6D 4MA3A 4J3VA 1MFAH 1PG7L 2JELH 5IEKA 3V6OA 4FTVD 2NW3A 1L0YA 1XIWC 3PQYD 4E0RB 2IPTH 2AXGB 3CXHK 4PJGB 1JHLL 3CZJA 4MB5A 3QQ9C 4GUPB 3B9EA 3QNZB 2NY4B 4GRWH 5D71H 1A7OH 1NAKL 2B1AL 2D03L 5IBTL 1A9BB 2WINA 4XPTL 3RPIB 3DVNA 2XN9B 3MUY1 4X8JA 2YZ8A 4KK8C 3R1GH 5D93B 3VXME 1OW0C 2GTWA 2PUQT 5JUEL 1LILA 4OCXL 1LEKB 1NGPH 1TCMA 1UCBL 3T4YA 3RDTA 3RTQA 3SBWC 4AEIL 2QSVA 1CU4L 4RNRA 1WFTA 4D9QE 3HE7B 5F9JB 4PYGA 1D6VH 5JNYB 1S9WB 3FO0H 4IRJD 2EXYC 3NCJL 1MLBA 2A0LD 4PJ7A 3U9UA 3I3DA 1F2QA 2AV7A 5DWUH 4TRPL 2VDML 4HXAH 3G6AA 5CEZD 1VEMA 4FXKB 3PGFL 1F8TH 4K94C 5C70A 1DUYA 4OD2B 3D9AH 3O3AB 5E5RB 4K7FA 1RIUL 1YC8A 4WI5A 3MNZA 3W11D 1D9KD 5J11B 4ODSL 1FVDA 1U95B 3SOBH 3ZDYE 4PJEF 3MUHL 3JWOL 4LVOC 3QYCA 4RFOH 4NJ9L 1AD0B 5GJSL 2AJXL 3QPQD 4JRYD 4PFEA 3V6ZA 4JGMA 2DN7A 1P6AB 3BDXA 5C7XH 1DBAH 1IGMH 3JTTB 4OLVL 5KZCD 3MRIB 4P2QE 3EOTH 4PJDE 4NKMA 1A7BA 2AJVH 1FIGH 5EOTA 3RVXC 4HIEB 2OK0L 3NFNA 2BJMH 1ZV5A 5EU5B 5DHYB 3T3MF 3B9VA 3DARA 3HE6A 2RB8A 3VCLA 4DW2L 1EUTA 2ZUXA 3V8OA 3VXSD 3HNVL 4FTVB 2I07A 2GJZA 3CDFA 4L3EE 5KS9A 2QADD 5SX4H 3QXVA 4QHNB 2JCCA 2ZSVB 4MCYA 4PV9A 4YK4B 2ZUSA 1A02N 5D6DC 4M43H 5DQJA 1LO5A 4WI2A 1JN6A 1FC2D 3RKPA 3RVTD 1PX3A 3HCVB 2WUBL 2P8PB 1JHLH 4MDJA 5B21A 4M5YH 2XTJE 1K3IA 1YEFL 2VLJA 5EZOH 4OFYD 1U58A 3D2UA 1R5VA 3MZTA 4LSRL 4OZ4B 2MHAA 5EG6C 3T4AB 3ARGC 5JO5B 3FQWA 1NAML 1NAKH 3DX6A 5IBTH 1SYSB 2X1QA 2BMKB 5HHXL 3VI3F 3FO9B 1E4XL 2IPKA 4POZD 1S7WA 2F8OA 2DLIA 4M7LH 5JUEH 2AK4A 3F7VB 4OCXH 5HDBF 3SDXF 2E27L 1UCBH 3DI3B 3RJDA 1K6QL 1XZ0B 3OAUL 2NNAB 4HJJH 1P2CA 2C3WA 4BSVB 3DHMA 2VDMH 4HS6A 3M1BB 2YC1B 1YEGL 4H25B 3PGFH 4W81A 4HUXB 1CD0A 1I3RA 5FK9A 1UVQB 1MCWM 5C09A 1VGEL 1INQA 4JVUA 4Y4HB 1RIUH 5E5MA 1OM3H 3BQUD 4IMLA 4ODSH 5KZCB 1ITCA 4FQPA 3O6FB 5C6TL 4JFEB 1X5FA 4JO2L 1UACH 2BZDA 3K8LA 4YBHA 1CI5A 5D1QD 5KSUA 4AMKL 2P45B 4DN3H 1UM6H 4LLWB 4XBPB 3MJ9A 4ORZC 3QCTL 1T3FB 3P0YH 5CZKA 5CS7A 4F8QA 3A6BH 3LV3B 4RFNB 1HQ4B 4MD5B 5DFVD 4YGAB 5C0BD 3ESVF 2AXHA 1ZGLB 4MCZB 2EC8A 1HH6A 3GKWH 4DW2H 3O3EA 4L4TB 1NMAH 1ES0A 3VFTA 3VFVA 2AAVA 5E94B 4YZFF 3WN5C 1P7KB 2QLVB 1AQDA 1KN4L 1KIQB 1C5DB 3MGOB 1CR9H 5I66A 3AC0A 5IFHL 2WUBH 4PJHE 4LRNL 4QOKB 1YMME 3HR5A 1CTNA 1DBJL 4GRLB 5T3XL 4PRIE 3BGMA 4ODVH 4E0RA 4ZDHB 4LSRH 3C5SB 3GJFK 5L7XL 4PJGA 3TFKD 3RKDC 1NAMH 3B5TA 1T4KA 4X7SH 3WFDL 3BEWA 4P48A 3QNZA 4ZFGL 2FNBA 4UV4L 1TDQA 3HG1E 3BDBA 2BDNL 5FFLA 3WUWG 2XN9A 5F7FA 4L9LC 2E27H 2E8ZA 4QY8A 4K3HA 2YD1A 1FE8L 3IU4L 1CXIA 5ITFB 3O3DA 2XPGB 5JNYA 1J0IA 1S9WA 2F53E 3GB7B 4NHCL 1YEGH 1HNGA 4YGVB 2BVQB 5DEZA 2DDQL 1VGEH 2C1OA 4NCC1 1OAYH 4R4FH 1T89C 1JGVL 4FXKA 4OF7A 5HPOA 2D31B 3DV6B 4M48L 1A6ZB 1QACA 5C6TH 1I1CA 3WNMA 5GZND 4CAGA 1VA9A 4DOHB 1U95A 3U0TB 3H9SE 3IS1X 3W2DH 2G9HA 4AMKH 4RWYL 2QKIA 4DVRL 3QCTH 5D1ZC 1RJLB 1YEKL 3L1OL 3DX7B 4OI8A 3U48A 4U6VL 2NY6C 1HINL 1I1AD 2XY1A 4PRDB 3JTTA 1JNLL 2WBWB 3B9KD 4HUUB 1KCSL 2FHBA 1IM9B 2VR5A 4JJ5B 5F7MC 3A67L 2DIBA 5DHYA 5JDSB 3IDUA 3L3GA 1A3LH 5I8EB 3E8UH 4ZFZB 4ZS6D 3GSUB 2JF1A 1H3PL 4WW2F 1BAFL 2X41A 4RGNB 2ZNXA 1KN4H 4I3SL 3CXDL 4QHNA 5CMAB 3WO3B 1UFUA 5IFHH 4ONFH 4LRNH 4F58L 1VFBA 3AXLA 4WFFD 4LPXA 5GS3A 5LGKA 3R0MA 5T3XH 3HCVA 2P8PA 4RISH 3MOQA 4IRJC 5E6ZA 3PUCA 3WFDH 1ZWIB 4LK4A 4ELMF 2A0LC 2X70B 1MAJA 3T4AA 2BSTB 4ZFGH 5JO5A 4UV4H 4D9LL 3BWAB 3HZMB 4PJAF 3VXMD 2BDNH 1HHKB 1SYSA 5E8NB 4GQ9L 2BMKA 4FQ1L 3FO9A 2WANA 1CBVL 5EZLB 3W11C 1D9KC 3ECBB 4D9QD 1BBJB 3QCVL 3KNBB 5KTEH 4UILL 1UWGH 1H0DA 2ZOKB 3E0GA 4WEUD 1MQ8A 2V2TB 3QPQC 3RUGB 2ARJB 3KWWB 2NNAA 5JPMB 5E56A 2CLRA 4E42B 3MV8E 1W72B 2YC1A 3O2WL 1JGVH 5CBEB 2YPVL 4HUXA 2DWEB 1UVQA 2FEDD 4U6TA 2VWEE 3K0WA 4Y4HA 4AY0A 3REVB 1AXTL 4V2CB 3O6FA 4JZJC 4JFEA 4CKVX 1MQKL 4M61B 2AK1L 2QADC 4UT9L 3PF2A 2YUWA 4XP6L 3EBAA 3QG7L 4P2QD 4U6VH 4FQCH 3VG9B 4LLWA 1AI1L 4M8VA 3V7MA 3TLRA 1T3FA 1JNLH 5DQDL 2X09A 2OSLB 1KCSH 3RVTC 5KN5B 1LE5B 2CH8A 1ACZA 2E7LC 3O41B 5CWSB 2UZYB 3TWCL 4MD5A 3NAAH 3ULSB 1LK3H 3MLUH 1ZGLA 4MCZA 5F1OB 4L3ED 4HH8A 3LKNB 5F8QC 1Z5LB 5GS1B 4OCMC 4L4TA 2HFEB 2H2SD 4QRSA 4I3SH 5E94A 4POZC 3B43A 3AFLA 5SX5K 1P7KA 4WHDA 3EDEA 4ZSOB 3V0VA 1IGFL 1C5DA 3MGOA 2HKHL 4DCQB 1ZTXH 1CLOL 4H1LB 1FO0L 3VDAA 4QOKA 2EC9T 4JDTL 4GRLA 4NKOA 1X7QB 1AY1H 1RPQA 4NC2B 3NCYS 2DQJH 5FA3A 4B53A 5F7EL 2HMID 2P5WA 4PREB 1CBVH 5I9QB 5DJZA 3C5ZB 3BQUC 3V2AR 3QCVH 1ERNA 2PYFB 2GSIB 1EHXA 2DQIL 2VLKA 5D1QC 2GI7A 3G5YB 1BZ9A 4YHPA 2ED8A 1HXMB 3RPKA 4FHBD 1BX2B 3BPNB 3OKYA 1L7IL 4OCRH 3TYFB 3UYRL 2XPGA 4OQTA 2RHEA 3P0VH 3KJ4B 2EEAA 3GB7A 2AJSL 5DFVC 3STZB 3WIHH 1S7TB 4Z78B 4WFGE 1XF3B 1X5AA 2BERA 2IANB 1AXTH 4U1HB 1CGWA 3DV6A 3WIFB 1A6ZA 1MQKH 2OTWB 2AK1H 1F6AB 4QRQB 4CU8A 5IFAL 3Q5TA 4RA0C 1UJ3A 5ENWA 3IAPA 2EZ0D 4DAGH 4PIRF 2R0ZH 3CGTA 3D48R 1BVKB 5C0ND 35C8H 4GH7B 2W9DL 5DQDH 3WEXB 1Y18B 3DX7A 1OPGL 12E8L 1NCUA 1QEWA 4ZUUB 3TWCH 4PRDA 4QTHB 1Q38A 4QLRA 4X6CF 1M7XA 3OB0H 1IM9A 5EC2B 3TFKC 3VWKB 5IB5A 2IQ9L 2VRAA 4CN1A 4FABH 2XTJB 4OZFA 1J0JA 3W5MA 2JJSA 3VJ6B 1I9IL 4GRWE 3K74B 3Q3GA 3LS4L 1EPFA 5GS0L 1BOGB 2BNRE 2V7HA 2KBGA 3V4PL 1CXLA 4B7LA 5CMAA 4KROB 2HKHH 5E8DH 4XPFH 2A6JB 1WZMA 2YD8A 1MFEL 5HY9B 2NY2D 1N0XL 1L4IA 5E99L 1RIHL 1X5ZA 1EFQA 1S7XB 3HG1D 4AZ8A 5MEQB 5B39A 5F7EH 3MBED 1ZWIA 4XCNB 2R8SL 2JJTA 2BSTA 4P2YA 5D7IB 2D7PA 5HYFA 4N0RA 2F5AH 5DQ9A 1HHKA 4QHLB 1LWRA 5E8NA 2XWJB 5FV2A 2FH6A 5GZNC 5IBLD 2R2HB 5KSBF 3ECBA 1BBJA 5MENE 3KNBA 5C08E 2F53D 4WDIA 2VB5A 3PGCA 4X7TB 3QWRA 2ZOKA 4BA8A 3UYRH 2V2TA 3X12B 1MVUB 3RUGA 3QNYB 1KC5L 1I1AC 1U8PB 2AJSH 3IKKA 4P57B 5JPMA 3B9KC 1KB9J 3VA2C 4JFFA 1R0AH 1JCKA 5IB2B 2BVPB 1IEAA 1W72A 2R0LH 4HBCL 5CBEA 1YYLL 1AR2A 3H9SD 3IDNB 3OXSB 3TO2B 4ZS6C 5IFAH 43C9B 5ISZB 2A6KB 1AGBA 3VXUB 2W9DH 12E8H 4N0UA 1OF2B 3S34L 2DQHL 4HT1H 1K3ZA 2HFTA 3QULB 1OTSD 2OSLA 1CLZH 1NC4D 4HD9A 4WI8A 3O41A 5CWSA 4P9ML 1YMMB 5K9KB 2IQ9H 5GQBA 3HRPA 5SWSA 4PRIB 3IAGC 4PGEB 4MQ7A 4JQVA 4PGCB 3UPAA 1I9IH 3LKNA 4CJ1A 5GS1A 4Z7VF 5GS0H 5L0QC 2HFEA 4TVPH 1MIMH 4HQQL 1ZLVK 1EDQA 4GBXB 4IDJH 1G7HA 4WNQB 4NDMB 4ZSOA 4PTTB 3OGCB 4C57C 4DCQA 3L5XL 1LD9B 3DO7A 1LP9E 4H1LA 1N0XH 4XBEH 1KCKA 5ILTL 3WNLA 5E99H 2VDOL 3LDBB 3DVIA 5DJ8B 3KJ6L 1GIGL 1X7QA 5DUBB 2AEPH 3VGGA 4C4KO 1EERB 2OR9L 3PV7A 2B5IB 3VFOB 3QQ4B 5DJAB 5FUZL 2FEDC 4PBWD 3D85D 3QJHB 3VXNB 5C6WH 2ERJC 3MLRH 4GAGL 4KY1L 3VFWB 4U1JB 3C5ZA 4OZIF 1SM3H 4MYWB 5E6YA 4F3FB 2D7QA 4P2OD 2PYFA 2GSIA 1UH2A 3WFBL 2ESVD 1A14L 1V3LA 3G5YA 4G42B 4UINH 4XNUL 1KC5H 3MV8D 3KVQA 3V5DB 1EK3A 2D9QB 3CFDA 3MRMB 2XXCB 3O45B 2BXZA 1BX2A 4GRMB 2YZ1A 3TYFA 2LU7A 3STZA 5GZOD 2IFGA 4Z78A 4JFZL 1RZGA 2B4CL 3GI9L 2IANA 4M02A 3WIFA 5HHOA 2H2SC 1JRHH 2OTWA 1F6AA 4QRQA 3NA4A 1O0VA 5KVFL 1VADB 3BI9X 4PJEE 4W68A 3MLPA 4MHHI 4HWBL 4ISVB 1AHWB 3O6LL 3TPKA 3KPOB 3WEXA 1TLKA 3D39E 4ZTPL 4ZUUA 4GAJL 1XT5A 2FSEA 3FQXB 4Z7WE 1XGRB 4QTHA 3JWDL 1LDPL 2UZIL 4YR6A 3UPRB 3HI5H 1HKFA 3T3ME 4KGJA 2E7CA 2DD8H 4K7PL 1R3LA 3K2MC 3VJ6A 2DBJA 1URLA 4HQQH 5DHVB 3TN0B 2HMIC 5ANMB 2OX5A 3TPUB 1P4LB 3L5XH 1DLHB 1TETL 4NQUA 4CVWA 2NW2A 4RBPH 2A6JA 2VDOH 1RUQL 1H3WM 3QUMA 4ZPTB 3IETB 2MMXA 1XAUA 2HFFB 4AQOA 4O00A 3O8XA 1XF5B 1RUPH 1S7XA 4RAUB 2OR9H 1DQJB 4UDTB 3UZVB 3AY4C 5L2JB 4XCNA 4GFTB 2PXYD 1H3TA 3O9WD 2GCYB 5D7IA 5AG9A 2NY5C 1AFVL 2CK2A 5BXFB 3QEQA 4JHAH 3VI3E 5FAAA 3V95A 5J6HA 3P9WB 2XWJA 1QBAA 5GXBB 2AJYL 4X5XB 4X6DF 2R2HA 1A14H 2PCPA 2Z92B 1PVHA 2EZ0C 4X6EB 5HDBE 3SDXE 4D8PA 3O6KL 2ICWI 4M1GH 1YEHL 5C0NC 1NBQA 3CXHJ 4X7TA 3FMGL 4X9IA 1CFSA 1MVUA 3F62A 1VCAA 3HHRB 3QNYA 2WV3A 5D70L 3T04D 2O5XH 4WFGD 1KPUB 2OR8A 2HT2D 1FFNB 3EYUH 2BVPA 4WI9A 4NQEA 4UV7H 1BFOB 3U46B 3S3SA 5DK3A 2ADJB 3IDNA 3OXSA 3MCKB 4Y88A 1QPPA 3R4DA 43C9A 2I9TB 5ISZA 5JIIA 2F8VA 2A6KA 3PNWA 5D7KD 3VXUA 3O6LH 1QG3A 2YEZA 2XTLA 5SX4I 4OF0A 4ZTPH 4C4KT 5T3XE 1IKFH 1MCHA 4LARH 1F3DH 2NY2C 1KN2H 2OL3A 1KELL 3ZO0A 1I8KB 1UC6A 2BNRD 3LN5B 1PKQB 5AYQA 4OTXL 3DUUA 3MBEC 2V5TA 4MJ6B 4OZHA 1N64H 2WUCL 5J1SC 5C6PB 4YZFE 4JPWH 1H5BB 3LDBC 3U7AA 4GBXA 4G80B 3SCMA 2P5ED 1TETH 4NNPL 5IBLC 1A6AB 4NDMA 3OMZA 3O9WB 1LD9A 1JZ6A 4LKXB 4CVXA 3SE4A 2KZ1B 1A4KB 2JB5L 5ETUB 3HC3L 5DUBA 4XWGL 1J1PL 4NKDB 4KI1A 2J8UF 1I3UA 3VFOA 5CSZA 5E8PA 3QQ4A 1UEYA 5MEND 3F7YA 1I75A 4L8CA 5C08D 3VXNA 3CLEL 5EULV 2Y06H 3FT2B 1DANU 3BGFB 1WCBB 4MJ2A 4MWFB 3CFCL 3O6KH 4TULH 1YEHH 4GG8B 5D2NE 3RA7L 1JZ4A 3RVWD 3IB4A 3V5DA 3MRMA 5DRNB 1OTSC 1XH3A 2P49B 4CW1A 1DCLA 4GRMA 3QQNA 5HVWA 4PJFA 4HMCA 5KVEH 3KPSE 4TUKL 4F7EB 5HYSA 1FZJA 4X9FA 3C8HA 3V4VL 3IFNH 2QSTA 2W9EL 1NC2D 4XX1E 2LE9A 4ZNEA 1A6PA 3FFDB 1VADA 3J8F7 4JQXC 1AKJD 4KHXH 1G7QB 4ISVA 3DXAE 1AHWA 3KPOA 3WD5L 3GSVB 3CVHB 4LCCB 5K9QI 1KELH 2F5BH 5TE4L 1I8MB 3FQXA 5D7JB 1MI5E 3MRRB 3UPRA 2X40A 2K3TA 4PRPA 1ZT7B 2WUCH 1ADQL 5KVDH 3MQIA 5DHVA 3OGOE 3U4BL 3TN0A 4XCCL 5ANMA 4XMKL 1TJIL 3OR6B 4XXDB 3TPUA 1DQML 5JA9A 4RDQG 1C5CL 4P2OC 3QIUD 1KIPA 2R4RL 5I18L 5FDWB 1P4LA 2ICWB 1RUML 4LCUB 2H41A 1N26A 2GIYA 4M93B 5CZVH 5MENB 1A7QL 3SKJL 4WWID 4Q9RL 3L3KA 3IETA 4O9HL 3W0WE 2JB5H 2HFFA 1MELA 2BFVL 4M1CD 2R2BB 5L2KA 2VWEC 4XWGH 1J1PH 4OB5L 4RAUA 1DQJA 1WIOA 5ELIA 4ELME 1JL8A 4LP4A 5L2JA 2AVGA 5GZOC 1UZ6F 3TM6A 2GCYA 1MCRA 5I1AA 4PJAE 4W6WB 2VZVA 5JOEA 2ADFL 5BXFA 1A64A 3PL6D 4JZNB 4XRCA 1BZQK 1S7QB 4FFZH 2XA3A 3BMWA 3SDCD 3U4EB 4X5XA 4LSPH 1OT2A 2BNQE 3MV11 5I1JL 3CMOL 2HTKD 1EEQA 5IW3A 4X6EA 1JMXA 4NBZB 1FYHB 4KU1A 2VDLL 4I2XA 1QSEE 1BVZA 1I1FA 3HUJF 3FQRB 4XVJL 3RNQA 4OLXL 1AQKL 5HHVH 5K59F 2RCSH 4HJ0D 5FM4A 1KPUA 2VXVH 1FFNA 4L3CA 5I1IL 1IAKB 3V0WL 3V4VH 1BFOA 4NNXA 1DZBA 3PV6B 4NZDA 1TZHB 3QQ3B 3QRGL 4PY8I 2ADJA 3SDYH 5IWLA 5F9OL 1G6RB 2V5YA 5J3HD 1Q0XL 5CUSL 4DUVA 1DQLL 1FN4B 4AG4L 3D39D 4MD0B 1MCPL 5DFTA 4UNUA 4I48B 4HUNB 4U3HA 5TE4H 3FZUD 4CBPA 2YD7A 4QRUB 2DQDL 1S7VB 4P9HC 4QF1B 2DQEL 1QR4A 1HWGB 1BFSA 1KTDA 1Z0MA 4XPBH 1GGIL 1S9XB 1L9NA 1NDMB 3LN5A 3PABB 1E4JA 1PKQA 4ZUTA 3ROOB 3GMPB 2M8XA 2PXYC 5GGVH 3T3PF 5AZ2H 3GFUA 3U4BH 4Y5VB 4XCCH 2UWEF 3U7YH 4MSWB 3UDWC 1TJIH 5E1AB 4XPHH 4G80A 5FHBL 4DGYH 3MUJA 2XQBH 1A6AA 2R23A 1R5WB 3Q1SH 2A83A 1A7QH 5DF0A 4Q9RH 2DYPD 1MRDL 1S9VB 4LKXA 5E6IA 2X1PA 4HWNA 4JPVL 2K7PA 4O2CB 3TCXA 3BKMH 1A4KA 1KCVH 3FT4B 3ARSA 3MCG1 4DFIA 3M8OL 4OCWL 2HT2C 5DJ2A 4J7RA 4QXUL 3GSRB 2ADFH 3FOLA 3O2VL 3FFCE 1F4HA 3S37X 4X9GA 2DJSA 1WCBA 4MWFA 2VOTA 4HF5H 2VDLH 4XVJH 5F7KC 4GG8A 4PJEB 1AQKH 2RIKA 4C56E 3VFPA 3PWNB 2Q7YB 4HGKC 5DRNA 2CKBH 4H20L 2IBZY 5B8CC 4KJPD 5GSRA 5EA0L 3V0WH 5DA0B 3S4SB 4F7EA 4NUJB 4X4ZA 3GJFB 5CD3B 4NWUL 1Q0XH 3TA3B 4LGRB 5CUSH 1LO0H 1DQLH 3GMMB 3FKUS 4TVPE 7CGTA 4S10A 5LGHH 3T1WA 1WZ1L 1MCPH 5T3XD 4JFDB 3FFDA 4UU9A 5EOCH 3CSYB 2YN3A 1BREA 1G7QA 2AJ3B 4J3WA 3BWUC 3GSVA 4FQQB 3CVHA 4XP1L 5D5MF 2QQQA 4KRLB 2NPLX 1WC7B 2WIIB 4X6CE 1I8MA 2O26U 5D7JA 3MRRA 4BM7A 3SBWA 4HEPG 3TP4A 4OI9A 5KSAD 3P73B 3T0XA 1D5MA 3CDGB 3HC4L 1HZHL 1WWCA 3BSZH 5JW3L 3TNNA 2MQCA 1U2CA 3BEVB 3TVMD 3OR6A 4K3EL 1KCUH 4NT6B 1IQWL 5FDWA 1S7SB 1MRDH 1JBJA 1RZ8B 25C8L 3HNTL 1FGVL 4G8FB 4JPVH 3UYOD 4UI2A 3SDXB 4QRRB 3RVWC 3MCLL 5KAQG 2OLDA 3M8OH 2R2BA 4WO4B 1CE1H 1T5XB 3ZDXE 3WIIL 4LDEB 4GW5B 4P0DA 5FGRA 3SJVA 1UWXH 2FIKA 4P3CL 4XBGB 2C1PB 4EQ3A 1JVKA 1IFHL 2AJZA 1FSKC 1YMHB 4MDIB 2BHYA 3VW3L 2DKMA 1OWWA 6CGTA 3ROLB 3U4EA 2Q87A 5KSBE 4WVRA 1KB5H 5HVHB 5FB8A 3GKZA 1RAMA 5JLZB 4FP8L 3U36A 3V5KB 1KIUA 3LMJH 4K9EH 4H20H 5F9WB 1XGPB 3ZKXC 3SDAD 4JFYB 4XI5D 5IVXF 2A9ML 4BQ8A 4U3XA 4NWUH 1IAKA 4OFDA 2HTLD 1KG0A 1TZHA 3QQ3A 2W59A 4U49A 4BZ2L 5IW1B 4YDVB 4AM0B