1EZUA

Ecotin y69f, d70p bound to d102n trypsin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
140
structure length
140
Chain Sequence
SVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGFPYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Compromise and accommodation in ecotin, a dimeric macromolecular inhibitor of serine proteases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/inhibitor
molecule keywords ECOTIN
total genus 18
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ezuA00
1IFGA 1EZUA 1XXDC 1N8OE 1P0SE 1SLWA 1FI8C 1ECYA 1SLXA 2Y6TE 4IW4C 1SLVA 1XXFC 4NIYE 1AZZC 1XX9C 1ECZA 1SLUA 1ID5I 1EZSA
chains in the Genus database with same CATH superfamily
2DMHA 3RIFF 3ZL4L 2V6HA 2FWOB 4FQIL 3BEWA 4FOMA 3CFIC 4X6DB 2J8OA 2VJ8A 4ALAH 2Q6WB 5F7YC 5CKAA 3L9RA 4XPHH 1N18A 3I02B 1LDPL 3AXHA 3FU9A 3NJNA 1PIFA 1T4KA 3D39A 3II3A 4DGWC 1EEZA 1NGZA 4R6UA 2QQKL 3T6ZA 2ZYHA 3N1FC 5HI5D 5F1IA 2UY6A 1G7QA 3ARYA 3BH8A 5B1CA 2C1OA 2NY6C 1JHLL 3Q06A 3W1ZA 4W6XB 4Z7OE 1RUKH 3K46A 2N01B 2FQFA 1S78C 2X4QA 3GMLA 1TUPA 1X5AA 3S6CA 5AFAA 5HP5A 4M02A 3OR7B 3C60B 4GQZA 2D2OA 1SLVA 3LKSB 4IKLA 2VAAB 3MSPA 4OZIA 5JMOC 4HZLB 2J25A 1EFXD 2AK1H 1YZZA 2LE9A 5IJCC 3ULVL 3T8MA 1R3JA 1Z9OA 4NWUL 1Q9KA 4MQ7A 3FRUB 2QFRA 1SXSA 2RACA 1JG9A 1U3NA 4AJYV 3C60D 2VSCA 2BVQB 3HC3H 4WI9A 4N8CH 3U2SB 3SDAC 4FYRA 4H26B 1BEYH 2GC7C 4KTEH 5IFHL 1E9QB 1LO0H 3WGVB 1ZHNA 1YPZF 4M1CC 1EERB 3NESA 4KH2A 3RFRA 3SQBA 5CZXC 2OL3A 1B0GA 1SEBB 2CIIB 3BKCL 2OMZA 2IAMD 3NPSC 4HW6A 15C8L 3L1OL 4LEOA 2Q87A 2V2XB 2W92A 3L4VA 5GZOD 1OARL 1AHKA 1M7IB 2YBGA 4I88A 4PJEF 5KOMC 4KI1A 2CSPA 1UZ6E 3EHBB 4PJIF 4JDEA 2ITEA 5JIKA 3LNDA 4HX1A 3MZTA 2WIIA 3M17B 2H32B 4U1HA 1AGBB 3OXSB 4H1LA 2UY7A 2XWJA 3FB6B 4JFPA 5HGDB 3OHXB 2CBQA 5ICZB 4R26L 2HRPH 4FDWA 2P5EB 3D34A 4XP4H 4XN9A 1SF3A 3GZOA 3KGSA 3PPEA 3UBXB 1S6NA 4BWUA 1AIZA 4J6IA 4HUMB 4JGUA 1P4IL 1AIFA 3PJSA 4TPRL 2DD8H 2VMJA 4WO4D 1HHGA 1X7QB 1D9KD 2CJUH 4JG0L 4PVMA 2TRHA 2ZOLA 3AACA 4HEPA 1NGPL 1OGAD 3V0GA 5B38B 1CD1A 1KTCA 2ZCHH 1DQDL 3GDBA 3ZY7A 5HDWA 4URKA 3OJDA 1RK1B 3DK2A 3HN8A 2WQUA 4OKVA 3MLXL 5CSBA 3L4UA 4FQLL 2M26A 3L2LA 2Z31D 5IY5B 3NYKA 3L54A 2FTAA 1TLKA 3GWJA 4MXWL 4YO0A 2E59A 1O9VA 2HB0A 2NY4B 3L3GA 4MBRA 3MCKB 4BH8B 2FHBA 4U33A 4YHPA 4KMTL 3B2MA 3STZB 4PCKA 5I71B 3L2NA 2PYEB 2NY2B 2X09A 2LQRA 1MFAH 4HEME 3FJTA 4C83B 1DHKA 5AYQA 2AJYH 1XCXA 2GJZA 4G8EA 3R0NA 3S88L 3WKPA 1GMEA 1BP3B 5K9OB 2CO7A 4H0IA 1QBML 5IFAL 5CCJA 5FOBB 1TQBC 3HE7C 4OIBA 4JFXB 3R7RA 3CBKB 3PLYA 1HILA 3KL3A 4FD0A 2Q5BA 2IANE 3ZMEA 2OJZH 4RAUA 5C0EA 5IMOB 4G9DA 5J4MA 5IV2B 4MNQD 1SHXA 3W0WE 4KHXL 1IZJA 2E7MA 2N1TE 2YPLD 3NJXA 3VFWB 4UT9L 3O4LE 3OR7A 4PS4L 3MPCA 1OPGH 1IGMH 3IFOB 2NZ9D 3KD4A 5JHLL 3IS0X 1UVQA 4URTB 2GITA 5IGXH 1A8ZA 3LB6C 1MCRA 4A63A 3FTSA 3LAFA 2NR6A 5ADOH 3NJJA 1XTLA 3KVDD 43C9A 4BKSC 2D31B 5JOEA 4O02H 5JW3H 3BAEH 3EGSB 3HS0B 3TZVA 4A6YH 2D4FA 4IRJD 1XZ0B 5JR1H 5BXFA 3JVFC 5IJDC 4JG5A 3FFCE 3PQYE 4W9GC 5D8JH 4PWGA 2MQCA 4WJKB 3VM5A 3WU1A 5CFHA 3BEVA 1NCUA 3QWOA 4J8RA 2FSDA 4HD5A 5TE4L 4XB8A 1JFQH 5JUEL 4FXGA 1IAKA 4E9WA 1CGSH 4NP4H 1J8KA 5E2UL 4HP5A 4Z3TA 4DGVH 1ZXQA 4KKCC 1CWVA 3FB7A 4R96A 4Z7NE 2EYRA 3U46A 4MMXA 3MLUL 3IWUA 5PCYA 2ICWB 1JFQL 2XWBB 4OBSA 5JUEH 5HY9A 3IJSB 3T0BA 3HC2A 5B21A 5DEFB 5C0JA 1G7IB 1B2YA 2APBA 3FB6A 2WBJC 4WHCA 3TIEB 5KVEE 3EUUA 3NBNA 2XBTA 2GABA 4MTMA 4ECNA 3LH2L 4LHJB 1A7QL 5D2LA 1DTUA 3U9UA 4NJAL 2VWEE 2IDQA 3GYRA 1I8UA 4JS7A 1RAMA 1KJ3L 1RZ8B 1UM5H 3KPNB 4EEEA 3QUYD 2PP8A 2A6DB 4JO1H 3N1MC 2YBRA 1TENA 3C87A 1MVUB 3Q8FA 3TYFB 3L1GA 4X4YA 5HYSA 5IGXL 1MW3A 3OMZA 4A68A 4RFOL 1TKWA 2I26N 3LPGA 4NRYA 5AZUA 4Y2OB 2A77H 2MOVA 2WTRB 4OFIA 5I5RA 5LGHH 1BG1A 5F6IC 1UM4H 1W72L 5FFOA 5JO5B 3C8DA 3CVHB 3HUJA 4CVUA 2WNWA 1OZTG 4I9WE 1BBJA 4XH2B 5GRXG 3DJZA 5B3SB 2CPCA 3GM0A 3H3KA 3GXMA 2H2PC 4GRMA 1LDSA 5GGRB 2LABA 2JJUA 2ED9A 1FL6A 2Z35A 1K85A 1GZPB 3M46A 1Y18A 2Q6WA 4EIUA 3Q3GB 1T89C 5IB4B 3AMKA 3P77B 4M48H 3QEHA 4JY4A 4IKKA 4QRUB 1F3JB 1XF1A 4NJ9L 1OE3A 3EFOA 4XAKD 5F6IB 1N8ZB 2VZVA 3TC9A 2ADJB 4TTDC 4LIQL 2AEWA 1IEHA 3A6CL 1KB3A 5C09E 5DEGA 5EUKB 1KYDA 5JYMA 4UV7L 1OSPH 3SBPA 1ETB1 1G7MA 1QI3A 3VFTA 1ND0B 1RJYA 4GS7B 4E9TA 1RPKA 1SHSA 3ARXA 4LPCA 1QLEB 4OIFA 2D7MA 5DMGC 1OAQH 2DKMA 4GLRH 4HC1L 1DSFH 3VWJC 1FO0B 5B7FA 2I7OA 3POCA 4PY8I 5LN8A 3CHOA 1UEMA 3HKFA 5IB2B 4QYAA 3KYOB 3X1GA 4CVXB 1KFAL 1HE7A 5CMAB 2EUWA 1ZVSA 2BW4A 1L7IL 5GS3A 1LNUB 4FFVC 2JCCB 1EZVX 4DP1X 4ZS7L 4F8PA 2A4CA 4NKOB 2ICEC 3RNQB 2V5SA 2OR9L 5F7UA 1KBGH 4LSUL 1MW2A 2A2QT 2P46B 3PGFH 1JGDA 1UH2A 4LOEA 4LLVB 1ZY9A 6PCYA 3K2MC 1SOQA 3ATBA 3ZIMA 3CUPB 5F0LB 4JHAL 4YQXL 3FRPB 4IHOB 3LNGA 4KY2A 1A7NL 3RKDC 2YPLE 1JXGA 1SN0A 1FE8L 2X88A 2VDLH 1FYHB 4ZS6C 4PJFB 2FEJA 1G1CA 4OH2A 4PQXA 3QAZC 3FTYA 3ZTEA 2BSEA 2VOTA 4IDJL 4D9QD 1ZWIA 4Q74A 3GHBH 4Y89A 2P48B 2VDMH 5KVGL 3A4DA 1ULVA 1NPUA 3F6IA 4KVCL 3FQXB 2H32H 1JK8A 1LWJA 5AALA 2WQSA 4U0RB 2H32A 4U1HB 4PV9B 4BH7B 4RAHA 3GNMH 2PCXA 4FTVB 5H37H 3DV4B 4GRWE 1KELH 4YHYC 3IBEA 2I27N 3OHXA 2BS8A 3TF4A 1NMCB 1NFKA 4KRPD 1VERA 2WGXA 5EIIG 5IMLB 2ENSA 3ESUF 2YD1A 4M7LT 1HIMH 3I6KB 3T0XA 1NFIB 2G5BA 3VVWA 3K6FA 3VA2C 4TXVB 5C08E 4ZW5A 1BPLB 4I5BA 3IE9A 4RISH 1GJIA 3TH3T 2DQTH 4HWEH 1BLNB 1WWAX 3L3HB 1G4MA 2YLKA 3U9PL 5BQ7B 3CXDH 1MHPH 3APNA 1GYVA 4XP9H 2OJEA 2HTKC 3PU7A 4KVNH 3QQ9C 3QSKB 1FVCA 4RAVB 3RA7H 3HG3A 4XT1C 4P2RD 3H85A 3ZBMA 2ZICA 4F58L 4FYSA 3HE6B 3V6OC 4MMYA 3TXAA 1F00I 5I1LA 3TEWA 1ES0A 3QUKB 1Z7JA 5FM5M 5GRJH 1L4IA 4DUXA 3MCLH 3RFZA 3QWRD 1DLHA 4HZLA 1FN4A 3QPXL 5MENE 4E41E 4FE9A 3VG9B 4RGMC 1S78D 3G6DL 2EDTA 3QFDB 3AXLA 1F3JA 3AREC 3IJEB 5FKAB 1IGCL 4PRHD 4WSKA 1E4KA 2NLJB 3L5HA 3L4CA 4ISVB 2WANA 4I8DA 2DJ4A 4QRBA 5DVPA 5L4MA 3RZWA 4OLEA 1BOYA 4H26A 3VWKD 4XHQA 5FCUL 1T1ZB 1QA9B 1ND0A 1RJYB 4JFZH 5B39B 3GMRA 2F53A 3CFKB 4HCRA 1YYML 1CIUA 3UC0H 5D1QD 1S7SA 2AERT 3CPUA 1BGXL 1CU4H 4QTHA 2A0LD 4QHNB 1G6RL 5FWQA 5KVDE 2K7QA 4P23A 1VF5C 2H0JA 3IU3A 3NZHL 4B95C 1QTYT 3MLWH 2R51A 1B4TA 3B37A 3T2NL 1DQLL 4Y8DC 3TBSA 1QACA 3AG2B 4K3DL 5BRZB 4BELD 1CD9B 4N6RB 3R1GL 5D70L 4DGUA 1OE2A 2FLBT 2FL5B 1FNAA 1A6VL 2BNUB 3QDJD 2MQ0A 3RWGA 5FYKL 1KNOA 2Y2TA 1RU9L 5JPNC 2KZ1B 3FT9A 4JEGB 3UFIA 2JCCF 1GS8A 1S7RB 3P4NA 3RDTB 2V8MA 1T6WA 1CB4A 2WMPA 3O6FC 2CUIA 1W72B 1S9VB 1Q9LB 2AJUH 3BUYA 4XNUL 2WAHA 5L9DL 3BP4A 1NZRA 3U4EA 1M05B 4JRYA 2XX1A 2CKBL 1CD0A 1UD4A 2RHEA 4PJIE 1DUYB 4FYQA 4QRAA 5E2TH 1SLUA 3S3SA 4BQ9A 3PWPA 4HIQA 4IRZH 5KVMC 3LKQB 3AQDA 5DHVB 3C6LA 2ICWA 4J4PD 2FX8L 4HAKA 1PY0A 4M7ZC 4C56E 5I19H 1QVOB 4YHML 4XVUD 2BNRB 4AV5A 5IJBC 2C7FA 4BDVB 2JB6A 3FQYA 4JJ5B 4P5MA 3V0WH 2ORBH 1XGQA 1D3CA 2DH2A 2ZXWB 3Q9QA 2D9QB 3SBRA 1E3ZA 3VFMA 1CGTA 3CXHJ 3I3EA 1IC5L 2APXA 3ZDZE 5BV7H 4YPGA 4QRPD 4DCQB 4MJ4A 4OCXH 2IDTA 3V8CA 4HJTA 1Q4NX 4B53A 1C5DB 4Z77A 4W81A 2F2HA 2FB4H 1NAMB 2XYCA 3MNVB 3L4ZA 5MI0C 1U3HD 4GQPH 3IFNL 4E0RB 3RP1A 2E9WA 2XA8L 3N41F 2Q8AH 3NIFB 4GRWH 1N10A 1O6SB 4U1KB 3NQIA 4ZQKA 3BFWA 2MCPH 5LXGL 5HGAA 1QHPA 3HS9A 1DQQA 5AB0A 4JVUA 1A7BA 3CHSA 3RL1B 4JW3A 5E6ZA 3UTOA 3GHEH 4GG6F 1UXLA 4O9HH 1OSZA 2N0KA 4LSTL 1MJJB 3GUTA 4DOHE 3G6JF 1QW9A 4D0DB 3O6LL 4MSWB 1BJ8A 2CWRA 1G7IA 1NCAH 1Y18B 3LZNA 4PWEA 1JV2B 1IZKA 1RHHB 1ROWA 4XO9A 4AMKL 2J1YA 2VW6A 1U41A 5GSVA 3JYBA 2AABH 3D9AH 2ETWA 3UADA 3LNIA 4FADA 4NEHB 4OZIE 4S11A 3UZQA 4KWUA 1QFPA 3D3VA 5G2NA 1FZMB 3S4SB 3L81A 4KDWA 2MMXA 3MOBL 1NCAL 4Z3IA 2AW2A 4U1MB 4RZKA 2EIZB 2Z7ZA 4AM0A 1E5CA 1E2VA 4HZAA 3H7BB 4R5VA 3F83A 3KGRA 4A2EA 4CVXA 5AW6B 3D4ZA 5F21B 2QLYA 2JIXD 4MMZA 3QZWB 4PJ5B 4NC2B 4PR5A 3UAJA 1VACA 1YY9D 3K80A 2EDHA 4PI2A 3AGWA 5KTEL 2V9RA 3DGCR 1PKQE 3R18A 4OGXH 2MCPL 4PRDA 5HXMA 3LN5B 2MEJB 1JYNA 3LV3A 4DAGL 2Q8AL 4AZ8A 3N9GL 1CICB 4M9OA 5IK3A 3KE0A 4LLVA 1HI6B 3UAJD 2ZXAA 4WK4B 1E2WA 3QUZC 1CFVL 4K3EH 3SYAA 4BK4A 4DZ8B 5D1QE 3H9SD 4GKSA 5D7LD 4CU6A 1K4DA 3EYFB 4LGSB 3AWFA 2WMPB 1JPEA 2X0WA 4HYTB 4P4KA 3B3IA 5I74B 1TEYA 4TSBL 2WN3A 3KPNA 4ZQTA 2PWEA 2YSSA 3Q5TA 2IPUG 3AS2A 1PLGL 3VI4B 1T2JA 2BXYA 4V2CB 4P9HH 2OZ4L 4CW1A 1D6VL 2ITCB 2J12B 4ANXA 1N5YL 4YHIA 3K6NA 4AQZA 2FX8H 4OI9A 1XT5A 2K7PA 4OZHA 4ZZFA 1WD9A 1NCBH 1ZVSB 5F7EH 3WFDL 3ZDXF 1FL5A 1DE4A 1T21B 3JT2A 5IVZA 1CTNA 3BWSA 2VISA 2QHLA 5E2TL 1TQBB 3HE7B 1GCYA 2K3HA 3P73A 3WLWC 3O9WC 4B9JA 3ZZLA 1MJUH 1LTXA 2GI7A 4FA7B 1WCBB 4FLQA 3A21A 4HIHB 1XSOA 3B5TA 1S7UA 4M7ZB 4B97A 5FLVA 1SYSA 4A39A 3VFSA 2HT2C 3MRIA 5DZPA 3T0VA 2NY2C 3FT0A 1WAPA 4OI7A 1SBBA 1SJHB 3JWOC 1RERA 4CU7A 1E28A 2BJML 4EXKA 1JYXA 2WWOA 2VO8A 3TO2A 4LCIL 5HSFA 2QKIA 3REWB 4DEPB 1D6EA 4Y9FA 4K3DH 1KGYE 2Y07L 5H2BA 1XAUA 5CU9A 4UANA 5CN1A 5EEWA 1HDMB 2N1KA 4O02A 1BVNP 4GY4A 4RMQA 3MGOA 5E7BA 1K8IA 4NPYB 2R0LH 1ZLWK 4EN3C 1J7VR 5T8IA 4BM7A 3HI6L 5BS0A 1WCQA 4JHWL 1CUOA 3LNFA 4OUOA 2OTWB 4ANWA 3MYZA 2VDKH 4JHZA 2P5WA 2UUDK 3LKOB 4PJCF 5JDJA 1QSVA 2GIMA 1OGAE 3SDDA 3DROA 1QAWA 4OJYA 4ZSOB 3VXRE 5CO1A 1XGYH 3O6MH 4J7RA 3I6KA 8CGTA 1E6OH 1PY9A 2G5BB 3PWLB 1UOLA 4AGQA 3KGTA 1PL3A 5DWPA 2H5UA 2VRAA 4GPVA 3F01A 4UINL 5D7IB 3PG2A 2CGRH 4K3JL 2Q7YB 4KXCA 2F54D 4RIRB 1JXDA 3FO1A 4XVSH 4WWPA 4XBGB 2E6PA 3N40F 3HPJB 3PWJB 4NKIL 3QW9A 3WFDH 4K0OA 4NC1E 2I60H 4NZTL 5INCA 3MLYH 1Z9PA 2OMWB 3K2IA 1SJMA 2QQLH 2AQRA 2TAAA 1PZAA 1N19A 1ORQB 2JKTM 3BCDA 3GMMB 3MUY1 1QSZA 4N6RA 4Q0XH 5JXAL 2K6WA 2DYPB 3B5GA 1AO7E 4CKQA 5KS9F 2APWA 4JM2F 3DK0A 1QATA 1IEBB 3U9PH 5C0BA 3WUWA 1KNOB 2J56A 1RIHL 4KO7A 3PAUA 4FQ2H 3WD5H 1TQWA 5CD3A 4OR1A 3TFKD 5GS0C 2Z92A 1N6UA 2Y36L 4JRXE 4P2OD 2DWDB 2V7NB 1BFOA 5ICYB 1LO4L 1QG3A 3M6DA 3QC6X 5TPWH 4JHUA 4TQPA 3SGKA 3HRZC 4CN1A 4O4YL 2AV1A 1NFIA 4ZW7A 1DUYA 3BMWA 4OB5H 1G9MC 2BP0B 3NRPA 4KV5E 4FG4A 5E6IC 1SDAB 2FX7H 1H3VA 3O41B 3BKML 3NJHA 2ATKA 1O6TA 1S9WB 2QJDA 1ZVYA 4JFFE 3PGDA 4JDVB 4AJWA 2OQJB 1HEZA 2YXWA 4HIPA 3VRJB 4QOKA 1YYLL 5AVXB 3FQWB 2VH5H 2ADGB 1IGTB 3SKOB 3TNMB 4L2YA 5C0IB 1AR1B 35C8H 5E9DE 2B2XL 5I8EA 3CGTA 1I7RA 1QRNA 3Q13A 3S98A 4KROD 5CSZB 5EZOL 5FYJU 2UZIL 1WFJA 4KX9A 3GD1C 4QHUB 3D2UB 1J5HA 5HYQB 5DQJB 3IEAA 3IDNA 3QORA 4PCYA 4EUPA 4Q89A 2Z8VC 4K2UL 1KBGL 4LSUH 4DP0X 1ASPA 1Q72L 2ZAGA 1IC4L 3OLDA 1JGLL 2JJSA 1OP3K 4QCIB 1I1AC 2EZ0C 5IMKB 4WZ9A 3WTUA 3L3IB 4OLYH 4WJ5B 2CO4A 2UV3A 5H2BB 3SE3C 3LEXA 3KEHA 4JG1H 1S5HB 4XPTH 3STLA 1GCFA 4IQHA 2UX6A 5FGCB 3SDCC 1TJGL 2HP4A 1LO5B 4XNXH 3O0RH 2AQTA 4AEIH 3GK8L 5CJXC 4FQHB 5C08A 4ZFQA 2K70A 5CIPB 3TOPA 5IQLA 5MENA 1KN4H 1AMXA 3ARPA 3OKKB 2NYYD 3BMVA 3I75B 4PRIA 4F9PC 2D7OA 5HGHB 4EDWL 2DM4A 4KI5D 1YQ2A 3FAXA 3NEOA 4BQCA 1FC2D 4GUQA 4WRLA 3WFEH 1U8OA 4H25B 1F42A 2BFVH 4NQEB 4TL4A 3QUMB 4LIQH 4Y2LA 2XA8H 4LVNB 3ZHDA 4BQ8A 1CYXA 3D3VD 4ETYA 4PJAF 3CD4A 1A6AB 3KJ6L 1T6VN 1GJUA 1AGDB 3FUFA 5ETUA 3RAJH 1LK3H 3WTXA 1HINH 1AZVA 3PP3H 4Z5RB 1AXSB 4ELME 3VG0L 3X3GH 3HZKA 4JRYB 1USQA 2VUKA 4EI5D 4J5VA 4QHKJ 5ECGA 5M95B 3UDWC 2BHFA 2WCPA 3KM2A 2FDBP 1WIPA 2X2HA 3DHMA 1OXYA 3X1BA 1QEXA 1S5IL 1TEFA 3MJGX 4PJBE 2HRHA 2FYVA 1DBKH 3FZUC 1YRKA 1E43A 4U4IA 4Q52A 4NZDA 3GSXA 3IJHB 4AITA 1A3ZA 4HEPG 3OZKA 3B9KA 4OZFG 3E2HB 3U1SH 4XZ4A 4DJMA 4Q9CA 2G75A 1CD8A 4DZ8A 3SE6A 1ID2A 4AK1A 2BNRE 2DWDA 5KS9B 4CILA 4GRWF 4KUCD 4O2CA 1KEGL 5I30H 2CO2A 2PF6A 3QC5X 4ZX6A 2F53D 2E9GA 1AXTH 4Z77B 2AMUA 5L2KD 2ZSVB 4L0ZA 1OOAA 1PNCA 4DN4H 2DL9A 4MNGA 1BQLH 2XBDA 2KZWA 4FZEL 5L7XH 2WBXA 4HIEA 4KQ0A 4HLZH 3F8UB 4RMVA 4J28A 1R3KB 5CBEA 4BUQA 3IMRA 1GA2A 1U2CA 5EZLA 2GW5A 3S3DB 2X6UA 4CMHB 2A73B 5LG1A 3P1VA 1XGPA 1X5KA 3NZHH 2CO6A 4OM1H 3W56A 3TBWB 1F11A 3NUKA 3WAKA 1BGXH 1CU4L 2DLIA 3ILPA 4AMXA 2F7PA 2KERA 4NBYB 3VI3E 5BVPH 3TLRA 2MKWA 5F9DC 4QMEA 4ZXBB 1EDQA 3OKMA 4IBLT 3F7YB 1DJSA 1JZGA 5AWNL 1LE5B 3DX7A 5D8JL 2WUBH 4PGEA 4IOFC 3HZ3A 4JO3L 1WICA 5J9PB 4K8RH 4GXFA 1NA8A 5D7JA 2IPTL 2LT9A 4U6YA 1I7UA 3SD2A 3HMWH 3EFFB 3B3IB 3TN0C 4Z3HA 4QRFA 5I1HH 3VMPA 3G6JE 1FZMA 3S4SA 1BFTA 1CFQB 3K1KC 4TL5A 1B0IA 3DJTA 4X7SL 2CGZA 5BMFL 1KMGA 3DX4A 3AWGA 5C0AA 4AT6B 1Q0YH 3T3ME 1J1PL 3F6JA 3UJJL 2BNQA 1ZLDA 2HRGA 2HWZL 3LTVA 5E94B 1YMHA 4RGOL 4E2OA 1PX4A 2R59A 5AUMB 4D3CH 2ICWJ 4NO3B 1Y0LB 1HXMA 3NP3A 5EU5B 5D6DA 4AIZA 3ULUH 3STBA 3Q8CA 1CFSA 3MOQA 4Z76A 3V0IA 3H8NA 5IFAH 4OZIF 3KWWA 5LGKA 3IDGA 1WCBA 3G5ZB 1BX2B 4EOWH 1NCNA 1PGRB 3FOLB 4PJHB 5F7NC 4CVWA 1RIVL 1DN0B 3D2TA 5CAYB 4JK0D 5BO0D 3W3BA 2X41A 2FWSA 4WI0A 4F2MB 1YUHB 3RURA 1J11A 5F1SA 2BOLA 1AY1H 4TQEH 1KCWA 2BOCA 3T2LA 3TO2B 3GIZL 2ZKXA 3EBGA 5ICUA 2EE2A 1XTMA 2VL5A 1I1FB 4BINA 2VXSL 4P8QA 4TQIA 1DBBH 3O2WL 2L04A 5D2LE 4AV4A 4FQLH 3MLXH 5DRZA 2OMUB 4EIGB 5I24A 2YPVH 5HYSG 5F0JB 3ETSA 1TO5A 1G0DA 3F04A 1PZSA 3F3HA 5C0CB 1M2VA 4PJIA 3ETTA 4ZMTA 1NBVL 3A0OA 3NZ8B 3P54A 5HDLA 2OTWA 1VADB 3WN5A 5TE7L 4F91B 1JF6A 3QCUL 4NN5B 4D9QE 5EZJB 1PY4A 1P4UA 1S3KH 2BMKA 2D31A 3LKNB 3N6YA 4GXUN 5JW4R 3BUPA 3H3PL 2B1HH 2YZ8A 3KDPB 5BV7C 3GMQA 1FFPB 1UD2A 4QOKD 5CP3H 2IPUK 4N0YH 1TTCA 4LLAA 3WKMH 2W94A 5JLZA 4WU5B 2OBGA 3W11D 3O9WD 4RGNB 1NAKH 4WUKH 3C5ZC 3H3PH 4WWKD 3TM6A 3UTTB 4YSCA 2Q76B 2XWTB 3ISWA 3C2AH 2QPDB 1IC0A 2OX5A 5IVXF 3FS9A 4XBEH 3I6SA 4DESA 3ARGB 1CMOA 1DSFL 3MJ7A 1CTOA 1RZ7L 4M62L 1X5JA 1OV8A 3FQNA 4U6XA 3COOA 4IOSD 1KZQA 5D9SB 4LCWD 1A1NA 2VIRA 4L8SB 3RVVD 4UYPA 1Q0XL 3I6LD 2VRKA 4IMLB 4L9DA 5D2LB 1R0AH 1Q90A 2ZNWA 4K9EL 1EVUA 3JZYA 2ZG1A 4F7KA 1KB9K 4RDQF 5EH1A 2E47A 4TSCH 2K0RA 3V0JA 3OLGA 4H8QA 4MZ2A 4XNAA 3RILA 4WFGE 4AT6A 2OP4H 4YSEA 1H9DA 3GKZA 1CF8L 3M1CA 5IREA 2VDOB 3NIGB 4WFFE 1UJTA 4D3CL 5E94A 4L4VB 2XA3A 3I75A 4I1PA 1JHLH 4F8TA 4QTIH 2H9GA 3DDGA 3QYMA 1I31A 3R06A 4NCC1 3LZLA 1KIUB 5TK2A 3SKOA 3H9ZA 1WK0A 3KPSD 2CM5A 1UWYA 2H1XA 4IU2A 4OUUA 2AF2A 4N2AA 1RURL 5DA4A 3RWIA 2E8ZA 5I6NA 3IMUA 5DYOA 3TJEH 3VXSE 3ZDWA 3VGEA 3UTZB 1RFDL 4FQCH 1K3IA 3UROR 3FULA 4KK9D 2K9UA 1SY6L 1T83A 2G30A 4N2EA 3FU5A 4XBPA 5AZEH 5AB1A 2GK0B 3WIIL 2HKHL 3RB7A 1FZOA 4QRUA 4Y19D 4ZODA 4BKLA 5JPNA 1MFEH 4W9DC 2ZQKA 1N6QH 2D03H 5HVHB 3MODL 1G4RA 3ENEA 4H4NA 1UFUA 4LKXA 4Y4FC 5DHEA 4NN7B 5AAMC 2F8IA 2DDQL 3KJ4B 4U3SB 2WXPA 4QAMB 3H4FA 4ADJA 5HGBA 2FYYA 4RLDA 4LCVA 4XWGL 3TA3B 2LAAA 4DGYH 1TJMA 1HZHL 3CZUB 4OFPA 5D1XB 3S3BB 4APQC 4CAGA 4PVBA 3ARFD 2YZ1A 1WYJA 1BW8A 4TNVK 3KYOA 4ZNCD 5JOPD 2CHNA 4N1EA 4DGVL 3M86A 2D3NA 4G6MH 5FO8A 3VWJB 2RCSL 4TLKA 5GGQH 1LNUA 1EXUA 1TT6A 1MCBA 1T5XB 2AJSH 4JFYA 1UWEL 2QSQA 1A9EA 2QVKA 2VKWA 5E8OA 1J0JA 2YPLA 3BKJH 1MCQA 1S9XB 4X8CA 1UKQA 3EGSA 5L2KA 3OV6A 1BQLL 4FZEH 1AR2A 4JQVC 1WZ1H 1A6AA 5JLZB 3QJZA 1RUAH 5IB3B 4X8GA 4JPKH 1IBBA 3CFJB 4P57A 5LBSA 4TVPE 1DDTA 5HHPB 1SEQL 3IDNB 4DN3H 2UZYB 4P2OA 3QI9C 4AE0A 3L95A 4ODWA 4CRPA 5CBEB 2ZP9A 3WSQL 3FO2A 4WF7A 3F5WA 2EDNA 4OTXL 1RFDH 4FQCL 4OM0H 1KEMH 1KXVA 2Z4QB 3E6HA 3QRLA 1RKRA 4AQAB 3FT1A 3FOMA 4NQUA 1G0XA 2P28B 4G1MB 4KBPA 4GSDL 3N41B 4NM4L 4KVPA 5KBPA 1KCSL 1L9QA 1SLXA 1XB3A 4LF3B 3VXRD 3DJ9A 1E90A 4FMVA 3MOAL 4JFOA 4YR6A 5D7LE 1C08A 1BLIA 3CVCA 4KK5D 3D5OF 3APFA 3HFML 4LCUB 5EULV 3S2AA 3SBWC 1ZGLB 1PSKH 3DX7B 3LRGA 2R23B 3EJRA 1SFHA 1WC7B 4YHLH 1RIUL 3U2IA 5E51A 2L3BA 1IE4A 1ZGLP 4M8QB 3WG7B 3ULVE 1OD7A 4QR7A 3BP7A 1QI4A 5DJ8B 2ZP8A 3KCPA 1CFBA 2ZWKA 2WXQA 1RZ8A 4IYKA 1G7HA 4OVUA 1O7DC 1MFAL 1CLYL 2YBRB 1BZ9B 3O3AB 1BBDH 2TSAA 3DC0A 4NBXB 3TL5A 4ELMB 3SKMA 1UG9A 2IQ9H 1ZT1A 2AQ1A 3ZQWA 1WAAE 3P4OB 4K3GA 5FYKU 5C0FB 3GSUB 4ZK8A 3GSVA 4PV1C 1GPOL 3K7UA 2F5BL 3OQRA 1TQTA 3IDXL 3WTWA 4PD4J 3MRMA 3NJIA 1P1VA 1D5XA 1A6WH 1NBZA 3GM8A 4FMKA 4BSVA 5FB8B 1CVSC 1KY6A 2J2ZA 2RIKA 2N3JA 5E03A 5GSRB 3MUGB 3CX5J 3D85A 5CBAB 2RAMA 2YFOA 1HX0A 3BPOB 3S36L 3CFQA 4JG0H 5GS1B 4X5LA 4CBZA 2FVNA 2VDPB 2BSDA 4G9FB 4ANKA 3DLQR 4BA8A 5IB4A 4A7SA 5KWYC 4HJGA 1Q72H 2J1XA 4F2MA 3WTVA 3WXVH 5LNEA 4GKZA 1F13A 4YAQB 1FZKA 1JXFA 3GO1H 1UUSA 1VFBA 1V3LA 5JORB 5FFLA 4QWWC 5MP6L 4JANB 4TUJA 1T1ZA 2C5DC 5EZOH 4O2EA 5EORL 2YQ2A 1Z0NA 3HJ0A 5DD6B 3JWNE 3H9YA 2WXIA 3ARVA 4OIAA 1IC7H 3OKNB 4TRPH 3R8BB 4FA6A 5BUPA 3VSQA 2MCAA 5HYIA 4HF5L 1J05B 1OARH 4NKMB 2KC0A 1DO5A 3DBSA 5I1AB 4XCNB 2WYIA 5KW9L 4I9WD 3OKOA 2NUPA 4GBXB 1MIEH 1TZHA 4JMXA 3AITA 4JHBA 2FX7L 1YEKL 3VFOB 5AW3B 3MA9L 2VGLM 1ZEAH 4PWJA 3QEQD 1JGEB 1AZRA 3WFBH 3IDGB 4N2HA 4Z7WB 2YAEA 2L8AA 5BZWB 4JFFB 5I1EL 5I15L 3RJOA 5I66B 4XB3A 2FLMA 3OAZK 4G5ZH 4L37B 4NDMA 4ODXA 4RMUA 2NUTA 4KZDH 1XGTA 1KTKE 4C54A 2X7LB 3FTWA 1UFGA 5B22A 5JOPE 3QH3A 1OAKH 4EOWL 1F4XH 3JQOB 4XN8A 4HPYH 3ZE2B 3FH5A 3VYNA 4LCYB 3NIDB 5GXBB 3TPUB 3SKNA 4X6DF 2P52A 1HFUA 5EOQL 1ZT4A 1J8HB 1Z5YD 5CD5D 2QKIC 1SVCP 1LGVA 3V5KA 4RH4A 3W0WA 3ULAB 4LCWB 1AG6A 4XCYB 1FIGH 2MPAL 3UTSB 1NGZB 2AXWA 2P4AB 5F1KC 3MLYL 1M2VB 1XF4B 4PCSA 4BFBD 4UQ2B 1YEFL 2YK1L 2X6CA 4NKIH 2FATL 2IBZY 3NZ8A 4K71B 1OP4A 4ZTPL 5DJYB 2MQ3A 4KGLA 5FHAH 4BFGA 1MCFA 2PPAA 2EXYC 1LDPH 3VXSD 5CXPA 4OSUH 3IU4H 1BX2A 1G7HB 1OTTD 3GEWB 1JGUL 3CZJA 1RPQA 3BGMA 2DZEA 2O5NA 1KJ2A 1BZ9A 1PYWA 3ECBB 4I5BB 4DQAA 4N5EC 1PNDA 4HS6A 5JQ6L 3FYIB 3MAWA 4ZFOA 2WLLB 4YGVB 4PJXE 1UATA 4R97C 2GCYA 1WG3A 1WRFA 3BZEA 2OK0H 3DMMC 3VFRB 1T0OA 3O3BB 1KCKA 2JELL 4WHDA 1DVFB 1BVZA 2R7EB 4HXBL 4ZMYA 1CC3A 3CV5A 1A9VA 3HRZB 4LSPL 4OD2B 3SOTA 4O2FB 5J6HA 1BXAA 2CKBB 4ES9A 3TEZA 4XN7A 4P06A 2FUTA 4ZFZA 2VE6A 1D5BB 2XG4A 4JPSA 1TYEB 1KGWA 5AB9A 3KPMB 1K8DA 3NVQA 1SXBA 1XFPA 5I6KA 2VR7A 4JPQA 1CFNA 5DF0A 2BNQE 1WGVA 1IBGL 2YKKA 1JOIA 3HI5H 2E7LA 1B4JH 3IFLH 3OF6A 4HSCX 1AXIB 5EPMB 1FZKB 4PG2C 3OLIA 4IMKA 5T1LA 4B9KC 4UM9B 1JVLA 3GB7A 1P5UC 2E86A 2Y5TB 3W2DL 3MROB 4G8GB 4WNJA 5E56A 4JFPB 1OM3L 5LGYA 2WVSA 1RVFL 1U6AL 3BAKA 4XPGH 4PJ7F 4CSPA 1CGYA 1FNHA 4HG4J 1QD0A 4OQTH 3N42F 4AQ1C 5T3XD 4N3TA 4YDJB 5E6IA 5BVJA 3DJSA 7PAZA 2BY3A 3FH8A 2EILB 4JE4B 5F96H 1BYNA 3F7RA 1U21A 2NQ3A 2ZOLB 3QRGH 2O5YL 3CXFA 1U8NB 3HBGA 3AY2A 3T0EB 5AKRA 4P3DB 4M5TA 2J5WA 4Z7WA 2NY4C 3CE1A 4E5XB 2R4RH 2X70B 1A1NB 1O7SA 3B8YA 1KLGB 3CDGA 3N0PB 2A9MH 4TSBH 2QQQA 2EH7L 2MRYA 2ZOKB 2BINA 3IDYB 1GGBL 2XTJE 4I0CC 2ODHA 5IBTL 3TVMB 5HYJD 1S9VA 2D3LA 1KACB 4L1HA 3VQMA 1FP5A 2Y3AA 4K3EL 4X0KA 2QLVB 5IMMA 4G8FA 4PPTA 3L08A 5TF1L 2JIXB 4BZ2H 2JJSC 1MQ8A 1INQB 4AXWB 3RWEA 1HH6B 1U3ZA 1RLWA 4FL4C 3FHAA 2F0CA 5E00B 2XVKA 2HA1A 4PS8A 2BSSB 2R1WA 4BDVA 2CBOA 5LLIC 2CO7B 2G4GA 3HI1A 3K81A 4HZ1A 2Q9OA 4H5SA 4UDUA 4B60A 7CGTA 4YBHA 2AXFA 4ZMPA 5KYNA 2YGNA 2UXTA 4NERA 1EXUB 2W9DH 1KDJA 3HG2A 3RIFK 5CJXA 1J5OL 4ZOEA 5HDBB 3MLTA 4XPTL 4JKKA 4AG4H 1I8MB 4XPFH 3VTAA 4ZMQA 3UZVA 1OP5K 2IOIA 3DX2A 4XC3L 3UTZA 4JPWL 5IR1B 4JHVA 1JGLH 1DQVA 1PX3A 1KJ2B 5CKGA 3WE6A 2XI9A 2AEQH 3E1ZA 3Q6GL 4JE0A 4U1IA 4MJHA 5IT2H 3OGOE 3GSNA 3WJMB 1AANA 2D7PA 3HS0C 1PZ5B 4F5CE 5IT2L 2JFCA 5EWIL 5C0RH 3V9CA 4Z0XB 3QR0A 4LNRA 4AMKH 2VITB 3F5WB 1FH5L 3H0TA 4YOKA 3OX8A 1F2XK 4NRXB 5FIEA 1K6QH 1NGQL 2B2XH 3BJLA 2VDMB 4PJAE 2EYTA 5DEJA 4F33A 4NKDB 3G7TA 1XZ0A 2ID5A 2VLKA 4Q9RH 1KBVA 2CKBA 4Z7QE 2Z1PA 3DETD 1K8IB 2GT9B 2X53A 3MUGA 3H53A 1QPKA 2CBPA 4I48B 3NCMA 3LRMA 1JJUA 5D5ME 2AV7B 5CP7A 4MSWA 4WUUE 4EVNA 4YHZH 1FNEB 5HHNA 4N87A 3DMMB 4WTXA 1WC7A 4UQ3A 3WHXA 3IGAB 3LKOA 1G5GA 4HFUH 4A2HA 2YRBA 3K72A 2G3XA 4IIZA 3PY9A 1S9XA 2R2CA 1WS7A 4YAQA 3DRQA 5EZPA 1KB5L 3NJVA 2BCMA 4H20L 4LLYA 4MZ3A 3C8KB 3BUBA 1ODAA 1F5WA 2NR6C 3ZDXE 3FUJA 1D5ZB 4JANA 1IL1A 2JJWA 3H2QA 2PWHA 4MDIB 1BQHG 1LO4H 5D2NE 3TIEA 3L7EA 3V4VL 1YAZA 4G8AC 2J6EA 3QQXA 3TZVC 3OKNA 2F58L 3FO2B 5I1GH 2NXYD 1TZOA 3P2BA 4HMCA 1RIHH 3DO7B 3BFOA 4ICXA 1WBXA 3MRBB 4F7TA 3DBXA 2LVEA 4CADB 4WI3A 5F9JB 3S3JA 2TRYA 4RETB 2NNXA 3WO4C 2OXGB 3EFDH 2O5YH 4B27A 3V4VA 4F7PB 1G7JA 3TYFA 1PG7L 2DN7A 4YHMH 4AMWA 4TNWF 4DPCX 1D7DA 1ZLVK 3U0WL 3ZE1E 5CEXB 5GSRA 5IWLC 3D85B 2P5WD 4AKQA 1B6UA 4NBZB 4PJGB 1KLGA 1M4KA 2GG1A 4KMQA 5AOJA 3BGFC 4NDMB 5BOJA 1CQKA 4GKSB 1OCZB 2NCMA 4OCSH 3CVHA 3HUJB 1F4YL 4QHLB 2P80A 5FHBH 3RRQA 4BHUA 2BVPB 3QVAA 1P1ZB 1N68A 3EZJB 1FAIH 3MJ6A 1OWRM 2R27A 4OLUL 2BVTA 4PRAB 5I9QC 4TSAH 5D7JC 2XLLA 1ZOXA 4LZKA 4RWYH 4KJWC 2BP0A 1OSEA 3WEAA 3IFLL 1G1OA 3SPJA 3BQUC 3CNKA 3F62A 1ZT1B 5JXEA 3EO9L 5DJAA 4DKTA 2DEYX 5CEZD 2JV6A 2WC7A 4UQCA 5CGYD 3OKEA 2OSLB 1IJ9A 1OLLA 4EZKA 1U42A 3M1BA 5HHOE 5ILTH 5TDPB 1CZ8H 5DDHB 5JNYA 3UJTL 2QADD 3K6IA 3VXTB 1FWXA 1ZT7B 4TVUA 4ERSL 1OHQA 5DMKB 3CQFA 4OLZL 2X6VA 3WELA 1EFXA 3FBKA 4X7FC 3NJFA 5AW5B 4MAYD 2FIRT 1AG0A 1H3UA 4HIIB 1SXCA 3GTNA 3QUXA 1Z9NA 3OSKA 2F54E 1KG0B 3NJMA 1S7UB 4JFUA 4DVBA 1P9MC 4YVUA 1P69B 4CVZA 1MW1A 2WQAA 3DRTB 1SRDA 4X6CB 3KPSA 3ORJA 2P24B 2MHAA 2ZUTA 3RJQB 4R3SA 2ZUSA 2AEOA 3OMIB 1RD6A 2HPTA 2ITFA 3DXAD 3F00A 3D4GA 4JO5A 4XMPL 4MJIA 2XV2A 1NM4A 4U7MA 2PMZA 1BECA 3CQPA 3HZMB 4ODUB 4O2EB 1GOGA 5GRJL 3FUIA 1I4FB 2IVFC 3GHPA 4QRSA 4OU3A 1K2DA 5J13C 4ZFZB 1JPSH 3TT3H 4XCEA 3U48A 3RPIB 4ZUWA 5DVMA 2BX5A 1FLTX 1HU8A 4IBVA 2ZCLH 4L4JA 3IDUA 5DVKA 4UQ2A 4HJJL 4F80A 2WGNB 1QLEH 2ZOUA 2NW3A 2NTSP 2VR6A 3SGJA 1IAOB 3CXDL 2YOAA 2CK0L 1T7XA 5EPMA 2FAUA 4YHYB 5F7HA 1FO0L 4Y2DA 3ZUNC 2A9BA 3V0EA 1F45A 2L7JA 2NT1A 3IB4A 3U9WA 5F3FA 4BH7A 3MV7D 1XR8B 3MACL 2ICEA 4GQ9L 5GGSA 4WFEE 5J1AA 2YAPA 1KB5H 5AOLA 1F2QA 3F05A 3IRPX 4RDBA 3TEUA 5I15H 5I1EH 5HI4C 4N6QA 1IGIL 1J9CT 4GKNB 4YXKH 2AK4E 2RMNA 2AVFA 3PWPE 4N8VA 5DD3L 3TPUA 1I3RA 4P4RB 3SCMA 4F37F 3GNML 1KGIA 1O7VA 2GIXA 5BJTA 3EDJA 2LR4A 4PWIA 2AS5M 4Z0BH 2XQBL 1GZQA 2IOOA 3LEYL 4X9BA 5TGBA 1GGCL 1R46A 4FTVE 4KROC 1KYUA 2CR6A 4Q9RL 2B59B 4AJ0A 5F3BA 3DYPA 1MIML 4G71B 5I1DA 4LDOB 5ACMA 2CCVA 2CIKA 1ESOA 3QJRB 4B7LA 1KTDB 4FNPA 2FR4B 4NQDD 1H3GA 1J12A 1WD8A 1SPDA 1Y1UA 3PWVA 3OHXC 1PAZA 5FDWA 3UO1H 1OZUA 1G6VK 1II4E 3T1FA 1V7NL 5K1JA 4AV0A 3PL6B 3X13B 5L2KE 4E36A 5CUSL 2CUHA 3OMNB 1SMDA 1JK9B 2APTA 1A3LH 5T3XH 1FHGA 5IOPB 4D8PA 1LWHA 2OA9A 1ZHBA 3QP3A 5E99L 4MNQA 1BZQK 1ZLEA 1KPRA 4J3OC 4MX7A 1DFXA 1E4XI 1FVDB 1UM6L 3UABA 4PRNA 4PJDA 2BOBA 2DLFH 1B4LA 2I24N 5B39A 1A6WL 2UYLB 5J1SC 1G0YR 1ZMYA 3ZN6A 2XG4B 1D5BA 5H37G 2YA2A 2F5BH 1GPOH 5AL8A 5EZIL 2DM7A 4UAOC 3P0GB 1P6AB 3AQZA 3KXFB 1NCCL 4ZFGL 1TEGA 2PLTA 2WWKO 1T0MB 4UF7C 4F3FA 2PWDA 3V6OA 2AQPA 4WKXA 1QR1A 1RUPL 2DQCL 3HAEA 5BRZA 1MF2H 2ZOKA 1VPOH 2G3NA 4U1SA 3S7GA 4OT1L 4M48L 1IT9H 3EDDA 3DA0A 4AQOA 1NQBA 2NY1B 3ES6B 5SWSB 4AQEB 5EF3A 3QIBB 3AREA 3VXSA 3FCSB 3LEXB 3QR1A 3GLEA 2ODIA 1KCBA 3QIWA 2B5IB 3P4NB 3RDTA 4JLRB 2R4SH 4Q9QH 3AU1B 1UA6L 1PSKL 2VW4A 3SE9L 2CRZA 1OT2A 2QGEA 3KWTA 3IGFA 1UQSA 3BP4B 5L6YH 1UD6A 1HNYA 1CL7H 4H5SB 4TYUA 1VFAA 3CN4A 4HKBA 5DZNA 1TZIA 5MEPA 1M7DA 2VDQL 3VD7A 5BW7C 3QHFL 4P23C 1JN6A 1HEHC 2NY1C 3WHXB 5I71C 1FV1B 4LOVA 2X9XA 1R5VA 3QNYA 4S1RH 3SPVA 4BUHA 4PJEB 1MFNA 1W8NA 3DIFA 4JFSA 1KGCD 2J8UA 4Z7QF 3BAJA 1T0PB 1U6AH 3C8KA 1TMQA 4LAQL 4RMBA 4XPGL 5CNHA 1R75A 3E6FA 4XNUH 4OZGE 2GEEA 4TNEA 4FP8H 3ALPA 1JNLH 3K5RA 3L7EB 4M7KL 2F7RA 2FGWL 5ID0A 1WVZA 2QQNL 5DZLA 1A6ZB 1KLFA 2N7AA 3QEQB 4KKLD 3KBFA 4OKDA 1WZ1L 5AL0A 3DBXB 4DKEH 3T4AC 2C9XA 2VXUL 2ZXBA 3KBPA 1QNZH 4J3SA 3DX6B 3QNZA 1U8MA 3QPQD 5KYUB 4DP2X 1NAMA 2WNGA 1G7JB 12E8L 1HH6A 4FQ1L 1DQLH 4QF1B 4ZUTB 3G04B 1PG7X 3TBCA 4YDKH 1GC1C 2AV7A 32C2A 4PJGA 4UTBH 1JNNL 1G6RH 4OLXH 2AXFB 3KLHD 2G75B 1UUNA 5FYJH 3S0PA 3BIBX 3QA3B 1NAML 1QRNE 5ECJE 3UC0L 1BZ8A 1NANI 4HXBH 5B4MD 4RFNB 3NCEB 3O2DA 4B50A 5FCUH 2FSEA 4PREB 4IRJA 2KZBA 4AUUA 1R24A 1X3DA 3QFJA 5GGUB 2ICCA 4XE0A 5JOFA 2D03L 3TN0D 2C9RA 3VX1A 1IILE 4R4NC 3F65A 1XD1A 2IH8A 1CGXA 1K5NB 3L3DB 3MUHL 4NSKB 3IDIB 4QRQA 4QDGA 3SDYH 3QUXD 3G6DH 3QQDB 2P3YA 1JK9A 4OSUL 4F8QA 4ZNEA 2DMBA 3OKEB 1SJEA 3EKCA 1URLA 3IRCA 3M1BB 1U4EA 3MXWL 4HGWB 4PLKC 4NO5B 4B7IA 2YR3A 1R5IB 1TETH 2UYLA 1FF5A 1IQWL 2XIIA 4UNTA 4YSDA 3HLAA 3WHE1 2MPAH 4KO9A 1GOHA 4X4ME 4ZXBA 1FGVL 3VXPB 1DZBA 5CP7B 2VLRD 1NC4D 2QMKA 4TULH 4FQJL 2APFA 4EBQL 3EJUA 1CXHA 2Y1ZA 4A6YB 4U7SA 2X12A 4LVOC 3N55A 1QWUA 3T09A 3Q6FA 3BWAA 3V7AG 2AXGB 5DUML 2AJYL 4GBXC 3NN8B 2ROYA 4Y9CA 3FFDB 5MEOA 1W6WA 2MKLC 3LQAH 4OBRA 5GIRB 2Q0ZX 3KDMB 4HKZA 2QTVA 2RFXB 3DJRA 2SODB 4KJYB 4L5FE 1RP9A 3LXUX 1CFQA 3GXUB 2J4WH 4JO2H 2BSED 2CDEA 2CHZA 3CPLA 3IAPA 2O72A 3QZMA 1YMMA 1NBYB 3UBXA 4MA7H 3GBEA 1DVSA 4CKVX 3AT9A 5FF6B 4J3UA 5F9JA 4J3OG 5DLML 3WBDA 3FTVA 4PGCA 1MW0A 4LE8A 3KLAB 3GRBA 1UZ8B 4GP4B 1OGTA 3UC2A 1BG9A 1F90L 1B6DA 3CSBA 5SWZE 2PPEA 2OW7A 2SEBA 1JHKL 4HF5H 1KYOJ 1OB1A 4X6FA 2ITCA 2OXHA 3HB3C 1DBML 3MV01 3KPSE 3QUXB 1MQKL 3GXIA 3KGUA 3Q05A 3D07A 4Y8AA 4PY7A 3CVDA 2EDFA 4J39A 5L2JB 5J5EA 1Q9WB 2Y25A 3AT0A 2QZQA 3ROLA 5JW5B 1FZOB 3OAYH 4QHLA 2MHAB 3SE8L 3SJVB 2RGSA 1UT1A 3HE7A 3H42H 2I25N 4TS6A 4WQOA 4S1DC 9PCYA 4R26H 4XP1L 3MCG1 2Y69B 3H42L 2E76C 4Z95L 4C47A 5DYFA 1A7RH 5HGBB 4HJSA 3UGXA 1SYSB 1TLMA 2EO1A 3HOGA 1XSIA 4GNKB 3NSJA 1H3XA 1QFOA 4G8EB 1BOGA 1JNJA 4R7DA 4NS0A 1HYSD 5IVXA 2BZDA 2CUMA 2BSRB 3HVNA 3THMH 3UL4A 3WXWH 4UWQB 4Y5YA 1PTZA 2VMCA 4ESKA 2FJGA 5DSCB 5IEHB 1T5XA 3PNWA 3KPQA 3UERA 1MWAH 3TYGL 1P5VA 3BKCH 2WBKA 5E23A 1JSYA 1S7WA 4FG0A 4WENB 3PUUA 5IW3A 5DK2A 1BM3L 2ITDB 2WBJB 4GAYA 4L4VD 3V4PA 3SN6N 5DRNA 1JERA 4Y19B 4ONGL 3GBML 4Z3JA 5IIEA 1AY1L 1NCIA 5HHPA 5IB5A 4L8BB 4WHYG 1FL3A 1MLBB 3MUUA 1L9PA 3MRPA 2XWTA 3V79C 3N3EA 3JV6A 4I18B 3MMEA 2ZWZA 4W9FC 3WI9A 1FG9C 3GGWA 4N8VB 4MMXC 1MHHA 4HGWA 4YHLL 5ES4B 2FBOJ 2BLFA 4NRZB 4QRSB 4KRPB 4POZD 4JQXA 1EHXA 1HESA 2WJ7A 2YS4A 4XVTH 3ULUL 1FA4A 4I0PD 4YIQB 2ZNXA 2NRDA 1OL0A 4L2LA 1U91B 1WUZA 1PFOA 1O0VA 1ZE3C 2A9NH 4YDVA 3ZZSA 1Q9OB 4EN3A 1ZAGA 2FQDA 2BY2A 2GI0A 4MMXB 1ZPUA 4QLRA 1KEML 1XQ4A 4MB4A 1T7WA 5DWUL 3S3PA 1T1YB 1X5XA 1WBZB 2HLEB 3U6RB 3AREB 5C0JB 4KJPD 4BFIB 5C0ND 2IEPA 1HHKB 2IPTH 1TITA 3NPSB 5ICZA 2FNWA 3JTSA 3C6SB 4R4FL 5KUKA 1NGXB 3BUDA 3ZLQC 4XE5B 3UYRH 5HI3D 3FRPG 4LRNL 4DK3A 4XCFL 5C0FA 2DBLL 3L4WA 2PTUA 2WZPD 2MNUA 2E46A 3EYOB 3U0PA 1MWAB 2VR9A 4WI6A 2NY3B 2PO6C 4OLXL 5B38A 1GVIA 3TCLB 2DIJA 1LVEA 4RSVA 1GZQB 5C07B 4L4TE 1CGSL 4NP4L 3L5WB 5GS0L 3FXIC 3W57A 2GBUA 4ZAKB 5IW6A 4FG2A 1A7PL 1Z3GH 3A6OA 3L3OA 1QSEA 1KOAA 4XWGH 3I6LE 1OHZA 5ANME 2OQJA 3T0EC 3WKQA 4KPHH 3EYQC 4S0SD 3L3GB 4I2XE 5I0YA 3D18A 4PIRF 4FFTA 4U1SB 5F88B 1WHOA 2GSIB 1AS7A 4N90E 4G6KL 3WIHH 1NLDL 3TIDA 1U3JA 4PTUB 2CH8A 4Y5VB 4M6NL 3TVMC 3DX6A 3QNZB 2ALAA 2L7EA 3X13A 1MHEB 3ARSA 5KYUA 2JMRA 2ZIDA 1HSBB 2W5PA 5DWUH 3GSRB 1YMME 2GJZB 3VQ2C 2ZOTA 3NEEA 3QDGE 5FUCE 1NDTA 4R8WL 5AW2B 3VXOB 1J05A 4QKTA 5IBLC 5DS2A 5FOBA 3ZKMD 1N64L 2EEXA 4OIIH 4ZD3H 4UT9H 1H0DB 1G9NL 4Y4HC 3S48A 5IEHA 2A38A 2PYFA 3FYEB 1MFVA 4QRRE 5DURD 4KHXH 1F3DH 4X6EA 4IBYA 4N0UB 4BWWA 2HVKB 4IIQC 4A2MA 1FUNA 4PREA 3CK0L 1WWWX 2R4SL 1NDMB 1NMCC 1F4AA 4Q9QL 2NCEA 2Z0UA 3BT0A 3H9SB 3QB7C 2P9RA 3VG0H 4N2MA 1O9WA 1T0MA 3FB8B 4F3FB 4F9LC 5LCVA 2PW1A 2X42A 2VSKB 3MO1A 2BIQA 2Z7YA 3UMTA 4L23A 4FRWA 2VLJE 3JUZA 4N22A 4BH8A 2VR4A 3F7VB 4DP5X 4KRLB 2HVJB 3LX9A 1VPOL 2Z4QA 3DXAE 1OM9A 3E6HB 3QORC 2NY6B 2R83A 3HS0A 4CC4A 1U8MB 3WFEL 1AGEB 3IT8D 2AJXL 4ZFFA 4LCCB 3HLAB 2CHWA 4PWKA 4PJFA 1B9KA 2DQFB 3UG3A 3HHRB 3T6XA 1ZGLA 1KCVH 2EIDA 3GK8H 4FKEA 4NFDA 3VNZA 1KGJA 4XBEL 5E2VL 4PU2A 1Q9OA 3CVIH 3QA3A 3I6GB 4FX5A 2VCOA 3GJEA 5M7QA 3NABH 3ARDA 3QDMB 2VRQA 3AJ7A 4WTQA 3BWAB 2X89A 4OZIB 1L9NA 3B7SA 3C2AL 1PX8A 4F9PA 4Z6AT 1SBSL 3QQ9D 3RWHA 3VFWA 2B4CH 3IMVA 5AVQB 1KB5A 4LPXA 4W9EC 2GVYA 5AW0B 2ED7A 1C5BH 4FXKB 2OLDA 1NAKL 5DJDA 4EUPG 2CLRA 3ERXA 1OP9A 2XN2A 1OTSC 3EYSH 3LOWA 4LEBA 1V7NH 5B1BB 2V5RA 5ISZD 3WKML 4PRPA 3MV7E 1A6ZA 1CK0L 3B8SA 2O6CA 4H7VA 43C9B 3FK3A 4G42A 4I77H 2UZIH 2CDFA 3RWDB 5IG7A 2I69A 3VFRA 2A74A 3OB0K 4FZ8H 1MCOH 3BDXA 3S8GB 2FJHA 2WVVA 35C8L 1FCCA 5TE7H 1OGTB 5F7DB 4ZPTB 1CJYA 4MNGB 4KKLC 3WL9A 4P05A 1WFUA 5ALCL 2H3KA 3TCLA 4QF1A 3VTMA 4LMQI 4EE2A 4ZMLA 2JI1A 4X6FB 2YJLA 5LCVL 3T2OA 1AGFA 1URZA 2XQBH 4YFDB 3R19A 4MCYA 2ZYRA 3K3QA 3OG6B 4OZGA 1AHWB 4R7NB 1WFNA 3C75A 4XPAH 1Q9WA 3NCJH 4K8RD 2A6JA 2EIMB 2B20A 5IQ7H 4MNHA 5EOTB 1VEPA 4FFYL 3LH8A 4XOAA 4OCMC 4YXKL 4MB3A 2FE0A 1NWOA 3RVUC 3JWDH 3VXQB 2QBWA 4MMYB 2Z7UA 2VERA 5GGTH 2Y5TA 2X1XR 3Q2WA 5D96B 1GY1A 2IWKA 3T0AA 1A5FH 3IFPB 3GSWA 2K8MA 3LQAL 4PW9A 1SHMA 4L3AA 3ATEA 4PSRA 3RY5A 4WNQA 5DUMH 5E08L 4K5MA 4ZUSB 1VCBC 2AK1L 2P44B 1N8ZA 1QLRA 3VXOA 1UASA 5D1ZD 3NG5A 4OJAA 5DSCA 1EVTC 3QDAA 4Q0XL 4RDQG 4X98A 3WENA 3X1EA 5JXAH 3BE1L 5C0AB 1P7QB 3O6KH 4GINA 4JN1H 3MFGB 4XNMB 3OPUA 3DVIA 1RH8A 2C9SA 3PJNA 4J3TA 4E5XA 5CEZE 3U36B 1PG7W 2UXGA 5CGBA 4YVNA 4W6WB 2IH1B 1B2WH 1FYTE 2OFQA 5C8JA 3SO3C 4RBPH 2JLLA 3EW3B 1NIDA 2GAZB 2AXGA 1IQDB 1Z5LB 1I8KA 3SDYL 4PJDE 5DK3A 1AJ7H 3DOSB 3NH7H 4EQ2A 4MHHI 2H8PA 5GGRA 5BRZD 3DMMD 1Q94B 4W4NA 3C6LC 3ZL4H 1FL6B 2Z35B 1GZPA 5B3JE 1ZT4B 5TD4A 3TN0A 1BD2E 1BFSA 3KYNA 1DCEA 4OAWA 1CFMA 4JM2C 4XVJL 2E9JA 3IETA 2ADJA 4JHWH 4L0PB 4WTZA 4OLZH 4AUJA 4BK8A 1XF4A 3MGTA 2W88A 1UZ8A 3MV8E 4I3SH 4TKWA 4LLMB 3ZT6A 3NTCL 1DYZA 3U7YL 3HZVA 4LL4A 5I16A 2OCJA 3C5JB 4M1CD 4QJ5B 4QGYA 3KYMB 4X7TB 1UGNA 4P2RA 4YS4A 3DUSA 1SJXA 4MA1C 3S36X 4PRHB 2IAMC 4XXDB 1BMWA 2B0SH 1DL7H 5TFSH 3EO9H 1KB5B 5D6DC 5DHMC 4X80L 4XB7A 2ZZUT 4JM2B 3ZE0B 4LP4A 3DV4A 1HQRB 3P69A 4UIMA 3WS3A 1RUMH 1KTLB 2CDGA 3N50A 3BWZA 3TASA 3D39E 5DK0B 4RWYL 2XFXA 3WN5B 4KROB 1R3LB 3NGBB 4LNRB 4YPGB 2YMXH 2D0HA 3HEIB 2F74A 1BAWA 2Y6SD 1PZCA 1KC5L 2A74B 3K8LA 4NUGH 4FP8L 5D72H 5I30L 4IJ3B 1J0HA 3LIZA 1GYCA 5C09A 1UC6A 4NXSA 2CR0A 4HH8A 3WL9B 2BDNH 2OYMA 4NRZA 4ZYKA 1LP9E 3X14A 3U0TA 3A4AA 4Y16A 1HKLH 2UZXA 4LOFA 5IW6B 1NIFA 2H3NA 2YRZA 4JZOA 1OPOA 3Q48A 2AQSA 5B7EA 4FG6D 3SYOA 2VQ1B 1N5YH 3E8UH 4KQ3H 5B7MA 2HX9A 2GBTA 4S0TD 5CZKA 4Z7WF 5I1CL 3U4BL 2CHDA 1B3IA 5IHUL 1S7QB 1WE5A 4H40A 3V4PB 2YD3A 4HIJA 3TBTB 4PTUA 1XHHA 3HHSA 2G2PA 5TTRA 1JD9A 2UWEB 3EAKA 2VLJD 1FDLL 1K4CB 1L9SA 2V17H 3US0A 4RMSA 5F7LB 2IMNA 3NFNB 5FKAA 1RUPH 2DQCH 3HG5A 3MMEB 3UAJC 3DO7A 3SGDI 3OXRB 1A3QA 5CJOH 1W0VB 4F7MB 5DQDH 5AZ2H 4PYGA 3EYOA 3U0PB 1INEH 3BD3A 1WZAA 1MCIA 3QEUB 1DQMH 1LD9B 4JRXD 3VI3A 1D9KA 1XV8A 4JQIL 4W93A 2LU4A 3UIYA 2A3TA 4RGMB 1TJGH 5SX5H 3IM1A 3WS6C 5IQ9B 4NN6C 4ZAKA 4B3VA 1J9QA 1TVHA 4PR5B 4QO1A 3L8QA 2BP5M 4RAVA 4K9EC 4QXWA 4P4KC 4OLYL 1ETZA 5BPPA 4GW4A 2VC2L 3L5JA 1DQKA 4H0GA 5BRQA 3HE6A 2E7CA 3GI9H 2WINB 4M29A 5EWIH 4K2UH 2ZF8A 3ZGIA 2X4TB 3IDYC 3SEPA 4WEUD 3DX3A 4MS8C 1FN4B 5DTFA 1BFVL 1G7LA 4ADGA 3RWEB 2GHZA 3C6SA 2GK0A 2W1NA 4AGPA 2WQVA 4R5TA 4W70A 2AFNA 3VXUE 3U4EB 1T2QL 1FYTA 1EJ6A 5FM4A 3UOAB 2W07A 3O9WA 2YSSB 3ZZ1A 3IWVA 4DEUA 5JNYB 5I6XC 5HI3C 4OFYA 3RIAF 4UNVA 4HFWA 2FYYB 5AOIA 3RZCC 4K07A 5DHVA 1NMBH 5DRWB 1DQML 4HJEA 2NYZA 4NOBA 4PJBF 4ORZC 3FKUS 3ZT7A 5BW7A 1NLBL 2CXGA 3CHPA 3UBGA 3FQTA 3EO1A 4B9IA 1UB6A 1HH9A 1U8HB 4LASL 4LIQE 2DQ6A 1DE4B 1T21A 3LMJL 4NX0A 4PRPB 5A6IA 5E1AA 3FQUA 4MD5B 5T1DH 5KVDH 1KYOK 4K5LA 5ESQA 5IG7B 1PD6A 4KI5F 3GSQB 4ETQB 2BVQA 1DUZB 3CFEA 2YEQA 3HZMA 5D4JA 3OR6B 2GQHA 3F7QA 2YEZB 1G94A 4Y4FA 4FQ2L 4UT7H 3GMOA 1CG9B 1EMTL 1QWNA 4NXKA 3UPCA 1W0WA 5F0MB 3UTSD 4XCEB 1C16A 4ATWA 5I1CH 4EI6A 5ADPH 1AGFB 1I8LA 2HFGL 3V0WL 1E5BA 5EF1A 1DANT 3FPXA 4D8OA 4BFFA 4ZX4A 5FUCC 1YHPA 3BVUA 5F96L 2V2XA 3VAEA 4U6VL 5KBNC 3UX9B 2WZPA 3EYVA 3BDYH 3QDMA 4PV8B 2KPWA 4HIJB 1C7SA 2CKBH 4L8CA 5C0GA 2ICWI 3S37X 1RZJH 4ZO6A 1QQDB 4WK2B 2CCLA 1CE1H 2ZUQC 3GSWB 4BQBA 1RPUA 2YAQA 4V1DE 4IRJC 2PW1B 1K4CA 4GMSH 4U3CA 2OI9C 1RHHA 2BHYA 3GKWL 2AHIA 3ILEA 2EVFA 5D1ZA 4JL1A 3G5YB 4OFDA 1XGYL 4M8RA 4NQCE 1I75A 5EDXA 2DQHL 4P2OC 1JPFA 4NO0D 1I9EA 2OXGA 2VDKL 1BVOA 4PJ5D 4R97B 3R1GH 1NBCA 3QEUA 2Z91B 2PPFA 3HG0A 5KG9A 1YJDH 1PVHA 1D5IL 4UM8A 5JW4Q 3WNMA 4F5CA 3JTBA 1QPPA 5A2FA 1JMXA 3T77B 2XU9A 1SDYA 1O6SA 4OKVB 3HPJA 3PWJA 1CZ8L 2R0ZH 2DQUL 5EIIB 2VB5A 5T1LD 1YG9A 1JDDA 1EXHA 4BRJA 3MNDA 4GW4B 5CSGA 3D0AA 1WV7T 2CA3A 2ERJC 2OK0L 3UMNA 3V4LA 4LLDA 5DZAA 1ZJAA 5EOCL 2X2YA 1XH3A 4BZ2A 5H35B 3B9EA 2CLRB 1QUPA 1UZ6F 4UDTA 5K59E 4C4UA 2EVHA 1YNLH 4IW4C 5EC1B 2AC0A 1T5WA 4CMHC 1J5DA 3JUYA 1F4YH 4N4YB 4DZBA 3W5MA 1MDAA 3IETB 2YAHA 1MJ7H 5GSVB 4N2GA 4OY9A 1WTGT 4HXAH 4E41D 4MNQB 3ECWA 5I82A 3O3DA 5DDHA 4OGAC 4LSDA 5A2BA 2GSMB 3OAUL 4L1DA 4HFWB 2OPCA 3RKDD 3HPLB 4U1MA 1IBHA 1WFTA 3BYTA 5A3IC 4Z7UE 1WH0A 5F97E 3O2VL 3QUZB 4MCYB 5F1OB 1D6VH 4AGOA 5D4IA 3HIZA 4P2QB 1T3FB 3VNYA 1MXDA 3PWPD 3A3YB 3EGDA 4NGHL 3V7AE 3QWRA 2IH1A 4HWEL 4RBPK 5EEUA 2P1YA 5EEYA 2NUPB 4YBQD 4JKPL 1FG2A 1R3LA 4QUOA 4A2LA 5HJ3B 1QSFE 3H4HA 1MVFA 3TESA 4Y5XB 2BCKA 1S2EA 5INDA 3SODB 3M17A 5JYLA 2K4WA 4L3EA 3DVGA 1CICA 5I6MA 1HQ4B 2Z31B 2NY7L 4OGYH 1E4XH 1PBYA 2LOEA 4PJ7E 1D5RA 3VXRA 1KY7A 4EZJA 3H56A 2BNRD 1EGJA 4AW7A 4P46D 3FQ1A 1TQSA 3MA9H 1OK8A 3I50H 4HETA 3NCJL 4HQQL 4XN5A 4HUWB 4K94C 4UZGA 1MIEL 1VFAB 2VC2B 5D7HA 2A1WL 3E8VA 3ZL2A 2ZX8A 3SDXE 2EJ1A 5TDNB 2DQEH 4IOSA 3DI2B 4DP9X 2Y7OA 1P7QA 1TSRA 4Y5YC 4Q58C 1RK1A 4M4PA 4NYLA 3KNBA 1AH1A 3BOVA 4G83A 5B8CB 2W0FA 1UOWA 2UWEA 4FZ8L 5FGBA 1M6OA 2NY5C 5C8JB 5FR3A 4N2OA 4I77L 1B0RA 2GAZA 2DS4A 4NUPA 5JDSB 3ML8A 4LFHG 4WY7H 1T4KB 3MRKA 4JFHE 4M7LH 2OL3H 3WNIA 2ZX6A 5CHNA 2AP2A 5LUMA 3MUJA 4YE0A 4BK5A 2Z8SA 1I3VA 4UT6L 3ZHNA 1JDCA 1K5WA 4OJEH 1MCPL 3MRJB 1UWXH 4JQXC 1QLFB 4PJDF 2WTRA 1OVZA 1ADQH 2Y22A 3Q44A 2O93L 1TTGA 4XNDA 4OZHE 4DQOH 4LHUG 3LHPL 4RAUB 3WO3B 3TH2T 2CIKB 2JH2A 4DFIA 4P2RB 3K6SB 1HDMA 5KSBE 3PWUA 1OCRB 2E6QA 2QVTA 4GQRA 5CCKH 2WVTA 1CI5A 3ZQ9A 2A0LC 1R24B 1TVBA 2JQAA 3BVNB 4JRFA 1ASOA 1AKPA 5KVFH 5JOFB 1TJHH 3LZOA 3CSTA 4HS8L 1NOAA 3UP6A 1BBDL 2NY0B 1SQ2N 1TR7A 5F7FA 3U2SA 4R84A 4ORGB 2QT6A 5JW4M 1P7KA 2X4UB 2XFXB 3EJYC 5KANG 4FXGC 4NO0A 3BPCB 4M4RA 3TS8A 1T5WB 4HU8A 5CCGE 3DGGB 4QRRD 2CO3A 3FRUA 3HE6D 5EO1B 5I76B 3M45A 4MJ5A 2JJTA 2QSCH 1EAJA 2JJVA 3JSSA 5FLUA 4IEFB 4AL8L 2ESVA 3H9HB 3Q1EA 1YPZB 3BIKA 3CK0H 5F8RC 5K9QI 2DV6A 1MLCA 2IADB 2NY5H 3FU6A 1MRDH 3UBHA 3ZDYF 5T3XE 4JDZA 4WW1B 4HX1B 2ADYA 5IB2A 3UTQA 3WDHA 5K1NA 1UB6B 1Z9MA 1YEGH 4YDIH 1ZA6B 1NCJA 3BPLC 4J3WA 3QJFA 2UY7B 2XWJB 3RYMA 3HAEB 5KJRH 1P6FA 2AGJL 2EDKA 1B88A 1S3RA 3A4EA 5BZZA 3U30B 1U8NA 3FFDA 1IIIA 2J1KA 5MEOB 1KJ3H 4NFBA 4F93B 3PPSA 4AQEA 5CSZA 3FMGH 3T3PB 3F7YA 3MNMA 2OMNA 3OR6A 4H1LB 2XN9A 3ILQD 2D3JA 1HHGB 1X7QA 4IMKC 3QIWB 5DQJA 3RY6A 3VFNB 3L3JB 1YEDA 5JIMA 5F9WC 4FA8A 3QR2A 1XIWB 2XVBA 3CN3A 3BKJL 1BZ7A 2AV1B 5FFGA 2HX8A 2GTZB 1YEIL 3MLUH 4HHAA 4DP7X 3STLB 4Y7OC 3GXFA 1QSFD 3ASOB 3LS4H 5SWZD 1XGUA 2WSPA 3O11A 1DP0A 4Y4HA 5DQ9A 3QJTB 1JYVA 2JTDA 4NN5C 4PV9A 1U4FA 3E6FB 4XVJH 1TVHB 2W0FB 2WLHA 1EEYA 4G82A 2E9BA 3DHUA 1QNIA 3C2SA 3SJVA 1BVLA 3VFPB 4QOKB 2X1OA 3JT0A 4YLQT 3MODH 2F1AA 4F9LA 5EB9A 1XCWA 3BT2H 1FBIH 3BZFB 1MFEL 2YXVA 3OM3B 3T8XA 5CCHE 2X4TA 5H4ZA 1OO2A 2HKHH 5DTFB 3IU4L 2JF1A 3MNWA 4X5QA 2HJKB 4ZMZA 1OEZW 2GK2A 5ADOL 43CAB 4QTFA 4W9KC 4LCWE 1BOGB 5HI5C 5HYQA 4U1JB 1PF3A 1U3HA 1BD2D 4ZTPH 3VDCA 5KYYB 2APVA 3WTTA 2VNCA 4J6RL 2HJFB 1BXXA 2XQYK 1F58L 2CNYA 4MS8D 4QCIA 4F58H 3T4YB 1YEFH 2W07B 4U6TA 1NGWB 3P4MB 4N24A 5AYTA 2WN2A 3RY4A 2XETA 4MD0A 3ZE2E 4BE6A 2EO7A 3GS4A 4HDIA 4KVNL 2W0KA 3MTXA 5DRWA 2OJZL 4JFHD 4JM4L 3X1NA 5DRZB 1ETA1 2XZQH 3SDCB 4CN4A 1FO0A 2C9UA 2YQGA 5FX3A 4DUWA 4NZFA 4XOCA 1ZA3B 4JRXA 1ZV2A 1AE6L 4MXQD 4ZJ9A 4BFOA 2WLNA 2GITB 1SDDA 4XMTA 4W4OA 1P7KB 3U7WH 2CAKA 2P7TA 1FNEA 5HHNB 3MKGA 4NCDA 1DJHA 2EH8L 5EC1A 5C2BH 5EZJA 1AO7A 3TO4D 1HIML 3IJEA 4IRZA 1K72A 4G6JH 3BEVB 4H88H 4NQEA 3KLSA 5F7KC 2EYSA 3ZTNL 2AANA 3GTVA 1YNTB 3FDWA 3OQ3B 2QFPA 1D7CA 2XN9E 3IS1X 2MTAA 4ONGH 3T6QC 3D4YA 1MWOA 4Z7VE 1YPZA 1BM3H 2A74C 4ENED 4JNXA 1PEWA 4KK6C 4OCWH 5DUPL 2Q76A 3TYGH 1MWAL 4IGBB 3DYOA 1Z9LA 4FQPA 4FXGB 1IB5A 2QV2A 4RQQA 3AS0A 3LVTA 3MKKA 2F9BT 4R83A 3ZKQD 2VXQH 3V4VB 3ZR5A 3Q6FB 2EICA 1QO3A 3DX8B 4HPOL 2HMIC 4WDIA 2FT7A 3D25A 3GSXB 3TEYA 2W60A 4S1DD 3ZKNC 4ZMAT 1PU0A 2ESVE 4UNIA 3O2DL 1NTDA 1QQDA 1QSEE 5JIIA 1O75A 1Q1JL 2A5UA 1MN4A 2V5TA 4WUKL 4JHAH 4TVSa 4AGLA 3ARWA 3GO1L 3RNKA 5HVHC 5KSVA 1S7RA 3W9DA 1YEDB 1MVUA 4HKXB 4X4YB 2DIAA 3CC1A 2B7DT 1RSFA 2C7UB 3Q2NA 2L0DA 3FUDA 1MCDA 4YSAA 3KPOB 1S3KL 3LDBB 4P59H 4HUWA 1KTJA 1OAJA 2AZUA 5LDSA 3PGCB 4CGUB 3HG1E 2Y23A 5TDOB 1NBVH 2NQDA 4UM8B 2C3HA 3CVIL 3LKQA 5A2LH 3UPRA 3HPLA 4HGMA 3RX9A 3ROOA 4G9FD 1JXJA 5DMJB 1NJ9A 4I1NB 2QTEA 5CZVL 4LT7A 2PO6B 4P5MB 3L3OB 3O2WH 3N91A 4OF8A 3O8XC 4APQD 4ZMXA 3QXAB 1NCWH 4N25A 5D71H 1BBJB 4XH2A 1AZZC 4CGTA 5F88A 5HJ3A 1BF5A 2WD0A 4J2XA 3BZFA 1FNFA 1GGIH 5A2KH 1C5DA 3ZHKA 3GXNA 1MHEA 3D6GA 4G6AC 1JCKA 4XBPB 3VSVA 3QNXA 1JWUA 2CMRH 1A7OL 4PGDB 1N59A 4Z7UB 2VERN 5TK4A 1RIUH 1AE6H 2J21A 3FTUA 3SQOH 4I0PC 2YWYA 2ZWSA 2GBAA 3O3DB 5CF3A 5IHZB 2YMOA 2EVGA 5GZND 3ZE0E 5CMAA 5EU7C 1T7ZA 2QSTA 5GS2D 4BGDA 5JZ7D 1OAXH 2NOYA 4HALA 1JTOA 1M71A 3MOAH 4XP6L 1D7BA 3BESR 2Y7NA 5AD0A 3LB6D 1TETL 2LV4A 4JFDE 4JL2A 4NKOA 3RNQA 4Y19A 1INDL 3IU3B 1E9PB 1NFDF 2EKJA 4BZYA 3EGDB 2ICES 2G3MA 2VQ4A 2WTOA 2JWYA 5C0NC 1HHIA 4N2NA 4WO4A 3VSUA 5A3ID 1O6VA 4JO1L 2ZONA 3OJMB 2NPLX 1YAIA 3WSQH 1KXVC 1PD0A 4G2AA 2CPUA 2Y1AA 1JMZA 2NY2D 4I3RL 2IAND 3CZFB 5I8CB 2WZ6A 3BVVA 4Z76B 4DN3L 3NJGA 3VYPA 1BYPA 4Y2DB 1MHHB 4A7UA 4JO3H 5GS0D 4CBPA 5D7SH 3FTGA 4LBEB 5FUZH 2ICEB 4GJTB 5IVXE 3ARRA 2X4OB 2IADA 5HPOA 3CSFA 1D5MA 2ENQA 4YIQA 1AHMA 5JHDA 2ZXQA 4NPKA 4A2FA 2FD6H 2RCSH 1OD9A 2YN5A 4ZW3A 1XEDA 1JPTH 4CSZA 4AYMC 5F7MC 3B7TA 3VUAA 3F6LA 3V52L 1TF4A 3FCTA 3US1A 5TE4H 5FW8A 2ZUUA 4Y1AB 3VU1A 1EZVY 4RFNC 2FECL 2EDJA 3ML9A 2B08A 5AG9A 3EDKA 3S5LG 4DKEL 2PN5A 3BWUF 2AK4A 5D1XD 3W81A 2V4LA 4A7TA 5HYEA 4M03A 5FW6A 4BSWB 1BEXA 1MFBL 4G42B 5JW3L 2I7SA 2CK2A 4Q6IA 3CFCL 2FR4A 4I3RH 1BZ7B 1KEGH 5J56B 1EUTA 1VDGA 1ONQB 2ZKHL 3EHBD 3PP4H 4F37K 3BUIA 4XPBL 1HWHB 2X1QA 4JFTA 3ZL1A 5E6UB 5T5FH 1GL4B 3OAWA 1JBJA 4JDTL 1M53A 1LLAA 4X42A 4PS4H 2DWXA 4JDZB 3UYOD 3PHOB 4R7NA 4W1TA 3TV8A 2OX5B 3TFKC 3QXAA 1TNNA 1NGYB 4NNXA 2EC8A 5LG6A 1I9RH 4PRNB 2MQGA 2VM4A 3D18B 3P02A 4AL8H 3LJ3A 1OSZB 2IO5A 3X3GL 3BVNA 1FH2A 4PRPE 4I4WB 3F64A 5DYOB 4FQXA 1JFHA 1U8IB 3EJSA 4APXB 3RFZB 1BWWA 1B0WA 2FH8A 2CMRL 3SZKC 3IFPA 4M00A 3MNWB 3RAJL 3V6FB 3KXFE 4TTDD 4WW2F 3UYPA 3ZKSD 2X4UA 4R2GB 3VFSB 3RBSA 2X9ZA 5HYJE 1HK6A 3KJ6H 4C59B 3QZPA 5EBMA 1R0AL 4M6MH 1X6LA 1NIEA 1CLOH 3L7FB 4MMZC 1H6FA 1VA9A 4ONOA 3PFQA 5DJ6B 1XIWA 5J89A 3RUGE 1B3JA 2GC4C 2YJQA 3MLZH 4H8WH 3V0VB 2NX5E 3S34L 4N2DA 2ESVB 1E7VA 1AD9A 2RH0A 3GPSA 4OCRH 3GMRB 4Y4KC 3RWJB 4RFEB 3RVTD 3WIAA 2KT6A 2EIZA 6PAZA 3QG7L 4Y4HB 5DQ9B 2KUTA 4WW1A 3IMTA 3QDME 1E9PA 4M1GL 5I5JA 1H3PH 3P2TA 3OSVA 3FU7B 2QHRL 2ATPB 1TQVA 4M56A 4MJJA 2WUCH 4GT0A 3F7VA 1PLAA 1Z9SA 5K9JH 2EYSB 4LAJH 2J8UB 4OF3A 4WY7L 4UOZA 1MCHA 4XP1H 3NACL 5FWRA 1BCIA 1IUZA 3TONA 3UO1L 1EEUA 2EXYD 5LBSL 2AEIT 2NUTB 3I02A 3L3JA 5F1NB 4FABL 2EAEA 4KKAD 2GSGB 1HHJA 1VEOA 1BMGA 1W72A 3BUYB 4MASA 4DH2A 5CJ5A 5LNGA 2XHNA 2VABB 3I84A 1M05A 5LAXA 3QIWC 4YWGH 4QRRA 5I75B 1RZQA 1XWVA 5F1IB 1RUQH 1MFMA 2GTZA 2L7QA 5INCB 1XGQB 5K39B 1JHKH 3S2CA 1N2RB 5E9NA 3EDFA 3TA3A 1JPGA 15C8H 4HQQH 3LIZH 2W60B 4YHIB 3HZYB 3QT2A 4GQQA 4YSUA 4LHUA 1A14H 1DLFL 4XNZC 2W0LA 1GYUA 4KXZI 1KBPA 1LO0L 5AAPA 4U7KA 1WWBX 2EXWC 3GINA 1KWKA 3VFMB 4WWKA 5ENWA 2NY7H 1U2HA 4OGYL 4L5FL 2CXKA 2COVD 4KKQA 4O4YH 2JCWA 1AP2B 4I2XA 4RMWA 4ZDHB 2VN4A 3T8XB 1MREH 5FEBA 4YK4C 4GO6B 3JTTA 2Y24A 1VESA 1VAHA 4K55A 4PB9H 3LEVH 5D1ZC 2BVUA 2DQJL 4HH9A 3WFZA 4UQAA 1ODUA 3BVXA 1UXSA 1JGIA 4HOXA 3DOHA 5KYYA 4UCFA 1UEYA 3QXUA 3TF7C 3BVDB 4I1RA 4ZQKB 2HJFA 2IFFL 3BZ5A 3PAVA 4PI0A 1HAUA 1PW3A 2BHZA 2JLPA 3ABMB 3G6JB 3O3BA 2WKGA 5ICXA 4AC2A 2E7LC 3PGDB 3IPFA 3ZYOA 1D5XB 2VL4A 1ZKAA 2X05A 4NZTH 1XVSA 1JPSL 3UTPE 1P5UA 4L8DB 4LK4A 4QT5B 1F58H 1WA0X 5E8DL 1NC2B 3BAWA 2WIIB 4HXAL 4XN2A 1C08B 5KSBF 3HHSB 2CGRL 2PTVA 1OQOA 3LKPA 4X6CE 2RQ8A 4S2SB 4FJZA 4CJ0A 3I9AA 4WI4A 2CBMA 1XGZA 2P7TB 5EBWA 3JVGA 3M7OA 5KSVB 3VU2A 4JFED 4A7GF 3FSWA 3W9DB 4AQ1A 3IGKA 3ALWA 4BHUI 3WMQA 5KVFE 4EUPB 1TYRA 1V54B 3BN9C 1KENL 5ID1B 4AYID 5T1LB 2ADFH 3KCPB 1DQJB 3PWLA 4NCC2 3DIVA 3WJJC 5I28A 4Q6KA 5LKNA 3Q9PA 4P2CG 1YNTF 1FFNB 4RFEA 3SZ6A 3DPDA 2YN3A 1AQHA 3DURA 1AQDB 4RQQB 1GAFH 4G3YL 1NFAA 1ZV5A 4YDKL 1RZPA 1EGJL 3BKYL 3QZWA 4PJ5A 5FCSH 4HUCA 4L3EE 1FNLA 1V3KA 4AY0A 5JHLA 5MERA 4IGBD 4KOBA 4MS6A 1JGEA 4P3DA 2WQRA 2JKWA 4XMVA 3GRGA 1B90A 1RJZB 4JFFA 4M7JH 4YZFE 4WNSA 3MU3A 2CJSA 3FTGB 3GKWH 4LBEA 1RK0A 3EO0A 1HS6A 2X4OA 3VXNA 4Z7UF 2GSGA 3PABA 1UTDA 5C08D 1CICC 4Z5RA 1Z1WA 2R0WL 4WEMB 4CW1B 5ITBL 1PCXA 5GISH 3PHSA 3HC0A 4XGZB 4M5ZH 1V8HA 2AJ3B 3OJVC 1NICA 3ULSA 2XKNA 1IKNC 1IMHC 1TCMA 4KZEH 1UACL 1YEGL 4AXWA 3FCTB 4PH8A 5DJ2A 1WFMA 5JXED 5E8NB 3PE9A 3ROOB 5I6PA 2DQIH 2JKNA 1PG7H 4P2RE 4FJYA 3JV4B 2IWFA 5IROA 2MNWA 5FPIA 4Z7VA 5ADPL 5L0QC 4OI8A 1BWMA 1USZA 3EOYG 4LVEA 3O3UN 2V3FA 3MJ9A 4UT7L 1XBDA 3WMPA 3B9DA 5IHBA 3MLTB 1IGFH 1I7ZA 3SKUD 3E9UA 5C0IA 2ALWA 3NSDA 5C6TL 3MRFB 5FGBC 3OF6D 1QFUL 5AW1B 3VGBA 4X7EC 5KYWA 1G9HA 1IT9L 2YWZA 3CWGA 1IV8A 1WBYB 3AT8A 2ZUXA 4NZRH 2XPZA 1SXAA 2O5XH 4U1IB 4HJ0C 3RVVC 1MF2L 3RUGA 1NKOA 3E9TA 5AOMA 4HBQA 2ZXGA 4N0FB 1L7TL 1NCDL 1NL0L 5TQ2L 3D0VB 3I9IA 4PGZA 4PRBB 2EEAA 4BK5C 4HIXL 1YECH 2R29A 4OD2A 4YK4B 5CZXD 2X0UA 4ODTL 3WGUB 4GG6A 4AH2A 4P4KD 3FHQA 1KCRL 1LO5A 2VUYA 2ATAA 3QULA 5BO1L 3DVNB 4LCWA 2EC9T 3LD8B 3PUCA 1A3LL 5T3XL 1IM3A 3QDJA 4Q7DA 4B3EA