1EZUA

Ecotin y69f, d70p bound to d102n trypsin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
140
structure length
140
Chain Sequence
SVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGFPYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/inhibitor
molecule keywords ECOTIN
publication title Compromise and accommodation in ecotin, a dimeric macromolecular inhibitor of serine proteases.
pubmed doi rcsb
source organism Escherichia coli
total genus 18
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ezuA00
1ECZA 1N8OE 4NIYE 4IW4C 1SLXA 1EZSA 1SLVA 1SLWA 1EZUA 1P0SE 1XX9C 1XXFC 1ID5I 1XXDC 1FI8C 1ECYA 1AZZC 1SLUA 1IFGA 2Y6TE
chains in the Genus database with same CATH superfamily
5DJCA 5E23A 3NFNB 1C5BH 4BRJA 1MRCH 1VCAA 4R2GB 4ERSL 1M1XA 3V79C 4PJAA 4FKHA 2DOCA 2E4FA 1XR9B 3W81A 2UZXA 3ILPA 4L8SA 3WNKA 4S1QH 1SMOA 4AMKH 1CO1A 4TV3A 3ECUA 3MV8E 3B2VH 1MJJB 2CJTA 2OMUA 3LKOB 1T7XA 1ZVSA 3OGCA 1YY9D 3UXFA 1HOCA 4GFXA 5DFVD 3MLRL 1I8LC 1GHFH 4GSQA 3WNOA 4FNUA 4ZO9A 3UIZA 1RULL 4A6YA 1EJFA 1MCSA 4N90E 4OJAA 4XXCC 2R1XB 3TWCL 2GJZB 5HYJB 5HYEA 2L7JA 1JHKL 5CCKL 5KANI 5JMOC 1RK1B 1CGYA 4PY8I 1MWAB 3KCPA 1E0OB 4LXFA 2WZPA 5GS0C 1A6PA 5ANHA 3MRCA 4P05A 4PRBA 3RTQA 2P42B 3AU1A 5L4MA 3BQUB 3G6DL 3DGDA 1Z9LA 2X70A 3A6CH 2PNDA 2VLLA 5E9AA 4ZUUB 1R33A 1R3LA 1EEZB 1WZAA 4XN7A 1S7VA 3OX8B 2CWRA 3H9SA 3BGMA 4QHUA 4R90L 4IJTA 1IGIL 3NA9H 3VQMA 1EO7A 5H94A 4MD4A 1X4XA 2CGRL 2XN1A 4M4RA 2KZWA 3Q3GB 3MRLA 4JJ5B 2FEJA 5IJCC 1BFTA 2EDTA 2XV6B 1BYNA 1KOAA 5IMLA 4XBGB 1OT1A 2DD8L 2EYSA 2V9UA 4HIHA 4JFFE 3K2UH 4I2XE 3VB9A 5J3HD 4WVRA 4NQDB 3TZVA 3ZT6A 4U1KA 2GEQA 4YXKH 3C6EA 1MG2C 5CP7B 4LOEA 1H6FA 5BV7C 4LSQH 3LZOA 2VW7A 1UZGA 3QDJB 2Y2TA 4JQIH 1YPZA 1MCHA 3IN2A 3PAZA 1NC4D 2CKBA 3SGJA 4EZLA 5L8LB 3RWJB 2FR4B 1ND0A 2OK0L 4RQQA 5E08L 3DHUA 1FVDA 1Z3GL 3KPNB 5KYYB 1J0IA 2R2HB 4U1NA 4X80H 3F7RA 4ZOAA 5E0QA 4APQD 1J0ZA 1E42A 3EO1B 3ZUCA 1NGWB 4TPRL 4NSKA 5D1ZB 4P46B 3GTNA 2D31B 2XA8H 3ARGA 3GKWH 2LW3A 3CU1A 2OP4H 3J27A 3WO4B 4EUPG 4A55A 3DUSA 4XNXH 1WT5A 4A7TA 3TS8A 2WVTA 1WWCA 5E5RB 4E9YA 1A6TB 1ZAGA 5EDXA 1E4WL 3I6KB 1ZMYA 5CUSH 4WI6A 5GRUL 12E8H 3HZKB 2GTWA 4YGVB 4YDKH 4MHHI 2RCSH 2XN9D 4ISVA 4JG1L 4YSEA 1HHHA 2G5RA 1JZDC 1ZANH 2DQUH 1G6RH 4NYLB 4U3HA 3UTSA 4FABL 4NBYB 7PCYA 4CMMB 3HE6D 4HZLB 4IRZH 2AV7B 4JG0H 1RY7B 4P9HL 4RISL 2FYYB 5IQ7L 2NZIA 2BVOA 3P9MA 2VZ1A 4RRPA 4PV1C 3NACH 3W2DH 4U1MB 3VXMA 3NPSB 3QJOA 4ALAL 4PPTA 2R0LH 3NGBB 5DUPL 4BHUI 5F0MB 3REWA 2P26A 3LTVA 1OGPA 5LGKA 5TQ0L 2ICCA 4KO7A 5DZPA 1UT2A 5EU3B 3D85A 2DY2A 1DSFL 1L7TL 1P4BH 1AQKL 5KVEH 2A1WL 5SWSD 5DEFA 4OD3L 5KAQF 3IDMA 4HIXL 4JHAL 3MCG1 4H8VA 2YEZB 2X4OA 4Q89A 4WRLA 3TBYA 3TN0D 1E27A 1LO5A 3HKZA 1RMFH 1WBZB 2WVVA 4H8WL 1UZ8B 2FEDD 3VE0B 2ENSA 5DJAA 5TH2A 2BS71 3PPSA 3OKKB 4WI3A 3UIYA 2LVEA 4PJDE 2JB6B 1RZIB 1OHQA 2BRQA 1IBDA 2GCYA 1WZ1H 4LASH 5DQDL 3QUYA 4A7QA 1K6QH 3TBWA 2IDTA 3MRMA 2OAAA 4P8QA 4ETQA 2P1YA 3UCRA 4HHAA 3WLBA 3OZ9H 3ZL4L 1YY8B 4BHUA 3CZJA 1FLRL 3MV11 1JNHA 1I3RB 2J8UA 3CPUA 1KELH 1OGAB 1SDDB 1WQVT 4MXQC 1UJ3B 4OBSA 3R06A 3DO7A 2APVA 3GFUA 4HX1A 2MPAL 2VERN 4LVHB 3FL7A 5I8OL 4MMZA 5AW5B 2NW3B 2DQHH 4QWWC 4JFOB 4J3BA 5EWIL 2H2PD 3KG5A 1T83C 2DQDL 4MQ7A 4ZMVA 5I16A 2VC2B 1UGNA 3GSNL 2H6PA 3L7EB 3OPZH 5B39A 4Z7NB 5EEXA 1M6UA 1RSYA 3OJVC 4GI6A 3QQ3A 4YS4A 4M56A 1QLEB 5G4OA 3BP6A 4LIQH 1D3CA 4MMXC 5J56B 4PWHA 1CF8H 3Q8BA 4JFQB 5DUBA 4NJAH 3ZGIA 1J8HA 5GIRB 1JZ7A 4RFNB 4JFXB 1NLBH 4KMTL 1LO0H 2H26A 1QVOB 3FQTA 4L8BB 1G7IA 1QEWA 5T1KA 3UYOD 3ARFD 1QSED 1UXMA 3ZE0B 4ZNCD 1G9EA 1G4MA 2TRHA 2OQJB 4NCC1 2R56L 2MMXA 5MENB 4BEIA 4PW3A 1XEDA 3IJHB 3R0MA 1CFTA 4Z0BH 5H35B 3RWHB 2DLEA 5GGVY 4E0RA 3AG4B 4H88L 3K74B 4X7EC 3MYZA 3N85H 1M7XA 2X40A 3U9UA 1T03L 2D7MA 3BUPA 3HTLX 1BZ9B 4FTVB 4NXKA 4F7EB 3CXFA 1GW0A 5D9SA 5LO7A 3S36L 2NLJB 4I87A 5EU6A 3SQOL 4PVLA 3NFSH 2XN2A 4EPSA 3EGXA 5ICYB 2ZWLT 1MVFA 3RNQB 2JV6A 3L5XL 1KG0A 4MQSB 1ACYH 1CE6A 3LRKA 3QR1A 2ZUXA 3GK8H 4WFFD 5I5JA 1BAFH 1F2XK 5BRPA 2F7RA 1ET7A 3L3GB 3LZNA 3SBQA 3BH9B 1F56A 1W72H 5JW4M 5KZCD 2Y7OA 5CCGE 1R0AH 2X7LB 2AJSH 5GRVL 4EMZA 4KC3B 1DHKA 3JVGA 1L3NA 3LJ3A 4HGWB 4RESB 4Y5VC 4NRXB 3QFJD 4U6HB 3T2QA 1L0QA 3QIWA 2W95A 1FVEA 4F91B 5LXGL 4UILL 4FFTA 1C7TA 1A0QL 1U8NB 2BS8A 1JHTA 1L6XA 1UWGL 4NKOA 3GMLA 4R0LA 4Y4HA 5KVDE 4QTFA 3GSXB 4FYTA 5I66B 4QYAA 1WAAE 4C83B 2LOEA 2A74A 3MRKA 4FXGC 1YMHB 1SF5A 2ATKB 4PS3A 4X9FA 3WNLA 4QRQB 4BSVB 1MH5B 3I9GL 1FFRA 3KMDA 1BVNT 3WUZA 3SDDB 1LHZA 1YUKB 4PG2A 5FO7A 3ZKND 4ZTPL 5F1NA 5AZEH 3U4AA 3KGSA 4IRSA 1E4XH 1MRFL 5CGYC 4PLNC 3C5ZA 4UTBA 5FGBC 4L1LA 2NCEA 3ET9F 3GSWB 2YD5A 3MBXL 4YHOH 2B0SL 4NPYA 4E9QA 5BRZE 1D5RA 3BT2H 3US1A 2ZOKA 3R18A 2YD8A 5IHBA 2NY7L 2VE6A 1JK8B 2ZIDA 4FQQA 1ZDSA 2HT2C 4PY7B 4M43L 1LMIA 4QRPD 4JRXD 1Q72L 4OTXH 3VD3A 1JUFB 1RSFA 4X9IA 3T77B 1GAFL 3U7YL 1PCSA 5F3HB 3UBXB 4XNBA 2J44A 2CHDA 2YPVA 4P2OB 4Q52A 3LKSB 4UOW0 2NQCA 5I6XB 2EUWA 4ILDA 3VFVB 4MNHB 4MZRA 2WBJC 2VDMB 3LZQA 5CBAA 1KNOB 5AVZB 3TVMD 1O75A 5JDSB 4AM0A 5B38G 2OX5B 3SO3C 4AUJA 4DWHA 1RZQA 3QJTB 3VI4F 2I07B 2YAQA 2BCKA 3QI9A 5A43C 3G5VB 4Q9RH 4ZAKD 4MA1C 1GGBH 1LM8V 4XNZC 3AGWA 1WWAX 2VO8A 2FJHB 4BZ1H 1S2EA 5GJSH 3B43A 2QSVA 5JW3H 3MRBA 4HKBB 4TQEH 1G7LB 3RVVD 4OLZH 1ETZB 15C8L 1NGZB 4YHML 4N2LA 4QHKI 4E41A 1KCSH 4QRBA 1WEJH 3BIAX 5I75C 3NCWA 5EF1A 1NBZA 1IGCL 4F7MA 4A66A 1YNLH 3VJ6A 3HG1B 4OD2B 2L04A 1RUQH 3RU8H 3SGDH 1U6AL 1U58A 3CFEA 5J6HB 2VDLH 2VOTA 2XWBB 2FDBP 3C60B 3DBSA 5FIEA 4AEEA 4HUVA 1EHXA 2HLFC 4XGZB 5LG6A 1SLWA 3FRPG 2HJFB 5K1JA 2H1PL 1WTLA 4P23B 1P9MC 2EO9A 2E6QA 3GSRB 4Y88A 4E42A 2JK5B 5GS1B 4GAGL 1QTSA 3LPGA 3BVNA 3IETB 2NY6B 1KB5L 1FNEB 1CMOA 4NLAA 4PJ7E 2V3DA 4OLWH 4A7SA 4CC4C 1M7DA 1EJ8A 2COQA 2BHFA 1FZJA 2OJZL 2K3HA 4K73A 4P4KC 4P5MB 1JNJA 3EGDA 1WHOA 4JPQA 1DQKA 3INUL 4P5KA 2FJGB 1M2VA 4G7QB 2VW4A 1GZPA 4PQXA 2WB1A 4MA3B 1EJOL 3RL2B 1U8HA 4O5LL 1EGJH 1S7WB 4N5EC 3LS5L 1R5VB 4U1JA 2Z7YA 3N41F 4LESA 3RL1A 3UO1L 1QSFE 4WFGD 4NC2B 3WE1A 2YA1A 3FBQA 2AK4D 1AOZA 4ICWA 2CXKA 2XXMB 3FU9A 1CXFA 4I0CC 4OF6A 3U48A 5KW9H 5EBMB 1MQKL 3QDGA 4HFWA 3RJDA 2Z3FA 3L2MA 1GS6X 1HH9B 1I7UA 3X3GL 2K6YA 3C5JB 1IKNC 1GYUA 2ZWYA 5KTEL 3MREB 4PRHA 4S1DC 3QUMH 5FO8B 1IV8A 3EYVB 4EKXA 1MFCL 2R69L 2IANA 3VXRB 4P9ML 4GINA 5ID1B 3BUYB 5DRNA 2PWHA 1WS8A 2CRMA 2QDWA 5IKCB 3CFQA 1EXUA 2PKDA 2ZSWB 3CBKB 3ULVL 4HOZA 3ZDWA 1AZRA 3K6FA 5DEZA 4XAKD 5J12C 3VD5A 3G3LA 3W39B 1UKTA 1UD3A 5DLLA 2C9UA 3ZE2B 1IZJA 2XBTA 4XXDA 2JXMB 1U93B 3D4GA 3BEWB 2PPCA 2XNAB 3KDMA 1OF2B 5I82A 4LCCA 4V2CB 3UPCA 3SO5A 4R7NA 3NG5A 3IJ8A 4XNQA 5ID0A 2MPVA 3GWJA 5C0RH 2VZUA 3CBRA 3V4PL 3JV5A 2F1BA 4IHBA 4O2EA 4EDXA 5AG8A 1VPOL 3NUKA 1E9QA 1IGFL 3JQOB 4KROC 2V3EA 3BDXA 3GDCA 3GJFH 2VXVH 1I4FA 3QQDB 1WTGT 1MXDA 1IBFA 3ZSSA 4ZUWA 4OZGF 4LAJH 4XX1G 3FOMA 4DN4L 1I9RL 1I8MA 1JPTL 1UWYA 3UAAA 5IK3A 1IM3D 4HUXA 3EFDH 1QATA 1TZIB 3B5TA 3OMAB 1BVNP 5F9JA 3LYRA 1HQRA 1J87A 2W5PA 3T1FB 1FDLH 1U8PB 5D5MF 4I5BB 1KPUB 3UEQA 4ERSH 3KPRA 1HK6A 5D7IE 3SYCA 5FYKL 2X3BA 3MOAL 1XIWB 1KLGB 1GGIL 3O4LD 2DJ4A 1VSCA 3IDIA 2E9IA 3AM8C 4NUQA 2QGCA 1J9CT 2N3JA 3B3IB 3PDOA 4YBQC 5CJOL 2O5ZL 2P5PA 5E6ID 1OALA 4KH2A 1I7TA 3CZLA 3HRZA 3CMOH 1B6UA 4DPAX 5IB5A 4CGTA 3BO8B 4D94A 2Q8BL 2WKGA 1M9WA 1XAUA 3TA3B 5FUCC 2NMSA 1FIEA 1GS7A 2XTJC 4WU5A 5ADPL 1UKQA 1WC7A 1FV1B 2HFEB 4O2FB 3TWCH 4K9EL 2VDRL 4XO8A 5F1OB 1OB1B 2H3XC 4XR8C 4OM1L 1G0DA 4HIJA 1NANH 2KYIA 4B6ZA 2AJZB 1FZKB 1XH1A 5DQ9B 3IGUA 1DJIA 4WKXA 3VFPB 2E27L 5IB4A 1FQ9C 5J06A 1SDAB 3OC8A 3EDEA 2R9HC 1L6PA 5KBNC 2NW2A 4B97A 2BSSA 1BVLA 2X6AA 3T65A 4FI6A 2ZSVA 3VFNB 2NQ3A 4QRAA 4N2MA 4R90H 5FOBA 4PS4H 4OW6A 3NSDA 1IGIH 3IJ7A 2CGRH 2V17L 2VUOA 3H6AA 4HV8A 3QG7H 2J1ZA 2N1KA 1QUPA 1LWJA 1X5KA 2DD8H 5C86A 5I73C 2A6IB 1A4BA 1KTLA 3B83A 3VI4B 3UBGA 4YDJA 2SEBA 1HH6A 1YEWA 4IOSA 4JN1L 4LCYB 3STZA 4R7DA 4DZBB 1R47A 4Z8FH 5B3SB 1SYSB 2PYFA 2RH0A 5L7XH 2Y1YA 4JO5A 3PABA 5ESVA 4Y4KB 5BUGA 4NXSA 3NZHH 4WUUB 4Y7OC 5D1QD 1JVOA 3HR6A 5DMGC 4F2FA 2OK0H 4YNYA 1IQDA 4DGIL 5HSFA 1K3IA 2WP3T 5E08H 1Z3GH 4IOIA 5I6NA 1K4CB 1NFIB 1YQVL 2YSSA 3PUUA 4UZSA 3QJRB 4L3EB 4TPRH 4JRWA 3AQYA 2WVSA 4X99B 3NSXA 3G6JF 4H1LH 2MQGA 2P28B 3ECVA 4ORZC 3ROOA 2EUXA 4P07A 5FECA 2BP0B 4QXUL 4G5AA 4N2GA 4UM8B 5KSAB 3SKMB 1UA3A 1HHGB 3MBWB 3QG6B 2FBRA 4OSUL 3TTYA 2VW6A 5I5RA 3VA6A 3PWPD 3QPQC 1P84K 5GRUH 5JOFA 5EHFA 4APQA 3B9EA 3ULSA 4JG1H 2KPNA 4BXVA 5LXVA 5F8QC 1VGKB 5IQ7H 1ZPLA 3KPQA 3MV7D 3VMOA 2MQCA 4ZO7A 5DUPH 5F7MC 1U33A 4X5XB 2QVIA 4N6QA 5TQ0H 1MCOH 5EZLB 1KGYE 2EKJA 4XWGL 1Q9WB 1EZUA 1DSFH 1XGUA 1AQKH 2J57A 2FT7A 4OD3H 3EOTL 4I18A 1BG1A 1IBYA 4HIXH 5B8CA 5IQOA 4JHAH 3STLA 3HE6A 3C5SB 5H4ZA 5KBDA 2YUWA 1OAJA 2B8OT 2GIXA 3KYOA 1KPRB 2ZXGA 3IDYC 4HJ0D 2OZ4A 3V6BR 5HHQA 1VGEH 2YC1A 2XVKA 1LP9A 2XZQL 2VMEA 1O9WA 3MCKA 4GUQA 1SHSA 2NT0A 4JLRB 4WNSA 3RZCD 3C6LC 3CLFL 2FWSA 2IAMA 5DQDH 4NI6A 5SWSA 5I1LA 1C7SA 2V6HA 4U6VL 4TQHA 3W1ZA 5J89A 2B08A 2IALB 2PYED 2DBJA 1M71A 1KCRL 1OW0A 1RD6A 3TN0A 3UGEA 2EXYD 1JWSA 2G5BA 3FS9A 3S96B 3FXIC 4FLSA 3ZL4H 4QF1A 3L7FB 3CFTA 4ELKA 3T0ED 4AT6A 4FFZA 5DJCB 3H56A 2MPAH 3F7QA 3F65A 4WW1A 5I8OH 1M1XB 2ZQKA 3ISYA 5FYLL 3ULVE 1LO4L 5AB9A 4LRIA 5ISZE 3EJTA 1HCZA 3DARA 4MWFA 3K71A 4NM8L 2UZXB 4I1PA 3ILPB 4L8SB 3BRGC 3AMKA 3MRJA 5H37G 3T04D 2F5BL 4JJOA 1A7NL 1JGUH 4EQ3A 1MCWW 2C1OA 3FAWA 3GSNH 3ZO9A 3F7VA 5L8KB 3GHBL 4NO2B 4XBPA 2OMUB 1ZVSB 1N8ZB 3OGCB 4JZOB 2NR6D 3S48A 3L1FA 1X5MA 3OB0K 1HXKA 3R1GL 3H1ZA 3MRIB 1FO0L 1XB8A 4KMTH 2O1AA 1CB4A 3G6AA 1YNTF 4NKIL 1CL7L 3TNNB 1W16A 1IAMA 3DX7A 5D5MB 4BFGA 1ANUA 5F8RC 3BSZL 1F97A 4MCYA 4EN3D 2X05A 1EXGA 3TTSA 3KCPB 3ZKXB 4KPHH 3S5LB 2R56H 2WJ5A 4XX5A 3V6ZB 3K6OA 4NZTL 3AU1B 1FFPB 1WIOA 3ALWA 3HG0A 5EZJA 2X70B 1QUNA 1RURL 4OAWA 4LDOB 4KRPB 2Y23A 1T03H 3VH8G 1N5AA 3NJMA 5FYKE 4U0QB 3QUZC 3BMWA 3BGMB 3ARFA 3GZQA 3H9SB 1QSEA 1RUAH 4KTEL 2GVYA 4OQTA 2AAAA 4ZS6C 4DVRL 3TU6A 4GKLA 4M4RB 2XXGA 1C16A 1R46A 3SDXA 4PD4J 3L5XH 1AHWA 2EYSB 1IM9D 4FQJH 4Y8AA 1O9ZA 1M7UA 2F8OA 3DOHA 4HSCX 1Q9OA 5EH1A 4A7GF 2HX9A 2V2TB 3TZVB 5SX5K 1FI8C 1S7TB 4U1KB 1DQMH 1P5UA 2GBVA 4WO0A 4A2FA 3MJWA 3AITA 4AQOA 3KPSE 3LNIA 2VXQL 2WLYA 4PTUB 3I2CL 2CCLA 5LXGH 4UILH 2X2JA 3QDMA 2A6KA 3DMMD 3LH9A 1A0QH 2CJSA 1PU0A 1UWGH 1M2OA 3DNKA 2WN2A 3P30L 4U1NB 5EORL 1JWUA 2A5UA 3HPLB 3O2VL 3CDZA 4MXQD 1RUPL 2WQ8A 4YVUA 2X42A 2Q8AH 3HZVA 4OFYD 1TYJA 4JPWL 4HJUA 3TXAA 4HOWA 1EUUA 3PUCA 3QRLA 4BK5C 9PCYA 3I9GH 1OAKL 3QFJA 3FT3A 1BQHB 1OP5K 1QQDA 4ZTPH 3DI3B 4K9JA 3P4OB 1MRFH 4NENA 3S37X 4I3GA 1HDMB 4X7DC 4LQFL 2WQXA 2EH8L 4E5XG 2NY7H 2GTWB 3KLDA 2HTKC 4R7LA 5D1XA 5KSVB 3EDKA 5JIDA 1HHHB 2XWJA 1X7QA 1KDIA 2VNCA 4D0BA 2WLJA 3KGRA 3MA9H 4F57L 1AMYA 1IAKA 2BVOB 3P9MB 4JRYD 3ULUL 1S9VB 2BW5A 2MEJB 1X5GA 3ALXA 3FQRA 3NIGE 4GKNA 3L4TA 5BNXD 1UA7A 2FCBA 1GAFH 3PAUA 3REWB 3U7YH 3SE4A 3ZUNC 4M8RA 4YSCA 3E1F1 5J5EA 1IFRA 4F9PC 3TH2T 1JF5A 2JKIS 1W91A 3D85B 2FLBT 2VDKL 1MLBA 4EI5D 5DEFB 4DGVL 3IDMB 5EC1A 5EBWB 4JRXA 4H0GA 2R29A 1E3ZA 1JCVA 2X4OB 2X4UA 5T3ZL 1JJUA 4U3CA 1I1YA 1JBJA 1I1AC 4N0UE 3OAYK 4WEUD 2B9BA 2NQDA 4HCRH 4ELDA 4E68A 2DYSB 2PTUA 2QGDA 5DJAB 1W0WB 5TH2B 4G6AC 2ZKHH 4K7FB 3HZMA 4GQ9H 1M3JA 15C8H 1UD8A 4YHMH 4FQIL 4KX8A 2CZNA 2AEPL 1NGPL 2GCYB 4UF7C 1Q4NX 3QUYB 4KKPA 3MNVA 3QULB 3TBWB 3TVMA 4K3HA 5CJ5A 4IRZA 3OKDA 3JTBA 4ETQB 1IGCH 2FAUA 4KV5F 5DC9B 4HHAB 1SRDA 3EOBA 5C7ZA 3AMLA 2Y7NA 2QSCH 1ZLEA 4ZAKA 3ALPA 5CEYA 5AVUB 5K59F 1JNHB 1E40A 2J1KA 2J8UB 1NCDH 1KPVA 3VGHA 3G9VA 2YMTA 4F24A 1D9KC 2V9TA 3DO7B 2J8HA 3G5WA 5D7EA 3L13A 2H1PH 4PTTB 4Y2OB 4X6DF 3F7YA 3VM7A 4QOKE 4MQ7B 5I16B 3RWCA 1V3JA 4GAGH 5T3XD 4WEBL 1DLHA 2R1YA 1N10A 1JMZA 1OWRM 2P48B 5J7CC 4LEBA 5G4NA 3FB6A 1AO7E 3OJMB 4ZX3A 3L5JA 4QJ5B 3INUH 1QTPA 5KSUB 1J8HB 1YCSA 2ZUWA 2RQ8A 4P3DB 3QARA 4FD0A 3FB7A 4ZW3A 4YSDA 1URIA 1D5XB 3FQTB 4TL5A 4UT6A 3H9HA 3LS5H 1J9SA 1NEUA 1YEKL 4LP8A 3GGWA 4GAJL 4FHKA 4P2QE 5T1KB 1SOKA 4LL4A 3UO1H 4L23A 4JANA 3BP4B 1IBZA 4BJLA 2HAZA 3NJIA 3H42H 3CSTA 1MQKH 3TT1L 5JZ7D 5DO2C 1E3XA 2C7FA 4OJEH 4J27A 3X3GH 2E47A 3LXUX 4J3OH 3D33A 4MJIE 2ZCHL 1AIZA 4OZFG 5C0DA 4AEHL 5DT1H 4D9LL 2R69H 2X4RA 5EU6B 2VJXA 4P9MH 5I8EB 1N2RA 2K78A 2AK4A 3I6SA 1O5PA 3D30A 3HN5A 3KVPA 4YJZL 4GRLD 1F90H 3ULVH 3LRGA 1DVFB 1KG0B 3V6OE 3AROA 4MB3A 2P49B 5IFJB 1ED3B 4GRWF 5TK2A 4AENA 3HFML 5KVGL 4IBSA 2F1EA 1D5BA 4DKEL 1E28A 1S7SA 1MW1A 2HX8A 3QRGL 2YA0A 3IN0A 4JY6A 3LHAA 4EZKA 1FL3A 3LKPA 3QIWB 3RUGE 3CFCL 3ETTA 3X12A 3V4PH 1ICTA 2ZPKL 3AJ7A 1JHTB 4XPFH 3GLDA 2YAMA 1RP9A 3VD9A 3NBNA 2DBLL 1S9YA 1VPOH 4D0DA 4DO6A 5AAWC 2A74B 3E8VA 5CZXD 4ELME 3T4AC 4PRID 3RGVC 1T20B 1FH2A 3QFDA 4L4VE 2LU7A 4DN4H 1I9RH 3GLEA 3TBSA 1AKJD 5GGRA 3ROLA 4AIZB 2H0EA 1E4XI 3AC0A 3EGSA 5F1NB 2YEVB 4IRSB 4UYPA 3ZLQC 1TJXA 3BDYL 1M6OA 1QZ1A 1XSIA 4PEEA 1ZA6A 5FYKH 3MOAH 2ZOKB 3N1MC 2CJUH 3OR6B 5HYQA 3MI6A 4UQAA 1GGIH 1OGSA 4QYOA 4NDMA 4AEIL 3T6WA 4J8RA 2GJ6E 2WLLA 3UYPA 5CJOH 5EBLA 4N5ED 2L7QA 3V8OA 1IM3A 1Z3RA 1ZJBA 4FFVC 1R3JB 4Z3IA 4Y19E 3VFSB 3FZUC 5LN4A 2DWSA 2DWDA 2PXYD 4BFJA 3BP7A 2WTRB 1S8DB 4GG6E 2DIJA 2P24A 4PCTA 1V7ML 3AAZA 4HWUA 1K9TA 2ZUVA 4K9EH 5I1DA 3HB3D 3RFZA 2DWTA 1NAMA 3T2OA 5HDWA 5BPPA 1QWHA 1SVCP 2NNAA 2FWUA 4MNQD 4OM1H 3TYFA 3RILA 3CSFA 2NPLX 1SVZA 5E6IA 2ZX6A 2BCKB 4I0PA 2FJUB 1KBKA 5A7BA 3MLTB 4MKTA 3IFLL 4IOFC 4QEGA 5JPNA 5T5NG 4X0KA 1TETH 3BX7C 5FCUH 2DIEA 1NDGB 1YUHA 3CFUA 3VD4A 1BIIB 3MHZA 1TEGA 3MXWL 3I02B 3WENA 1CFBA 4YSSA 3OKNA 3OKOB 4GSXA 3VJ6B 2X4NA 4TOYL 3QZBA 4I2XA 1VFMA 3HS0B 4DP1X 3CFEB 5IIEA 2CO3A 5CGMA 1PX3A 1UB5A 3DPDA 4XWOC 4YE4H 2C9AA 4OJFL 2ZOTA 3I3DA 1QSZA 1PJ9A 2G75B 2Y2YA 2XN0A 3IFPA 4PB0H 3OHXA 1J0JA 4TF4A 3L8QA 2A0LC 2F54D 2JKXA 1MLCA 3Q8CA 5DD6A 1OCCB 1GZHC 3L3DA 3WIFA 5J9PA 3P40A 1YG9A 4RFEA 1T1YA 1Q9LB 3NJVA 4W70A 5HHPA 3BVNB 2FO4A 2CLZB 4OCNC 5E4EC 1Z7JA 4BZ2L 3L4VA 4DGIH 3F6IA 1D7FA 3QHZL 1QOKA 4YSPA 1HQ4A 4HF5L 4BE5A 3REVB 4BBWA 1XCTA 4KGJA 3DGGB 1DJXA 1N3NA 1YQVH 3EGDB 3UACA 4H8PA 4P5KB 4FLHA 1M2VB 5DF0A 4JFYA 2VJ8A 2X89D 3MDJA 3S2CA 1GZPB 3VI3F 3VRLF 3KL3A 4Z9KB 5FFOA 1BBDL 5FKAA 2WXPA 4MJ6A 3TASA 1VJSA 4QXUH 5D1QA 1E5BA 3LPFA 1ZLVH 1IC0A 4TSBH 4YBQD 4NQEE 1HHKA 3WS3A 3RY6C 2F5AH 2VN3A 5D93C 4JGJA 2AVGA 4ZOBA 3DRQB 3QDGB 3L1GA 4HFWB 3QAZB 2WTPA 5E24E 2ZX5A 2WO3B 4RAVA 3QQ9C 3RUGB 4Q6YA 4Z3HA 2XTJD 4PRHB 1AGBB 1Y1DA 4RAUA 5KN5A 1OL0A 3PWJA 1CDJA 4NN5C 2G0KA 2W92A 2IANB 4BFNA 4P5SA 4EXPX 4LSTH 2DKUA 3KJ4B 2HVKA 3NSYA 4ZFOL 4NKMB 1X5JA 4DZ8A 5DS2A 4JY5L 5D4HA 1EXUB 1H5BA 1XH2A 5F70A 3PWPA 2BVTA 5AOLA 4PRPE 4XWGH 4WI7A 3LOWA 4GXUM 1B2WH 2JKNA 1DQIA 3MLUL 4N2FA 2R9HD 3EOTH 4ENZA 2IDFA 1PZ3A 2CM6A 3Q6FB 2RFXB 4FFWC 3KDMB 4QXWA 5IEKA 2W9EL 3MV7A 5JXAH 5IWLA 3BZEB 5ID0B 3GI8L 5D2LE 1I9IL 3DOSB 4PYHA 4PJDA 1QBML 2XZQH 5LBSA 3ZPDA 3KW7A 1NWPA 5J6GA 4M1DL 1T1WA 3NK3A 3ECQA 5EUOF 3WJLA 1E9QB 5C9JB 3ZR5A 1AR1D 2VMJA 4U6VH 3CXHJ 1I4FB 5AG9A 1KCRH 4HETA 1MWAL 3DLQR 4ZUWB 4LVNB 1CQKA 3PV7A 1YVLA 2Q6WB 1I8MB 5SX4H 3QP3A 5HI5D 5IK3B 1YRKA 3OZLA 2DLGA 4GO8A 4HUXB 4TKWA 4RWYL 3TNMB 1CXLA 3PXLA 4NFCA 3TGXA 1HQRB 3LNHA 5DMGD 2DJUA 3ABZA 4AG4L 2BDNL 4DQAA 2XV0A 2F53D 2ZUTA 3KPRB 3P54A 1DJZA 4Z7UB 3P77A 3RZCA 4JFSA 3N1FC 4WI2A 2ZYRA 2PYEA 2J21A 2F5BH 2XY1A 1A7NH 3O2WH 4GSUA 3PDOB 5ITFA 4Z7OE 1P4IL 1YA5A 4PRNA 5C0AE 1AI1L 4JO1L 1VFAB 5BQ7A 4FJYA 3FCUB 1F58L 2I60H 3JSSA 4QLWA 3AG2B 5EU4A 3WKQA 4UM9B 3T0EA 1XL6A 1EZVX 3PE9A 4ZPVA 3PWLA 3ZL1A 4F1ZA 3LIZA 3R1GH 2BVUA 1FO0H 4YK4B 4FS0A 1BQKA 5DRXA 1WC7B 2BNQD 1CL7H 4JM0A 4HPHA 2NT1A 4UCFA 2E59A 3BSZH 1S5IL 3O6FA 1TJIL 3DSNA 1NANI 1SVBA 4HIJB 4XPGL 4F27A 4FA6A 5KVFL 4LNVA 1S3KL 3EFFA 5FDYA 3LDBB 1AYOA 2NR6A 1ZVHA 1KYUA 3C9NA 4XVUC 1CF1A 5B21A 3O2DA 3SDAA 2FNWA 2BSSB 5E9DE 3D39E 1SDYA 2XQBH 3WFBL 4IRJA 2XWRA 2IV9A 2F15A 4LLWA 5FOBB 4CMHC 3F7PC 4KTEH 4EN3A 4QKXB 1HEHC 3B5HA 1K72A 2YAPA 5ABZA 3K81A 5C0NC 3L2LA 4GBXC 5CGTA 3T1WA 5ITBL 4KHXL 1OM9A 3MLXL 1FF5A 2SEBB 5CLYA 5EO1A 1MFUA 3BWUF 3GSOB 1REIA 3CGTA 4R7DB 1AXSA 4X5WA 4BUQA 5GGSY 2PYFB 1ZS8A 3PRZA 1HZHH 1NIEA 4JFPA 4W4OC 2VXQH 4O2CA 4XP1L 5EOQL 3I2CH 1LK3H 4EF3A 2WQVA 2BSRA 2AEQL 1QZNA 3B9KD 1WAAA 2MIZA 1IM9A 5EORH 5I0ZA 3EDJA 5CCJA 3K80A 4JN2A 3O2VH 3EYUL 4ODHL 4HXBL 5DK3A 4IU3A 3WBDA 2GI7A 1ECZA 4R4BA 4JPWH 4TM9A 5DJ6A 2QADB 3MPCA 4WWKC 2Y36L 1OAKH 3ZU8A 3ROOB 4ZMAT 5IHUL 3LSOB 4O02L 1CFVL 1QPPA 4KKAC 5CJ8A 4PJ9D 4RWHA 3APDA 5F3BA 1HNFA 1MFNA 4LU5L 1NC4B 3DMMA 3SYOA 5BRZA 2EH8H 1D6EB 1PIGA 5JUEH 1UA6L 1BAWA 5JOFB 2WZ5A 3OWEA 4APQB 1JN6B 3ULSB 1QHPA 2YD2A 4GXUN 3I85A 4HFUL 4ODSL 5E2TL 4OFYA 4KRMB 2XX1A 2D9CA 3KPQB 2XIIA 3AW5A 3ASOB 4DEPB 2EUVA 2OA9A 1NFDE 3MUHL 2IDCA 3V4LA 3UEZA 4ZJ9A 2YBRA 2DI8A 2D2OA 1JXFA 1F0LA 1INDL 5EEVA 1XSOA 2VDKH 1ZT4B 2X2IA 3IKCA 2W0LA 2XN9B 3ZDXE 4DGVH 3BAEL 5IEHB 5B8CB 1JWMA 1U3JA 1HL8A 1TQSA 4M6ML 1OWWA 4H1LA 3HE6B 3UABA 1E5UI 1ZHNB 1IJNA 4M5YL 3APFA 4E9RA 3FC8A 4JRYA 1D2OA 2J6WA 2ADJA 3QJSB 3BH8B 3D3VE 3QUZD 4JQXC 1QLEL 3KYOB 4ZS6D 3KS0H 3QB7C 5HHQB 2YC1B 3KLAA 1LP9B 1E4KC 5FFLA 3V4VL 3BUQA 3DIFA 2ZOLB 1U3HD 4H25A 3MCKB 4FQIH 4N2CA 4MMYA 3A4EA 5F9WB 2AEPH 1NGPH 1W80A 2YWZA 4EI5A 5I1LB 1G9ML 3BEVB 4ZMZA 1JZ4A 4N8VA 1M71B 3TN0B 1JPFA 1G0YR 2YXWA 3WTUA 3M17A 5T5NF 1NZRA 3CFKB 1UQSB 4QF1B 2KI6A 4ZFGL 4ELKB 2DQTL 3UTOA 2NTFA 5DHVA 1E5AA 1G94A 4ZS7L 4AT6B 4QHNA 5C0EA 1NUGA 2YK1H 5CN2A 2HA1A 4D9RE 3FFDA 3HC3H 1LMKA 4WW1B 2BIPA 3MYJB 3D25A 3CTTA 1N6QL 4P2QD 1BM3H 1MCPH 4TVPL 4MWFB 3GXPA 3K71B 1X5AA 1A3RH 4WV1B 5EUOB 4WEBH 3F7VB 3T9WA 2D7TL 1OTSD 1AC6A 2FRGP 4XBPB 1IGTA 5ICUA 3U82B 6TAAA 2XA3A 1DVTA 3D2TA 1NBVL 2J71A 1K5NB 4ES9A 5TPWL 3DTUB 2QPFA 3QHFL 4UMSA 4R96A 1MXGA 5F7LB 4IBTA 5KJRH 1CGWA 1FFNA 1E90A 3H3PH 3HE7C 2BNUB 1F4YL 2HTKD 4P48A 5I30L 5J11B 2V2XB 1UZ6E 2BP5M 3DX7B 3R0NA 5HYJE 4MCYB 5L4FA 3ZYZA 1OCRB 2C7UB 1ZHKA 2CG9X 4MB1A 2Z7WA 3BYTA 5EF3A 3TT1H 5LVEA 4XCCL 1KLUA 3IM1A 3ZSTA 4C54A 1L0YA 2KPWA 2PPEA 1RHFA 1S78D 2BINA 4PGDB 5FGBA 1N12A 3GM8A 4I48A 4U33A 2OZNA 2ZCHH 4DP7X 3B2PA 4KUCF 3SYAA 4AEHH 5KANG 1SXCA 4CGUB 1N5AB 4WK0B 3ARFB 2A6JB 4HUKB 1QSEB 2HTLC 3BAXA 3O41B 5K1VA 3CFMA 3K8LA 1TZ8A 5LAPA 3CC5B 3SDXB 1PZUB 1DFBL 4DPRA 2D7OA 1AHWB 2EKSA 3BKJL 1OGTB 4P9HC 4OLXL 3W9DB 2VLRD 2WIMA 4EQ2A 3HFMH 3HC0A 4NQDE 4ALAC 3DPBA 4DKEH 4YHYB 2A9DA 2QTEA 2VERA 1FG2B 5KJ7E 4R3SA 4HGKC 3LB6C 3WD5L 3DVGA 4Y4FB 3L4UA 1WA2X 3QRGH 3IMRA 2P8PA 3CHRA 3CFCH 5JW4Q 3QDJE 4GW4A 4KKLC 2V8MA 4RMTA 2A6KB 1ORSA 2ZPKH 3QORB 4PJ8C 4XPAH 4GRLA 2CAKA 3V0VB 4J2XA 2DBLH 4G3YL 2XZAL 1QR4A 1JWUB 1KV7A 4XVTL 4L1DA 4LVOC 3U6XS 4A2HA 1D9KD 1OZTG 2VDML 4RRPG 4GKOA 2KDGA 1S9WA 4H8WC 1M05A 3SYPA 5C0FB 2IXQA 1KCUH 1F1AA 4K7PX 4M00A 4HW6A 5GGTA 3QFJB 1F11B 3FT3B 3WN5A 4TSCH 4IBWA 1QQDB 2APXA 2CM5A 1JCKA 1JRHI 5MEQA 5IUSA 5D7IA 4JKKA 4NQXA 2IADB 3P9LA 2QKIC 3U46B 2ZF8A 5B1AB 1UOVA 5DJYA 4AEIH 3CDCA 4PRIA 1X7QB 3V4UH 1EAPB 1IC1A 3QIUC 1WBYB 3N43F 3A24A 3QJZA 3CZFA 5FKPB 2BRRH 2OL3A 4KNUA 5E7BA 4Z18A 3S3CB 2GUYA 4PJ5D 3S98A 3UJJH 4BINA 3IXAA 5A40E 3QVAA 5AW4B 4X4XB 2YUZA 1PIFA 5IMKA 1ZE3H 4Y2NA 3U7AA 4U3XA 5E2VH 2X2UA 5AVYB 5F21B 3FULA 4LGSB 3EFOA 3LV3A 3MU3A 5FYJL 3CCHA 5SV4A 4HIEB 4CSZA 1JTTA 4QRPB 1TG8A 3PL6C 2X4UB 3QNXA 4X0NA 1GGCL 3SCMA 5CLWA 4KK9C 1I1YB 4NCDA 1ETA1 1YSOA 3FUKA 2N1TE 1HL9A 2APSA 3VWJA 5D4IA 3A6BH 2PXYA 4M8QB 2BW4A 1U41A 2GUOA 2X1QA 3IFLH 3HZMB 2A83B 3U6XA 1ZLDA 4LLUA 3ZTJG 3UAJD 4P5TC 4LL1A 4B7LA 2NZ1A 1UYWH 3KWWA 3FO2B 1XT5A 2VGLM 4NERA 3MXWH 4JKWA 3TVMB 2P7TA 5B39G 4MNQA 3OKDB 2IEPA 4LLMA 3QYMA 1QLRA 3EOBB 4TOYH 3V0IA 1YC7A 1ZY9A 4ZAKB 5JIKA 3MROA 3VTAA 3DYMA 4ZMXA 3RDJA 2HJKA 4DK6A 1KPVB 4OJFH 2N0KA 1OGAE 2L7UA 1DDHA 4KJQC 2IWFA 2BVQA 2WINA 3U4EA 4M7JH 3F7YB 4JFHD 3I9PA 8PAZA 5EO9B 3KLQA 1E2VA 1DVXA 1A9EB 2FQEA 4XMKH 1WDAA 2XKNB 4IU2A 1FL5A 4MYWB 5IBUB 3RGVD 3RWCB 1DLHB 3DJTA 4BZ2H 4HCRA 3GXTA 3QHZH 1CJYA 3BT0A 4HF5H 4Z7NE 4E9XA 3FB6B 5BOJA 4J12A 1B4RA 1B0RA 3WEBA 2JCCA 3NJXA 1YEJH 3QEHA 1HJBC 3SQBA 3FB7B 3VU2A 4QJ3B 1MPAH 2VDNB 3FU8A 3H9HB 5HI3D 2P80A 2BPBA 3GGWB 1DJYA 5HGBB 4XAWL 5DSCA 3RY5A 3ZE0E 2L4OA 3GF8A 1SY6H 4HG4J 5DCCA 3NP3A 4FFVD 2QPDB 2VQ1A 3O8XD 1HE7A 5MENE 2H47C 2NNXA 2LHAA 2X89A 5IROC 2BXZA 2BOBB 4ZO6A 43CAB 3E80A 4CVZA 5C0DB 4DGUA 8FABA 2FT6A 4FTVE 4TVPE 2X4RB 3V0WL 1L9MA 5AOIA 1YLBB 2APFA 3A21A 1N2RB 2OMWB 2AK4B 2J73A 3BAIA 3FQ1A 4WI5A 3OHMB 1JTPA 1O0VA 4JY5H 4P3CH 3GRBA 3T0WA 2ZD0A 1A2YA 1DQVA 5BJTA 1R6VA 2PP9A 4A7VA 1HKFA 3MLUH 4IOFD 4YIQA 4JM2C 4AENB 2ADFL 1QFWM 2HT4D 4DESA 5IF0B 1T7YA 1E28B 2FO8A 2W9EH 4KNQA 1ZLWK 4GLRI 1H9VA 3CDGB 5GHWL 3GI8H 3LKPB 4F9LC 3ARXA 1I9IH 1U0QA 3X12B 2P9RA 4RZCB 2VLME 3PHQB 3B7SA 1MHEB 2A4ZA 2D3JA 4H0HB 4M1DH 4L1HA 5GISL 2FUQA 3DURB 4D0DB 1LE9B 2K1MA 4N6RB 3L3JA 1JZFA 1MWAH 1UOLA 1WIUA 3QA3A 5JHDD 5JHBA 5I9QC 4FQCL 3TBSB 3O0RH 4RAHA 5ERWA 4RWYH 2K6ZA 4M5ZL 1QP1A 4UQ3A 4YHNB 2AJVL 3T6XA 3RWGA 4KJPD 4HUWA 3P4MA 4PJFF 5CSBA 3K1DA 3WG7B 1U8IA 4AG4H 2BDNH 3FT2A 3MX0B 3HUJF 2QVTA 1HFUA 1NGYA 1PG7L 2DMGA 5IQ9A 4BSWB 2XXCB 1ZA6B 2XLLA 3KL5A 4ZMWA 3BD3A 3WTWA 2V5YA 5HYQB 2NXYD 4Z76A 3TIDB 2EAEA 4NDMB 4LSVL 3BFQG 4TUKL 2IOOA 5LGHL 4FQXC 3VXNA 2WLLB 1LQBC 3FU3A 4D2NA 2H5UA 4XTRC 5EBLB 2X1PA 1BFOB 2QV2A 5F88B 1AI1H 4JO1H 3WGUB 1IM3B 2PETA 4U1SA 2P52A 1SPDA 3FCBA 2DWDB 3A4DA 4FADA 1A47A 2EVFA 2WLKA 1KGXA 2WVUA 2Z65C 5HY9B 5E9DD 3SPGA 2F53A 4WJKB 2GC7C 4JL1A 4XB3A 3VD2A 4BKSC 1ZVNA 2P24B 1XF3A 5CU5A 3RPBA 2AV1B 1AG0A 1YN6A 4M48L 1X5XA 2K4WA 1NAMB 1X9QA 3HHSA 3O4LB 1DP0A 1OD7A 3BW9A 7FABL 1TJIH 2NNAB 3TYFB 4TYUA 4N8UA 5F6IC 2CLRA 3TYGL 1PLBA 1RPQA 2EEBA 2NY2C 1S3KH 5E6IB 2VWEC 5TGBB 3CIAA 2CHWA 3D5OF 4PJIA 1T5XA 3N43B 4BFRA 4XN5A 2V2WA 5TDNA 3MMEA 4N2KA 1KULA 1XB3A 2VL4A 4IM8A 4X0KB 3V8CA 4G80B 1TQWA 3WFBH 4DUVA 5IY5B 2BNQA 4WTZG 3E8UL 2A2QT 5IR1B 5HJDA 4S0SD 1FZOB 3OKNB 4FFWD 2G2NA 1WFMA 3ZZ1A 4KHXH 3HG1E 5I18H 5EU5B 3DROB 3MLXH 1AD0A 2Y6SC 3G04A 1DCEA 4BDVA 4XCYA 3O4OC 1R19A 4RRPM 3GBML 5KBMA 2Z91A 4TSAL 1ID5I 5J9PB 4I3RL 5DD6B 3L3DB 5GRXG 3WIFB 3U7WL 3F58L 4XP1H 1KIQA 1T1YB 3F7KA 4FQHA 5EOQH 5FYJE 2KQMA 5HHPB 1Q1PA 2FSEA 3VO0A 3ULVC 2XG4B 1N18A 5EZOL 1R75A 1GPOH 1TZHB 5E56A 5FHAL 3BD4A 1P6AB 2JLLA 1XCTB 4KMQA 2ARWA 1N3NB 3EYUH 4ODHH 3ZX1A 1ZHLA 1SXZA 4HXBH 3WV0A 4JQVC 4DIXA 2DWYA 1ADWA 4JFYB 3BYYA 2QTVA 1P7BA 2NY1C 1FN4A 4KK5C 2VMDA 5AW0B 1P84J 2Y36H 4X7FC 1J1XH 3PREA 3JV6A 5IHUH 3L5IA 1CFVH 2Z4TA 4J6RL 4O02H 1J05A 1F1DA 4QPEA 3MJ7A 4DO5A 4Z7WF 5K69A 3OAZK 5D1QB 2C3VA 1HHKB 3GIVA 2ZOUA 1L7IH 1G4RA 3P2TA 4LU5H 3WS3B 4OD1L 3B9KA 2B5IB 1UA6H 3B5GA 1VEPA 1RHHB 4V1DD 4B60A 3C8KB 3UROR 2VIRA 4QO1A 4WENB 4G9FD 4ADGA 4LSRL 1NH6A 4HFUH 4ODSH 1LNUA 5E2TH 2DQEL 4WGVB 4HCIA 3FSOA 4AV5A 4MRBA 2HKHH 5KN5B 1EMTH 1U36A 2WPGA 3D3VD 2F08A 4DPBX 1CICC 3I6LD 4PJ9A 2ZX7A 3DX1A 3VXRE 4HT1H 4WJ5B 1JHLL 4DZ8B 3QH3B 3LZFL 4XVSL 4N25A 1L3WA 3PWPB 5AOMA 1TJGH 4NNPL 4AYDC 1PVHA 3U4BL 1OAXL 3INOA 1AQDA 3NJGA 3BAEH 3UG5A 5IB2A 2IBGA 4M6MH 5JQHC 2BVPA 1CLYL 2IH3A 2VC2H 5IEKB 3ZE2E 1KXVC 1OP3H 3MV7B 3UMTA 3F5WA 1QFWL 2MOGA 3MBED 1TCRA 1QLEH 2UZYB 3RVXC 1DQQA 3SKJH 1YHPA 2AERT 2LAAA 3KE0A 4HJGB 4WCYL 4K9EC 5I8KL 4TS6A 5AKTA 3OKMA 5J6GB 3FTYA 3VUAA 3HCVB 3H85A 4A6YL 5JPMA 1OE2A 5EG6C 4MDIA 5I0WA 1NTDA 1X7SA 1G9MH 3B2UC 3SZKC 2WXRA 5DK2A 3OMIB 3EHBC 3UAEA 5DS1A 3QXTA 4XMWA 4TLUA 3GUTA 3X1FA 4YFEA 4ZFGH 1I75A 2WBXA 3FSVA 3NJJA 2AZAA 2D7QA 1VZHA 5IBLD 1M57B 3LRLA 5AW6B 3MLZH 3DA0A 1M4KA 1E9OA 1F4XH 5C0GB 3KDPB 1RZ7L 3CN3A 1O5DT 1U3HA 2BO0A 2KDYA 3QSKB 4K3EL 3FN9A 1JDDA 4KQ3L 2GSIA 3X13A 5GSVB 2N7AA 4M4PA 1X5IA 3RZCB 1N6QH 5ACMA 1KBBA 4TVPH 4EN2A 5HYJD 5AD0A 1QD0A 1PLCA 3FUIA 3S3PA 5AEAA 2PYEB 5GZNC 5ITFB 1YMMB 4WWKD 2VXSH 3FMGL 2D7TH 1FGNL 5I71B 4KXDA 5BQ7B 1AO7A 3JZYA 3BQUD 3ATAA 3PGCA 3WIIH 1NBVH 3T0EB 2NUTA 3KS0J 2PTTA 3FONA 5TPWH 3SBRA 4H4NA 5CJXA 4KVPA 1Q94B 4ZD3H 3QHFH 1CXIA 2QKSA 4OFPA 1JGEA 5JO5B 2CO6B 5TF1L 3APNA 4ABVA 4E9WA 4ZX6A 5ESQA 4PJFB 4X6CF 3ZHFA 4AJVA 4P2QA 1F4YH 1IGYB 5I30H 3T6ZA 5TFSL 1K2DA 3VVWA 5JHAA 3HUJB 4IIZA 2KH2B 3DSNB 3NRFA 4C4BA 1HS6A 2CKBL 1CTMA 1W0YT 1RZ8A 4XCCH 3C9NB 2AMUA 3TO4A 3F05A 5F9OL 5IFHL 4CADA 3VFRB 4LLQB 3V0JA 4QHUB 4X5LA 3TPUA 3HNTL 1E5CA 5IFAL 5T1MA 4XNDA 5DC2A 3WIHA 3QDJD 4EN3B 5CKAA 1D5IL 5LB1A 2F2HA 1VKXB 4KJYA 1MJUL 3Q44A 4P2RB 5ALBH 1PFOA 1A9VA 3P1VA 1DFBH 2ZP8A 2VMFA 4L3CB 4FA7B 1I85C 1FGVH 5A6LA 4O4YH 5I5IA 4OLXH 3HLKA 3VI4E 2VSKB 5TE7L 2GFBA 4WU7A 3AQXA 1DANT 1ZS8B 1U30A 2JTDA 4KKBD 3WD5H 3OB8A 3OLGA 3RUGA 4P57A 4JFPB 2X9ZA 4WGKA 4G70B 3EXJA 2E9WA 4PLJD 4U6YA 4F2MB 4JHZA 4WUUE 4NFBA 2CGZA 5HD8D 1G6VK 3O9WA 2BSRB 1ZXQA 5K39B 3RX7A 4ZNEA 5J4MA 1QFOA 2XZAH 5FK9B 1IM9B 4XVTH 5ICXB 4L1TA 2G4EA 2VDMH 4FNQA 3AS0A 3KNBA 4L3EE 4R4BB 2BMKA 5DJ6B 3RWFA 3VXPA 2CIIB 3MR9A 1LDPL 4F92B 5DJXB 5EOCL 2WLIA 1FE8L 4LLVA 3EJUA 4Y16C 2GJJA 3RURA 5JORA 4Z7VF 1TZOA 2O61A 4AW7A 3CX2A 4OCWL 2YXVA 1GIGH 4JCWA 4HBCL 3ESNA 3GLAA 1XD1A 3FSZA 4OZ4A 4WIQA 4WI8A 4DT2A 1MDTA 3NCCB 2EDLA 1ET5A 4NKDA 5AYQA 2QLYA 4H8QA 5E7FA 1T89A 1CFNA 1J7VR 1I8IA 3BKML 3X2QB 4EI6A 2YMOA 1U3YA 4OB5L 3UG3A 4GG6A 3RDTD 2YBRB 2W0FA 4G83A 1OOWA 1PBYA 3WUWA 4Z7WB 3B2DC 3UC0L 5I26A 1TXKA 4LHUA 3W37A 2QL1A 3KBEA 4EIZC 2IAAC 3OQRA 1ITCA 3IKCB 4N8CL 1CGTA 3G5ZA 2QT6A 1UVQA 5FYJH 1JWMB 5E8EA 4FHJA 3V6OC 1ZS2A 3EYSL 1GGCH 2Z7ZA 5FDWA 4Y5YC 1PEWA 4CN1A 4JRYB 5AAMA 6FABL 4NP9A 4F1SA 4PJ5A 3TF4A 3Q43A 5DDHA 1NCUA 1NEZG 2YGOA 3SGEH 5FO2A 4ZXBD 3DIFB 3GHPA 4RA0C 4MMYB 3ZKMC 2GI0A 1BOGA 4EI5B 4NNYA 1HI6A 2BOLA 2YA2A 3NIDF 4Q6IA 3AADB 3QWRA 4L29A 4YVNA 4XC1L 2CUHA 1IAII 3FYIB 5F1KC 2VR5A 4NQCD 1CZ8L 3EUUA 4Y5XC 1FFTB 4QGTA 1XSKA 5TDPA 1A14L 5IHZB 3ORJA 4QKTA 1GVIA 3CVIL 4LK4A 3QXDA 2NTFB 3QRBA 3PFQA 5DHVB 1TQVA 4QHNB 4WY7L 1G7JB 3LKQA 4R26L 2UWEF 1KIUA 3FFDB 3KL0A 3UAJA 2X9YA 4LCIH 4XMLH 4JDEA 3L5WB 1F45A 2WYTA 2QELA 2WWNA 2AKRA 3FFOA 3PAYA 3PXHA 4HZAA 2XRAL 4UIKL 3NCBB 5IM7B 3IF1A 4Y5VB 2WIIA 4ZK8A 4BFIB 4MCMA 5HGGS 3EJZC 3VB8A 4QCIB 5LN8A 3NSFA 1YEGL 2PO6C 2RJMA 5E95B 1CE1L 3H9ZA 4U4IA 1FFNB 2DLHA 1PZ5A 5DJ0A 2Y22A 1ZOXA 5AVSB 4HULB 1X6LA 5D7SL 3S4SA 3VCLB 5D5ME 3BPLC 4FXGB 1EHNA 5B3JE 4XAWH 4CVWA 3EG9B 3Q1EA 3IWUA 4Q14A 3FO1A 1B6DA 3BSHA 1L4IA 5DR5H 1MJ7L 2XBDA 3T3PF 3HR5A 4RFOH 1II4E 4Y9EA 4E2OA 1HSAA 3LQAL 1OE3A 4NPJA 1PQZA 2Z0BA 4PJXA 5CEZL 1KZQA 2VB5A 4WNQB 1A8ZA 4OCRL 2RB8A 3FSAA 3LVEA 5C8JA 3DX6A 9CGTA 3DTDA 3SPVB 2PLTA 4LP5A 5TJWK 1ORQB 4BE6A 3H9SE 3PJLA 1JGLL 4LPWA 1GCYA 4KK9D 1SHMA 4X5QA 4NN6B 4UTBL 2KZ1B 4PRPA 2Q2EB 4B3EA 2E9GA 2CD0A 3O8XA 4AQ8C 1V7NH 3P0VL 5AW7B 3DHMA 2O6EA 3CSYB 3KPMA 4EOWL 1F1GA 4I89A 3ULUC 2KZBA 5EIIA 2ADFH 2G2RA 3DPBB 1VENA 4NRYA 4LSUH 4P5TD 2C9PA 1IEBB 2WHVA 2XQYK 3Q13A 4ODUA 3MFFA 4A38A 4OUUA 2WD0A 3QJUB 4QXTA 3SDDD 4JY4B 5DUJA 1PDKB 1MZYA 4OF5A 3SO3B 3I6GA 3MODL 1T22A 3OF6D 2V9RA 4WFHE 3WEOA 3WLWC 3IDXL 1ORSB 3US0A 1HU8A 3OAUL 2BP8B 2IQAA 1PX4A 2YPVL 3OTTA 4WZ9A 4MA1B 4XNZB 3KWXA 1QFHA 5F89A 5DU7A 5GSRA 4CRPA 5GISH 3QWQB 3QJHA 1MEXL 3QUXD 1A7OH 2Y3NA 4YHPA 5T5FH 4G2AA 1RUKL 3T0DA 2HUEA 2W60A 4TNWF 4KJQD 5GZOC 1S9WB 2IXQB 1RZKH 4FQCH 5F6HI 4OIBA 5C0BD 4DP9X 3LNDA 1TLKA 5ESAA 3WN5B 1S4IA 5FB8B 4M5ZH 5B1JC 5I75B 2SODB 1PNDA 3G5XA 4M29A 4OKDA 4FXLA 5IVXF 2A9ML 4H26A 5MEQB 2CK0L 2YGNA 1RJYA 2BHYA 4KGLA 1QW9A 4NQXB 1J5IA 1PG7H 3PLYA 3FF7A 2UY7A 3P9LB 2VDOB 1F41A 2FT8A 4KQ4L 4PJCF 2W65A 5DJYB 4PRIB 5BS0D 1H19A 4KI5C 4AJWA 2GHZA 5LGHH 5C0AA 4GRMA 3IGLA 3FHQA 3LPOA 1WPCA 5JHDA 4QTHA 1AKJB 2OL3B 1ZLUH 4TNWK 1R3IL 1HHJB 3N0AA 3IXAB 3PNWA 3VWKC 1SMAA 4OJDH 3SE9L 2LGNA 3AS2A 1JZ8A 3UJIH 3EJJX 2Q3ZA 4LE8A 3L95A 4Z7VB 4M8VA 4M48H 4NZFA 4PGEA 2V33A 1U92A 4QI3A 5BVJB 7FABH 3D0LA 3OVUB 1CIUA 3TYGH 1IAOB 3HZ3A 4QRSB 2NZ9C 4LAQL 2AJUL 4OGYL 1PAZA 1G7PA 5CF3A 3RNKB 4K94L 5F96H 2PXYB 1CIDA 1VFBB 3V0EA 4PJGF 2YLHA 4CKVX 4XNAA 5J13C 5E9DA 1GJIA 4RBPH 3D39A 4F8OA 4LLUB 1BJ1H 3CUPB 3DX0A 1JZIA 2EEAA 2Q76A 2EABA 2K7PA 3E8UH 4P23D 3HB3B 4JO4L 4L37A 3KH4A 4IW4C 1J12A 4AYMC 2P7TB 2WO4A 1JSYA 4MNQB 1JZHA 4LLMB 5BMFL 5D7KE 4X4YA 2O5YL 2CLVA 1JFQL 1AMXA 2ICEC 1EWHA 5IMMB 1CLZL 2HJKB 3WHE1 4DCQA 2J8UE 4QUOA 4ABWA 4R5TA 2QPSA 1DDHB 1JDCA 4TSAH 4U1HA 5CEXB 5J12B 2ED6A 2WINB 3U4EB 2PPFA 4I3RH 3PS6A 3AY4C 3N1QC 4WWOA 3S3BB 4OZIF 1H6TA 2JKLA 2YUVA 3JWDH 3ZE1F 3VACA 5IG7A 1NCBL 2CALA 2TSBA 5FHAH 1I8UA 4LO9A 3NIDB 4F3FA 1D7BA 1ZSDB 3BSGA 3TBCA 2ESVD 1NC2D 1J5DA 1T3FA 1S7UA 3LPWA 2LAGB 4NHCL 3VFOB 3WIAA 1PD6A 1N59A 2JCCB 4Y9GA 3O6KH 4WHTA 1PSKL 3GT6A 3ARBC 1INQB 3DVFA 2F54B 3U6RA 4J6RH 4PLKD 3VXQB 4YN3A 1ACZA 1HX0A 3QR2A 5DSCB 3IDGA 4S1RL 3LKRA 1XCWA 4NB7A 3DETD 4OD1H 2VQ1B 3EBIA 3GPSA 2CRIA 4G9DA 4GP5B 4ONFH 1FWXA 4I1NB 2MSPA 3B7TA 4LSRH 2DQEH 4AK1A 1NFDA 3FU6A 2J5WA 4UI2A 1HYSC 1KZYA 4H20L 4XP4L 5L2JA 1KJ3L 3NIFB 4QHLA 5EU6E 4LCUA 1JHLH 4FG0A 4W81A 1U8KA 5D96B 4YSAA 4XVSH 3QZMA 4MNGA 3IMBA 5BJTB 3NH7L 4V1DA 3U4BH 2B39A 3SPCA 2ZUQB 5LQBH 4YIQB 2G3MA 2XTJB 1CLYH 3U79A 2TSAA 5FX3A 1RIUL 3D3VA 3VXUD 1QFWH 1P4LB 3PWUB 1ROWA 3Q8AA 2DLTA 1ZE3C 5A2BA 4CBPA 4RETB 2E6JA 2BIIA 3VYOA 1KCBA 1SY6A 5DJ2A 4WCYH 5I8KH 5JW4R 2DYRB 1ADQA 3SJVD 1N19A 1QWUA 3U2IA 3KZ8A 4A6YH 4M93B 3RJOA 2OSXA 4XPHL 3QEGH 4DGYL 5DZNA 2OJEA 4JDVA 3SZ6A 4Z7QF 2E7LA 3Q48A 1H8NA 3J2PA 3QA3B 4J3UA 2E76C 3L6FA 4ZUVA 1XF1A 4LOUC 5JDJA 3MBEA 2EE6A 5CWSB 4IS6A 3SD5A 4UQ3B 3E0GA 3UZQB 3RWGB 3NJNA 1I3UA 5JHLA 4AQ1C 1U8IB 5B4MC 1JZ6A 1RZ7H 4G43B 4K3EH 4KQ3H 5I73B 5DHEA 1XR9A 3SKOB 2PWGA 4Z76B 1AR1B 2JKJA 4KK5D 4BKTC 3VRJA 4U1GC 1BJMA 3FMGH 4NOFA 1CURA 4U31A 1DQLH 1EH9A 3ARQA 1FGNH 4X7CC 2IMNA 2PTVA 2CCWA 4U1SB 5F7EL 4FA8A 2X9WA 1MQ8A 1VRSA 4OF0A 2GSGB 2C3HA 3NJKA 1N26A 5CU9A 1JGIA 2YPKB 1OSPL 2F53B 2NX5B 2YD4A 1EUTA 1T0OA 4K8RD 5CSZB 4WW2C 5IVXB 4TUOB 2EVHA 1SJXA 3ZDZF 1T6VN 3GB7B 1PMYA 3JTSB 1WCBA 5HYJA 3CHQA 5TFSH 4CC0A 1RK1A 4OCLC 2NDFA 3BW9B 3K3QA 3NZ8B 3W3BA 2IGTA 2OMXA 4WWKA 3DKHA 2GYSA 4PJCB 5DEGB 3S7GA 4TN9A 2VM4A 1BQSA 3BQUA 1UOWA 4PJIB 5D70L 3EYFA 3EH4B 5IFHH 1TQBB 4HKZA 4HQQL 4UINL 1NL0L 3MMEB 4TNFA 5D1ZI 4ZUUA 1D2PA 4NC1E 1YEHH 1TTGA 3HNTH 5DD3L 2BC4B 2VDPL 4LLDB 5IFAH 2BNQB 5IHWA 5KYNA 4WK4B 3OX8A 1N67A 4J7RA 4AUYA 1YC8A 1FIGL 1SOSA 3Q3GA 5INDB 4BM7A 2WMPB 4J3SA 2NNRA 3MLWL 3WU1A 1D7DA 3HAEA 4XBGA 2FO1A 1H6EA 3RVXD 1I7ZB 1VLXA 3IXTB 4V33A 3RIKA 3KLHC 4Z23A 2FVNA 1AFVL 4B9IA 4G7YL 4XCYB 5HHNB 5F7DB 2Z91B 2JLPA 5HVHC 2DJMA 4PJGB 5T1LB 1FFOA 1Z9SB 3D0VA 4N24A 3QDJA 3KGUA 1KIQB 4FQHB 1ZCRA 2WBKA 1MOEA 1BVZA 2ZTBA 3WFHB 1DO5A 5E99L 5KSAD 3RWJA 4CJ1A 2WXMA 1KJ2A 2R2HA 3KWTA 5DVMA 4MXVF 4KZ0A 1NICA 3EO1A 1ZHLB 4KV5E 5L0QC 1NCAL 1NGWA 5IJVB 4AOFA 3VSVA 3D4YA 5EIQA 3C6LB 2ZXBA 3HPJA 5DD1H 1OO2A 2BS9A 1FE8H 1J05B 2JJTA 2OMZA 3MJ7B 3TJHC 2EE9A 3ZMEA 4C57C 2OZ4L 1A6TA 2ZOOA 3I6KA 1RIHH 2FD6L 5F9AC 4IKIA 2YRZA 4ZOEA 2BJML 3TEWA 2P8LA 4HBCH 3ZE1B 4JZNB 3QDGE 3HZKA 4QO1B 1SN2A 4B9FA 2AQRA 5FM5M 1LNUB 4CMMA 4HZLA 5F7UA 2AV7A 4PRHE 3KBPA 3BKMH 1LJMA 4U1MA 5C97A 1NCCH 2P44B 5DD5L 5INCA 2EO1A 4MRCA 3DJSA 4PJ9B 5BRQA 4OB5H 5EEUA 4HS8L 3VMNA 2IANE 1ZJAA 4FFZL 4K5LA 2HPOA 3UC0H 5K9QI 5EU3A 1VADA 5EPMB 2HWZH 2KL6A 2YIHA 3FO9A 4R8WL 4UUJB 4Z78B 2O93L 2P5WD 4N8CH 3NEOA 5IB2B 1Y18A 2PCPB 2QSQA 3WMPA 2YEZA 2BVPB 1KFAL 5DHYA 1SLXA 3F5WB 2UYLB 1B4TA 2VH5L 1WBZA 1TCRB 3K2KA 1UZ8A 4JCLA 3WEAA 3IJYA 2ETWA 2C1PB 3NTCL 3RDTA 4NZ8A 3RTLA 4KKNA 4XCEA 4AGPA 3MZTA 3VGFA 4K71C 3FJTA 2JB6A 4LCWD 4U1IB 2Y5QA 4F33A 3KPOA 3V6FB 1CN4A 2EDDA 2EDRA 1KXQE 4MYPA 3RG1C 2WK2A 1CZ8H 4FNRA 5HJGA 1NKGA 3QUZB 3GUTB 1IVLA 4JGUA 1YYML 1A14H 4AC2A 2DEYX 3NAAL 5D1ZC 4P46C 2WSKA 5K5YA 4LBAA 4J3WA 4WY7H 3QCVH 4ZXBA 3WO4C 5G4MA 4R26H 1WFJA 1C5BL 4I0KA 4KXAA 1U3HB 4N1CA 2B3IA 5B1BB 1EZVY 3KPRE 4FX5A 2OULB 2LTQC 4Z7UE 4JFOA 2X4TB 3SKUD 5AD0B 4OQTL 3LQZA 2QQKL 3QJFA 3MACL 2XRAH 3AREC 4UIKH 3UDWA 4UNVA 4NQCA 3WE6A 3MUJA 3BCDA 1T1XA 5GPRA 1X44A 3PGCB 5A2FA 1YEGH 4WO4C 3D69A 4JFQA 3FONB 1HNGA 1GHFL 5GIRA 1CE1H 1JGEB 3WS6A 1XF5A 2HVBA 3NPSC 4JFXA 3CJJA 3DIDA 3MZGB 3NGBC 5ESQB 4L8BA 3DV4B 4RGOL 5D7SH 3JZ7A 1Q38A 4KKQA 4FAAB 1O7DE 2W0PA 2H2SC 2OQJA 3L4YA 2VCOA 2J43A 2AXJA 1TSRA 4FG4A 1R34A 4I13B 1MJ7H 1RZ8B 3M46A 1Z66A 5FYLD 3VD0A 3LQAH 5H35A 4CADB 3RWHA 2X9XA 2AS5M 4JKPL 4OCRH 4PP2B 3RVTC 5I1DB 3FN3A 4F7EA 3QYCA 4AQZA 5I24A 3D6GA 3DX8B 2VQ4A 1JGLH 1BPVA 2AEOA 4POZC 1Y0LB 4KJYB 3ZDZB 3Q06A 3GUFA 2B1HH 4G8FB 4LPXA 3QUKA 3VG9C 5LGYA 4MS8D 3IYLW 4ODTL 2PR4L 4DJMA 3P0VH 3NOIA 2EH7L 2K70A 4EOWH 2E86A 3BH9A 4JUTA 2E46A 1P69B 1ZK5A 4UNUA 3FB5A 4AYFA 2X7LA 4WU7B 4ACPA 5EEYA 2IDUA 3LIUA 3LRSB 1OPGH 4HGWA 3RKDC 3ZZLA 4PD4K 4U6HA 3QIBC 1UJ3C 4WF7A 3P69A 4PI2A 1QFUH 1C5CL 3MODH 1KF9B 3HBQA 4X83A 3IDXH 3HMXA 1I1AB 3AT0A 1U8NA 4FG6D 4G7SB 1RV6X 2BERA 2VN6A 3ZDYF 5I66A 1LEIA 1PTZA 3B3BA 2YN5A 2X28A 1MEXH 4C83A 2VLRB 5BW7C 2XI9A 1YMHA 1DN2A 2ATKA 3KNBB 2BMKB 2DQJL 2XA8L 4G5ZL 2R29L 1UFUA 4QRQA 3QNYA 1CD8A 2JTYA 3SDDA 3I74A 5HDLA 4IMKC 1BIHA 4HS3B 3BGFC 5JORB 2A9MH 4AL8L 2CK0H 4MFHA 1A7PL 2FLRT 1XXFC 1G9MC 3GSWA 1MF2L 1UHVA 4L1SA 4MJ5A 3ZIYA 4OZ4B 4BFFA 4KQ4H 4H1LG 3QUXA 2O4EA 1EDQA 1D9KB 3HBPA 3SPHA 1V5JA 2J25A 3BUBA 4PJ6A 2B4CL 4IRZL 2F8XC 3BVUA 1CFNB 1JFHA 1I8IB 2EDQA 1JUFA 3BWZA 3WEXA 1R3IH 4R7VA 1YEIH 2ALAA 3IB4A 4PP1C 4FYQA 4BUHA 1RJLB 5F3HA 3ESPA 1XR8B 5FHBL 3V5HA 3SE9H 3VRLE 4BKLB 2W0FB 4P2OA 3WTYA 3CX5K 3EYOA 1JF1B 1UACL 1VB9A 3MNZB 4HXAL 1IGJB 1A1MB 3VFVA 1P4BL 3TONA 2OW7A 3GYRA 3G5ZB 4N8VG 1TT6A 1KNOA 1UVQB 4LPYA 2OI9C 2XN9E 2QPUA 5BS0A 3G08B 3GSQB 3AXLA 3E2HC 1JPEA 5D7KD 2I07A 1TKWA 4LAQH 5FGCB 3BVXA 4OGYH 1RMFL 3MLVL 1DYZA 1TENA 2IDQA 4PJ5B 4K94H 4K2UL 4AYID 2WYZA 3SGEI 2FJHA 4P2YA 1H9DA 4YDNA 2Y7LA 4MAYD 1TTAA 1LP9E 5DLML 5C3TA 1G7LA 4PJEF 1NGZA 5C07D 2ITCB 4TRPH 3R19A 5FEBA 3DHJA 4X7SH 1BOGB 3ILDA 4JO4H 2A9BA 1A4JA 4NNYB 1QTYT 4UT6L 5I6OA 5IVNA 1G5AA 1WISA 2WWMC 4L29B 3H4FA 4XNUH 2LQRA 4M5TA 3A23A 1NFKA 2PP8A 1Z5HA 2UXTA 4R4NC 3HG1A 7CGTA 4OD2A 1LEKB 5TDPB 2H9GB 1JFQH 4UIMA 3WKNA 2ZICA 3WLWD 2XWBA 1CLZH 1KELL 3C60A 4WGWB 4XGZA 1JV2B 4UQ9A 3WTXA 3ARDD 3LMJL 5GS3A 2HJFA 5JXED 2I9TA 5T3ZD 2Z31C 4P23A 4XZUA 2X0WA 4PGBB 1A8JH 2IPUG 2E9BA 4MVBC 1NBCA 5GS1A 1S7RB 2BFVH 4ATTA 1HE8A 1AXTL 5I6KA 1GGTA 3IETA 3IF1B 2WIIB 1FNEA 2ZX9A 4X2UA 2YD6A 4FMVA 5EUOE 4XHJC 4NHCH 3UGXA 4P5MA 5FC9A 1I1FA 4NJAL 2AHIA 3PWVB 1S5HB 3NCFB 4KDVA 2IFFH 1PSKH 4MA3A 3RL2A 1BJ1J 1PZ5B 4ODWB 3ZZQA 4ANUA 1T66D 3PXJA 3S4SB 3FQXB 3C12A 1ZD6A 4F2EA 1HAUA 4KI5D 3RGVB 4I7ZC 5L2KD 3U30B 3VFUA 1JK9B 2ESVA 1DEEA 1DVFD 4PWIA 1NC2A 4PSPA 4DNLA 4OIFA 5JQ6L 1HH9A 1HSAB 2YRLA 3VSTA 2XVLA 1PQZB 2QFPA 4PJXB 2DRUA 2X88A 3C5JA 3F62A 4OCXL 3TEXA 1E43A 4S0HA 5C8JB 5FO8A 4XCFL 3DX6B 4RMQA 3EYVA 3DVNA 2F18A 4QRRD 4XP4H 1UOKA 3L08A 5I1GL 2VYRE 1FCGA 1HILA 2VRAA 1QSEE 5CD5D 1F00I 3BMVA 1G7HA 4I3SH 3L48A 1A7RH 2NYYD 2ZSWA 3LH2L 4QMEA 1ACYL 3HG5A 3O8XB 3SDXE 3GBEA 1UENA 3L45A 5GQBA 3WFZA 3KPMB 2E8YA 2R2BA 1CQYA 2AQ3A 3U9WA 1HIMH 1AP2A 4AYBA 3WL9A 2TAAA 2YZ1A 1WO2A 3FH8A 3M7OA 2CO4A 1OF2A 1MUJB 2ADIA 4NOBA 3ARRA 3MFFB 4OUUB 4GFTB 4QXTB 2K8MA 5CZRA 2DKSA 2AQSA 4UOZA 1AG6A 2L8AA 5AOKA 1T22B 3LEVL 2NXZD 4Y2DD 1OM3H 4GW1B 4O58L 2K6WA 4TULL 2IQAB 1RL1A 4DGYH 1CDCA 3QJHB 2P8MB 4UAOC 4UQEA 4WFFE 1NAML 2NY6C 1G0XA 3QZWA 5DYFA 2W60B 1OTUD 3C2AL 5I74B 2ZP9A 1HHIB 4G6KH 4N2BA 4AGOA 2FQFA 3H7BA 3QFJE 2YUXA 5AZEL 3G5XB 4G11A 1E4XL 3MUGA 2ZKXA 5HDRA 5JA9A 1U8PA 2ZX8A 2JMRA 4K07A 2X1OA 2VXTL 2VN5A 4F58H 2UY7B 5LCVH 4UZGA 2X2YA 1KLGA 3QS2A 1VFOA 4AIOA 1AS7A 1EAJA 3T3MF 3QJQB 4J2QA 2UUDH 2EDOA 1OTTC 1PY4A 3B3IA 1S7QA 4G6FB 3VX0A 5KBKA 3ARBD 4OTXL 5JHDB 4NKQB 5F7EH 4ZDHB 4EVNB 2X53A 2D3NA 5T1DH 1OP9A 4HH8A 3PNWB 4M1GL 6FABH 4FNPA 5E4EB 1HCFX 3TA3A 1OSPH 2Z0UA 5BZDA 3T8XB 5AENA 1Y6KR 3WY2A 2HFEA 4ZMPA 1FV1A 4PGEB 5IJKC 2NXYB 5T5FA 1U92B 3IMWA 5AKSA 1IT9L 2WNWA 2X44D 3D0LB 4IGBD 1GH7A 4XXWC 3ARTA 4PWGA 2OXGA 4QRPE 2AJZA 4UTAA 5GRZA 1R9FA 25C8L 4LMQI 4IIQA 5IW6B 4Q9RL 1Z0NA 5HDQL 4N2NA 5D70H 4OIAA 1OB0A 2WKLA 3IMVA 4HQQH 1U4EA 1YEDB 1JXGA 1QO3B 1NL0H 3QUHA 4HWBL 4UINH 5F7HA 5D93B 5JW3L 2WV3A 2Y7QB 3GJFK 1SYVA 2CPUA 5DD3H 1IBGH 3EYQC 3Q6GL 2Q76B 2NY5H 2Q86B 4L37B 4HD5A 1WEJL 4MCNA 3VXOB 4DETA 4YX2L 5L88H 3UERA 3RP1A 4CUCA 4X4YB 4EI0A 2A6IA 2HN7A 5I28A 3EDDA 3IDNB 3VI4A 3N40P 3FBKA 4QRFA 3IMSA 1SYSA 4U1HB 1V27A 4PJHF 1Q90A 2H32B 5DZ9A 2FSDA 4MLSA 3BZ5A 5E6ZA 4PJEB 5GJTL 1UG9A 4WUUA 2RIKA 3GBLA 5HI4C 1YQ2A 2ZCLL 4PY8J 1MCFA 1XIWC 4F3FB 3DUHA 1BYPA 1GC1L 1OSEA 1T3FB 3QWOB 4UDTA 1S7UB 1TTFA 3GO1L 4XI5C 5A7EA 4HPOH 1SBBA 4BCZA 1VHPA 1NCAH 4L3EA 5KYUA 5AUMA 4KX9A 4WHTB 2EO7A 5IP4A 3QJVB 3D87B 4GAAA 5MEPB 1QLFA 5BXFA 3U6RB 4MA8L 2BP0A 2YD3A 2JF1A 3FAXA 1OAZH 2OZ4H 1NPNA 2FD6H 5KSAA 3SKMA 2JH2A 4EIBA 1HHGA 3GRWA 3MBWA 1KMGA 5AQ0A 5LBSL 4ENED 2KC0A 3NMEA 3AS3A 4XO3A 1OK8A 1F02I 2X41A 3WXVL 3E9TA 1ZSHA 1DBAH 1VGKA 3A3YB 4X4KA 4JS7A 1SXAA 1MIEL 4BYHA 1XWVA 4LEOB 2V5SA 5DD5H 3L1OL 2VSMB 4X5XA 2MRYA 1YEFH 1YJDL 2Y72A 4HS8H 3MLYH 4IYKA 2JELH 4WFGE 4QTIL 1U8KB 5JOPD 2JQMA 2AK4E 1DL7L 4FFZH 4S10A 4UYQA 4MNGB 3ZOAA 5J1AA 1LK2A 1D5MA 1Q9WA 2DAVA 4V1DB 4J3OG 3BISA 4R8WH 3UTQB 1DJSA 3FUDA 5DA4A 3EXLA 4G9FB 4J4PC 4R5VA 4YSUA 3TJPA 3VG0L 4NJ9L 4F8QA 1J1OL 5IQMA 4EUPA 1UM5H 1QFWI 3D3VB 4KKZA 4RSVA 2VH5H 4FL4B 5ANMB 1A22B 3DXAD 3KYKH 1KPRA 4J1UB 3K6DA 5EOCJ 2CIKA 3SBWA 4HJTA 3EJYC 3P9WB 1WLHA 4H8HA 4ODXA 4TXVB 3NTCH 3X1NA 2FGWH 4OV5A 5J1TC 4Y4KC 3MKGA 4KDTC 4AGNA 4CAGA 3LIZL 1F5WA 2ERJB 3LVTA 5DJZA 1Q0EA 4JLRA 3S5YA 3LQMA 1UASA 2P5WA 1F8TL 4LKCB 4JDVB 3IK2A 2IALA 3GMPB 3T6VA 3THMH 4F8PA 3T8MA 1NEPA 3TBVB 4MCZB 4ZUVB 3L6FB 4FP8L 1WZMA 3TCLB 4CMHB 1YYMH 3L7FA 3EFDL 3NAAH 4IS6B 3GS4A 4UM9D 4UZUA 4HMDA 2ZT9C 1CI3M 2YOAA 1KB3A 3CXHK 4PJ7F 2ZWNA 3SDCD 3O2DL 3Q5YA 2HMIC 3ATBA 1G1CA 2F7PA 3S8GB 3WJJC 5I1IL 3U2SB 4GP8B 5F7NC 3UG4A 2QQNL 4OQTH 5IUCA 2QQKH 3MACH 3VRJB 4AZUA 4NO2A 2QFRA 5I19H 3JWNE 3CK0L 5AZUA 3EJRA 2NNFA 1KYAA 1N8ZA 2CK2A 4JZOA 4L8CA 3CMOL 1DO6A 4OZGA 3VVVA 5E0FA 3HFFA 1XGTA 4EIGB 4GT0A 3US9A 3PU7A 3QZLA 5E5MA 1FYTD 3MRIA 1R24B 2PCXA 4C4UA 4N3UA 1CR9L 3TNNA 5JNYB 5D5MA 4RGOH 1WCBB 1IE5A 2V37A 4F37F 3O4LE 4Z6AT 2OMXB 3S5LA 4WWKB 4UT7L 5DXWA 4FTDA 3V6ZA 3Q7JA 3GXMA 5KVDL 3T3MB 1FFPA 4JPIA 3FT4B 2WQAA 4RDBA 3EYFB 4DFHA 4H0IA 4MAUH 4HKZB 3RFRA 3H3KA 1HKLH 4AH2B 4N87A 4JKPH 1FAIL 4ANWA 3S0PA 4PS4L 4B0MB 2AP2A 2FX7H 1OK0A 2CBMA 5MEOB 2EXWC 3P4NA 3QG7L 4L5FE 2E7DA 5AW1B 5MERB 2YOCA 3HAEB 1OCOB 4F37K 4IEFB 1MKFA 1HL5A 4ODTH 4OGXL 2PR4H 1NCWL 2W38A 2EH7H 2YFNA 2N4IA 3ENEA 2F1AA 2V2TA 1UUSA 1S7TA 4Z8FL 4KJWC 3TF7C 2QADD 5L7XL 1J5OL 4F15B 1BD2D 4YH6A 2I69A 3TO2B 2P3YA 3ATDA 2CHNA 2H45A 4ODVL 1FFOB 3D0VB 1NOAA 3LY6A 3NZHL 4J8QA 5CILH 5D6DA 5DHXB 4PTUA 2E6PA 4DKTA 1TQUA 1C5CH 5I6LA 3K1KC 3CNKA 3K72A 4H2CA 2WXKA 3D9AL 3SN6N 4G42A 1Q0YL 3BN9D 1N6VA 1KJ2B 2KZKA 4L8SC 4GW5A 2X1WL 3HPLA 3L9RA 1I8KA 4DVBB 3DRTA 3GNML 1TQCB 1AS8A 5D7IF 2DQJH 2GG1A 4G5ZH 4GKSA 2R29H 5TK4A 5JTWA 3HPJB 2JJUA 1BQHA 1M7IA 4AM0Q 4MZ2A 4ZMLA 5C2BL 2OMZB 2XX0A 3GXIA 3LKNA 5HYSB 4PJHB 3P4OA 4AL8H 3DO4A 5D1QE 1A7PH 1HDMA 4NS0A 3BVTA 1MF2H 2X4SA 2R0WL 2VUKA 2P8LB 3J8F7 2I7SA 1AJ7H 4WO4D 2CRYA 5KSVA 1LXMA 1FNLA 1JYWA 2HVJB 1HXYA 3CQFA 3RTQC 2B4CH 3ME0A 4TLKA 2WYIA 2HFTA 3RGHA 1S9VA 2VRQA 4N22A 3N9GL 1J0YA 2BOCB 5INCB 1UD4A 3G6JA 3H53A 4KRPC 2AXHA 5FHBH 1NQBA 1MCOL 2P43B 1UACH 4HK3N 1OF0A 4HXAH 1VADB 5GRVK 1NCNA 3FO9B 3PWPE 4CSPA 5ENWB 5BVPL 3UO8B 5FM5O 1LQSR 4NP4L 1Y18B 5EBWA 1VCBC 5DHYB 4J3XA 2MCPL 2JIXB 2CGYA 1PY9A 2DW5A 3B4NA 3MV7E 3MLVH 4HJJL 3TZVC 4K2UH 1VGEL 4BH7A 3F8UB 3IJYB 1W0WA 4MB5A 5LJYH 2E5EA 3RDTB 4JM4L 1E8ZA 4K7FA 4J6IA 4XCEB 5DLMH 3LN5A 4UOJA 4JM2F 2OMYA 5GRJL 5E8NA 3P2DA 2G2PA 4DW2L 3PGDB 1BFSA 2WZ6A 4UT6H 4F33B 5FF6A 4H40A 3KPOB 4OVVA 3QULA 1XD0A 3SGJC 3CSPA 1EEQA 4YC2B 2A3TA 4UNTA 2MKLC 5T3XL 2B14A 3SE3A 3MNDA 4A1RA 3ILQD 2GKIA 4NWTH 3Q1SL 3QIBD 4XN8A 4ZW8A 4DP0X 2R0KL 3ARGC 4FKKA 4GY4A 3E6HA 4MAYA 4ZXBB 3H8NA 1SEQL 3LMJH 5C07A 3IJ9A 1WT5C 2JJSA 4PTTA 4Y2OA 2F68X 2V0AA 4PIBA 3SGKA 5B38A 1T2JA 5L6YH 3LQZB 3LS4H 1JGUL 3QJFB 2D73A 1AXTH 4QHMA 5D7LD 3U36B 2PYEE 5AW9B 4NQCB 1CT8B 1MCIA 3WE6B 1YMME 1T1XB 1LLAA 2F0CA 2ATAA 2DM2A 3D69B 1RZPA 3GBNL 3T0EE 4F93B 5KSUA 3B2XA 1T5WA 1XF5B 3DC0A 4FXKA 3ARDA 2WCPA 4P3DA 2AABL 3N42B 3WTSA 5JXEA 4UV7L 4DN3H 2G9HA 4HCGA 1D5XA 4LVOB 1AVAA 4JZJA 3FK3A 4PJFE 4XNMB 1OLZA 4BGLA 4QHKJ 5GRWA 1XGYH 3BP4A 2OTWA 4W68A 5F1SA 3WXWL 1JNLL 3HUJE 1MFEL 4KPHL 5GGSB 3ZQXA 4GSRA 1M1SA 3NJFA 2CBOA 5JQIB 4M1CD 1WF5A 4GG8A 4LVEA 4HD9A 5JQ6H 3CH1A 5CNHA 3OWRA 4MQXC 3ZR6A 3K91A 4HGMA 4OCXH 3BP5B 4XCFH 5HHOD 3L3OA 4WWPA 1CU4L 4XNYL 4Y4FD 4M7ZC 5GGTL 3UP6A 1RUAL 2E7HA 5I1GH 2N59A 3AT8A 5I8EA 1JYVA 1YNTA 4XT1C 1UEMA 1BV8A 3QORD 1ZV9A 3QUKB 1KTRL 4P2RE 2CO7B 1DVFA 1QABA 3KCWA 3LH2H 3QUYC 4M02A 4FQJL 4NNXA 2I85A 2VDOL 3VQ2C 1AGDA 1ED3A 5IFJA 3V9CA 3WDJA 2ODIA 1MHHA 2QR0A 3FB5B 1DQML 4N0CD 4ZFQA 4AYFB 3JWNH 4MB4A 2ZXDA 2R15A 3JUZA 3UADA 2WWMD 2OL3L 4QRRA 5HY9A 3GLZA 3N50A 4DTGL