4OZIA

S2 protein complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
181
structure length
181
Chain Sequence
IVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title T-cell receptor recognition of HLA-DQ2-gliadin complexes associated with celiac disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4oziA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4oziA01
3MFFB 4ZFFA 1CK0H 4ONHA 5HPOA 1U8LB 1GZPA 3HR6A 2VYRE 2CQVA 4QOKD 2E8YA 3EKCA 5KAQG 1I7UA 3RBSA 5CCKH 2AV1B 3D0VB 2VRAA 5F1OB 4KI1A 4P3WA 3MUY1 1DP0A 4HH9B 1DDHB 4G8FB 2RFXA 4OQTL 3CIQA 1U8OA 2J3SA 5I1EH 2E7BA 1S7XB 4GUPB 5L2KD 2FEEI 1AO7D 4C55A 1BPVA 4V1DE 4JRXE 5HHMB 3BKCH 1EAPB 1I8KA 4GKZB 1A2YB 3ALXA 3JSSA 3QRGL 4OZ4B 3C5ZC 4PJDB 3C60B 4YZFF 2Q8BL 1EVTC 3L3GB 1KJVA 1OQOA 1XMWA 1UACH 3M1BA 4F37K 2VDRL 1M71A 2C7UA 2WUCH 3MOQA 4OFDA 3GSXB 5D7KE 5JOPD 5ESQB 3LH2L 1VENA 1I8MA 3QXVA 4J3UA 3BJLA 4NQXA 4XPFH 32C2B 1CN4A 2IPKB 1HHKB 1R3LB 1C7SA 1ZA6B 4FQJH 3TZVA 5HGAB 2G5RA 2ZCHL 3L5XH 3QEHB 5IB3B 1JTOA 4NKIH 5FM8A 4JQIH 1EEZB 4A6YA 2V5YA 2O26U 2ED7A 1T03L 1IGML 3VGEA 4O51B 5KG9A 4M61A 4I4WB 2QQNL 2BVOA 3LKPA 1D9KA 3AFLA 3MRKB 3O41A 4FA8A 4B53A 4ZS6C 5I1IL 3ARSA 3LHPL 1LO0H 1A7NH 1AJ7H 2H6PA 2R56L 3KPPB 1FYTE 2EICA 2LTQC 4YE4L 3VGBA 5KVGL 4OD2A 1A14H 3IDMB 1JZ2A 4LBEA 5J13B 4L5FL 3BKML 1GZQA 4EQ3A 2VDLH 5FO8A 2OR7A 4K8RH 5IB5B 4GG6B 4LP5A 4JREC 1Y18A 3OPZL 3QDJB 5DRNA 2Y4SA 1I8LC 3BE1L 1DSFL 3MRJA 3DRTA 4LEXL 5D2NA 3NTCL 1CXIA 3BWAB 3MTRA 1BBDH 4PTTA 3FFCB 5TE4L 1Z0MA 2IH1A 4IRSB 3B8SA 4O2CB 4PJHB 3S6CA 1U8IB 3ULVL 4M7KH 5ISZB 1CGYA 2XA8L 3P0VH 4TUKH 5IBUG 3GMLA 3V5HB 1CFNB 5DEGA 5GRWA 4PRPD 3VJ6A 5E1HB 1J8KA 4WV1A 4PUBL 1VFBB 4UOJA 1NCAH 3D85B 4FZ8L 1CGSH 2HH0L 2R0ZL 3V0WH 5KW9L 3PIQB 5KSAA 1CL7L 3G5VB 4LSVL 5ITBH 1B0GB 4LNVA 3MLRH 2BVTA 4PJAE 5EU6E 1B4JL 2OK0H 3RNQB 2F5BL 4KVNL 5IJKA 3T0WA 4DOHB 4XC3H 4JZJA 4LCIL 4PJ7F 5ADOH 3RBGA 1DBAL 2XPGB 4X6DA 2BY2A 3BGFB 4APQA 3WS3B 2HVJA 3JV5A 3RPIB 4XBEL 3VRJB 1FCCA 2PYED 1P7QA 4JAMB 5ESVA 2J88H 4O5LL 4X4MA 4QRQB 1W72L 1RULH 4IOIA 4L4VD 1T80A 3MNZB 5MENE 4XMKL 3EHBC 2IG2H 3QPXH 1HINH 3R1GH 4Z7WE 4PLKD 5IHZB 5JW3L 3K8KA 2A9NH 1IRAY 3H9HA 1FNSH 3J7HA 4WFHE 5KG9B 1IJ9A 1J1XH 2Q8AL 3NA9H 4P2RD 3SE3C 5F9OL 2LE9A 3QXAA 5D7SH 2MHAB 1FL3B 2CH8A 2ZSVB 4M93C 4PRNA 3C6LA 4O00A 1EH9A 1ITBB 3PHQA 5IG7B 2MKWA 1NGZB 5EU5B 5F7WC 4HXAH 4H26A 3BZDA 4DGVL 1NDGB 1FDLH 5EWIH 2QSCH 1MAKA 3OMZA 3RWHB 2EYRB 4RWYH 3ULUE 1S7SA 5DYOA 2APWA 2DQCL 1DN0A 4KQ3L 3I2CL 3STZB 1YEEL 3V7AE 3OAUL 3PABB 2ZCKH 1G9NC 4UV4L 1M6OB 2O93L 4GLRI 4NYLB 4S0TD 3T65B 2B4CH 4Z0XA 3FB5A 1H8OA 3O9WA 1JNLL 4Y19B 2HG5B 2DQTL 5L9DL 4XP6H 1I3UA 4YC2B 3GHBL 1S3KH 2OTUA 1S7UB 3MRPB 4CVZB 4Z78A 5I18L 2HKHL 4K3DH 1N26A 1X7QB 4RMQA 1YPZB 1L9NA 1A6WH 2GCYA 4YHPB 4RX4A 4LPTA 2YPKB 5DXWA 4CU7A 4GRWE 1U0QA 2W9DL 3G6JE 4GLRH 4ODTL 5GGQL 4QTHB 4RFNC 5SWZB 1DANU 4WWKC 1ZLSL 3L3OB 1HHJA 5A3IC 2RHEA 1NCWH 5E7BA 1UB6A 3MR9B 3L3DA 5C0BB 5HYSA 1DFBH 2JCCF 2UZIL 3MQIA 4HIXH 1YUHA 3O8XC 2ATKB 4MJ5A 4ESKA 2UV3A 2HVKA 2P47B 4PYHA 3B9KA 5GGTL 4IOFD 2G2RB 1TCRA 4J3OC 4XMPL 3WEXB 3RAJH 3MNVA 2F15A 2QQQA 1WITA 4LHUD 2QSQA 3O2VL 2ADGB 3UTZA 3HRPA 4HKJB 3O6FA 5F3BB 2MPAH 2WAHA 4LARL 4PRHB 4DN4H 2MJWA 1ZSDA 3BO8A 4KUZL 3F65A 3VXME 1D5MB 1NL0L 3PHOB 3NFSH 1C7TA 1QSFE 1XZ0A 4PP1D 1UEYA 4LSPH 3GSUA 1YECH 1GGTA 4LCCA 4MXWH 4RFEB 4YQXL 1SEQH 4I77H 4FTVB 5KS9A 1UXSB 1DQDH 3FT4A 4LDOB 4PB0H 4Y4FC 2FD6H 3THML 1KB5B 4MZ3A 4KRLB 4JDZB 1Z9OA 1W0WA 4P4KB 2KZWA 3U9UA 1UM5H 3VXUD 4ODSH 5C08D 2P1YA 1H3TA 4JFEA 3CSBA 2AXFA 1FVDA 3GFUA 3P0YH 3ARXA 3VXNB 4DAGH 4Z76B 5LGHL 4U0RC 1U8JA 4U49A 5IVXF 5TDNB 3DTXB 2L7JA 1MNUH 4GXUN 3KPRD 2DAVA 3A67L 5KSBF 3P4MA 4Y7MA 1Q72L 3BVNB 2B0SH 3O11A 1QBLH 1EO7A 1JPFA 1RVFL 2A83A 1R6VA 4I2XB 1D5IL 4WDIB 1OP5H 1FLRH 5IGXH 8FABA 3SDAB 2BNUA 4BQ8A 5DJYA 4TULH 1LD9A 1YYML 1IAMA 3LKNB 2VL5B 4PBVC 3C5SA 1UG9A 2FBJH 3QQNA 4Z7NE 1CFBA 1NEZB 3OQ3B 3W82A 4ZPVB 1ZKAA 4P59L 4AIOA 3GJFH 2OX5A 2Q6WB 2WANA 1S7QB 4XWOD 3UZVB 4PJ5D 5EOQL 5I6XC 4KROC 1KELL 1OAQL 5TH2B 2I27N 5FB8A 2XZCH 4Z0BL 4ODHL 2DDQL 2Z35A 4ZFGL 3HC3H 4Y4KC 4WFED 1HOCB 3O6KL 4PGCA 4OGAC 2V9QA 3T09A 4EIZC 3LKRA 5DVKA 3BZ4A 5C0JA 4HW6A 2HN7A 3P30H 3BKYL 4LASH 4AIXA 4JQVA 4BSJA 2H1PH 3T2QA 3BD3A 1UB6B 3QP3A 2D31B 4PJEF 1ZHKB 1BD2B 2DI7A 3HG1B 2EKSB 2VXTL 5JDJA 2PW2A 4C56E 3LRHA 3CXDH 3UJJH 2AEIT 4Y2DB 4HPYL 2R69H 4YNYB 5C0RL 3GGWB 4Q9QH 4PRBA 1PKQE 3BGMA 1EFXA 1VEOA 3K7UA 5IM7A 1NLBL 1AXTL 1X5ZA 1XF2B 3TP4A 1QNZL 1MCOH 3BW9A 5EO9B 4ELME 1CI5A 2W91A 2ZPKL 2XN9A 3AU1B 4RQQA 3TBTB 1XCTA 4Z7OF 1FZJA 4GQ9H 1CWVA 2R4SH 3FT2A 3MV11 1AC0A 5IF0B 1WAAA 5A2KH 5JMOC 1A7QL 1KN4L 4X6EA 4EI5D 4NCDA 2VC2H 2VH5H 4M9OA 3KPLB 1UCBH 1QQDB 2R8SH 3KLHC 5IBTH 4PJ8B 1HKFA 1NEUA 2CRYA 3U82B 1MAJA 3VFNB 1NAKH 5HYJA 2GSIB 1BZ9B 4JY5L 3ULVD 1M7IB 1QBAA 3LIZL 5IFAL 4NNXA 3IFLH 3RIAF 4JO4L 5ID0A 3TBYB 5HHOA 5IBUB 5BRZD 5FAAA 5A3ID 3P4MB 3PNWA 3MGAA 2Z93B 3UJIH 1OM3L 4FXGB 4QHNA 5E8PA 5IFJB 2GEEA 3D18A 2VQ1B 3KPMA 1A4KA 3O8XD 4HCRA 3X11A 5BV7H 4S2SB 1C5BH 4FFWD 2ID5A 4LAQL 3MJ8A 2ILLA 5INCA 3EOAA 3B2VL 3ULSB 3SDXE 2VDNL 1ITCA 1FVCB 3QUZB 5EO1A 4M3KB 4NN5C 5C0CB 4LLUA 1OGAE 3ARBB 5EU7E 2DM4A 3T0BA 1MFAL 2RJMA 4GSDH 5IVZA 5FO9B 4UB0H 3DX8B 3L5WB 3P3YA 4B41A 4NKMA 4DWHA 1S9YB 3MRMA 1K6QL 2X1OA 4OGXL 4PGEB 1KACB 3GRWL 4UQ2A 5D72H 2YKLH 2LAGB 3H42H 2BOBB 3CDFA 3S4SG 5JIHA 1KTLA 1OAUL 2HT2C 4MSWA 4GH7B 4X9FA 4YIQA 1D6VH 4O9HL 4JN2B 1IM9A 5C6WH 3HZKB 4XNMB 5C09E 3GJFB 5DMKB 2BRQA 5KSVB 4FQ2L 4Y4FD 1FAKT 2DLEA 3MOBH 5INDA 1MI5E 5E94B 1MHEA 4FXLA 3Q6GL 4PYGA 2GY5A 3OX8A 2DYPB 4OZFH 2O5ZL 4K7PL 4JO1L 4DZBA 2XXCB 4YHZL 3C60C 1MCKA 3FN9A 1PZUB 2C1OA 2YA2A 3D9AL 4PJ7B 2IBBA 5IFHH 1OVZA 5GRVK 3GHEL 4K9EC 2Z8RA 4CKVX 4F58H 1MLBA 1FIGL 1I85A 3AY4A 5F6IB 4OV5A 4K71B 3JUZA 4I18B 4EDWL 4A6YL 1ETZB 4LFHG 3REVB 4L3CB 3MACH 2GJ6D 2ED8A 1MCSA 1E0OB 2D0HA 2P44B 4LSSL 2EIEA 5DGRA 3E6HA 4N0FA 2FEEL 1QLEL 5HI3D 4G7VL 4JFYA 4KGJA 4KKNA 5I0DA 1DZBA 1AQKH 4HDIA 2F8XC 2AQ1A 2NNAB 4KROD 1F4YH 5EZIL 3RNKB 2FX8H 4PRIE 1OHQA 1T0MB 5SWQA 1OAYH 4G42B 3QI9B 4OFVA 3ZTNL 5CILL 2GITB 4NRYA 4NNXB 3P4LA 1OTUC 5ID0B 5J13C 1DBML 5C0DB 2BMKA 2VLKB 4HJJL 2OL3H 1FFNA 1JPST 4DJMA 3PNWB 1OAXH 2OP4H 3ALWA 3MYJB 4X7CC 3H0TB 2J1KA 3KPMB 1TVBA 5I1KL 4PJIE 5CBEA 1WCBA 5I1IH 3LHPH 1F3RB 3EYFB 5CEYA 5C0AB 3CFEA 3WL9A 4OZIA 3OAYK 4LRNH 4HIHB 1T20A 4Q0XH 4XP4H 1WBYA 4Z7QE 4IRSC 3C08H 3AREA 3QIUB 2FZ3B 1C16B 3DXAE 3FTGA 5ENWB 4AENB 2ADJA 5E2VH 1SJVA 4NKOA 4GAGL 3RKDC 5E5MB 5JOPE 1MRFL 1CCZA 4QHKJ 3ZKNC 1KTLB 5JW4M 1JNNH 1SBSL 2NY3B 4KJYB 5FK9A 2HWZL 3BE1H 1FZKA 3QFDB 1DVFA 3QUMB 4CBPA 2W07A 1R3JA 4LEXH 2X4NB 3TO4A 3NTCH 3ETBF 2BK8A 3DBXA 2EDQA 3V79C 2EEBA 4K7PY 4R7DA 3WD5H 4MYWB 1F2QA 4PY7A 4H1LG 4YZFE 3VXQA 5F21B 4L3ED 1OF2A 4HWBH 4WU5A 1MCJA 4JG1L 3NCJL 4M62H 2GT9A 3GDBA 4KK5C 1WSST 5T1DL 1NH6A 2DQJL 3OTTA 3VDBA 2FX7H 3ZE2F 4UV7H 3K1DA 2Q7YB 2YEZA 4QNPF 3BGFC 5DJCB 1K3ZA 3M17B 4QHUA 3KXFD 4U6HA 2Y6SC 3MLZH 4OZFB 4J1UB 1A1NB 4Y1AB 1YMMB 4MNQB 1BZ7A 2P24B 1NCUA 3UTTA 1KB5L 3A0OA 2DQHL 3P77B 4UT7L 2VZ1A 1SQ2N 2YBRB 5DHVH 3U4BL 4XB7A 5IW6A 1R3HA 2X44D 5H35A 1EJOL 5LGJA 4ZD3L 3TIEB 2C3VA 2Q86B 3D39D 2VISA 1WEJL 2VZVA 5K9QG 2DQDL 3MRFB 5FOJA 5LBSL 5A1AA 3WIFA 3T8XB 1HSBB 3BAEH 3UO1L 2APVA 1K4CA 2PTTB 4K3HA 2X89A 4GMTH 4NJAL 3O45A 1BJ8A 1NC4A 1QYGL 2VAJA 3C5JA 4BQ6A 2DIAA 3FB8B 3P4OA 3IXTB 5DA0B 3FL7A 5D7IA 2ZCLL 5C9JA 3N1GC 4PV9A 5EH1A 3VFUB 3E3QE 1KN2L 2CGRH 2VXUH 2G5BB 3KYNA 4CVUA 3A6BH 5F7UA 5H37G 3UTPE 5HHMD 5F8RC 4P2OD 3T0XA 4UMGA 2EH8H 1IGCH 2BVQB 5KSUB 2VL4A 5K59E 2CDEA 1KLUB 1HKLH 3C60D 5CHNB 1JV5A 1IFHL 4TQEL 3Q5YA 2NLJA 3MMEA 3QIBB 3OXSB 4M8VA 1TPXB 4WEUD 4I0KA 2OL3B 1U9KA 4K8RC 5IQ7L 5TE7L 3MOAL 2EC9T 3X3FL 1HHIB 1PLGL 4GAJL 5B21A 4ETYA 1I1YA 4RWHA 4WI3A 3MUGA 4JFFE 1A7BA 2PN5A 1XEDA 3ARFA 3EDEA 4YC2C 4MNGA 5D6DA 1CGTA 5CAYB 3RWJA 5FKPA 5DDHB 2OSLA 4QWWC 3WXWH 2XYCA 3QO1A 1A7PH 4NBYB 4BZYA 4MAYA 3KPOA 3SKOB 4ZQKB 1LK2B 4U1NB 2YUZA 3QJFA 2BNRD 4GW1A 4KQ3H 4L4VE 4WEMB 1DLFL 2ZUWA 3OAUH 1D5BA 4FQLL 4U1LA 4J3SA 3S36X 4ZDHA 5EU3B 2BDNL 3FQUA 1OOAA 3F6LA 4Y5XB 2P5WA 3BT2H 2F54E 4XT1C 3BPNB 5HYQB 1NMAH 5E8OB 4JDTH 4NZTL 4XNYL 2W60A 5FYJL 2BCKB 5HDLA 1G7QA 4A2MA 1KBGL 4U6YB 4YXKL 1R24A 1U8PB 1BFVL 2LU4A 1PQZB 1OTUD 4FQCH 4KU1A 5DO2C 3FQXB 3QR2A 4HLJA 1UVQA 2YA0A 1CG9A 3UYRH 5BJTA 4GW5B 4DTGH 1IGJB 1DBKH 4X6BB 2VUYA 1P4LA 3VFTA 3QDJD 2BSRB 4QRRA 3MV8B 4WW2A 1G7JA 2ERJB 4MA7H 1JGDA 1BZ7B 3CH1B 4BK5A 3CVHA 4HV8B 1DEEA 2E6QA 3U9PL 1T0NA 3RY6A 3FFCD 43C9A 2NY7L 3QNYA 4LCWB 1CDYA 1MAML 4IRSD 4PBXA 2FYYB 5EIVA 3KPSA 2APTA 5ISZD 3RKDD 4ZAKA 4JGMA 2VZTA 4X4YB 3WIFB 5I74B 2H3NA 2YHGA 4P4KC 1HIML 4LSQL 2WNGA 4QRSB 5HY9B 4WUKL 2HTLC 3WJJC 1ZGLA 2QHRH 5DS8B 3D85D 4YO0B 4KUZH 2AEWA 4KRPD 1FE8H 1QFPA 2FH8A 4TRPL 5JLZA 4PB9H 2JF1A 4GAFB 2RBLA 4QY8B 1BQLL 4YQXH 3QNZA 1MCWM 5EA0H 2A38A 1J8HA 3L95A 1JPTL 4ORGB 3BN3B 3SDAC 1ZT4B 2R2EA 3THMH 2IADB 4KQ4L 2QTEA 1ZOXA 4M7LH 3KJ4B 2V2TA 3O0RL 1QVOA 4X9IA 3U79A 4LQFH 2HRPH 2IBGA 2Q20A 1XR8B 1KCSL 3GIVA 4OJFH 4XBGB 2E7LA 3QISA 3EYQC 4F37F 4NQCB 1YQVH 3ZTJG 1ZS8B 4KKCC 1GJIA 4JY4A 3MXVH 5FYKU 2Y6SD 5A2JH 2VZSA 3QCVH 4KXZI 3CVIH 1Q72H 3TNMB 1Z3GH 2BHZA 3GEWB 2NX5A 4RFOL 1AFVL 2G9HA 2IANA 1EA9C 1H8NA 5D2LE 5D1XB 2H45A 3R8QA 1DBBH 4F33A 3KPOB 1C1EH 2NXZB 5CJXA 1A6UL 12E8H 4YPGB 1XR9B 4I3SH 1K3IA 3EFDL 2FGZA 4NQSA 3UJTH 3ZHDA 1D9KD 1U95A 2Y23A 2VOTA 3GSNA 4LMQI 5M95B 1JYWA 2AJVH 2BRRH 5DD1L 3MLSL 5ADPL 4KXZH 1JL8A 3L3HB 3SDCB 4ODBD 1UQSB 1WTLA 2MTPA 5EOQH 4NOBA 3SBWA 4WI6A 1UWGH 2YPVL 5H37H 3VXUE 5ID1A 4KY1L 2EECA 4Y2DC 3RVWC 4DFHA 3HC0A 1R5IB 3CH8A 4TOYH 2H41A 2DJSA 3G04A 4ZS7L 3DUUA 4L29A 4X0KB 4IRZH 5DVOA 3EGSB 3DSFL 3IXAA 2PR4L 4K2UH 1CE6B 1WZLA 1I9IH 3ARTA 3ELAT 3SDYL 2X4TB 3SHSA 3NAAL 1E27B 1Q1JL 3MV7B 4CN4A 4KKAD 1QBML 3LEVH 4LIQL 5GS1A 2X4OA 2VXTH 1IEAA 1RQ5A 4Y19D 4KTEH 4ISVB 4B5EA 5DJ0B 3IS0X 5J1AB 3LS5H 5J7CC 2QJDA 1HYSC 4QWWD 2DQGL 2Z31A 5DJ8A 1B0WA 1NKOA 1NLBH 4OF6A 3NCEB 3D69B 3K80A 4PJ8C 3ILQC 1LEGB 3AAZA 1GHFL 5GRYA 4PV8B 2FLBT 4H25A 1NMCB 3VH8A 2DLGA 4N0UE 4HPOL 1WQVT 5KSAD 3G5ZA 3F7YA 5C7XL 5EUKA 1T6WA 2NY5L 4W6XB 2CIIB 4QLRA 4WFEE 3IJHB 2YN5A 5C0BD 2E27H 1FNGA 5IB2B 3VWJB 5DO2D 3RU8H 2CLVA 1ZHNB 5IMKA 2C4FU 4NUGL 3LD8B 4HJGB 4XH2B 4WUUE 5DQDH 4ZNCD 3QUZC 3F5WB 2DLFH 1DL7L 1T2XA 3FMGH 3ARBC 3NIDF 3BI9X 4JY5H 1YDPB 1A0QL 4M1CC 1P7QD 2DKUA 4HK0B 3RDTB 5DTFA 3IGAB 1NGYB 1NANI 4LSUL 4HUXA 4LOUC 3QUML 4LCYB 1RUAL 1CTNA 4IOSD 2EC8A 3TIDA 3VGFA 1S8DB 4F7MB 5J6GB 1URLA 2BZDA 3QHTC 1JGEA 5AYQA 4JQXA 1YEGH 4FTVD 2IPTH 4HQQL 1UJ3A 1QP1A 3P0GB 4BFEA 3SE4C 9CGTA 1U2HA 2CJUL 3WFHA 4HUUB 4XZUA 3CC5A 4KK9C 3MYZA 4HIJB 5CSBA 3O3DB 5DMGD 3OKEA 4I1NB 1HDMA 2HTLD 1OP3H 2D7NA 4JB9H 2OJEA 1NANH 2X4RA 3GI8L 4UT9L 5GGRB 5IT2H 1ZT7A 1A3LL 4OGZA 3RQ3A 3VWKB 4JCMA 1DUZB 2X4SA 1FAIL 1R3IL 3C9NB 3BH9B 3MX0A 3ULVE 4OI8A 3QEUB 3ILPA 1A6AB 1SEBB 3DUUB 3L7EA 4P9HH 3SDAD 3PV6B 2IAMA 4AEIH 1MJJB 4K71C 4I18C 5DQJA 2DL2A 3LQZA 2VITA 2ESVB 1FGVH 4N9GA 1MFDH 5FCSH 1SYVB 3QXUA 5DK3A 3ZTJH 3T0EA 5ESAB 4XPBL 1KPRB 1IZKA 1VADA 5GS1B 3VI3F 5F9JB 5E1AA 1LP9A 5E6IB 4HAGA 5BW7C 4ZO7A 3O9WD 5C6TL 1XGUB 1Y0LB 5TF1L 5B3NA 3UC0H 2OJZL 1JPGB 1N6VA 2HAZA 1FHGA 3QI9C 4MQ7B 1WK0A 5DUBA 3TBWB 5L8KB 1T2QL 3DETD 4MJIB 4RX4D 3I6LD 5EC1A 4XPTL 3NN8B 4RDQF 4ZYKA 1KJ2B 3JV4B 3ROOA 3VFOB 1KCVL 1NUDA 2WUBL 3QO0B 4LF3A 4CU8A 4HS8L 5D5ME 2UWEE 1X5GA 1QLEH 4H5SA 2XQYG 3I6KB 3TT1H 3O3BB 3T0DA 1U58B 1AXIB 3K4DA 1CQYA 1GC1L 5DJXB 2ADFH 1ACZA 1BD2D 4KK6C 2HJLB 5HYSG 5E9DA 2P49B 1FZOA 1MREL 4Y2DD 4GRLB 5F9DC 3RVWD 2BC4A 1Q0XL 2V9TA 2NY5C 2FSEA 2YS4A 5JTWA 5FGCB 1D5XB 5FYJD 4O58L 5CILH 3PL6B 4JRYA 3V6FB 3AUVA 4MDIB 3VD3A 5ACMA 5MHSD 3QIUC 3C6SA 3W0WA 1MCPL 5D1QB 1WZMA 4FXKB 3HLAB 4UIMB 4M7ZB 3RUGA 5LQBL 5I1KH 2NY3C 3F7PC 5DHXB 4UTBL 1YYLH 4DVRL 3U1SL 1A47A 2VWEC 2ZZUT 3ZDZF 5FV2A 1CXFA 5EOCJ 4P3DA 5ICZA 4PJ8D 3AMLA 2ZSWB 5BMFL 1MHCB 3ILQD 4QXGL 1RZ7L 2F53B 2VXQL 3OKEB 3QUYB 4YDKH 3B4NA 4CN6A 1ZAGA 4EDXA 1HEZA 1PEWA 4L4TB 4DUVA 5JPNA 2VXSL 5B22A 3DIFB 2F8VA 2YRLA 5DC0A 5F93C 1JUFB 4UQ3A 5EU4A 5J6HA 4U2YA 4E9LA 1HYRC 2EYSA 4XWGH 5C07E 4M5YH 3AROA 1F4WL 5I1JL 2Z8WC 2YSSA 3MNWB 3P4NA 1FNFA 2D0GA 3T0EB 3VW3L 3ARBD 3TWCH 5F71A 1M4KA 1W0VB 2BXYA 5C0GB 2YUWA 4M1CD 4TSCH 1S7WB 5CGYC 5T5NF 4NUJB 1KTDA 4LOUD 5K9KB 4X5WA 1D5ZB 1U36A 1TQBB 5D7JA 2AS5M 4R2GB 1EGJA 4U1JA 1R5VA 4R90L 1CVRA 1U8NA 3DV4B 1H3WM 1ED3A 4JFDA 3JV0A 3GMNB 3WIHL 4JFZH 1TJIH 4FFVD 1AGBA 3U4EB 3QHZL 4NFDA 5AYUL 1I7RA 2DM7A 4KK9D 4JVWA 3BP5B 3EJYC 4H20H 4AQ1B 4MLIA 4XCCH 5DD5H 3P2TA 5I1AA 4QGYA 3NIGE 4PLOB 2X7LB 5D7LA 1Q9WA 4UILL 1JBJA 1K2DA 1RZFH 1CICB 2YMXH 5LBSH 4HZLB 1R3KA 5I17A 4L3EE 1FJ1A 1FZOB 2VLRB 4NQEB 3BIAX 3QUKB 2CRIA 1A6ZA 5E6ZA 1P53A 1T0PB 3QIBC 1IT9L 1FRGL 4JN1H 1TPXC 3IJYA 1UGNA 4EEEA 4M6ML 3DYPA 1OPGL 4RCAA 3KNBB 1RUKH 3QZWA 1KB9J 1X5YA 4R3SA 1MFCH 4JM4L 3KYOA 4LLMA 4HS3B 5I8OL 5GHWH 1KTRL 2VDKL 3UTSA 5AAMA 1Y6NR 2PNDA 3BMWA 3KXFE 3LN5A 1XIWB 4QT5B 1HQ4A 1KLFA 2AJSH 4PJCF 4WENB 1T3FB 2C3HA 2WBJB 4Q7DA 1KC5H 3I50H 4OFYA 1AR2A 3EDFA 5EFIA 2N1KA 1S5IL 4Y5XC 1ZWIA 2A6IA 5ETUA 3UBXI 3QI9D 5IQ7H 5IW1A 3BPNC 3K2UL 1ACYL 3DV6A 2BNQB 3D39E 2VAAA 5JXEC 3QDGB 1O7VA 5C71A 1I7TA 1NBYB 3IU4L 1IGTB 3MBEB 1UEMA 1AP2A 4QHLB 4RZCB 3GSRB 1ZLVK 3QUXA 4GAYB 4P5TB 3AS1A 4M00A 3CLEH 2VLKD 4M1DH 2ENSA 1DQTA 3IJSA 1TTFA 4F15B 4UIKH 3I9GH 5FV1L 1XF4A 3JWOH 3OXRA 4NM4L 4FQ1L 3CVHL 3NACL 4TTGA 4UQ3B 4KK6D 5TFSH 1RFDH 1E4XH 1N5YL 7FABH 2FL5B 4Z95H 3IAGC 2BDNH 2FATH 2GI7A 2ERJC 1IKFL 1KB9K 4GO6B 4WJ5A 4J2XA 5CJQH 3SO3C 3JWNC 5DWUH 1CT8A 3FT3B 5C0AD 5LWYH 1KBGH 5IESL 5FM5O 4Y5YB 3HMXL 3O2DA 4HBQA 4X5WB 4RMRA 2BX5A 5BZDB 1LHZA 5I74C 1INEH 1PDKA 4I9WE 3S3PA 5JR1L 3VXSB 4WW1B 2D2OA 3V6ZA 1PGRB 3HNSH 1MVUB 1BZQK 1U92B 2HFGL 5H2BB 1I3RB 1IAKB 3V5DB 3MJ7B 1T7VA 2GQHA 4D0DB 1AIFB 3S36L 3MGOA 5FF6A 2BNRE 1T4KA 1FBIH 3QB7C 1BFOB 1S78C 2DM2A 4MVBD 3VDCA 1SM3L 1M7XA 2P8LA 4I13B 4NC1E 5GQBA 1RZJH 4ZO8A 4Q58C 5D71L 2XWTA 5JO5A 1FJ1B 3KJ4C 4X7SH 1Z0NA 1WWCA 1HIMH 5ECJE 2GSGB 4LRIA 4WUKH 3WE6B 2BVUA 1FL5B 4FFYH 4I8DA 4A2LA 4NO0B 2O5XH 3RGVA 1CR9H 2EDEA 4Y1AD 3FN3A 2YR3A 1YMMD 4MNQD 1QSEE 3QG7H 4D9QD 4N0YH 4NHCL 1RJLA 1EK3A 4Y88A 3WDJA 5I16B 1CBVH 5D1XC 3KPNA 3EFFB 3LRSA 1UWEL 4PJAA 4F9LA 3UPRA 5F7FA 5CGYD 2NXZC 5CEZH 5CSZB 1J87A 4DVBA 3DNKA 1VFMA 3V6OC 5L7XL 3DO7B 3CX5J 4F2MA 2H2PC 1IM3A 4YHIB 15C8L 2AGJL 3CUPB 1VCAA 1I1RA 5JZ7D 1AGCB 5ISZE 2HMIC 5C0ND 3RY5A 3SDCC 2DBLL 1TTGA 5I2IA 5MP6L 2MQ0A 5KZCB 5F70A 2IWGA 5AD0A 4UU9A 3HNTL 1JZ4A 1RSFA 3EJYD 4L9DA 3BP4A 4QF1A 2RCSH 4UTAL 1BQSA 1N0LA 3EYSL 4YFDB 3WN5A 2YWYA 3LEYL 1HXMA 1LE9A 3U2SA 1VACA 1OAZL 1U41A 3TV3H 3W5MA 4JPIA 5DD1H 3QIBD 3MRGA 1LDPL 2VUOA 5ADPH 1FNEA 3NZHL 3OKNB 4DOHE 1V5JA 3P40A 3BXNB 4X9BA 4KY1H 3DURB 4MS8C 3ARED 4WGWB 5EPMB 2AI0L 5EIQA 1KJ2L 3SE9H 4BH8A 3UBXB 3D2UB 4Q6IA 5CKAA 5CZXD 5T1KB 2F19H 5GGSB 5IROC 4YAQA 3CX5K 4NZRH 4OCNC 5TDPB 4S1SH 4NP4H 4XBPA 1JF1B 1RHFA 1DQLH 2H26A 3BUTA 3CSYB 1MJ7H 1ZA3B 3O3UN 1V3JA 2QQKL 4AIZA 5IMLB 2EH7H 4O4YH 2GJJA 1QFUL 1NMCC 4GS7B 3TCXA 1DUYA 2V17H 4S1DC 2DTMH 2ARJB 3MGOB 3MSPA 5SV3A 5JXED 2E6JA 3T2PA 1HQRB 3TN0A 3Q3GA 3VWJC 4KHXH 5C2UB 4PJGF 3LD8C 5C8JA 2IQAA 1A7RH 2ATPA 1MPAL 4M7LT 3CFKB 2CLRA 5HGBA 3SJVB 4OB5L 4EI6A 1BFSA 5L0QC 4HCRH 2UVFA 3RDTC 4XGZB 5JQ6H 2I24N 5D1ZA 2PO6B 4HKBB 1PY4A 1C5DB 5E24E 6FABH 35C8H 2X4QA 4WFFD 2DBJA 3UCRA 5GGRY 4IMKA 1BOGB 3O3EA 4OUOA 1GVIA 5F44A 3PWNA 2VDML 4LCWD 5D8JL 5E8EB 5D2NE 5JNYA 4PJBF 4R4BB 4P57A 1AE6L 4GKNA 2CD0A 1EIBA 5J9PB 4HC1H 1NC2A 2AEQL 5ITFA 1WVZA 3DX7B 4XNUL 4Y19E 1VB9A 1J10A 3UTOA 3UZEA 2FCBA 5JHLL 1KSRA 4OIAA 4P23B 5DC4B 3UXFA 3P9WB 1MRDL 4U1MB 4QHMB 1I8IA 3KJ6H 4FQXA 4OCWH 4F7TA 4XCFL 5HYEA 4LPXA 4AEEA 4X8XA 3VWKC 4CMMB 5DVMA 3MLYL 5CWSB 2Z92A 4W6YB 2IJ0C 5CBAA 4OLXL 4ZSOB 5B3JF 3M8OH 3RIFK 1S78D 2EDWA 2IH3B 2V2WA 4QRPA 1L7IH 5IBLC 4YFLF 4DW2H 4LVHB 5ANMA 5GS0H 4DEPB 3NFPA 4F57L 2R29H 3E0GA 4PTUB 3W9EA 5D70L 1KJ3L 3MV9B 1F90L 1RMFH 1EJ6A 5K9OA 1MCDA 5HD8C 1K8IA 4FQPA 4LSRL 5FUCE 1T7WA 1YEKL 3GMPB 5E6IC 4BYHA 4URTB 3FQRB 5BS0B 3UDWC 2CDGB 3RWFA 1X5KA 3WNNA 4JFQB 4X6DE 1R3IH 3NCBB 4RMWA 4QCIB 4OF5A 4WRLA 5C0EA 3GK8H 2MCPL 4X98B 4X4ME 1EMTL 2NXZD 3QSKB 4X80H 3L9RA 5DMYA 1AXSB 3SGKA 3O6LH 2H2PD 1E28A 4IIQB 1P6FA 3IETA 1CDJA 3QHFL 1FO0H 3LS4L 1MUJB 3WUZA 1N59B 1U6AL 3L3JA 3TPUA 2HMID 3SDCD 3TEUA 4YHKL 3PJSB 4HX1B 4HKZB 5JW5A 1B6DA 5CEXA 4WWID 2VIRA 1N8ZA 3DRQB 4GRLC 3R0NA 3U7WL 3T04D 1GGUA 4MD0A 1NFKA 1T2QH 3PL6C 2N56A 3VG9B 4XNXH 3ARUA 3JZ7A 2WUBH 1IQWL 1VERA 5CGTA 4G6KH 2WINA 4DZ8B 1AGDA 1BGXH 3MV7D 5D1QC 1KGCD 4LEOA 5DD0H 3DMMA 1S7RA 2DICA 5AZ2L 4PJCB 4M7ZC 2OQJB 3FRUB 4XMLH 4U6TA 1ZANL 4NJ9L 1KV3A 1QRNA 2DQIL 4NNYB 3GM8A 3RWCA 1G6RA 2FJGA 4ZAKD 4XP5L 1HH6A 2OR9H 2CPCA 4NZJA 1U8MA 4JKLA 1N3NA 2VR5A 2C3GA 1T5XA 3QUYC 4XCNB 3LQMA 3S96A 3QEGL 4OZHF 2PCPB 1F6AB 1MIMH 3S34L 4ELMA 3DGGA 3TESA 2VB5A 5HJ3A 4S1DD 1KULA 5IJVB 3FQWA 3ROLA 2A6KA 3TFKC 1ULVA 1HH9A 5CGMA 1U91B 5GS2D 1F4XH 3WSQL 3OAYH 1RIHH 3VWJD 4P5KB 3FO1A 1CDIA 4MQXC 3VFGL 2EXWC 3LN9A 3IDNA 2WWMC 1XF3B 5A2FA 5BMFH 3RP1A 4TUOB 2AK4B 1A4JA 2KKQA 1XFPA 4LHQB 5FA4B 5HHVH 1BEYL 2B1AL 4NWTL 3FO2B 4MA8L 1SYSB 5GISL 1N2RB 4Q74A 5FYJE 5TDOA 4N1HB 4JG0L 5TPWH 5JXAH 1NCCL 1TQBC 2NX5D 3QG6B 5CFHA 3EO1B 4U6XA 1RZKC 2XKNA 5MHSE 4R7NB 1D6EB 4HXBH 3SCMA 1PD6A 3HUJA 3R8BB 3P11H 4R2GC 5KVEL 3LN4A 5DUML 1T22B 4F7CA 4ZODA 4MXVF 4OAWB 5CMAB 5DLML 4OD1H 2HKFH 3QPQC 3OKKA 3UP1A 2AJXH 2COQA 3QWOA 4NQVB 3SDXA 1EBPA 5KS9E 1UKTA 4CU6A 2R23A 4OF0A 5MEQB 5EOCL 3MODL 5TGBA 3RL2A 1CICC 2G60L 2R2BA 3CZFA 4BH7B 3GB7A 4LP4A 2I26N 3EDKA 4QTIL 25C8H 2VR9A 1CD0A 4ODWB 3TYFA 1FO0B 2A9ML 3DROA 4R90H 1DE4A 2R2HB 5L6YH 5FUOH 1HWGB 4YFLI 3PQYB 3QNXB 3ME0A 1CYGA 2ESVD 3BQUB 1HHHB 1IGYB 2X70A 3BZEA 2YC1A 4ZG1A 3VXPB 5HD8D 4G9DB 2P7TA 4TN9A 1TQCB 4LCUA 3HR5B 4R4FL 5K9JH 4LLVA 1XIWC 2F8OA 3HRZB 5E6ID 4M5ZL 3OF6A 2WBJC 4MNHB 5C0FB 1UXWB 2BOCB 2GK2A 3I6GA 2W38A 1MQKL 2ICEA 1L7TL 1GAFH 2MCG1 4NM8L 3SQOL 2EDXA 2SEBA 1XH3A 3MA7A 5DR5L 1H3VA 1EVUA 1QPPA 5DZNA 4MJID 4WNQB 3EOBB 2WM0A 4YHLH 3MBEC 1AD9A 1OSZB 4P5TC 3Q6FA 3SE8H 5HJ3B 2A1WH 3F12A 4KI5D 2AJZA 1SMOA 5KTEH 3AB0B 5H94A 4ENED 4JM2A 4F15C 5E2UH 2DD8H 3BHBB 3OKDB 3FHAA 1EO8H 3B2UC 3CFBB 5E8NB 3MXWL 4IHOB 4CGTA 5AAWA 2XNAB 4OKDA 3BP6B 4NO5B 4WO4B 1AKJA 1OCWL 2CMRH 4R8WL 4GRLD 3RJDA 1YEDA 3KWWB 4QEGA 4BQ9A 2JB5H 3PGDB 3LKQA 4J7RA 4L8SA 2CXGA 2MMXA 3PL6D 5IR1A 3DOSA 3SKNB 1QLRA 3MJ9A 4Y5YC 5L88L 3WNOA 3CXHK 2NTSP 2YD5A 1MEXH 4JANB 4WHYG 4QOKA 3EZ8A 5D1QD 1MH5B 1V7ML 3CVHH 5EBLA 5MERA 2UZXB 2BVPA 2FO1A 1P4IL 3FHQA 2JKXA 4LPCA 3E8UL 5GGVH 5IEKA 5TQ0H 1N64L 5L2KA 1AO7A 1FFQA 3BIKB 3ZDYF 4PJIA 4HWUA 2IPUG 1G7HA 5JA8B 1WAAE 1BBJB 3MO1B 4G6MH 4PJFB 3BPOB 2PW1A 3CDGA 3QRFM 2ZOLA 5MEPA 2F53D 4X9HA 3QUYD 3ZKXB 4X4XA 2MSPA 1WLHA 1KIPA 5E2WH 2VN4A 3MJ6A 4LIQE 3HTLX 4OCYH 1MLCB 5TGBB 4PJGB 1IQDA 4UT6H 5GSVB 4DQOH 4X6CF 1BWWA 1B0RA 3T1FB 4ODXB 3VE0B 5B38G 4G8IA 5HHOE 2IAMD 5EORH 5JPMB 4MD4A 3JVGC 1P5UA 2EXWD 3EYUL 4OT1L 4M6OL 1IC7H 2YD4A 1Z5LB 3FZUC 3T0ED 4D0CA 2B7DT 2R1WB 4NQDB 5HI5C 1NCTA 2X9WA 3ZSSA 2LU7A 4XP1H 2ICWJ 1C08B 5EC2B 4LPVA 4YDVA 1A9EA 4PJBB 1TETL 4OZGB 1B2WH 2QSVA 1UB5B 4XVTH 5C0AE 2WBKA 4UDUB 1MJUH 3OKOA 4Q6YA 4PP2A 2R39A 1CF8H 1MCCA 4NRXA 3K8LA 1YMHB 2VE6A 4NKDA 1IC4H 4I5BA 1G7LA 5IMOA 4X99A 1HE7A 1GGBH 5AWNH 4K3JL 3HI1B 5EUOA 3U6RA 1MRCH 4JJ5B 4D3CL 4F7PB 1TZIA 2I25N 4ACPA 3GSVA 3GSNH 2DKMA 2VXVL 4KAQH 5DMIL 1IZJA 4JM2B 3B43A 1AI1H 2VWEE 1TZHB 3AS3A 1A1MB 2J8UB 3QH3A 5IV2B 1BM3H 3UMTA 1KG0A 5GGSY 2CLZA 4M6AA 3FRPA 2ARWA 4NQED 1FN4A 2DLHA 3NA4A 2AXHA 5F7MC 4JRYD 2GUOB 3QDMB 1MCRA 1WT5C 4KDWA 2M26A 1KPVA 4NDMB 1E4JA 3HNTH 4PRPA 1E4WH 1ADQH 4JFHD 4P4RB 2OYPA 2RR3A 4IDJH 4X7FC 3X3GL 1XIWD 5E4EB 5SWSB 2DQFA 4E42A 4YHNB 1P5VA 5FM5M 3FOMB 3K2MC 5HHPA 2WBJD 4D9QE 3TC9A 2I9LB 1HILB 4XPGL 1P2CA 1XAUA 4PRAA 4YBQC 4H8WH 2AV7A 4PGBB 2H32B 3LMJL 1F6FB 4GS7C 2NW3B 1N0XH 4UNTA 3OR6B 4OKVA 1UYWH 2YA1A 3EJJX 5IHUH 4JVUA 3QDGD 1CZ8L 3KLDA 3ZO0A 4HGWB 3PWUA 1GRWA 3TBSB 1MCEA 3OR7A 1A1OB 4WY7L 3HFMH 4PRDA 4RISH 4P5TD 2GFBB 2ICWA 5IQ9B 4UZGA 2OZ4A 1G7PA 1OSPH 1MELA 2PYEA 1BQHG 1KIRB 3S88L 3B2UD 4W4OA 2QQKH 1M7DB 4HIIA 2R1XA 1T5WA 1PZ5B 4KDTC 2PO6C 1Q9LA 3DX9B 2XI9A 1RZJC 5DJ2A 5E2TL 4G8GB 3TJEH 1VPOL 3ZE0E 4M43L 3VXTB 5B39A 4DUXA 4WHYH 4P2RA 1X5FA 4ZTPH 1YNKH 4M3JA 5EIIA 2DI9A 2GJZB 3GSWA 1TJHL 4ONGH 1MPAH 4OZIE 4OTXH 4YHML 2CK0L 4MDJB 1SJXA 5EN2A 3VXSD 4BKLB 4X7DC 2XZAH 1UA6L 3D1MC 3T2NL 4RNRB 4P23C 2YRPA 4U4BA 4BUHA 2JE8A 3WKMH 5FECA 3AGVA 4OZHB 3UYPA 3KG5A 3D3VB 3E6FA 1T21A 1NBZB 1Q0YH 4HS6B 2FGWL 3C5ZA 4MHHG 2DM3A 1I3VA 1KOAA 5D8JH 4POZC 2XY2A 1UM6L 3L6FA 4WEBL 4LVHC 3TO2A 5D7LD 4DEPC 1RIUL 5DZLA 5DD6B 3QEQA 5C0IB 5CJOH 3DARA 2HLFC 2ADIA 3V6BR 5KJRH 4Y16C 1LE5B 1NMBH 1G9MH 3GNML 4NO0D 4XPHL 4FQHB 3GMOB 4XCFH 2Y5EA 5LKNA 3MLYH 2P45B 3QZWG 2FLRT 1ZV5A 5ALCL 1JHTB 3X14A 5HI5D 2Z4QB 5DUPH 4BFIB 1A3RH 4NO3B 3IDUA 4F57H 3M07A 4YGVB 4R4NC 1RJYA 3UTTE 4ETQB 5F88A 2OBGA 3QULA 2EIZA 4NGHH 4U6VL 3MLWH 4IIQC 4Y89A 4ZOCA 1MWAA 2V5MA 4RMTA 4ZUUB 4LSRH 1JTTA 4KZEL 1KJMA 3HI6H 4FZEL 1FNHA 1JGLH 5EO0A 3MLUL 4PGDA 1LO5B 1FL6A 1RV6X 1FPTH 2FHBA 1A5FH 3QUXD 3RL1B 4E5XB 4RGNB 3QXDA 2W65A 3EUUA 3R06A 4LHUA 1F11B 5CINH 5JDSA 3T77A 5GJSL 4OLZH 3VRLE 5DK0B 2WLYA 1F00I 1JHKH 5D2LA 5HGHB 1I8LA 5D7IE 1PJ9A 2Z91B 4P2QB 4XXDB 4JDVA 3VG9C 1CLYL 1MCLA 4PGZA 4X6FB 2VJXA 1XGYL 1ZVSB 5BZWA 3BMVA 3INUL 2WIIA 4N8VA 4XVUD 1JZ6A 1G6RL 1OLZA 1U6AH 2VZOA 5I19L 3GBML 3SY0A 4M7JL 3L1OH 3VD9A 2Y7QB 4D8PB 2BERA 3RZWA 1CFVL 4YX2H 3WHE1 1N6QL 3MBXH 3VXUA 3UAJC 5C08A 2PXYB 3KPQA 5BXFA 3BPCA 3N85H 5HDBE 1H0DA 4DUWA 5E08H 1IQWH 3KPRA 4MNGE 4KJWC 4PY8J 1FV1B 4YBQD 3T4YB 3IDGB 5BVPL 3MREB 4NSKA 1HWHB 1MFBL 1P1ZA 4G6JL 5HDQL 1J05A 2DQIH 3CLFH 4PJAF 4GBXB 1W0YT 1OD7A 5GRUH 1VDGA 4MCYB 5FYKH 4JPWL 3QFJA 2NXYB 1RJZA 3UTQA 4ZUWA 3SQBA 5DJDB 1CLOH 1YN6A 3OJ2C 1RU9H 5DGQA 3SJVD 4PJ5A 1JWSB 3IU3A 4NHUA 4M4PA 2PO6D 1BX2A 1X5HA 5GS0C 4KZDH 5DRXB 3WFEL 3DI2B 4N0CC 4R9HA 1ZEAH 4M48L 5T3ZL 5B38B 4P46B 4TYUA 3N9GL 4G6FB 2VLJB 3LPWA 4Z7WF 4U1IB 3SE3A 3VFGH 5F7EH 3O3AB 1LNUA 2B2XH 5ICYA 1ZHLA 4Y8AA 3Q5OA 3RTQB 3VD5A 8CGTA 1U8QB 1DANT 4X7EC 4AL8L 1ZT1A 5GISH 1T1WB 3KPSE 4P23D 4L3AA 1EGJH 4PGDB 4JG0H 2VLLB 2Y5TB 4TSBH 1MJ8H 1IBGL 3P9MB 4NRZA 3ARQA 4JO2H 4Z77B 1IC5H 4X6CB 1S9VA 3BEVB 1RUMH 4POZD 1A6VL 1GPOL 5DUMH 2W0FA 5F1IB 1RUQL 3LQAH 4ODVH 1HXYA 4Q9RH 1NUNB 4K3EH 3BQUC 3GSQA 4JY6B 1QEWA 4IMLA 4PJXA 3BZFB 3ULUF 2ZJSH 4LLYB 1J8HE 3NFNB 3TNNB 3PP3K 1TQCC 3DYMA 4HJ0D 3OJDB 3A6OA 3ALPA 5EOCH 3MODH 1LO3L 3MFGB 5IKCB 4M1GL 4OCXH 3JWDL 3ARWA 4KMQA 1FG2B 1JMZA 3Q48A 3H7LA 4BZ1L 1VFAB 1OTSD 4QYOA 1BLNA 2AKRA 1NFDB 3PF2A 3BRFA 4R4ND 3EO9L 2I9TA 1EV2E 4GW4A 3LKSA 2VDPL 5BRZA 4WWKA 3VXRB 5DRZA 2NX5E 1I4FB 3T0VA 3KYMA 4XCEA 1T89C 4P3CL 4OGYL 1I3GH 1T04B 3FFDB 3MRLB 4NNPH 4GRWF 3W39A 3MRHB 3G6JF 3TBVB 3V7AG 3AB0C 3O8XA 3HE6B 2L0DA 4M8QA 1MHHA 1EO5A 1OAKL 3TN0D 1J05B 3MJ9L 3NABL 1UZ8A 1U8KA 4WO4C 5FOBA 5BQ7B 1TCMA 2ZUXA 1NJ9A 4Q2ZB 5GPRA 4CMHB 4LNRB 5I76A 1TENA 2ORBH 5C6PB 2NY2D 2DQEH 5D6CB 5I1DA 3H7BB 5F7DA 3FQNB 1GGCL 3C8DA 5DRWA 4K7FB 4NWUL 1BQHB 3OV6A 4TSAL 1QA9A 1GGYA 2EZ0C 1W72A 1ND0B 2ESVE 1WWWX 4Y4FA 3VCLB 4XVJL 1IL1B 4YXHH 1C5CH 1YY9C 5HGDB 3O2DH 3TYGH 5F1NA 1N7ML 1ORSA 2V7HA 3UAJD 1IC1A 4QXTA 4EVNA 4O02L 4GMSL 2YD1A 3OJMB 4LPUA 1NC2D 5CP7B 2EDBA 1PVHA 3BPOC 3A6CH 1G7IB 4P9MH 4OLVH 5KANG 2C3XA 3FB6B 4LVOB 4X8JB 5JIKA 4BSVA 4KJWD 3ZKXC 3OGOE 4LMQE 4JLRA 4L8DB 2FJHA 1H3XA 4XVSL 3O6MH 2D7TH 3B9EA 1RK0B 1YJDC 4LKXA 4JZOB 1J1OL 4F8TA 5CIPA 5DSCB 1QR1B 3V4VH 3O2WH 4Z7VB 4AT6B 2GJ6A 3HCVB 2EYTA 3RIFF 2FECL 4KI5E 1HHGB 4HWEH 5EB9A 1YEJL 2BSTB 5B4MC 1HSAB 1YEIH 3L3IB 1AY1H 5JOFB 1FZMB 2AK4D 3GKWL 3N1PC 3DYOA 4Z7NF 2PKDA 4TVPD 4I48A 3X13B 2P5EA 1V7NL 1NDMA 3IF1B 4YH6A 4KVCH 3U0TA 5T1LA 5GS0D 4ZFOB 3E1F1 3I02A 3HNVH 4MMXC 4NZUH 3HE7B 4N0CD 5I15L 2EIDA 4BFBD 4PGJA 5DHYA 2YD9A 4RMSA 4Y4KA 2YPLA 1JWMB 1VHPA 3EYOA 3GMRB 2EDOA 2Y07H 1BLNB 1HNFA 2I5YL 3JWDC 4F3FA 1CFTA 1SVCP 4XRCB 4RSVA 2A73B 3CCHA 2JELL 1FH5H 2G75A 4FABH 5EZLB 4LLQB 3FO9B 4QGTA 2WV3A 5L2JA 1RK1A 4YEEA 2H9GA 2EEAA 4V1DB 1RZGA 4JRXB 4RIRB 3S5LB 4Z7UA 3PWJA 2VKWA 3G6AA 3L3KB 4L8BA 5HHXL 3B9DA 4PJ9B 1YY8B 1OT1A 3S97C 1OGTB 3GI9H 1NPUA 4JR9H 1I7ZA 2DIBA 1ORQA 1KEGL 4H88H 2KL6A 2X1WL 1BECA 3PQYD 4U1HB 4ZTOH 5LXGL 1KPUB 3BQUD 1IAII 1KLGB 2JJVA 5E99H 2AJ3B 3WFCH 4ELMF 3ES6B 1J86A 2UYLA 4JHWH 3HMWL 5DFWH 2R1YB 4QRUB 3DMMD 1YN7A 3JV6A 5GGVY 5E4EC 1INQB 3DPBA 3PWPA 4XXCC 1RHHB 1I1FA 1J0IA 3S35L 3NPZB 1BVLA 3HZVA 2QKIB 1Q9KA 1BIIA 1PYWB 2YZ8A 3T0EE 1RI8A 2CUMA 5F1NB 4XAKD 1LP9E 2BP3A 4OIBA 1JCKA 2BSSB 1KFAH 1KNOB 4ODUB 3SOBL 1ONQB 3C87A 4LK4A 4EUPA 2CSPA 4HUVA 1IAIH 5TJWK 1FYTB 2FHFA 4UNVA 2Y36L 2AEPH 5LCVH 3ULUH 5CD3A 3CPLA 1A6TA 5JW4N 4LLWA 4PLJC 3HZYB 1QTYT 1JVKA 3KXFA 5FO7A 5EULV 4DKEL 4G5ZH 1Q8MA 2VERN 4OLYH 1VGKA 4LKCA 2IALB 5KVDL 4WO4D 4MZ2A 1S7TA 5JIPA 4KPHL 1A3QA 4OLUH 4NCC2 2VDQH 1CGUA 3OKMA 1OP9A 2CKBB 2D03L 4PREA 4RAUB 1U2CA 2GK0A 3SDXF 3MA9L 4MB3A 5E9DE 4WY7H 3MFFA 2KDGA 3LKOB 4ZPTB 5JHDB 1HZHH 1U8LA 5GZOC 1JFQH 4AM0B 1UM4H 2CDFB 2DWDB 4YHOL 1K8DB 5JOEA 4GRWH 4JRYE 4EBQH 2AV1A 3D0VA 4C83A 2EZ0D 4HH9A 4OLWH 4G8FA 3SPVB 3EYOB 3QAZB 5AUMB 4MJ6B 5IIEB 1YY9D 3W0WE 1RUPH 4JFHE 1S7XA 4GUPA 1MCHA 2VDOL 3IDXH 1EAPA 1JRHH 4ALAL 3RUGE 4AQOA 1CLZL 1A2YA 4GKZA 4OZ4A 1C12B 4PJDA 3C60A 2GAZB 3ARDB 3L3GA 1RIVL 5DEFB 2ZP0T 1RZGB 5EU6B 5T3XL 1JGUL 3S37L 5BVJB 5E00B 3GSXA 4U1KB 4JPVL 5ESQA 4MWFB 2IGFH 1MCWW 4PS4H 3T2NH 1I9RH 3BD5A 5FFLA 3KLAB 4QXWA 1KXQE 32C2A 4OM0H 2IPKA 1UZ6E 5JUEH 1HHKA 1R3LA 1ZA6A 1QFWI 1G6VK 3EYVB 4WTWA 5HGAA 3QCUH 1S5HB 2BSED 4G9FA 3QEHA 3EW3B 5B4MD 3CMOL 5IB3A 2R4RL 1EEZA 2C5DC 3K46A 1FFPB 4LSTL 5I8KH 5F96L 3VFVB 3PXJA 3KLSA 4NQDD 4O51A 5MENB 4OIIL 5SX4I 1EXUB 3IFNH 4I4WA 2FR4B 4Z7WB 1CGXA 3MRKA 2EE3A 5IK3B 1OARL 4XAWL 2NY4D 5I1GL 1J18A 3OKLB 1KUMA 2EIBA 3KPPA 5DEZA 4UDTB 1NQBA 2R0KL 5J1SC 2Q1EA 3IDMA 2X5PA 2WW8A 2VTFA 4WTZG 5KVFL 1QKZL 3DUSB 4L9LB 5BCAA 5IB5A 2DQUH 2GIYA 1DBJL 4HWZB 5F6HI 4RGNC 4CVXB 4GG6A 4H8WC 5SX4H 3QDJA 4XPAL 3K3QA 4JM2D 1LK3H 2P46B 3WXVL 3C2AL 3DHJA 5F3HB 2QSTA 1AKJD 3FFCA 2DJ4A 4PJIF 5GJTL 1NSNL 1OY3B 4DN3L 1RD6A 4PREB 5D7LE 1RURH 2E7MA 1J12A 4IRSA 3MRDB 5FYJU 4O2CA 4PR5B 4PJHA 3WNMA 1U8IA 2A77L 3VGAB 3QDMD 1WWAX 5ISZA 4WI4A 3DHMA 5DJ6B 3V5HA 1CFNA 1NGPH 4Z7QF 1AGEB 3N1FC 4MD5A 3CK0H 2PXYC 1JNHB 1VFBA 5I73B 2O61B 4C83B 3D85A 1U3HB 4AEFA 3GRWA 1DJSA 4FFZH 3IDJB 3PIQA 3G5VA 3CDCA 3ZYZA 1B0GA 4JFPB 3UTSE 2HT3C 4GRWB 3ZKSD 3GBMH 3G6JB 2UZYB 4MA3B 3WNLA 3RNQA 1OB1B 4HIEA 5CUSL 3RA7H 2AK1L 3PWVB 2V2XB 2RAMA 2F9BT 2XPGA 4GBXC 4PLJD 3I84A 3WS3A 3RPIA 5DT1H 4HF5H 1EPFA 3VRJA 1YQ2A 2NXYC 2XWBB 4JAMA 1J0HA 4KTDH 3T2OA 4QRQA 5CLTA 1EEYA 3MNZA 1QSVA 4J6RL 4ONOA 5LAXB 4G9FB 5IHZA 3K8MA 4NC0B 1AD0B 1IARB 4HBCL 3IDIB 3VXMB 4G8GD 1GGIH 5HVHB 5HDQH 4P46C 1QSFB 1EHLH 4HFWB 5GZOD 4BA8A 1G9MC 1KCKA 4MLSA 2MHAA 1FL3A 1NCBH 1FORL 2ZSVA 3RTQC 2NW2B 7CGTA 3BP7B 5JORB 4J3XA 1FGNH 3WLWD 1WBXB 2GTZB 2MQCA 3ARRA 1NGXB 5IG7A 4KHTH 4H0IA 1NGZA 5EU5A 3QWRD 3TM6A 1G9NL 4GFTB 1X6LA 1NDGA 3FOLB 3VMNA 3D3VD 4AMKH 4IS6B 3RWHA 2BVYA 2EE6A 2EYRA 1WIOA 5DQ9B 4Z9KB 3STZA 4G43B 3PABA 1LO4H 4FQQB 1M6OA 4NYLA 3T65A 5K59F 1EZVX 1NCDH 2OXGA 3PP4L 4ZFOL 1XF5B 1ZTXH 2D7PA 1F3DJ 3B9AA 1FG9C 1MFEH 1LO2H 3CFDB 2HG5A 2Z9TA 1XGQB 1VFUA 4LHJB 2V9RA 4Y19A 3QT2A 4ORZC 4NZDA 3MRPA 1S7UA 2CR3A 4CVZA 1CS6A 2HYMA 2ZUTA 1X7QA 4Y2OA 1YPZA 4MD5B 2OS7A 4YHPA 3WUWG 5CJ8A 3REWB 1AQDB 4HWNA 4AZ8A 2YPKA 5DF0A 1GL4B 3T1WA 2XZQH 4EZMA 2NY1B 5F97E 2Z8SA 4QTHA 3LRGA 5SWZA 5J4MA 3L3OA 2R9HC 4U0QB 3JTSB 3P73B 5E8DL 2APBA 3MR9A 5C0BA 5I8CB 2Z0BA 2Q76B 3HE6C 2ATKA 4P5MA 4QXUL 3FB7B 1JF6A 4HIEB 2P43B 1IGFH 1NAMH 3MRRB 2P8MB 2G2RA 3WEXA 1L6ZA 5DFVC 4WI7A 4RGND 4PLNC 1EHNA 1S9XB 2ADGA 1V05A 1FP5A 4HKJA 4J8RB 4C56B 4CMHC 1KT2A 1I1AB 5F3BA 3JTTB 4JPKL 2RIKA 4PRHA 1P69B 3QWQB 5EBGA 4I0PB 5FUZL 1KENL 3QBTB 1CU4H 1D5MA 2YK1H 1F6LL 1EEYB 3PHOA 4U3CA 3K74B 3VG0H 4RFEA 3WFBL 3IFPA 2B5IB 4FTVA 2J2ZA 1UXSA 4Z18A 1OAKH 1MCNA 3AXLB 4ONFL 1WICA 3MJ9H 1GIGL 1KB5A 3N1MC 1H3PL 2BXZA 2APXA 5E56A 5AZEL 4K94H 4JDZA 1D3CA 4HT1L 4P4KA 5B39G 1SMAA 2PXYD 5CZVL 3WJJA 1Z6JT 3VXNA 4EOWL 4Z76A 3KR3L 3IKCB 4OD3H 5EDXA 5TDNA 3JXAA 3DTXA 4LVOC 4BZ2H 3X12B 4O2FB 3AVEA 2QEJA 4HFUL 1QG3A 3BVNA 1LEKB 1J0KA 1TVHB 4AG4L 4I2XA 2IQ9L 4WDIA 2HT3D 5D9SB 5F7HA 4WU7B 3SDAA 4OM1H 4ELKB 1X5LA 3MRCA 3C5ZD 2AJYH 1ERNA 1WC7B 3LKNA 2CKBL 2E9BA 2VL5A 2XQYK 3HS0B 5DD3L 3V52L 1NEZA 4ZPVA 4GMSH 1A9BB 4UUJB 4ERSH 3H3PL 3QEQD 2Q6WA 2NXYD 5T5FL 1S7QA 3KYKL 4R96B 3WBDA 4NC2B 2HFEB 1CFSB 3RHWK 4GRMB 1NGWB 5HXMA 1OGAB 1PG7L 5T3XD 5TH2A 2P8PB 3L7FA 3VXOB 3I3EA 4P99A 3HE7C 4AEHL 2ITCB 1TVDA 3MLVH 4KTYA 3GIZL 1YC7A 3VMOA 1E6OL 1HOCA 1U93B 3W2DL 4G6FD 5D2LF 2MKLC 2I60L 2YD7A 4YWGH 4ZS6D 3SDDB 3U46B 2FRGP 1JGVL 1ZGLM 2AJUH 5C09B 3FO0H 3RTQD 2F58H 1J0JA 2D31A 4YR6B 1NBQA 3RX5A 4N5EC 3RX7A 4TPRL 1ZHKA 1MI5B 1BD2A 1QLFB 4E41B 3HG1A 3RY4A 2EKSA 1MHPH 4OI7A 1NCNA 1NLDL 5ERWB 3VFWB 2DI8A 2KBGA 4P5MB 2Y1VA 5FHAH 4Y2DA 2OMNA 4YNYA 3GGWA 2ZG3A 3OGCB 5I15H 2C4FT 3BFOA 3SKJH 4G3YH 4LLDB 4PJ9C 1XF2A 2FX9H 1TZGL 3DUHA 1KT2B 1DQMH 3WCYA 1F8TH 3H8NA 3OL2A 4LHUG 1BF8A 5EO9A 4G8EB 3AU1A 3TBTA 1NAMB 4S1RH 3G5YA 5IF0A 1OW0C 4QRPE 5ANME 1H5BB 3IFPB 3FN0L 3FQTB 1VGEH 3KPLA 3RZCB 1QQDA 5GRJH 2AK4E 4M6NH 4PJ8A 5I1CH 3VFNA 3U36B 3WFDH 2XKUA 2GSIA 4DGIL 2FB4H 1BZ9A 4OSUL 4PRIB 4RGOL 1M7IA 4YXLH 4KMTH 1L9MA 3DVGB 3TBYA 2QQLL 3G6DL 2R9HD 3EZJB 1GSMA 2Z93A 1FCGA 4FXGA 1A7OL 5IFJA 2VQ1A 4WHTB 4S2SA 5IHLB 3MRCB 1UWXK 3W9DB 4CRPA 4I3RH 5FYLL 1YNTB 4YUEH 3ULSA 5DFVD 1FVCA 3MLXL 3QUZA 5C0CA 2J4WH 5FHBL 3ARBA 1KIQB 1F2XK 1T1XB 4PFEA 1LILA 1F45A 5FO9A 1IEHA 3QFJD 1Z9MA 4EKXA 2OZ4H 3DX8A 2CKNA 3L5WA 4IBLT 1S9YA 5T1MB 4PGEA 3DGCR 1P4BH 5CS7A 3GBNH 3KVQA 4YPJA 3EHBD 4JEGB 2BOBA 1E6JH 1T1ZB 2E7CA 2ZNWA 3L7FB 5MI0B 4F7EB 4JN2A 4RGMB 1H8SA 3TCLB 5A43C 3NCYP 3OG6B 3DXAB 3HZKA 4XNMA 3GJFA 4DKEH 1IEBB 3C8KB 5DMKA 2HJKB 1YNLH 3CFCH 2GTWB 3SE4A 5KSVA 2XICA 4PBWD 1B6UA 3HN3A 3QAZC 3QIWB 1VFOA 1W2KT 3BWUC 5DI8B 4J3WA 5EZOL 5E94A 1JZ7A 3D48R 1WZ1H 5KBNC 4K9EL 2DYPA 1TJGL 1FNLA 3T3ME 3RWDB 1F58L 3VU2A 1T1YB 1QRNE 1QACA 3ARDC 2V6HA 2JJSC 3MCLH 4PJ7A 4XAKE 4Y4HB 2Y06H 4YHOH 1YEFL 1SY6L 3F7VB 1CE1H 2FO4B 4FMFA 3VFRB 3OB0K 5IOPB 4JO3L 5I1HL 3IVKB 1JHLH 4I18A 1ETZA 3REVA 1ZVHA 2J6EL 4L3CA 5HHQB 1QR4A 3ULVF 5JA9A 2VZ3A 4D9RE 3D25B 4ZUSB 3G5YB 2X6MA 3VFSB 2XRAH 4Y5VB 3G5XB 5BW7A 1IAOB 1BAFH 2XQBL 2ZKHL 1RIVH 4OCSL 2NNAA 3PDOB 4G6AC 2JJWA 3RNKA 2BFVH 5E70A 4L8CB 3BD4A 1T0MA 2QR0B 4G42A 3QI9A 1BMGA 3HE7D 1INDH 1KCUL 1WGOA 5T33H 2BJML 3QA3B 2GITA 1NGQL 3BSZL 4JHAL 4YDIH 4Z8FH 4G7YH 3ZL4H 2WLZA 3MGTB 5GS3A 5C0DA 4WWKD 2VLKA 1QFWL 4PG2C 1JPSL 3IFOB 4L9LC 4JKKA 3WUWB 3MYJA 4LSTH 4N5ED 3H0TA 3HUJE 1MWAH 4MQTB 5D5MF 2UWEF 4HG4J 1G0DA 3SKMB 2HLAB 4XCYB 2IEPA 1NBVL 4V1DD 4JRXD 4WCYL 2PYFB 3EJZC 1KCRL 3U0WL 5T3ZE 4ZXBB 3ZKMC 3CAFA 5ACZB 4OUUB 5TQ2H 2ARJQ 3EYFA 3PGFH 4GXVH 1M05B 2CXKA 5C0AA 3ULUC 2XWJB 1FFRA 4PJ9D 3TGXA 1PBYA 5FCUH 4HIHA 4IJ3B 4LPYA 4MCZB 1K4DA 3GJEB 4FP8L 3QIUA 3V8CA 2FZ3A 1C16A 2YD2A 2HFFB 5ENWA 4AENA 3VGAC 2X09A 3OZ9H 3MRBB 5E5MA 3B5HA 2YD6A 1XGPB 4JFFB 1CK0L 4NQTA 3ARPA 4XNZC 4XPAH 4KJYA 4LU5H 1V3MA 3HAEG 5I73C 3NGBB 3QFDA 3QUMA 4KV5E 1U3HC 3FONB 5C3TA 3PWLB 3BKJH 2X4NA 5FA3B 3S98A 1AH1A 1B90A 2WMPA 5CCKL 5I1LA 5BO1H 1BVKB 5IB4B 4L4VB 1PY9A 1Q94B 3IRZA 1E4KC 4G80B 5I1EL 4XNQB 4KUCF 4OF8A 2F54B 3BKCL 1OWRM 4HG4K 1A21A 1FYTD 2QBWA 3MRQB 1JMXA 4O2EB 2Q7YA 5FGBC 1VKXB 1UACL 5DJCA 3M17A 5E4IA 4F9PC 4OQTH 2FWOB 2WUCL 4J1UA 4OZFA 1A1NA 4Y1AA 1FVEB 1YMMA 3LDBB 4MNQA 1QHOA 3I75B 2P24A 4XPFL 4ZUVB 3P77A 2C1PB 2YBRA 4FQJL 2NTFB 4NO2A 3QRGH 5I8EB 3L5XL 5GZNC 4NKIL 4E0RB 4JQIL 2Q8BH 3TIEA 1U8HB 2Q86A 5HVHC 4GG8B 2P5ED 1DQQB 3MRFA 1L0XA 4LGPB 5JHDD 5HPMA 3T8XA 1HSBA 2VDRH 4P49A 3ET9F 3T4AB 5T1LD 2PTTA 1GCFA 2X4UB 2CO7B 3LH2H 5B8CB 3FB8A 4Y4KD 3IXTA 2YPLD 1LO0L 3BEWB 1A7NL 3QJHB 5LGKA 4OGAD 1H15B 2ZCHH 2JK5B 4J6RH 4QOKE 3VFUA 3OHXB 2G5BA 1A14L 1T03H 4HBCH 1IGMH 3D0LB 2BVQA 2D7QA 2VDLL 5KSUA 4K8RL 1KLUA 5CHNA 2QQNH 5E0QA 5L2KE 1AO7E 5KOVC 1TITA 3EOYG 1LWRA 5EU6D 3TVMB 3HZMB 3NIGF 3QIBA 3NPSB 3OXSA 2R56H 2OL3A 4YE4H 2GY7B 4IRJB 4X4ZA 3HPJB 3WLBB 5KVGH 1HHIA 4M03A 3ZSTA 2KQNA 3VFMB 4L5FH 1K4DB 3BKMH 4D0BB 5BV7B 5DDHA 4Z5RB 2ZOKB 5ELIA 1Y6KR 3JUYA 4M7KL 4JFXB 1QBBA 2P48B 3P0VL 4TUKL 3SKOA 4ZQKA 3OPZH 1LK2A 4U1NA 3LPGA 4TTDC 1BJ1J 3B6SB 3BPLB 3PGCB 2H8PB 4HKXB 1DSFH 2VABB 4G6AD 2NY1C 3PWPD 1I9JL 5EU3A 1XGTB 5I1LB 4Y5XA 1NCAL 1OL0A 4HLZG 3PUCA 5HYQA 3KLHD 5TE4H 3MLTB 5E8OA 1CGSL 3V0WL 5JXEA 3RWGB 2BCKA 5ITBL 3HPLB 2YWZA 3ZHKA 4U6YA 2JCCB 1U8PA 3ULVH 1PQZA 4B7LA 2XA8H 3FQXA 4JRWA 2OK0L 1J88A 2NQCA 1SJEB 3L5JA 4GW5A 4XC3L 1IGJA 1ES0B 4X6BA 4PUBH 5ADOL 4PG9B 4FZ8H 5F1SA 1I1AC 3PP3H 4N90D 2BSRA 2CIKB 2HH0H 2R0ZH 3MV8A 5KW9H 1CL7H 4LSVH 3EJZD 5EUOE 3D87B 4I0PC 3ZKMD 3CH1A 3EDJA 2V7NB 2J88L 1RJCA 4HV8A 3RGHA 2RQ8A 2HTKC 1B4JH 3HA0A 2NY0B 4NO2B 5IB1B 3ESVF 2F5BH 4KVNH 4LCWA 2B5IC 5HHNB 1HINL 5FYLD 2FYYA 2ZNXA 4OCRL 3O81A 4LCIH 3LSOB 2A9NL 1FNSL 4X4YA 1DBAH 5HPMB 3ZT5A 4CW1B 4CAGA 1N5AB 1Q38A 2HT2D 1NFIB 3HAEH 1J1XL 4XBEH 3NA9L 4QRSA 5HY9A 3CX2A 3P9LB 5DS8A 5D7SL 5HDOA 1U3HD 3ARGB 4O5LH 4YO0A 3QQ3B 1W72H 5IVXB 4JE4B 4JZNB 1QFOA 5GGUB 2XFXB 4PRPE 4XMKH 5FKAB 1BREA 4KWUA 5KSBB 4QY8A 3BN9C 3ECBB 5FDWB 5JW3H 1AGFB 5C3LD 1U3ZA 1G1YA 3TA3B 4HXAL 4ORGA 3STLB 2YXMA 2VZUA 4N0UB 4CJ0A 2W0LA 3WIHA 1ZT4A 2IADA 2C3WA 4IDLA 5EWIL 2QSCL 2Q8AH 1K85A 3F6IA 5F9OH 4RWYL 4J4PC 1XR8A 2JIXB 4XBGA 5F9WB 2ZCKL 4EOWH 3RI5K 4NQCA 3NIFE 4JKPL 1ZS8A 4HH8A 4EN3B 5A16B 5CIPH 4WUUB 5E5RB 4HFUH 3TNMA 2Q3AA 4DGVH 5EU7C 3VRIB 3CFJA 4G9FD 4XP6L 1CD1B 3IKKA 1MY7A 2PYEE 5D1XA 1S3KL 5GZND 2E5EA 5ALBL 2DQCH 3I2CH 1YEEH 4K3DL 4CJ1A 4YPGA 1XR9A 1QSFD 1A6WL 3V6OA 4UV4H 5J12B 3SDDC 1UCTA 4CNIB 1JNLH 2DQTH 5L9DH 3L3HA 3SDCA 3CZJA 4U05A 4EI5B 4PJEB 4P2RE 1UQSA 1NCWL 1PG7H 3GHBH 2D7OA 5JMRA 2DLTA 4POUB 5I18H 4OCLC 1SJHB 1R5IA 1U42A 2HKHH 1EDQA 4HIXL 2Z8VC 4X0KA 3EGSA 3RAJL 3HB3C 1CE6A 2W9DH 4ODTH 1QOKA 4Q97A 5GGQH 1EZVY 2X4TA 1ZLSH 1E27A 1X9QA 2X9YA 3KHOA 3MV7A 4DN4L 3SO3B 1KYOJ 3VFPB 1O0VA 2X4PB 2UZIH 3BJ91 3NFSL 3CGTA 1H5BC 4ISVA 5DJ0A 1JK8B 4LSPL 5GGTH 5J1AA 3RZCC 1YECL 4MXWL 1SEQL 3IAPA 4I77L 4XMPH 3QEQE 1DQDL 1FC2D 4XX1G 3ZKND 5IROA 4PB0L 1FFOB 3O2VH 2FD6L 3D69A 4TTDD 1PFCA 3GSOB 4LARH 3HMXA 1LEGA 3KYAA 5DHVB 3V95A 4PV8A 4ODSL 2NY1D 4HLZH 5BOZG 1NL0H 4H1LH 4DAGL 3P0YL 1EFQA 4UOW1 3S4SB 3QQ4B 2A6DB 1D7FA 1MNUL 2CIIA 2D0FA 4K94C 3IJHA 3FCTB 2DS4A 2J8HA 5IB2A 3HAEB 3FN0H 4N1EA 2B0SL 5D5MB 2UWEB 4OQ1A 3VWJA 1QBLL 1WIUA 5TF0A 4KK5D 5IGXL 1P7KB 1ZHNA 5K9QI 4HJGA 4XH2A 4TULL 4U7SA 2DWEB 3F5WA 1P9MC 5DZOA 1YDPA 5LGHH 1I1AD 1CIDA 3EBAA 4HK0A 3RDTA 4MX7B 2QQLH 3IGAA 3A67H 1NGYA 5IHBA 1JN6B 1OQXA 4LCYA 4I0PD 3W11C 3MC0A 1QO3B 3DX6B 1RVFH 1A7OH 1D5IH 3CFJB 1S8DA 4F7MA 5J6GA 5MI0C 1MCIA 3B83A 2XZCL 4RGMC 2B4CC 1YYMH 4AH2B 5F7LB 2A6JB 1TXKA 4HUUA 5CSGA 3QIWC 2IFFL 4P59H 4HIJA 1IAIM 3O3DA 3DVNB 3P30L 1GOGA 4LASL 2XY1A 2H1PL 5GGRA 3LEXB 1DQJB 1LMKA 1KELH 1OAQH 3VWKA 1DUZA 3BN9D 4Y4HC 4Z0BH 4ODHH 1EERB 5C08E 4DKAA 2DDQH 1G7MB 4ZFGH 3C9NA 3BH9A 1JYNA 1TLKA 3QEUA 3CXDL 3UJJL 2R69L 1A6AA 1NFDE 1SEBA 4HHAB 3MRNB 4Q9QL 3PV6A 1CD9B 3KPRE 1MJJA 3O6KH 5EOTB 2ESVA 1AHWC 2NPLX 1SYVA 4NN7B 2JJTC 3NBNA 3BKYH 4RRPA 4J4PD 5ESAA 1VEMA 1KPRA 4K8RD 5DURB 5C07B 43CAB 5F9JA 1RZIB 4Y5VC 5E6IA 1AC6A 3F58L 4GQ9L 2AERT 2R4SL 3UDWA 1XGUA 1Y0LA 2AVGA 4HPYH 2VC2L 1OGAD 1YEFH 5C0RH 5DK2B 1JPGA 2VH5L 4N0RA 1JJUA 4J23A 1Q9OB 3QFJE 3SGDH 4YBHA 1CTOA 4MQ7A 1AXTH 1UCBL 4HUKB 3TBWA 3GM0A 4X6DF 4PJ5E 4MJIA 1P84J 1QNZH 2R8SL 5IBTL 3NN8A 3PDGA 1KJ2A 3JV4A 5KN5B 3VFOA 2ZPKH 1CFQB 3QO0A 4BJLA 5IWLC 1LEIB 1QUNA 3ESUF 1CGVA 5SWZD 3I6KA 3O3BA 3IFLL 1U58A 1A7QH 1KN4H 4UOW0 3WMSA 2ZKHH 4ZFZB 5DJXA 1MI5D 3VA2C 3UJIL 2IPUK 4E41D 3E3QC 2HJLA 1A8JH 2K1MA 3F8UB 4GRLA 2JB6B 5BV7L 4H1LB 4ZXBC 1C5BL 4D94A 1D5XA 3PL6A 3V6FA 4MDIA 2UY6A 4JFOB 2F74B 3V0VB 1NGQH 1WFNA 3LIZH 5IFAH 3BSZH 2APFA 4L3EB 4Q9BA 1V3KA 1MCBA 2OCFD 2B39A 4JO4H 5EZJB 5L0QB 2WK2A 4PRHD 4IJ3C 4GSDL 3AMKA 4UB0L 1IKNC 4NT6B 5D1QA 1OM3H 3OB8A 4FXKA 1WBZB 4RAVB 4JKMA 3D5OF 1T83C 3HLAA 5D72L 4Z7VE 4UIMA 2YKLL 3H42L 3MRIB 5F89A 4LAQH 3NGBC 1D6VL 3G08B 2HFTA 3B2VH 1S9WB 3LVEA 4PJXE 4Y0GA 2VDNH 1QFWM 1ZE3C 2XA3A 4P4KD 1MFAH 2ZSWA 1MHCA 4WI9A 3WDIA 2F53A 1WWBX 3QUYA 2ED9A 3U0PB 4PRID 4L1DA 1T7YA 4LVNB 1K6QH 4OGXH 3GRWH 4L4TA 1WFOA 3DIFA 1T7ZA 4RA3A 2X1PA 1OAUH 2X40A 5ILTL 4O9HH 5JQHC 1JUFA 5IFHL 3CSPA 4F58L 4FQ2H 2EDNA 5BRZE 1RPQA 4NFCA 3RWIB 3LDBC 4YLQT 3MACL 3Q6GH 3MNWA 3BH8B 1J9CT 3EYQD 4R97B 1NEZG 4KKCD 2PTVA 1W0VA 2O5ZH 2XKSA 4K7PH 3GUTB 5C0GA 4JO1H 3NZ8B 4P2OB 4YHZH 1S7WA 4NUJA 5J56B 5F9AC 3D9AH 3AS0A 3W11D 5K9KA 2C4XA 3B3IB 1D5ZA 4GKSB 4ZUTB 3RWEB 3RHWF 3GHEH 2Y72A 2EDJA 1AQKL 3U7YL 2ICCA 1FIGH 1F4YL 2FX8L 4EDWH 4YDJB 5GXBB 2A74A 4A6YH 3DXAD 4R0LB 1OAYL 5B8CC 4DCQB 3DV4A 3GMNA 4LSSH 5HVFB 3QIWD 3U4EA 1HCVA 4U2ZA 3BP5A 5AEAA 5DJAB 4G7VH 2OTWB 4HULB 4C58B 2OL3L 4U1SB 2X7LA 3HG1D 1CICA 1OAXL 2OP4L 4HZLA 5EZIH 2BNRB 5KS9F 3DJ9A 3EO0B 4Y4HD 2VLRA 4NQEA 3QUKA 4BM7A 3TVMC 4X7TB 3NPSC 1DR9A 3ZTNH 5DJZB 3LV3B 3CDYA 2ICES 1BP3B 4IRJC 3KNBA 2OM5A 1DBMH 4LRNL 4HJJH 1XCQB 5BV7C 4HS3A 2FIKB 3T08A 4Q0XL 4XP4L 3C08L 2LU3A 4CADB 4IOFC 5IEHA 1XIWA 2XTLA 4QT5A 5E2VL 2GJ6E 5FIEA 1QSEB 4S1QL 1T3FA 3BPLC 1JWUB 2WBJA 5I0ZA 1FQ9C 5F89B 1LGVA 3BUYB 5GSRB 1I9EA 5CJBA 1JNNL 1HYSD 4X5XB 2CR6A 2FDBP 2BNQA 5IMMB 1JI2A 3QDGA 1NBYA 2P5EE 3WD5L 4MGXA 1IGTA 1OD9A 5JHDE 4PP1C 3MBEA 4FS0A 2ITDB 4QHLA 4RZCA 4HWBL 4WGVB 3GSRA 4GAYA 4PD4J 4GAGH 4OI9A 4P5TA 1ZLUK 2FHCA 1MRFH 4M62L 4MJ2A 4ZFFB 4ONHB 2YPLE 1SBSH 1GZPB 2HWZH 2FX7L 2FL5A 4UV7L 3C09B 1I9JH 1I7UB 1KTKE 3UTPD 4KRPB 4ZXBD 2RFXB 3MLZL 3QUZD 3FT3A 5C0CD 1U8OB 4WHDA 1G9EA 2EDYA 2NY0C 4JG1H 3NCJH 4Y5YA 4Z7UE 3F7QA 1I8KB 5T1DH 2DQJH 5BZDA 1KJVB 3UX9B 1BFTA 2V5SA 4M4RA 3S3SA 4JFFD 3VXSA 3M1BB 4WW1A 3BAEL 1M71B 2A74B 1MVUA 2C7UB 4WHCA 4GMTL 3ARGC 1WF5A 1U92A 5H2BA 1I3RA 1IAKA 4XWOC 1KB5H 3V5DA 1I8MB 3MJ7A 4NQXB 2DQHH 4D0DA 1AIFA 4UT7H 4PD4K 5C86A 3U4BH 1JYVA 3TZVB 2CGRL 1EJOH 2VXUL 3PWPE 2DYPD 3TA3C 1BFOA 4ZD3H 4OCRH 3A6BL 1WAAF 1WEJH 4A6YB 1BHGA 2F54D 2DQDH 2EH8L 1IGCL 1F3DH 3UO1H 4M61B 4NJAH 1HKLL 2BVOB 3LKPB 1D9KB 5HBBA 1QYGH 2GSGA 3E2HB 3O41B 3WE6A 5F9WC 1FL5A 3BDYL 4NO0A 2ZUYA 1J7VR 4EN3C 3ZDXE 2J12B 2H6PB 3B9VA 2ZCLH 5HSFA 3JVGA 2KPNA 1KN2H 1JI1A 4OD2B 2ZUSA 4X9GA 4LBEB 4JGUA 1W8NA 4N90E 2DMBA 1GZQB 5I16A 4ZMAT 4LSDA 5FO8B 5IEHB 3EFFA 3WXWL 1A7PL 1IFHH 5CSZA 1E4XI 1Y18B 4TQEH 5DRNB 3DO7A 5J12C 1HNGA 4EQ2A 4YHIA 4JKPH 5TE7H 3CUPA 3DRTB 3MRJB 5D2NB 3MOAH 5FYLE 3X3FH 2D9CA 1PLGH 3Q5TA 4GAJH 4HD9A 1AGCA 4W6WB 3BT2L 1JZ5A 4PTTB 1NMAL 3B8YA 4R6UA 2ZUVA 4EI5C 4JDTL 2IH1B 5J11B 3IRPX 3KAAA 3CMGA 4HMEA 4FQCL 5ALBH 3GMLB 3TJHC 5DEGB 3UYRL 1DLFH 3VJ6B 2AABL 4OBRA 4FQLH 4DTGL 1DBKL 4WV1B 3ULVC 5HHME 1H3UA 3TVMD 4YBLB 4MA7L 4NZTH 5KSAB 2XTJB 4XNYH 5FYJH 3OKNA 4IRJD 4PJDE 2FJFA 4YXKH 3BXNA 1BFVH 1WT5A 4ZNEA 3DURA 5EPMA 3T0AA 3QIUD 3UBXA 3D2UA 4FFWC 5T1KA 4JZJB 3MZGB 5GGSA 4GT7A 5TDPA 2E8ZA 5CJ5A 4X6DB 1JF1A 2NY3D 4KKBC 3CSYA 1ZA3A 4APQB 5IMLA 2HVJB 4G9FE 1DCLA 1P7QB 2MQ3A 2QHRL 2VR4A 5ESVB 1U3YA 3U9PH 2ARJA 1FE8L 3WDHA 4POYA 4IOIB 4PB9L 4NIKB 2NY7H 1HQRA 3OJVC 1MAMH 5EA0L 3V2AR 1ZLWK 3H9HB 1FLTX 1X4ZA 4LSQH 4M7LL 3QXAB 3CFKA 2WIMA 2XXMB 3VI4E 3SJVA 4LQFL 2HRPL 4OJFL 2LFGA 4PRNB 4TRPH 4C57C 4XGZA 3C6LB 4KDTA 1YQVL 1OTTC 2PO6A 4HKBA 1C5DA 1BQLH 3MXVL 1GOFA 4GG6E 4OZFG 3PHQB 3QCVL 1BJMA 3QDJE 3CVIL 1JPTH 4H26B 1Z3GL 2NY0D 1BOGA 1UH4A 2WQRA 5E8EA 4KQ4H 2UUDK 2LVEA 4R4BA 1DBBL 1L0YA 3O0RH 5J9PA 2PETA 1C1EL 3ZE0F 1S7SB 5DYOB 3FFCE 4OF3A 3C2SA 1DN0B 12E8L 1KCSH 3DX7A 4I3SL 3UJTL 4PJHE 4XX1E 4P23A 2W59A 4U1MA 5HI3C 3ARGD 4QHMA 2AJVL 3FB5B 1N4XL 2BRRL 4Z0XB 5GRZA 4OZIF 3O9WB 1UWXH 1MF2L 4RFOH 1AFVH 4CMMA 5CWSA 2IMNA 1UWGL 4ZSOA 2OTUB 4Z78B 3VGHA 3TA3D 2IH3A 1A6UH 4TOYL 3EFDH 2GCYB 5BOPA 4PTUA 2FNBA 4IRZL 4B0MM 1G0YR 3MV9A 4NN7C 3WJLC 2IFFH 4K2UL 2JIXD 4Y16A 1I9IL 3MLSH 1FC1A 4MA1B 3NCFB 1HHJB 1PW3A 2FJFB 4EN3D 3GMPA 3ARVA 3EOTL 3U7AA 3FQRA 3L3DB 3LEVL 2YPVH 4WUUD 1UKQA 5BS0A 5HYSB 5IUSA 2CDGA 1UKSA 4JFQA 1YUHB 4MJ5B 4KTEL 2H2SC 2HVKB 4QCIA 4ZS7H 3B9KB 1TCRB 3L5HA 3LS5L 4TNVK 4ZO6A 2WSKA 3DSFH 3MNVB 4X98A 5FGRA 2PR4H